data_2P2Q
# 
_entry.id   2P2Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2P2Q         pdb_00002p2q 10.2210/pdb2p2q/pdb 
RCSB  RCSB041891   ?            ?                   
WWPDB D_1000041891 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PG4 . unspecified 
PDB 1RY2 . unspecified 
PDB 1T5D . unspecified 
PDB 2P20 . unspecified 
PDB 2P2B . unspecified 
PDB 2P2F . unspecified 
PDB 2P2J . unspecified 
PDB 2P2M . unspecified 
# 
_pdbx_database_status.entry_id                        2P2Q 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-07 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Reger, A.S.'  1 
'Gulick, A.M.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                6536 
_citation.page_last                 6546 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17497934 
_citation.pdbx_database_id_DOI      10.1021/bi6026506 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Reger, A.S.'  1 ? 
primary 'Carney, J.M.' 2 ? 
primary 'Gulick, A.M.' 3 ? 
# 
_cell.entry_id           2P2Q 
_cell.length_a           92.050 
_cell.length_b           95.532 
_cell.length_c           164.250 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2P2Q 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Acetyl-coenzyme A synthetase'            72208.398 2   6.2.1.1 R584E ? ? 
2 non-polymer syn 
;ADENOSINE-5'-MONOPHOSPHATE-PROPYL ESTER
;
389.301   2   ?       ?     ? ? 
3 water       nat water                                     18.015    241 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Acetate-CoA ligase, Acyl-activating enzyme' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVEKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVEKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLN n 
1 4   THR n 
1 5   HIS n 
1 6   LYS n 
1 7   HIS n 
1 8   ALA n 
1 9   ILE n 
1 10  PRO n 
1 11  ALA n 
1 12  ASN n 
1 13  ILE n 
1 14  ALA n 
1 15  ASP n 
1 16  ARG n 
1 17  CYS n 
1 18  LEU n 
1 19  ILE n 
1 20  ASN n 
1 21  PRO n 
1 22  GLU n 
1 23  GLN n 
1 24  TYR n 
1 25  GLU n 
1 26  THR n 
1 27  LYS n 
1 28  TYR n 
1 29  LYS n 
1 30  GLN n 
1 31  SER n 
1 32  ILE n 
1 33  ASN n 
1 34  ASP n 
1 35  PRO n 
1 36  ASP n 
1 37  THR n 
1 38  PHE n 
1 39  TRP n 
1 40  GLY n 
1 41  GLU n 
1 42  GLN n 
1 43  GLY n 
1 44  LYS n 
1 45  ILE n 
1 46  LEU n 
1 47  ASP n 
1 48  TRP n 
1 49  ILE n 
1 50  THR n 
1 51  PRO n 
1 52  TYR n 
1 53  GLN n 
1 54  LYS n 
1 55  VAL n 
1 56  LYS n 
1 57  ASN n 
1 58  THR n 
1 59  SER n 
1 60  PHE n 
1 61  ALA n 
1 62  PRO n 
1 63  GLY n 
1 64  ASN n 
1 65  VAL n 
1 66  SER n 
1 67  ILE n 
1 68  LYS n 
1 69  TRP n 
1 70  TYR n 
1 71  GLU n 
1 72  ASP n 
1 73  GLY n 
1 74  THR n 
1 75  LEU n 
1 76  ASN n 
1 77  LEU n 
1 78  ALA n 
1 79  ALA n 
1 80  ASN n 
1 81  CYS n 
1 82  LEU n 
1 83  ASP n 
1 84  ARG n 
1 85  HIS n 
1 86  LEU n 
1 87  GLN n 
1 88  GLU n 
1 89  ASN n 
1 90  GLY n 
1 91  ASP n 
1 92  ARG n 
1 93  THR n 
1 94  ALA n 
1 95  ILE n 
1 96  ILE n 
1 97  TRP n 
1 98  GLU n 
1 99  GLY n 
1 100 ASP n 
1 101 ASP n 
1 102 THR n 
1 103 SER n 
1 104 GLN n 
1 105 SER n 
1 106 LYS n 
1 107 HIS n 
1 108 ILE n 
1 109 SER n 
1 110 TYR n 
1 111 ARG n 
1 112 GLU n 
1 113 LEU n 
1 114 HIS n 
1 115 ARG n 
1 116 ASP n 
1 117 VAL n 
1 118 CYS n 
1 119 ARG n 
1 120 PHE n 
1 121 ALA n 
1 122 ASN n 
1 123 THR n 
1 124 LEU n 
1 125 LEU n 
1 126 ASP n 
1 127 LEU n 
1 128 GLY n 
1 129 ILE n 
1 130 LYS n 
1 131 LYS n 
1 132 GLY n 
1 133 ASP n 
1 134 VAL n 
1 135 VAL n 
1 136 ALA n 
1 137 ILE n 
1 138 TYR n 
1 139 MET n 
1 140 PRO n 
1 141 MET n 
1 142 VAL n 
1 143 PRO n 
1 144 GLU n 
1 145 ALA n 
1 146 ALA n 
1 147 VAL n 
1 148 ALA n 
1 149 MET n 
1 150 LEU n 
1 151 ALA n 
1 152 CYS n 
1 153 ALA n 
1 154 ARG n 
1 155 ILE n 
1 156 GLY n 
1 157 ALA n 
1 158 VAL n 
1 159 HIS n 
1 160 SER n 
1 161 VAL n 
1 162 ILE n 
1 163 PHE n 
1 164 GLY n 
1 165 GLY n 
1 166 PHE n 
1 167 SER n 
1 168 PRO n 
1 169 GLU n 
1 170 ALA n 
1 171 VAL n 
1 172 ALA n 
1 173 GLY n 
1 174 ARG n 
1 175 ILE n 
1 176 ILE n 
1 177 ASP n 
1 178 SER n 
1 179 SER n 
1 180 SER n 
1 181 ARG n 
1 182 LEU n 
1 183 VAL n 
1 184 ILE n 
1 185 THR n 
1 186 ALA n 
1 187 ASP n 
1 188 GLU n 
1 189 GLY n 
1 190 VAL n 
1 191 ARG n 
1 192 ALA n 
1 193 GLY n 
1 194 ARG n 
1 195 SER n 
1 196 ILE n 
1 197 PRO n 
1 198 LEU n 
1 199 LYS n 
1 200 LYS n 
1 201 ASN n 
1 202 VAL n 
1 203 ASP n 
1 204 ASP n 
1 205 ALA n 
1 206 LEU n 
1 207 LYS n 
1 208 ASN n 
1 209 PRO n 
1 210 ASN n 
1 211 VAL n 
1 212 THR n 
1 213 SER n 
1 214 VAL n 
1 215 GLU n 
1 216 HIS n 
1 217 VAL n 
1 218 ILE n 
1 219 VAL n 
1 220 LEU n 
1 221 LYS n 
1 222 ARG n 
1 223 THR n 
1 224 GLY n 
1 225 SER n 
1 226 ASP n 
1 227 ILE n 
1 228 ASP n 
1 229 TRP n 
1 230 GLN n 
1 231 GLU n 
1 232 GLY n 
1 233 ARG n 
1 234 ASP n 
1 235 LEU n 
1 236 TRP n 
1 237 TRP n 
1 238 ARG n 
1 239 ASP n 
1 240 LEU n 
1 241 ILE n 
1 242 GLU n 
1 243 LYS n 
1 244 ALA n 
1 245 SER n 
1 246 PRO n 
1 247 GLU n 
1 248 HIS n 
1 249 GLN n 
1 250 PRO n 
1 251 GLU n 
1 252 ALA n 
1 253 MET n 
1 254 ASN n 
1 255 ALA n 
1 256 GLU n 
1 257 ASP n 
1 258 PRO n 
1 259 LEU n 
1 260 PHE n 
1 261 ILE n 
1 262 LEU n 
1 263 TYR n 
1 264 THR n 
1 265 SER n 
1 266 GLY n 
1 267 SER n 
1 268 THR n 
1 269 GLY n 
1 270 LYS n 
1 271 PRO n 
1 272 LYS n 
1 273 GLY n 
1 274 VAL n 
1 275 LEU n 
1 276 HIS n 
1 277 THR n 
1 278 THR n 
1 279 GLY n 
1 280 GLY n 
1 281 TYR n 
1 282 LEU n 
1 283 VAL n 
1 284 TYR n 
1 285 ALA n 
1 286 ALA n 
1 287 THR n 
1 288 THR n 
1 289 PHE n 
1 290 LYS n 
1 291 TYR n 
1 292 VAL n 
1 293 PHE n 
1 294 ASP n 
1 295 TYR n 
1 296 HIS n 
1 297 PRO n 
1 298 GLY n 
1 299 ASP n 
1 300 ILE n 
1 301 TYR n 
1 302 TRP n 
1 303 CYS n 
1 304 THR n 
1 305 ALA n 
1 306 ASP n 
1 307 VAL n 
1 308 GLY n 
1 309 TRP n 
1 310 VAL n 
1 311 THR n 
1 312 GLY n 
1 313 HIS n 
1 314 SER n 
1 315 TYR n 
1 316 LEU n 
1 317 LEU n 
1 318 TYR n 
1 319 GLY n 
1 320 PRO n 
1 321 LEU n 
1 322 ALA n 
1 323 CYS n 
1 324 GLY n 
1 325 ALA n 
1 326 THR n 
1 327 THR n 
1 328 LEU n 
1 329 MET n 
1 330 PHE n 
1 331 GLU n 
1 332 GLY n 
1 333 VAL n 
1 334 PRO n 
1 335 ASN n 
1 336 TRP n 
1 337 PRO n 
1 338 THR n 
1 339 PRO n 
1 340 ALA n 
1 341 ARG n 
1 342 MET n 
1 343 CYS n 
1 344 GLN n 
1 345 VAL n 
1 346 VAL n 
1 347 ASP n 
1 348 LYS n 
1 349 HIS n 
1 350 GLN n 
1 351 VAL n 
1 352 ASN n 
1 353 ILE n 
1 354 LEU n 
1 355 TYR n 
1 356 THR n 
1 357 ALA n 
1 358 PRO n 
1 359 THR n 
1 360 ALA n 
1 361 ILE n 
1 362 ARG n 
1 363 ALA n 
1 364 LEU n 
1 365 MET n 
1 366 ALA n 
1 367 GLU n 
1 368 GLY n 
1 369 ASP n 
1 370 LYS n 
1 371 ALA n 
1 372 ILE n 
1 373 GLU n 
1 374 GLY n 
1 375 THR n 
1 376 ASP n 
1 377 ARG n 
1 378 SER n 
1 379 SER n 
1 380 LEU n 
1 381 ARG n 
1 382 ILE n 
1 383 LEU n 
1 384 GLY n 
1 385 SER n 
1 386 VAL n 
1 387 GLY n 
1 388 GLU n 
1 389 PRO n 
1 390 ILE n 
1 391 ASN n 
1 392 PRO n 
1 393 GLU n 
1 394 ALA n 
1 395 TRP n 
1 396 GLU n 
1 397 TRP n 
1 398 TYR n 
1 399 TRP n 
1 400 LYS n 
1 401 LYS n 
1 402 ILE n 
1 403 GLY n 
1 404 LYS n 
1 405 GLU n 
1 406 LYS n 
1 407 CYS n 
1 408 PRO n 
1 409 VAL n 
1 410 VAL n 
1 411 ASP n 
1 412 THR n 
1 413 TRP n 
1 414 TRP n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 THR n 
1 419 GLY n 
1 420 GLY n 
1 421 PHE n 
1 422 MET n 
1 423 ILE n 
1 424 THR n 
1 425 PRO n 
1 426 LEU n 
1 427 PRO n 
1 428 GLY n 
1 429 ALA n 
1 430 ILE n 
1 431 GLU n 
1 432 LEU n 
1 433 LYS n 
1 434 ALA n 
1 435 GLY n 
1 436 SER n 
1 437 ALA n 
1 438 THR n 
1 439 ARG n 
1 440 PRO n 
1 441 PHE n 
1 442 PHE n 
1 443 GLY n 
1 444 VAL n 
1 445 GLN n 
1 446 PRO n 
1 447 ALA n 
1 448 LEU n 
1 449 VAL n 
1 450 ASP n 
1 451 ASN n 
1 452 GLU n 
1 453 GLY n 
1 454 HIS n 
1 455 PRO n 
1 456 GLN n 
1 457 GLU n 
1 458 GLY n 
1 459 ALA n 
1 460 THR n 
1 461 GLU n 
1 462 GLY n 
1 463 ASN n 
1 464 LEU n 
1 465 VAL n 
1 466 ILE n 
1 467 THR n 
1 468 ASP n 
1 469 SER n 
1 470 TRP n 
1 471 PRO n 
1 472 GLY n 
1 473 GLN n 
1 474 ALA n 
1 475 ARG n 
1 476 THR n 
1 477 LEU n 
1 478 PHE n 
1 479 GLY n 
1 480 ASP n 
1 481 HIS n 
1 482 GLU n 
1 483 ARG n 
1 484 PHE n 
1 485 GLU n 
1 486 GLN n 
1 487 THR n 
1 488 TYR n 
1 489 PHE n 
1 490 SER n 
1 491 THR n 
1 492 PHE n 
1 493 LYS n 
1 494 ASN n 
1 495 MET n 
1 496 TYR n 
1 497 PHE n 
1 498 SER n 
1 499 GLY n 
1 500 ASP n 
1 501 GLY n 
1 502 ALA n 
1 503 ARG n 
1 504 ARG n 
1 505 ASP n 
1 506 GLU n 
1 507 ASP n 
1 508 GLY n 
1 509 TYR n 
1 510 TYR n 
1 511 TRP n 
1 512 ILE n 
1 513 THR n 
1 514 GLY n 
1 515 ARG n 
1 516 VAL n 
1 517 ASP n 
1 518 ASP n 
1 519 VAL n 
1 520 LEU n 
1 521 ASN n 
1 522 VAL n 
1 523 SER n 
1 524 GLY n 
1 525 HIS n 
1 526 ARG n 
1 527 LEU n 
1 528 GLY n 
1 529 THR n 
1 530 ALA n 
1 531 GLU n 
1 532 ILE n 
1 533 GLU n 
1 534 SER n 
1 535 ALA n 
1 536 LEU n 
1 537 VAL n 
1 538 ALA n 
1 539 HIS n 
1 540 PRO n 
1 541 LYS n 
1 542 ILE n 
1 543 ALA n 
1 544 GLU n 
1 545 ALA n 
1 546 ALA n 
1 547 VAL n 
1 548 VAL n 
1 549 GLY n 
1 550 ILE n 
1 551 PRO n 
1 552 HIS n 
1 553 ALA n 
1 554 ILE n 
1 555 LYS n 
1 556 GLY n 
1 557 GLN n 
1 558 ALA n 
1 559 ILE n 
1 560 TYR n 
1 561 ALA n 
1 562 TYR n 
1 563 VAL n 
1 564 THR n 
1 565 LEU n 
1 566 ASN n 
1 567 HIS n 
1 568 GLY n 
1 569 GLU n 
1 570 GLU n 
1 571 PRO n 
1 572 SER n 
1 573 PRO n 
1 574 GLU n 
1 575 LEU n 
1 576 TYR n 
1 577 ALA n 
1 578 GLU n 
1 579 VAL n 
1 580 ARG n 
1 581 ASN n 
1 582 TRP n 
1 583 VAL n 
1 584 GLU n 
1 585 LYS n 
1 586 GLU n 
1 587 ILE n 
1 588 GLY n 
1 589 PRO n 
1 590 LEU n 
1 591 ALA n 
1 592 THR n 
1 593 PRO n 
1 594 ASP n 
1 595 VAL n 
1 596 LEU n 
1 597 HIS n 
1 598 TRP n 
1 599 THR n 
1 600 ASP n 
1 601 SER n 
1 602 LEU n 
1 603 PRO n 
1 604 LYS n 
1 605 THR n 
1 606 ARG n 
1 607 SER n 
1 608 GLY n 
1 609 LYS n 
1 610 ILE n 
1 611 MET n 
1 612 ARG n 
1 613 ARG n 
1 614 ILE n 
1 615 LEU n 
1 616 ARG n 
1 617 LYS n 
1 618 ILE n 
1 619 ALA n 
1 620 ALA n 
1 621 GLY n 
1 622 ASP n 
1 623 THR n 
1 624 SER n 
1 625 ASN n 
1 626 LEU n 
1 627 GLY n 
1 628 ASP n 
1 629 THR n 
1 630 SER n 
1 631 THR n 
1 632 LEU n 
1 633 ALA n 
1 634 ASP n 
1 635 PRO n 
1 636 GLY n 
1 637 VAL n 
1 638 VAL n 
1 639 GLU n 
1 640 LYS n 
1 641 LEU n 
1 642 LEU n 
1 643 GLU n 
1 644 GLU n 
1 645 LYS n 
1 646 GLN n 
1 647 ALA n 
1 648 ILE n 
1 649 ALA n 
1 650 MET n 
1 651 PRO n 
1 652 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Salmonella 
_entity_src_gen.pdbx_gene_src_gene                 acs 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    Typhi 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Salmonella typhimurium' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     602 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTYB1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'according to Biochemistry, 41, 2379' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACSA_SALTY 
_struct_ref.pdbx_db_accession          Q8ZKF6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2P2Q A 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
2 1 2P2Q B 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2P2Q GLU A 584 ? UNP Q8ZKF6 ARG 584 'engineered mutation' 584 1 
2 2P2Q GLU B 584 ? UNP Q8ZKF6 ARG 584 'engineered mutation' 584 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                   ?                              'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                  ?                              'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ?                              'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ?                              'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                  ?                              'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                 ?                              'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ?                              'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                   ?                              'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ?                              'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                     ?                              'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ?                              'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                   ?                              'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                    ?                              'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                ?                              'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                             ?                              'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                   ?                              'C5 H9 N O2'      115.130 
PRX non-polymer         . 
;ADENOSINE-5'-MONOPHOSPHATE-PROPYL ESTER
;
"ADENOSINE-5'-PROPYLPHOSPHATE" 'C13 H20 N5 O7 P' 389.301 
SER 'L-peptide linking' y SERINE                                    ?                              'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                 ?                              'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ?                              'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                  ?                              'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                    ?                              'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2P2Q 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.50 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   50.78 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            287 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;6-15% PEG 8000, 9-13% ethylene glycol, 50 mM BTP, 1 mM CoA, 1 mM Propyl-AMP, 1 mM TCEP, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 287K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2005-07-31 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97930 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F2' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97930 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F2 
# 
_reflns.entry_id                     2P2Q 
_reflns.d_resolution_high            2.400 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   55167 
_reflns.pdbx_Rmerge_I_obs            0.106 
_reflns.pdbx_netI_over_sigmaI        8.000 
_reflns.pdbx_chi_squared             1.301 
_reflns.pdbx_redundancy              3.100 
_reflns.percent_possible_obs         93.400 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.49 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.370 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       0.953 
_reflns_shell.pdbx_redundancy        2.40 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4827 
_reflns_shell.percent_possible_all   82.90 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2P2Q 
_refine.ls_d_res_high                            2.420 
_refine.ls_d_res_low                             35.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    94.180 
_refine.ls_number_reflns_obs                     52215 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.188 
_refine.ls_R_factor_R_work                       0.184 
_refine.ls_R_factor_R_free                       0.245 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2655 
_refine.B_iso_mean                               25.887 
_refine.aniso_B[1][1]                            -0.240 
_refine.aniso_B[2][2]                            -0.670 
_refine.aniso_B[3][3]                            0.910 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.936 
_refine.correlation_coeff_Fo_to_Fc_free          0.890 
_refine.pdbx_overall_ESU_R                       0.491 
_refine.pdbx_overall_ESU_R_Free                  0.279 
_refine.overall_SU_ML                            0.187 
_refine.overall_SU_B                             16.200 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'pdb entry 1PG4' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9838 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         52 
_refine_hist.number_atoms_solvent             241 
_refine_hist.number_atoms_total               10131 
_refine_hist.d_res_high                       2.420 
_refine_hist.d_res_low                        35.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         10157 0.013  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      13863 1.408  1.948  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   1266  6.508  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   448   36.862 24.085 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1564  16.018 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   55    21.170 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           1515  0.091  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     7817  0.005  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            4666  0.202  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          6799  0.304  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    497   0.138  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   27    0.194  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 6     0.082  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              6461  0.566  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             10164 0.973  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              4326  1.594  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             3699  2.556  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.42 
_refine_ls_shell.d_res_low                        2.483 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               84.710 
_refine_ls_shell.number_reflns_R_work             2865 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.230 
_refine_ls_shell.R_factor_R_free                  0.328 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             165 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                3030 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2P2Q 
_struct.title                     'Acetyl-CoA Synthetase, R584E mutation' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2P2Q 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'Adenylate-forming enzymes, Domain Alternation, Acyl-CoA ligase, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 10  ? CYS A 17  ? PRO A 10  CYS A 17  1 ? 8  
HELX_P HELX_P2  2  ASN A 20  ? ASP A 34  ? ASN A 20  ASP A 34  1 ? 15 
HELX_P HELX_P3  3  ASP A 34  ? GLY A 43  ? ASP A 34  GLY A 43  1 ? 10 
HELX_P HELX_P4  4  LYS A 44  ? LEU A 46  ? LYS A 44  LEU A 46  5 ? 3  
HELX_P HELX_P5  5  ASN A 76  ? LEU A 82  ? ASN A 76  LEU A 82  1 ? 7  
HELX_P HELX_P6  6  HIS A 85  ? GLY A 90  ? HIS A 85  GLY A 90  1 ? 6  
HELX_P HELX_P7  7  TYR A 110 ? LEU A 127 ? TYR A 110 LEU A 127 1 ? 18 
HELX_P HELX_P8  8  VAL A 142 ? GLY A 156 ? VAL A 142 GLY A 156 1 ? 15 
HELX_P HELX_P9  9  SER A 167 ? SER A 179 ? SER A 167 SER A 179 1 ? 13 
HELX_P HELX_P10 10 PRO A 197 ? LYS A 207 ? PRO A 197 LYS A 207 1 ? 11 
HELX_P HELX_P11 11 TRP A 237 ? ALA A 244 ? TRP A 237 ALA A 244 1 ? 8  
HELX_P HELX_P12 12 THR A 278 ? PHE A 293 ? THR A 278 PHE A 293 1 ? 16 
HELX_P HELX_P13 13 TRP A 309 ? LEU A 316 ? TRP A 309 LEU A 316 1 ? 8  
HELX_P HELX_P14 14 LEU A 317 ? CYS A 323 ? LEU A 317 CYS A 323 1 ? 7  
HELX_P HELX_P15 15 ALA A 340 ? GLN A 350 ? ALA A 340 GLN A 350 1 ? 11 
HELX_P HELX_P16 16 ALA A 357 ? GLU A 367 ? ALA A 357 GLU A 367 1 ? 11 
HELX_P HELX_P17 17 GLY A 368 ? ILE A 372 ? GLY A 368 ILE A 372 5 ? 5  
HELX_P HELX_P18 18 ASN A 391 ? ILE A 402 ? ASN A 391 ILE A 402 1 ? 12 
HELX_P HELX_P19 19 GLN A 415 ? GLY A 419 ? GLN A 415 GLY A 419 5 ? 5  
HELX_P HELX_P20 20 ASP A 480 ? SER A 490 ? ASP A 480 SER A 490 1 ? 11 
HELX_P HELX_P21 21 THR A 529 ? HIS A 539 ? THR A 529 HIS A 539 1 ? 11 
HELX_P HELX_P22 22 SER A 572 ? ILE A 587 ? SER A 572 ILE A 587 1 ? 16 
HELX_P HELX_P23 23 GLY A 588 ? THR A 592 ? GLY A 588 THR A 592 5 ? 5  
HELX_P HELX_P24 24 MET A 611 ? ALA A 620 ? MET A 611 ALA A 620 1 ? 10 
HELX_P HELX_P25 25 GLY A 636 ? ALA A 647 ? GLY A 636 ALA A 647 1 ? 12 
HELX_P HELX_P26 26 PRO B 10  ? CYS B 17  ? PRO B 10  CYS B 17  1 ? 8  
HELX_P HELX_P27 27 ASN B 20  ? ASP B 34  ? ASN B 20  ASP B 34  1 ? 15 
HELX_P HELX_P28 28 ASP B 34  ? GLY B 43  ? ASP B 34  GLY B 43  1 ? 10 
HELX_P HELX_P29 29 LYS B 44  ? LEU B 46  ? LYS B 44  LEU B 46  5 ? 3  
HELX_P HELX_P30 30 ASN B 76  ? LEU B 82  ? ASN B 76  LEU B 82  1 ? 7  
HELX_P HELX_P31 31 HIS B 85  ? GLY B 90  ? HIS B 85  GLY B 90  1 ? 6  
HELX_P HELX_P32 32 TYR B 110 ? LEU B 127 ? TYR B 110 LEU B 127 1 ? 18 
HELX_P HELX_P33 33 VAL B 142 ? GLY B 156 ? VAL B 142 GLY B 156 1 ? 15 
HELX_P HELX_P34 34 SER B 167 ? SER B 179 ? SER B 167 SER B 179 1 ? 13 
HELX_P HELX_P35 35 PRO B 197 ? LEU B 206 ? PRO B 197 LEU B 206 1 ? 10 
HELX_P HELX_P36 36 TRP B 237 ? ALA B 244 ? TRP B 237 ALA B 244 1 ? 8  
HELX_P HELX_P37 37 THR B 278 ? PHE B 293 ? THR B 278 PHE B 293 1 ? 16 
HELX_P HELX_P38 38 TRP B 309 ? TYR B 315 ? TRP B 309 TYR B 315 1 ? 7  
HELX_P HELX_P39 39 LEU B 317 ? CYS B 323 ? LEU B 317 CYS B 323 1 ? 7  
HELX_P HELX_P40 40 ALA B 340 ? GLN B 350 ? ALA B 340 GLN B 350 1 ? 11 
HELX_P HELX_P41 41 ALA B 357 ? GLY B 368 ? ALA B 357 GLY B 368 1 ? 12 
HELX_P HELX_P42 42 ASP B 369 ? ILE B 372 ? ASP B 369 ILE B 372 5 ? 4  
HELX_P HELX_P43 43 ASN B 391 ? ILE B 402 ? ASN B 391 ILE B 402 1 ? 12 
HELX_P HELX_P44 44 GLN B 415 ? GLY B 419 ? GLN B 415 GLY B 419 5 ? 5  
HELX_P HELX_P45 45 ASP B 480 ? SER B 490 ? ASP B 480 SER B 490 1 ? 11 
HELX_P HELX_P46 46 THR B 529 ? HIS B 539 ? THR B 529 HIS B 539 1 ? 11 
HELX_P HELX_P47 47 SER B 572 ? ILE B 587 ? SER B 572 ILE B 587 1 ? 16 
HELX_P HELX_P48 48 GLY B 588 ? THR B 592 ? GLY B 588 THR B 592 5 ? 5  
HELX_P HELX_P49 49 MET B 611 ? GLY B 621 ? MET B 611 GLY B 621 1 ? 11 
HELX_P HELX_P50 50 GLY B 636 ? ILE B 648 ? GLY B 636 ILE B 648 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 62  A . ? PRO 62  A GLY 63  A ? GLY 63  A 1 -21.83 
2 TRP 336 A . ? TRP 336 A PRO 337 A ? PRO 337 A 1 1.36   
3 TRP 336 B . ? TRP 336 B PRO 337 B ? PRO 337 B 1 -1.11  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 7 ? 
D ? 8 ? 
E ? 2 ? 
F ? 4 ? 
G ? 2 ? 
H ? 3 ? 
I ? 2 ? 
J ? 2 ? 
K ? 7 ? 
L ? 8 ? 
M ? 2 ? 
N ? 4 ? 
O ? 2 ? 
P ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? anti-parallel 
D 7 8 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? parallel      
K 3 4 ? parallel      
K 4 5 ? parallel      
K 5 6 ? parallel      
K 6 7 ? parallel      
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? parallel      
L 6 7 ? anti-parallel 
L 7 8 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 56  ? ALA A 61  ? LYS A 56  ALA A 61  
A 2 ASN A 64  ? TRP A 69  ? ASN A 64  TRP A 69  
B 1 THR A 74  ? LEU A 75  ? THR A 74  LEU A 75  
B 2 MET A 253 ? ASN A 254 ? MET A 253 ASN A 254 
C 1 SER A 105 ? SER A 109 ? SER A 105 SER A 109 
C 2 THR A 93  ? GLU A 98  ? THR A 93  GLU A 98  
C 3 THR A 326 ? PHE A 330 ? THR A 326 PHE A 330 
C 4 ILE A 300 ? CYS A 303 ? ILE A 300 CYS A 303 
C 5 ILE A 353 ? THR A 356 ? ILE A 353 THR A 356 
C 6 ILE A 382 ? VAL A 386 ? ILE A 382 VAL A 386 
C 7 VAL A 409 ? THR A 412 ? VAL A 409 THR A 412 
D 1 ASP A 234 ? TRP A 236 ? ASP A 234 TRP A 236 
D 2 HIS A 216 ? LEU A 220 ? HIS A 216 LEU A 220 
D 3 LEU A 182 ? ALA A 186 ? LEU A 182 ALA A 186 
D 4 VAL A 134 ? TYR A 138 ? VAL A 134 TYR A 138 
D 5 VAL A 158 ? VAL A 161 ? VAL A 158 VAL A 161 
D 6 PRO A 258 ? THR A 264 ? PRO A 258 THR A 264 
D 7 LYS A 272 ? THR A 277 ? LYS A 272 THR A 277 
D 8 THR A 476 ? LEU A 477 ? THR A 476 LEU A 477 
E 1 GLY A 189 ? ARG A 191 ? GLY A 189 ARG A 191 
E 2 ARG A 194 ? ILE A 196 ? ARG A 194 ILE A 196 
F 1 PRO A 446 ? VAL A 449 ? PRO A 446 VAL A 449 
F 2 THR A 460 ? ILE A 466 ? THR A 460 ILE A 466 
F 3 TYR A 496 ? ARG A 504 ? TYR A 496 ARG A 504 
F 4 TYR A 510 ? ARG A 515 ? TYR A 510 ARG A 515 
G 1 VAL A 519 ? VAL A 522 ? VAL A 519 VAL A 522 
G 2 HIS A 525 ? GLY A 528 ? HIS A 525 GLY A 528 
H 1 ILE A 542 ? HIS A 552 ? ILE A 542 HIS A 552 
H 2 GLY A 556 ? LEU A 565 ? GLY A 556 LEU A 565 
H 3 VAL A 595 ? TRP A 598 ? VAL A 595 TRP A 598 
I 1 LYS B 56  ? SER B 59  ? LYS B 56  SER B 59  
I 2 SER B 66  ? TRP B 69  ? SER B 66  TRP B 69  
J 1 THR B 74  ? LEU B 75  ? THR B 74  LEU B 75  
J 2 MET B 253 ? ASN B 254 ? MET B 253 ASN B 254 
K 1 SER B 105 ? SER B 109 ? SER B 105 SER B 109 
K 2 THR B 93  ? GLU B 98  ? THR B 93  GLU B 98  
K 3 THR B 326 ? PHE B 330 ? THR B 326 PHE B 330 
K 4 ILE B 300 ? CYS B 303 ? ILE B 300 CYS B 303 
K 5 ILE B 353 ? THR B 356 ? ILE B 353 THR B 356 
K 6 ILE B 382 ? VAL B 386 ? ILE B 382 VAL B 386 
K 7 VAL B 409 ? THR B 412 ? VAL B 409 THR B 412 
L 1 ASP B 234 ? TRP B 236 ? ASP B 234 TRP B 236 
L 2 HIS B 216 ? LEU B 220 ? HIS B 216 LEU B 220 
L 3 LEU B 182 ? ALA B 186 ? LEU B 182 ALA B 186 
L 4 VAL B 134 ? TYR B 138 ? VAL B 134 TYR B 138 
L 5 VAL B 158 ? VAL B 161 ? VAL B 158 VAL B 161 
L 6 PHE B 260 ? THR B 264 ? PHE B 260 THR B 264 
L 7 LYS B 272 ? HIS B 276 ? LYS B 272 HIS B 276 
L 8 THR B 476 ? LEU B 477 ? THR B 476 LEU B 477 
M 1 GLY B 189 ? ARG B 191 ? GLY B 189 ARG B 191 
M 2 ARG B 194 ? ILE B 196 ? ARG B 194 ILE B 196 
N 1 PRO B 446 ? VAL B 449 ? PRO B 446 VAL B 449 
N 2 THR B 460 ? ILE B 466 ? THR B 460 ILE B 466 
N 3 TYR B 496 ? ARG B 504 ? TYR B 496 ARG B 504 
N 4 TYR B 510 ? ARG B 515 ? TYR B 510 ARG B 515 
O 1 VAL B 519 ? VAL B 522 ? VAL B 519 VAL B 522 
O 2 HIS B 525 ? GLY B 528 ? HIS B 525 GLY B 528 
P 1 ILE B 542 ? HIS B 552 ? ILE B 542 HIS B 552 
P 2 GLY B 556 ? LEU B 565 ? GLY B 556 LEU B 565 
P 3 VAL B 595 ? TRP B 598 ? VAL B 595 TRP B 598 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 61  ? N ALA A 61  O ASN A 64  ? O ASN A 64  
B 1 2 N LEU A 75  ? N LEU A 75  O MET A 253 ? O MET A 253 
C 1 2 O LYS A 106 ? O LYS A 106 N TRP A 97  ? N TRP A 97  
C 2 3 N ILE A 96  ? N ILE A 96  O MET A 329 ? O MET A 329 
C 3 4 O LEU A 328 ? O LEU A 328 N TYR A 301 ? N TYR A 301 
C 4 5 N TRP A 302 ? N TRP A 302 O ILE A 353 ? O ILE A 353 
C 5 6 N LEU A 354 ? N LEU A 354 O ILE A 382 ? O ILE A 382 
C 6 7 N LEU A 383 ? N LEU A 383 O VAL A 410 ? O VAL A 410 
D 1 2 O LEU A 235 ? O LEU A 235 N VAL A 219 ? N VAL A 219 
D 2 3 O ILE A 218 ? O ILE A 218 N THR A 185 ? N THR A 185 
D 3 4 O ILE A 184 ? O ILE A 184 N TYR A 138 ? N TYR A 138 
D 4 5 N VAL A 135 ? N VAL A 135 O SER A 160 ? O SER A 160 
D 5 6 N HIS A 159 ? N HIS A 159 O ILE A 261 ? O ILE A 261 
D 6 7 N LEU A 259 ? N LEU A 259 O HIS A 276 ? O HIS A 276 
D 7 8 N LEU A 275 ? N LEU A 275 O THR A 476 ? O THR A 476 
E 1 2 N ARG A 191 ? N ARG A 191 O ARG A 194 ? O ARG A 194 
F 1 2 N VAL A 449 ? N VAL A 449 O ASN A 463 ? O ASN A 463 
F 2 3 N THR A 460 ? N THR A 460 O ARG A 504 ? O ARG A 504 
F 3 4 N GLY A 501 ? N GLY A 501 O GLY A 514 ? O GLY A 514 
G 1 2 N LEU A 520 ? N LEU A 520 O LEU A 527 ? O LEU A 527 
H 1 2 N GLU A 544 ? N GLU A 544 O THR A 564 ? O THR A 564 
H 2 3 N ALA A 561 ? N ALA A 561 O HIS A 597 ? O HIS A 597 
I 1 2 N ASN B 57  ? N ASN B 57  O LYS B 68  ? O LYS B 68  
J 1 2 N LEU B 75  ? N LEU B 75  O MET B 253 ? O MET B 253 
K 1 2 O ILE B 108 ? O ILE B 108 N ILE B 95  ? N ILE B 95  
K 2 3 N ILE B 96  ? N ILE B 96  O MET B 329 ? O MET B 329 
K 3 4 O THR B 326 ? O THR B 326 N TYR B 301 ? N TYR B 301 
K 4 5 N TRP B 302 ? N TRP B 302 O ILE B 353 ? O ILE B 353 
K 5 6 N LEU B 354 ? N LEU B 354 O ILE B 382 ? O ILE B 382 
K 6 7 N LEU B 383 ? N LEU B 383 O VAL B 410 ? O VAL B 410 
L 1 2 O LEU B 235 ? O LEU B 235 N VAL B 217 ? N VAL B 217 
L 2 3 O ILE B 218 ? O ILE B 218 N THR B 185 ? N THR B 185 
L 3 4 O LEU B 182 ? O LEU B 182 N ALA B 136 ? N ALA B 136 
L 4 5 N VAL B 135 ? N VAL B 135 O SER B 160 ? O SER B 160 
L 5 6 N HIS B 159 ? N HIS B 159 O ILE B 261 ? O ILE B 261 
L 6 7 N LEU B 262 ? N LEU B 262 O VAL B 274 ? O VAL B 274 
L 7 8 N LEU B 275 ? N LEU B 275 O THR B 476 ? O THR B 476 
M 1 2 N ARG B 191 ? N ARG B 191 O ARG B 194 ? O ARG B 194 
N 1 2 N VAL B 449 ? N VAL B 449 O ASN B 463 ? O ASN B 463 
N 2 3 N THR B 460 ? N THR B 460 O ARG B 504 ? O ARG B 504 
N 3 4 N ARG B 503 ? N ARG B 503 O TRP B 511 ? O TRP B 511 
O 1 2 N LEU B 520 ? N LEU B 520 O LEU B 527 ? O LEU B 527 
P 1 2 N GLU B 544 ? N GLU B 544 O THR B 564 ? O THR B 564 
P 2 3 N ALA B 561 ? N ALA B 561 O HIS B 597 ? O HIS B 597 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PRX 999 ? 15 'BINDING SITE FOR RESIDUE PRX A 999' 
AC2 Software B PRX 998 ? 16 'BINDING SITE FOR RESIDUE PRX B 998' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 THR A 311 ? THR A 311  . ? 1_555 ? 
2  AC1 15 GLY A 387 ? GLY A 387  . ? 1_555 ? 
3  AC1 15 GLU A 388 ? GLU A 388  . ? 1_555 ? 
4  AC1 15 PRO A 389 ? PRO A 389  . ? 1_555 ? 
5  AC1 15 ASP A 411 ? ASP A 411  . ? 1_555 ? 
6  AC1 15 THR A 412 ? THR A 412  . ? 1_555 ? 
7  AC1 15 TRP A 413 ? TRP A 413  . ? 1_555 ? 
8  AC1 15 TRP A 414 ? TRP A 414  . ? 1_555 ? 
9  AC1 15 GLN A 415 ? GLN A 415  . ? 1_555 ? 
10 AC1 15 THR A 416 ? THR A 416  . ? 1_555 ? 
11 AC1 15 ASP A 500 ? ASP A 500  . ? 1_555 ? 
12 AC1 15 ILE A 512 ? ILE A 512  . ? 1_555 ? 
13 AC1 15 ARG A 515 ? ARG A 515  . ? 1_555 ? 
14 AC1 15 ARG A 526 ? ARG A 526  . ? 1_555 ? 
15 AC1 15 HOH E .   ? HOH A 1110 . ? 1_555 ? 
16 AC2 16 THR B 311 ? THR B 311  . ? 1_555 ? 
17 AC2 16 VAL B 386 ? VAL B 386  . ? 1_555 ? 
18 AC2 16 GLY B 387 ? GLY B 387  . ? 1_555 ? 
19 AC2 16 GLU B 388 ? GLU B 388  . ? 1_555 ? 
20 AC2 16 PRO B 389 ? PRO B 389  . ? 1_555 ? 
21 AC2 16 ASP B 411 ? ASP B 411  . ? 1_555 ? 
22 AC2 16 THR B 412 ? THR B 412  . ? 1_555 ? 
23 AC2 16 TRP B 413 ? TRP B 413  . ? 1_555 ? 
24 AC2 16 TRP B 414 ? TRP B 414  . ? 1_555 ? 
25 AC2 16 GLN B 415 ? GLN B 415  . ? 1_555 ? 
26 AC2 16 THR B 416 ? THR B 416  . ? 1_555 ? 
27 AC2 16 ASP B 500 ? ASP B 500  . ? 1_555 ? 
28 AC2 16 ILE B 512 ? ILE B 512  . ? 1_555 ? 
29 AC2 16 ARG B 515 ? ARG B 515  . ? 1_555 ? 
30 AC2 16 ARG B 526 ? ARG B 526  . ? 1_555 ? 
31 AC2 16 HOH F .   ? HOH B 1112 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2P2Q 
_atom_sites.fract_transf_matrix[1][1]   0.010864 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010468 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006088 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . LYS A 1 6   ? -21.705 16.839  7.400   1.00 34.26 ? 6    LYS A N     1 
ATOM   2     C CA    . LYS A 1 6   ? -20.329 16.580  6.856   1.00 34.97 ? 6    LYS A CA    1 
ATOM   3     C C     . LYS A 1 6   ? -20.052 17.402  5.607   1.00 34.49 ? 6    LYS A C     1 
ATOM   4     O O     . LYS A 1 6   ? -20.919 17.534  4.747   1.00 34.51 ? 6    LYS A O     1 
ATOM   5     C CB    . LYS A 1 6   ? -20.092 15.088  6.545   1.00 35.13 ? 6    LYS A CB    1 
ATOM   6     C CG    . LYS A 1 6   ? -19.274 14.321  7.628   1.00 36.51 ? 6    LYS A CG    1 
ATOM   7     C CD    . LYS A 1 6   ? -18.934 12.842  7.271   1.00 36.37 ? 6    LYS A CD    1 
ATOM   8     C CE    . LYS A 1 6   ? -17.974 12.218  8.343   1.00 38.06 ? 6    LYS A CE    1 
ATOM   9     N NZ    . LYS A 1 6   ? -17.134 10.977  7.992   1.00 37.57 ? 6    LYS A NZ    1 
ATOM   10    N N     . HIS A 1 7   ? -18.847 17.971  5.521   1.00 33.82 ? 7    HIS A N     1 
ATOM   11    C CA    . HIS A 1 7   ? -18.364 18.591  4.280   1.00 32.69 ? 7    HIS A CA    1 
ATOM   12    C C     . HIS A 1 7   ? -17.333 17.680  3.611   1.00 32.01 ? 7    HIS A C     1 
ATOM   13    O O     . HIS A 1 7   ? -16.282 17.384  4.181   1.00 31.63 ? 7    HIS A O     1 
ATOM   14    C CB    . HIS A 1 7   ? -17.820 20.017  4.518   1.00 32.44 ? 7    HIS A CB    1 
ATOM   15    C CG    . HIS A 1 7   ? -18.900 21.035  4.740   1.00 33.05 ? 7    HIS A CG    1 
ATOM   16    N ND1   . HIS A 1 7   ? -19.428 21.800  3.721   1.00 32.21 ? 7    HIS A ND1   1 
ATOM   17    C CD2   . HIS A 1 7   ? -19.589 21.379  5.857   1.00 32.87 ? 7    HIS A CD2   1 
ATOM   18    C CE1   . HIS A 1 7   ? -20.375 22.587  4.204   1.00 30.70 ? 7    HIS A CE1   1 
ATOM   19    N NE2   . HIS A 1 7   ? -20.488 22.358  5.498   1.00 31.60 ? 7    HIS A NE2   1 
ATOM   20    N N     . ALA A 1 8   ? -17.672 17.217  2.411   1.00 31.13 ? 8    ALA A N     1 
ATOM   21    C CA    . ALA A 1 8   ? -16.776 16.413  1.581   1.00 30.44 ? 8    ALA A CA    1 
ATOM   22    C C     . ALA A 1 8   ? -15.589 17.241  1.122   1.00 29.63 ? 8    ALA A C     1 
ATOM   23    O O     . ALA A 1 8   ? -15.701 18.462  0.960   1.00 29.97 ? 8    ALA A O     1 
ATOM   24    C CB    . ALA A 1 8   ? -17.532 15.854  0.345   1.00 30.31 ? 8    ALA A CB    1 
ATOM   25    N N     . ILE A 1 9   ? -14.473 16.557  0.887   1.00 28.43 ? 9    ILE A N     1 
ATOM   26    C CA    . ILE A 1 9   ? -13.257 17.163  0.359   1.00 26.97 ? 9    ILE A CA    1 
ATOM   27    C C     . ILE A 1 9   ? -13.468 17.541  -1.097  1.00 26.47 ? 9    ILE A C     1 
ATOM   28    O O     . ILE A 1 9   ? -13.843 16.710  -1.914  1.00 26.22 ? 9    ILE A O     1 
ATOM   29    C CB    . ILE A 1 9   ? -12.019 16.209  0.549   1.00 27.19 ? 9    ILE A CB    1 
ATOM   30    C CG1   . ILE A 1 9   ? -11.812 15.931  2.048   1.00 25.45 ? 9    ILE A CG1   1 
ATOM   31    C CG2   . ILE A 1 9   ? -10.740 16.785  -0.093  1.00 24.53 ? 9    ILE A CG2   1 
ATOM   32    C CD1   . ILE A 1 9   ? -11.195 14.601  2.363   1.00 26.65 ? 9    ILE A CD1   1 
ATOM   33    N N     . PRO A 1 10  ? -13.248 18.816  -1.421  1.00 26.29 ? 10   PRO A N     1 
ATOM   34    C CA    . PRO A 1 10  ? -13.461 19.257  -2.801  1.00 25.82 ? 10   PRO A CA    1 
ATOM   35    C C     . PRO A 1 10  ? -12.355 18.767  -3.722  1.00 25.67 ? 10   PRO A C     1 
ATOM   36    O O     . PRO A 1 10  ? -11.187 18.682  -3.298  1.00 25.31 ? 10   PRO A O     1 
ATOM   37    C CB    . PRO A 1 10  ? -13.439 20.786  -2.690  1.00 26.21 ? 10   PRO A CB    1 
ATOM   38    C CG    . PRO A 1 10  ? -12.541 21.071  -1.468  1.00 26.32 ? 10   PRO A CG    1 
ATOM   39    C CD    . PRO A 1 10  ? -12.791 19.901  -0.521  1.00 26.31 ? 10   PRO A CD    1 
ATOM   40    N N     . ALA A 1 11  ? -12.727 18.465  -4.969  1.00 25.21 ? 11   ALA A N     1 
ATOM   41    C CA    . ALA A 1 11  ? -11.794 17.972  -6.011  1.00 25.29 ? 11   ALA A CA    1 
ATOM   42    C C     . ALA A 1 11  ? -10.469 18.740  -6.147  1.00 25.21 ? 11   ALA A C     1 
ATOM   43    O O     . ALA A 1 11  ? -9.407  18.120  -6.273  1.00 25.47 ? 11   ALA A O     1 
ATOM   44    C CB    . ALA A 1 11  ? -12.499 17.879  -7.389  1.00 24.62 ? 11   ALA A CB    1 
ATOM   45    N N     . ASN A 1 12  ? -10.540 20.072  -6.136  1.00 24.92 ? 12   ASN A N     1 
ATOM   46    C CA    . ASN A 1 12  ? -9.347  20.909  -6.272  1.00 24.74 ? 12   ASN A CA    1 
ATOM   47    C C     . ASN A 1 12  ? -8.318  20.641  -5.147  1.00 24.48 ? 12   ASN A C     1 
ATOM   48    O O     . ASN A 1 12  ? -7.110  20.545  -5.411  1.00 24.39 ? 12   ASN A O     1 
ATOM   49    C CB    . ASN A 1 12  ? -9.732  22.402  -6.351  1.00 24.69 ? 12   ASN A CB    1 
ATOM   50    C CG    . ASN A 1 12  ? -10.210 22.973  -4.983  1.00 25.39 ? 12   ASN A CG    1 
ATOM   51    O OD1   . ASN A 1 12  ? -11.189 22.495  -4.393  1.00 22.49 ? 12   ASN A OD1   1 
ATOM   52    N ND2   . ASN A 1 12  ? -9.498  23.991  -4.483  1.00 24.44 ? 12   ASN A ND2   1 
ATOM   53    N N     . ILE A 1 13  ? -8.805  20.513  -3.907  1.00 24.10 ? 13   ILE A N     1 
ATOM   54    C CA    . ILE A 1 13  ? -7.960  20.123  -2.776  1.00 23.66 ? 13   ILE A CA    1 
ATOM   55    C C     . ILE A 1 13  ? -7.535  18.654  -2.917  1.00 23.37 ? 13   ILE A C     1 
ATOM   56    O O     . ILE A 1 13  ? -6.369  18.332  -2.721  1.00 23.30 ? 13   ILE A O     1 
ATOM   57    C CB    . ILE A 1 13  ? -8.624  20.443  -1.385  1.00 23.85 ? 13   ILE A CB    1 
ATOM   58    C CG1   . ILE A 1 13  ? -8.847  21.952  -1.225  1.00 22.98 ? 13   ILE A CG1   1 
ATOM   59    C CG2   . ILE A 1 13  ? -7.783  19.912  -0.174  1.00 23.89 ? 13   ILE A CG2   1 
ATOM   60    C CD1   . ILE A 1 13  ? -7.591  22.849  -1.412  1.00 19.56 ? 13   ILE A CD1   1 
ATOM   61    N N     . ALA A 1 14  ? -8.451  17.773  -3.303  1.00 23.24 ? 14   ALA A N     1 
ATOM   62    C CA    . ALA A 1 14  ? -8.075  16.363  -3.526  1.00 23.67 ? 14   ALA A CA    1 
ATOM   63    C C     . ALA A 1 14  ? -6.865  16.248  -4.444  1.00 23.74 ? 14   ALA A C     1 
ATOM   64    O O     . ALA A 1 14  ? -5.941  15.477  -4.183  1.00 24.13 ? 14   ALA A O     1 
ATOM   65    C CB    . ALA A 1 14  ? -9.260  15.526  -4.068  1.00 23.41 ? 14   ALA A CB    1 
ATOM   66    N N     . ASP A 1 15  ? -6.863  17.063  -5.493  1.00 24.14 ? 15   ASP A N     1 
ATOM   67    C CA    . ASP A 1 15  ? -5.886  16.975  -6.568  1.00 24.30 ? 15   ASP A CA    1 
ATOM   68    C C     . ASP A 1 15  ? -4.482  17.401  -6.189  1.00 24.24 ? 15   ASP A C     1 
ATOM   69    O O     . ASP A 1 15  ? -3.510  16.996  -6.836  1.00 23.74 ? 15   ASP A O     1 
ATOM   70    C CB    . ASP A 1 15  ? -6.393  17.744  -7.783  1.00 24.42 ? 15   ASP A CB    1 
ATOM   71    C CG    . ASP A 1 15  ? -7.471  16.966  -8.545  1.00 27.25 ? 15   ASP A CG    1 
ATOM   72    O OD1   . ASP A 1 15  ? -7.583  15.729  -8.341  1.00 29.47 ? 15   ASP A OD1   1 
ATOM   73    O OD2   . ASP A 1 15  ? -8.215  17.574  -9.339  1.00 29.15 ? 15   ASP A OD2   1 
ATOM   74    N N     . ARG A 1 16  ? -4.369  18.199  -5.129  1.00 24.14 ? 16   ARG A N     1 
ATOM   75    C CA    . ARG A 1 16  ? -3.095  18.816  -4.808  1.00 24.36 ? 16   ARG A CA    1 
ATOM   76    C C     . ARG A 1 16  ? -2.586  18.476  -3.419  1.00 23.79 ? 16   ARG A C     1 
ATOM   77    O O     . ARG A 1 16  ? -1.442  18.812  -3.086  1.00 23.05 ? 16   ARG A O     1 
ATOM   78    C CB    . ARG A 1 16  ? -3.166  20.329  -4.995  1.00 24.71 ? 16   ARG A CB    1 
ATOM   79    C CG    . ARG A 1 16  ? -3.947  21.039  -3.900  1.00 27.83 ? 16   ARG A CG    1 
ATOM   80    C CD    . ARG A 1 16  ? -4.178  22.511  -4.262  1.00 31.29 ? 16   ARG A CD    1 
ATOM   81    N NE    . ARG A 1 16  ? -3.228  23.379  -3.579  1.00 32.78 ? 16   ARG A NE    1 
ATOM   82    C CZ    . ARG A 1 16  ? -2.439  24.267  -4.176  1.00 33.71 ? 16   ARG A CZ    1 
ATOM   83    N NH1   . ARG A 1 16  ? -2.488  24.446  -5.498  1.00 32.33 ? 16   ARG A NH1   1 
ATOM   84    N NH2   . ARG A 1 16  ? -1.616  24.997  -3.426  1.00 33.61 ? 16   ARG A NH2   1 
ATOM   85    N N     . CYS A 1 17  ? -3.427  17.807  -2.623  1.00 23.47 ? 17   CYS A N     1 
ATOM   86    C CA    . CYS A 1 17  ? -3.180  17.704  -1.179  1.00 22.90 ? 17   CYS A CA    1 
ATOM   87    C C     . CYS A 1 17  ? -1.961  16.859  -0.859  1.00 22.84 ? 17   CYS A C     1 
ATOM   88    O O     . CYS A 1 17  ? -1.716  15.822  -1.480  1.00 22.24 ? 17   CYS A O     1 
ATOM   89    C CB    . CYS A 1 17  ? -4.398  17.198  -0.409  1.00 22.64 ? 17   CYS A CB    1 
ATOM   90    S SG    . CYS A 1 17  ? -4.873  15.513  -0.790  1.00 23.09 ? 17   CYS A SG    1 
ATOM   91    N N     . LEU A 1 18  ? -1.211  17.318  0.133   1.00 22.63 ? 18   LEU A N     1 
ATOM   92    C CA    . LEU A 1 18  ? -0.009  16.646  0.526   1.00 22.75 ? 18   LEU A CA    1 
ATOM   93    C C     . LEU A 1 18  ? -0.336  15.359  1.254   1.00 22.65 ? 18   LEU A C     1 
ATOM   94    O O     . LEU A 1 18  ? 0.391   14.390  1.148   1.00 23.00 ? 18   LEU A O     1 
ATOM   95    C CB    . LEU A 1 18  ? 0.865   17.583  1.356   1.00 22.81 ? 18   LEU A CB    1 
ATOM   96    C CG    . LEU A 1 18  ? 1.444   18.815  0.602   1.00 23.23 ? 18   LEU A CG    1 
ATOM   97    C CD1   . LEU A 1 18  ? 2.375   19.594  1.516   1.00 23.20 ? 18   LEU A CD1   1 
ATOM   98    C CD2   . LEU A 1 18  ? 2.167   18.482  -0.726  1.00 20.69 ? 18   LEU A CD2   1 
ATOM   99    N N     . ILE A 1 19  ? -1.461  15.359  1.959   1.00 22.98 ? 19   ILE A N     1 
ATOM   100   C CA    . ILE A 1 19  ? -1.923  14.225  2.752   1.00 22.96 ? 19   ILE A CA    1 
ATOM   101   C C     . ILE A 1 19  ? -3.369  13.943  2.367   1.00 22.84 ? 19   ILE A C     1 
ATOM   102   O O     . ILE A 1 19  ? -4.235  14.790  2.593   1.00 22.76 ? 19   ILE A O     1 
ATOM   103   C CB    . ILE A 1 19  ? -1.863  14.530  4.294   1.00 23.31 ? 19   ILE A CB    1 
ATOM   104   C CG1   . ILE A 1 19  ? -0.428  14.857  4.769   1.00 23.99 ? 19   ILE A CG1   1 
ATOM   105   C CG2   . ILE A 1 19  ? -2.434  13.364  5.113   1.00 23.32 ? 19   ILE A CG2   1 
ATOM   106   C CD1   . ILE A 1 19  ? 0.595   13.727  4.521   1.00 23.15 ? 19   ILE A CD1   1 
ATOM   107   N N     . ASN A 1 20  ? -3.618  12.772  1.776   1.00 22.34 ? 20   ASN A N     1 
ATOM   108   C CA    . ASN A 1 20  ? -4.971  12.281  1.555   1.00 22.15 ? 20   ASN A CA    1 
ATOM   109   C C     . ASN A 1 20  ? -5.476  11.440  2.755   1.00 22.75 ? 20   ASN A C     1 
ATOM   110   O O     . ASN A 1 20  ? -4.746  11.290  3.751   1.00 22.75 ? 20   ASN A O     1 
ATOM   111   C CB    . ASN A 1 20  ? -5.086  11.530  0.215   1.00 21.74 ? 20   ASN A CB    1 
ATOM   112   C CG    . ASN A 1 20  ? -4.266  10.253  0.158   1.00 20.10 ? 20   ASN A CG    1 
ATOM   113   O OD1   . ASN A 1 20  ? -4.060  9.554   1.153   1.00 18.73 ? 20   ASN A OD1   1 
ATOM   114   N ND2   . ASN A 1 20  ? -3.784  9.945   -1.035  1.00 19.73 ? 20   ASN A ND2   1 
ATOM   115   N N     . PRO A 1 21  ? -6.731  10.937  2.697   1.00 23.05 ? 21   PRO A N     1 
ATOM   116   C CA    . PRO A 1 21  ? -7.272  10.172  3.834   1.00 23.98 ? 21   PRO A CA    1 
ATOM   117   C C     . PRO A 1 21  ? -6.422  8.970   4.244   1.00 25.10 ? 21   PRO A C     1 
ATOM   118   O O     . PRO A 1 21  ? -6.202  8.742   5.436   1.00 25.22 ? 21   PRO A O     1 
ATOM   119   C CB    . PRO A 1 21  ? -8.635  9.699   3.320   1.00 23.66 ? 21   PRO A CB    1 
ATOM   120   C CG    . PRO A 1 21  ? -9.013  10.709  2.280   1.00 23.29 ? 21   PRO A CG    1 
ATOM   121   C CD    . PRO A 1 21  ? -7.734  11.113  1.627   1.00 22.75 ? 21   PRO A CD    1 
ATOM   122   N N     . GLU A 1 22  ? -5.957  8.214   3.251   1.00 25.90 ? 22   GLU A N     1 
ATOM   123   C CA    . GLU A 1 22  ? -5.172  7.002   3.474   1.00 26.83 ? 22   GLU A CA    1 
ATOM   124   C C     . GLU A 1 22  ? -3.827  7.339   4.124   1.00 26.29 ? 22   GLU A C     1 
ATOM   125   O O     . GLU A 1 22  ? -3.382  6.654   5.063   1.00 26.21 ? 22   GLU A O     1 
ATOM   126   C CB    . GLU A 1 22  ? -4.963  6.239   2.149   1.00 27.31 ? 22   GLU A CB    1 
ATOM   127   C CG    . GLU A 1 22  ? -6.257  5.604   1.523   1.00 32.19 ? 22   GLU A CG    1 
ATOM   128   C CD    . GLU A 1 22  ? -7.379  6.624   1.124   1.00 35.58 ? 22   GLU A CD    1 
ATOM   129   O OE1   . GLU A 1 22  ? -8.571  6.358   1.471   1.00 33.25 ? 22   GLU A OE1   1 
ATOM   130   O OE2   . GLU A 1 22  ? -7.065  7.669   0.465   1.00 35.73 ? 22   GLU A OE2   1 
ATOM   131   N N     . GLN A 1 23  ? -3.185  8.385   3.612   1.00 25.70 ? 23   GLN A N     1 
ATOM   132   C CA    . GLN A 1 23  ? -1.916  8.839   4.155   1.00 25.26 ? 23   GLN A CA    1 
ATOM   133   C C     . GLN A 1 23  ? -2.065  9.340   5.590   1.00 25.13 ? 23   GLN A C     1 
ATOM   134   O O     . GLN A 1 23  ? -1.167  9.100   6.423   1.00 24.64 ? 23   GLN A O     1 
ATOM   135   C CB    . GLN A 1 23  ? -1.297  9.907   3.257   1.00 25.45 ? 23   GLN A CB    1 
ATOM   136   C CG    . GLN A 1 23  ? -0.873  9.381   1.901   1.00 25.67 ? 23   GLN A CG    1 
ATOM   137   C CD    . GLN A 1 23  ? -0.548  10.487  0.929   1.00 27.21 ? 23   GLN A CD    1 
ATOM   138   O OE1   . GLN A 1 23  ? -1.397  11.324  0.621   1.00 26.13 ? 23   GLN A OE1   1 
ATOM   139   N NE2   . GLN A 1 23  ? 0.689   10.497  0.430   1.00 28.33 ? 23   GLN A NE2   1 
ATOM   140   N N     . TYR A 1 24  ? -3.185  10.011  5.892   1.00 24.89 ? 24   TYR A N     1 
ATOM   141   C CA    . TYR A 1 24  ? -3.442  10.411  7.276   1.00 25.15 ? 24   TYR A CA    1 
ATOM   142   C C     . TYR A 1 24  ? -3.557  9.192   8.191   1.00 25.40 ? 24   TYR A C     1 
ATOM   143   O O     . TYR A 1 24  ? -3.002  9.188   9.297   1.00 25.57 ? 24   TYR A O     1 
ATOM   144   C CB    . TYR A 1 24  ? -4.680  11.312  7.459   1.00 25.42 ? 24   TYR A CB    1 
ATOM   145   C CG    . TYR A 1 24  ? -5.066  11.386  8.927   1.00 25.24 ? 24   TYR A CG    1 
ATOM   146   C CD1   . TYR A 1 24  ? -4.432  12.287  9.772   1.00 25.71 ? 24   TYR A CD1   1 
ATOM   147   C CD2   . TYR A 1 24  ? -5.999  10.489  9.489   1.00 23.85 ? 24   TYR A CD2   1 
ATOM   148   C CE1   . TYR A 1 24  ? -4.725  12.325  11.135  1.00 26.03 ? 24   TYR A CE1   1 
ATOM   149   C CE2   . TYR A 1 24  ? -6.309  10.525  10.858  1.00 23.08 ? 24   TYR A CE2   1 
ATOM   150   C CZ    . TYR A 1 24  ? -5.661  11.447  11.668  1.00 25.14 ? 24   TYR A CZ    1 
ATOM   151   O OH    . TYR A 1 24  ? -5.924  11.535  13.015  1.00 26.09 ? 24   TYR A OH    1 
ATOM   152   N N     . GLU A 1 25  ? -4.282  8.175   7.735   1.00 25.29 ? 25   GLU A N     1 
ATOM   153   C CA    . GLU A 1 25  ? -4.432  6.930   8.497   1.00 26.19 ? 25   GLU A CA    1 
ATOM   154   C C     . GLU A 1 25  ? -3.105  6.174   8.723   1.00 25.59 ? 25   GLU A C     1 
ATOM   155   O O     . GLU A 1 25  ? -2.804  5.746   9.852   1.00 24.56 ? 25   GLU A O     1 
ATOM   156   C CB    . GLU A 1 25  ? -5.481  5.998   7.855   1.00 26.27 ? 25   GLU A CB    1 
ATOM   157   C CG    . GLU A 1 25  ? -6.962  6.394   8.094   1.00 29.20 ? 25   GLU A CG    1 
ATOM   158   C CD    . GLU A 1 25  ? -7.384  6.411   9.576   1.00 33.10 ? 25   GLU A CD    1 
ATOM   159   O OE1   . GLU A 1 25  ? -6.801  5.665   10.411  1.00 33.72 ? 25   GLU A OE1   1 
ATOM   160   O OE2   . GLU A 1 25  ? -8.311  7.187   9.904   1.00 35.33 ? 25   GLU A OE2   1 
ATOM   161   N N     . THR A 1 26  ? -2.335  6.025   7.643   1.00 25.38 ? 26   THR A N     1 
ATOM   162   C CA    . THR A 1 26  ? -1.039  5.370   7.684   1.00 25.58 ? 26   THR A CA    1 
ATOM   163   C C     . THR A 1 26  ? -0.095  6.164   8.553   1.00 25.80 ? 26   THR A C     1 
ATOM   164   O O     . THR A 1 26  ? 0.531   5.607   9.430   1.00 25.98 ? 26   THR A O     1 
ATOM   165   C CB    . THR A 1 26  ? -0.406  5.216   6.274   1.00 25.90 ? 26   THR A CB    1 
ATOM   166   O OG1   . THR A 1 26  ? -1.312  4.546   5.385   1.00 25.45 ? 26   THR A OG1   1 
ATOM   167   C CG2   . THR A 1 26  ? 0.887   4.421   6.344   1.00 27.27 ? 26   THR A CG2   1 
ATOM   168   N N     . LYS A 1 27  ? 0.017   7.467   8.326   1.00 26.37 ? 27   LYS A N     1 
ATOM   169   C CA    . LYS A 1 27  ? 0.963   8.256   9.126   1.00 27.12 ? 27   LYS A CA    1 
ATOM   170   C C     . LYS A 1 27  ? 0.544   8.350   10.597  1.00 26.55 ? 27   LYS A C     1 
ATOM   171   O O     . LYS A 1 27  ? 1.393   8.256   11.501  1.00 26.19 ? 27   LYS A O     1 
ATOM   172   C CB    . LYS A 1 27  ? 1.200   9.651   8.531   1.00 27.24 ? 27   LYS A CB    1 
ATOM   173   C CG    . LYS A 1 27  ? 1.993   9.633   7.222   1.00 28.38 ? 27   LYS A CG    1 
ATOM   174   C CD    . LYS A 1 27  ? 2.402   11.043  6.782   1.00 28.89 ? 27   LYS A CD    1 
ATOM   175   C CE    . LYS A 1 27  ? 3.286   10.982  5.520   1.00 31.15 ? 27   LYS A CE    1 
ATOM   176   N NZ    . LYS A 1 27  ? 4.735   10.703  5.813   1.00 30.60 ? 27   LYS A NZ    1 
ATOM   177   N N     . TYR A 1 28  ? -0.755  8.530   10.842  1.00 26.09 ? 28   TYR A N     1 
ATOM   178   C CA    . TYR A 1 28  ? -1.217  8.608   12.213  1.00 26.06 ? 28   TYR A CA    1 
ATOM   179   C C     . TYR A 1 28  ? -0.852  7.340   12.984  1.00 26.48 ? 28   TYR A C     1 
ATOM   180   O O     . TYR A 1 28  ? -0.334  7.417   14.112  1.00 26.69 ? 28   TYR A O     1 
ATOM   181   C CB    . TYR A 1 28  ? -2.716  8.868   12.332  1.00 25.70 ? 28   TYR A CB    1 
ATOM   182   C CG    . TYR A 1 28  ? -3.084  8.992   13.791  1.00 26.54 ? 28   TYR A CG    1 
ATOM   183   C CD1   . TYR A 1 28  ? -2.782  10.174  14.508  1.00 25.21 ? 28   TYR A CD1   1 
ATOM   184   C CD2   . TYR A 1 28  ? -3.648  7.907   14.496  1.00 25.70 ? 28   TYR A CD2   1 
ATOM   185   C CE1   . TYR A 1 28  ? -3.064  10.276  15.869  1.00 24.96 ? 28   TYR A CE1   1 
ATOM   186   C CE2   . TYR A 1 28  ? -3.942  8.013   15.855  1.00 23.90 ? 28   TYR A CE2   1 
ATOM   187   C CZ    . TYR A 1 28  ? -3.644  9.197   16.527  1.00 24.77 ? 28   TYR A CZ    1 
ATOM   188   O OH    . TYR A 1 28  ? -3.917  9.318   17.858  1.00 24.92 ? 28   TYR A OH    1 
ATOM   189   N N     . LYS A 1 29  ? -1.121  6.187   12.367  1.00 26.12 ? 29   LYS A N     1 
ATOM   190   C CA    . LYS A 1 29  ? -0.867  4.886   12.960  1.00 25.76 ? 29   LYS A CA    1 
ATOM   191   C C     . LYS A 1 29  ? 0.620   4.630   13.242  1.00 25.80 ? 29   LYS A C     1 
ATOM   192   O O     . LYS A 1 29  ? 0.955   4.102   14.297  1.00 25.70 ? 29   LYS A O     1 
ATOM   193   C CB    . LYS A 1 29  ? -1.477  3.771   12.087  1.00 26.24 ? 29   LYS A CB    1 
ATOM   194   N N     . GLN A 1 30  ? 1.506   5.003   12.316  1.00 25.76 ? 30   GLN A N     1 
ATOM   195   C CA    . GLN A 1 30  ? 2.952   4.901   12.556  1.00 26.25 ? 30   GLN A CA    1 
ATOM   196   C C     . GLN A 1 30  ? 3.431   5.835   13.691  1.00 26.68 ? 30   GLN A C     1 
ATOM   197   O O     . GLN A 1 30  ? 4.233   5.440   14.554  1.00 26.28 ? 30   GLN A O     1 
ATOM   198   C CB    . GLN A 1 30  ? 3.765   5.163   11.277  1.00 25.97 ? 30   GLN A CB    1 
ATOM   199   C CG    . GLN A 1 30  ? 5.274   4.888   11.477  1.00 26.46 ? 30   GLN A CG    1 
ATOM   200   C CD    . GLN A 1 30  ? 6.126   5.085   10.231  1.00 26.56 ? 30   GLN A CD    1 
ATOM   201   O OE1   . GLN A 1 30  ? 6.074   6.138   9.591   1.00 30.10 ? 30   GLN A OE1   1 
ATOM   202   N NE2   . GLN A 1 30  ? 6.945   4.089   9.903   1.00 23.43 ? 30   GLN A NE2   1 
ATOM   203   N N     . SER A 1 31  ? 2.933   7.071   13.671  1.00 27.01 ? 31   SER A N     1 
ATOM   204   C CA    . SER A 1 31  ? 3.254   8.069   14.691  1.00 27.50 ? 31   SER A CA    1 
ATOM   205   C C     . SER A 1 31  ? 3.017   7.587   16.121  1.00 27.48 ? 31   SER A C     1 
ATOM   206   O O     . SER A 1 31  ? 3.663   8.055   17.051  1.00 28.07 ? 31   SER A O     1 
ATOM   207   C CB    . SER A 1 31  ? 2.470   9.365   14.426  1.00 27.50 ? 31   SER A CB    1 
ATOM   208   O OG    . SER A 1 31  ? 1.093   9.209   14.705  1.00 27.75 ? 31   SER A OG    1 
ATOM   209   N N     . ILE A 1 32  ? 2.097   6.644   16.279  1.00 27.48 ? 32   ILE A N     1 
ATOM   210   C CA    . ILE A 1 32  ? 1.721   6.105   17.579  1.00 27.52 ? 32   ILE A CA    1 
ATOM   211   C C     . ILE A 1 32  ? 2.425   4.780   17.884  1.00 27.37 ? 32   ILE A C     1 
ATOM   212   O O     . ILE A 1 32  ? 2.943   4.585   18.984  1.00 27.34 ? 32   ILE A O     1 
ATOM   213   C CB    . ILE A 1 32  ? 0.182   5.923   17.668  1.00 27.68 ? 32   ILE A CB    1 
ATOM   214   C CG1   . ILE A 1 32  ? -0.546  7.237   17.319  1.00 27.62 ? 32   ILE A CG1   1 
ATOM   215   C CG2   . ILE A 1 32  ? -0.228  5.352   19.036  1.00 28.40 ? 32   ILE A CG2   1 
ATOM   216   C CD1   . ILE A 1 32  ? -0.134  8.494   18.163  1.00 26.37 ? 32   ILE A CD1   1 
ATOM   217   N N     . ASN A 1 33  ? 2.435   3.885   16.900  1.00 27.48 ? 33   ASN A N     1 
ATOM   218   C CA    . ASN A 1 33  ? 3.049   2.561   17.021  1.00 27.74 ? 33   ASN A CA    1 
ATOM   219   C C     . ASN A 1 33  ? 4.584   2.602   17.035  1.00 27.82 ? 33   ASN A C     1 
ATOM   220   O O     . ASN A 1 33  ? 5.231   1.781   17.691  1.00 27.40 ? 33   ASN A O     1 
ATOM   221   C CB    . ASN A 1 33  ? 2.584   1.644   15.875  1.00 27.77 ? 33   ASN A CB    1 
ATOM   222   C CG    . ASN A 1 33  ? 1.095   1.297   15.952  1.00 29.50 ? 33   ASN A CG    1 
ATOM   223   O OD1   . ASN A 1 33  ? 0.468   1.370   17.029  1.00 30.94 ? 33   ASN A OD1   1 
ATOM   224   N ND2   . ASN A 1 33  ? 0.519   0.909   14.803  1.00 29.04 ? 33   ASN A ND2   1 
ATOM   225   N N     . ASP A 1 34  ? 5.159   3.533   16.279  1.00 27.55 ? 34   ASP A N     1 
ATOM   226   C CA    . ASP A 1 34  ? 6.601   3.682   16.226  1.00 27.69 ? 34   ASP A CA    1 
ATOM   227   C C     . ASP A 1 34  ? 6.997   5.167   16.113  1.00 27.62 ? 34   ASP A C     1 
ATOM   228   O O     . ASP A 1 34  ? 7.310   5.648   15.023  1.00 27.87 ? 34   ASP A O     1 
ATOM   229   C CB    . ASP A 1 34  ? 7.168   2.845   15.077  1.00 27.46 ? 34   ASP A CB    1 
ATOM   230   C CG    . ASP A 1 34  ? 8.689   2.860   15.024  1.00 28.11 ? 34   ASP A CG    1 
ATOM   231   O OD1   . ASP A 1 34  ? 9.350   3.362   15.980  1.00 26.23 ? 34   ASP A OD1   1 
ATOM   232   O OD2   . ASP A 1 34  ? 9.216   2.357   14.000  1.00 27.79 ? 34   ASP A OD2   1 
ATOM   233   N N     . PRO A 1 35  ? 6.985   5.894   17.250  1.00 27.41 ? 35   PRO A N     1 
ATOM   234   C CA    . PRO A 1 35  ? 7.308   7.323   17.282  1.00 27.45 ? 35   PRO A CA    1 
ATOM   235   C C     . PRO A 1 35  ? 8.704   7.615   16.792  1.00 27.52 ? 35   PRO A C     1 
ATOM   236   O O     . PRO A 1 35  ? 8.939   8.651   16.195  1.00 28.38 ? 35   PRO A O     1 
ATOM   237   C CB    . PRO A 1 35  ? 7.217   7.667   18.765  1.00 27.43 ? 35   PRO A CB    1 
ATOM   238   C CG    . PRO A 1 35  ? 6.304   6.645   19.331  1.00 27.42 ? 35   PRO A CG    1 
ATOM   239   C CD    . PRO A 1 35  ? 6.638   5.394   18.591  1.00 27.23 ? 35   PRO A CD    1 
ATOM   240   N N     . ASP A 1 36  ? 9.621   6.692   17.027  1.00 27.58 ? 36   ASP A N     1 
ATOM   241   C CA    . ASP A 1 36  ? 11.018  6.921   16.751  1.00 27.25 ? 36   ASP A CA    1 
ATOM   242   C C     . ASP A 1 36  ? 11.339  6.924   15.259  1.00 27.02 ? 36   ASP A C     1 
ATOM   243   O O     . ASP A 1 36  ? 11.985  7.853   14.775  1.00 27.20 ? 36   ASP A O     1 
ATOM   244   C CB    . ASP A 1 36  ? 11.877  5.930   17.552  1.00 27.79 ? 36   ASP A CB    1 
ATOM   245   C CG    . ASP A 1 36  ? 12.103  6.387   18.999  1.00 28.20 ? 36   ASP A CG    1 
ATOM   246   O OD1   . ASP A 1 36  ? 12.445  5.548   19.862  1.00 30.40 ? 36   ASP A OD1   1 
ATOM   247   O OD2   . ASP A 1 36  ? 11.956  7.599   19.274  1.00 28.10 ? 36   ASP A OD2   1 
ATOM   248   N N     . THR A 1 37  ? 10.882  5.906   14.526  1.00 26.44 ? 37   THR A N     1 
ATOM   249   C CA    . THR A 1 37  ? 10.969  5.929   13.061  1.00 25.36 ? 37   THR A CA    1 
ATOM   250   C C     . THR A 1 37  ? 10.128  7.083   12.467  1.00 25.15 ? 37   THR A C     1 
ATOM   251   O O     . THR A 1 37  ? 10.596  7.801   11.568  1.00 25.28 ? 37   THR A O     1 
ATOM   252   C CB    . THR A 1 37  ? 10.540  4.588   12.424  1.00 25.25 ? 37   THR A CB    1 
ATOM   253   O OG1   . THR A 1 37  ? 11.387  3.537   12.905  1.00 25.00 ? 37   THR A OG1   1 
ATOM   254   C CG2   . THR A 1 37  ? 10.653  4.650   10.906  1.00 23.93 ? 37   THR A CG2   1 
ATOM   255   N N     . PHE A 1 38  ? 8.903   7.264   12.959  1.00 24.38 ? 38   PHE A N     1 
ATOM   256   C CA    . PHE A 1 38  ? 8.079   8.352   12.447  1.00 23.90 ? 38   PHE A CA    1 
ATOM   257   C C     . PHE A 1 38  ? 8.742   9.727   12.608  1.00 23.61 ? 38   PHE A C     1 
ATOM   258   O O     . PHE A 1 38  ? 9.031   10.385  11.610  1.00 23.74 ? 38   PHE A O     1 
ATOM   259   C CB    . PHE A 1 38  ? 6.650   8.360   12.996  1.00 23.51 ? 38   PHE A CB    1 
ATOM   260   C CG    . PHE A 1 38  ? 5.795   9.414   12.362  1.00 22.78 ? 38   PHE A CG    1 
ATOM   261   C CD1   . PHE A 1 38  ? 5.102   9.146   11.178  1.00 23.88 ? 38   PHE A CD1   1 
ATOM   262   C CD2   . PHE A 1 38  ? 5.726   10.702  12.910  1.00 23.65 ? 38   PHE A CD2   1 
ATOM   263   C CE1   . PHE A 1 38  ? 4.323   10.142  10.557  1.00 23.47 ? 38   PHE A CE1   1 
ATOM   264   C CE2   . PHE A 1 38  ? 4.964   11.710  12.302  1.00 23.44 ? 38   PHE A CE2   1 
ATOM   265   C CZ    . PHE A 1 38  ? 4.255   11.430  11.127  1.00 23.44 ? 38   PHE A CZ    1 
ATOM   266   N N     . TRP A 1 39  ? 8.989   10.157  13.841  1.00 23.18 ? 39   TRP A N     1 
ATOM   267   C CA    . TRP A 1 39  ? 9.592   11.486  14.056  1.00 23.17 ? 39   TRP A CA    1 
ATOM   268   C C     . TRP A 1 39  ? 11.072  11.572  13.686  1.00 23.18 ? 39   TRP A C     1 
ATOM   269   O O     . TRP A 1 39  ? 11.571  12.653  13.389  1.00 23.37 ? 39   TRP A O     1 
ATOM   270   C CB    . TRP A 1 39  ? 9.357   11.986  15.480  1.00 22.64 ? 39   TRP A CB    1 
ATOM   271   C CG    . TRP A 1 39  ? 7.918   12.251  15.753  1.00 22.83 ? 39   TRP A CG    1 
ATOM   272   C CD1   . TRP A 1 39  ? 7.079   11.505  16.544  1.00 23.37 ? 39   TRP A CD1   1 
ATOM   273   C CD2   . TRP A 1 39  ? 7.123   13.320  15.221  1.00 21.65 ? 39   TRP A CD2   1 
ATOM   274   N NE1   . TRP A 1 39  ? 5.817   12.057  16.543  1.00 23.56 ? 39   TRP A NE1   1 
ATOM   275   C CE2   . TRP A 1 39  ? 5.818   13.170  15.743  1.00 22.07 ? 39   TRP A CE2   1 
ATOM   276   C CE3   . TRP A 1 39  ? 7.389   14.390  14.358  1.00 21.65 ? 39   TRP A CE3   1 
ATOM   277   C CZ2   . TRP A 1 39  ? 4.786   14.053  15.438  1.00 22.08 ? 39   TRP A CZ2   1 
ATOM   278   C CZ3   . TRP A 1 39  ? 6.369   15.258  14.044  1.00 22.97 ? 39   TRP A CZ3   1 
ATOM   279   C CH2   . TRP A 1 39  ? 5.076   15.089  14.587  1.00 23.03 ? 39   TRP A CH2   1 
ATOM   280   N N     . GLY A 1 40  ? 11.760  10.429  13.701  1.00 23.68 ? 40   GLY A N     1 
ATOM   281   C CA    . GLY A 1 40  ? 13.123  10.314  13.162  1.00 23.51 ? 40   GLY A CA    1 
ATOM   282   C C     . GLY A 1 40  ? 13.188  10.731  11.708  1.00 23.74 ? 40   GLY A C     1 
ATOM   283   O O     . GLY A 1 40  ? 14.071  11.488  11.326  1.00 24.06 ? 40   GLY A O     1 
ATOM   284   N N     . GLU A 1 41  ? 12.238  10.255  10.899  1.00 23.87 ? 41   GLU A N     1 
ATOM   285   C CA    . GLU A 1 41  ? 12.118  10.658  9.484   1.00 24.26 ? 41   GLU A CA    1 
ATOM   286   C C     . GLU A 1 41  ? 11.607  12.086  9.350   1.00 23.02 ? 41   GLU A C     1 
ATOM   287   O O     . GLU A 1 41  ? 12.162  12.897  8.631   1.00 22.00 ? 41   GLU A O     1 
ATOM   288   C CB    . GLU A 1 41  ? 11.207  9.684   8.714   1.00 23.28 ? 41   GLU A CB    1 
ATOM   289   C CG    . GLU A 1 41  ? 11.942  8.477   8.092   1.00 27.08 ? 41   GLU A CG    1 
ATOM   290   C CD    . GLU A 1 41  ? 10.998  7.311   7.694   1.00 28.12 ? 41   GLU A CD    1 
ATOM   291   O OE1   . GLU A 1 41  ? 11.446  6.128   7.728   1.00 31.59 ? 41   GLU A OE1   1 
ATOM   292   O OE2   . GLU A 1 41  ? 9.808   7.573   7.356   1.00 32.70 ? 41   GLU A OE2   1 
ATOM   293   N N     . GLN A 1 42  ? 10.545  12.387  10.078  1.00 23.27 ? 42   GLN A N     1 
ATOM   294   C CA    . GLN A 1 42  ? 9.903   13.679  9.983   1.00 23.59 ? 42   GLN A CA    1 
ATOM   295   C C     . GLN A 1 42  ? 10.787  14.849  10.469  1.00 23.57 ? 42   GLN A C     1 
ATOM   296   O O     . GLN A 1 42  ? 10.646  15.959  9.951   1.00 23.75 ? 42   GLN A O     1 
ATOM   297   C CB    . GLN A 1 42  ? 8.509   13.650  10.643  1.00 23.49 ? 42   GLN A CB    1 
ATOM   298   C CG    . GLN A 1 42  ? 7.604   14.858  10.303  1.00 24.77 ? 42   GLN A CG    1 
ATOM   299   C CD    . GLN A 1 42  ? 7.613   15.230  8.816   1.00 25.54 ? 42   GLN A CD    1 
ATOM   300   O OE1   . GLN A 1 42  ? 7.723   16.403  8.450   1.00 27.52 ? 42   GLN A OE1   1 
ATOM   301   N NE2   . GLN A 1 42  ? 7.484   14.239  7.966   1.00 25.80 ? 42   GLN A NE2   1 
ATOM   302   N N     . GLY A 1 43  ? 11.722  14.592  11.397  1.00 23.43 ? 43   GLY A N     1 
ATOM   303   C CA    . GLY A 1 43  ? 12.692  15.607  11.861  1.00 23.72 ? 43   GLY A CA    1 
ATOM   304   C C     . GLY A 1 43  ? 13.573  16.223  10.758  1.00 24.46 ? 43   GLY A C     1 
ATOM   305   O O     . GLY A 1 43  ? 14.174  17.284  10.943  1.00 24.60 ? 43   GLY A O     1 
ATOM   306   N N     . LYS A 1 44  ? 13.623  15.567  9.601   1.00 24.45 ? 44   LYS A N     1 
ATOM   307   C CA    . LYS A 1 44  ? 14.445  15.991  8.475   1.00 24.74 ? 44   LYS A CA    1 
ATOM   308   C C     . LYS A 1 44  ? 13.857  17.188  7.730   1.00 24.51 ? 44   LYS A C     1 
ATOM   309   O O     . LYS A 1 44  ? 14.481  17.726  6.814   1.00 24.22 ? 44   LYS A O     1 
ATOM   310   C CB    . LYS A 1 44  ? 14.663  14.809  7.524   1.00 25.78 ? 44   LYS A CB    1 
ATOM   311   C CG    . LYS A 1 44  ? 15.317  13.570  8.204   1.00 25.99 ? 44   LYS A CG    1 
ATOM   312   C CD    . LYS A 1 44  ? 16.821  13.547  8.038   1.00 28.31 ? 44   LYS A CD    1 
ATOM   313   C CE    . LYS A 1 44  ? 17.502  12.384  8.843   1.00 30.20 ? 44   LYS A CE    1 
ATOM   314   N NZ    . LYS A 1 44  ? 17.218  10.999  8.319   1.00 30.01 ? 44   LYS A NZ    1 
ATOM   315   N N     . ILE A 1 45  ? 12.654  17.613  8.132   1.00 24.11 ? 45   ILE A N     1 
ATOM   316   C CA    . ILE A 1 45  ? 12.064  18.867  7.626   1.00 23.05 ? 45   ILE A CA    1 
ATOM   317   C C     . ILE A 1 45  ? 12.972  20.101  7.977   1.00 23.29 ? 45   ILE A C     1 
ATOM   318   O O     . ILE A 1 45  ? 12.858  21.186  7.380   1.00 22.94 ? 45   ILE A O     1 
ATOM   319   C CB    . ILE A 1 45  ? 10.611  19.020  8.162   1.00 23.36 ? 45   ILE A CB    1 
ATOM   320   C CG1   . ILE A 1 45  ? 9.804   20.037  7.327   1.00 21.46 ? 45   ILE A CG1   1 
ATOM   321   C CG2   . ILE A 1 45  ? 10.604  19.255  9.724   1.00 21.51 ? 45   ILE A CG2   1 
ATOM   322   C CD1   . ILE A 1 45  ? 8.303   20.022  7.614   1.00 22.28 ? 45   ILE A CD1   1 
ATOM   323   N N     . LEU A 1 46  ? 13.875  19.884  8.939   1.00 22.93 ? 46   LEU A N     1 
ATOM   324   C CA    . LEU A 1 46  ? 14.884  20.847  9.356   1.00 22.53 ? 46   LEU A CA    1 
ATOM   325   C C     . LEU A 1 46  ? 16.313  20.409  8.999   1.00 22.92 ? 46   LEU A C     1 
ATOM   326   O O     . LEU A 1 46  ? 16.591  19.213  8.825   1.00 22.21 ? 46   LEU A O     1 
ATOM   327   C CB    . LEU A 1 46  ? 14.803  21.052  10.873  1.00 22.26 ? 46   LEU A CB    1 
ATOM   328   C CG    . LEU A 1 46  ? 13.463  21.339  11.549  1.00 21.10 ? 46   LEU A CG    1 
ATOM   329   C CD1   . LEU A 1 46  ? 13.700  21.580  13.052  1.00 20.21 ? 46   LEU A CD1   1 
ATOM   330   C CD2   . LEU A 1 46  ? 12.709  22.504  10.881  1.00 19.51 ? 46   LEU A CD2   1 
ATOM   331   N N     . ASP A 1 47  ? 17.203  21.399  8.898   1.00 22.95 ? 47   ASP A N     1 
ATOM   332   C CA    . ASP A 1 47  ? 18.630  21.165  8.813   1.00 23.65 ? 47   ASP A CA    1 
ATOM   333   C C     . ASP A 1 47  ? 19.187  20.943  10.210  1.00 23.66 ? 47   ASP A C     1 
ATOM   334   O O     . ASP A 1 47  ? 18.879  21.696  11.154  1.00 24.54 ? 47   ASP A O     1 
ATOM   335   C CB    . ASP A 1 47  ? 19.342  22.360  8.165   1.00 24.00 ? 47   ASP A CB    1 
ATOM   336   C CG    . ASP A 1 47  ? 19.110  22.459  6.641   1.00 25.05 ? 47   ASP A CG    1 
ATOM   337   O OD1   . ASP A 1 47  ? 19.767  23.328  6.022   1.00 24.86 ? 47   ASP A OD1   1 
ATOM   338   O OD2   . ASP A 1 47  ? 18.291  21.691  6.069   1.00 24.65 ? 47   ASP A OD2   1 
ATOM   339   N N     . TRP A 1 48  ? 19.992  19.907  10.355  1.00 23.33 ? 48   TRP A N     1 
ATOM   340   C CA    . TRP A 1 48  ? 20.669  19.645  11.624  1.00 23.30 ? 48   TRP A CA    1 
ATOM   341   C C     . TRP A 1 48  ? 22.202  19.814  11.479  1.00 23.90 ? 48   TRP A C     1 
ATOM   342   O O     . TRP A 1 48  ? 22.791  19.364  10.480  1.00 23.33 ? 48   TRP A O     1 
ATOM   343   C CB    . TRP A 1 48  ? 20.274  18.259  12.155  1.00 22.99 ? 48   TRP A CB    1 
ATOM   344   C CG    . TRP A 1 48  ? 18.830  18.194  12.508  1.00 22.55 ? 48   TRP A CG    1 
ATOM   345   C CD1   . TRP A 1 48  ? 17.772  18.045  11.643  1.00 23.27 ? 48   TRP A CD1   1 
ATOM   346   C CD2   . TRP A 1 48  ? 18.259  18.315  13.820  1.00 22.74 ? 48   TRP A CD2   1 
ATOM   347   N NE1   . TRP A 1 48  ? 16.579  18.062  12.343  1.00 22.26 ? 48   TRP A NE1   1 
ATOM   348   C CE2   . TRP A 1 48  ? 16.849  18.235  13.675  1.00 21.59 ? 48   TRP A CE2   1 
ATOM   349   C CE3   . TRP A 1 48  ? 18.802  18.473  15.107  1.00 22.37 ? 48   TRP A CE3   1 
ATOM   350   C CZ2   . TRP A 1 48  ? 15.979  18.304  14.764  1.00 22.38 ? 48   TRP A CZ2   1 
ATOM   351   C CZ3   . TRP A 1 48  ? 17.932  18.553  16.194  1.00 22.51 ? 48   TRP A CZ3   1 
ATOM   352   C CH2   . TRP A 1 48  ? 16.537  18.466  16.013  1.00 23.39 ? 48   TRP A CH2   1 
ATOM   353   N N     . ILE A 1 49  ? 22.835  20.488  12.449  1.00 24.23 ? 49   ILE A N     1 
ATOM   354   C CA    . ILE A 1 49  ? 24.279  20.688  12.412  1.00 24.87 ? 49   ILE A CA    1 
ATOM   355   C C     . ILE A 1 49  ? 25.054  19.392  12.778  1.00 25.79 ? 49   ILE A C     1 
ATOM   356   O O     . ILE A 1 49  ? 25.849  18.887  11.974  1.00 25.69 ? 49   ILE A O     1 
ATOM   357   C CB    . ILE A 1 49  ? 24.698  21.923  13.220  1.00 25.01 ? 49   ILE A CB    1 
ATOM   358   C CG1   . ILE A 1 49  ? 23.996  23.162  12.643  1.00 24.10 ? 49   ILE A CG1   1 
ATOM   359   C CG2   . ILE A 1 49  ? 26.233  22.090  13.166  1.00 24.95 ? 49   ILE A CG2   1 
ATOM   360   C CD1   . ILE A 1 49  ? 23.926  24.385  13.538  1.00 21.23 ? 49   ILE A CD1   1 
ATOM   361   N N     . THR A 1 50  ? 24.815  18.847  13.970  1.00 26.70 ? 50   THR A N     1 
ATOM   362   C CA    . THR A 1 50  ? 25.052  17.421  14.190  1.00 27.31 ? 50   THR A CA    1 
ATOM   363   C C     . THR A 1 50  ? 23.698  16.707  14.322  1.00 27.52 ? 50   THR A C     1 
ATOM   364   O O     . THR A 1 50  ? 22.846  17.117  15.114  1.00 27.28 ? 50   THR A O     1 
ATOM   365   C CB    . THR A 1 50  ? 26.039  17.099  15.352  1.00 27.72 ? 50   THR A CB    1 
ATOM   366   O OG1   . THR A 1 50  ? 25.349  16.570  16.493  1.00 27.85 ? 50   THR A OG1   1 
ATOM   367   C CG2   . THR A 1 50  ? 26.864  18.319  15.740  1.00 28.44 ? 50   THR A CG2   1 
ATOM   368   N N     . PRO A 1 51  ? 23.467  15.693  13.468  1.00 27.86 ? 51   PRO A N     1 
ATOM   369   C CA    . PRO A 1 51  ? 22.283  14.816  13.494  1.00 27.63 ? 51   PRO A CA    1 
ATOM   370   C C     . PRO A 1 51  ? 22.015  14.149  14.835  1.00 26.72 ? 51   PRO A C     1 
ATOM   371   O O     . PRO A 1 51  ? 22.942  13.768  15.531  1.00 26.87 ? 51   PRO A O     1 
ATOM   372   C CB    . PRO A 1 51  ? 22.609  13.747  12.434  1.00 27.43 ? 51   PRO A CB    1 
ATOM   373   C CG    . PRO A 1 51  ? 24.072  13.920  12.137  1.00 28.07 ? 51   PRO A CG    1 
ATOM   374   C CD    . PRO A 1 51  ? 24.335  15.369  12.324  1.00 27.73 ? 51   PRO A CD    1 
ATOM   375   N N     . TYR A 1 52  ? 20.739  14.028  15.176  1.00 26.35 ? 52   TYR A N     1 
ATOM   376   C CA    . TYR A 1 52  ? 20.304  13.304  16.369  1.00 26.17 ? 52   TYR A CA    1 
ATOM   377   C C     . TYR A 1 52  ? 20.383  11.818  16.092  1.00 26.54 ? 52   TYR A C     1 
ATOM   378   O O     . TYR A 1 52  ? 20.323  11.382  14.932  1.00 26.48 ? 52   TYR A O     1 
ATOM   379   C CB    . TYR A 1 52  ? 18.867  13.695  16.790  1.00 24.93 ? 52   TYR A CB    1 
ATOM   380   C CG    . TYR A 1 52  ? 17.894  13.659  15.639  1.00 24.32 ? 52   TYR A CG    1 
ATOM   381   C CD1   . TYR A 1 52  ? 17.288  12.467  15.237  1.00 22.49 ? 52   TYR A CD1   1 
ATOM   382   C CD2   . TYR A 1 52  ? 17.602  14.819  14.927  1.00 23.43 ? 52   TYR A CD2   1 
ATOM   383   C CE1   . TYR A 1 52  ? 16.434  12.441  14.159  1.00 22.09 ? 52   TYR A CE1   1 
ATOM   384   C CE2   . TYR A 1 52  ? 16.743  14.800  13.855  1.00 23.45 ? 52   TYR A CE2   1 
ATOM   385   C CZ    . TYR A 1 52  ? 16.165  13.621  13.476  1.00 23.06 ? 52   TYR A CZ    1 
ATOM   386   O OH    . TYR A 1 52  ? 15.316  13.639  12.411  1.00 22.90 ? 52   TYR A OH    1 
ATOM   387   N N     . GLN A 1 53  ? 20.536  11.049  17.166  1.00 27.52 ? 53   GLN A N     1 
ATOM   388   C CA    . GLN A 1 53  ? 20.397  9.604   17.110  1.00 28.39 ? 53   GLN A CA    1 
ATOM   389   C C     . GLN A 1 53  ? 19.114  9.217   17.859  1.00 27.60 ? 53   GLN A C     1 
ATOM   390   O O     . GLN A 1 53  ? 18.278  8.480   17.351  1.00 27.11 ? 53   GLN A O     1 
ATOM   391   C CB    . GLN A 1 53  ? 21.649  8.919   17.672  1.00 29.03 ? 53   GLN A CB    1 
ATOM   392   C CG    . GLN A 1 53  ? 22.865  8.902   16.693  1.00 33.92 ? 53   GLN A CG    1 
ATOM   393   C CD    . GLN A 1 53  ? 23.976  9.940   17.038  1.00 40.43 ? 53   GLN A CD    1 
ATOM   394   O OE1   . GLN A 1 53  ? 23.852  11.144  16.742  1.00 43.07 ? 53   GLN A OE1   1 
ATOM   395   N NE2   . GLN A 1 53  ? 25.069  9.461   17.643  1.00 39.08 ? 53   GLN A NE2   1 
ATOM   396   N N     . LYS A 1 54  ? 18.954  9.761   19.057  1.00 27.51 ? 54   LYS A N     1 
ATOM   397   C CA    . LYS A 1 54  ? 17.750  9.575   19.862  1.00 27.16 ? 54   LYS A CA    1 
ATOM   398   C C     . LYS A 1 54  ? 16.633  10.411  19.277  1.00 26.81 ? 54   LYS A C     1 
ATOM   399   O O     . LYS A 1 54  ? 16.884  11.447  18.647  1.00 26.78 ? 54   LYS A O     1 
ATOM   400   C CB    . LYS A 1 54  ? 18.019  10.017  21.304  1.00 27.71 ? 54   LYS A CB    1 
ATOM   401   C CG    . LYS A 1 54  ? 19.045  9.162   22.009  1.00 28.70 ? 54   LYS A CG    1 
ATOM   402   C CD    . LYS A 1 54  ? 19.634  9.823   23.225  1.00 31.34 ? 54   LYS A CD    1 
ATOM   403   C CE    . LYS A 1 54  ? 20.614  8.857   23.895  1.00 33.98 ? 54   LYS A CE    1 
ATOM   404   N NZ    . LYS A 1 54  ? 21.753  9.524   24.602  1.00 36.42 ? 54   LYS A NZ    1 
ATOM   405   N N     . VAL A 1 55  ? 15.399  9.956   19.466  1.00 26.10 ? 55   VAL A N     1 
ATOM   406   C CA    . VAL A 1 55  ? 14.231  10.712  19.018  1.00 25.76 ? 55   VAL A CA    1 
ATOM   407   C C     . VAL A 1 55  ? 13.330  11.002  20.228  1.00 25.53 ? 55   VAL A C     1 
ATOM   408   O O     . VAL A 1 55  ? 13.403  12.101  20.798  1.00 25.24 ? 55   VAL A O     1 
ATOM   409   C CB    . VAL A 1 55  ? 13.477  10.008  17.836  1.00 25.91 ? 55   VAL A CB    1 
ATOM   410   C CG1   . VAL A 1 55  ? 12.111  10.675  17.551  1.00 25.18 ? 55   VAL A CG1   1 
ATOM   411   C CG2   . VAL A 1 55  ? 14.353  9.990   16.580  1.00 25.53 ? 55   VAL A CG2   1 
ATOM   412   N N     . LYS A 1 56  ? 12.527  10.008  20.634  1.00 25.04 ? 56   LYS A N     1 
ATOM   413   C CA    . LYS A 1 56  ? 11.573  10.166  21.731  1.00 24.82 ? 56   LYS A CA    1 
ATOM   414   C C     . LYS A 1 56  ? 12.176  9.679   23.030  1.00 24.76 ? 56   LYS A C     1 
ATOM   415   O O     . LYS A 1 56  ? 12.626  8.544   23.112  1.00 24.94 ? 56   LYS A O     1 
ATOM   416   C CB    . LYS A 1 56  ? 10.273  9.414   21.429  1.00 24.42 ? 56   LYS A CB    1 
ATOM   417   C CG    . LYS A 1 56  ? 9.161   9.628   22.450  1.00 24.65 ? 56   LYS A CG    1 
ATOM   418   C CD    . LYS A 1 56  ? 7.927   8.778   22.090  1.00 24.90 ? 56   LYS A CD    1 
ATOM   419   C CE    . LYS A 1 56  ? 6.693   9.043   22.981  1.00 23.44 ? 56   LYS A CE    1 
ATOM   420   N NZ    . LYS A 1 56  ? 6.921   8.685   24.392  1.00 20.00 ? 56   LYS A NZ    1 
ATOM   421   N N     . ASN A 1 57  ? 12.185  10.549  24.036  1.00 24.80 ? 57   ASN A N     1 
ATOM   422   C CA    . ASN A 1 57  ? 12.693  10.218  25.361  1.00 24.59 ? 57   ASN A CA    1 
ATOM   423   C C     . ASN A 1 57  ? 11.949  11.022  26.421  1.00 24.55 ? 57   ASN A C     1 
ATOM   424   O O     . ASN A 1 57  ? 12.446  12.038  26.937  1.00 24.12 ? 57   ASN A O     1 
ATOM   425   C CB    . ASN A 1 57  ? 14.209  10.433  25.441  1.00 24.75 ? 57   ASN A CB    1 
ATOM   426   C CG    . ASN A 1 57  ? 14.798  10.041  26.800  1.00 25.28 ? 57   ASN A CG    1 
ATOM   427   O OD1   . ASN A 1 57  ? 14.197  9.276   27.562  1.00 24.69 ? 57   ASN A OD1   1 
ATOM   428   N ND2   . ASN A 1 57  ? 15.981  10.577  27.109  1.00 25.72 ? 57   ASN A ND2   1 
ATOM   429   N N     . THR A 1 58  ? 10.746  10.537  26.738  1.00 24.63 ? 58   THR A N     1 
ATOM   430   C CA    . THR A 1 58  ? 9.768   11.300  27.533  1.00 24.30 ? 58   THR A CA    1 
ATOM   431   C C     . THR A 1 58  ? 9.069   10.499  28.639  1.00 24.34 ? 58   THR A C     1 
ATOM   432   O O     . THR A 1 58  ? 8.933   9.282   28.546  1.00 24.36 ? 58   THR A O     1 
ATOM   433   C CB    . THR A 1 58  ? 8.674   11.916  26.636  1.00 23.47 ? 58   THR A CB    1 
ATOM   434   O OG1   . THR A 1 58  ? 7.702   10.917  26.327  1.00 22.18 ? 58   THR A OG1   1 
ATOM   435   C CG2   . THR A 1 58  ? 9.269   12.492  25.367  1.00 22.77 ? 58   THR A CG2   1 
ATOM   436   N N     . SER A 1 59  ? 8.598   11.203  29.664  1.00 24.43 ? 59   SER A N     1 
ATOM   437   C CA    . SER A 1 59  ? 7.895   10.576  30.788  1.00 24.73 ? 59   SER A CA    1 
ATOM   438   C C     . SER A 1 59  ? 6.927   11.567  31.440  1.00 24.93 ? 59   SER A C     1 
ATOM   439   O O     . SER A 1 59  ? 7.285   12.719  31.716  1.00 24.71 ? 59   SER A O     1 
ATOM   440   C CB    . SER A 1 59  ? 8.912   10.040  31.826  1.00 24.71 ? 59   SER A CB    1 
ATOM   441   O OG    . SER A 1 59  ? 8.320   9.201   32.806  1.00 24.15 ? 59   SER A OG    1 
ATOM   442   N N     . PHE A 1 60  ? 5.705   11.099  31.675  1.00 25.36 ? 60   PHE A N     1 
ATOM   443   C CA    . PHE A 1 60  ? 4.701   11.831  32.454  1.00 25.59 ? 60   PHE A CA    1 
ATOM   444   C C     . PHE A 1 60  ? 4.574   11.286  33.899  1.00 26.48 ? 60   PHE A C     1 
ATOM   445   O O     . PHE A 1 60  ? 3.687   11.706  34.652  1.00 26.62 ? 60   PHE A O     1 
ATOM   446   C CB    . PHE A 1 60  ? 3.322   11.771  31.753  1.00 25.50 ? 60   PHE A CB    1 
ATOM   447   C CG    . PHE A 1 60  ? 3.232   12.541  30.423  1.00 24.45 ? 60   PHE A CG    1 
ATOM   448   C CD1   . PHE A 1 60  ? 2.075   12.424  29.629  1.00 24.78 ? 60   PHE A CD1   1 
ATOM   449   C CD2   . PHE A 1 60  ? 4.270   13.364  29.973  1.00 22.73 ? 60   PHE A CD2   1 
ATOM   450   C CE1   . PHE A 1 60  ? 1.933   13.123  28.435  1.00 23.24 ? 60   PHE A CE1   1 
ATOM   451   C CE2   . PHE A 1 60  ? 4.156   14.067  28.765  1.00 24.61 ? 60   PHE A CE2   1 
ATOM   452   C CZ    . PHE A 1 60  ? 2.977   13.947  27.991  1.00 25.50 ? 60   PHE A CZ    1 
ATOM   453   N N     . ALA A 1 61  ? 5.438   10.342  34.280  1.00 27.01 ? 61   ALA A N     1 
ATOM   454   C CA    . ALA A 1 61  ? 5.392   9.748   35.627  1.00 27.93 ? 61   ALA A CA    1 
ATOM   455   C C     . ALA A 1 61  ? 5.601   10.762  36.764  1.00 28.68 ? 61   ALA A C     1 
ATOM   456   O O     . ALA A 1 61  ? 6.433   11.665  36.650  1.00 28.91 ? 61   ALA A O     1 
ATOM   457   C CB    . ALA A 1 61  ? 6.399   8.627   35.742  1.00 27.44 ? 61   ALA A CB    1 
ATOM   458   N N     . PRO A 1 62  ? 4.814   10.653  37.849  1.00 29.45 ? 62   PRO A N     1 
ATOM   459   C CA    . PRO A 1 62  ? 5.185   11.428  39.062  1.00 29.89 ? 62   PRO A CA    1 
ATOM   460   C C     . PRO A 1 62  ? 6.423   10.823  39.708  1.00 30.49 ? 62   PRO A C     1 
ATOM   461   O O     . PRO A 1 62  ? 6.581   9.600   39.642  1.00 31.49 ? 62   PRO A O     1 
ATOM   462   C CB    . PRO A 1 62  ? 3.997   11.194  40.006  1.00 29.84 ? 62   PRO A CB    1 
ATOM   463   C CG    . PRO A 1 62  ? 3.303   9.946   39.499  1.00 29.40 ? 62   PRO A CG    1 
ATOM   464   C CD    . PRO A 1 62  ? 3.567   9.875   38.017  1.00 29.01 ? 62   PRO A CD    1 
ATOM   465   N N     . GLY A 1 63  ? 7.335   11.603  40.287  1.00 31.00 ? 63   GLY A N     1 
ATOM   466   C CA    . GLY A 1 63  ? 7.565   13.012  40.041  1.00 30.70 ? 63   GLY A CA    1 
ATOM   467   C C     . GLY A 1 63  ? 8.810   12.957  39.173  1.00 30.95 ? 63   GLY A C     1 
ATOM   468   O O     . GLY A 1 63  ? 9.915   13.356  39.564  1.00 30.66 ? 63   GLY A O     1 
ATOM   469   N N     . ASN A 1 64  ? 8.613   12.394  37.991  1.00 30.87 ? 64   ASN A N     1 
ATOM   470   C CA    . ASN A 1 64  ? 9.665   12.228  37.041  1.00 30.80 ? 64   ASN A CA    1 
ATOM   471   C C     . ASN A 1 64  ? 9.144   12.610  35.670  1.00 29.40 ? 64   ASN A C     1 
ATOM   472   O O     . ASN A 1 64  ? 9.197   11.823  34.730  1.00 29.63 ? 64   ASN A O     1 
ATOM   473   C CB    . ASN A 1 64  ? 10.149  10.785  37.079  1.00 31.63 ? 64   ASN A CB    1 
ATOM   474   C CG    . ASN A 1 64  ? 11.658  10.684  37.002  1.00 34.49 ? 64   ASN A CG    1 
ATOM   475   O OD1   . ASN A 1 64  ? 12.295  11.245  36.084  1.00 36.66 ? 64   ASN A OD1   1 
ATOM   476   N ND2   . ASN A 1 64  ? 12.250  9.966   37.964  1.00 35.11 ? 64   ASN A ND2   1 
ATOM   477   N N     . VAL A 1 65  ? 8.598   13.818  35.583  1.00 27.94 ? 65   VAL A N     1 
ATOM   478   C CA    . VAL A 1 65  ? 8.170   14.394  34.307  1.00 26.52 ? 65   VAL A CA    1 
ATOM   479   C C     . VAL A 1 65  ? 9.391   14.949  33.556  1.00 26.28 ? 65   VAL A C     1 
ATOM   480   O O     . VAL A 1 65  ? 10.059  15.880  34.016  1.00 25.97 ? 65   VAL A O     1 
ATOM   481   C CB    . VAL A 1 65  ? 7.084   15.491  34.490  1.00 26.33 ? 65   VAL A CB    1 
ATOM   482   C CG1   . VAL A 1 65  ? 6.782   16.187  33.142  1.00 25.34 ? 65   VAL A CG1   1 
ATOM   483   C CG2   . VAL A 1 65  ? 5.820   14.893  35.110  1.00 24.63 ? 65   VAL A CG2   1 
ATOM   484   N N     . SER A 1 66  ? 9.677   14.357  32.402  1.00 25.70 ? 66   SER A N     1 
ATOM   485   C CA    . SER A 1 66  ? 10.864  14.694  31.652  1.00 24.90 ? 66   SER A CA    1 
ATOM   486   C C     . SER A 1 66  ? 10.556  14.529  30.167  1.00 24.24 ? 66   SER A C     1 
ATOM   487   O O     . SER A 1 66  ? 10.126  13.473  29.718  1.00 24.33 ? 66   SER A O     1 
ATOM   488   C CB    . SER A 1 66  ? 12.021  13.808  32.113  1.00 25.19 ? 66   SER A CB    1 
ATOM   489   O OG    . SER A 1 66  ? 13.118  13.907  31.225  1.00 26.43 ? 66   SER A OG    1 
ATOM   490   N N     . ILE A 1 67  ? 10.723  15.608  29.413  1.00 23.51 ? 67   ILE A N     1 
ATOM   491   C CA    . ILE A 1 67  ? 10.328  15.614  28.027  1.00 22.18 ? 67   ILE A CA    1 
ATOM   492   C C     . ILE A 1 67  ? 11.547  15.979  27.188  1.00 22.44 ? 67   ILE A C     1 
ATOM   493   O O     . ILE A 1 67  ? 12.064  17.099  27.258  1.00 21.95 ? 67   ILE A O     1 
ATOM   494   C CB    . ILE A 1 67  ? 9.097   16.561  27.754  1.00 22.24 ? 67   ILE A CB    1 
ATOM   495   C CG1   . ILE A 1 67  ? 7.912   16.222  28.678  1.00 21.94 ? 67   ILE A CG1   1 
ATOM   496   C CG2   . ILE A 1 67  ? 8.659   16.477  26.282  1.00 19.08 ? 67   ILE A CG2   1 
ATOM   497   C CD1   . ILE A 1 67  ? 7.019   17.412  29.055  1.00 21.30 ? 67   ILE A CD1   1 
ATOM   498   N N     . LYS A 1 68  ? 12.014  15.019  26.403  1.00 22.58 ? 68   LYS A N     1 
ATOM   499   C CA    . LYS A 1 68  ? 13.115  15.273  25.489  1.00 23.38 ? 68   LYS A CA    1 
ATOM   500   C C     . LYS A 1 68  ? 12.871  14.676  24.122  1.00 23.17 ? 68   LYS A C     1 
ATOM   501   O O     . LYS A 1 68  ? 12.416  13.537  23.995  1.00 23.28 ? 68   LYS A O     1 
ATOM   502   C CB    . LYS A 1 68  ? 14.458  14.784  26.068  1.00 23.80 ? 68   LYS A CB    1 
ATOM   503   C CG    . LYS A 1 68  ? 15.004  15.684  27.170  1.00 25.36 ? 68   LYS A CG    1 
ATOM   504   C CD    . LYS A 1 68  ? 16.138  15.014  27.929  1.00 30.82 ? 68   LYS A CD    1 
ATOM   505   C CE    . LYS A 1 68  ? 16.406  15.733  29.263  1.00 32.87 ? 68   LYS A CE    1 
ATOM   506   N NZ    . LYS A 1 68  ? 17.629  15.186  29.935  1.00 33.85 ? 68   LYS A NZ    1 
ATOM   507   N N     . TRP A 1 69  ? 13.209  15.465  23.109  1.00 23.00 ? 69   TRP A N     1 
ATOM   508   C CA    . TRP A 1 69  ? 13.032  15.111  21.717  1.00 22.48 ? 69   TRP A CA    1 
ATOM   509   C C     . TRP A 1 69  ? 14.280  15.510  20.965  1.00 22.95 ? 69   TRP A C     1 
ATOM   510   O O     . TRP A 1 69  ? 14.764  16.644  21.140  1.00 22.83 ? 69   TRP A O     1 
ATOM   511   C CB    . TRP A 1 69  ? 11.822  15.838  21.122  1.00 21.82 ? 69   TRP A CB    1 
ATOM   512   C CG    . TRP A 1 69  ? 10.544  15.224  21.539  1.00 21.02 ? 69   TRP A CG    1 
ATOM   513   C CD1   . TRP A 1 69  ? 9.829   15.522  22.652  1.00 19.96 ? 69   TRP A CD1   1 
ATOM   514   C CD2   . TRP A 1 69  ? 9.836   14.161  20.871  1.00 20.44 ? 69   TRP A CD2   1 
ATOM   515   N NE1   . TRP A 1 69  ? 8.710   14.725  22.719  1.00 20.37 ? 69   TRP A NE1   1 
ATOM   516   C CE2   . TRP A 1 69  ? 8.684   13.889  21.634  1.00 19.46 ? 69   TRP A CE2   1 
ATOM   517   C CE3   . TRP A 1 69  ? 10.057  13.429  19.688  1.00 20.38 ? 69   TRP A CE3   1 
ATOM   518   C CZ2   . TRP A 1 69  ? 7.744   12.910  21.262  1.00 20.82 ? 69   TRP A CZ2   1 
ATOM   519   C CZ3   . TRP A 1 69  ? 9.132   12.452  19.315  1.00 20.36 ? 69   TRP A CZ3   1 
ATOM   520   C CH2   . TRP A 1 69  ? 7.985   12.202  20.101  1.00 20.37 ? 69   TRP A CH2   1 
ATOM   521   N N     . TYR A 1 70  ? 14.799  14.563  20.159  1.00 22.81 ? 70   TYR A N     1 
ATOM   522   C CA    . TYR A 1 70  ? 15.958  14.766  19.301  1.00 22.59 ? 70   TYR A CA    1 
ATOM   523   C C     . TYR A 1 70  ? 17.163  15.225  20.097  1.00 23.37 ? 70   TYR A C     1 
ATOM   524   O O     . TYR A 1 70  ? 17.982  15.994  19.590  1.00 23.35 ? 70   TYR A O     1 
ATOM   525   C CB    . TYR A 1 70  ? 15.648  15.813  18.238  1.00 22.16 ? 70   TYR A CB    1 
ATOM   526   C CG    . TYR A 1 70  ? 14.430  15.518  17.408  1.00 22.14 ? 70   TYR A CG    1 
ATOM   527   C CD1   . TYR A 1 70  ? 13.307  16.340  17.468  1.00 21.79 ? 70   TYR A CD1   1 
ATOM   528   C CD2   . TYR A 1 70  ? 14.397  14.409  16.561  1.00 21.69 ? 70   TYR A CD2   1 
ATOM   529   C CE1   . TYR A 1 70  ? 12.191  16.080  16.690  1.00 21.23 ? 70   TYR A CE1   1 
ATOM   530   C CE2   . TYR A 1 70  ? 13.290  14.131  15.798  1.00 21.72 ? 70   TYR A CE2   1 
ATOM   531   C CZ    . TYR A 1 70  ? 12.191  14.965  15.865  1.00 21.47 ? 70   TYR A CZ    1 
ATOM   532   O OH    . TYR A 1 70  ? 11.104  14.674  15.088  1.00 21.85 ? 70   TYR A OH    1 
ATOM   533   N N     . GLU A 1 71  ? 17.283  14.720  21.321  1.00 24.13 ? 71   GLU A N     1 
ATOM   534   C CA    . GLU A 1 71  ? 18.106  15.358  22.347  1.00 25.56 ? 71   GLU A CA    1 
ATOM   535   C C     . GLU A 1 71  ? 19.616  15.443  22.065  1.00 25.25 ? 71   GLU A C     1 
ATOM   536   O O     . GLU A 1 71  ? 20.282  16.380  22.536  1.00 24.96 ? 71   GLU A O     1 
ATOM   537   C CB    . GLU A 1 71  ? 17.814  14.759  23.738  1.00 25.80 ? 71   GLU A CB    1 
ATOM   538   C CG    . GLU A 1 71  ? 18.639  13.552  24.119  1.00 27.11 ? 71   GLU A CG    1 
ATOM   539   C CD    . GLU A 1 71  ? 18.096  12.857  25.358  1.00 27.62 ? 71   GLU A CD    1 
ATOM   540   O OE1   . GLU A 1 71  ? 17.079  12.147  25.216  1.00 30.02 ? 71   GLU A OE1   1 
ATOM   541   O OE2   . GLU A 1 71  ? 18.692  13.006  26.462  1.00 30.81 ? 71   GLU A OE2   1 
ATOM   542   N N     . ASP A 1 72  ? 20.156  14.503  21.292  1.00 24.56 ? 72   ASP A N     1 
ATOM   543   C CA    . ASP A 1 72  ? 21.593  14.555  21.012  1.00 24.43 ? 72   ASP A CA    1 
ATOM   544   C C     . ASP A 1 72  ? 21.921  15.294  19.716  1.00 24.28 ? 72   ASP A C     1 
ATOM   545   O O     . ASP A 1 72  ? 23.050  15.215  19.219  1.00 24.64 ? 72   ASP A O     1 
ATOM   546   C CB    . ASP A 1 72  ? 22.223  13.155  21.046  1.00 24.31 ? 72   ASP A CB    1 
ATOM   547   C CG    . ASP A 1 72  ? 21.465  12.148  20.195  1.00 24.14 ? 72   ASP A CG    1 
ATOM   548   O OD1   . ASP A 1 72  ? 20.409  12.494  19.629  1.00 20.77 ? 72   ASP A OD1   1 
ATOM   549   O OD2   . ASP A 1 72  ? 21.945  11.006  20.087  1.00 25.77 ? 72   ASP A OD2   1 
ATOM   550   N N     . GLY A 1 73  ? 20.934  16.017  19.189  1.00 23.97 ? 73   GLY A N     1 
ATOM   551   C CA    . GLY A 1 73  ? 21.058  16.727  17.921  1.00 23.69 ? 73   GLY A CA    1 
ATOM   552   C C     . GLY A 1 73  ? 21.282  18.218  18.116  1.00 23.94 ? 73   GLY A C     1 
ATOM   553   O O     . GLY A 1 73  ? 20.868  18.801  19.130  1.00 23.89 ? 73   GLY A O     1 
ATOM   554   N N     . THR A 1 74  ? 21.944  18.857  17.159  1.00 23.88 ? 74   THR A N     1 
ATOM   555   C CA    . THR A 1 74  ? 22.129  20.296  17.268  1.00 24.06 ? 74   THR A CA    1 
ATOM   556   C C     . THR A 1 74  ? 21.642  20.973  16.006  1.00 24.14 ? 74   THR A C     1 
ATOM   557   O O     . THR A 1 74  ? 21.637  20.360  14.929  1.00 24.77 ? 74   THR A O     1 
ATOM   558   C CB    . THR A 1 74  ? 23.573  20.673  17.547  1.00 24.32 ? 74   THR A CB    1 
ATOM   559   O OG1   . THR A 1 74  ? 24.331  20.558  16.341  1.00 24.77 ? 74   THR A OG1   1 
ATOM   560   C CG2   . THR A 1 74  ? 24.172  19.772  18.651  1.00 24.45 ? 74   THR A CG2   1 
ATOM   561   N N     . LEU A 1 75  ? 21.220  22.224  16.144  1.00 23.30 ? 75   LEU A N     1 
ATOM   562   C CA    . LEU A 1 75  ? 20.583  22.941  15.064  1.00 23.01 ? 75   LEU A CA    1 
ATOM   563   C C     . LEU A 1 75  ? 20.529  24.434  15.405  1.00 23.15 ? 75   LEU A C     1 
ATOM   564   O O     . LEU A 1 75  ? 20.839  24.828  16.524  1.00 23.02 ? 75   LEU A O     1 
ATOM   565   C CB    . LEU A 1 75  ? 19.162  22.402  14.867  1.00 23.10 ? 75   LEU A CB    1 
ATOM   566   C CG    . LEU A 1 75  ? 18.025  22.834  15.823  1.00 23.14 ? 75   LEU A CG    1 
ATOM   567   C CD1   . LEU A 1 75  ? 16.652  22.639  15.145  1.00 22.04 ? 75   LEU A CD1   1 
ATOM   568   C CD2   . LEU A 1 75  ? 18.087  22.158  17.241  1.00 22.28 ? 75   LEU A CD2   1 
ATOM   569   N N     . ASN A 1 76  ? 20.140  25.255  14.432  1.00 22.78 ? 76   ASN A N     1 
ATOM   570   C CA    . ASN A 1 76  ? 19.855  26.666  14.665  1.00 22.58 ? 76   ASN A CA    1 
ATOM   571   C C     . ASN A 1 76  ? 18.463  26.974  14.082  1.00 22.43 ? 76   ASN A C     1 
ATOM   572   O O     . ASN A 1 76  ? 18.164  26.637  12.923  1.00 22.87 ? 76   ASN A O     1 
ATOM   573   C CB    . ASN A 1 76  ? 20.956  27.572  14.055  1.00 22.61 ? 76   ASN A CB    1 
ATOM   574   C CG    . ASN A 1 76  ? 20.934  29.005  14.618  1.00 23.70 ? 76   ASN A CG    1 
ATOM   575   O OD1   . ASN A 1 76  ? 21.735  29.360  15.492  1.00 25.68 ? 76   ASN A OD1   1 
ATOM   576   N ND2   . ASN A 1 76  ? 20.007  29.822  14.133  1.00 23.30 ? 76   ASN A ND2   1 
ATOM   577   N N     . LEU A 1 77  ? 17.605  27.589  14.882  1.00 21.52 ? 77   LEU A N     1 
ATOM   578   C CA    . LEU A 1 77  ? 16.290  27.956  14.388  1.00 21.14 ? 77   LEU A CA    1 
ATOM   579   C C     . LEU A 1 77  ? 16.386  28.981  13.285  1.00 20.86 ? 77   LEU A C     1 
ATOM   580   O O     . LEU A 1 77  ? 15.720  28.861  12.256  1.00 21.13 ? 77   LEU A O     1 
ATOM   581   C CB    . LEU A 1 77  ? 15.383  28.453  15.516  1.00 21.13 ? 77   LEU A CB    1 
ATOM   582   C CG    . LEU A 1 77  ? 13.939  28.809  15.129  1.00 20.63 ? 77   LEU A CG    1 
ATOM   583   C CD1   . LEU A 1 77  ? 12.944  28.359  16.192  1.00 17.93 ? 77   LEU A CD1   1 
ATOM   584   C CD2   . LEU A 1 77  ? 13.816  30.300  14.821  1.00 19.77 ? 77   LEU A CD2   1 
ATOM   585   N N     . ALA A 1 78  ? 17.210  29.994  13.497  1.00 20.74 ? 78   ALA A N     1 
ATOM   586   C CA    . ALA A 1 78  ? 17.364  31.069  12.503  1.00 20.71 ? 78   ALA A CA    1 
ATOM   587   C C     . ALA A 1 78  ? 17.930  30.604  11.137  1.00 20.15 ? 78   ALA A C     1 
ATOM   588   O O     . ALA A 1 78  ? 17.447  31.047  10.102  1.00 19.96 ? 78   ALA A O     1 
ATOM   589   C CB    . ALA A 1 78  ? 18.176  32.218  13.092  1.00 20.47 ? 78   ALA A CB    1 
ATOM   590   N N     . ALA A 1 79  ? 18.921  29.708  11.147  1.00 19.79 ? 79   ALA A N     1 
ATOM   591   C CA    . ALA A 1 79  ? 19.440  29.076  9.916   1.00 20.35 ? 79   ALA A CA    1 
ATOM   592   C C     . ALA A 1 79  ? 18.380  28.285  9.150   1.00 20.74 ? 79   ALA A C     1 
ATOM   593   O O     . ALA A 1 79  ? 18.434  28.183  7.916   1.00 20.95 ? 79   ALA A O     1 
ATOM   594   C CB    . ALA A 1 79  ? 20.619  28.164  10.218  1.00 19.92 ? 79   ALA A CB    1 
ATOM   595   N N     . ASN A 1 80  ? 17.449  27.697  9.893   1.00 20.86 ? 80   ASN A N     1 
ATOM   596   C CA    . ASN A 1 80  ? 16.354  26.939  9.315   1.00 21.46 ? 80   ASN A CA    1 
ATOM   597   C C     . ASN A 1 80  ? 15.262  27.832  8.728   1.00 21.51 ? 80   ASN A C     1 
ATOM   598   O O     . ASN A 1 80  ? 14.564  27.432  7.785   1.00 21.97 ? 80   ASN A O     1 
ATOM   599   C CB    . ASN A 1 80  ? 15.774  25.973  10.358  1.00 20.98 ? 80   ASN A CB    1 
ATOM   600   C CG    . ASN A 1 80  ? 16.543  24.674  10.425  1.00 22.83 ? 80   ASN A CG    1 
ATOM   601   O OD1   . ASN A 1 80  ? 16.384  23.784  9.573   1.00 23.64 ? 80   ASN A OD1   1 
ATOM   602   N ND2   . ASN A 1 80  ? 17.405  24.560  11.420  1.00 22.37 ? 80   ASN A ND2   1 
ATOM   603   N N     . CYS A 1 81  ? 15.119  29.029  9.294   1.00 21.34 ? 81   CYS A N     1 
ATOM   604   C CA    . CYS A 1 81  ? 14.028  29.958  8.941   1.00 21.11 ? 81   CYS A CA    1 
ATOM   605   C C     . CYS A 1 81  ? 14.497  31.027  7.950   1.00 21.13 ? 81   CYS A C     1 
ATOM   606   O O     . CYS A 1 81  ? 13.677  31.739  7.388   1.00 21.56 ? 81   CYS A O     1 
ATOM   607   C CB    . CYS A 1 81  ? 13.444  30.636  10.199  1.00 21.13 ? 81   CYS A CB    1 
ATOM   608   S SG    . CYS A 1 81  ? 12.472  29.558  11.321  1.00 20.59 ? 81   CYS A SG    1 
ATOM   609   N N     . LEU A 1 82  ? 15.814  31.111  7.724   1.00 21.35 ? 82   LEU A N     1 
ATOM   610   C CA    . LEU A 1 82  ? 16.422  32.176  6.890   1.00 20.48 ? 82   LEU A CA    1 
ATOM   611   C C     . LEU A 1 82  ? 17.554  31.656  6.021   1.00 20.80 ? 82   LEU A C     1 
ATOM   612   O O     . LEU A 1 82  ? 17.359  31.489  4.818   1.00 20.73 ? 82   LEU A O     1 
ATOM   613   C CB    . LEU A 1 82  ? 16.936  33.337  7.761   1.00 19.91 ? 82   LEU A CB    1 
ATOM   614   C CG    . LEU A 1 82  ? 15.961  33.955  8.764   1.00 18.84 ? 82   LEU A CG    1 
ATOM   615   C CD1   . LEU A 1 82  ? 16.708  34.736  9.837   1.00 16.19 ? 82   LEU A CD1   1 
ATOM   616   C CD2   . LEU A 1 82  ? 14.965  34.818  8.008   1.00 15.53 ? 82   LEU A CD2   1 
ATOM   617   N N     . ASP A 1 83  ? 18.720  31.383  6.637   1.00 20.79 ? 83   ASP A N     1 
ATOM   618   C CA    . ASP A 1 83  ? 19.949  31.039  5.902   1.00 21.05 ? 83   ASP A CA    1 
ATOM   619   C C     . ASP A 1 83  ? 19.764  30.012  4.823   1.00 21.17 ? 83   ASP A C     1 
ATOM   620   O O     . ASP A 1 83  ? 20.283  30.178  3.712   1.00 21.75 ? 83   ASP A O     1 
ATOM   621   C CB    . ASP A 1 83  ? 21.096  30.598  6.830   1.00 20.78 ? 83   ASP A CB    1 
ATOM   622   C CG    . ASP A 1 83  ? 21.421  31.642  7.897   1.00 22.18 ? 83   ASP A CG    1 
ATOM   623   O OD1   . ASP A 1 83  ? 22.621  31.952  8.091   1.00 21.67 ? 83   ASP A OD1   1 
ATOM   624   O OD2   . ASP A 1 83  ? 20.466  32.161  8.529   1.00 21.36 ? 83   ASP A OD2   1 
ATOM   625   N N     . ARG A 1 84  ? 19.020  28.961  5.140   1.00 21.59 ? 84   ARG A N     1 
ATOM   626   C CA    . ARG A 1 84  ? 18.922  27.796  4.254   1.00 21.78 ? 84   ARG A CA    1 
ATOM   627   C C     . ARG A 1 84  ? 18.059  28.064  3.020   1.00 22.46 ? 84   ARG A C     1 
ATOM   628   O O     . ARG A 1 84  ? 18.167  27.360  2.013   1.00 22.13 ? 84   ARG A O     1 
ATOM   629   C CB    . ARG A 1 84  ? 18.448  26.561  5.020   1.00 21.41 ? 84   ARG A CB    1 
ATOM   630   C CG    . ARG A 1 84  ? 17.022  26.589  5.500   1.00 20.00 ? 84   ARG A CG    1 
ATOM   631   C CD    . ARG A 1 84  ? 16.637  25.191  5.882   1.00 18.72 ? 84   ARG A CD    1 
ATOM   632   N NE    . ARG A 1 84  ? 15.281  25.098  6.416   1.00 18.29 ? 84   ARG A NE    1 
ATOM   633   C CZ    . ARG A 1 84  ? 14.672  23.946  6.682   1.00 17.23 ? 84   ARG A CZ    1 
ATOM   634   N NH1   . ARG A 1 84  ? 15.309  22.793  6.465   1.00 14.28 ? 84   ARG A NH1   1 
ATOM   635   N NH2   . ARG A 1 84  ? 13.432  23.943  7.168   1.00 15.67 ? 84   ARG A NH2   1 
ATOM   636   N N     . HIS A 1 85  ? 17.227  29.101  3.099   1.00 22.93 ? 85   HIS A N     1 
ATOM   637   C CA    . HIS A 1 85  ? 16.393  29.495  1.966   1.00 23.69 ? 85   HIS A CA    1 
ATOM   638   C C     . HIS A 1 85  ? 17.089  30.464  0.985   1.00 24.55 ? 85   HIS A C     1 
ATOM   639   O O     . HIS A 1 85  ? 16.574  30.741  -0.105  1.00 25.15 ? 85   HIS A O     1 
ATOM   640   C CB    . HIS A 1 85  ? 15.065  30.077  2.475   1.00 22.99 ? 85   HIS A CB    1 
ATOM   641   C CG    . HIS A 1 85  ? 14.371  29.199  3.466   1.00 22.95 ? 85   HIS A CG    1 
ATOM   642   N ND1   . HIS A 1 85  ? 13.906  27.941  3.141   1.00 19.88 ? 85   HIS A ND1   1 
ATOM   643   C CD2   . HIS A 1 85  ? 14.081  29.387  4.783   1.00 21.87 ? 85   HIS A CD2   1 
ATOM   644   C CE1   . HIS A 1 85  ? 13.347  27.398  4.212   1.00 20.36 ? 85   HIS A CE1   1 
ATOM   645   N NE2   . HIS A 1 85  ? 13.445  28.251  5.221   1.00 20.29 ? 85   HIS A NE2   1 
ATOM   646   N N     . LEU A 1 86  ? 18.252  30.972  1.368   1.00 25.26 ? 86   LEU A N     1 
ATOM   647   C CA    . LEU A 1 86  ? 18.887  32.062  0.629   1.00 25.97 ? 86   LEU A CA    1 
ATOM   648   C C     . LEU A 1 86  ? 19.405  31.665  -0.760  1.00 26.20 ? 86   LEU A C     1 
ATOM   649   O O     . LEU A 1 86  ? 19.191  32.367  -1.740  1.00 25.63 ? 86   LEU A O     1 
ATOM   650   C CB    . LEU A 1 86  ? 20.029  32.670  1.455   1.00 25.47 ? 86   LEU A CB    1 
ATOM   651   C CG    . LEU A 1 86  ? 19.694  33.481  2.702   1.00 26.08 ? 86   LEU A CG    1 
ATOM   652   C CD1   . LEU A 1 86  ? 20.981  34.096  3.268   1.00 25.37 ? 86   LEU A CD1   1 
ATOM   653   C CD2   . LEU A 1 86  ? 18.633  34.566  2.399   1.00 25.05 ? 86   LEU A CD2   1 
ATOM   654   N N     . GLN A 1 87  ? 20.103  30.544  -0.824  1.00 26.95 ? 87   GLN A N     1 
ATOM   655   C CA    . GLN A 1 87  ? 20.774  30.135  -2.049  1.00 27.91 ? 87   GLN A CA    1 
ATOM   656   C C     . GLN A 1 87  ? 19.851  30.151  -3.255  1.00 28.34 ? 87   GLN A C     1 
ATOM   657   O O     . GLN A 1 87  ? 20.180  30.751  -4.294  1.00 28.62 ? 87   GLN A O     1 
ATOM   658   C CB    . GLN A 1 87  ? 21.375  28.748  -1.876  1.00 27.93 ? 87   GLN A CB    1 
ATOM   659   C CG    . GLN A 1 87  ? 21.672  28.047  -3.156  1.00 29.89 ? 87   GLN A CG    1 
ATOM   660   C CD    . GLN A 1 87  ? 23.100  27.705  -3.236  1.00 31.84 ? 87   GLN A CD    1 
ATOM   661   O OE1   . GLN A 1 87  ? 23.836  28.307  -4.004  1.00 32.90 ? 87   GLN A OE1   1 
ATOM   662   N NE2   . GLN A 1 87  ? 23.533  26.763  -2.404  1.00 33.68 ? 87   GLN A NE2   1 
ATOM   663   N N     . GLU A 1 88  ? 18.712  29.483  -3.101  1.00 28.61 ? 88   GLU A N     1 
ATOM   664   C CA    . GLU A 1 88  ? 17.765  29.267  -4.184  1.00 28.96 ? 88   GLU A CA    1 
ATOM   665   C C     . GLU A 1 88  ? 16.526  30.154  -4.097  1.00 28.29 ? 88   GLU A C     1 
ATOM   666   O O     . GLU A 1 88  ? 15.912  30.417  -5.130  1.00 28.07 ? 88   GLU A O     1 
ATOM   667   C CB    . GLU A 1 88  ? 17.362  27.793  -4.232  1.00 29.54 ? 88   GLU A CB    1 
ATOM   668   C CG    . GLU A 1 88  ? 18.519  26.860  -4.657  1.00 32.47 ? 88   GLU A CG    1 
ATOM   669   C CD    . GLU A 1 88  ? 19.029  27.173  -6.055  1.00 35.19 ? 88   GLU A CD    1 
ATOM   670   O OE1   . GLU A 1 88  ? 20.265  27.276  -6.250  1.00 37.59 ? 88   GLU A OE1   1 
ATOM   671   O OE2   . GLU A 1 88  ? 18.181  27.346  -6.956  1.00 36.62 ? 88   GLU A OE2   1 
ATOM   672   N N     . ASN A 1 89  ? 16.173  30.612  -2.884  1.00 27.28 ? 89   ASN A N     1 
ATOM   673   C CA    . ASN A 1 89  ? 14.996  31.484  -2.679  1.00 26.53 ? 89   ASN A CA    1 
ATOM   674   C C     . ASN A 1 89  ? 15.217  32.811  -1.941  1.00 25.98 ? 89   ASN A C     1 
ATOM   675   O O     . ASN A 1 89  ? 14.280  33.382  -1.378  1.00 25.90 ? 89   ASN A O     1 
ATOM   676   C CB    . ASN A 1 89  ? 13.836  30.692  -2.049  1.00 26.71 ? 89   ASN A CB    1 
ATOM   677   C CG    . ASN A 1 89  ? 13.233  29.672  -3.028  1.00 27.38 ? 89   ASN A CG    1 
ATOM   678   O OD1   . ASN A 1 89  ? 13.488  28.456  -2.913  1.00 27.33 ? 89   ASN A OD1   1 
ATOM   679   N ND2   . ASN A 1 89  ? 12.465  30.169  -4.022  1.00 24.38 ? 89   ASN A ND2   1 
ATOM   680   N N     . GLY A 1 90  ? 16.442  33.325  -1.991  1.00 25.38 ? 90   GLY A N     1 
ATOM   681   C CA    . GLY A 1 90  ? 16.780  34.601  -1.379  1.00 25.08 ? 90   GLY A CA    1 
ATOM   682   C C     . GLY A 1 90  ? 15.886  35.756  -1.760  1.00 25.02 ? 90   GLY A C     1 
ATOM   683   O O     . GLY A 1 90  ? 15.601  36.618  -0.936  1.00 25.54 ? 90   GLY A O     1 
ATOM   684   N N     . ASP A 1 91  ? 15.445  35.764  -3.014  1.00 25.50 ? 91   ASP A N     1 
ATOM   685   C CA    . ASP A 1 91  ? 14.598  36.817  -3.571  1.00 25.60 ? 91   ASP A CA    1 
ATOM   686   C C     . ASP A 1 91  ? 13.115  36.645  -3.274  1.00 25.12 ? 91   ASP A C     1 
ATOM   687   O O     . ASP A 1 91  ? 12.328  37.585  -3.453  1.00 24.83 ? 91   ASP A O     1 
ATOM   688   C CB    . ASP A 1 91  ? 14.842  36.929  -5.074  1.00 25.65 ? 91   ASP A CB    1 
ATOM   689   C CG    . ASP A 1 91  ? 16.236  37.460  -5.395  1.00 28.66 ? 91   ASP A CG    1 
ATOM   690   O OD1   . ASP A 1 91  ? 16.915  38.001  -4.469  1.00 30.85 ? 91   ASP A OD1   1 
ATOM   691   O OD2   . ASP A 1 91  ? 16.660  37.338  -6.574  1.00 29.06 ? 91   ASP A OD2   1 
ATOM   692   N N     . ARG A 1 92  ? 12.739  35.451  -2.823  1.00 25.01 ? 92   ARG A N     1 
ATOM   693   C CA    . ARG A 1 92  ? 11.373  35.196  -2.359  1.00 25.96 ? 92   ARG A CA    1 
ATOM   694   C C     . ARG A 1 92  ? 11.043  36.119  -1.185  1.00 24.95 ? 92   ARG A C     1 
ATOM   695   O O     . ARG A 1 92  ? 11.909  36.388  -0.341  1.00 25.04 ? 92   ARG A O     1 
ATOM   696   C CB    . ARG A 1 92  ? 11.212  33.727  -1.954  1.00 26.79 ? 92   ARG A CB    1 
ATOM   697   C CG    . ARG A 1 92  ? 9.842   33.338  -1.388  1.00 30.00 ? 92   ARG A CG    1 
ATOM   698   C CD    . ARG A 1 92  ? 9.529   31.880  -1.725  1.00 36.28 ? 92   ARG A CD    1 
ATOM   699   N NE    . ARG A 1 92  ? 9.491   31.697  -3.180  1.00 40.86 ? 92   ARG A NE    1 
ATOM   700   C CZ    . ARG A 1 92  ? 9.430   30.526  -3.811  1.00 43.47 ? 92   ARG A CZ    1 
ATOM   701   N NH1   . ARG A 1 92  ? 9.403   29.374  -3.136  1.00 43.60 ? 92   ARG A NH1   1 
ATOM   702   N NH2   . ARG A 1 92  ? 9.413   30.514  -5.137  1.00 45.16 ? 92   ARG A NH2   1 
ATOM   703   N N     . THR A 1 93  ? 9.807   36.621  -1.158  1.00 24.35 ? 93   THR A N     1 
ATOM   704   C CA    . THR A 1 93  ? 9.320   37.450  -0.055  1.00 23.47 ? 93   THR A CA    1 
ATOM   705   C C     . THR A 1 93  ? 9.123   36.546  1.146   1.00 23.54 ? 93   THR A C     1 
ATOM   706   O O     . THR A 1 93  ? 8.358   35.585  1.079   1.00 24.07 ? 93   THR A O     1 
ATOM   707   C CB    . THR A 1 93  ? 7.985   38.150  -0.410  1.00 23.82 ? 93   THR A CB    1 
ATOM   708   O OG1   . THR A 1 93  ? 8.123   38.878  -1.650  1.00 23.01 ? 93   THR A OG1   1 
ATOM   709   C CG2   . THR A 1 93  ? 7.527   39.087  0.730   1.00 21.61 ? 93   THR A CG2   1 
ATOM   710   N N     . ALA A 1 94  ? 9.851   36.826  2.228   1.00 23.20 ? 94   ALA A N     1 
ATOM   711   C CA    . ALA A 1 94  ? 9.653   36.127  3.503   1.00 22.12 ? 94   ALA A CA    1 
ATOM   712   C C     . ALA A 1 94  ? 8.439   36.724  4.237   1.00 21.77 ? 94   ALA A C     1 
ATOM   713   O O     . ALA A 1 94  ? 7.522   35.983  4.629   1.00 21.15 ? 94   ALA A O     1 
ATOM   714   C CB    . ALA A 1 94  ? 10.910  36.187  4.363   1.00 21.20 ? 94   ALA A CB    1 
ATOM   715   N N     . ILE A 1 95  ? 8.439   38.047  4.432   1.00 20.95 ? 95   ILE A N     1 
ATOM   716   C CA    . ILE A 1 95  ? 7.312   38.698  5.103   1.00 20.93 ? 95   ILE A CA    1 
ATOM   717   C C     . ILE A 1 95  ? 6.649   39.749  4.214   1.00 20.62 ? 95   ILE A C     1 
ATOM   718   O O     . ILE A 1 95  ? 7.319   40.615  3.656   1.00 20.15 ? 95   ILE A O     1 
ATOM   719   C CB    . ILE A 1 95  ? 7.719   39.350  6.464   1.00 21.19 ? 95   ILE A CB    1 
ATOM   720   C CG1   . ILE A 1 95  ? 8.176   38.286  7.472   1.00 21.38 ? 95   ILE A CG1   1 
ATOM   721   C CG2   . ILE A 1 95  ? 6.547   40.152  7.068   1.00 20.43 ? 95   ILE A CG2   1 
ATOM   722   C CD1   . ILE A 1 95  ? 8.838   38.880  8.722   1.00 21.27 ? 95   ILE A CD1   1 
ATOM   723   N N     . ILE A 1 96  ? 5.334   39.646  4.056   1.00 20.69 ? 96   ILE A N     1 
ATOM   724   C CA    . ILE A 1 96  ? 4.550   40.785  3.575   1.00 20.56 ? 96   ILE A CA    1 
ATOM   725   C C     . ILE A 1 96  ? 4.012   41.590  4.764   1.00 20.75 ? 96   ILE A C     1 
ATOM   726   O O     . ILE A 1 96  ? 3.289   41.064  5.604   1.00 20.50 ? 96   ILE A O     1 
ATOM   727   C CB    . ILE A 1 96  ? 3.394   40.359  2.666   1.00 20.81 ? 96   ILE A CB    1 
ATOM   728   C CG1   . ILE A 1 96  ? 3.939   39.646  1.416   1.00 20.71 ? 96   ILE A CG1   1 
ATOM   729   C CG2   . ILE A 1 96  ? 2.510   41.581  2.325   1.00 20.11 ? 96   ILE A CG2   1 
ATOM   730   C CD1   . ILE A 1 96  ? 2.873   39.033  0.526   1.00 22.34 ? 96   ILE A CD1   1 
ATOM   731   N N     . TRP A 1 97  ? 4.398   42.856  4.838   1.00 20.75 ? 97   TRP A N     1 
ATOM   732   C CA    . TRP A 1 97  ? 3.904   43.750  5.866   1.00 20.81 ? 97   TRP A CA    1 
ATOM   733   C C     . TRP A 1 97  ? 2.877   44.745  5.296   1.00 21.69 ? 97   TRP A C     1 
ATOM   734   O O     . TRP A 1 97  ? 3.166   45.524  4.371   1.00 21.78 ? 97   TRP A O     1 
ATOM   735   C CB    . TRP A 1 97  ? 5.062   44.478  6.560   1.00 20.26 ? 97   TRP A CB    1 
ATOM   736   C CG    . TRP A 1 97  ? 4.602   45.284  7.709   1.00 19.71 ? 97   TRP A CG    1 
ATOM   737   C CD1   . TRP A 1 97  ? 4.180   44.815  8.933   1.00 19.31 ? 97   TRP A CD1   1 
ATOM   738   C CD2   . TRP A 1 97  ? 4.489   46.709  7.760   1.00 19.67 ? 97   TRP A CD2   1 
ATOM   739   N NE1   . TRP A 1 97  ? 3.803   45.865  9.732   1.00 20.14 ? 97   TRP A NE1   1 
ATOM   740   C CE2   . TRP A 1 97  ? 3.994   47.040  9.051   1.00 19.84 ? 97   TRP A CE2   1 
ATOM   741   C CE3   . TRP A 1 97  ? 4.764   47.746  6.841   1.00 20.01 ? 97   TRP A CE3   1 
ATOM   742   C CZ2   . TRP A 1 97  ? 3.754   48.371  9.452   1.00 20.12 ? 97   TRP A CZ2   1 
ATOM   743   C CZ3   . TRP A 1 97  ? 4.522   49.066  7.231   1.00 20.18 ? 97   TRP A CZ3   1 
ATOM   744   C CH2   . TRP A 1 97  ? 4.015   49.368  8.533   1.00 19.59 ? 97   TRP A CH2   1 
ATOM   745   N N     . GLU A 1 98  ? 1.669   44.676  5.847   1.00 22.28 ? 98   GLU A N     1 
ATOM   746   C CA    . GLU A 1 98  ? 0.576   45.576  5.544   1.00 22.35 ? 98   GLU A CA    1 
ATOM   747   C C     . GLU A 1 98  ? 0.416   46.463  6.772   1.00 23.22 ? 98   GLU A C     1 
ATOM   748   O O     . GLU A 1 98  ? 0.244   45.944  7.881   1.00 24.01 ? 98   GLU A O     1 
ATOM   749   C CB    . GLU A 1 98  ? -0.703  44.752  5.320   1.00 22.27 ? 98   GLU A CB    1 
ATOM   750   C CG    . GLU A 1 98  ? -2.004  45.545  5.060   1.00 20.96 ? 98   GLU A CG    1 
ATOM   751   C CD    . GLU A 1 98  ? -2.001  46.295  3.728   1.00 20.47 ? 98   GLU A CD    1 
ATOM   752   O OE1   . GLU A 1 98  ? -1.069  46.117  2.923   1.00 19.58 ? 98   GLU A OE1   1 
ATOM   753   O OE2   . GLU A 1 98  ? -2.948  47.060  3.467   1.00 23.17 ? 98   GLU A OE2   1 
ATOM   754   N N     . GLY A 1 99  ? 0.495   47.784  6.590   1.00 23.50 ? 99   GLY A N     1 
ATOM   755   C CA    . GLY A 1 99  ? 0.265   48.736  7.685   1.00 23.00 ? 99   GLY A CA    1 
ATOM   756   C C     . GLY A 1 99  ? -1.213  48.977  7.995   1.00 23.30 ? 99   GLY A C     1 
ATOM   757   O O     . GLY A 1 99  ? -2.091  48.823  7.125   1.00 22.60 ? 99   GLY A O     1 
ATOM   758   N N     . ASP A 1 100 ? -1.484  49.336  9.250   1.00 23.41 ? 100  ASP A N     1 
ATOM   759   C CA    . ASP A 1 100 ? -2.770  49.877  9.662   1.00 24.11 ? 100  ASP A CA    1 
ATOM   760   C C     . ASP A 1 100 ? -3.368  50.769  8.536   1.00 24.46 ? 100  ASP A C     1 
ATOM   761   O O     . ASP A 1 100 ? -4.490  50.554  8.035   1.00 24.28 ? 100  ASP A O     1 
ATOM   762   C CB    . ASP A 1 100 ? -2.565  50.662  10.960  1.00 24.27 ? 100  ASP A CB    1 
ATOM   763   C CG    . ASP A 1 100 ? -3.870  51.103  11.595  1.00 25.91 ? 100  ASP A CG    1 
ATOM   764   O OD1   . ASP A 1 100 ? -4.762  50.241  11.746  1.00 27.00 ? 100  ASP A OD1   1 
ATOM   765   O OD2   . ASP A 1 100 ? -3.998  52.305  11.945  1.00 26.04 ? 100  ASP A OD2   1 
ATOM   766   N N     . ASP A 1 101 ? -2.564  51.739  8.131   1.00 25.18 ? 101  ASP A N     1 
ATOM   767   C CA    . ASP A 1 101 ? -2.769  52.580  6.961   1.00 25.30 ? 101  ASP A CA    1 
ATOM   768   C C     . ASP A 1 101 ? -2.267  51.824  5.724   1.00 25.24 ? 101  ASP A C     1 
ATOM   769   O O     . ASP A 1 101 ? -1.074  51.516  5.580   1.00 24.94 ? 101  ASP A O     1 
ATOM   770   C CB    . ASP A 1 101 ? -1.985  53.860  7.190   1.00 25.62 ? 101  ASP A CB    1 
ATOM   771   C CG    . ASP A 1 101 ? -2.058  54.830  6.049   1.00 27.59 ? 101  ASP A CG    1 
ATOM   772   O OD1   . ASP A 1 101 ? -1.379  55.864  6.225   1.00 29.92 ? 101  ASP A OD1   1 
ATOM   773   O OD2   . ASP A 1 101 ? -2.752  54.605  5.014   1.00 28.09 ? 101  ASP A OD2   1 
ATOM   774   N N     . THR A 1 102 ? -3.199  51.505  4.836   1.00 25.37 ? 102  THR A N     1 
ATOM   775   C CA    . THR A 1 102 ? -2.888  50.653  3.712   1.00 25.40 ? 102  THR A CA    1 
ATOM   776   C C     . THR A 1 102 ? -1.921  51.284  2.706   1.00 25.80 ? 102  THR A C     1 
ATOM   777   O O     . THR A 1 102 ? -1.369  50.573  1.864   1.00 25.94 ? 102  THR A O     1 
ATOM   778   C CB    . THR A 1 102 ? -4.163  50.110  3.022   1.00 25.76 ? 102  THR A CB    1 
ATOM   779   O OG1   . THR A 1 102 ? -3.799  49.036  2.145   1.00 24.58 ? 102  THR A OG1   1 
ATOM   780   C CG2   . THR A 1 102 ? -4.919  51.228  2.244   1.00 24.80 ? 102  THR A CG2   1 
ATOM   781   N N     . SER A 1 103 ? -1.689  52.596  2.816   1.00 25.83 ? 103  SER A N     1 
ATOM   782   C CA    . SER A 1 103 ? -0.689  53.272  1.976   1.00 26.51 ? 103  SER A CA    1 
ATOM   783   C C     . SER A 1 103 ? 0.738   52.815  2.303   1.00 26.75 ? 103  SER A C     1 
ATOM   784   O O     . SER A 1 103 ? 1.675   53.044  1.519   1.00 26.13 ? 103  SER A O     1 
ATOM   785   C CB    . SER A 1 103 ? -0.790  54.794  2.124   1.00 26.92 ? 103  SER A CB    1 
ATOM   786   O OG    . SER A 1 103 ? -0.417  55.221  3.436   1.00 26.78 ? 103  SER A OG    1 
ATOM   787   N N     . GLN A 1 104 ? 0.867   52.151  3.456   1.00 27.05 ? 104  GLN A N     1 
ATOM   788   C CA    . GLN A 1 104 ? 2.134   51.698  3.993   1.00 27.82 ? 104  GLN A CA    1 
ATOM   789   C C     . GLN A 1 104 ? 2.241   50.166  3.930   1.00 27.87 ? 104  GLN A C     1 
ATOM   790   O O     . GLN A 1 104 ? 1.486   49.440  4.595   1.00 28.79 ? 104  GLN A O     1 
ATOM   791   C CB    . GLN A 1 104 ? 2.319   52.230  5.435   1.00 27.27 ? 104  GLN A CB    1 
ATOM   792   C CG    . GLN A 1 104 ? 2.396   53.774  5.545   1.00 28.00 ? 104  GLN A CG    1 
ATOM   793   C CD    . GLN A 1 104 ? 2.915   54.286  6.917   1.00 29.29 ? 104  GLN A CD    1 
ATOM   794   O OE1   . GLN A 1 104 ? 2.712   53.664  7.973   1.00 29.83 ? 104  GLN A OE1   1 
ATOM   795   N NE2   . GLN A 1 104 ? 3.604   55.421  6.887   1.00 29.73 ? 104  GLN A NE2   1 
ATOM   796   N N     . SER A 1 105 ? 3.174   49.662  3.130   1.00 27.95 ? 105  SER A N     1 
ATOM   797   C CA    . SER A 1 105 ? 3.412   48.215  3.072   1.00 28.12 ? 105  SER A CA    1 
ATOM   798   C C     . SER A 1 105 ? 4.839   47.921  2.706   1.00 28.37 ? 105  SER A C     1 
ATOM   799   O O     . SER A 1 105 ? 5.599   48.809  2.342   1.00 28.72 ? 105  SER A O     1 
ATOM   800   C CB    . SER A 1 105 ? 2.498   47.523  2.077   1.00 27.84 ? 105  SER A CB    1 
ATOM   801   O OG    . SER A 1 105 ? 2.794   48.011  0.794   1.00 27.85 ? 105  SER A OG    1 
ATOM   802   N N     . LYS A 1 106 ? 5.200   46.654  2.821   1.00 28.50 ? 106  LYS A N     1 
ATOM   803   C CA    . LYS A 1 106 ? 6.571   46.230  2.656   1.00 28.17 ? 106  LYS A CA    1 
ATOM   804   C C     . LYS A 1 106 ? 6.601   44.779  2.242   1.00 27.91 ? 106  LYS A C     1 
ATOM   805   O O     . LYS A 1 106 ? 5.826   43.953  2.759   1.00 27.46 ? 106  LYS A O     1 
ATOM   806   C CB    . LYS A 1 106 ? 7.317   46.364  3.987   1.00 27.99 ? 106  LYS A CB    1 
ATOM   807   C CG    . LYS A 1 106 ? 8.369   47.443  4.053   1.00 28.60 ? 106  LYS A CG    1 
ATOM   808   C CD    . LYS A 1 106 ? 9.176   47.235  5.332   1.00 30.96 ? 106  LYS A CD    1 
ATOM   809   C CE    . LYS A 1 106 ? 9.827   48.516  5.868   1.00 33.54 ? 106  LYS A CE    1 
ATOM   810   N NZ    . LYS A 1 106 ? 10.464  48.253  7.218   1.00 35.50 ? 106  LYS A NZ    1 
ATOM   811   N N     . HIS A 1 107 ? 7.508   44.472  1.319   1.00 27.43 ? 107  HIS A N     1 
ATOM   812   C CA    . HIS A 1 107 ? 7.825   43.092  0.991   1.00 26.69 ? 107  HIS A CA    1 
ATOM   813   C C     . HIS A 1 107 ? 9.254   42.825  1.379   1.00 26.29 ? 107  HIS A C     1 
ATOM   814   O O     . HIS A 1 107 ? 10.181  43.267  0.687   1.00 26.26 ? 107  HIS A O     1 
ATOM   815   C CB    . HIS A 1 107 ? 7.678   42.858  -0.498  1.00 26.59 ? 107  HIS A CB    1 
ATOM   816   C CG    . HIS A 1 107 ? 6.268   42.688  -0.938  1.00 27.55 ? 107  HIS A CG    1 
ATOM   817   N ND1   . HIS A 1 107 ? 5.347   43.712  -0.880  1.00 27.30 ? 107  HIS A ND1   1 
ATOM   818   C CD2   . HIS A 1 107 ? 5.619   41.617  -1.457  1.00 27.32 ? 107  HIS A CD2   1 
ATOM   819   C CE1   . HIS A 1 107 ? 4.187   43.279  -1.342  1.00 27.52 ? 107  HIS A CE1   1 
ATOM   820   N NE2   . HIS A 1 107 ? 4.325   42.010  -1.691  1.00 28.09 ? 107  HIS A NE2   1 
ATOM   821   N N     . ILE A 1 108 ? 9.442   42.107  2.478   1.00 25.34 ? 108  ILE A N     1 
ATOM   822   C CA    . ILE A 1 108 ? 10.788  41.765  2.905   1.00 24.70 ? 108  ILE A CA    1 
ATOM   823   C C     . ILE A 1 108 ? 11.179  40.385  2.376   1.00 24.94 ? 108  ILE A C     1 
ATOM   824   O O     . ILE A 1 108 ? 10.558  39.383  2.729   1.00 25.80 ? 108  ILE A O     1 
ATOM   825   C CB    . ILE A 1 108 ? 10.948  41.864  4.439   1.00 24.00 ? 108  ILE A CB    1 
ATOM   826   C CG1   . ILE A 1 108 ? 10.521  43.259  4.908   1.00 23.07 ? 108  ILE A CG1   1 
ATOM   827   C CG2   . ILE A 1 108 ? 12.391  41.603  4.851   1.00 22.94 ? 108  ILE A CG2   1 
ATOM   828   C CD1   . ILE A 1 108 ? 9.722   43.252  6.210   1.00 17.91 ? 108  ILE A CD1   1 
ATOM   829   N N     . SER A 1 109 ? 12.204  40.345  1.527   1.00 24.90 ? 109  SER A N     1 
ATOM   830   C CA    . SER A 1 109 ? 12.749  39.086  1.010   1.00 24.88 ? 109  SER A CA    1 
ATOM   831   C C     . SER A 1 109 ? 13.461  38.334  2.123   1.00 25.37 ? 109  SER A C     1 
ATOM   832   O O     . SER A 1 109 ? 13.835  38.935  3.143   1.00 25.45 ? 109  SER A O     1 
ATOM   833   C CB    . SER A 1 109 ? 13.731  39.325  -0.151  1.00 24.87 ? 109  SER A CB    1 
ATOM   834   O OG    . SER A 1 109 ? 14.903  40.025  0.262   1.00 22.68 ? 109  SER A OG    1 
ATOM   835   N N     . TYR A 1 110 ? 13.660  37.029  1.913   1.00 25.29 ? 110  TYR A N     1 
ATOM   836   C CA    . TYR A 1 110 ? 14.425  36.193  2.843   1.00 24.71 ? 110  TYR A CA    1 
ATOM   837   C C     . TYR A 1 110 ? 15.825  36.758  3.095   1.00 25.30 ? 110  TYR A C     1 
ATOM   838   O O     . TYR A 1 110 ? 16.315  36.739  4.226   1.00 24.85 ? 110  TYR A O     1 
ATOM   839   C CB    . TYR A 1 110 ? 14.497  34.740  2.325   1.00 24.09 ? 110  TYR A CB    1 
ATOM   840   C CG    . TYR A 1 110 ? 13.356  33.908  2.825   1.00 23.00 ? 110  TYR A CG    1 
ATOM   841   C CD1   . TYR A 1 110 ? 12.168  33.814  2.112   1.00 21.92 ? 110  TYR A CD1   1 
ATOM   842   C CD2   . TYR A 1 110 ? 13.443  33.258  4.053   1.00 25.05 ? 110  TYR A CD2   1 
ATOM   843   C CE1   . TYR A 1 110 ? 11.095  33.055  2.593   1.00 23.33 ? 110  TYR A CE1   1 
ATOM   844   C CE2   . TYR A 1 110 ? 12.371  32.502  4.560   1.00 25.63 ? 110  TYR A CE2   1 
ATOM   845   C CZ    . TYR A 1 110 ? 11.208  32.407  3.813   1.00 23.75 ? 110  TYR A CZ    1 
ATOM   846   O OH    . TYR A 1 110 ? 10.178  31.687  4.319   1.00 23.32 ? 110  TYR A OH    1 
ATOM   847   N N     . ARG A 1 111 ? 16.444  37.257  2.020   1.00 25.94 ? 111  ARG A N     1 
ATOM   848   C CA    . ARG A 1 111 ? 17.808  37.775  2.034   1.00 26.81 ? 111  ARG A CA    1 
ATOM   849   C C     . ARG A 1 111 ? 17.839  39.066  2.804   1.00 26.08 ? 111  ARG A C     1 
ATOM   850   O O     . ARG A 1 111 ? 18.736  39.256  3.634   1.00 26.36 ? 111  ARG A O     1 
ATOM   851   C CB    . ARG A 1 111 ? 18.357  37.933  0.599   1.00 26.83 ? 111  ARG A CB    1 
ATOM   852   C CG    . ARG A 1 111 ? 19.764  38.531  0.477   1.00 28.51 ? 111  ARG A CG    1 
ATOM   853   C CD    . ARG A 1 111 ? 20.443  38.176  -0.873  1.00 28.86 ? 111  ARG A CD    1 
ATOM   854   N NE    . ARG A 1 111 ? 20.998  36.808  -0.859  1.00 31.26 ? 111  ARG A NE    1 
ATOM   855   C CZ    . ARG A 1 111 ? 20.703  35.843  -1.729  1.00 30.08 ? 111  ARG A CZ    1 
ATOM   856   N NH1   . ARG A 1 111 ? 19.852  36.061  -2.739  1.00 29.50 ? 111  ARG A NH1   1 
ATOM   857   N NH2   . ARG A 1 111 ? 21.275  34.650  -1.583  1.00 29.49 ? 111  ARG A NH2   1 
ATOM   858   N N     . GLU A 1 112 ? 16.852  39.929  2.563   1.00 25.66 ? 112  GLU A N     1 
ATOM   859   C CA    . GLU A 1 112 ? 16.723  41.162  3.332   1.00 25.98 ? 112  GLU A CA    1 
ATOM   860   C C     . GLU A 1 112 ? 16.513  40.857  4.812   1.00 25.07 ? 112  GLU A C     1 
ATOM   861   O O     . GLU A 1 112 ? 17.155  41.460  5.680   1.00 24.94 ? 112  GLU A O     1 
ATOM   862   C CB    . GLU A 1 112 ? 15.587  42.046  2.810   1.00 25.88 ? 112  GLU A CB    1 
ATOM   863   C CG    . GLU A 1 112 ? 15.834  42.622  1.408   1.00 28.16 ? 112  GLU A CG    1 
ATOM   864   C CD    . GLU A 1 112 ? 14.563  43.168  0.704   1.00 28.53 ? 112  GLU A CD    1 
ATOM   865   O OE1   . GLU A 1 112 ? 13.413  42.848  1.114   1.00 27.26 ? 112  GLU A OE1   1 
ATOM   866   O OE2   . GLU A 1 112 ? 14.746  43.913  -0.298  1.00 33.47 ? 112  GLU A OE2   1 
ATOM   867   N N     . LEU A 1 113 ? 15.612  39.919  5.090   1.00 24.26 ? 113  LEU A N     1 
ATOM   868   C CA    . LEU A 1 113 ? 15.279  39.562  6.454   1.00 23.64 ? 113  LEU A CA    1 
ATOM   869   C C     . LEU A 1 113 ? 16.495  38.964  7.173   1.00 23.43 ? 113  LEU A C     1 
ATOM   870   O O     . LEU A 1 113 ? 16.793  39.309  8.334   1.00 23.23 ? 113  LEU A O     1 
ATOM   871   C CB    . LEU A 1 113 ? 14.076  38.605  6.483   1.00 23.37 ? 113  LEU A CB    1 
ATOM   872   C CG    . LEU A 1 113 ? 13.567  38.223  7.878   1.00 23.47 ? 113  LEU A CG    1 
ATOM   873   C CD1   . LEU A 1 113 ? 13.144  39.468  8.725   1.00 20.84 ? 113  LEU A CD1   1 
ATOM   874   C CD2   . LEU A 1 113 ? 12.443  37.196  7.780   1.00 23.66 ? 113  LEU A CD2   1 
ATOM   875   N N     . HIS A 1 114 ? 17.201  38.086  6.471   1.00 22.58 ? 114  HIS A N     1 
ATOM   876   C CA    . HIS A 1 114 ? 18.393  37.444  6.999   1.00 22.77 ? 114  HIS A CA    1 
ATOM   877   C C     . HIS A 1 114 ? 19.470  38.480  7.375   1.00 22.83 ? 114  HIS A C     1 
ATOM   878   O O     . HIS A 1 114 ? 20.065  38.406  8.455   1.00 22.62 ? 114  HIS A O     1 
ATOM   879   C CB    . HIS A 1 114 ? 18.886  36.418  5.967   1.00 22.48 ? 114  HIS A CB    1 
ATOM   880   C CG    . HIS A 1 114 ? 20.273  35.913  6.197   1.00 23.50 ? 114  HIS A CG    1 
ATOM   881   N ND1   . HIS A 1 114 ? 21.379  36.481  5.597   1.00 24.86 ? 114  HIS A ND1   1 
ATOM   882   C CD2   . HIS A 1 114 ? 20.735  34.869  6.927   1.00 24.64 ? 114  HIS A CD2   1 
ATOM   883   C CE1   . HIS A 1 114 ? 22.460  35.802  5.938   1.00 24.42 ? 114  HIS A CE1   1 
ATOM   884   N NE2   . HIS A 1 114 ? 22.097  34.818  6.742   1.00 25.84 ? 114  HIS A NE2   1 
ATOM   885   N N     . ARG A 1 115 ? 19.678  39.462  6.497   1.00 22.78 ? 115  ARG A N     1 
ATOM   886   C CA    . ARG A 1 115 ? 20.685  40.498  6.704   1.00 23.55 ? 115  ARG A CA    1 
ATOM   887   C C     . ARG A 1 115 ? 20.428  41.278  7.976   1.00 22.85 ? 115  ARG A C     1 
ATOM   888   O O     . ARG A 1 115 ? 21.342  41.513  8.770   1.00 22.69 ? 115  ARG A O     1 
ATOM   889   C CB    . ARG A 1 115 ? 20.745  41.460  5.506   1.00 23.21 ? 115  ARG A CB    1 
ATOM   890   C CG    . ARG A 1 115 ? 21.776  42.574  5.684   1.00 25.01 ? 115  ARG A CG    1 
ATOM   891   C CD    . ARG A 1 115 ? 21.907  43.538  4.480   1.00 26.31 ? 115  ARG A CD    1 
ATOM   892   N NE    . ARG A 1 115 ? 22.456  44.829  4.928   1.00 32.95 ? 115  ARG A NE    1 
ATOM   893   C CZ    . ARG A 1 115 ? 23.706  45.251  4.710   1.00 36.62 ? 115  ARG A CZ    1 
ATOM   894   N NH1   . ARG A 1 115 ? 24.578  44.500  4.013   1.00 37.18 ? 115  ARG A NH1   1 
ATOM   895   N NH2   . ARG A 1 115 ? 24.089  46.442  5.176   1.00 37.40 ? 115  ARG A NH2   1 
ATOM   896   N N     . ASP A 1 116 ? 19.177  41.691  8.157   1.00 23.15 ? 116  ASP A N     1 
ATOM   897   C CA    . ASP A 1 116 ? 18.789  42.469  9.330   1.00 23.24 ? 116  ASP A CA    1 
ATOM   898   C C     . ASP A 1 116 ? 18.834  41.646  10.600  1.00 22.54 ? 116  ASP A C     1 
ATOM   899   O O     . ASP A 1 116 ? 19.156  42.172  11.662  1.00 22.23 ? 116  ASP A O     1 
ATOM   900   C CB    . ASP A 1 116 ? 17.442  43.151  9.122   1.00 23.82 ? 116  ASP A CB    1 
ATOM   901   C CG    . ASP A 1 116 ? 17.585  44.529  8.479   1.00 26.63 ? 116  ASP A CG    1 
ATOM   902   O OD1   . ASP A 1 116 ? 18.727  45.067  8.396   1.00 28.92 ? 116  ASP A OD1   1 
ATOM   903   O OD2   . ASP A 1 116 ? 16.551  45.086  8.071   1.00 28.20 ? 116  ASP A OD2   1 
ATOM   904   N N     . VAL A 1 117 ? 18.573  40.345  10.466  1.00 21.96 ? 117  VAL A N     1 
ATOM   905   C CA    . VAL A 1 117 ? 18.680  39.414  11.582  1.00 21.80 ? 117  VAL A CA    1 
ATOM   906   C C     . VAL A 1 117 ? 20.157  39.254  12.030  1.00 22.31 ? 117  VAL A C     1 
ATOM   907   O O     . VAL A 1 117 ? 20.453  39.263  13.235  1.00 22.30 ? 117  VAL A O     1 
ATOM   908   C CB    . VAL A 1 117 ? 17.984  38.052  11.256  1.00 21.85 ? 117  VAL A CB    1 
ATOM   909   C CG1   . VAL A 1 117 ? 18.406  36.917  12.246  1.00 19.76 ? 117  VAL A CG1   1 
ATOM   910   C CG2   . VAL A 1 117 ? 16.446  38.231  11.206  1.00 20.86 ? 117  VAL A CG2   1 
ATOM   911   N N     . CYS A 1 118 ? 21.073  39.143  11.065  1.00 21.91 ? 118  CYS A N     1 
ATOM   912   C CA    . CYS A 1 118 ? 22.498  39.091  11.381  1.00 21.86 ? 118  CYS A CA    1 
ATOM   913   C C     . CYS A 1 118 ? 22.952  40.366  12.080  1.00 22.20 ? 118  CYS A C     1 
ATOM   914   O O     . CYS A 1 118 ? 23.531  40.299  13.172  1.00 22.76 ? 118  CYS A O     1 
ATOM   915   C CB    . CYS A 1 118 ? 23.330  38.788  10.135  1.00 21.93 ? 118  CYS A CB    1 
ATOM   916   S SG    . CYS A 1 118 ? 22.976  37.111  9.477   1.00 20.19 ? 118  CYS A SG    1 
ATOM   917   N N     . ARG A 1 119 ? 22.653  41.521  11.483  1.00 22.11 ? 119  ARG A N     1 
ATOM   918   C CA    . ARG A 1 119 ? 22.853  42.827  12.138  1.00 21.82 ? 119  ARG A CA    1 
ATOM   919   C C     . ARG A 1 119 ? 22.343  42.879  13.583  1.00 22.05 ? 119  ARG A C     1 
ATOM   920   O O     . ARG A 1 119 ? 23.083  43.294  14.482  1.00 22.25 ? 119  ARG A O     1 
ATOM   921   C CB    . ARG A 1 119 ? 22.224  43.964  11.334  1.00 21.32 ? 119  ARG A CB    1 
ATOM   922   C CG    . ARG A 1 119 ? 22.902  44.242  9.983   1.00 23.99 ? 119  ARG A CG    1 
ATOM   923   C CD    . ARG A 1 119 ? 22.766  45.711  9.532   1.00 25.96 ? 119  ARG A CD    1 
ATOM   924   N NE    . ARG A 1 119 ? 21.381  46.102  9.242   1.00 29.04 ? 119  ARG A NE    1 
ATOM   925   C CZ    . ARG A 1 119 ? 20.994  47.303  8.787   1.00 29.42 ? 119  ARG A CZ    1 
ATOM   926   N NH1   . ARG A 1 119 ? 21.867  48.279  8.555   1.00 26.16 ? 119  ARG A NH1   1 
ATOM   927   N NH2   . ARG A 1 119 ? 19.710  47.526  8.553   1.00 30.51 ? 119  ARG A NH2   1 
ATOM   928   N N     . PHE A 1 120 ? 21.102  42.447  13.815  1.00 21.79 ? 120  PHE A N     1 
ATOM   929   C CA    . PHE A 1 120 ? 20.521  42.565  15.144  1.00 22.03 ? 120  PHE A CA    1 
ATOM   930   C C     . PHE A 1 120 ? 21.097  41.547  16.141  1.00 21.95 ? 120  PHE A C     1 
ATOM   931   O O     . PHE A 1 120 ? 21.287  41.851  17.325  1.00 21.24 ? 120  PHE A O     1 
ATOM   932   C CB    . PHE A 1 120 ? 18.978  42.562  15.101  1.00 22.27 ? 120  PHE A CB    1 
ATOM   933   C CG    . PHE A 1 120 ? 18.357  43.146  16.325  1.00 23.10 ? 120  PHE A CG    1 
ATOM   934   C CD1   . PHE A 1 120 ? 18.418  44.525  16.559  1.00 23.93 ? 120  PHE A CD1   1 
ATOM   935   C CD2   . PHE A 1 120 ? 17.755  42.310  17.298  1.00 24.72 ? 120  PHE A CD2   1 
ATOM   936   C CE1   . PHE A 1 120 ? 17.876  45.076  17.749  1.00 24.39 ? 120  PHE A CE1   1 
ATOM   937   C CE2   . PHE A 1 120 ? 17.201  42.842  18.481  1.00 22.97 ? 120  PHE A CE2   1 
ATOM   938   C CZ    . PHE A 1 120 ? 17.264  44.221  18.707  1.00 23.20 ? 120  PHE A CZ    1 
ATOM   939   N N     . ALA A 1 121 ? 21.387  40.345  15.637  1.00 22.23 ? 121  ALA A N     1 
ATOM   940   C CA    . ALA A 1 121 ? 22.152  39.337  16.372  1.00 22.21 ? 121  ALA A CA    1 
ATOM   941   C C     . ALA A 1 121 ? 23.478  39.915  16.888  1.00 22.18 ? 121  ALA A C     1 
ATOM   942   O O     . ALA A 1 121 ? 23.805  39.767  18.070  1.00 22.51 ? 121  ALA A O     1 
ATOM   943   C CB    . ALA A 1 121 ? 22.397  38.099  15.504  1.00 21.93 ? 121  ALA A CB    1 
ATOM   944   N N     . ASN A 1 122 ? 24.220  40.581  16.008  1.00 21.91 ? 122  ASN A N     1 
ATOM   945   C CA    . ASN A 1 122 ? 25.450  41.281  16.396  1.00 22.13 ? 122  ASN A CA    1 
ATOM   946   C C     . ASN A 1 122 ? 25.217  42.456  17.373  1.00 21.97 ? 122  ASN A C     1 
ATOM   947   O O     . ASN A 1 122 ? 25.988  42.637  18.319  1.00 22.09 ? 122  ASN A O     1 
ATOM   948   C CB    . ASN A 1 122 ? 26.250  41.735  15.154  1.00 21.93 ? 122  ASN A CB    1 
ATOM   949   C CG    . ASN A 1 122 ? 27.077  40.600  14.520  1.00 21.96 ? 122  ASN A CG    1 
ATOM   950   O OD1   . ASN A 1 122 ? 27.607  39.725  15.216  1.00 23.00 ? 122  ASN A OD1   1 
ATOM   951   N ND2   . ASN A 1 122 ? 27.200  40.627  13.199  1.00 20.07 ? 122  ASN A ND2   1 
ATOM   952   N N     . THR A 1 123 ? 24.151  43.226  17.154  1.00 21.80 ? 123  THR A N     1 
ATOM   953   C CA    . THR A 1 123 ? 23.755  44.294  18.077  1.00 21.62 ? 123  THR A CA    1 
ATOM   954   C C     . THR A 1 123 ? 23.527  43.728  19.460  1.00 22.00 ? 123  THR A C     1 
ATOM   955   O O     . THR A 1 123 ? 23.947  44.329  20.435  1.00 22.97 ? 123  THR A O     1 
ATOM   956   C CB    . THR A 1 123 ? 22.465  45.034  17.634  1.00 21.74 ? 123  THR A CB    1 
ATOM   957   O OG1   . THR A 1 123 ? 22.652  45.595  16.338  1.00 20.97 ? 123  THR A OG1   1 
ATOM   958   C CG2   . THR A 1 123 ? 22.099  46.150  18.613  1.00 20.36 ? 123  THR A CG2   1 
ATOM   959   N N     . LEU A 1 124 ? 22.867  42.575  19.551  1.00 22.42 ? 124  LEU A N     1 
ATOM   960   C CA    . LEU A 1 124 ? 22.599  41.955  20.851  1.00 22.70 ? 124  LEU A CA    1 
ATOM   961   C C     . LEU A 1 124 ? 23.873  41.462  21.524  1.00 23.24 ? 124  LEU A C     1 
ATOM   962   O O     . LEU A 1 124 ? 24.085  41.684  22.732  1.00 23.95 ? 124  LEU A O     1 
ATOM   963   C CB    . LEU A 1 124 ? 21.612  40.803  20.713  1.00 22.39 ? 124  LEU A CB    1 
ATOM   964   C CG    . LEU A 1 124 ? 20.177  41.157  20.328  1.00 22.10 ? 124  LEU A CG    1 
ATOM   965   C CD1   . LEU A 1 124 ? 19.416  39.877  19.984  1.00 20.90 ? 124  LEU A CD1   1 
ATOM   966   C CD2   . LEU A 1 124 ? 19.475  41.968  21.419  1.00 19.86 ? 124  LEU A CD2   1 
ATOM   967   N N     . LEU A 1 125 ? 24.717  40.807  20.737  1.00 23.25 ? 125  LEU A N     1 
ATOM   968   C CA    . LEU A 1 125 ? 26.003  40.335  21.201  1.00 23.67 ? 125  LEU A CA    1 
ATOM   969   C C     . LEU A 1 125 ? 26.897  41.476  21.679  1.00 24.44 ? 125  LEU A C     1 
ATOM   970   O O     . LEU A 1 125 ? 27.539  41.375  22.733  1.00 23.92 ? 125  LEU A O     1 
ATOM   971   C CB    . LEU A 1 125 ? 26.683  39.519  20.106  1.00 23.36 ? 125  LEU A CB    1 
ATOM   972   C CG    . LEU A 1 125 ? 26.062  38.131  19.895  1.00 22.23 ? 125  LEU A CG    1 
ATOM   973   C CD1   . LEU A 1 125 ? 26.561  37.486  18.584  1.00 22.68 ? 125  LEU A CD1   1 
ATOM   974   C CD2   . LEU A 1 125 ? 26.327  37.208  21.070  1.00 20.55 ? 125  LEU A CD2   1 
ATOM   975   N N     . ASP A 1 126 ? 26.903  42.576  20.932  1.00 25.49 ? 126  ASP A N     1 
ATOM   976   C CA    . ASP A 1 126 ? 27.714  43.735  21.308  1.00 26.96 ? 126  ASP A CA    1 
ATOM   977   C C     . ASP A 1 126 ? 27.237  44.386  22.592  1.00 27.52 ? 126  ASP A C     1 
ATOM   978   O O     . ASP A 1 126 ? 28.050  44.896  23.376  1.00 28.12 ? 126  ASP A O     1 
ATOM   979   C CB    . ASP A 1 126 ? 27.764  44.753  20.179  1.00 27.01 ? 126  ASP A CB    1 
ATOM   980   C CG    . ASP A 1 126 ? 28.683  44.316  19.053  1.00 28.68 ? 126  ASP A CG    1 
ATOM   981   O OD1   . ASP A 1 126 ? 29.492  43.373  19.255  1.00 29.95 ? 126  ASP A OD1   1 
ATOM   982   O OD2   . ASP A 1 126 ? 28.584  44.902  17.955  1.00 31.46 ? 126  ASP A OD2   1 
ATOM   983   N N     . LEU A 1 127 ? 25.923  44.335  22.806  1.00 27.63 ? 127  LEU A N     1 
ATOM   984   C CA    . LEU A 1 127 ? 25.287  44.848  24.006  1.00 27.64 ? 127  LEU A CA    1 
ATOM   985   C C     . LEU A 1 127 ? 25.617  43.983  25.230  1.00 27.19 ? 127  LEU A C     1 
ATOM   986   O O     . LEU A 1 127 ? 25.355  44.385  26.359  1.00 26.85 ? 127  LEU A O     1 
ATOM   987   C CB    . LEU A 1 127 ? 23.778  44.897  23.782  1.00 28.20 ? 127  LEU A CB    1 
ATOM   988   C CG    . LEU A 1 127 ? 22.991  46.181  24.069  1.00 29.84 ? 127  LEU A CG    1 
ATOM   989   C CD1   . LEU A 1 127 ? 23.864  47.402  24.431  1.00 30.22 ? 127  LEU A CD1   1 
ATOM   990   C CD2   . LEU A 1 127 ? 22.119  46.480  22.853  1.00 29.18 ? 127  LEU A CD2   1 
ATOM   991   N N     . GLY A 1 128 ? 26.196  42.804  24.999  1.00 26.80 ? 128  GLY A N     1 
ATOM   992   C CA    . GLY A 1 128 ? 26.604  41.910  26.081  1.00 26.47 ? 128  GLY A CA    1 
ATOM   993   C C     . GLY A 1 128 ? 25.569  40.833  26.371  1.00 27.11 ? 128  GLY A C     1 
ATOM   994   O O     . GLY A 1 128 ? 25.683  40.119  27.384  1.00 27.31 ? 128  GLY A O     1 
ATOM   995   N N     . ILE A 1 129 ? 24.551  40.721  25.503  1.00 26.40 ? 129  ILE A N     1 
ATOM   996   C CA    . ILE A 1 129 ? 23.541  39.674  25.628  1.00 26.21 ? 129  ILE A CA    1 
ATOM   997   C C     . ILE A 1 129 ? 24.190  38.368  25.216  1.00 26.73 ? 129  ILE A C     1 
ATOM   998   O O     . ILE A 1 129 ? 24.886  38.327  24.192  1.00 26.96 ? 129  ILE A O     1 
ATOM   999   C CB    . ILE A 1 129 ? 22.301  39.930  24.723  1.00 25.71 ? 129  ILE A CB    1 
ATOM   1000  C CG1   . ILE A 1 129 ? 21.613  41.260  25.084  1.00 26.14 ? 129  ILE A CG1   1 
ATOM   1001  C CG2   . ILE A 1 129 ? 21.348  38.738  24.746  1.00 23.71 ? 129  ILE A CG2   1 
ATOM   1002  C CD1   . ILE A 1 129 ? 21.056  41.363  26.532  1.00 26.39 ? 129  ILE A CD1   1 
ATOM   1003  N N     . LYS A 1 130 ? 23.940  37.317  26.004  1.00 26.96 ? 130  LYS A N     1 
ATOM   1004  C CA    . LYS A 1 130 ? 24.526  35.993  25.805  1.00 27.59 ? 130  LYS A CA    1 
ATOM   1005  C C     . LYS A 1 130 ? 23.499  34.858  25.663  1.00 27.20 ? 130  LYS A C     1 
ATOM   1006  O O     . LYS A 1 130 ? 22.317  35.014  25.996  1.00 26.73 ? 130  LYS A O     1 
ATOM   1007  C CB    . LYS A 1 130 ? 25.465  35.680  26.978  1.00 29.24 ? 130  LYS A CB    1 
ATOM   1008  C CG    . LYS A 1 130 ? 26.815  36.418  26.903  1.00 30.70 ? 130  LYS A CG    1 
ATOM   1009  C CD    . LYS A 1 130 ? 27.201  36.992  28.265  1.00 34.10 ? 130  LYS A CD    1 
ATOM   1010  C CE    . LYS A 1 130 ? 28.602  37.667  28.222  1.00 35.64 ? 130  LYS A CE    1 
ATOM   1011  N NZ    . LYS A 1 130 ? 29.090  38.024  26.829  1.00 36.92 ? 130  LYS A NZ    1 
ATOM   1012  N N     . LYS A 1 131 ? 23.969  33.711  25.175  1.00 26.61 ? 131  LYS A N     1 
ATOM   1013  C CA    . LYS A 1 131 ? 23.151  32.517  25.096  1.00 25.98 ? 131  LYS A CA    1 
ATOM   1014  C C     . LYS A 1 131 ? 22.535  32.218  26.462  1.00 25.94 ? 131  LYS A C     1 
ATOM   1015  O O     . LYS A 1 131 ? 23.242  32.074  27.452  1.00 25.88 ? 131  LYS A O     1 
ATOM   1016  C CB    . LYS A 1 131 ? 23.980  31.323  24.619  1.00 25.73 ? 131  LYS A CB    1 
ATOM   1017  C CG    . LYS A 1 131 ? 23.190  30.003  24.627  1.00 25.46 ? 131  LYS A CG    1 
ATOM   1018  C CD    . LYS A 1 131 ? 24.028  28.829  24.213  1.00 24.04 ? 131  LYS A CD    1 
ATOM   1019  C CE    . LYS A 1 131 ? 23.172  27.589  24.083  1.00 23.29 ? 131  LYS A CE    1 
ATOM   1020  N NZ    . LYS A 1 131 ? 23.925  26.414  23.545  1.00 21.93 ? 131  LYS A NZ    1 
ATOM   1021  N N     . GLY A 1 132 ? 21.214  32.122  26.507  1.00 25.61 ? 132  GLY A N     1 
ATOM   1022  C CA    . GLY A 1 132 ? 20.520  31.814  27.744  1.00 25.18 ? 132  GLY A CA    1 
ATOM   1023  C C     . GLY A 1 132 ? 19.865  33.003  28.425  1.00 25.33 ? 132  GLY A C     1 
ATOM   1024  O O     . GLY A 1 132 ? 18.949  32.809  29.227  1.00 25.72 ? 132  GLY A O     1 
ATOM   1025  N N     . ASP A 1 133 ? 20.341  34.222  28.138  1.00 25.00 ? 133  ASP A N     1 
ATOM   1026  C CA    . ASP A 1 133 ? 19.731  35.442  28.677  1.00 24.83 ? 133  ASP A CA    1 
ATOM   1027  C C     . ASP A 1 133 ? 18.300  35.613  28.164  1.00 24.68 ? 133  ASP A C     1 
ATOM   1028  O O     . ASP A 1 133 ? 18.013  35.330  26.998  1.00 24.03 ? 133  ASP A O     1 
ATOM   1029  C CB    . ASP A 1 133 ? 20.507  36.692  28.273  1.00 24.49 ? 133  ASP A CB    1 
ATOM   1030  C CG    . ASP A 1 133 ? 21.894  36.757  28.852  1.00 26.33 ? 133  ASP A CG    1 
ATOM   1031  O OD1   . ASP A 1 133 ? 22.258  35.997  29.785  1.00 25.07 ? 133  ASP A OD1   1 
ATOM   1032  O OD2   . ASP A 1 133 ? 22.636  37.617  28.339  1.00 28.70 ? 133  ASP A OD2   1 
ATOM   1033  N N     . VAL A 1 134 ? 17.422  36.106  29.035  1.00 24.76 ? 134  VAL A N     1 
ATOM   1034  C CA    . VAL A 1 134 ? 16.065  36.451  28.639  1.00 24.70 ? 134  VAL A CA    1 
ATOM   1035  C C     . VAL A 1 134 ? 15.981  37.867  28.062  1.00 24.48 ? 134  VAL A C     1 
ATOM   1036  O O     . VAL A 1 134 ? 16.530  38.839  28.607  1.00 24.63 ? 134  VAL A O     1 
ATOM   1037  C CB    . VAL A 1 134 ? 15.055  36.257  29.797  1.00 24.99 ? 134  VAL A CB    1 
ATOM   1038  C CG1   . VAL A 1 134 ? 13.591  36.506  29.317  1.00 24.61 ? 134  VAL A CG1   1 
ATOM   1039  C CG2   . VAL A 1 134 ? 15.182  34.843  30.378  1.00 24.56 ? 134  VAL A CG2   1 
ATOM   1040  N N     . VAL A 1 135 ? 15.292  37.977  26.937  1.00 24.36 ? 135  VAL A N     1 
ATOM   1041  C CA    . VAL A 1 135 ? 15.088  39.279  26.300  1.00 23.78 ? 135  VAL A CA    1 
ATOM   1042  C C     . VAL A 1 135 ? 13.589  39.555  26.173  1.00 23.58 ? 135  VAL A C     1 
ATOM   1043  O O     . VAL A 1 135 ? 12.882  38.801  25.516  1.00 23.36 ? 135  VAL A O     1 
ATOM   1044  C CB    . VAL A 1 135 ? 15.802  39.362  24.920  1.00 23.74 ? 135  VAL A CB    1 
ATOM   1045  C CG1   . VAL A 1 135 ? 15.535  40.722  24.257  1.00 23.68 ? 135  VAL A CG1   1 
ATOM   1046  C CG2   . VAL A 1 135 ? 17.317  39.117  25.071  1.00 21.68 ? 135  VAL A CG2   1 
ATOM   1047  N N     . ALA A 1 136 ? 13.120  40.609  26.840  1.00 23.06 ? 136  ALA A N     1 
ATOM   1048  C CA    . ALA A 1 136 ? 11.725  41.040  26.752  1.00 23.14 ? 136  ALA A CA    1 
ATOM   1049  C C     . ALA A 1 136 ? 11.469  41.825  25.455  1.00 23.37 ? 136  ALA A C     1 
ATOM   1050  O O     . ALA A 1 136 ? 12.228  42.748  25.094  1.00 23.71 ? 136  ALA A O     1 
ATOM   1051  C CB    . ALA A 1 136 ? 11.331  41.878  27.973  1.00 22.80 ? 136  ALA A CB    1 
ATOM   1052  N N     . ILE A 1 137 ? 10.414  41.427  24.742  1.00 23.20 ? 137  ILE A N     1 
ATOM   1053  C CA    . ILE A 1 137 ? 10.002  42.096  23.524  1.00 22.31 ? 137  ILE A CA    1 
ATOM   1054  C C     . ILE A 1 137 ? 8.562   42.604  23.717  1.00 22.93 ? 137  ILE A C     1 
ATOM   1055  O O     . ILE A 1 137 ? 7.635   41.834  23.971  1.00 22.56 ? 137  ILE A O     1 
ATOM   1056  C CB    . ILE A 1 137 ? 10.187  41.183  22.297  1.00 22.80 ? 137  ILE A CB    1 
ATOM   1057  C CG1   . ILE A 1 137 ? 11.676  40.750  22.181  1.00 22.30 ? 137  ILE A CG1   1 
ATOM   1058  C CG2   . ILE A 1 137 ? 9.705   41.886  21.016  1.00 20.23 ? 137  ILE A CG2   1 
ATOM   1059  C CD1   . ILE A 1 137 ? 11.942  39.604  21.232  1.00 21.45 ? 137  ILE A CD1   1 
ATOM   1060  N N     . TYR A 1 138 ? 8.405   43.924  23.663  1.00 23.14 ? 138  TYR A N     1 
ATOM   1061  C CA    . TYR A 1 138 ? 7.102   44.566  23.868  1.00 23.50 ? 138  TYR A CA    1 
ATOM   1062  C C     . TYR A 1 138 ? 6.823   45.465  22.653  1.00 23.27 ? 138  TYR A C     1 
ATOM   1063  O O     . TYR A 1 138 ? 7.048   46.692  22.665  1.00 22.45 ? 138  TYR A O     1 
ATOM   1064  C CB    . TYR A 1 138 ? 7.119   45.306  25.202  1.00 23.04 ? 138  TYR A CB    1 
ATOM   1065  C CG    . TYR A 1 138 ? 5.825   45.958  25.646  1.00 24.46 ? 138  TYR A CG    1 
ATOM   1066  C CD1   . TYR A 1 138 ? 4.653   45.211  25.856  1.00 23.11 ? 138  TYR A CD1   1 
ATOM   1067  C CD2   . TYR A 1 138 ? 5.790   47.333  25.920  1.00 24.62 ? 138  TYR A CD2   1 
ATOM   1068  C CE1   . TYR A 1 138 ? 3.478   45.827  26.286  1.00 22.62 ? 138  TYR A CE1   1 
ATOM   1069  C CE2   . TYR A 1 138 ? 4.624   47.949  26.358  1.00 24.45 ? 138  TYR A CE2   1 
ATOM   1070  C CZ    . TYR A 1 138 ? 3.477   47.198  26.542  1.00 23.37 ? 138  TYR A CZ    1 
ATOM   1071  O OH    . TYR A 1 138 ? 2.348   47.846  26.999  1.00 23.63 ? 138  TYR A OH    1 
ATOM   1072  N N     . MET A 1 139 ? 6.360   44.813  21.590  1.00 23.42 ? 139  MET A N     1 
ATOM   1073  C CA    . MET A 1 139 ? 6.313   45.429  20.275  1.00 24.54 ? 139  MET A CA    1 
ATOM   1074  C C     . MET A 1 139 ? 4.904   45.445  19.664  1.00 24.65 ? 139  MET A C     1 
ATOM   1075  O O     . MET A 1 139 ? 4.048   44.610  20.017  1.00 25.04 ? 139  MET A O     1 
ATOM   1076  C CB    . MET A 1 139 ? 7.259   44.679  19.323  1.00 25.25 ? 139  MET A CB    1 
ATOM   1077  C CG    . MET A 1 139 ? 8.748   44.771  19.652  1.00 26.67 ? 139  MET A CG    1 
ATOM   1078  S SD    . MET A 1 139 ? 9.451   46.305  19.055  1.00 30.78 ? 139  MET A SD    1 
ATOM   1079  C CE    . MET A 1 139 ? 10.150  45.809  17.481  1.00 25.17 ? 139  MET A CE    1 
ATOM   1080  N N     . PRO A 1 140 ? 4.662   46.384  18.723  1.00 24.13 ? 140  PRO A N     1 
ATOM   1081  C CA    . PRO A 1 140 ? 3.479   46.295  17.883  1.00 23.46 ? 140  PRO A CA    1 
ATOM   1082  C C     . PRO A 1 140 ? 3.781   45.335  16.733  1.00 22.95 ? 140  PRO A C     1 
ATOM   1083  O O     . PRO A 1 140 ? 4.904   44.808  16.671  1.00 23.13 ? 140  PRO A O     1 
ATOM   1084  C CB    . PRO A 1 140 ? 3.316   47.723  17.356  1.00 23.42 ? 140  PRO A CB    1 
ATOM   1085  C CG    . PRO A 1 140 ? 4.686   48.255  17.286  1.00 23.32 ? 140  PRO A CG    1 
ATOM   1086  C CD    . PRO A 1 140 ? 5.483   47.560  18.384  1.00 24.34 ? 140  PRO A CD    1 
ATOM   1087  N N     . MET A 1 141 ? 2.802   45.122  15.844  1.00 22.00 ? 141  MET A N     1 
ATOM   1088  C CA    . MET A 1 141 ? 2.935   44.208  14.694  1.00 21.05 ? 141  MET A CA    1 
ATOM   1089  C C     . MET A 1 141 ? 3.674   44.875  13.535  1.00 20.32 ? 141  MET A C     1 
ATOM   1090  O O     . MET A 1 141 ? 3.094   45.335  12.562  1.00 19.34 ? 141  MET A O     1 
ATOM   1091  C CB    . MET A 1 141 ? 1.564   43.682  14.253  1.00 21.12 ? 141  MET A CB    1 
ATOM   1092  C CG    . MET A 1 141 ? 0.942   42.714  15.259  1.00 20.30 ? 141  MET A CG    1 
ATOM   1093  S SD    . MET A 1 141 ? 1.579   41.081  14.964  1.00 23.34 ? 141  MET A SD    1 
ATOM   1094  C CE    . MET A 1 141 ? 0.436   40.443  13.748  1.00 22.13 ? 141  MET A CE    1 
ATOM   1095  N N     . VAL A 1 142 ? 4.984   44.932  13.681  1.00 20.60 ? 142  VAL A N     1 
ATOM   1096  C CA    . VAL A 1 142 ? 5.857   45.494  12.666  1.00 20.39 ? 142  VAL A CA    1 
ATOM   1097  C C     . VAL A 1 142 ? 6.968   44.466  12.433  1.00 20.79 ? 142  VAL A C     1 
ATOM   1098  O O     . VAL A 1 142 ? 7.223   43.631  13.298  1.00 20.71 ? 142  VAL A O     1 
ATOM   1099  C CB    . VAL A 1 142 ? 6.403   46.888  13.098  1.00 20.53 ? 142  VAL A CB    1 
ATOM   1100  C CG1   . VAL A 1 142 ? 5.264   47.950  13.126  1.00 18.11 ? 142  VAL A CG1   1 
ATOM   1101  C CG2   . VAL A 1 142 ? 7.134   46.807  14.466  1.00 19.59 ? 142  VAL A CG2   1 
ATOM   1102  N N     . PRO A 1 143 ? 7.622   44.503  11.260  1.00 21.75 ? 143  PRO A N     1 
ATOM   1103  C CA    . PRO A 1 143 ? 8.619   43.453  10.913  1.00 21.93 ? 143  PRO A CA    1 
ATOM   1104  C C     . PRO A 1 143 ? 9.827   43.384  11.855  1.00 21.93 ? 143  PRO A C     1 
ATOM   1105  O O     . PRO A 1 143 ? 10.406  42.325  12.001  1.00 22.72 ? 143  PRO A O     1 
ATOM   1106  C CB    . PRO A 1 143 ? 9.093   43.850  9.516   1.00 21.83 ? 143  PRO A CB    1 
ATOM   1107  C CG    . PRO A 1 143 ? 8.085   44.848  9.021   1.00 22.13 ? 143  PRO A CG    1 
ATOM   1108  C CD    . PRO A 1 143 ? 7.501   45.529  10.208  1.00 21.08 ? 143  PRO A CD    1 
ATOM   1109  N N     . GLU A 1 144 ? 10.180  44.491  12.507  1.00 21.88 ? 144  GLU A N     1 
ATOM   1110  C CA    . GLU A 1 144 ? 11.255  44.520  13.529  1.00 21.45 ? 144  GLU A CA    1 
ATOM   1111  C C     . GLU A 1 144 ? 11.055  43.612  14.764  1.00 21.56 ? 144  GLU A C     1 
ATOM   1112  O O     . GLU A 1 144 ? 12.029  43.234  15.422  1.00 22.20 ? 144  GLU A O     1 
ATOM   1113  C CB    . GLU A 1 144 ? 11.513  45.950  13.981  1.00 20.56 ? 144  GLU A CB    1 
ATOM   1114  C CG    . GLU A 1 144 ? 12.105  46.794  12.905  1.00 21.07 ? 144  GLU A CG    1 
ATOM   1115  C CD    . GLU A 1 144 ? 11.070  47.429  11.976  1.00 22.01 ? 144  GLU A CD    1 
ATOM   1116  O OE1   . GLU A 1 144 ? 9.838   47.221  12.115  1.00 20.61 ? 144  GLU A OE1   1 
ATOM   1117  O OE2   . GLU A 1 144 ? 11.516  48.163  11.087  1.00 24.17 ? 144  GLU A OE2   1 
ATOM   1118  N N     . ALA A 1 145 ? 9.811   43.269  15.076  1.00 21.28 ? 145  ALA A N     1 
ATOM   1119  C CA    . ALA A 1 145 ? 9.526   42.333  16.164  1.00 21.54 ? 145  ALA A CA    1 
ATOM   1120  C C     . ALA A 1 145 ? 9.981   40.935  15.777  1.00 21.50 ? 145  ALA A C     1 
ATOM   1121  O O     . ALA A 1 145 ? 10.654  40.245  16.559  1.00 21.77 ? 145  ALA A O     1 
ATOM   1122  C CB    . ALA A 1 145 ? 8.026   42.341  16.515  1.00 21.50 ? 145  ALA A CB    1 
ATOM   1123  N N     . ALA A 1 146 ? 9.631   40.545  14.551  1.00 20.60 ? 146  ALA A N     1 
ATOM   1124  C CA    . ALA A 1 146 ? 10.131  39.311  13.937  1.00 20.03 ? 146  ALA A CA    1 
ATOM   1125  C C     . ALA A 1 146 ? 11.670  39.272  13.902  1.00 19.58 ? 146  ALA A C     1 
ATOM   1126  O O     . ALA A 1 146 ? 12.281  38.300  14.375  1.00 19.09 ? 146  ALA A O     1 
ATOM   1127  C CB    . ALA A 1 146 ? 9.537   39.155  12.509  1.00 20.04 ? 146  ALA A CB    1 
ATOM   1128  N N     . VAL A 1 147 ? 12.280  40.329  13.348  1.00 19.09 ? 147  VAL A N     1 
ATOM   1129  C CA    . VAL A 1 147 ? 13.738  40.487  13.363  1.00 18.80 ? 147  VAL A CA    1 
ATOM   1130  C C     . VAL A 1 147 ? 14.336  40.261  14.751  1.00 19.26 ? 147  VAL A C     1 
ATOM   1131  O O     . VAL A 1 147 ? 15.363  39.604  14.872  1.00 18.40 ? 147  VAL A O     1 
ATOM   1132  C CB    . VAL A 1 147 ? 14.228  41.901  12.885  1.00 18.94 ? 147  VAL A CB    1 
ATOM   1133  C CG1   . VAL A 1 147 ? 15.759  41.957  12.952  1.00 16.64 ? 147  VAL A CG1   1 
ATOM   1134  C CG2   . VAL A 1 147 ? 13.752  42.239  11.492  1.00 17.04 ? 147  VAL A CG2   1 
ATOM   1135  N N     . ALA A 1 148 ? 13.703  40.853  15.777  1.00 19.85 ? 148  ALA A N     1 
ATOM   1136  C CA    . ALA A 1 148 ? 14.169  40.756  17.169  1.00 20.49 ? 148  ALA A CA    1 
ATOM   1137  C C     . ALA A 1 148 ? 14.038  39.316  17.668  1.00 20.74 ? 148  ALA A C     1 
ATOM   1138  O O     . ALA A 1 148 ? 14.921  38.789  18.328  1.00 21.27 ? 148  ALA A O     1 
ATOM   1139  C CB    . ALA A 1 148 ? 13.361  41.722  18.086  1.00 20.35 ? 148  ALA A CB    1 
ATOM   1140  N N     . MET A 1 149 ? 12.915  38.688  17.350  1.00 21.13 ? 149  MET A N     1 
ATOM   1141  C CA    . MET A 1 149 ? 12.652  37.328  17.793  1.00 21.39 ? 149  MET A CA    1 
ATOM   1142  C C     . MET A 1 149 ? 13.607  36.322  17.169  1.00 22.03 ? 149  MET A C     1 
ATOM   1143  O O     . MET A 1 149 ? 14.163  35.469  17.879  1.00 22.09 ? 149  MET A O     1 
ATOM   1144  C CB    . MET A 1 149 ? 11.208  36.954  17.474  1.00 21.78 ? 149  MET A CB    1 
ATOM   1145  C CG    . MET A 1 149 ? 10.223  37.628  18.409  1.00 20.52 ? 149  MET A CG    1 
ATOM   1146  S SD    . MET A 1 149 ? 8.589   37.346  17.812  1.00 20.41 ? 149  MET A SD    1 
ATOM   1147  C CE    . MET A 1 149 ? 8.288   35.659  18.393  1.00 19.87 ? 149  MET A CE    1 
ATOM   1148  N N     . LEU A 1 150 ? 13.795  36.426  15.846  1.00 22.19 ? 150  LEU A N     1 
ATOM   1149  C CA    . LEU A 1 150 ? 14.760  35.588  15.122  1.00 22.20 ? 150  LEU A CA    1 
ATOM   1150  C C     . LEU A 1 150 ? 16.213  35.847  15.533  1.00 22.48 ? 150  LEU A C     1 
ATOM   1151  O O     . LEU A 1 150 ? 17.047  34.925  15.504  1.00 22.45 ? 150  LEU A O     1 
ATOM   1152  C CB    . LEU A 1 150 ? 14.608  35.767  13.609  1.00 21.96 ? 150  LEU A CB    1 
ATOM   1153  C CG    . LEU A 1 150 ? 13.325  35.187  12.994  1.00 22.18 ? 150  LEU A CG    1 
ATOM   1154  C CD1   . LEU A 1 150 ? 12.881  36.011  11.752  1.00 20.97 ? 150  LEU A CD1   1 
ATOM   1155  C CD2   . LEU A 1 150 ? 13.501  33.694  12.669  1.00 19.55 ? 150  LEU A CD2   1 
ATOM   1156  N N     . ALA A 1 151 ? 16.527  37.092  15.905  1.00 22.47 ? 151  ALA A N     1 
ATOM   1157  C CA    . ALA A 1 151 ? 17.891  37.392  16.338  1.00 22.51 ? 151  ALA A CA    1 
ATOM   1158  C C     . ALA A 1 151 ? 18.153  36.766  17.696  1.00 22.24 ? 151  ALA A C     1 
ATOM   1159  O O     . ALA A 1 151 ? 19.227  36.215  17.917  1.00 22.58 ? 151  ALA A O     1 
ATOM   1160  C CB    . ALA A 1 151 ? 18.160  38.875  16.354  1.00 22.45 ? 151  ALA A CB    1 
ATOM   1161  N N     . CYS A 1 152 ? 17.165  36.795  18.588  1.00 22.15 ? 152  CYS A N     1 
ATOM   1162  C CA    . CYS A 1 152 ? 17.324  36.116  19.883  1.00 22.41 ? 152  CYS A CA    1 
ATOM   1163  C C     . CYS A 1 152 ? 17.612  34.638  19.695  1.00 23.11 ? 152  CYS A C     1 
ATOM   1164  O O     . CYS A 1 152 ? 18.580  34.112  20.259  1.00 23.28 ? 152  CYS A O     1 
ATOM   1165  C CB    . CYS A 1 152 ? 16.118  36.332  20.784  1.00 21.94 ? 152  CYS A CB    1 
ATOM   1166  S SG    . CYS A 1 152 ? 16.091  38.006  21.406  1.00 21.00 ? 152  CYS A SG    1 
ATOM   1167  N N     . ALA A 1 153 ? 16.786  33.992  18.865  1.00 23.46 ? 153  ALA A N     1 
ATOM   1168  C CA    . ALA A 1 153 ? 16.957  32.589  18.489  1.00 23.28 ? 153  ALA A CA    1 
ATOM   1169  C C     . ALA A 1 153 ? 18.325  32.264  17.863  1.00 23.41 ? 153  ALA A C     1 
ATOM   1170  O O     . ALA A 1 153 ? 18.933  31.235  18.184  1.00 23.25 ? 153  ALA A O     1 
ATOM   1171  C CB    . ALA A 1 153 ? 15.821  32.158  17.551  1.00 22.68 ? 153  ALA A CB    1 
ATOM   1172  N N     . ARG A 1 154 ? 18.805  33.131  16.965  1.00 23.71 ? 154  ARG A N     1 
ATOM   1173  C CA    . ARG A 1 154 ? 20.073  32.884  16.281  1.00 23.42 ? 154  ARG A CA    1 
ATOM   1174  C C     . ARG A 1 154 ? 21.230  32.718  17.264  1.00 23.49 ? 154  ARG A C     1 
ATOM   1175  O O     . ARG A 1 154 ? 22.041  31.792  17.133  1.00 23.58 ? 154  ARG A O     1 
ATOM   1176  C CB    . ARG A 1 154 ? 20.382  33.971  15.250  1.00 23.35 ? 154  ARG A CB    1 
ATOM   1177  C CG    . ARG A 1 154 ? 21.508  33.607  14.286  1.00 23.78 ? 154  ARG A CG    1 
ATOM   1178  C CD    . ARG A 1 154 ? 21.756  34.749  13.309  1.00 23.78 ? 154  ARG A CD    1 
ATOM   1179  N NE    . ARG A 1 154 ? 22.679  34.448  12.197  1.00 21.36 ? 154  ARG A NE    1 
ATOM   1180  C CZ    . ARG A 1 154 ? 22.343  33.819  11.067  1.00 19.58 ? 154  ARG A CZ    1 
ATOM   1181  N NH1   . ARG A 1 154 ? 21.115  33.332  10.879  1.00 17.58 ? 154  ARG A NH1   1 
ATOM   1182  N NH2   . ARG A 1 154 ? 23.249  33.667  10.118  1.00 16.62 ? 154  ARG A NH2   1 
ATOM   1183  N N     . ILE A 1 155 ? 21.288  33.609  18.247  1.00 23.35 ? 155  ILE A N     1 
ATOM   1184  C CA    . ILE A 1 155 ? 22.340  33.580  19.256  1.00 23.16 ? 155  ILE A CA    1 
ATOM   1185  C C     . ILE A 1 155 ? 21.990  32.741  20.508  1.00 23.75 ? 155  ILE A C     1 
ATOM   1186  O O     . ILE A 1 155 ? 22.793  32.664  21.447  1.00 24.41 ? 155  ILE A O     1 
ATOM   1187  C CB    . ILE A 1 155 ? 22.805  35.041  19.660  1.00 23.35 ? 155  ILE A CB    1 
ATOM   1188  C CG1   . ILE A 1 155 ? 21.751  35.761  20.524  1.00 22.69 ? 155  ILE A CG1   1 
ATOM   1189  C CG2   . ILE A 1 155 ? 23.131  35.862  18.417  1.00 21.48 ? 155  ILE A CG2   1 
ATOM   1190  C CD1   . ILE A 1 155 ? 22.175  37.138  20.978  1.00 22.49 ? 155  ILE A CD1   1 
ATOM   1191  N N     . GLY A 1 156 ? 20.820  32.109  20.529  1.00 23.86 ? 156  GLY A N     1 
ATOM   1192  C CA    . GLY A 1 156 ? 20.407  31.331  21.697  1.00 24.23 ? 156  GLY A CA    1 
ATOM   1193  C C     . GLY A 1 156 ? 19.998  32.132  22.935  1.00 25.09 ? 156  GLY A C     1 
ATOM   1194  O O     . GLY A 1 156 ? 19.944  31.590  24.046  1.00 25.48 ? 156  GLY A O     1 
ATOM   1195  N N     . ALA A 1 157 ? 19.724  33.426  22.779  1.00 25.18 ? 157  ALA A N     1 
ATOM   1196  C CA    . ALA A 1 157 ? 19.059  34.176  23.854  1.00 25.06 ? 157  ALA A CA    1 
ATOM   1197  C C     . ALA A 1 157 ? 17.634  33.650  23.927  1.00 24.99 ? 157  ALA A C     1 
ATOM   1198  O O     . ALA A 1 157 ? 17.114  33.122  22.955  1.00 25.64 ? 157  ALA A O     1 
ATOM   1199  C CB    . ALA A 1 157 ? 19.064  35.663  23.570  1.00 24.71 ? 157  ALA A CB    1 
ATOM   1200  N N     . VAL A 1 158 ? 17.005  33.777  25.077  1.00 24.58 ? 158  VAL A N     1 
ATOM   1201  C CA    . VAL A 1 158 ? 15.664  33.252  25.263  1.00 24.03 ? 158  VAL A CA    1 
ATOM   1202  C C     . VAL A 1 158 ? 14.700  34.439  25.282  1.00 23.64 ? 158  VAL A C     1 
ATOM   1203  O O     . VAL A 1 158 ? 14.758  35.284  26.189  1.00 23.67 ? 158  VAL A O     1 
ATOM   1204  C CB    . VAL A 1 158 ? 15.601  32.422  26.570  1.00 24.41 ? 158  VAL A CB    1 
ATOM   1205  C CG1   . VAL A 1 158 ? 14.157  31.993  26.905  1.00 23.89 ? 158  VAL A CG1   1 
ATOM   1206  C CG2   . VAL A 1 158 ? 16.547  31.219  26.459  1.00 23.72 ? 158  VAL A CG2   1 
ATOM   1207  N N     . HIS A 1 159 ? 13.836  34.532  24.277  1.00 22.20 ? 159  HIS A N     1 
ATOM   1208  C CA    . HIS A 1 159 ? 13.014  35.719  24.184  1.00 21.66 ? 159  HIS A CA    1 
ATOM   1209  C C     . HIS A 1 159 ? 11.698  35.518  24.892  1.00 22.05 ? 159  HIS A C     1 
ATOM   1210  O O     . HIS A 1 159 ? 11.161  34.403  24.958  1.00 22.04 ? 159  HIS A O     1 
ATOM   1211  C CB    . HIS A 1 159 ? 12.798  36.201  22.742  1.00 20.98 ? 159  HIS A CB    1 
ATOM   1212  C CG    . HIS A 1 159 ? 11.927  35.300  21.911  1.00 20.95 ? 159  HIS A CG    1 
ATOM   1213  N ND1   . HIS A 1 159 ? 12.361  34.728  20.731  1.00 19.50 ? 159  HIS A ND1   1 
ATOM   1214  C CD2   . HIS A 1 159 ? 10.654  34.871  22.088  1.00 18.90 ? 159  HIS A CD2   1 
ATOM   1215  C CE1   . HIS A 1 159 ? 11.394  33.992  20.215  1.00 19.21 ? 159  HIS A CE1   1 
ATOM   1216  N NE2   . HIS A 1 159 ? 10.351  34.052  21.023  1.00 20.23 ? 159  HIS A NE2   1 
ATOM   1217  N N     . SER A 1 160 ? 11.181  36.618  25.416  1.00 21.67 ? 160  SER A N     1 
ATOM   1218  C CA    . SER A 1 160 ? 9.936   36.605  26.100  1.00 22.15 ? 160  SER A CA    1 
ATOM   1219  C C     . SER A 1 160 ? 9.083   37.739  25.553  1.00 22.24 ? 160  SER A C     1 
ATOM   1220  O O     . SER A 1 160 ? 9.187   38.890  25.989  1.00 22.94 ? 160  SER A O     1 
ATOM   1221  C CB    . SER A 1 160 ? 10.179  36.765  27.585  1.00 21.47 ? 160  SER A CB    1 
ATOM   1222  O OG    . SER A 1 160 ? 8.972   36.569  28.262  1.00 24.59 ? 160  SER A OG    1 
ATOM   1223  N N     . VAL A 1 161 ? 8.235   37.409  24.589  1.00 22.34 ? 161  VAL A N     1 
ATOM   1224  C CA    . VAL A 1 161 ? 7.410   38.409  23.926  1.00 21.79 ? 161  VAL A CA    1 
ATOM   1225  C C     . VAL A 1 161 ? 6.244   38.744  24.834  1.00 21.94 ? 161  VAL A C     1 
ATOM   1226  O O     . VAL A 1 161 ? 5.553   37.854  25.357  1.00 22.15 ? 161  VAL A O     1 
ATOM   1227  C CB    . VAL A 1 161 ? 6.927   37.943  22.522  1.00 21.54 ? 161  VAL A CB    1 
ATOM   1228  C CG1   . VAL A 1 161 ? 6.209   39.070  21.808  1.00 21.91 ? 161  VAL A CG1   1 
ATOM   1229  C CG2   . VAL A 1 161 ? 8.107   37.510  21.682  1.00 21.22 ? 161  VAL A CG2   1 
ATOM   1230  N N     . ILE A 1 162 ? 6.057   40.041  25.051  1.00 22.13 ? 162  ILE A N     1 
ATOM   1231  C CA    . ILE A 1 162 ? 4.941   40.543  25.855  1.00 21.40 ? 162  ILE A CA    1 
ATOM   1232  C C     . ILE A 1 162 ? 3.952   41.258  24.932  1.00 21.13 ? 162  ILE A C     1 
ATOM   1233  O O     . ILE A 1 162 ? 4.309   42.197  24.242  1.00 21.20 ? 162  ILE A O     1 
ATOM   1234  C CB    . ILE A 1 162 ? 5.439   41.457  27.006  1.00 21.15 ? 162  ILE A CB    1 
ATOM   1235  C CG1   . ILE A 1 162 ? 6.564   40.749  27.792  1.00 20.51 ? 162  ILE A CG1   1 
ATOM   1236  C CG2   . ILE A 1 162 ? 4.271   41.835  27.895  1.00 20.21 ? 162  ILE A CG2   1 
ATOM   1237  C CD1   . ILE A 1 162 ? 7.232   41.562  28.906  1.00 20.48 ? 162  ILE A CD1   1 
ATOM   1238  N N     . PHE A 1 163 ? 2.715   40.786  24.917  1.00 21.79 ? 163  PHE A N     1 
ATOM   1239  C CA    . PHE A 1 163 ? 1.649   41.360  24.085  1.00 22.04 ? 163  PHE A CA    1 
ATOM   1240  C C     . PHE A 1 163 ? 1.493   42.839  24.349  1.00 22.48 ? 163  PHE A C     1 
ATOM   1241  O O     . PHE A 1 163 ? 1.326   43.261  25.515  1.00 21.74 ? 163  PHE A O     1 
ATOM   1242  C CB    . PHE A 1 163 ? 0.320   40.640  24.343  1.00 22.53 ? 163  PHE A CB    1 
ATOM   1243  C CG    . PHE A 1 163 ? -0.898  41.352  23.785  1.00 22.52 ? 163  PHE A CG    1 
ATOM   1244  C CD1   . PHE A 1 163 ? -1.097  41.464  22.403  1.00 24.01 ? 163  PHE A CD1   1 
ATOM   1245  C CD2   . PHE A 1 163 ? -1.870  41.846  24.644  1.00 22.57 ? 163  PHE A CD2   1 
ATOM   1246  C CE1   . PHE A 1 163 ? -2.242  42.093  21.875  1.00 25.62 ? 163  PHE A CE1   1 
ATOM   1247  C CE2   . PHE A 1 163 ? -3.014  42.476  24.150  1.00 26.11 ? 163  PHE A CE2   1 
ATOM   1248  C CZ    . PHE A 1 163 ? -3.204  42.621  22.753  1.00 25.84 ? 163  PHE A CZ    1 
ATOM   1249  N N     . GLY A 1 164 ? 1.535   43.596  23.240  1.00 23.41 ? 164  GLY A N     1 
ATOM   1250  C CA    . GLY A 1 164 ? 1.470   45.065  23.213  1.00 24.26 ? 164  GLY A CA    1 
ATOM   1251  C C     . GLY A 1 164 ? 0.349   45.681  24.050  1.00 24.76 ? 164  GLY A C     1 
ATOM   1252  O O     . GLY A 1 164 ? 0.500   46.777  24.595  1.00 25.67 ? 164  GLY A O     1 
ATOM   1253  N N     . GLY A 1 165 ? -0.770  44.980  24.164  1.00 24.22 ? 165  GLY A N     1 
ATOM   1254  C CA    . GLY A 1 165 ? -1.860  45.457  24.993  1.00 24.21 ? 165  GLY A CA    1 
ATOM   1255  C C     . GLY A 1 165 ? -1.771  45.263  26.500  1.00 23.91 ? 165  GLY A C     1 
ATOM   1256  O O     . GLY A 1 165 ? -2.720  45.614  27.195  1.00 23.97 ? 165  GLY A O     1 
ATOM   1257  N N     . PHE A 1 166 ? -0.663  44.727  27.022  1.00 23.71 ? 166  PHE A N     1 
ATOM   1258  C CA    . PHE A 1 166 ? -0.496  44.655  28.497  1.00 23.59 ? 166  PHE A CA    1 
ATOM   1259  C C     . PHE A 1 166 ? -0.160  46.003  29.148  1.00 23.27 ? 166  PHE A C     1 
ATOM   1260  O O     . PHE A 1 166 ? 0.553   46.831  28.567  1.00 23.49 ? 166  PHE A O     1 
ATOM   1261  C CB    . PHE A 1 166 ? 0.516   43.567  28.936  1.00 23.69 ? 166  PHE A CB    1 
ATOM   1262  C CG    . PHE A 1 166 ? -0.048  42.152  28.938  1.00 23.99 ? 166  PHE A CG    1 
ATOM   1263  C CD1   . PHE A 1 166 ? -1.092  41.793  29.782  1.00 24.09 ? 166  PHE A CD1   1 
ATOM   1264  C CD2   . PHE A 1 166 ? 0.466   41.183  28.077  1.00 25.50 ? 166  PHE A CD2   1 
ATOM   1265  C CE1   . PHE A 1 166 ? -1.617  40.488  29.769  1.00 24.15 ? 166  PHE A CE1   1 
ATOM   1266  C CE2   . PHE A 1 166 ? -0.053  39.868  28.061  1.00 24.12 ? 166  PHE A CE2   1 
ATOM   1267  C CZ    . PHE A 1 166 ? -1.077  39.522  28.909  1.00 23.54 ? 166  PHE A CZ    1 
ATOM   1268  N N     . SER A 1 167 ? -0.667  46.210  30.359  1.00 22.67 ? 167  SER A N     1 
ATOM   1269  C CA    . SER A 1 167 ? -0.451  47.446  31.110  1.00 23.19 ? 167  SER A CA    1 
ATOM   1270  C C     . SER A 1 167 ? 0.972   47.505  31.683  1.00 22.27 ? 167  SER A C     1 
ATOM   1271  O O     . SER A 1 167 ? 1.614   46.484  31.767  1.00 22.81 ? 167  SER A O     1 
ATOM   1272  C CB    . SER A 1 167 ? -1.490  47.520  32.242  1.00 23.53 ? 167  SER A CB    1 
ATOM   1273  O OG    . SER A 1 167 ? -1.138  46.612  33.289  1.00 25.64 ? 167  SER A OG    1 
ATOM   1274  N N     . PRO A 1 168 ? 1.492   48.697  32.031  1.00 22.39 ? 168  PRO A N     1 
ATOM   1275  C CA    . PRO A 1 168 ? 2.819   48.749  32.703  1.00 22.61 ? 168  PRO A CA    1 
ATOM   1276  C C     . PRO A 1 168 ? 2.996   47.770  33.887  1.00 23.23 ? 168  PRO A C     1 
ATOM   1277  O O     . PRO A 1 168 ? 4.030   47.082  33.995  1.00 23.01 ? 168  PRO A O     1 
ATOM   1278  C CB    . PRO A 1 168 ? 2.927   50.201  33.155  1.00 22.03 ? 168  PRO A CB    1 
ATOM   1279  C CG    . PRO A 1 168 ? 2.158   50.962  32.131  1.00 21.03 ? 168  PRO A CG    1 
ATOM   1280  C CD    . PRO A 1 168 ? 0.979   50.060  31.762  1.00 22.80 ? 168  PRO A CD    1 
ATOM   1281  N N     . GLU A 1 169 ? 1.990   47.684  34.743  1.00 23.71 ? 169  GLU A N     1 
ATOM   1282  C CA    . GLU A 1 169 ? 1.985   46.674  35.787  1.00 24.48 ? 169  GLU A CA    1 
ATOM   1283  C C     . GLU A 1 169 ? 2.158   45.235  35.257  1.00 24.09 ? 169  GLU A C     1 
ATOM   1284  O O     . GLU A 1 169 ? 2.944   44.469  35.811  1.00 24.88 ? 169  GLU A O     1 
ATOM   1285  C CB    . GLU A 1 169 ? 0.726   46.807  36.644  1.00 25.03 ? 169  GLU A CB    1 
ATOM   1286  C CG    . GLU A 1 169 ? 0.685   45.835  37.820  1.00 28.34 ? 169  GLU A CG    1 
ATOM   1287  C CD    . GLU A 1 169 ? 1.684   46.174  38.898  1.00 30.82 ? 169  GLU A CD    1 
ATOM   1288  O OE1   . GLU A 1 169 ? 2.069   47.358  39.013  1.00 32.45 ? 169  GLU A OE1   1 
ATOM   1289  O OE2   . GLU A 1 169 ? 2.080   45.252  39.629  1.00 32.74 ? 169  GLU A OE2   1 
ATOM   1290  N N     . ALA A 1 170 ? 1.462   44.867  34.182  1.00 23.51 ? 170  ALA A N     1 
ATOM   1291  C CA    . ALA A 1 170 ? 1.572   43.505  33.649  1.00 22.70 ? 170  ALA A CA    1 
ATOM   1292  C C     . ALA A 1 170 ? 2.947   43.204  33.011  1.00 23.16 ? 170  ALA A C     1 
ATOM   1293  O O     . ALA A 1 170 ? 3.507   42.117  33.219  1.00 23.60 ? 170  ALA A O     1 
ATOM   1294  C CB    . ALA A 1 170 ? 0.433   43.210  32.705  1.00 22.04 ? 170  ALA A CB    1 
ATOM   1295  N N     . VAL A 1 171 ? 3.479   44.160  32.246  1.00 22.43 ? 171  VAL A N     1 
ATOM   1296  C CA    . VAL A 1 171 ? 4.858   44.141  31.759  1.00 22.01 ? 171  VAL A CA    1 
ATOM   1297  C C     . VAL A 1 171 ? 5.904   43.951  32.893  1.00 22.87 ? 171  VAL A C     1 
ATOM   1298  O O     . VAL A 1 171 ? 6.799   43.078  32.789  1.00 23.11 ? 171  VAL A O     1 
ATOM   1299  C CB    . VAL A 1 171 ? 5.179   45.472  30.989  1.00 21.99 ? 171  VAL A CB    1 
ATOM   1300  C CG1   . VAL A 1 171 ? 6.654   45.593  30.659  1.00 20.27 ? 171  VAL A CG1   1 
ATOM   1301  C CG2   . VAL A 1 171 ? 4.305   45.623  29.725  1.00 21.89 ? 171  VAL A CG2   1 
ATOM   1302  N N     . ALA A 1 172 ? 5.821   44.765  33.957  1.00 23.02 ? 172  ALA A N     1 
ATOM   1303  C CA    . ALA A 1 172 ? 6.780   44.661  35.078  1.00 23.62 ? 172  ALA A CA    1 
ATOM   1304  C C     . ALA A 1 172 ? 6.839   43.232  35.630  1.00 23.79 ? 172  ALA A C     1 
ATOM   1305  O O     . ALA A 1 172 ? 7.907   42.628  35.665  1.00 23.93 ? 172  ALA A O     1 
ATOM   1306  C CB    . ALA A 1 172 ? 6.469   45.681  36.200  1.00 23.44 ? 172  ALA A CB    1 
ATOM   1307  N N     . GLY A 1 173 ? 5.682   42.690  36.011  1.00 24.07 ? 173  GLY A N     1 
ATOM   1308  C CA    . GLY A 1 173 ? 5.568   41.300  36.468  1.00 24.23 ? 173  GLY A CA    1 
ATOM   1309  C C     . GLY A 1 173 ? 6.286   40.294  35.583  1.00 24.56 ? 173  GLY A C     1 
ATOM   1310  O O     . GLY A 1 173 ? 7.020   39.447  36.075  1.00 25.50 ? 173  GLY A O     1 
ATOM   1311  N N     . ARG A 1 174 ? 6.108   40.407  34.276  1.00 24.25 ? 174  ARG A N     1 
ATOM   1312  C CA    . ARG A 1 174 ? 6.754   39.501  33.329  1.00 24.03 ? 174  ARG A CA    1 
ATOM   1313  C C     . ARG A 1 174 ? 8.294   39.632  33.319  1.00 24.84 ? 174  ARG A C     1 
ATOM   1314  O O     . ARG A 1 174 ? 8.994   38.619  33.233  1.00 25.23 ? 174  ARG A O     1 
ATOM   1315  C CB    . ARG A 1 174 ? 6.142   39.679  31.919  1.00 23.73 ? 174  ARG A CB    1 
ATOM   1316  C CG    . ARG A 1 174 ? 4.774   39.020  31.820  1.00 22.45 ? 174  ARG A CG    1 
ATOM   1317  C CD    . ARG A 1 174 ? 3.896   39.514  30.670  1.00 22.50 ? 174  ARG A CD    1 
ATOM   1318  N NE    . ARG A 1 174 ? 2.645   38.774  30.681  1.00 20.55 ? 174  ARG A NE    1 
ATOM   1319  C CZ    . ARG A 1 174 ? 1.641   38.982  31.546  1.00 21.14 ? 174  ARG A CZ    1 
ATOM   1320  N NH1   . ARG A 1 174 ? 1.702   39.949  32.464  1.00 18.77 ? 174  ARG A NH1   1 
ATOM   1321  N NH2   . ARG A 1 174 ? 0.559   38.221  31.492  1.00 21.16 ? 174  ARG A NH2   1 
ATOM   1322  N N     . ILE A 1 175 ? 8.793   40.871  33.422  1.00 25.05 ? 175  ILE A N     1 
ATOM   1323  C CA    . ILE A 1 175 ? 10.231  41.195  33.446  1.00 24.81 ? 175  ILE A CA    1 
ATOM   1324  C C     . ILE A 1 175 ? 10.869  40.746  34.748  1.00 25.09 ? 175  ILE A C     1 
ATOM   1325  O O     . ILE A 1 175 ? 12.046  40.331  34.762  1.00 25.60 ? 175  ILE A O     1 
ATOM   1326  C CB    . ILE A 1 175 ? 10.474  42.731  33.304  1.00 25.09 ? 175  ILE A CB    1 
ATOM   1327  C CG1   . ILE A 1 175 ? 10.296  43.205  31.859  1.00 24.76 ? 175  ILE A CG1   1 
ATOM   1328  C CG2   . ILE A 1 175 ? 11.860  43.154  33.820  1.00 25.28 ? 175  ILE A CG2   1 
ATOM   1329  C CD1   . ILE A 1 175 ? 10.202  44.730  31.736  1.00 24.50 ? 175  ILE A CD1   1 
ATOM   1330  N N     . ILE A 1 176 ? 10.107  40.870  35.837  1.00 24.76 ? 176  ILE A N     1 
ATOM   1331  C CA    . ILE A 1 176 ? 10.561  40.489  37.173  1.00 24.58 ? 176  ILE A CA    1 
ATOM   1332  C C     . ILE A 1 176 ? 10.690  38.963  37.247  1.00 25.62 ? 176  ILE A C     1 
ATOM   1333  O O     . ILE A 1 176 ? 11.736  38.435  37.620  1.00 25.03 ? 176  ILE A O     1 
ATOM   1334  C CB    . ILE A 1 176 ? 9.604   41.032  38.280  1.00 24.59 ? 176  ILE A CB    1 
ATOM   1335  C CG1   . ILE A 1 176 ? 9.620   42.570  38.300  1.00 24.07 ? 176  ILE A CG1   1 
ATOM   1336  C CG2   . ILE A 1 176 ? 9.980   40.498  39.654  1.00 23.06 ? 176  ILE A CG2   1 
ATOM   1337  C CD1   . ILE A 1 176 ? 8.548   43.205  39.134  1.00 24.42 ? 176  ILE A CD1   1 
ATOM   1338  N N     . ASP A 1 177 ? 9.630   38.250  36.866  1.00 26.65 ? 177  ASP A N     1 
ATOM   1339  C CA    . ASP A 1 177 ? 9.676   36.792  36.878  1.00 27.74 ? 177  ASP A CA    1 
ATOM   1340  C C     . ASP A 1 177 ? 10.794  36.224  36.015  1.00 27.22 ? 177  ASP A C     1 
ATOM   1341  O O     . ASP A 1 177 ? 11.425  35.232  36.396  1.00 27.53 ? 177  ASP A O     1 
ATOM   1342  C CB    . ASP A 1 177 ? 8.365   36.182  36.407  1.00 28.26 ? 177  ASP A CB    1 
ATOM   1343  C CG    . ASP A 1 177 ? 8.342   34.672  36.606  1.00 32.65 ? 177  ASP A CG    1 
ATOM   1344  O OD1   . ASP A 1 177 ? 8.819   33.925  35.713  1.00 32.54 ? 177  ASP A OD1   1 
ATOM   1345  O OD2   . ASP A 1 177 ? 7.879   34.227  37.691  1.00 38.42 ? 177  ASP A OD2   1 
ATOM   1346  N N     . SER A 1 178 ? 11.030  36.845  34.859  1.00 26.25 ? 178  SER A N     1 
ATOM   1347  C CA    . SER A 1 178 ? 11.959  36.306  33.887  1.00 25.42 ? 178  SER A CA    1 
ATOM   1348  C C     . SER A 1 178 ? 13.382  36.847  34.030  1.00 25.62 ? 178  SER A C     1 
ATOM   1349  O O     . SER A 1 178 ? 14.299  36.355  33.373  1.00 25.18 ? 178  SER A O     1 
ATOM   1350  C CB    . SER A 1 178 ? 11.436  36.550  32.467  1.00 24.92 ? 178  SER A CB    1 
ATOM   1351  O OG    . SER A 1 178 ? 11.474  37.916  32.149  1.00 22.15 ? 178  SER A OG    1 
ATOM   1352  N N     . SER A 1 179 ? 13.563  37.867  34.866  1.00 26.03 ? 179  SER A N     1 
ATOM   1353  C CA    . SER A 1 179 ? 14.865  38.550  34.986  1.00 27.05 ? 179  SER A CA    1 
ATOM   1354  C C     . SER A 1 179 ? 15.439  39.067  33.634  1.00 27.12 ? 179  SER A C     1 
ATOM   1355  O O     . SER A 1 179 ? 16.613  38.872  33.321  1.00 26.48 ? 179  SER A O     1 
ATOM   1356  C CB    . SER A 1 179 ? 15.874  37.656  35.725  1.00 27.28 ? 179  SER A CB    1 
ATOM   1357  O OG    . SER A 1 179 ? 15.685  37.730  37.128  1.00 28.66 ? 179  SER A OG    1 
ATOM   1358  N N     . SER A 1 180 ? 14.598  39.737  32.851  1.00 27.76 ? 180  SER A N     1 
ATOM   1359  C CA    . SER A 1 180 ? 14.981  40.173  31.514  1.00 28.21 ? 180  SER A CA    1 
ATOM   1360  C C     . SER A 1 180 ? 16.079  41.234  31.570  1.00 28.36 ? 180  SER A C     1 
ATOM   1361  O O     . SER A 1 180 ? 15.985  42.228  32.306  1.00 27.79 ? 180  SER A O     1 
ATOM   1362  C CB    . SER A 1 180 ? 13.760  40.676  30.732  1.00 28.74 ? 180  SER A CB    1 
ATOM   1363  O OG    . SER A 1 180 ? 12.725  39.671  30.660  1.00 29.62 ? 180  SER A OG    1 
ATOM   1364  N N     . ARG A 1 181 ? 17.129  40.999  30.784  1.00 28.46 ? 181  ARG A N     1 
ATOM   1365  C CA    . ARG A 1 181 ? 18.289  41.891  30.738  1.00 28.50 ? 181  ARG A CA    1 
ATOM   1366  C C     . ARG A 1 181 ? 18.097  43.103  29.807  1.00 27.63 ? 181  ARG A C     1 
ATOM   1367  O O     . ARG A 1 181 ? 18.853  44.082  29.863  1.00 27.47 ? 181  ARG A O     1 
ATOM   1368  C CB    . ARG A 1 181 ? 19.512  41.079  30.332  1.00 28.98 ? 181  ARG A CB    1 
ATOM   1369  C CG    . ARG A 1 181 ? 19.952  40.057  31.407  1.00 31.49 ? 181  ARG A CG    1 
ATOM   1370  C CD    . ARG A 1 181 ? 21.406  39.627  31.195  1.00 34.90 ? 181  ARG A CD    1 
ATOM   1371  N NE    . ARG A 1 181 ? 22.298  40.746  30.877  1.00 35.05 ? 181  ARG A NE    1 
ATOM   1372  C CZ    . ARG A 1 181 ? 23.475  40.624  30.267  1.00 36.22 ? 181  ARG A CZ    1 
ATOM   1373  N NH1   . ARG A 1 181 ? 23.915  39.424  29.896  1.00 36.20 ? 181  ARG A NH1   1 
ATOM   1374  N NH2   . ARG A 1 181 ? 24.213  41.706  30.021  1.00 35.40 ? 181  ARG A NH2   1 
ATOM   1375  N N     . LEU A 1 182 ? 17.054  43.030  28.983  1.00 26.20 ? 182  LEU A N     1 
ATOM   1376  C CA    . LEU A 1 182 ? 16.823  43.967  27.906  1.00 25.19 ? 182  LEU A CA    1 
ATOM   1377  C C     . LEU A 1 182 ? 15.330  43.979  27.585  1.00 24.54 ? 182  LEU A C     1 
ATOM   1378  O O     . LEU A 1 182 ? 14.655  42.943  27.647  1.00 23.98 ? 182  LEU A O     1 
ATOM   1379  C CB    . LEU A 1 182 ? 17.615  43.541  26.652  1.00 24.90 ? 182  LEU A CB    1 
ATOM   1380  C CG    . LEU A 1 182 ? 17.525  44.377  25.373  1.00 25.07 ? 182  LEU A CG    1 
ATOM   1381  C CD1   . LEU A 1 182 ? 18.270  45.697  25.548  1.00 27.09 ? 182  LEU A CD1   1 
ATOM   1382  C CD2   . LEU A 1 182 ? 18.085  43.646  24.183  1.00 24.78 ? 182  LEU A CD2   1 
ATOM   1383  N N     . VAL A 1 183 ? 14.830  45.165  27.246  1.00 23.26 ? 183  VAL A N     1 
ATOM   1384  C CA    . VAL A 1 183 ? 13.509  45.309  26.723  1.00 22.22 ? 183  VAL A CA    1 
ATOM   1385  C C     . VAL A 1 183 ? 13.647  45.963  25.355  1.00 22.39 ? 183  VAL A C     1 
ATOM   1386  O O     . VAL A 1 183 ? 14.351  46.973  25.209  1.00 22.27 ? 183  VAL A O     1 
ATOM   1387  C CB    . VAL A 1 183 ? 12.596  46.153  27.656  1.00 22.32 ? 183  VAL A CB    1 
ATOM   1388  C CG1   . VAL A 1 183 ? 11.178  46.276  27.066  1.00 21.16 ? 183  VAL A CG1   1 
ATOM   1389  C CG2   . VAL A 1 183 ? 12.551  45.545  29.063  1.00 21.63 ? 183  VAL A CG2   1 
ATOM   1390  N N     . ILE A 1 184 ? 12.983  45.354  24.368  1.00 21.99 ? 184  ILE A N     1 
ATOM   1391  C CA    . ILE A 1 184 ? 12.898  45.859  22.998  1.00 21.49 ? 184  ILE A CA    1 
ATOM   1392  C C     . ILE A 1 184 ? 11.456  46.267  22.713  1.00 21.13 ? 184  ILE A C     1 
ATOM   1393  O O     . ILE A 1 184 ? 10.522  45.465  22.822  1.00 20.89 ? 184  ILE A O     1 
ATOM   1394  C CB    . ILE A 1 184 ? 13.376  44.780  21.961  1.00 22.22 ? 184  ILE A CB    1 
ATOM   1395  C CG1   . ILE A 1 184 ? 14.803  44.326  22.282  1.00 20.64 ? 184  ILE A CG1   1 
ATOM   1396  C CG2   . ILE A 1 184 ? 13.245  45.286  20.494  1.00 21.45 ? 184  ILE A CG2   1 
ATOM   1397  C CD1   . ILE A 1 184 ? 15.201  43.089  21.572  1.00 21.50 ? 184  ILE A CD1   1 
ATOM   1398  N N     . THR A 1 185 ? 11.297  47.527  22.341  1.00 20.52 ? 185  THR A N     1 
ATOM   1399  C CA    . THR A 1 185 ? 10.007  48.112  22.190  1.00 20.79 ? 185  THR A CA    1 
ATOM   1400  C C     . THR A 1 185 ? 10.002  49.122  21.032  1.00 20.91 ? 185  THR A C     1 
ATOM   1401  O O     . THR A 1 185 ? 10.962  49.190  20.240  1.00 19.71 ? 185  THR A O     1 
ATOM   1402  C CB    . THR A 1 185 ? 9.517   48.743  23.544  1.00 21.49 ? 185  THR A CB    1 
ATOM   1403  O OG1   . THR A 1 185 ? 8.127   49.086  23.438  1.00 24.47 ? 185  THR A OG1   1 
ATOM   1404  C CG2   . THR A 1 185 ? 10.314  49.981  23.932  1.00 19.81 ? 185  THR A CG2   1 
ATOM   1405  N N     . ALA A 1 186 ? 8.906   49.880  20.935  1.00 21.20 ? 186  ALA A N     1 
ATOM   1406  C CA    . ALA A 1 186 ? 8.793   50.997  19.999  1.00 22.09 ? 186  ALA A CA    1 
ATOM   1407  C C     . ALA A 1 186 ? 8.273   52.252  20.719  1.00 22.88 ? 186  ALA A C     1 
ATOM   1408  O O     . ALA A 1 186 ? 7.656   52.149  21.796  1.00 21.92 ? 186  ALA A O     1 
ATOM   1409  C CB    . ALA A 1 186 ? 7.891   50.628  18.828  1.00 21.85 ? 186  ALA A CB    1 
ATOM   1410  N N     . ASP A 1 187 ? 8.537   53.430  20.138  1.00 23.66 ? 187  ASP A N     1 
ATOM   1411  C CA    . ASP A 1 187 ? 7.983   54.671  20.682  1.00 24.88 ? 187  ASP A CA    1 
ATOM   1412  C C     . ASP A 1 187 ? 6.456   54.574  20.851  1.00 25.75 ? 187  ASP A C     1 
ATOM   1413  O O     . ASP A 1 187 ? 5.961   54.733  21.956  1.00 26.61 ? 187  ASP A O     1 
ATOM   1414  C CB    . ASP A 1 187 ? 8.434   55.937  19.916  1.00 24.35 ? 187  ASP A CB    1 
ATOM   1415  C CG    . ASP A 1 187 ? 8.114   55.903  18.429  1.00 24.66 ? 187  ASP A CG    1 
ATOM   1416  O OD1   . ASP A 1 187 ? 7.473   54.955  17.918  1.00 24.46 ? 187  ASP A OD1   1 
ATOM   1417  O OD2   . ASP A 1 187 ? 8.513   56.875  17.757  1.00 25.64 ? 187  ASP A OD2   1 
ATOM   1418  N N     . GLU A 1 188 ? 5.733   54.261  19.782  1.00 26.25 ? 188  GLU A N     1 
ATOM   1419  C CA    . GLU A 1 188 ? 4.309   53.947  19.878  1.00 27.67 ? 188  GLU A CA    1 
ATOM   1420  C C     . GLU A 1 188 ? 3.925   52.821  18.908  1.00 27.59 ? 188  GLU A C     1 
ATOM   1421  O O     . GLU A 1 188 ? 4.650   52.566  17.952  1.00 27.42 ? 188  GLU A O     1 
ATOM   1422  C CB    . GLU A 1 188 ? 3.462   55.174  19.508  1.00 27.63 ? 188  GLU A CB    1 
ATOM   1423  C CG    . GLU A 1 188 ? 3.421   56.308  20.497  1.00 28.60 ? 188  GLU A CG    1 
ATOM   1424  C CD    . GLU A 1 188 ? 2.711   57.525  19.928  1.00 29.21 ? 188  GLU A CD    1 
ATOM   1425  O OE1   . GLU A 1 188 ? 2.820   57.777  18.701  1.00 29.86 ? 188  GLU A OE1   1 
ATOM   1426  O OE2   . GLU A 1 188 ? 2.035   58.230  20.710  1.00 32.58 ? 188  GLU A OE2   1 
ATOM   1427  N N     . GLY A 1 189 ? 2.776   52.182  19.151  1.00 27.98 ? 189  GLY A N     1 
ATOM   1428  C CA    . GLY A 1 189 ? 2.117   51.310  18.164  1.00 28.64 ? 189  GLY A CA    1 
ATOM   1429  C C     . GLY A 1 189 ? 1.001   52.035  17.423  1.00 29.46 ? 189  GLY A C     1 
ATOM   1430  O O     . GLY A 1 189 ? 0.335   52.895  17.988  1.00 29.14 ? 189  GLY A O     1 
ATOM   1431  N N     . VAL A 1 190 ? 0.808   51.706  16.149  1.00 30.75 ? 190  VAL A N     1 
ATOM   1432  C CA    . VAL A 1 190 ? -0.267  52.294  15.330  1.00 31.96 ? 190  VAL A CA    1 
ATOM   1433  C C     . VAL A 1 190 ? -1.346  51.233  15.054  1.00 32.78 ? 190  VAL A C     1 
ATOM   1434  O O     . VAL A 1 190 ? -1.075  50.215  14.411  1.00 33.12 ? 190  VAL A O     1 
ATOM   1435  C CB    . VAL A 1 190 ? 0.297   52.903  13.990  1.00 32.45 ? 190  VAL A CB    1 
ATOM   1436  C CG1   . VAL A 1 190 ? -0.809  53.159  12.944  1.00 31.52 ? 190  VAL A CG1   1 
ATOM   1437  C CG2   . VAL A 1 190 ? 1.074   54.194  14.260  1.00 32.63 ? 190  VAL A CG2   1 
ATOM   1438  N N     . ARG A 1 191 ? -2.557  51.469  15.549  1.00 33.76 ? 191  ARG A N     1 
ATOM   1439  C CA    . ARG A 1 191 ? -3.651  50.498  15.458  1.00 35.41 ? 191  ARG A CA    1 
ATOM   1440  C C     . ARG A 1 191 ? -4.974  51.249  15.316  1.00 35.87 ? 191  ARG A C     1 
ATOM   1441  O O     . ARG A 1 191 ? -5.265  52.159  16.115  1.00 36.16 ? 191  ARG A O     1 
ATOM   1442  C CB    . ARG A 1 191 ? -3.686  49.626  16.717  1.00 35.64 ? 191  ARG A CB    1 
ATOM   1443  C CG    . ARG A 1 191 ? -4.364  48.279  16.562  1.00 38.32 ? 191  ARG A CG    1 
ATOM   1444  C CD    . ARG A 1 191 ? -3.356  47.109  16.607  1.00 44.30 ? 191  ARG A CD    1 
ATOM   1445  N NE    . ARG A 1 191 ? -3.957  45.781  16.834  1.00 48.75 ? 191  ARG A NE    1 
ATOM   1446  C CZ    . ARG A 1 191 ? -5.030  45.520  17.601  1.00 52.11 ? 191  ARG A CZ    1 
ATOM   1447  N NH1   . ARG A 1 191 ? -5.674  46.488  18.267  1.00 51.59 ? 191  ARG A NH1   1 
ATOM   1448  N NH2   . ARG A 1 191 ? -5.472  44.268  17.707  1.00 52.15 ? 191  ARG A NH2   1 
ATOM   1449  N N     . ALA A 1 192 ? -5.752  50.875  14.296  1.00 36.19 ? 192  ALA A N     1 
ATOM   1450  C CA    . ALA A 1 192 ? -7.059  51.482  13.974  1.00 36.51 ? 192  ALA A CA    1 
ATOM   1451  C C     . ALA A 1 192 ? -7.129  53.016  14.040  1.00 37.01 ? 192  ALA A C     1 
ATOM   1452  O O     . ALA A 1 192 ? -8.091  53.576  14.593  1.00 36.63 ? 192  ALA A O     1 
ATOM   1453  C CB    . ALA A 1 192 ? -8.167  50.854  14.828  1.00 36.48 ? 192  ALA A CB    1 
ATOM   1454  N N     . GLY A 1 193 ? -6.117  53.684  13.482  1.00 37.54 ? 193  GLY A N     1 
ATOM   1455  C CA    . GLY A 1 193 ? -6.026  55.153  13.512  1.00 38.86 ? 193  GLY A CA    1 
ATOM   1456  C C     . GLY A 1 193 ? -5.432  55.744  14.788  1.00 40.00 ? 193  GLY A C     1 
ATOM   1457  O O     . GLY A 1 193 ? -5.076  56.923  14.827  1.00 40.20 ? 193  GLY A O     1 
ATOM   1458  N N     . ARG A 1 194 ? -5.308  54.917  15.826  1.00 41.00 ? 194  ARG A N     1 
ATOM   1459  C CA    . ARG A 1 194 ? -4.865  55.352  17.156  1.00 41.93 ? 194  ARG A CA    1 
ATOM   1460  C C     . ARG A 1 194 ? -3.481  54.784  17.513  1.00 41.69 ? 194  ARG A C     1 
ATOM   1461  O O     . ARG A 1 194 ? -3.034  53.806  16.912  1.00 41.39 ? 194  ARG A O     1 
ATOM   1462  C CB    . ARG A 1 194 ? -5.867  54.893  18.236  1.00 42.35 ? 194  ARG A CB    1 
ATOM   1463  C CG    . ARG A 1 194 ? -7.230  55.590  18.253  1.00 43.89 ? 194  ARG A CG    1 
ATOM   1464  C CD    . ARG A 1 194 ? -8.236  54.639  18.906  1.00 48.86 ? 194  ARG A CD    1 
ATOM   1465  N NE    . ARG A 1 194 ? -9.200  55.322  19.768  1.00 51.91 ? 194  ARG A NE    1 
ATOM   1466  C CZ    . ARG A 1 194 ? -10.493 55.478  19.485  1.00 55.22 ? 194  ARG A CZ    1 
ATOM   1467  N NH1   . ARG A 1 194 ? -10.989 54.997  18.347  1.00 56.13 ? 194  ARG A NH1   1 
ATOM   1468  N NH2   . ARG A 1 194 ? -11.299 56.121  20.338  1.00 56.09 ? 194  ARG A NH2   1 
ATOM   1469  N N     . SER A 1 195 ? -2.850  55.398  18.525  1.00 41.54 ? 195  SER A N     1 
ATOM   1470  C CA    . SER A 1 195 ? -1.526  55.019  19.050  1.00 40.74 ? 195  SER A CA    1 
ATOM   1471  C C     . SER A 1 195 ? -1.600  54.310  20.397  1.00 39.88 ? 195  SER A C     1 
ATOM   1472  O O     . SER A 1 195 ? -2.300  54.752  21.300  1.00 40.00 ? 195  SER A O     1 
ATOM   1473  C CB    . SER A 1 195 ? -0.671  56.257  19.217  1.00 40.65 ? 195  SER A CB    1 
ATOM   1474  O OG    . SER A 1 195 ? -0.942  57.155  18.168  1.00 42.06 ? 195  SER A OG    1 
ATOM   1475  N N     . ILE A 1 196 ? -0.894  53.191  20.505  1.00 38.80 ? 196  ILE A N     1 
ATOM   1476  C CA    . ILE A 1 196 ? -0.565  52.597  21.793  1.00 37.63 ? 196  ILE A CA    1 
ATOM   1477  C C     . ILE A 1 196 ? 0.739   53.268  22.284  1.00 36.21 ? 196  ILE A C     1 
ATOM   1478  O O     . ILE A 1 196 ? 1.707   53.366  21.524  1.00 35.31 ? 196  ILE A O     1 
ATOM   1479  C CB    . ILE A 1 196 ? -0.341  51.056  21.696  1.00 38.09 ? 196  ILE A CB    1 
ATOM   1480  C CG1   . ILE A 1 196 ? -1.433  50.376  20.849  1.00 39.72 ? 196  ILE A CG1   1 
ATOM   1481  C CG2   . ILE A 1 196 ? -0.191  50.433  23.092  1.00 37.48 ? 196  ILE A CG2   1 
ATOM   1482  C CD1   . ILE A 1 196 ? -2.874  50.636  21.337  1.00 43.49 ? 196  ILE A CD1   1 
ATOM   1483  N N     . PRO A 1 197 ? 0.761   53.732  23.552  1.00 34.92 ? 197  PRO A N     1 
ATOM   1484  C CA    . PRO A 1 197 ? 2.008   54.297  24.067  1.00 33.77 ? 197  PRO A CA    1 
ATOM   1485  C C     . PRO A 1 197 ? 2.928   53.206  24.637  1.00 32.55 ? 197  PRO A C     1 
ATOM   1486  O O     . PRO A 1 197 ? 2.953   52.972  25.858  1.00 33.69 ? 197  PRO A O     1 
ATOM   1487  C CB    . PRO A 1 197 ? 1.527   55.277  25.155  1.00 33.60 ? 197  PRO A CB    1 
ATOM   1488  C CG    . PRO A 1 197 ? 0.189   54.729  25.613  1.00 33.89 ? 197  PRO A CG    1 
ATOM   1489  C CD    . PRO A 1 197 ? -0.330  53.779  24.553  1.00 34.85 ? 197  PRO A CD    1 
ATOM   1490  N N     . LEU A 1 198 ? 3.698   52.558  23.769  1.00 30.16 ? 198  LEU A N     1 
ATOM   1491  C CA    . LEU A 1 198 ? 4.461   51.385  24.174  1.00 27.56 ? 198  LEU A CA    1 
ATOM   1492  C C     . LEU A 1 198 ? 5.614   51.739  25.108  1.00 26.46 ? 198  LEU A C     1 
ATOM   1493  O O     . LEU A 1 198 ? 5.649   51.258  26.236  1.00 26.75 ? 198  LEU A O     1 
ATOM   1494  C CB    . LEU A 1 198 ? 4.899   50.552  22.957  1.00 26.98 ? 198  LEU A CB    1 
ATOM   1495  C CG    . LEU A 1 198 ? 3.772   49.838  22.191  1.00 25.17 ? 198  LEU A CG    1 
ATOM   1496  C CD1   . LEU A 1 198 ? 4.252   49.345  20.871  1.00 23.22 ? 198  LEU A CD1   1 
ATOM   1497  C CD2   . LEU A 1 198 ? 3.122   48.680  22.990  1.00 25.24 ? 198  LEU A CD2   1 
ATOM   1498  N N     . LYS A 1 199 ? 6.503   52.623  24.657  1.00 25.46 ? 199  LYS A N     1 
ATOM   1499  C CA    . LYS A 1 199 ? 7.706   53.023  25.389  1.00 24.17 ? 199  LYS A CA    1 
ATOM   1500  C C     . LYS A 1 199 ? 7.378   53.707  26.723  1.00 23.56 ? 199  LYS A C     1 
ATOM   1501  O O     . LYS A 1 199 ? 8.003   53.434  27.750  1.00 22.65 ? 199  LYS A O     1 
ATOM   1502  C CB    . LYS A 1 199 ? 8.608   53.879  24.479  1.00 24.21 ? 199  LYS A CB    1 
ATOM   1503  C CG    . LYS A 1 199 ? 9.684   54.730  25.167  1.00 24.55 ? 199  LYS A CG    1 
ATOM   1504  C CD    . LYS A 1 199 ? 10.894  53.935  25.602  1.00 23.89 ? 199  LYS A CD    1 
ATOM   1505  C CE    . LYS A 1 199 ? 12.026  54.860  26.032  1.00 23.83 ? 199  LYS A CE    1 
ATOM   1506  N NZ    . LYS A 1 199 ? 11.635  55.795  27.130  1.00 23.71 ? 199  LYS A NZ    1 
ATOM   1507  N N     . LYS A 1 200 ? 6.381   54.578  26.717  1.00 23.31 ? 200  LYS A N     1 
ATOM   1508  C CA    . LYS A 1 200 ? 5.897   55.127  27.968  1.00 23.50 ? 200  LYS A CA    1 
ATOM   1509  C C     . LYS A 1 200 ? 5.553   54.034  28.988  1.00 23.34 ? 200  LYS A C     1 
ATOM   1510  O O     . LYS A 1 200 ? 5.957   54.123  30.150  1.00 23.39 ? 200  LYS A O     1 
ATOM   1511  C CB    . LYS A 1 200 ? 4.696   56.056  27.758  1.00 24.42 ? 200  LYS A CB    1 
ATOM   1512  C CG    . LYS A 1 200 ? 4.399   56.916  28.995  1.00 23.51 ? 200  LYS A CG    1 
ATOM   1513  C CD    . LYS A 1 200 ? 3.247   57.865  28.754  1.00 27.25 ? 200  LYS A CD    1 
ATOM   1514  C CE    . LYS A 1 200 ? 2.874   58.653  30.031  1.00 27.87 ? 200  LYS A CE    1 
ATOM   1515  N NZ    . LYS A 1 200 ? 4.020   59.455  30.609  1.00 29.12 ? 200  LYS A NZ    1 
ATOM   1516  N N     . ASN A 1 201 ? 4.784   53.034  28.551  1.00 23.28 ? 201  ASN A N     1 
ATOM   1517  C CA    . ASN A 1 201 ? 4.439   51.871  29.366  1.00 22.74 ? 201  ASN A CA    1 
ATOM   1518  C C     . ASN A 1 201 ? 5.690   51.188  29.893  1.00 22.95 ? 201  ASN A C     1 
ATOM   1519  O O     . ASN A 1 201 ? 5.724   50.747  31.039  1.00 22.79 ? 201  ASN A O     1 
ATOM   1520  C CB    . ASN A 1 201 ? 3.601   50.869  28.562  1.00 22.64 ? 201  ASN A CB    1 
ATOM   1521  C CG    . ASN A 1 201 ? 2.125   51.320  28.354  1.00 21.72 ? 201  ASN A CG    1 
ATOM   1522  O OD1   . ASN A 1 201 ? 1.690   52.351  28.859  1.00 19.17 ? 201  ASN A OD1   1 
ATOM   1523  N ND2   . ASN A 1 201 ? 1.369   50.524  27.602  1.00 17.16 ? 201  ASN A ND2   1 
ATOM   1524  N N     . VAL A 1 202 ? 6.726   51.102  29.056  1.00 23.35 ? 202  VAL A N     1 
ATOM   1525  C CA    . VAL A 1 202 ? 8.006   50.494  29.486  1.00 23.36 ? 202  VAL A CA    1 
ATOM   1526  C C     . VAL A 1 202 ? 8.610   51.339  30.605  1.00 23.58 ? 202  VAL A C     1 
ATOM   1527  O O     . VAL A 1 202 ? 8.991   50.806  31.655  1.00 23.91 ? 202  VAL A O     1 
ATOM   1528  C CB    . VAL A 1 202 ? 8.985   50.265  28.309  1.00 22.86 ? 202  VAL A CB    1 
ATOM   1529  C CG1   . VAL A 1 202 ? 10.339  49.817  28.797  1.00 22.90 ? 202  VAL A CG1   1 
ATOM   1530  C CG2   . VAL A 1 202 ? 8.440   49.208  27.405  1.00 23.76 ? 202  VAL A CG2   1 
ATOM   1531  N N     . ASP A 1 203 ? 8.644   52.653  30.389  1.00 23.50 ? 203  ASP A N     1 
ATOM   1532  C CA    . ASP A 1 203 ? 9.116   53.608  31.387  1.00 23.53 ? 203  ASP A CA    1 
ATOM   1533  C C     . ASP A 1 203 ? 8.471   53.358  32.725  1.00 23.42 ? 203  ASP A C     1 
ATOM   1534  O O     . ASP A 1 203 ? 9.167   53.266  33.752  1.00 23.48 ? 203  ASP A O     1 
ATOM   1535  C CB    . ASP A 1 203 ? 8.812   55.050  30.958  1.00 23.49 ? 203  ASP A CB    1 
ATOM   1536  C CG    . ASP A 1 203 ? 9.775   55.567  29.893  1.00 24.45 ? 203  ASP A CG    1 
ATOM   1537  O OD1   . ASP A 1 203 ? 10.797  54.891  29.586  1.00 21.59 ? 203  ASP A OD1   1 
ATOM   1538  O OD2   . ASP A 1 203 ? 9.489   56.668  29.364  1.00 26.14 ? 203  ASP A OD2   1 
ATOM   1539  N N     . ASP A 1 204 ? 7.142   53.261  32.703  1.00 23.20 ? 204  ASP A N     1 
ATOM   1540  C CA    . ASP A 1 204 ? 6.342   53.070  33.916  1.00 23.49 ? 204  ASP A CA    1 
ATOM   1541  C C     . ASP A 1 204 ? 6.622   51.759  34.617  1.00 23.32 ? 204  ASP A C     1 
ATOM   1542  O O     . ASP A 1 204 ? 6.749   51.727  35.843  1.00 23.85 ? 204  ASP A O     1 
ATOM   1543  C CB    . ASP A 1 204 ? 4.857   53.223  33.616  1.00 23.75 ? 204  ASP A CB    1 
ATOM   1544  C CG    . ASP A 1 204 ? 4.468   54.670  33.356  1.00 24.59 ? 204  ASP A CG    1 
ATOM   1545  O OD1   . ASP A 1 204 ? 3.347   54.909  32.863  1.00 27.02 ? 204  ASP A OD1   1 
ATOM   1546  O OD2   . ASP A 1 204 ? 5.289   55.563  33.641  1.00 22.54 ? 204  ASP A OD2   1 
ATOM   1547  N N     . ALA A 1 205 ? 6.756   50.703  33.819  1.00 23.20 ? 205  ALA A N     1 
ATOM   1548  C CA    . ALA A 1 205 ? 7.152   49.374  34.264  1.00 23.18 ? 205  ALA A CA    1 
ATOM   1549  C C     . ALA A 1 205 ? 8.463   49.375  35.034  1.00 23.61 ? 205  ALA A C     1 
ATOM   1550  O O     . ALA A 1 205 ? 8.554   48.801  36.131  1.00 23.59 ? 205  ALA A O     1 
ATOM   1551  C CB    . ALA A 1 205 ? 7.242   48.435  33.061  1.00 22.50 ? 205  ALA A CB    1 
ATOM   1552  N N     . LEU A 1 206 ? 9.468   50.037  34.462  1.00 24.41 ? 206  LEU A N     1 
ATOM   1553  C CA    . LEU A 1 206 ? 10.837  49.986  34.973  1.00 25.20 ? 206  LEU A CA    1 
ATOM   1554  C C     . LEU A 1 206 ? 11.045  50.812  36.244  1.00 26.08 ? 206  LEU A C     1 
ATOM   1555  O O     . LEU A 1 206 ? 12.044  50.651  36.951  1.00 25.83 ? 206  LEU A O     1 
ATOM   1556  C CB    . LEU A 1 206 ? 11.818  50.384  33.874  1.00 25.17 ? 206  LEU A CB    1 
ATOM   1557  C CG    . LEU A 1 206 ? 11.828  49.446  32.653  1.00 25.85 ? 206  LEU A CG    1 
ATOM   1558  C CD1   . LEU A 1 206 ? 12.951  49.809  31.709  1.00 26.32 ? 206  LEU A CD1   1 
ATOM   1559  C CD2   . LEU A 1 206 ? 11.931  47.975  33.034  1.00 25.98 ? 206  LEU A CD2   1 
ATOM   1560  N N     . LYS A 1 207 ? 10.074  51.671  36.534  1.00 27.00 ? 207  LYS A N     1 
ATOM   1561  C CA    . LYS A 1 207 ? 9.998   52.398  37.793  1.00 28.22 ? 207  LYS A CA    1 
ATOM   1562  C C     . LYS A 1 207 ? 9.625   51.481  38.975  1.00 28.27 ? 207  LYS A C     1 
ATOM   1563  O O     . LYS A 1 207 ? 9.878   51.817  40.126  1.00 28.01 ? 207  LYS A O     1 
ATOM   1564  C CB    . LYS A 1 207 ? 8.998   53.559  37.658  1.00 29.01 ? 207  LYS A CB    1 
ATOM   1565  C CG    . LYS A 1 207 ? 9.615   54.832  37.041  1.00 30.11 ? 207  LYS A CG    1 
ATOM   1566  C CD    . LYS A 1 207 ? 8.571   55.662  36.287  1.00 32.35 ? 207  LYS A CD    1 
ATOM   1567  C CE    . LYS A 1 207 ? 9.103   57.072  35.957  1.00 33.21 ? 207  LYS A CE    1 
ATOM   1568  N NZ    . LYS A 1 207 ? 8.419   57.714  34.771  1.00 33.63 ? 207  LYS A NZ    1 
ATOM   1569  N N     . ASN A 1 208 ? 9.022   50.329  38.688  1.00 28.43 ? 208  ASN A N     1 
ATOM   1570  C CA    . ASN A 1 208 ? 8.742   49.350  39.731  1.00 28.47 ? 208  ASN A CA    1 
ATOM   1571  C C     . ASN A 1 208 ? 10.049  48.947  40.404  1.00 28.75 ? 208  ASN A C     1 
ATOM   1572  O O     . ASN A 1 208 ? 10.984  48.509  39.726  1.00 28.92 ? 208  ASN A O     1 
ATOM   1573  C CB    . ASN A 1 208 ? 7.997   48.129  39.175  1.00 28.13 ? 208  ASN A CB    1 
ATOM   1574  C CG    . ASN A 1 208 ? 7.663   47.093  40.257  1.00 27.83 ? 208  ASN A CG    1 
ATOM   1575  O OD1   . ASN A 1 208 ? 8.528   46.700  41.037  1.00 29.33 ? 208  ASN A OD1   1 
ATOM   1576  N ND2   . ASN A 1 208 ? 6.406   46.640  40.292  1.00 24.26 ? 208  ASN A ND2   1 
ATOM   1577  N N     . PRO A 1 209 ? 10.111  49.091  41.743  1.00 29.08 ? 209  PRO A N     1 
ATOM   1578  C CA    . PRO A 1 209 ? 11.359  48.911  42.478  1.00 28.93 ? 209  PRO A CA    1 
ATOM   1579  C C     . PRO A 1 209 ? 11.871  47.482  42.394  1.00 28.95 ? 209  PRO A C     1 
ATOM   1580  O O     . PRO A 1 209 ? 13.077  47.256  42.430  1.00 28.54 ? 209  PRO A O     1 
ATOM   1581  C CB    . PRO A 1 209 ? 10.976  49.270  43.924  1.00 28.90 ? 209  PRO A CB    1 
ATOM   1582  C CG    . PRO A 1 209 ? 9.503   49.062  44.015  1.00 28.77 ? 209  PRO A CG    1 
ATOM   1583  C CD    . PRO A 1 209 ? 8.984   49.424  42.644  1.00 29.48 ? 209  PRO A CD    1 
ATOM   1584  N N     . ASN A 1 210 ? 10.967  46.518  42.269  1.00 29.16 ? 210  ASN A N     1 
ATOM   1585  C CA    . ASN A 1 210 ? 11.411  45.127  42.158  1.00 29.69 ? 210  ASN A CA    1 
ATOM   1586  C C     . ASN A 1 210 ? 12.036  44.776  40.787  1.00 29.52 ? 210  ASN A C     1 
ATOM   1587  O O     . ASN A 1 210 ? 12.599  43.702  40.639  1.00 29.36 ? 210  ASN A O     1 
ATOM   1588  C CB    . ASN A 1 210 ? 10.303  44.139  42.552  1.00 29.79 ? 210  ASN A CB    1 
ATOM   1589  C CG    . ASN A 1 210 ? 9.671   44.468  43.896  1.00 30.76 ? 210  ASN A CG    1 
ATOM   1590  O OD1   . ASN A 1 210 ? 10.354  44.747  44.891  1.00 31.66 ? 210  ASN A OD1   1 
ATOM   1591  N ND2   . ASN A 1 210 ? 8.352   44.453  43.926  1.00 32.67 ? 210  ASN A ND2   1 
ATOM   1592  N N     . VAL A 1 211 ? 11.957  45.685  39.813  1.00 29.21 ? 211  VAL A N     1 
ATOM   1593  C CA    . VAL A 1 211 ? 12.619  45.472  38.531  1.00 29.76 ? 211  VAL A CA    1 
ATOM   1594  C C     . VAL A 1 211 ? 14.094  45.855  38.655  1.00 29.59 ? 211  VAL A C     1 
ATOM   1595  O O     . VAL A 1 211 ? 14.419  47.027  38.905  1.00 29.55 ? 211  VAL A O     1 
ATOM   1596  C CB    . VAL A 1 211 ? 11.956  46.263  37.379  1.00 30.36 ? 211  VAL A CB    1 
ATOM   1597  C CG1   . VAL A 1 211 ? 12.786  46.149  36.080  1.00 30.58 ? 211  VAL A CG1   1 
ATOM   1598  C CG2   . VAL A 1 211 ? 10.530  45.772  37.136  1.00 30.52 ? 211  VAL A CG2   1 
ATOM   1599  N N     . THR A 1 212 ? 14.974  44.863  38.485  1.00 29.19 ? 212  THR A N     1 
ATOM   1600  C CA    . THR A 1 212 ? 16.392  45.019  38.813  1.00 29.02 ? 212  THR A CA    1 
ATOM   1601  C C     . THR A 1 212 ? 17.362  44.501  37.736  1.00 29.38 ? 212  THR A C     1 
ATOM   1602  O O     . THR A 1 212 ? 18.584  44.654  37.866  1.00 28.83 ? 212  THR A O     1 
ATOM   1603  C CB    . THR A 1 212 ? 16.745  44.360  40.206  1.00 28.67 ? 212  THR A CB    1 
ATOM   1604  O OG1   . THR A 1 212 ? 16.434  42.966  40.193  1.00 27.78 ? 212  THR A OG1   1 
ATOM   1605  C CG2   . THR A 1 212 ? 15.977  45.007  41.337  1.00 28.63 ? 212  THR A CG2   1 
ATOM   1606  N N     . SER A 1 213 ? 16.823  43.886  36.685  1.00 29.79 ? 213  SER A N     1 
ATOM   1607  C CA    . SER A 1 213 ? 17.642  43.108  35.756  1.00 29.99 ? 213  SER A CA    1 
ATOM   1608  C C     . SER A 1 213 ? 17.859  43.807  34.420  1.00 30.52 ? 213  SER A C     1 
ATOM   1609  O O     . SER A 1 213 ? 18.684  43.371  33.602  1.00 30.97 ? 213  SER A O     1 
ATOM   1610  C CB    . SER A 1 213 ? 16.999  41.743  35.521  1.00 30.05 ? 213  SER A CB    1 
ATOM   1611  O OG    . SER A 1 213 ? 15.658  41.881  35.076  1.00 29.22 ? 213  SER A OG    1 
ATOM   1612  N N     . VAL A 1 214 ? 17.114  44.885  34.197  1.00 30.69 ? 214  VAL A N     1 
ATOM   1613  C CA    . VAL A 1 214 ? 17.075  45.519  32.887  1.00 30.64 ? 214  VAL A CA    1 
ATOM   1614  C C     . VAL A 1 214 ? 18.209  46.502  32.773  1.00 30.75 ? 214  VAL A C     1 
ATOM   1615  O O     . VAL A 1 214 ? 18.282  47.467  33.534  1.00 30.93 ? 214  VAL A O     1 
ATOM   1616  C CB    . VAL A 1 214 ? 15.695  46.180  32.576  1.00 30.74 ? 214  VAL A CB    1 
ATOM   1617  C CG1   . VAL A 1 214 ? 15.774  47.092  31.331  1.00 30.75 ? 214  VAL A CG1   1 
ATOM   1618  C CG2   . VAL A 1 214 ? 14.661  45.112  32.354  1.00 29.15 ? 214  VAL A CG2   1 
ATOM   1619  N N     . GLU A 1 215 ? 19.089  46.243  31.813  1.00 30.73 ? 215  GLU A N     1 
ATOM   1620  C CA    . GLU A 1 215 ? 20.271  47.069  31.596  1.00 31.47 ? 215  GLU A CA    1 
ATOM   1621  C C     . GLU A 1 215 ? 20.021  48.157  30.558  1.00 30.26 ? 215  GLU A C     1 
ATOM   1622  O O     . GLU A 1 215 ? 20.531  49.279  30.675  1.00 29.86 ? 215  GLU A O     1 
ATOM   1623  C CB    . GLU A 1 215 ? 21.463  46.185  31.211  1.00 31.03 ? 215  GLU A CB    1 
ATOM   1624  C CG    . GLU A 1 215 ? 22.088  45.477  32.428  1.00 34.01 ? 215  GLU A CG    1 
ATOM   1625  C CD    . GLU A 1 215 ? 23.003  44.292  32.071  1.00 35.02 ? 215  GLU A CD    1 
ATOM   1626  O OE1   . GLU A 1 215 ? 23.170  43.411  32.952  1.00 39.40 ? 215  GLU A OE1   1 
ATOM   1627  O OE2   . GLU A 1 215 ? 23.544  44.233  30.931  1.00 37.48 ? 215  GLU A OE2   1 
ATOM   1628  N N     . HIS A 1 216 ? 19.226  47.819  29.547  1.00 29.12 ? 216  HIS A N     1 
ATOM   1629  C CA    . HIS A 1 216 ? 18.959  48.722  28.444  1.00 28.53 ? 216  HIS A CA    1 
ATOM   1630  C C     . HIS A 1 216 ? 17.561  48.527  27.876  1.00 27.88 ? 216  HIS A C     1 
ATOM   1631  O O     . HIS A 1 216 ? 16.964  47.439  28.020  1.00 27.51 ? 216  HIS A O     1 
ATOM   1632  C CB    . HIS A 1 216 ? 19.950  48.491  27.313  1.00 28.75 ? 216  HIS A CB    1 
ATOM   1633  C CG    . HIS A 1 216 ? 21.355  48.844  27.655  1.00 29.66 ? 216  HIS A CG    1 
ATOM   1634  N ND1   . HIS A 1 216 ? 21.779  50.151  27.786  1.00 31.55 ? 216  HIS A ND1   1 
ATOM   1635  C CD2   . HIS A 1 216 ? 22.443  48.066  27.869  1.00 29.61 ? 216  HIS A CD2   1 
ATOM   1636  C CE1   . HIS A 1 216 ? 23.067  50.161  28.082  1.00 31.33 ? 216  HIS A CE1   1 
ATOM   1637  N NE2   . HIS A 1 216 ? 23.492  48.909  28.135  1.00 31.34 ? 216  HIS A NE2   1 
ATOM   1638  N N     . VAL A 1 217 ? 17.061  49.582  27.227  1.00 26.63 ? 217  VAL A N     1 
ATOM   1639  C CA    . VAL A 1 217 ? 15.850  49.500  26.420  1.00 26.04 ? 217  VAL A CA    1 
ATOM   1640  C C     . VAL A 1 217 ? 16.202  49.958  25.001  1.00 25.50 ? 217  VAL A C     1 
ATOM   1641  O O     . VAL A 1 217 ? 16.663  51.069  24.808  1.00 25.37 ? 217  VAL A O     1 
ATOM   1642  C CB    . VAL A 1 217 ? 14.660  50.360  26.998  1.00 26.17 ? 217  VAL A CB    1 
ATOM   1643  C CG1   . VAL A 1 217 ? 13.354  50.071  26.232  1.00 24.68 ? 217  VAL A CG1   1 
ATOM   1644  C CG2   . VAL A 1 217 ? 14.460  50.087  28.458  1.00 25.10 ? 217  VAL A CG2   1 
ATOM   1645  N N     . ILE A 1 218 ? 16.005  49.081  24.024  1.00 24.59 ? 218  ILE A N     1 
ATOM   1646  C CA    . ILE A 1 218 ? 16.144  49.432  22.627  1.00 23.75 ? 218  ILE A CA    1 
ATOM   1647  C C     . ILE A 1 218 ? 14.777  49.829  22.122  1.00 23.55 ? 218  ILE A C     1 
ATOM   1648  O O     . ILE A 1 218 ? 13.811  49.081  22.309  1.00 24.10 ? 218  ILE A O     1 
ATOM   1649  C CB    . ILE A 1 218 ? 16.650  48.225  21.815  1.00 24.14 ? 218  ILE A CB    1 
ATOM   1650  C CG1   . ILE A 1 218 ? 18.006  47.775  22.358  1.00 23.18 ? 218  ILE A CG1   1 
ATOM   1651  C CG2   . ILE A 1 218 ? 16.657  48.535  20.286  1.00 22.45 ? 218  ILE A CG2   1 
ATOM   1652  C CD1   . ILE A 1 218 ? 18.490  46.501  21.797  1.00 24.03 ? 218  ILE A CD1   1 
ATOM   1653  N N     . VAL A 1 219 ? 14.701  50.995  21.485  1.00 23.23 ? 219  VAL A N     1 
ATOM   1654  C CA    . VAL A 1 219 ? 13.429  51.593  21.027  1.00 23.20 ? 219  VAL A CA    1 
ATOM   1655  C C     . VAL A 1 219 ? 13.392  51.808  19.520  1.00 23.72 ? 219  VAL A C     1 
ATOM   1656  O O     . VAL A 1 219 ? 14.245  52.536  18.977  1.00 24.45 ? 219  VAL A O     1 
ATOM   1657  C CB    . VAL A 1 219 ? 13.199  52.988  21.634  1.00 22.84 ? 219  VAL A CB    1 
ATOM   1658  C CG1   . VAL A 1 219 ? 11.826  53.506  21.247  1.00 23.27 ? 219  VAL A CG1   1 
ATOM   1659  C CG2   . VAL A 1 219 ? 13.376  52.968  23.158  1.00 22.24 ? 219  VAL A CG2   1 
ATOM   1660  N N     . LEU A 1 220 ? 12.414  51.192  18.848  1.00 23.41 ? 220  LEU A N     1 
ATOM   1661  C CA    . LEU A 1 220 ? 12.122  51.519  17.455  1.00 23.44 ? 220  LEU A CA    1 
ATOM   1662  C C     . LEU A 1 220 ? 11.306  52.836  17.316  1.00 24.42 ? 220  LEU A C     1 
ATOM   1663  O O     . LEU A 1 220 ? 10.223  52.990  17.902  1.00 23.63 ? 220  LEU A O     1 
ATOM   1664  C CB    . LEU A 1 220 ? 11.431  50.356  16.754  1.00 22.62 ? 220  LEU A CB    1 
ATOM   1665  C CG    . LEU A 1 220 ? 11.005  50.522  15.293  1.00 23.58 ? 220  LEU A CG    1 
ATOM   1666  C CD1   . LEU A 1 220 ? 12.197  50.623  14.327  1.00 24.19 ? 220  LEU A CD1   1 
ATOM   1667  C CD2   . LEU A 1 220 ? 10.100  49.369  14.872  1.00 22.93 ? 220  LEU A CD2   1 
ATOM   1668  N N     . LYS A 1 221 ? 11.873  53.787  16.558  1.00 25.52 ? 221  LYS A N     1 
ATOM   1669  C CA    . LYS A 1 221 ? 11.172  55.012  16.158  1.00 26.15 ? 221  LYS A CA    1 
ATOM   1670  C C     . LYS A 1 221 ? 10.111  54.695  15.083  1.00 26.45 ? 221  LYS A C     1 
ATOM   1671  O O     . LYS A 1 221 ? 10.366  54.774  13.871  1.00 25.92 ? 221  LYS A O     1 
ATOM   1672  C CB    . LYS A 1 221 ? 12.153  56.079  15.681  1.00 25.55 ? 221  LYS A CB    1 
ATOM   1673  C CG    . LYS A 1 221 ? 11.545  57.478  15.628  1.00 27.44 ? 221  LYS A CG    1 
ATOM   1674  C CD    . LYS A 1 221 ? 12.590  58.538  15.302  1.00 31.27 ? 221  LYS A CD    1 
ATOM   1675  C CE    . LYS A 1 221 ? 13.144  59.225  16.556  1.00 33.20 ? 221  LYS A CE    1 
ATOM   1676  N NZ    . LYS A 1 221 ? 14.620  59.547  16.389  1.00 35.92 ? 221  LYS A NZ    1 
ATOM   1677  N N     . ARG A 1 222 ? 8.927   54.309  15.548  1.00 26.83 ? 222  ARG A N     1 
ATOM   1678  C CA    . ARG A 1 222 ? 7.860   53.891  14.641  1.00 27.66 ? 222  ARG A CA    1 
ATOM   1679  C C     . ARG A 1 222 ? 7.024   55.082  14.180  1.00 28.21 ? 222  ARG A C     1 
ATOM   1680  O O     . ARG A 1 222 ? 6.713   55.179  13.001  1.00 28.03 ? 222  ARG A O     1 
ATOM   1681  C CB    . ARG A 1 222 ? 6.979   52.812  15.290  1.00 27.38 ? 222  ARG A CB    1 
ATOM   1682  C CG    . ARG A 1 222 ? 5.661   52.577  14.603  1.00 27.85 ? 222  ARG A CG    1 
ATOM   1683  C CD    . ARG A 1 222 ? 5.855   51.958  13.241  1.00 29.56 ? 222  ARG A CD    1 
ATOM   1684  N NE    . ARG A 1 222 ? 4.603   51.916  12.506  1.00 29.64 ? 222  ARG A NE    1 
ATOM   1685  C CZ    . ARG A 1 222 ? 4.216   52.830  11.623  1.00 31.21 ? 222  ARG A CZ    1 
ATOM   1686  N NH1   . ARG A 1 222 ? 4.999   53.880  11.356  1.00 29.95 ? 222  ARG A NH1   1 
ATOM   1687  N NH2   . ARG A 1 222 ? 3.040   52.692  11.012  1.00 28.69 ? 222  ARG A NH2   1 
ATOM   1688  N N     . THR A 1 223 ? 6.663   55.971  15.114  1.00 29.00 ? 223  THR A N     1 
ATOM   1689  C CA    . THR A 1 223 ? 5.814   57.123  14.808  1.00 29.93 ? 223  THR A CA    1 
ATOM   1690  C C     . THR A 1 223 ? 6.571   58.441  14.847  1.00 30.71 ? 223  THR A C     1 
ATOM   1691  O O     . THR A 1 223 ? 6.166   59.424  14.203  1.00 30.59 ? 223  THR A O     1 
ATOM   1692  C CB    . THR A 1 223 ? 4.607   57.237  15.762  1.00 30.04 ? 223  THR A CB    1 
ATOM   1693  O OG1   . THR A 1 223 ? 5.075   57.325  17.115  1.00 29.45 ? 223  THR A OG1   1 
ATOM   1694  C CG2   . THR A 1 223 ? 3.671   56.036  15.594  1.00 29.29 ? 223  THR A CG2   1 
ATOM   1695  N N     . GLY A 1 224 ? 7.661   58.453  15.611  1.00 31.27 ? 224  GLY A N     1 
ATOM   1696  C CA    . GLY A 1 224 ? 8.470   59.650  15.788  1.00 32.05 ? 224  GLY A CA    1 
ATOM   1697  C C     . GLY A 1 224 ? 7.830   60.609  16.767  1.00 32.42 ? 224  GLY A C     1 
ATOM   1698  O O     . GLY A 1 224 ? 8.054   61.808  16.698  1.00 32.70 ? 224  GLY A O     1 
ATOM   1699  N N     . SER A 1 225 ? 7.042   60.067  17.686  1.00 32.92 ? 225  SER A N     1 
ATOM   1700  C CA    . SER A 1 225 ? 6.441   60.835  18.765  1.00 33.16 ? 225  SER A CA    1 
ATOM   1701  C C     . SER A 1 225 ? 7.400   61.309  19.851  1.00 33.26 ? 225  SER A C     1 
ATOM   1702  O O     . SER A 1 225 ? 8.429   60.686  20.102  1.00 33.32 ? 225  SER A O     1 
ATOM   1703  C CB    . SER A 1 225 ? 5.318   60.032  19.407  1.00 33.13 ? 225  SER A CB    1 
ATOM   1704  O OG    . SER A 1 225 ? 4.114   60.386  18.772  1.00 33.39 ? 225  SER A OG    1 
ATOM   1705  N N     . ASP A 1 226 ? 7.038   62.429  20.483  1.00 33.42 ? 226  ASP A N     1 
ATOM   1706  C CA    . ASP A 1 226 ? 7.738   62.936  21.643  1.00 33.66 ? 226  ASP A CA    1 
ATOM   1707  C C     . ASP A 1 226 ? 7.633   61.894  22.725  1.00 32.98 ? 226  ASP A C     1 
ATOM   1708  O O     . ASP A 1 226 ? 6.520   61.568  23.156  1.00 33.03 ? 226  ASP A O     1 
ATOM   1709  C CB    . ASP A 1 226 ? 7.096   64.234  22.139  1.00 34.35 ? 226  ASP A CB    1 
ATOM   1710  C CG    . ASP A 1 226 ? 7.603   65.452  21.396  1.00 36.69 ? 226  ASP A CG    1 
ATOM   1711  O OD1   . ASP A 1 226 ? 7.937   65.310  20.188  1.00 40.24 ? 226  ASP A OD1   1 
ATOM   1712  O OD2   . ASP A 1 226 ? 7.659   66.544  22.015  1.00 35.82 ? 226  ASP A OD2   1 
ATOM   1713  N N     . ILE A 1 227 ? 8.780   61.355  23.137  1.00 31.98 ? 227  ILE A N     1 
ATOM   1714  C CA    . ILE A 1 227 ? 8.832   60.415  24.271  1.00 31.07 ? 227  ILE A CA    1 
ATOM   1715  C C     . ILE A 1 227 ? 9.928   60.828  25.217  1.00 30.67 ? 227  ILE A C     1 
ATOM   1716  O O     . ILE A 1 227 ? 10.888  61.492  24.814  1.00 31.03 ? 227  ILE A O     1 
ATOM   1717  C CB    . ILE A 1 227 ? 9.070   58.933  23.845  1.00 30.71 ? 227  ILE A CB    1 
ATOM   1718  C CG1   . ILE A 1 227 ? 10.442  58.764  23.168  1.00 30.82 ? 227  ILE A CG1   1 
ATOM   1719  C CG2   . ILE A 1 227 ? 7.909   58.422  22.997  1.00 30.06 ? 227  ILE A CG2   1 
ATOM   1720  C CD1   . ILE A 1 227 ? 10.795  57.342  22.735  1.00 30.61 ? 227  ILE A CD1   1 
ATOM   1721  N N     . ASP A 1 228 ? 9.785   60.434  26.473  1.00 29.91 ? 228  ASP A N     1 
ATOM   1722  C CA    . ASP A 1 228 ? 10.853  60.591  27.440  1.00 29.30 ? 228  ASP A CA    1 
ATOM   1723  C C     . ASP A 1 228 ? 12.027  59.662  27.131  1.00 28.49 ? 228  ASP A C     1 
ATOM   1724  O O     . ASP A 1 228 ? 11.842  58.536  26.706  1.00 28.15 ? 228  ASP A O     1 
ATOM   1725  C CB    . ASP A 1 228 ? 10.302  60.386  28.850  1.00 29.68 ? 228  ASP A CB    1 
ATOM   1726  C CG    . ASP A 1 228 ? 9.127   61.312  29.139  1.00 30.70 ? 228  ASP A CG    1 
ATOM   1727  O OD1   . ASP A 1 228 ? 8.083   60.824  29.621  1.00 30.89 ? 228  ASP A OD1   1 
ATOM   1728  O OD2   . ASP A 1 228 ? 9.244   62.528  28.844  1.00 31.73 ? 228  ASP A OD2   1 
ATOM   1729  N N     . TRP A 1 229 ? 13.235  60.167  27.313  1.00 28.03 ? 229  TRP A N     1 
ATOM   1730  C CA    . TRP A 1 229 ? 14.435  59.405  27.040  1.00 28.05 ? 229  TRP A CA    1 
ATOM   1731  C C     . TRP A 1 229 ? 15.292  59.312  28.303  1.00 28.16 ? 229  TRP A C     1 
ATOM   1732  O O     . TRP A 1 229 ? 15.526  60.315  28.979  1.00 26.99 ? 229  TRP A O     1 
ATOM   1733  C CB    . TRP A 1 229 ? 15.217  60.065  25.899  1.00 27.62 ? 229  TRP A CB    1 
ATOM   1734  C CG    . TRP A 1 229 ? 16.138  59.141  25.163  1.00 27.15 ? 229  TRP A CG    1 
ATOM   1735  C CD1   . TRP A 1 229 ? 17.504  59.156  25.179  1.00 26.41 ? 229  TRP A CD1   1 
ATOM   1736  C CD2   . TRP A 1 229 ? 15.759  58.067  24.287  1.00 27.60 ? 229  TRP A CD2   1 
ATOM   1737  N NE1   . TRP A 1 229 ? 18.001  58.151  24.380  1.00 25.91 ? 229  TRP A NE1   1 
ATOM   1738  C CE2   . TRP A 1 229 ? 16.957  57.471  23.815  1.00 26.90 ? 229  TRP A CE2   1 
ATOM   1739  C CE3   . TRP A 1 229 ? 14.523  57.546  23.856  1.00 25.71 ? 229  TRP A CE3   1 
ATOM   1740  C CZ2   . TRP A 1 229 ? 16.957  56.380  22.936  1.00 27.56 ? 229  TRP A CZ2   1 
ATOM   1741  C CZ3   . TRP A 1 229 ? 14.525  56.469  22.988  1.00 26.07 ? 229  TRP A CZ3   1 
ATOM   1742  C CH2   . TRP A 1 229 ? 15.736  55.891  22.536  1.00 26.91 ? 229  TRP A CH2   1 
ATOM   1743  N N     . GLN A 1 230 ? 15.725  58.099  28.637  1.00 29.06 ? 230  GLN A N     1 
ATOM   1744  C CA    . GLN A 1 230 ? 16.739  57.921  29.698  1.00 29.95 ? 230  GLN A CA    1 
ATOM   1745  C C     . GLN A 1 230 ? 18.137  57.656  29.112  1.00 30.09 ? 230  GLN A C     1 
ATOM   1746  O O     . GLN A 1 230 ? 18.437  56.564  28.609  1.00 29.96 ? 230  GLN A O     1 
ATOM   1747  C CB    . GLN A 1 230 ? 16.341  56.844  30.708  1.00 29.64 ? 230  GLN A CB    1 
ATOM   1748  C CG    . GLN A 1 230 ? 17.266  56.776  31.918  1.00 30.02 ? 230  GLN A CG    1 
ATOM   1749  C CD    . GLN A 1 230 ? 16.711  55.906  33.033  1.00 31.31 ? 230  GLN A CD    1 
ATOM   1750  O OE1   . GLN A 1 230 ? 15.621  56.154  33.562  1.00 31.16 ? 230  GLN A OE1   1 
ATOM   1751  N NE2   . GLN A 1 230 ? 17.467  54.885  33.406  1.00 31.80 ? 230  GLN A NE2   1 
ATOM   1752  N N     . GLU A 1 231 ? 18.967  58.688  29.178  1.00 30.40 ? 231  GLU A N     1 
ATOM   1753  C CA    . GLU A 1 231 ? 20.340  58.665  28.669  1.00 31.08 ? 231  GLU A CA    1 
ATOM   1754  C C     . GLU A 1 231 ? 21.150  57.468  29.210  1.00 30.01 ? 231  GLU A C     1 
ATOM   1755  O O     . GLU A 1 231 ? 21.186  57.227  30.421  1.00 29.57 ? 231  GLU A O     1 
ATOM   1756  C CB    . GLU A 1 231 ? 21.030  60.001  29.034  1.00 31.52 ? 231  GLU A CB    1 
ATOM   1757  C CG    . GLU A 1 231 ? 21.866  60.623  27.925  1.00 34.84 ? 231  GLU A CG    1 
ATOM   1758  C CD    . GLU A 1 231 ? 21.102  60.761  26.601  1.00 39.14 ? 231  GLU A CD    1 
ATOM   1759  O OE1   . GLU A 1 231 ? 20.036  61.434  26.565  1.00 40.02 ? 231  GLU A OE1   1 
ATOM   1760  O OE2   . GLU A 1 231 ? 21.580  60.192  25.591  1.00 40.32 ? 231  GLU A OE2   1 
ATOM   1761  N N     . GLY A 1 232 ? 21.790  56.725  28.306  1.00 29.28 ? 232  GLY A N     1 
ATOM   1762  C CA    . GLY A 1 232 ? 22.587  55.551  28.690  1.00 27.77 ? 232  GLY A CA    1 
ATOM   1763  C C     . GLY A 1 232 ? 21.799  54.244  28.615  1.00 27.08 ? 232  GLY A C     1 
ATOM   1764  O O     . GLY A 1 232 ? 22.257  53.271  28.001  1.00 27.47 ? 232  GLY A O     1 
ATOM   1765  N N     . ARG A 1 233 ? 20.617  54.220  29.235  1.00 25.34 ? 233  ARG A N     1 
ATOM   1766  C CA    . ARG A 1 233 ? 19.752  53.046  29.216  1.00 24.03 ? 233  ARG A CA    1 
ATOM   1767  C C     . ARG A 1 233 ? 19.069  52.853  27.861  1.00 23.71 ? 233  ARG A C     1 
ATOM   1768  O O     . ARG A 1 233 ? 19.117  51.759  27.297  1.00 23.57 ? 233  ARG A O     1 
ATOM   1769  C CB    . ARG A 1 233 ? 18.703  53.139  30.315  1.00 23.57 ? 233  ARG A CB    1 
ATOM   1770  C CG    . ARG A 1 233 ? 17.831  51.898  30.475  1.00 22.79 ? 233  ARG A CG    1 
ATOM   1771  C CD    . ARG A 1 233 ? 16.657  52.224  31.376  1.00 22.62 ? 233  ARG A CD    1 
ATOM   1772  N NE    . ARG A 1 233 ? 15.684  53.006  30.629  1.00 22.27 ? 233  ARG A NE    1 
ATOM   1773  C CZ    . ARG A 1 233 ? 14.505  53.414  31.085  1.00 25.15 ? 233  ARG A CZ    1 
ATOM   1774  N NH1   . ARG A 1 233 ? 14.130  53.155  32.341  1.00 25.50 ? 233  ARG A NH1   1 
ATOM   1775  N NH2   . ARG A 1 233 ? 13.698  54.111  30.275  1.00 25.64 ? 233  ARG A NH2   1 
ATOM   1776  N N     . ASP A 1 234 ? 18.451  53.921  27.351  1.00 23.09 ? 234  ASP A N     1 
ATOM   1777  C CA    . ASP A 1 234 ? 17.653  53.872  26.133  1.00 22.61 ? 234  ASP A CA    1 
ATOM   1778  C C     . ASP A 1 234 ? 18.505  54.035  24.899  1.00 21.94 ? 234  ASP A C     1 
ATOM   1779  O O     . ASP A 1 234 ? 19.347  54.939  24.805  1.00 21.50 ? 234  ASP A O     1 
ATOM   1780  C CB    . ASP A 1 234 ? 16.570  54.967  26.125  1.00 23.10 ? 234  ASP A CB    1 
ATOM   1781  C CG    . ASP A 1 234 ? 15.575  54.826  27.258  1.00 24.52 ? 234  ASP A CG    1 
ATOM   1782  O OD1   . ASP A 1 234 ? 15.527  53.762  27.899  1.00 24.85 ? 234  ASP A OD1   1 
ATOM   1783  O OD2   . ASP A 1 234 ? 14.841  55.797  27.519  1.00 28.63 ? 234  ASP A OD2   1 
ATOM   1784  N N     . LEU A 1 235 ? 18.246  53.164  23.940  1.00 21.27 ? 235  LEU A N     1 
ATOM   1785  C CA    . LEU A 1 235 ? 18.927  53.165  22.662  1.00 21.36 ? 235  LEU A CA    1 
ATOM   1786  C C     . LEU A 1 235 ? 17.903  53.105  21.524  1.00 21.67 ? 235  LEU A C     1 
ATOM   1787  O O     . LEU A 1 235 ? 16.856  52.442  21.643  1.00 21.39 ? 235  LEU A O     1 
ATOM   1788  C CB    . LEU A 1 235 ? 19.888  51.973  22.580  1.00 20.80 ? 235  LEU A CB    1 
ATOM   1789  C CG    . LEU A 1 235 ? 20.899  51.830  23.723  1.00 21.47 ? 235  LEU A CG    1 
ATOM   1790  C CD1   . LEU A 1 235 ? 21.350  50.353  23.849  1.00 20.88 ? 235  LEU A CD1   1 
ATOM   1791  C CD2   . LEU A 1 235 ? 22.100  52.844  23.639  1.00 17.28 ? 235  LEU A CD2   1 
ATOM   1792  N N     . TRP A 1 236 ? 18.209  53.802  20.431  1.00 21.99 ? 236  TRP A N     1 
ATOM   1793  C CA    . TRP A 1 236 ? 17.384  53.747  19.232  1.00 22.47 ? 236  TRP A CA    1 
ATOM   1794  C C     . TRP A 1 236 ? 17.798  52.550  18.395  1.00 22.69 ? 236  TRP A C     1 
ATOM   1795  O O     . TRP A 1 236 ? 18.986  52.276  18.239  1.00 22.95 ? 236  TRP A O     1 
ATOM   1796  C CB    . TRP A 1 236 ? 17.506  55.016  18.392  1.00 22.48 ? 236  TRP A CB    1 
ATOM   1797  C CG    . TRP A 1 236 ? 16.861  56.214  18.982  1.00 22.26 ? 236  TRP A CG    1 
ATOM   1798  C CD1   . TRP A 1 236 ? 17.495  57.322  19.481  1.00 22.21 ? 236  TRP A CD1   1 
ATOM   1799  C CD2   . TRP A 1 236 ? 15.455  56.454  19.126  1.00 23.47 ? 236  TRP A CD2   1 
ATOM   1800  N NE1   . TRP A 1 236 ? 16.572  58.237  19.928  1.00 23.18 ? 236  TRP A NE1   1 
ATOM   1801  C CE2   . TRP A 1 236 ? 15.310  57.732  19.724  1.00 24.49 ? 236  TRP A CE2   1 
ATOM   1802  C CE3   . TRP A 1 236 ? 14.300  55.714  18.821  1.00 23.44 ? 236  TRP A CE3   1 
ATOM   1803  C CZ2   . TRP A 1 236 ? 14.053  58.289  20.012  1.00 22.89 ? 236  TRP A CZ2   1 
ATOM   1804  C CZ3   . TRP A 1 236 ? 13.052  56.270  19.111  1.00 23.30 ? 236  TRP A CZ3   1 
ATOM   1805  C CH2   . TRP A 1 236 ? 12.943  57.540  19.702  1.00 23.17 ? 236  TRP A CH2   1 
ATOM   1806  N N     . TRP A 1 237 ? 16.793  51.844  17.891  1.00 22.78 ? 237  TRP A N     1 
ATOM   1807  C CA    . TRP A 1 237 ? 16.952  50.694  17.002  1.00 22.89 ? 237  TRP A CA    1 
ATOM   1808  C C     . TRP A 1 237 ? 17.853  51.023  15.822  1.00 22.83 ? 237  TRP A C     1 
ATOM   1809  O O     . TRP A 1 237 ? 18.852  50.327  15.608  1.00 23.50 ? 237  TRP A O     1 
ATOM   1810  C CB    . TRP A 1 237 ? 15.567  50.247  16.510  1.00 22.54 ? 237  TRP A CB    1 
ATOM   1811  C CG    . TRP A 1 237 ? 15.575  49.059  15.591  1.00 23.31 ? 237  TRP A CG    1 
ATOM   1812  C CD1   . TRP A 1 237 ? 15.913  49.037  14.253  1.00 21.81 ? 237  TRP A CD1   1 
ATOM   1813  C CD2   . TRP A 1 237 ? 15.195  47.723  15.923  1.00 22.33 ? 237  TRP A CD2   1 
ATOM   1814  N NE1   . TRP A 1 237 ? 15.784  47.771  13.755  1.00 20.15 ? 237  TRP A NE1   1 
ATOM   1815  C CE2   . TRP A 1 237 ? 15.333  46.946  14.744  1.00 20.24 ? 237  TRP A CE2   1 
ATOM   1816  C CE3   . TRP A 1 237 ? 14.756  47.107  17.098  1.00 21.36 ? 237  TRP A CE3   1 
ATOM   1817  C CZ2   . TRP A 1 237 ? 15.067  45.593  14.713  1.00 21.45 ? 237  TRP A CZ2   1 
ATOM   1818  C CZ3   . TRP A 1 237 ? 14.463  45.762  17.065  1.00 21.72 ? 237  TRP A CZ3   1 
ATOM   1819  C CH2   . TRP A 1 237 ? 14.639  45.009  15.887  1.00 22.63 ? 237  TRP A CH2   1 
ATOM   1820  N N     . ARG A 1 238 ? 17.512  52.079  15.075  1.00 22.65 ? 238  ARG A N     1 
ATOM   1821  C CA    . ARG A 1 238 ? 18.258  52.455  13.877  1.00 22.74 ? 238  ARG A CA    1 
ATOM   1822  C C     . ARG A 1 238 ? 19.722  52.731  14.187  1.00 23.41 ? 238  ARG A C     1 
ATOM   1823  O O     . ARG A 1 238 ? 20.617  52.212  13.515  1.00 23.27 ? 238  ARG A O     1 
ATOM   1824  C CB    . ARG A 1 238 ? 17.647  53.678  13.168  1.00 22.54 ? 238  ARG A CB    1 
ATOM   1825  C CG    . ARG A 1 238 ? 18.388  53.986  11.856  1.00 22.04 ? 238  ARG A CG    1 
ATOM   1826  C CD    . ARG A 1 238 ? 17.740  54.984  10.891  1.00 23.29 ? 238  ARG A CD    1 
ATOM   1827  N NE    . ARG A 1 238 ? 18.780  55.460  9.969   1.00 23.78 ? 238  ARG A NE    1 
ATOM   1828  C CZ    . ARG A 1 238 ? 19.045  54.930  8.772   1.00 24.07 ? 238  ARG A CZ    1 
ATOM   1829  N NH1   . ARG A 1 238 ? 18.306  53.929  8.298   1.00 24.56 ? 238  ARG A NH1   1 
ATOM   1830  N NH2   . ARG A 1 238 ? 20.045  55.406  8.037   1.00 22.49 ? 238  ARG A NH2   1 
ATOM   1831  N N     . ASP A 1 239 ? 19.962  53.570  15.195  1.00 24.11 ? 239  ASP A N     1 
ATOM   1832  C CA    . ASP A 1 239 ? 21.316  53.922  15.591  1.00 24.54 ? 239  ASP A CA    1 
ATOM   1833  C C     . ASP A 1 239 ? 22.174  52.689  15.786  1.00 24.24 ? 239  ASP A C     1 
ATOM   1834  O O     . ASP A 1 239 ? 23.298  52.650  15.346  1.00 24.79 ? 239  ASP A O     1 
ATOM   1835  C CB    . ASP A 1 239 ? 21.287  54.767  16.867  1.00 25.26 ? 239  ASP A CB    1 
ATOM   1836  C CG    . ASP A 1 239 ? 20.815  56.195  16.610  1.00 27.83 ? 239  ASP A CG    1 
ATOM   1837  O OD1   . ASP A 1 239 ? 20.762  56.585  15.416  1.00 29.55 ? 239  ASP A OD1   1 
ATOM   1838  O OD2   . ASP A 1 239 ? 20.508  56.926  17.591  1.00 28.79 ? 239  ASP A OD2   1 
ATOM   1839  N N     . LEU A 1 240 ? 21.625  51.665  16.417  1.00 24.55 ? 240  LEU A N     1 
ATOM   1840  C CA    . LEU A 1 240 ? 22.386  50.474  16.758  1.00 24.91 ? 240  LEU A CA    1 
ATOM   1841  C C     . LEU A 1 240 ? 22.576  49.538  15.571  1.00 24.41 ? 240  LEU A C     1 
ATOM   1842  O O     . LEU A 1 240 ? 23.678  49.016  15.355  1.00 23.61 ? 240  LEU A O     1 
ATOM   1843  C CB    . LEU A 1 240 ? 21.674  49.700  17.862  1.00 25.33 ? 240  LEU A CB    1 
ATOM   1844  C CG    . LEU A 1 240 ? 21.666  50.268  19.274  1.00 27.00 ? 240  LEU A CG    1 
ATOM   1845  C CD1   . LEU A 1 240 ? 20.754  49.379  20.125  1.00 26.81 ? 240  LEU A CD1   1 
ATOM   1846  C CD2   . LEU A 1 240 ? 23.077  50.328  19.851  1.00 26.33 ? 240  LEU A CD2   1 
ATOM   1847  N N     . ILE A 1 241 ? 21.491  49.306  14.832  1.00 24.11 ? 241  ILE A N     1 
ATOM   1848  C CA    . ILE A 1 241 ? 21.512  48.329  13.738  1.00 24.01 ? 241  ILE A CA    1 
ATOM   1849  C C     . ILE A 1 241 ? 22.401  48.772  12.561  1.00 24.41 ? 241  ILE A C     1 
ATOM   1850  O O     . ILE A 1 241 ? 23.124  47.970  12.014  1.00 23.91 ? 241  ILE A O     1 
ATOM   1851  C CB    . ILE A 1 241 ? 20.076  47.909  13.302  1.00 24.23 ? 241  ILE A CB    1 
ATOM   1852  C CG1   . ILE A 1 241 ? 20.104  46.507  12.671  1.00 24.07 ? 241  ILE A CG1   1 
ATOM   1853  C CG2   . ILE A 1 241 ? 19.429  48.972  12.396  1.00 23.45 ? 241  ILE A CG2   1 
ATOM   1854  C CD1   . ILE A 1 241 ? 18.755  45.820  12.564  1.00 22.97 ? 241  ILE A CD1   1 
ATOM   1855  N N     . GLU A 1 242 ? 22.354  50.060  12.213  1.00 25.25 ? 242  GLU A N     1 
ATOM   1856  C CA    . GLU A 1 242 ? 23.260  50.672  11.247  1.00 26.12 ? 242  GLU A CA    1 
ATOM   1857  C C     . GLU A 1 242 ? 24.731  50.422  11.583  1.00 26.29 ? 242  GLU A C     1 
ATOM   1858  O O     . GLU A 1 242 ? 25.529  50.157  10.689  1.00 25.72 ? 242  GLU A O     1 
ATOM   1859  C CB    . GLU A 1 242 ? 22.998  52.189  11.136  1.00 26.61 ? 242  GLU A CB    1 
ATOM   1860  C CG    . GLU A 1 242 ? 21.670  52.545  10.429  1.00 28.31 ? 242  GLU A CG    1 
ATOM   1861  C CD    . GLU A 1 242 ? 21.415  51.716  9.154   1.00 30.60 ? 242  GLU A CD    1 
ATOM   1862  O OE1   . GLU A 1 242 ? 22.211  51.815  8.179   1.00 29.56 ? 242  GLU A OE1   1 
ATOM   1863  O OE2   . GLU A 1 242 ? 20.406  50.968  9.140   1.00 32.89 ? 242  GLU A OE2   1 
ATOM   1864  N N     . LYS A 1 243 ? 25.067  50.490  12.876  1.00 26.30 ? 243  LYS A N     1 
ATOM   1865  C CA    . LYS A 1 243 ? 26.425  50.225  13.351  1.00 26.34 ? 243  LYS A CA    1 
ATOM   1866  C C     . LYS A 1 243 ? 26.887  48.769  13.235  1.00 25.92 ? 243  LYS A C     1 
ATOM   1867  O O     . LYS A 1 243 ? 28.070  48.507  13.167  1.00 26.36 ? 243  LYS A O     1 
ATOM   1868  C CB    . LYS A 1 243 ? 26.579  50.701  14.795  1.00 26.54 ? 243  LYS A CB    1 
ATOM   1869  C CG    . LYS A 1 243 ? 26.879  52.197  14.925  1.00 28.05 ? 243  LYS A CG    1 
ATOM   1870  C CD    . LYS A 1 243 ? 26.739  52.649  16.376  1.00 28.82 ? 243  LYS A CD    1 
ATOM   1871  N N     . ALA A 1 244 ? 25.948  47.835  13.192  1.00 25.75 ? 244  ALA A N     1 
ATOM   1872  C CA    . ALA A 1 244 ? 26.227  46.408  13.307  1.00 25.32 ? 244  ALA A CA    1 
ATOM   1873  C C     . ALA A 1 244 ? 26.668  45.800  11.982  1.00 25.06 ? 244  ALA A C     1 
ATOM   1874  O O     . ALA A 1 244 ? 26.195  46.218  10.923  1.00 25.84 ? 244  ALA A O     1 
ATOM   1875  C CB    . ALA A 1 244 ? 24.982  45.680  13.843  1.00 24.42 ? 244  ALA A CB    1 
ATOM   1876  N N     . SER A 1 245 ? 27.562  44.812  12.048  1.00 24.64 ? 245  SER A N     1 
ATOM   1877  C CA    . SER A 1 245 ? 27.904  43.984  10.888  1.00 24.54 ? 245  SER A CA    1 
ATOM   1878  C C     . SER A 1 245 ? 26.733  43.155  10.335  1.00 24.59 ? 245  SER A C     1 
ATOM   1879  O O     . SER A 1 245 ? 25.980  42.516  11.095  1.00 23.69 ? 245  SER A O     1 
ATOM   1880  C CB    . SER A 1 245 ? 29.061  43.028  11.211  1.00 24.84 ? 245  SER A CB    1 
ATOM   1881  O OG    . SER A 1 245 ? 29.378  42.222  10.071  1.00 25.23 ? 245  SER A OG    1 
ATOM   1882  N N     . PRO A 1 246 ? 26.579  43.160  9.002   1.00 24.52 ? 246  PRO A N     1 
ATOM   1883  C CA    . PRO A 1 246 ? 25.629  42.268  8.342   1.00 24.88 ? 246  PRO A CA    1 
ATOM   1884  C C     . PRO A 1 246 ? 26.077  40.814  8.300   1.00 25.31 ? 246  PRO A C     1 
ATOM   1885  O O     . PRO A 1 246 ? 25.309  39.965  7.851   1.00 25.27 ? 246  PRO A O     1 
ATOM   1886  C CB    . PRO A 1 246 ? 25.529  42.838  6.918   1.00 24.71 ? 246  PRO A CB    1 
ATOM   1887  C CG    . PRO A 1 246 ? 26.799  43.529  6.696   1.00 23.90 ? 246  PRO A CG    1 
ATOM   1888  C CD    . PRO A 1 246 ? 27.245  44.057  8.047   1.00 24.60 ? 246  PRO A CD    1 
ATOM   1889  N N     . GLU A 1 247 ? 27.297  40.535  8.763   1.00 26.21 ? 247  GLU A N     1 
ATOM   1890  C CA    . GLU A 1 247 ? 27.842  39.168  8.748   1.00 27.30 ? 247  GLU A CA    1 
ATOM   1891  C C     . GLU A 1 247 ? 27.707  38.515  10.098  1.00 26.52 ? 247  GLU A C     1 
ATOM   1892  O O     . GLU A 1 247 ? 28.120  39.082  11.104  1.00 25.82 ? 247  GLU A O     1 
ATOM   1893  C CB    . GLU A 1 247 ? 29.319  39.143  8.345   1.00 27.62 ? 247  GLU A CB    1 
ATOM   1894  C CG    . GLU A 1 247 ? 29.660  39.987  7.129   1.00 32.10 ? 247  GLU A CG    1 
ATOM   1895  C CD    . GLU A 1 247 ? 29.097  39.414  5.853   1.00 35.76 ? 247  GLU A CD    1 
ATOM   1896  O OE1   . GLU A 1 247 ? 29.897  38.837  5.079   1.00 37.84 ? 247  GLU A OE1   1 
ATOM   1897  O OE2   . GLU A 1 247 ? 27.864  39.529  5.632   1.00 35.83 ? 247  GLU A OE2   1 
ATOM   1898  N N     . HIS A 1 248 ? 27.128  37.318  10.102  1.00 26.69 ? 248  HIS A N     1 
ATOM   1899  C CA    . HIS A 1 248 ? 26.976  36.546  11.329  1.00 27.05 ? 248  HIS A CA    1 
ATOM   1900  C C     . HIS A 1 248 ? 26.842  35.052  11.062  1.00 27.53 ? 248  HIS A C     1 
ATOM   1901  O O     . HIS A 1 248 ? 25.983  34.616  10.284  1.00 27.44 ? 248  HIS A O     1 
ATOM   1902  C CB    . HIS A 1 248 ? 25.796  37.056  12.164  1.00 26.79 ? 248  HIS A CB    1 
ATOM   1903  C CG    . HIS A 1 248 ? 25.710  36.428  13.515  1.00 26.33 ? 248  HIS A CG    1 
ATOM   1904  N ND1   . HIS A 1 248 ? 24.994  35.278  13.751  1.00 24.73 ? 248  HIS A ND1   1 
ATOM   1905  C CD2   . HIS A 1 248 ? 26.280  36.769  14.696  1.00 26.72 ? 248  HIS A CD2   1 
ATOM   1906  C CE1   . HIS A 1 248 ? 25.110  34.947  15.025  1.00 26.59 ? 248  HIS A CE1   1 
ATOM   1907  N NE2   . HIS A 1 248 ? 25.879  35.839  15.622  1.00 25.73 ? 248  HIS A NE2   1 
ATOM   1908  N N     . GLN A 1 249 ? 27.688  34.269  11.728  1.00 27.88 ? 249  GLN A N     1 
ATOM   1909  C CA    . GLN A 1 249 ? 27.639  32.821  11.582  1.00 28.77 ? 249  GLN A CA    1 
ATOM   1910  C C     . GLN A 1 249 ? 26.847  32.153  12.725  1.00 28.00 ? 249  GLN A C     1 
ATOM   1911  O O     . GLN A 1 249 ? 27.166  32.337  13.908  1.00 27.82 ? 249  GLN A O     1 
ATOM   1912  C CB    . GLN A 1 249 ? 29.050  32.226  11.424  1.00 29.46 ? 249  GLN A CB    1 
ATOM   1913  C CG    . GLN A 1 249 ? 29.976  32.955  10.398  1.00 34.12 ? 249  GLN A CG    1 
ATOM   1914  C CD    . GLN A 1 249 ? 29.289  33.331  9.044   1.00 40.74 ? 249  GLN A CD    1 
ATOM   1915  O OE1   . GLN A 1 249 ? 29.566  34.402  8.457   1.00 41.36 ? 249  GLN A OE1   1 
ATOM   1916  N NE2   . GLN A 1 249 ? 28.393  32.452  8.556   1.00 42.94 ? 249  GLN A NE2   1 
ATOM   1917  N N     . PRO A 1 250 ? 25.807  31.376  12.373  1.00 27.37 ? 250  PRO A N     1 
ATOM   1918  C CA    . PRO A 1 250 ? 24.995  30.769  13.420  1.00 27.63 ? 250  PRO A CA    1 
ATOM   1919  C C     . PRO A 1 250 ? 25.726  29.589  14.033  1.00 28.09 ? 250  PRO A C     1 
ATOM   1920  O O     . PRO A 1 250 ? 26.277  28.747  13.303  1.00 28.35 ? 250  PRO A O     1 
ATOM   1921  C CB    . PRO A 1 250 ? 23.726  30.322  12.685  1.00 27.39 ? 250  PRO A CB    1 
ATOM   1922  C CG    . PRO A 1 250 ? 24.163  30.086  11.272  1.00 27.44 ? 250  PRO A CG    1 
ATOM   1923  C CD    . PRO A 1 250 ? 25.359  30.992  11.019  1.00 27.46 ? 250  PRO A CD    1 
ATOM   1924  N N     . GLU A 1 251 ? 25.767  29.559  15.361  1.00 28.42 ? 251  GLU A N     1 
ATOM   1925  C CA    . GLU A 1 251 ? 26.396  28.472  16.096  1.00 28.98 ? 251  GLU A CA    1 
ATOM   1926  C C     . GLU A 1 251 ? 25.339  27.442  16.404  1.00 28.30 ? 251  GLU A C     1 
ATOM   1927  O O     . GLU A 1 251 ? 24.140  27.759  16.438  1.00 28.25 ? 251  GLU A O     1 
ATOM   1928  C CB    . GLU A 1 251 ? 26.989  28.981  17.405  1.00 29.72 ? 251  GLU A CB    1 
ATOM   1929  C CG    . GLU A 1 251 ? 28.387  29.561  17.301  1.00 33.63 ? 251  GLU A CG    1 
ATOM   1930  C CD    . GLU A 1 251 ? 28.662  30.520  18.439  1.00 39.79 ? 251  GLU A CD    1 
ATOM   1931  O OE1   . GLU A 1 251 ? 29.438  31.478  18.226  1.00 43.36 ? 251  GLU A OE1   1 
ATOM   1932  O OE2   . GLU A 1 251 ? 28.093  30.335  19.546  1.00 41.02 ? 251  GLU A OE2   1 
ATOM   1933  N N     . ALA A 1 252 ? 25.785  26.211  16.633  1.00 27.49 ? 252  ALA A N     1 
ATOM   1934  C CA    . ALA A 1 252 ? 24.878  25.116  16.965  1.00 26.40 ? 252  ALA A CA    1 
ATOM   1935  C C     . ALA A 1 252 ? 24.292  25.247  18.381  1.00 25.96 ? 252  ALA A C     1 
ATOM   1936  O O     . ALA A 1 252 ? 25.023  25.453  19.361  1.00 25.68 ? 252  ALA A O     1 
ATOM   1937  C CB    . ALA A 1 252 ? 25.595  23.788  16.792  1.00 26.22 ? 252  ALA A CB    1 
ATOM   1938  N N     . MET A 1 253 ? 22.972  25.135  18.464  1.00 24.90 ? 253  MET A N     1 
ATOM   1939  C CA    . MET A 1 253 ? 22.261  25.035  19.723  1.00 24.39 ? 253  MET A CA    1 
ATOM   1940  C C     . MET A 1 253 ? 21.860  23.576  19.872  1.00 24.66 ? 253  MET A C     1 
ATOM   1941  O O     . MET A 1 253 ? 21.618  22.908  18.865  1.00 24.22 ? 253  MET A O     1 
ATOM   1942  C CB    . MET A 1 253 ? 21.008  25.931  19.687  1.00 24.32 ? 253  MET A CB    1 
ATOM   1943  C CG    . MET A 1 253 ? 21.311  27.359  19.207  1.00 23.46 ? 253  MET A CG    1 
ATOM   1944  S SD    . MET A 1 253 ? 22.290  28.210  20.455  1.00 23.31 ? 253  MET A SD    1 
ATOM   1945  C CE    . MET A 1 253 ? 23.468  29.186  19.495  1.00 22.92 ? 253  MET A CE    1 
ATOM   1946  N N     . ASN A 1 254 ? 21.800  23.067  21.102  1.00 24.98 ? 254  ASN A N     1 
ATOM   1947  C CA    . ASN A 1 254 ? 21.235  21.735  21.309  1.00 25.93 ? 254  ASN A CA    1 
ATOM   1948  C C     . ASN A 1 254 ? 19.713  21.749  21.143  1.00 25.06 ? 254  ASN A C     1 
ATOM   1949  O O     . ASN A 1 254 ? 19.056  22.756  21.442  1.00 25.37 ? 254  ASN A O     1 
ATOM   1950  C CB    . ASN A 1 254 ? 21.609  21.152  22.681  1.00 26.72 ? 254  ASN A CB    1 
ATOM   1951  C CG    . ASN A 1 254 ? 23.093  21.275  22.980  1.00 30.88 ? 254  ASN A CG    1 
ATOM   1952  O OD1   . ASN A 1 254 ? 23.940  20.668  22.304  1.00 34.41 ? 254  ASN A OD1   1 
ATOM   1953  N ND2   . ASN A 1 254 ? 23.422  22.068  24.007  1.00 34.63 ? 254  ASN A ND2   1 
ATOM   1954  N N     . ALA A 1 255 ? 19.157  20.623  20.697  1.00 24.27 ? 255  ALA A N     1 
ATOM   1955  C CA    . ALA A 1 255 ? 17.709  20.490  20.512  1.00 23.75 ? 255  ALA A CA    1 
ATOM   1956  C C     . ALA A 1 255 ? 16.915  20.945  21.735  1.00 23.44 ? 255  ALA A C     1 
ATOM   1957  O O     . ALA A 1 255 ? 15.794  21.455  21.601  1.00 23.89 ? 255  ALA A O     1 
ATOM   1958  C CB    . ALA A 1 255 ? 17.339  19.065  20.141  1.00 23.35 ? 255  ALA A CB    1 
ATOM   1959  N N     . GLU A 1 256 ? 17.496  20.754  22.916  1.00 22.84 ? 256  GLU A N     1 
ATOM   1960  C CA    . GLU A 1 256 ? 16.806  21.033  24.180  1.00 22.01 ? 256  GLU A CA    1 
ATOM   1961  C C     . GLU A 1 256 ? 17.265  22.319  24.863  1.00 21.97 ? 256  GLU A C     1 
ATOM   1962  O O     . GLU A 1 256 ? 16.944  22.537  26.033  1.00 22.01 ? 256  GLU A O     1 
ATOM   1963  C CB    . GLU A 1 256 ? 16.888  19.834  25.144  1.00 21.67 ? 256  GLU A CB    1 
ATOM   1964  C CG    . GLU A 1 256 ? 16.103  18.590  24.687  1.00 20.36 ? 256  GLU A CG    1 
ATOM   1965  C CD    . GLU A 1 256 ? 14.591  18.788  24.660  1.00 19.58 ? 256  GLU A CD    1 
ATOM   1966  O OE1   . GLU A 1 256 ? 14.080  19.702  25.323  1.00 20.34 ? 256  GLU A OE1   1 
ATOM   1967  O OE2   . GLU A 1 256 ? 13.882  18.010  23.994  1.00 21.30 ? 256  GLU A OE2   1 
ATOM   1968  N N     . ASP A 1 257 ? 18.001  23.162  24.130  1.00 21.69 ? 257  ASP A N     1 
ATOM   1969  C CA    . ASP A 1 257 ? 18.289  24.524  24.566  1.00 22.08 ? 257  ASP A CA    1 
ATOM   1970  C C     . ASP A 1 257 ? 16.990  25.342  24.553  1.00 22.59 ? 257  ASP A C     1 
ATOM   1971  O O     . ASP A 1 257 ? 16.244  25.338  23.564  1.00 22.25 ? 257  ASP A O     1 
ATOM   1972  C CB    . ASP A 1 257 ? 19.336  25.217  23.668  1.00 21.89 ? 257  ASP A CB    1 
ATOM   1973  C CG    . ASP A 1 257 ? 20.777  24.776  23.956  1.00 21.81 ? 257  ASP A CG    1 
ATOM   1974  O OD1   . ASP A 1 257 ? 21.104  24.336  25.078  1.00 20.88 ? 257  ASP A OD1   1 
ATOM   1975  O OD2   . ASP A 1 257 ? 21.609  24.891  23.037  1.00 23.47 ? 257  ASP A OD2   1 
ATOM   1976  N N     . PRO A 1 258 ? 16.730  26.078  25.642  1.00 23.11 ? 258  PRO A N     1 
ATOM   1977  C CA    . PRO A 1 258 ? 15.456  26.806  25.755  1.00 22.93 ? 258  PRO A CA    1 
ATOM   1978  C C     . PRO A 1 258 ? 15.372  27.860  24.658  1.00 22.97 ? 258  PRO A C     1 
ATOM   1979  O O     . PRO A 1 258 ? 16.404  28.399  24.263  1.00 23.82 ? 258  PRO A O     1 
ATOM   1980  C CB    . PRO A 1 258 ? 15.508  27.424  27.160  1.00 23.18 ? 258  PRO A CB    1 
ATOM   1981  C CG    . PRO A 1 258 ? 17.017  27.443  27.559  1.00 23.97 ? 258  PRO A CG    1 
ATOM   1982  C CD    . PRO A 1 258 ? 17.643  26.279  26.791  1.00 23.35 ? 258  PRO A CD    1 
ATOM   1983  N N     . LEU A 1 259 ? 14.170  28.110  24.134  1.00 22.80 ? 259  LEU A N     1 
ATOM   1984  C CA    . LEU A 1 259 ? 13.982  28.947  22.933  1.00 22.65 ? 259  LEU A CA    1 
ATOM   1985  C C     . LEU A 1 259 ? 13.205  30.238  23.263  1.00 22.96 ? 259  LEU A C     1 
ATOM   1986  O O     . LEU A 1 259 ? 13.625  31.349  22.930  1.00 23.08 ? 259  LEU A O     1 
ATOM   1987  C CB    . LEU A 1 259 ? 13.242  28.159  21.822  1.00 22.33 ? 259  LEU A CB    1 
ATOM   1988  C CG    . LEU A 1 259 ? 12.870  28.949  20.543  1.00 23.06 ? 259  LEU A CG    1 
ATOM   1989  C CD1   . LEU A 1 259 ? 14.126  29.358  19.722  1.00 21.13 ? 259  LEU A CD1   1 
ATOM   1990  C CD2   . LEU A 1 259 ? 11.862  28.227  19.651  1.00 21.86 ? 259  LEU A CD2   1 
ATOM   1991  N N     . PHE A 1 260 ? 12.049  30.072  23.886  1.00 22.53 ? 260  PHE A N     1 
ATOM   1992  C CA    . PHE A 1 260 ? 11.312  31.197  24.355  1.00 22.70 ? 260  PHE A CA    1 
ATOM   1993  C C     . PHE A 1 260 ? 10.490  30.844  25.601  1.00 23.29 ? 260  PHE A C     1 
ATOM   1994  O O     . PHE A 1 260 ? 10.316  29.655  25.942  1.00 23.01 ? 260  PHE A O     1 
ATOM   1995  C CB    . PHE A 1 260 ? 10.465  31.814  23.219  1.00 23.08 ? 260  PHE A CB    1 
ATOM   1996  C CG    . PHE A 1 260 ? 9.358   30.925  22.700  1.00 22.80 ? 260  PHE A CG    1 
ATOM   1997  C CD1   . PHE A 1 260 ? 8.095   30.917  23.317  1.00 21.93 ? 260  PHE A CD1   1 
ATOM   1998  C CD2   . PHE A 1 260 ? 9.573   30.114  21.584  1.00 22.24 ? 260  PHE A CD2   1 
ATOM   1999  C CE1   . PHE A 1 260 ? 7.055   30.084  22.836  1.00 24.34 ? 260  PHE A CE1   1 
ATOM   2000  C CE2   . PHE A 1 260 ? 8.551   29.275  21.093  1.00 24.38 ? 260  PHE A CE2   1 
ATOM   2001  C CZ    . PHE A 1 260 ? 7.278   29.268  21.708  1.00 23.68 ? 260  PHE A CZ    1 
ATOM   2002  N N     . ILE A 1 261 ? 10.032  31.896  26.281  1.00 23.66 ? 261  ILE A N     1 
ATOM   2003  C CA    . ILE A 1 261 ? 9.085   31.820  27.393  1.00 24.40 ? 261  ILE A CA    1 
ATOM   2004  C C     . ILE A 1 261 ? 7.908   32.617  26.910  1.00 24.38 ? 261  ILE A C     1 
ATOM   2005  O O     . ILE A 1 261 ? 8.108   33.673  26.291  1.00 24.65 ? 261  ILE A O     1 
ATOM   2006  C CB    . ILE A 1 261 ? 9.563   32.624  28.664  1.00 24.50 ? 261  ILE A CB    1 
ATOM   2007  C CG1   . ILE A 1 261 ? 10.924  32.178  29.210  1.00 25.50 ? 261  ILE A CG1   1 
ATOM   2008  C CG2   . ILE A 1 261 ? 8.529   32.568  29.759  1.00 25.80 ? 261  ILE A CG2   1 
ATOM   2009  C CD1   . ILE A 1 261 ? 11.115  30.688  29.224  1.00 26.86 ? 261  ILE A CD1   1 
ATOM   2010  N N     . LEU A 1 262 ? 6.699   32.147  27.221  1.00 23.91 ? 262  LEU A N     1 
ATOM   2011  C CA    . LEU A 1 262 ? 5.486   32.933  27.067  1.00 23.75 ? 262  LEU A CA    1 
ATOM   2012  C C     . LEU A 1 262 ? 4.687   32.910  28.355  1.00 23.36 ? 262  LEU A C     1 
ATOM   2013  O O     . LEU A 1 262 ? 4.254   31.851  28.821  1.00 23.59 ? 262  LEU A O     1 
ATOM   2014  C CB    . LEU A 1 262 ? 4.601   32.402  25.921  1.00 23.88 ? 262  LEU A CB    1 
ATOM   2015  C CG    . LEU A 1 262 ? 4.607   33.170  24.597  1.00 24.91 ? 262  LEU A CG    1 
ATOM   2016  C CD1   . LEU A 1 262 ? 3.807   32.427  23.544  1.00 26.05 ? 262  LEU A CD1   1 
ATOM   2017  C CD2   . LEU A 1 262 ? 4.071   34.575  24.730  1.00 23.98 ? 262  LEU A CD2   1 
ATOM   2018  N N     . TYR A 1 263 ? 4.463   34.071  28.935  1.00 23.00 ? 263  TYR A N     1 
ATOM   2019  C CA    . TYR A 1 263 ? 3.582   34.091  30.082  1.00 23.79 ? 263  TYR A CA    1 
ATOM   2020  C C     . TYR A 1 263 ? 2.138   33.770  29.693  1.00 23.91 ? 263  TYR A C     1 
ATOM   2021  O O     . TYR A 1 263 ? 1.574   34.320  28.722  1.00 23.64 ? 263  TYR A O     1 
ATOM   2022  C CB    . TYR A 1 263 ? 3.763   35.352  30.918  1.00 23.73 ? 263  TYR A CB    1 
ATOM   2023  C CG    . TYR A 1 263 ? 5.092   35.280  31.634  1.00 24.00 ? 263  TYR A CG    1 
ATOM   2024  C CD1   . TYR A 1 263 ? 6.266   35.664  30.990  1.00 21.96 ? 263  TYR A CD1   1 
ATOM   2025  C CD2   . TYR A 1 263 ? 5.176   34.794  32.951  1.00 25.08 ? 263  TYR A CD2   1 
ATOM   2026  C CE1   . TYR A 1 263 ? 7.477   35.576  31.619  1.00 22.52 ? 263  TYR A CE1   1 
ATOM   2027  C CE2   . TYR A 1 263 ? 6.405   34.693  33.604  1.00 23.08 ? 263  TYR A CE2   1 
ATOM   2028  C CZ    . TYR A 1 263 ? 7.545   35.086  32.921  1.00 24.33 ? 263  TYR A CZ    1 
ATOM   2029  O OH    . TYR A 1 263 ? 8.768   35.015  33.539  1.00 26.14 ? 263  TYR A OH    1 
ATOM   2030  N N     . THR A 1 264 ? 1.597   32.798  30.417  1.00 23.99 ? 264  THR A N     1 
ATOM   2031  C CA    . THR A 1 264 ? 0.311   32.208  30.109  1.00 24.20 ? 264  THR A CA    1 
ATOM   2032  C C     . THR A 1 264 ? -0.510  32.119  31.384  1.00 24.58 ? 264  THR A C     1 
ATOM   2033  O O     . THR A 1 264 ? 0.008   31.727  32.444  1.00 23.98 ? 264  THR A O     1 
ATOM   2034  C CB    . THR A 1 264 ? 0.478   30.807  29.455  1.00 24.25 ? 264  THR A CB    1 
ATOM   2035  O OG1   . THR A 1 264 ? 1.348   30.938  28.343  1.00 23.07 ? 264  THR A OG1   1 
ATOM   2036  C CG2   . THR A 1 264 ? -0.861  30.247  28.958  1.00 22.77 ? 264  THR A CG2   1 
ATOM   2037  N N     . SER A 1 265 ? -1.782  32.502  31.253  1.00 24.85 ? 265  SER A N     1 
ATOM   2038  C CA    . SER A 1 265 ? -2.751  32.442  32.345  1.00 25.32 ? 265  SER A CA    1 
ATOM   2039  C C     . SER A 1 265 ? -3.180  31.031  32.717  1.00 25.56 ? 265  SER A C     1 
ATOM   2040  O O     . SER A 1 265 ? -3.364  30.144  31.867  1.00 24.79 ? 265  SER A O     1 
ATOM   2041  C CB    . SER A 1 265 ? -3.997  33.273  32.022  1.00 25.18 ? 265  SER A CB    1 
ATOM   2042  O OG    . SER A 1 265 ? -3.680  34.642  32.037  1.00 25.42 ? 265  SER A OG    1 
ATOM   2043  N N     . GLY A 1 266 ? -3.388  30.858  34.015  1.00 26.32 ? 266  GLY A N     1 
ATOM   2044  C CA    . GLY A 1 266 ? -3.733  29.567  34.541  1.00 27.32 ? 266  GLY A CA    1 
ATOM   2045  C C     . GLY A 1 266 ? -4.873  29.644  35.509  1.00 27.67 ? 266  GLY A C     1 
ATOM   2046  O O     . GLY A 1 266 ? -5.337  30.732  35.840  1.00 26.82 ? 266  GLY A O     1 
ATOM   2047  N N     . SER A 1 267 ? -5.296  28.457  35.944  1.00 28.53 ? 267  SER A N     1 
ATOM   2048  C CA    . SER A 1 267 ? -6.352  28.261  36.916  1.00 29.71 ? 267  SER A CA    1 
ATOM   2049  C C     . SER A 1 267 ? -6.057  28.890  38.283  1.00 30.38 ? 267  SER A C     1 
ATOM   2050  O O     . SER A 1 267 ? -6.969  29.355  38.993  1.00 30.43 ? 267  SER A O     1 
ATOM   2051  C CB    . SER A 1 267 ? -6.587  26.777  37.112  1.00 29.54 ? 267  SER A CB    1 
ATOM   2052  O OG    . SER A 1 267 ? -7.831  26.601  37.748  1.00 31.32 ? 267  SER A OG    1 
ATOM   2053  N N     . THR A 1 268 ? -4.788  28.895  38.669  1.00 30.66 ? 268  THR A N     1 
ATOM   2054  C CA    . THR A 1 268 ? -4.428  29.518  39.926  1.00 31.31 ? 268  THR A CA    1 
ATOM   2055  C C     . THR A 1 268 ? -3.231  30.431  39.712  1.00 30.78 ? 268  THR A C     1 
ATOM   2056  O O     . THR A 1 268 ? -2.395  30.178  38.849  1.00 30.61 ? 268  THR A O     1 
ATOM   2057  C CB    . THR A 1 268 ? -4.210  28.469  41.092  1.00 31.45 ? 268  THR A CB    1 
ATOM   2058  O OG1   . THR A 1 268 ? -3.040  27.703  40.842  1.00 32.90 ? 268  THR A OG1   1 
ATOM   2059  C CG2   . THR A 1 268 ? -5.372  27.478  41.187  1.00 31.45 ? 268  THR A CG2   1 
ATOM   2060  N N     . GLY A 1 269 ? -3.208  31.521  40.481  1.00 31.06 ? 269  GLY A N     1 
ATOM   2061  C CA    . GLY A 1 269 ? -2.082  32.455  40.556  1.00 30.04 ? 269  GLY A CA    1 
ATOM   2062  C C     . GLY A 1 269 ? -1.915  33.311  39.313  1.00 29.82 ? 269  GLY A C     1 
ATOM   2063  O O     . GLY A 1 269 ? -2.765  33.329  38.434  1.00 29.60 ? 269  GLY A O     1 
ATOM   2064  N N     . LYS A 1 270 ? -0.796  34.022  39.262  1.00 29.58 ? 270  LYS A N     1 
ATOM   2065  C CA    . LYS A 1 270 ? -0.435  34.837  38.133  1.00 29.12 ? 270  LYS A CA    1 
ATOM   2066  C C     . LYS A 1 270 ? 0.080   33.983  36.963  1.00 28.07 ? 270  LYS A C     1 
ATOM   2067  O O     . LYS A 1 270 ? 0.437   32.802  37.154  1.00 26.72 ? 270  LYS A O     1 
ATOM   2068  C CB    . LYS A 1 270 ? 0.587   35.894  38.561  1.00 29.76 ? 270  LYS A CB    1 
ATOM   2069  C CG    . LYS A 1 270 ? -0.034  37.036  39.460  1.00 32.60 ? 270  LYS A CG    1 
ATOM   2070  N N     . PRO A 1 271 ? 0.087   34.584  35.741  1.00 27.41 ? 271  PRO A N     1 
ATOM   2071  C CA    . PRO A 1 271 ? 0.589   33.933  34.537  1.00 26.63 ? 271  PRO A CA    1 
ATOM   2072  C C     . PRO A 1 271 ? 1.973   33.389  34.780  1.00 25.68 ? 271  PRO A C     1 
ATOM   2073  O O     . PRO A 1 271 ? 2.730   33.985  35.531  1.00 25.17 ? 271  PRO A O     1 
ATOM   2074  C CB    . PRO A 1 271 ? 0.627   35.089  33.522  1.00 26.82 ? 271  PRO A CB    1 
ATOM   2075  C CG    . PRO A 1 271 ? -0.523  35.961  33.951  1.00 26.40 ? 271  PRO A CG    1 
ATOM   2076  C CD    . PRO A 1 271 ? -0.393  35.954  35.443  1.00 26.75 ? 271  PRO A CD    1 
ATOM   2077  N N     . LYS A 1 272 ? 2.279   32.249  34.170  1.00 25.62 ? 272  LYS A N     1 
ATOM   2078  C CA    . LYS A 1 272 ? 3.603   31.599  34.303  1.00 25.01 ? 272  LYS A CA    1 
ATOM   2079  C C     . LYS A 1 272 ? 4.286   31.459  32.968  1.00 24.23 ? 272  LYS A C     1 
ATOM   2080  O O     . LYS A 1 272 ? 3.636   31.393  31.918  1.00 23.47 ? 272  LYS A O     1 
ATOM   2081  C CB    . LYS A 1 272 ? 3.490   30.224  34.963  1.00 25.37 ? 272  LYS A CB    1 
ATOM   2082  C CG    . LYS A 1 272 ? 2.953   30.269  36.396  1.00 27.69 ? 272  LYS A CG    1 
ATOM   2083  C CD    . LYS A 1 272 ? 3.864   31.154  37.275  1.00 33.71 ? 272  LYS A CD    1 
ATOM   2084  C CE    . LYS A 1 272 ? 3.332   31.284  38.705  1.00 37.39 ? 272  LYS A CE    1 
ATOM   2085  N NZ    . LYS A 1 272 ? 4.242   32.125  39.548  1.00 38.11 ? 272  LYS A NZ    1 
ATOM   2086  N N     . GLY A 1 273 ? 5.614   31.418  33.013  1.00 23.25 ? 273  GLY A N     1 
ATOM   2087  C CA    . GLY A 1 273 ? 6.398   31.384  31.798  1.00 21.82 ? 273  GLY A CA    1 
ATOM   2088  C C     . GLY A 1 273 ? 6.431   29.992  31.238  1.00 20.92 ? 273  GLY A C     1 
ATOM   2089  O O     . GLY A 1 273 ? 7.281   29.182  31.600  1.00 21.46 ? 273  GLY A O     1 
ATOM   2090  N N     . VAL A 1 274 ? 5.484   29.702  30.372  1.00 20.30 ? 274  VAL A N     1 
ATOM   2091  C CA    . VAL A 1 274 ? 5.505   28.456  29.612  1.00 20.10 ? 274  VAL A CA    1 
ATOM   2092  C C     . VAL A 1 274 ? 6.794   28.389  28.717  1.00 20.28 ? 274  VAL A C     1 
ATOM   2093  O O     . VAL A 1 274 ? 7.017   29.255  27.856  1.00 20.03 ? 274  VAL A O     1 
ATOM   2094  C CB    . VAL A 1 274 ? 4.152   28.290  28.833  1.00 19.57 ? 274  VAL A CB    1 
ATOM   2095  C CG1   . VAL A 1 274 ? 4.180   27.109  27.874  1.00 18.57 ? 274  VAL A CG1   1 
ATOM   2096  C CG2   . VAL A 1 274 ? 2.997   28.146  29.821  1.00 18.10 ? 274  VAL A CG2   1 
ATOM   2097  N N     . LEU A 1 275 ? 7.646   27.391  28.964  1.00 20.22 ? 275  LEU A N     1 
ATOM   2098  C CA    . LEU A 1 275 ? 8.935   27.298  28.286  1.00 20.39 ? 275  LEU A CA    1 
ATOM   2099  C C     . LEU A 1 275 ? 8.965   26.298  27.140  1.00 20.87 ? 275  LEU A C     1 
ATOM   2100  O O     . LEU A 1 275 ? 8.595   25.137  27.301  1.00 20.59 ? 275  LEU A O     1 
ATOM   2101  C CB    . LEU A 1 275 ? 10.088  27.015  29.263  1.00 20.66 ? 275  LEU A CB    1 
ATOM   2102  C CG    . LEU A 1 275 ? 11.546  27.112  28.715  1.00 20.16 ? 275  LEU A CG    1 
ATOM   2103  C CD1   . LEU A 1 275 ? 12.515  27.542  29.809  1.00 17.09 ? 275  LEU A CD1   1 
ATOM   2104  C CD2   . LEU A 1 275 ? 12.065  25.861  28.023  1.00 15.32 ? 275  LEU A CD2   1 
ATOM   2105  N N     . HIS A 1 276 ? 9.435   26.771  25.983  1.00 21.58 ? 276  HIS A N     1 
ATOM   2106  C CA    . HIS A 1 276 ? 9.713   25.915  24.851  1.00 22.15 ? 276  HIS A CA    1 
ATOM   2107  C C     . HIS A 1 276 ? 11.208  25.839  24.517  1.00 22.49 ? 276  HIS A C     1 
ATOM   2108  O O     . HIS A 1 276 ? 11.937  26.857  24.574  1.00 22.60 ? 276  HIS A O     1 
ATOM   2109  C CB    . HIS A 1 276 ? 8.906   26.384  23.634  1.00 22.89 ? 276  HIS A CB    1 
ATOM   2110  C CG    . HIS A 1 276 ? 7.461   25.994  23.693  1.00 23.12 ? 276  HIS A CG    1 
ATOM   2111  N ND1   . HIS A 1 276 ? 7.019   24.734  23.353  1.00 23.79 ? 276  HIS A ND1   1 
ATOM   2112  C CD2   . HIS A 1 276 ? 6.360   26.693  24.064  1.00 22.98 ? 276  HIS A CD2   1 
ATOM   2113  C CE1   . HIS A 1 276 ? 5.707   24.676  23.509  1.00 23.47 ? 276  HIS A CE1   1 
ATOM   2114  N NE2   . HIS A 1 276 ? 5.284   25.849  23.943  1.00 22.84 ? 276  HIS A NE2   1 
ATOM   2115  N N     . THR A 1 277 ? 11.669  24.630  24.192  1.00 22.21 ? 277  THR A N     1 
ATOM   2116  C CA    . THR A 1 277 ? 13.014  24.456  23.621  1.00 22.11 ? 277  THR A CA    1 
ATOM   2117  C C     . THR A 1 277 ? 12.962  24.527  22.075  1.00 22.47 ? 277  THR A C     1 
ATOM   2118  O O     . THR A 1 277 ? 11.969  25.019  21.510  1.00 23.80 ? 277  THR A O     1 
ATOM   2119  C CB    . THR A 1 277 ? 13.751  23.189  24.154  1.00 21.42 ? 277  THR A CB    1 
ATOM   2120  O OG1   . THR A 1 277 ? 13.018  22.021  23.792  1.00 20.87 ? 277  THR A OG1   1 
ATOM   2121  C CG2   . THR A 1 277 ? 13.892  23.251  25.651  1.00 20.96 ? 277  THR A CG2   1 
ATOM   2122  N N     . THR A 1 278 ? 14.000  24.025  21.413  1.00 22.03 ? 278  THR A N     1 
ATOM   2123  C CA    . THR A 1 278 ? 14.296  24.351  20.024  1.00 22.25 ? 278  THR A CA    1 
ATOM   2124  C C     . THR A 1 278 ? 13.916  23.321  18.959  1.00 22.41 ? 278  THR A C     1 
ATOM   2125  O O     . THR A 1 278 ? 13.124  23.640  18.051  1.00 21.85 ? 278  THR A O     1 
ATOM   2126  C CB    . THR A 1 278 ? 15.793  24.675  19.879  1.00 22.35 ? 278  THR A CB    1 
ATOM   2127  O OG1   . THR A 1 278 ? 16.130  25.667  20.853  1.00 24.63 ? 278  THR A OG1   1 
ATOM   2128  C CG2   . THR A 1 278 ? 16.114  25.209  18.483  1.00 21.08 ? 278  THR A CG2   1 
ATOM   2129  N N     . GLY A 1 279 ? 14.501  22.114  19.054  1.00 22.49 ? 279  GLY A N     1 
ATOM   2130  C CA    . GLY A 1 279 ? 14.415  21.094  17.989  1.00 22.42 ? 279  GLY A CA    1 
ATOM   2131  C C     . GLY A 1 279 ? 13.011  20.539  17.761  1.00 22.71 ? 279  GLY A C     1 
ATOM   2132  O O     . GLY A 1 279 ? 12.451  20.666  16.659  1.00 22.42 ? 279  GLY A O     1 
ATOM   2133  N N     . GLY A 1 280 ? 12.439  19.928  18.804  1.00 22.16 ? 280  GLY A N     1 
ATOM   2134  C CA    . GLY A 1 280 ? 11.126  19.304  18.694  1.00 21.54 ? 280  GLY A CA    1 
ATOM   2135  C C     . GLY A 1 280 ? 10.056  20.341  18.403  1.00 21.38 ? 280  GLY A C     1 
ATOM   2136  O O     . GLY A 1 280 ? 9.129   20.084  17.632  1.00 20.85 ? 280  GLY A O     1 
ATOM   2137  N N     . TYR A 1 281 ? 10.210  21.517  19.028  1.00 21.24 ? 281  TYR A N     1 
ATOM   2138  C CA    . TYR A 1 281 ? 9.322   22.643  18.821  1.00 20.41 ? 281  TYR A CA    1 
ATOM   2139  C C     . TYR A 1 281 ? 9.298   23.051  17.354  1.00 20.20 ? 281  TYR A C     1 
ATOM   2140  O O     . TYR A 1 281 ? 8.222   23.149  16.756  1.00 19.84 ? 281  TYR A O     1 
ATOM   2141  C CB    . TYR A 1 281 ? 9.712   23.872  19.672  1.00 20.44 ? 281  TYR A CB    1 
ATOM   2142  C CG    . TYR A 1 281 ? 8.920   25.101  19.219  1.00 20.93 ? 281  TYR A CG    1 
ATOM   2143  C CD1   . TYR A 1 281 ? 7.591   25.286  19.630  1.00 19.94 ? 281  TYR A CD1   1 
ATOM   2144  C CD2   . TYR A 1 281 ? 9.466   26.031  18.309  1.00 21.56 ? 281  TYR A CD2   1 
ATOM   2145  C CE1   . TYR A 1 281 ? 6.827   26.388  19.171  1.00 20.76 ? 281  TYR A CE1   1 
ATOM   2146  C CE2   . TYR A 1 281 ? 8.715   27.149  17.848  1.00 19.95 ? 281  TYR A CE2   1 
ATOM   2147  C CZ    . TYR A 1 281 ? 7.401   27.308  18.290  1.00 21.10 ? 281  TYR A CZ    1 
ATOM   2148  O OH    . TYR A 1 281 ? 6.653   28.370  17.866  1.00 21.75 ? 281  TYR A OH    1 
ATOM   2149  N N     . LEU A 1 282 ? 10.479  23.316  16.784  1.00 20.01 ? 282  LEU A N     1 
ATOM   2150  C CA    . LEU A 1 282 ? 10.532  23.790  15.418  1.00 19.64 ? 282  LEU A CA    1 
ATOM   2151  C C     . LEU A 1 282 ? 10.040  22.725  14.438  1.00 19.71 ? 282  LEU A C     1 
ATOM   2152  O O     . LEU A 1 282 ? 9.337   23.050  13.473  1.00 19.59 ? 282  LEU A O     1 
ATOM   2153  C CB    . LEU A 1 282 ? 11.919  24.298  15.040  1.00 20.23 ? 282  LEU A CB    1 
ATOM   2154  C CG    . LEU A 1 282 ? 11.942  25.043  13.692  1.00 21.17 ? 282  LEU A CG    1 
ATOM   2155  C CD1   . LEU A 1 282 ? 10.965  26.248  13.779  1.00 21.11 ? 282  LEU A CD1   1 
ATOM   2156  C CD2   . LEU A 1 282 ? 13.374  25.466  13.250  1.00 18.54 ? 282  LEU A CD2   1 
ATOM   2157  N N     . VAL A 1 283 ? 10.404  21.464  14.688  1.00 19.42 ? 283  VAL A N     1 
ATOM   2158  C CA    . VAL A 1 283 ? 9.944   20.356  13.840  1.00 19.60 ? 283  VAL A CA    1 
ATOM   2159  C C     . VAL A 1 283 ? 8.415   20.290  13.872  1.00 20.34 ? 283  VAL A C     1 
ATOM   2160  O O     . VAL A 1 283 ? 7.750   20.192  12.813  1.00 19.56 ? 283  VAL A O     1 
ATOM   2161  C CB    . VAL A 1 283 ? 10.511  18.968  14.296  1.00 19.35 ? 283  VAL A CB    1 
ATOM   2162  C CG1   . VAL A 1 283 ? 9.736   17.831  13.646  1.00 17.08 ? 283  VAL A CG1   1 
ATOM   2163  C CG2   . VAL A 1 283 ? 12.021  18.842  13.991  1.00 18.33 ? 283  VAL A CG2   1 
ATOM   2164  N N     . TYR A 1 284 ? 7.867   20.341  15.100  1.00 20.43 ? 284  TYR A N     1 
ATOM   2165  C CA    . TYR A 1 284 ? 6.427   20.255  15.274  1.00 20.09 ? 284  TYR A CA    1 
ATOM   2166  C C     . TYR A 1 284 ? 5.731   21.447  14.605  1.00 19.98 ? 284  TYR A C     1 
ATOM   2167  O O     . TYR A 1 284 ? 4.698   21.277  13.900  1.00 19.44 ? 284  TYR A O     1 
ATOM   2168  C CB    . TYR A 1 284 ? 6.037   20.095  16.754  1.00 19.94 ? 284  TYR A CB    1 
ATOM   2169  C CG    . TYR A 1 284 ? 4.658   19.476  16.895  1.00 19.84 ? 284  TYR A CG    1 
ATOM   2170  C CD1   . TYR A 1 284 ? 3.557   20.248  17.241  1.00 18.91 ? 284  TYR A CD1   1 
ATOM   2171  C CD2   . TYR A 1 284 ? 4.454   18.123  16.622  1.00 18.09 ? 284  TYR A CD2   1 
ATOM   2172  C CE1   . TYR A 1 284 ? 2.303   19.676  17.345  1.00 18.88 ? 284  TYR A CE1   1 
ATOM   2173  C CE2   . TYR A 1 284 ? 3.211   17.556  16.718  1.00 15.75 ? 284  TYR A CE2   1 
ATOM   2174  C CZ    . TYR A 1 284 ? 2.141   18.329  17.070  1.00 17.24 ? 284  TYR A CZ    1 
ATOM   2175  O OH    . TYR A 1 284 ? 0.892   17.752  17.134  1.00 17.96 ? 284  TYR A OH    1 
ATOM   2176  N N     . ALA A 1 285 ? 6.313   22.636  14.790  1.00 19.41 ? 285  ALA A N     1 
ATOM   2177  C CA    . ALA A 1 285 ? 5.774   23.849  14.140  1.00 19.99 ? 285  ALA A CA    1 
ATOM   2178  C C     . ALA A 1 285 ? 5.749   23.723  12.603  1.00 20.02 ? 285  ALA A C     1 
ATOM   2179  O O     . ALA A 1 285 ? 4.731   24.019  11.969  1.00 20.14 ? 285  ALA A O     1 
ATOM   2180  C CB    . ALA A 1 285 ? 6.535   25.117  14.577  1.00 19.47 ? 285  ALA A CB    1 
ATOM   2181  N N     . ALA A 1 286 ? 6.868   23.268  12.026  1.00 19.91 ? 286  ALA A N     1 
ATOM   2182  C CA    . ALA A 1 286 ? 7.027   23.156  10.581  1.00 19.95 ? 286  ALA A CA    1 
ATOM   2183  C C     . ALA A 1 286 ? 6.088   22.125  9.916   1.00 20.09 ? 286  ALA A C     1 
ATOM   2184  O O     . ALA A 1 286 ? 5.413   22.422  8.920   1.00 20.58 ? 286  ALA A O     1 
ATOM   2185  C CB    . ALA A 1 286 ? 8.498   22.897  10.225  1.00 19.24 ? 286  ALA A CB    1 
ATOM   2186  N N     . THR A 1 287 ? 6.083   20.920  10.471  1.00 19.64 ? 287  THR A N     1 
ATOM   2187  C CA    . THR A 1 287 ? 5.206   19.825  10.086  1.00 19.16 ? 287  THR A CA    1 
ATOM   2188  C C     . THR A 1 287 ? 3.682   20.135  10.145  1.00 19.29 ? 287  THR A C     1 
ATOM   2189  O O     . THR A 1 287 ? 2.934   19.820  9.218   1.00 18.75 ? 287  THR A O     1 
ATOM   2190  C CB    . THR A 1 287 ? 5.560   18.605  10.983  1.00 19.00 ? 287  THR A CB    1 
ATOM   2191  O OG1   . THR A 1 287 ? 6.972   18.367  10.898  1.00 18.95 ? 287  THR A OG1   1 
ATOM   2192  C CG2   . THR A 1 287 ? 4.776   17.330  10.598  1.00 18.36 ? 287  THR A CG2   1 
ATOM   2193  N N     . THR A 1 288 ? 3.229   20.707  11.257  1.00 20.20 ? 288  THR A N     1 
ATOM   2194  C CA    . THR A 1 288 ? 1.816   21.035  11.440  1.00 21.17 ? 288  THR A CA    1 
ATOM   2195  C C     . THR A 1 288 ? 1.392   22.071  10.411  1.00 21.51 ? 288  THR A C     1 
ATOM   2196  O O     . THR A 1 288 ? 0.363   21.902  9.758   1.00 22.76 ? 288  THR A O     1 
ATOM   2197  C CB    . THR A 1 288 ? 1.504   21.505  12.873  1.00 20.99 ? 288  THR A CB    1 
ATOM   2198  O OG1   . THR A 1 288 ? 2.597   22.282  13.371  1.00 22.79 ? 288  THR A OG1   1 
ATOM   2199  C CG2   . THR A 1 288 ? 1.350   20.316  13.795  1.00 21.35 ? 288  THR A CG2   1 
ATOM   2200  N N     . PHE A 1 289 ? 2.204   23.110  10.237  1.00 21.20 ? 289  PHE A N     1 
ATOM   2201  C CA    . PHE A 1 289 ? 1.952   24.138  9.231   1.00 21.24 ? 289  PHE A CA    1 
ATOM   2202  C C     . PHE A 1 289 ? 1.850   23.550  7.803   1.00 22.41 ? 289  PHE A C     1 
ATOM   2203  O O     . PHE A 1 289 ? 0.834   23.747  7.111   1.00 23.21 ? 289  PHE A O     1 
ATOM   2204  C CB    . PHE A 1 289 ? 3.045   25.218  9.302   1.00 20.24 ? 289  PHE A CB    1 
ATOM   2205  C CG    . PHE A 1 289 ? 3.021   26.186  8.150   1.00 18.00 ? 289  PHE A CG    1 
ATOM   2206  C CD1   . PHE A 1 289 ? 2.234   27.336  8.211   1.00 14.36 ? 289  PHE A CD1   1 
ATOM   2207  C CD2   . PHE A 1 289 ? 3.780   25.936  6.996   1.00 15.88 ? 289  PHE A CD2   1 
ATOM   2208  C CE1   . PHE A 1 289 ? 2.191   28.222  7.135   1.00 14.92 ? 289  PHE A CE1   1 
ATOM   2209  C CE2   . PHE A 1 289 ? 3.763   26.814  5.915   1.00 13.33 ? 289  PHE A CE2   1 
ATOM   2210  C CZ    . PHE A 1 289 ? 2.958   27.962  5.972   1.00 15.91 ? 289  PHE A CZ    1 
ATOM   2211  N N     . LYS A 1 290 ? 2.904   22.859  7.362   1.00 22.92 ? 290  LYS A N     1 
ATOM   2212  C CA    . LYS A 1 290 ? 2.911   22.191  6.068   1.00 23.96 ? 290  LYS A CA    1 
ATOM   2213  C C     . LYS A 1 290 ? 1.616   21.402  5.798   1.00 24.08 ? 290  LYS A C     1 
ATOM   2214  O O     . LYS A 1 290 ? 0.898   21.695  4.862   1.00 25.01 ? 290  LYS A O     1 
ATOM   2215  C CB    . LYS A 1 290 ? 4.086   21.252  5.995   1.00 23.77 ? 290  LYS A CB    1 
ATOM   2216  C CG    . LYS A 1 290 ? 4.503   20.844  4.591   1.00 25.07 ? 290  LYS A CG    1 
ATOM   2217  C CD    . LYS A 1 290 ? 5.963   20.382  4.702   1.00 26.81 ? 290  LYS A CD    1 
ATOM   2218  C CE    . LYS A 1 290 ? 6.495   19.639  3.498   1.00 28.38 ? 290  LYS A CE    1 
ATOM   2219  N NZ    . LYS A 1 290 ? 7.960   19.556  3.706   1.00 28.07 ? 290  LYS A NZ    1 
ATOM   2220  N N     . TYR A 1 291 ? 1.323   20.430  6.646   1.00 23.97 ? 291  TYR A N     1 
ATOM   2221  C CA    . TYR A 1 291 ? 0.264   19.491  6.406   1.00 23.83 ? 291  TYR A CA    1 
ATOM   2222  C C     . TYR A 1 291 ? -1.105  20.085  6.659   1.00 24.14 ? 291  TYR A C     1 
ATOM   2223  O O     . TYR A 1 291 ? -2.013  19.879  5.854   1.00 24.98 ? 291  TYR A O     1 
ATOM   2224  C CB    . TYR A 1 291 ? 0.471   18.216  7.245   1.00 23.66 ? 291  TYR A CB    1 
ATOM   2225  C CG    . TYR A 1 291 ? 1.691   17.386  6.838   1.00 24.56 ? 291  TYR A CG    1 
ATOM   2226  C CD1   . TYR A 1 291 ? 2.385   16.592  7.784   1.00 22.51 ? 291  TYR A CD1   1 
ATOM   2227  C CD2   . TYR A 1 291 ? 2.159   17.390  5.510   1.00 23.26 ? 291  TYR A CD2   1 
ATOM   2228  C CE1   . TYR A 1 291 ? 3.499   15.828  7.413   1.00 21.13 ? 291  TYR A CE1   1 
ATOM   2229  C CE2   . TYR A 1 291 ? 3.275   16.620  5.134   1.00 23.11 ? 291  TYR A CE2   1 
ATOM   2230  C CZ    . TYR A 1 291 ? 3.942   15.847  6.086   1.00 23.23 ? 291  TYR A CZ    1 
ATOM   2231  O OH    . TYR A 1 291 ? 5.044   15.098  5.684   1.00 23.24 ? 291  TYR A OH    1 
ATOM   2232  N N     . VAL A 1 292 ? -1.283  20.803  7.769   1.00 23.83 ? 292  VAL A N     1 
ATOM   2233  C CA    . VAL A 1 292 ? -2.607  21.346  8.070   1.00 23.37 ? 292  VAL A CA    1 
ATOM   2234  C C     . VAL A 1 292 ? -3.060  22.473  7.112   1.00 23.87 ? 292  VAL A C     1 
ATOM   2235  O O     . VAL A 1 292 ? -4.252  22.596  6.820   1.00 24.43 ? 292  VAL A O     1 
ATOM   2236  C CB    . VAL A 1 292 ? -2.741  21.758  9.550   1.00 23.28 ? 292  VAL A CB    1 
ATOM   2237  C CG1   . VAL A 1 292 ? -3.986  22.579  9.781   1.00 20.92 ? 292  VAL A CG1   1 
ATOM   2238  C CG2   . VAL A 1 292 ? -2.734  20.511  10.438  1.00 22.94 ? 292  VAL A CG2   1 
ATOM   2239  N N     . PHE A 1 293 ? -2.133  23.285  6.607   1.00 23.79 ? 293  PHE A N     1 
ATOM   2240  C CA    . PHE A 1 293 ? -2.533  24.310  5.635   1.00 23.54 ? 293  PHE A CA    1 
ATOM   2241  C C     . PHE A 1 293 ? -2.283  23.884  4.193   1.00 24.07 ? 293  PHE A C     1 
ATOM   2242  O O     . PHE A 1 293 ? -2.440  24.693  3.269   1.00 23.94 ? 293  PHE A O     1 
ATOM   2243  C CB    . PHE A 1 293 ? -1.851  25.638  5.941   1.00 23.47 ? 293  PHE A CB    1 
ATOM   2244  C CG    . PHE A 1 293 ? -2.207  26.193  7.285   1.00 22.87 ? 293  PHE A CG    1 
ATOM   2245  C CD1   . PHE A 1 293 ? -1.246  26.319  8.270   1.00 23.23 ? 293  PHE A CD1   1 
ATOM   2246  C CD2   . PHE A 1 293 ? -3.511  26.570  7.568   1.00 19.82 ? 293  PHE A CD2   1 
ATOM   2247  C CE1   . PHE A 1 293 ? -1.579  26.840  9.538   1.00 22.89 ? 293  PHE A CE1   1 
ATOM   2248  C CE2   . PHE A 1 293 ? -3.849  27.073  8.819   1.00 22.19 ? 293  PHE A CE2   1 
ATOM   2249  C CZ    . PHE A 1 293 ? -2.887  27.206  9.805   1.00 22.87 ? 293  PHE A CZ    1 
ATOM   2250  N N     . ASP A 1 294 ? -1.883  22.619  4.014   1.00 23.76 ? 294  ASP A N     1 
ATOM   2251  C CA    . ASP A 1 294 ? -1.511  22.091  2.709   1.00 24.05 ? 294  ASP A CA    1 
ATOM   2252  C C     . ASP A 1 294 ? -0.511  22.988  1.977   1.00 24.54 ? 294  ASP A C     1 
ATOM   2253  O O     . ASP A 1 294 ? -0.653  23.259  0.768   1.00 24.26 ? 294  ASP A O     1 
ATOM   2254  C CB    . ASP A 1 294 ? -2.760  21.923  1.863   1.00 24.60 ? 294  ASP A CB    1 
ATOM   2255  C CG    . ASP A 1 294 ? -2.590  20.913  0.767   1.00 24.54 ? 294  ASP A CG    1 
ATOM   2256  O OD1   . ASP A 1 294 ? -3.109  21.177  -0.337  1.00 26.38 ? 294  ASP A OD1   1 
ATOM   2257  O OD2   . ASP A 1 294 ? -1.944  19.872  1.010   1.00 24.83 ? 294  ASP A OD2   1 
ATOM   2258  N N     . TYR A 1 295 ? 0.510   23.446  2.692   1.00 24.59 ? 295  TYR A N     1 
ATOM   2259  C CA    . TYR A 1 295 ? 1.370   24.456  2.123   1.00 25.15 ? 295  TYR A CA    1 
ATOM   2260  C C     . TYR A 1 295 ? 2.168   23.956  0.906   1.00 25.34 ? 295  TYR A C     1 
ATOM   2261  O O     . TYR A 1 295 ? 2.854   22.933  0.973   1.00 24.95 ? 295  TYR A O     1 
ATOM   2262  C CB    . TYR A 1 295 ? 2.292   25.091  3.170   1.00 25.64 ? 295  TYR A CB    1 
ATOM   2263  C CG    . TYR A 1 295 ? 3.292   25.970  2.482   1.00 26.91 ? 295  TYR A CG    1 
ATOM   2264  C CD1   . TYR A 1 295 ? 2.974   27.291  2.118   1.00 25.79 ? 295  TYR A CD1   1 
ATOM   2265  C CD2   . TYR A 1 295 ? 4.535   25.451  2.111   1.00 27.10 ? 295  TYR A CD2   1 
ATOM   2266  C CE1   . TYR A 1 295 ? 3.893   28.072  1.427   1.00 27.32 ? 295  TYR A CE1   1 
ATOM   2267  C CE2   . TYR A 1 295 ? 5.439   26.204  1.428   1.00 27.79 ? 295  TYR A CE2   1 
ATOM   2268  C CZ    . TYR A 1 295 ? 5.127   27.511  1.084   1.00 27.96 ? 295  TYR A CZ    1 
ATOM   2269  O OH    . TYR A 1 295 ? 6.104   28.226  0.408   1.00 29.95 ? 295  TYR A OH    1 
ATOM   2270  N N     . HIS A 1 296 ? 2.055   24.694  -0.200  1.00 25.49 ? 296  HIS A N     1 
ATOM   2271  C CA    . HIS A 1 296 ? 2.823   24.452  -1.425  1.00 25.64 ? 296  HIS A CA    1 
ATOM   2272  C C     . HIS A 1 296 ? 3.651   25.727  -1.700  1.00 25.47 ? 296  HIS A C     1 
ATOM   2273  O O     . HIS A 1 296 ? 3.150   26.835  -1.486  1.00 25.42 ? 296  HIS A O     1 
ATOM   2274  C CB    . HIS A 1 296 ? 1.881   24.243  -2.618  1.00 25.37 ? 296  HIS A CB    1 
ATOM   2275  C CG    . HIS A 1 296 ? 1.223   22.896  -2.673  1.00 27.47 ? 296  HIS A CG    1 
ATOM   2276  N ND1   . HIS A 1 296 ? 0.280   22.482  -1.752  1.00 28.81 ? 296  HIS A ND1   1 
ATOM   2277  C CD2   . HIS A 1 296 ? 1.318   21.896  -3.588  1.00 27.66 ? 296  HIS A CD2   1 
ATOM   2278  C CE1   . HIS A 1 296 ? -0.140  21.268  -2.071  1.00 29.23 ? 296  HIS A CE1   1 
ATOM   2279  N NE2   . HIS A 1 296 ? 0.471   20.893  -3.183  1.00 28.30 ? 296  HIS A NE2   1 
ATOM   2280  N N     . PRO A 1 297 ? 4.909   25.583  -2.176  1.00 24.93 ? 297  PRO A N     1 
ATOM   2281  C CA    . PRO A 1 297 ? 5.637   26.770  -2.654  1.00 24.77 ? 297  PRO A CA    1 
ATOM   2282  C C     . PRO A 1 297 ? 4.788   27.715  -3.499  1.00 24.73 ? 297  PRO A C     1 
ATOM   2283  O O     . PRO A 1 297 ? 4.082   27.289  -4.444  1.00 23.94 ? 297  PRO A O     1 
ATOM   2284  C CB    . PRO A 1 297 ? 6.782   26.169  -3.483  1.00 24.47 ? 297  PRO A CB    1 
ATOM   2285  C CG    . PRO A 1 297 ? 7.103   24.880  -2.720  1.00 24.48 ? 297  PRO A CG    1 
ATOM   2286  C CD    . PRO A 1 297 ? 5.743   24.363  -2.253  1.00 24.86 ? 297  PRO A CD    1 
ATOM   2287  N N     . GLY A 1 298 ? 4.851   28.994  -3.123  1.00 24.82 ? 298  GLY A N     1 
ATOM   2288  C CA    . GLY A 1 298 ? 4.105   30.043  -3.810  1.00 24.82 ? 298  GLY A CA    1 
ATOM   2289  C C     . GLY A 1 298 ? 2.813   30.438  -3.120  1.00 24.81 ? 298  GLY A C     1 
ATOM   2290  O O     . GLY A 1 298 ? 2.222   31.471  -3.467  1.00 25.53 ? 298  GLY A O     1 
ATOM   2291  N N     . ASP A 1 299 ? 2.347   29.604  -2.192  1.00 24.17 ? 299  ASP A N     1 
ATOM   2292  C CA    . ASP A 1 299 ? 1.195   29.954  -1.357  1.00 24.74 ? 299  ASP A CA    1 
ATOM   2293  C C     . ASP A 1 299 ? 1.526   31.134  -0.441  1.00 24.04 ? 299  ASP A C     1 
ATOM   2294  O O     . ASP A 1 299 ? 2.584   31.165  0.213   1.00 24.50 ? 299  ASP A O     1 
ATOM   2295  C CB    . ASP A 1 299 ? 0.699   28.762  -0.534  1.00 24.61 ? 299  ASP A CB    1 
ATOM   2296  C CG    . ASP A 1 299 ? 0.176   27.605  -1.414  1.00 28.06 ? 299  ASP A CG    1 
ATOM   2297  O OD1   . ASP A 1 299 ? -0.145  27.840  -2.625  1.00 29.55 ? 299  ASP A OD1   1 
ATOM   2298  O OD2   . ASP A 1 299 ? 0.073   26.466  -0.881  1.00 27.76 ? 299  ASP A OD2   1 
ATOM   2299  N N     . ILE A 1 300 ? 0.628   32.118  -0.473  1.00 23.18 ? 300  ILE A N     1 
ATOM   2300  C CA    . ILE A 1 300 ? 0.714   33.338  0.303   1.00 21.99 ? 300  ILE A CA    1 
ATOM   2301  C C     . ILE A 1 300 ? -0.186  33.057  1.476   1.00 20.92 ? 300  ILE A C     1 
ATOM   2302  O O     . ILE A 1 300 ? -1.372  32.792  1.302   1.00 20.70 ? 300  ILE A O     1 
ATOM   2303  C CB    . ILE A 1 300 ? 0.196   34.589  -0.491  1.00 22.06 ? 300  ILE A CB    1 
ATOM   2304  C CG1   . ILE A 1 300 ? 0.942   34.773  -1.827  1.00 23.44 ? 300  ILE A CG1   1 
ATOM   2305  C CG2   . ILE A 1 300 ? 0.190   35.874  0.385   1.00 21.24 ? 300  ILE A CG2   1 
ATOM   2306  C CD1   . ILE A 1 300 ? 2.496   34.861  -1.714  1.00 24.82 ? 300  ILE A CD1   1 
ATOM   2307  N N     . TYR A 1 301 ? 0.405   33.140  2.664   1.00 19.98 ? 301  TYR A N     1 
ATOM   2308  C CA    . TYR A 1 301 ? -0.191  32.700  3.901   1.00 19.01 ? 301  TYR A CA    1 
ATOM   2309  C C     . TYR A 1 301 ? -0.366  33.898  4.827   1.00 19.31 ? 301  TYR A C     1 
ATOM   2310  O O     . TYR A 1 301 ? 0.567   34.715  4.984   1.00 18.86 ? 301  TYR A O     1 
ATOM   2311  C CB    . TYR A 1 301 ? 0.743   31.670  4.538   1.00 18.51 ? 301  TYR A CB    1 
ATOM   2312  C CG    . TYR A 1 301 ? 0.425   31.322  5.969   1.00 18.80 ? 301  TYR A CG    1 
ATOM   2313  C CD1   . TYR A 1 301 ? 1.115   31.939  7.022   1.00 15.95 ? 301  TYR A CD1   1 
ATOM   2314  C CD2   . TYR A 1 301 ? -0.563  30.360  6.273   1.00 18.41 ? 301  TYR A CD2   1 
ATOM   2315  C CE1   . TYR A 1 301 ? 0.851   31.616  8.326   1.00 18.14 ? 301  TYR A CE1   1 
ATOM   2316  C CE2   . TYR A 1 301 ? -0.865  30.030  7.592   1.00 19.40 ? 301  TYR A CE2   1 
ATOM   2317  C CZ    . TYR A 1 301 ? -0.151  30.662  8.623   1.00 19.56 ? 301  TYR A CZ    1 
ATOM   2318  O OH    . TYR A 1 301 ? -0.421  30.338  9.933   1.00 19.08 ? 301  TYR A OH    1 
ATOM   2319  N N     . TRP A 1 302 ? -1.555  34.010  5.433   1.00 19.58 ? 302  TRP A N     1 
ATOM   2320  C CA    . TRP A 1 302 ? -1.816  35.060  6.415   1.00 19.95 ? 302  TRP A CA    1 
ATOM   2321  C C     . TRP A 1 302 ? -2.457  34.515  7.672   1.00 20.13 ? 302  TRP A C     1 
ATOM   2322  O O     . TRP A 1 302 ? -3.619  34.097  7.680   1.00 21.05 ? 302  TRP A O     1 
ATOM   2323  C CB    . TRP A 1 302 ? -2.666  36.172  5.802   1.00 19.94 ? 302  TRP A CB    1 
ATOM   2324  C CG    . TRP A 1 302 ? -2.965  37.326  6.730   1.00 20.87 ? 302  TRP A CG    1 
ATOM   2325  C CD1   . TRP A 1 302 ? -2.232  37.736  7.820   1.00 20.73 ? 302  TRP A CD1   1 
ATOM   2326  C CD2   . TRP A 1 302 ? -4.072  38.237  6.631   1.00 20.48 ? 302  TRP A CD2   1 
ATOM   2327  N NE1   . TRP A 1 302 ? -2.828  38.835  8.409   1.00 20.69 ? 302  TRP A NE1   1 
ATOM   2328  C CE2   . TRP A 1 302 ? -3.951  39.165  7.692   1.00 19.39 ? 302  TRP A CE2   1 
ATOM   2329  C CE3   . TRP A 1 302 ? -5.138  38.374  5.736   1.00 19.78 ? 302  TRP A CE3   1 
ATOM   2330  C CZ2   . TRP A 1 302 ? -4.852  40.199  7.875   1.00 19.43 ? 302  TRP A CZ2   1 
ATOM   2331  C CZ3   . TRP A 1 302 ? -6.051  39.402  5.938   1.00 19.39 ? 302  TRP A CZ3   1 
ATOM   2332  C CH2   . TRP A 1 302 ? -5.902  40.295  6.989   1.00 19.72 ? 302  TRP A CH2   1 
ATOM   2333  N N     . CYS A 1 303 ? -1.683  34.503  8.741   1.00 20.84 ? 303  CYS A N     1 
ATOM   2334  C CA    . CYS A 1 303 ? -2.227  34.256  10.074  1.00 20.77 ? 303  CYS A CA    1 
ATOM   2335  C C     . CYS A 1 303 ? -2.439  35.629  10.724  1.00 20.88 ? 303  CYS A C     1 
ATOM   2336  O O     . CYS A 1 303 ? -1.553  36.475  10.644  1.00 21.05 ? 303  CYS A O     1 
ATOM   2337  C CB    . CYS A 1 303 ? -1.255  33.399  10.867  1.00 20.43 ? 303  CYS A CB    1 
ATOM   2338  S SG    . CYS A 1 303 ? -1.428  33.487  12.635  1.00 21.83 ? 303  CYS A SG    1 
ATOM   2339  N N     . THR A 1 304 ? -3.612  35.868  11.325  1.00 21.08 ? 304  THR A N     1 
ATOM   2340  C CA    . THR A 1 304 ? -3.935  37.207  11.822  1.00 21.08 ? 304  THR A CA    1 
ATOM   2341  C C     . THR A 1 304 ? -3.551  37.438  13.304  1.00 21.32 ? 304  THR A C     1 
ATOM   2342  O O     . THR A 1 304 ? -3.787  38.534  13.858  1.00 20.48 ? 304  THR A O     1 
ATOM   2343  C CB    . THR A 1 304 ? -5.428  37.572  11.605  1.00 21.17 ? 304  THR A CB    1 
ATOM   2344  O OG1   . THR A 1 304 ? -6.255  36.761  12.459  1.00 21.67 ? 304  THR A OG1   1 
ATOM   2345  C CG2   . THR A 1 304 ? -5.826  37.401  10.146  1.00 20.64 ? 304  THR A CG2   1 
ATOM   2346  N N     . ALA A 1 305 ? -2.941  36.421  13.927  1.00 21.27 ? 305  ALA A N     1 
ATOM   2347  C CA    . ALA A 1 305 ? -2.641  36.460  15.363  1.00 21.51 ? 305  ALA A CA    1 
ATOM   2348  C C     . ALA A 1 305 ? -1.508  37.402  15.702  1.00 22.25 ? 305  ALA A C     1 
ATOM   2349  O O     . ALA A 1 305 ? -0.557  37.555  14.933  1.00 22.84 ? 305  ALA A O     1 
ATOM   2350  C CB    . ALA A 1 305 ? -2.328  35.083  15.889  1.00 21.12 ? 305  ALA A CB    1 
ATOM   2351  N N     . ASP A 1 306 ? -1.603  38.020  16.877  1.00 22.81 ? 306  ASP A N     1 
ATOM   2352  C CA    . ASP A 1 306 ? -0.529  38.842  17.376  1.00 23.14 ? 306  ASP A CA    1 
ATOM   2353  C C     . ASP A 1 306 ? 0.666   37.966  17.763  1.00 23.95 ? 306  ASP A C     1 
ATOM   2354  O O     . ASP A 1 306 ? 0.571   36.940  18.468  1.00 23.70 ? 306  ASP A O     1 
ATOM   2355  C CB    . ASP A 1 306 ? -0.984  39.719  18.544  1.00 23.22 ? 306  ASP A CB    1 
ATOM   2356  C CG    . ASP A 1 306 ? -0.027  40.864  18.829  1.00 23.49 ? 306  ASP A CG    1 
ATOM   2357  O OD1   . ASP A 1 306 ? 0.873   40.700  19.665  1.00 24.39 ? 306  ASP A OD1   1 
ATOM   2358  O OD2   . ASP A 1 306 ? -0.163  41.940  18.225  1.00 27.00 ? 306  ASP A OD2   1 
ATOM   2359  N N     . VAL A 1 307 ? 1.795   38.394  17.238  1.00 24.27 ? 307  VAL A N     1 
ATOM   2360  C CA    . VAL A 1 307 ? 3.110   37.971  17.665  1.00 25.02 ? 307  VAL A CA    1 
ATOM   2361  C C     . VAL A 1 307 ? 3.289   37.775  19.207  1.00 25.04 ? 307  VAL A C     1 
ATOM   2362  O O     . VAL A 1 307 ? 4.118   36.970  19.641  1.00 25.77 ? 307  VAL A O     1 
ATOM   2363  C CB    . VAL A 1 307 ? 4.127   38.986  17.065  1.00 25.27 ? 307  VAL A CB    1 
ATOM   2364  C CG1   . VAL A 1 307 ? 4.522   40.085  18.077  1.00 22.76 ? 307  VAL A CG1   1 
ATOM   2365  C CG2   . VAL A 1 307 ? 5.309   38.250  16.433  1.00 26.51 ? 307  VAL A CG2   1 
ATOM   2366  N N     . GLY A 1 308 ? 2.526   38.500  20.025  1.00 24.63 ? 308  GLY A N     1 
ATOM   2367  C CA    . GLY A 1 308 ? 2.626   38.374  21.479  1.00 23.98 ? 308  GLY A CA    1 
ATOM   2368  C C     . GLY A 1 308 ? 1.932   37.133  22.034  1.00 24.02 ? 308  GLY A C     1 
ATOM   2369  O O     . GLY A 1 308 ? 2.011   36.876  23.221  1.00 24.52 ? 308  GLY A O     1 
ATOM   2370  N N     . TRP A 1 309 ? 1.255   36.369  21.170  1.00 23.87 ? 309  TRP A N     1 
ATOM   2371  C CA    . TRP A 1 309 ? 0.652   35.083  21.524  1.00 23.01 ? 309  TRP A CA    1 
ATOM   2372  C C     . TRP A 1 309 ? 1.319   33.955  20.748  1.00 22.39 ? 309  TRP A C     1 
ATOM   2373  O O     . TRP A 1 309 ? 1.963   34.181  19.722  1.00 22.46 ? 309  TRP A O     1 
ATOM   2374  C CB    . TRP A 1 309 ? -0.847  35.066  21.235  1.00 22.93 ? 309  TRP A CB    1 
ATOM   2375  C CG    . TRP A 1 309 ? -1.593  36.284  21.703  1.00 23.22 ? 309  TRP A CG    1 
ATOM   2376  C CD1   . TRP A 1 309 ? -2.320  37.149  20.916  1.00 23.70 ? 309  TRP A CD1   1 
ATOM   2377  C CD2   . TRP A 1 309 ? -1.692  36.790  23.055  1.00 21.97 ? 309  TRP A CD2   1 
ATOM   2378  N NE1   . TRP A 1 309 ? -2.858  38.149  21.699  1.00 24.39 ? 309  TRP A NE1   1 
ATOM   2379  C CE2   . TRP A 1 309 ? -2.496  37.952  23.006  1.00 21.35 ? 309  TRP A CE2   1 
ATOM   2380  C CE3   . TRP A 1 309 ? -1.189  36.366  24.296  1.00 23.46 ? 309  TRP A CE3   1 
ATOM   2381  C CZ2   . TRP A 1 309 ? -2.817  38.690  24.144  1.00 23.43 ? 309  TRP A CZ2   1 
ATOM   2382  C CZ3   . TRP A 1 309 ? -1.496  37.105  25.434  1.00 24.32 ? 309  TRP A CZ3   1 
ATOM   2383  C CH2   . TRP A 1 309 ? -2.309  38.257  25.354  1.00 23.74 ? 309  TRP A CH2   1 
ATOM   2384  N N     . VAL A 1 310 ? 1.147   32.737  21.248  1.00 21.66 ? 310  VAL A N     1 
ATOM   2385  C CA    . VAL A 1 310 ? 1.819   31.546  20.723  1.00 20.96 ? 310  VAL A CA    1 
ATOM   2386  C C     . VAL A 1 310 ? 1.472   31.245  19.238  1.00 21.25 ? 310  VAL A C     1 
ATOM   2387  O O     . VAL A 1 310 ? 2.294   30.707  18.501  1.00 20.59 ? 310  VAL A O     1 
ATOM   2388  C CB    . VAL A 1 310 ? 1.546   30.312  21.661  1.00 20.79 ? 310  VAL A CB    1 
ATOM   2389  C CG1   . VAL A 1 310 ? 0.040   29.922  21.683  1.00 18.28 ? 310  VAL A CG1   1 
ATOM   2390  C CG2   . VAL A 1 310 ? 2.450   29.142  21.313  1.00 19.09 ? 310  VAL A CG2   1 
ATOM   2391  N N     . THR A 1 311 ? 0.242   31.579  18.837  1.00 21.49 ? 311  THR A N     1 
ATOM   2392  C CA    . THR A 1 311 ? -0.201  31.469  17.450  1.00 21.76 ? 311  THR A CA    1 
ATOM   2393  C C     . THR A 1 311 ? 0.659   32.364  16.543  1.00 21.97 ? 311  THR A C     1 
ATOM   2394  O O     . THR A 1 311 ? 1.032   31.960  15.439  1.00 21.55 ? 311  THR A O     1 
ATOM   2395  C CB    . THR A 1 311 ? -1.728  31.732  17.321  1.00 21.37 ? 311  THR A CB    1 
ATOM   2396  O OG1   . THR A 1 311 ? -2.416  30.827  18.189  1.00 22.80 ? 311  THR A OG1   1 
ATOM   2397  C CG2   . THR A 1 311 ? -2.236  31.465  15.909  1.00 21.18 ? 311  THR A CG2   1 
ATOM   2398  N N     . GLY A 1 312 ? 1.002   33.554  17.046  1.00 22.15 ? 312  GLY A N     1 
ATOM   2399  C CA    . GLY A 1 312 ? 1.934   34.465  16.376  1.00 22.10 ? 312  GLY A CA    1 
ATOM   2400  C C     . GLY A 1 312 ? 3.329   33.883  16.348  1.00 22.36 ? 312  GLY A C     1 
ATOM   2401  O O     . GLY A 1 312 ? 4.022   34.012  15.361  1.00 23.94 ? 312  GLY A O     1 
ATOM   2402  N N     . HIS A 1 313 ? 3.738   33.201  17.411  1.00 21.84 ? 313  HIS A N     1 
ATOM   2403  C CA    . HIS A 1 313 ? 5.029   32.500  17.414  1.00 21.35 ? 313  HIS A CA    1 
ATOM   2404  C C     . HIS A 1 313 ? 5.081   31.355  16.385  1.00 21.50 ? 313  HIS A C     1 
ATOM   2405  O O     . HIS A 1 313 ? 5.876   31.384  15.447  1.00 21.20 ? 313  HIS A O     1 
ATOM   2406  C CB    . HIS A 1 313 ? 5.338   31.935  18.806  1.00 20.30 ? 313  HIS A CB    1 
ATOM   2407  C CG    . HIS A 1 313 ? 5.708   32.968  19.817  1.00 20.14 ? 313  HIS A CG    1 
ATOM   2408  N ND1   . HIS A 1 313 ? 5.052   34.183  19.932  1.00 18.10 ? 313  HIS A ND1   1 
ATOM   2409  C CD2   . HIS A 1 313 ? 6.638   32.946  20.805  1.00 19.72 ? 313  HIS A CD2   1 
ATOM   2410  C CE1   . HIS A 1 313 ? 5.582   34.869  20.932  1.00 18.03 ? 313  HIS A CE1   1 
ATOM   2411  N NE2   . HIS A 1 313 ? 6.537   34.138  21.487  1.00 17.56 ? 313  HIS A NE2   1 
ATOM   2412  N N     . SER A 1 314 ? 4.251   30.335  16.590  1.00 21.89 ? 314  SER A N     1 
ATOM   2413  C CA    . SER A 1 314 ? 4.302   29.118  15.762  1.00 22.40 ? 314  SER A CA    1 
ATOM   2414  C C     . SER A 1 314 ? 3.797   29.289  14.322  1.00 22.34 ? 314  SER A C     1 
ATOM   2415  O O     . SER A 1 314 ? 4.381   28.703  13.392  1.00 21.36 ? 314  SER A O     1 
ATOM   2416  C CB    . SER A 1 314 ? 3.548   27.973  16.437  1.00 22.18 ? 314  SER A CB    1 
ATOM   2417  O OG    . SER A 1 314 ? 4.011   27.793  17.748  1.00 23.34 ? 314  SER A OG    1 
ATOM   2418  N N     . TYR A 1 315 ? 2.730   30.085  14.153  1.00 22.23 ? 315  TYR A N     1 
ATOM   2419  C CA    . TYR A 1 315 ? 2.024   30.139  12.884  1.00 22.84 ? 315  TYR A CA    1 
ATOM   2420  C C     . TYR A 1 315 ? 2.039   31.466  12.118  1.00 24.12 ? 315  TYR A C     1 
ATOM   2421  O O     . TYR A 1 315 ? 1.572   31.531  10.983  1.00 24.82 ? 315  TYR A O     1 
ATOM   2422  C CB    . TYR A 1 315 ? 0.628   29.501  13.015  1.00 21.86 ? 315  TYR A CB    1 
ATOM   2423  C CG    . TYR A 1 315 ? 0.766   28.073  13.491  1.00 21.22 ? 315  TYR A CG    1 
ATOM   2424  C CD1   . TYR A 1 315 ? 0.495   27.733  14.820  1.00 20.95 ? 315  TYR A CD1   1 
ATOM   2425  C CD2   . TYR A 1 315 ? 1.266   27.072  12.641  1.00 21.03 ? 315  TYR A CD2   1 
ATOM   2426  C CE1   . TYR A 1 315 ? 0.694   26.435  15.289  1.00 20.49 ? 315  TYR A CE1   1 
ATOM   2427  C CE2   . TYR A 1 315 ? 1.464   25.757  13.098  1.00 21.62 ? 315  TYR A CE2   1 
ATOM   2428  C CZ    . TYR A 1 315 ? 1.172   25.450  14.430  1.00 21.60 ? 315  TYR A CZ    1 
ATOM   2429  O OH    . TYR A 1 315 ? 1.324   24.162  14.905  1.00 21.48 ? 315  TYR A OH    1 
ATOM   2430  N N     . LEU A 1 316 ? 2.606   32.511  12.705  1.00 25.77 ? 316  LEU A N     1 
ATOM   2431  C CA    . LEU A 1 316 ? 2.910   33.719  11.941  1.00 26.05 ? 316  LEU A CA    1 
ATOM   2432  C C     . LEU A 1 316 ? 4.374   33.624  11.521  1.00 26.15 ? 316  LEU A C     1 
ATOM   2433  O O     . LEU A 1 316 ? 4.714   33.864  10.360  1.00 26.39 ? 316  LEU A O     1 
ATOM   2434  C CB    . LEU A 1 316 ? 2.643   34.989  12.772  1.00 27.01 ? 316  LEU A CB    1 
ATOM   2435  C CG    . LEU A 1 316 ? 2.754   36.451  12.267  1.00 27.64 ? 316  LEU A CG    1 
ATOM   2436  C CD1   . LEU A 1 316 ? 3.956   36.695  11.356  1.00 29.97 ? 316  LEU A CD1   1 
ATOM   2437  C CD2   . LEU A 1 316 ? 1.466   36.907  11.533  1.00 30.03 ? 316  LEU A CD2   1 
ATOM   2438  N N     . LEU A 1 317 ? 5.234   33.238  12.461  1.00 26.00 ? 317  LEU A N     1 
ATOM   2439  C CA    . LEU A 1 317 ? 6.680   33.215  12.228  1.00 25.48 ? 317  LEU A CA    1 
ATOM   2440  C C     . LEU A 1 317 ? 7.321   31.873  11.927  1.00 24.28 ? 317  LEU A C     1 
ATOM   2441  O O     . LEU A 1 317 ? 7.766   31.622  10.797  1.00 24.45 ? 317  LEU A O     1 
ATOM   2442  C CB    . LEU A 1 317 ? 7.414   33.804  13.435  1.00 26.67 ? 317  LEU A CB    1 
ATOM   2443  C CG    . LEU A 1 317 ? 7.559   35.320  13.486  1.00 29.52 ? 317  LEU A CG    1 
ATOM   2444  C CD1   . LEU A 1 317 ? 8.693   35.632  14.451  1.00 30.18 ? 317  LEU A CD1   1 
ATOM   2445  C CD2   . LEU A 1 317 ? 7.848   35.868  12.070  1.00 29.64 ? 317  LEU A CD2   1 
ATOM   2446  N N     . TYR A 1 318 ? 7.410   31.029  12.950  1.00 22.60 ? 318  TYR A N     1 
ATOM   2447  C CA    . TYR A 1 318 ? 8.372   29.927  12.941  1.00 21.42 ? 318  TYR A CA    1 
ATOM   2448  C C     . TYR A 1 318 ? 8.065   28.786  11.970  1.00 21.07 ? 318  TYR A C     1 
ATOM   2449  O O     . TYR A 1 318 ? 8.940   28.390  11.210  1.00 20.24 ? 318  TYR A O     1 
ATOM   2450  C CB    . TYR A 1 318 ? 8.666   29.447  14.373  1.00 21.11 ? 318  TYR A CB    1 
ATOM   2451  C CG    . TYR A 1 318 ? 9.425   30.476  15.197  1.00 20.11 ? 318  TYR A CG    1 
ATOM   2452  C CD1   . TYR A 1 318 ? 10.417  31.245  14.619  1.00 18.96 ? 318  TYR A CD1   1 
ATOM   2453  C CD2   . TYR A 1 318 ? 9.141   30.679  16.557  1.00 21.21 ? 318  TYR A CD2   1 
ATOM   2454  C CE1   . TYR A 1 318 ? 11.114  32.202  15.359  1.00 21.91 ? 318  TYR A CE1   1 
ATOM   2455  C CE2   . TYR A 1 318 ? 9.837   31.633  17.323  1.00 19.93 ? 318  TYR A CE2   1 
ATOM   2456  C CZ    . TYR A 1 318 ? 10.836  32.387  16.711  1.00 21.90 ? 318  TYR A CZ    1 
ATOM   2457  O OH    . TYR A 1 318 ? 11.584  33.319  17.413  1.00 21.21 ? 318  TYR A OH    1 
ATOM   2458  N N     . GLY A 1 319 ? 6.831   28.276  11.995  1.00 21.58 ? 319  GLY A N     1 
ATOM   2459  C CA    . GLY A 1 319 ? 6.363   27.237  11.042  1.00 21.70 ? 319  GLY A CA    1 
ATOM   2460  C C     . GLY A 1 319 ? 6.470   27.730  9.610   1.00 21.54 ? 319  GLY A C     1 
ATOM   2461  O O     . GLY A 1 319 ? 7.127   27.106  8.780   1.00 20.37 ? 319  GLY A O     1 
ATOM   2462  N N     . PRO A 1 320 ? 5.852   28.887  9.325   1.00 22.22 ? 320  PRO A N     1 
ATOM   2463  C CA    . PRO A 1 320 ? 5.933   29.454  7.973   1.00 22.69 ? 320  PRO A CA    1 
ATOM   2464  C C     . PRO A 1 320 ? 7.351   29.646  7.429   1.00 22.57 ? 320  PRO A C     1 
ATOM   2465  O O     . PRO A 1 320 ? 7.624   29.215  6.294   1.00 22.86 ? 320  PRO A O     1 
ATOM   2466  C CB    . PRO A 1 320 ? 5.151   30.777  8.095   1.00 22.31 ? 320  PRO A CB    1 
ATOM   2467  C CG    . PRO A 1 320 ? 4.144   30.472  9.148   1.00 22.62 ? 320  PRO A CG    1 
ATOM   2468  C CD    . PRO A 1 320 ? 4.963   29.695  10.179  1.00 22.14 ? 320  PRO A CD    1 
ATOM   2469  N N     . LEU A 1 321 ? 8.234   30.274  8.210   1.00 22.21 ? 321  LEU A N     1 
ATOM   2470  C CA    . LEU A 1 321 ? 9.586   30.552  7.724   1.00 21.92 ? 321  LEU A CA    1 
ATOM   2471  C C     . LEU A 1 321 ? 10.476  29.293  7.638   1.00 21.66 ? 321  LEU A C     1 
ATOM   2472  O O     . LEU A 1 321 ? 11.271  29.185  6.727   1.00 21.64 ? 321  LEU A O     1 
ATOM   2473  C CB    . LEU A 1 321 ? 10.279  31.697  8.499   1.00 22.10 ? 321  LEU A CB    1 
ATOM   2474  C CG    . LEU A 1 321 ? 9.736   33.141  8.521   1.00 22.85 ? 321  LEU A CG    1 
ATOM   2475  C CD1   . LEU A 1 321 ? 10.470  33.966  9.560   1.00 22.91 ? 321  LEU A CD1   1 
ATOM   2476  C CD2   . LEU A 1 321 ? 9.755   33.847  7.162   1.00 20.64 ? 321  LEU A CD2   1 
ATOM   2477  N N     . ALA A 1 322 ? 10.344  28.339  8.549   1.00 21.52 ? 322  ALA A N     1 
ATOM   2478  C CA    . ALA A 1 322 ? 11.070  27.068  8.382   1.00 21.88 ? 322  ALA A CA    1 
ATOM   2479  C C     . ALA A 1 322 ? 10.717  26.439  7.040   1.00 22.62 ? 322  ALA A C     1 
ATOM   2480  O O     . ALA A 1 322 ? 11.574  25.836  6.381   1.00 22.57 ? 322  ALA A O     1 
ATOM   2481  C CB    . ALA A 1 322 ? 10.767  26.079  9.517   1.00 21.29 ? 322  ALA A CB    1 
ATOM   2482  N N     . CYS A 1 323 ? 9.450   26.575  6.631   1.00 23.24 ? 323  CYS A N     1 
ATOM   2483  C CA    . CYS A 1 323 ? 8.990   25.952  5.387   1.00 23.55 ? 323  CYS A CA    1 
ATOM   2484  C C     . CYS A 1 323 ? 9.275   26.762  4.117   1.00 23.69 ? 323  CYS A C     1 
ATOM   2485  O O     . CYS A 1 323 ? 9.033   26.279  3.007   1.00 24.43 ? 323  CYS A O     1 
ATOM   2486  C CB    . CYS A 1 323 ? 7.513   25.611  5.481   1.00 23.52 ? 323  CYS A CB    1 
ATOM   2487  S SG    . CYS A 1 323 ? 7.185   24.256  6.579   1.00 25.23 ? 323  CYS A SG    1 
ATOM   2488  N N     . GLY A 1 324 ? 9.793   27.979  4.277   1.00 23.54 ? 324  GLY A N     1 
ATOM   2489  C CA    . GLY A 1 324 ? 10.166  28.822  3.150   1.00 22.96 ? 324  GLY A CA    1 
ATOM   2490  C C     . GLY A 1 324 ? 8.990   29.589  2.595   1.00 23.21 ? 324  GLY A C     1 
ATOM   2491  O O     . GLY A 1 324 ? 9.038   30.080  1.484   1.00 23.81 ? 324  GLY A O     1 
ATOM   2492  N N     . ALA A 1 325 ? 7.927   29.706  3.380   1.00 23.49 ? 325  ALA A N     1 
ATOM   2493  C CA    . ALA A 1 325 ? 6.681   30.326  2.924   1.00 23.48 ? 325  ALA A CA    1 
ATOM   2494  C C     . ALA A 1 325 ? 6.776   31.847  2.914   1.00 22.93 ? 325  ALA A C     1 
ATOM   2495  O O     . ALA A 1 325 ? 7.609   32.404  3.588   1.00 23.02 ? 325  ALA A O     1 
ATOM   2496  C CB    . ALA A 1 325 ? 5.499   29.873  3.836   1.00 23.31 ? 325  ALA A CB    1 
ATOM   2497  N N     . THR A 1 326 ? 5.913   32.506  2.144   1.00 22.68 ? 326  THR A N     1 
ATOM   2498  C CA    . THR A 1 326 ? 5.645   33.921  2.329   1.00 21.56 ? 326  THR A CA    1 
ATOM   2499  C C     . THR A 1 326 ? 4.542   34.015  3.380   1.00 21.44 ? 326  THR A C     1 
ATOM   2500  O O     . THR A 1 326 ? 3.449   33.429  3.241   1.00 21.00 ? 326  THR A O     1 
ATOM   2501  C CB    . THR A 1 326 ? 5.183   34.605  1.031   1.00 21.69 ? 326  THR A CB    1 
ATOM   2502  O OG1   . THR A 1 326 ? 6.104   34.336  -0.018  1.00 21.15 ? 326  THR A OG1   1 
ATOM   2503  C CG2   . THR A 1 326 ? 5.073   36.132  1.218   1.00 21.90 ? 326  THR A CG2   1 
ATOM   2504  N N     . THR A 1 327 ? 4.843   34.751  4.444   1.00 21.37 ? 327  THR A N     1 
ATOM   2505  C CA    . THR A 1 327 ? 3.908   34.947  5.551   1.00 20.59 ? 327  THR A CA    1 
ATOM   2506  C C     . THR A 1 327 ? 3.596   36.444  5.675   1.00 20.77 ? 327  THR A C     1 
ATOM   2507  O O     . THR A 1 327 ? 4.474   37.289  5.577   1.00 20.60 ? 327  THR A O     1 
ATOM   2508  C CB    . THR A 1 327 ? 4.432   34.343  6.893   1.00 20.58 ? 327  THR A CB    1 
ATOM   2509  O OG1   . THR A 1 327 ? 3.358   34.275  7.859   1.00 18.71 ? 327  THR A OG1   1 
ATOM   2510  C CG2   . THR A 1 327 ? 5.584   35.161  7.448   1.00 18.85 ? 327  THR A CG2   1 
ATOM   2511  N N     . LEU A 1 328 ? 2.320   36.747  5.833   1.00 20.74 ? 328  LEU A N     1 
ATOM   2512  C CA    . LEU A 1 328 ? 1.858   38.111  5.931   1.00 21.17 ? 328  LEU A CA    1 
ATOM   2513  C C     . LEU A 1 328 ? 1.701   38.569  7.396   1.00 21.78 ? 328  LEU A C     1 
ATOM   2514  O O     . LEU A 1 328 ? 1.130   37.869  8.216   1.00 20.72 ? 328  LEU A O     1 
ATOM   2515  C CB    . LEU A 1 328 ? 0.546   38.228  5.185   1.00 20.31 ? 328  LEU A CB    1 
ATOM   2516  C CG    . LEU A 1 328 ? 0.029   39.611  4.873   1.00 20.65 ? 328  LEU A CG    1 
ATOM   2517  C CD1   . LEU A 1 328 ? -0.934  39.480  3.693   1.00 20.92 ? 328  LEU A CD1   1 
ATOM   2518  C CD2   . LEU A 1 328 ? -0.644  40.256  6.076   1.00 18.23 ? 328  LEU A CD2   1 
ATOM   2519  N N     . MET A 1 329 ? 2.234   39.754  7.689   1.00 23.74 ? 329  MET A N     1 
ATOM   2520  C CA    . MET A 1 329 ? 2.114   40.414  8.977   1.00 25.58 ? 329  MET A CA    1 
ATOM   2521  C C     . MET A 1 329 ? 1.293   41.664  8.782   1.00 25.53 ? 329  MET A C     1 
ATOM   2522  O O     . MET A 1 329 ? 1.681   42.546  8.004   1.00 26.43 ? 329  MET A O     1 
ATOM   2523  C CB    . MET A 1 329 ? 3.492   40.818  9.511   1.00 25.65 ? 329  MET A CB    1 
ATOM   2524  C CG    . MET A 1 329 ? 3.435   41.475  10.921  1.00 28.05 ? 329  MET A CG    1 
ATOM   2525  S SD    . MET A 1 329 ? 5.047   41.801  11.703  1.00 29.45 ? 329  MET A SD    1 
ATOM   2526  C CE    . MET A 1 329 ? 5.452   40.161  12.306  1.00 30.30 ? 329  MET A CE    1 
ATOM   2527  N N     . PHE A 1 330 ? 0.177   41.753  9.501   1.00 25.50 ? 330  PHE A N     1 
ATOM   2528  C CA    . PHE A 1 330 ? -0.747  42.879  9.379   1.00 25.74 ? 330  PHE A CA    1 
ATOM   2529  C C     . PHE A 1 330 ? -0.686  43.703  10.646  1.00 25.45 ? 330  PHE A C     1 
ATOM   2530  O O     . PHE A 1 330 ? -0.790  43.163  11.749  1.00 26.13 ? 330  PHE A O     1 
ATOM   2531  C CB    . PHE A 1 330 ? -2.172  42.356  9.113   1.00 25.82 ? 330  PHE A CB    1 
ATOM   2532  C CG    . PHE A 1 330 ? -3.237  43.416  9.072   1.00 26.10 ? 330  PHE A CG    1 
ATOM   2533  C CD1   . PHE A 1 330 ? -3.049  44.610  8.365   1.00 26.62 ? 330  PHE A CD1   1 
ATOM   2534  C CD2   . PHE A 1 330 ? -4.460  43.202  9.700   1.00 25.78 ? 330  PHE A CD2   1 
ATOM   2535  C CE1   . PHE A 1 330 ? -4.054  45.588  8.324   1.00 25.77 ? 330  PHE A CE1   1 
ATOM   2536  C CE2   . PHE A 1 330 ? -5.465  44.179  9.651   1.00 25.24 ? 330  PHE A CE2   1 
ATOM   2537  C CZ    . PHE A 1 330 ? -5.267  45.364  8.962   1.00 23.89 ? 330  PHE A CZ    1 
ATOM   2538  N N     . GLU A 1 331 ? -0.499  45.006  10.485  1.00 25.53 ? 331  GLU A N     1 
ATOM   2539  C CA    . GLU A 1 331 ? -0.318  45.905  11.616  1.00 26.36 ? 331  GLU A CA    1 
ATOM   2540  C C     . GLU A 1 331 ? -1.644  46.278  12.281  1.00 26.48 ? 331  GLU A C     1 
ATOM   2541  O O     . GLU A 1 331 ? -1.662  46.653  13.459  1.00 26.43 ? 331  GLU A O     1 
ATOM   2542  C CB    . GLU A 1 331 ? 0.397   47.171  11.158  1.00 26.73 ? 331  GLU A CB    1 
ATOM   2543  C CG    . GLU A 1 331 ? 0.913   48.086  12.278  1.00 26.78 ? 331  GLU A CG    1 
ATOM   2544  C CD    . GLU A 1 331 ? 1.377   49.472  11.771  1.00 27.30 ? 331  GLU A CD    1 
ATOM   2545  O OE1   . GLU A 1 331 ? 0.909   49.942  10.689  1.00 27.61 ? 331  GLU A OE1   1 
ATOM   2546  O OE2   . GLU A 1 331 ? 2.194   50.104  12.485  1.00 28.17 ? 331  GLU A OE2   1 
ATOM   2547  N N     . GLY A 1 332 ? -2.745  46.163  11.536  1.00 26.19 ? 332  GLY A N     1 
ATOM   2548  C CA    . GLY A 1 332 ? -4.021  46.712  11.981  1.00 26.78 ? 332  GLY A CA    1 
ATOM   2549  C C     . GLY A 1 332 ? -5.029  45.710  12.535  1.00 27.19 ? 332  GLY A C     1 
ATOM   2550  O O     . GLY A 1 332 ? -4.657  44.678  13.107  1.00 26.24 ? 332  GLY A O     1 
ATOM   2551  N N     . VAL A 1 333 ? -6.312  46.043  12.366  1.00 27.46 ? 333  VAL A N     1 
ATOM   2552  C CA    . VAL A 1 333 ? -7.427  45.185  12.793  1.00 27.75 ? 333  VAL A CA    1 
ATOM   2553  C C     . VAL A 1 333 ? -8.315  44.854  11.585  1.00 27.77 ? 333  VAL A C     1 
ATOM   2554  O O     . VAL A 1 333 ? -8.407  45.646  10.659  1.00 27.85 ? 333  VAL A O     1 
ATOM   2555  C CB    . VAL A 1 333 ? -8.264  45.826  13.961  1.00 27.92 ? 333  VAL A CB    1 
ATOM   2556  C CG1   . VAL A 1 333 ? -7.488  45.830  15.255  1.00 26.20 ? 333  VAL A CG1   1 
ATOM   2557  C CG2   . VAL A 1 333 ? -8.699  47.238  13.608  1.00 28.34 ? 333  VAL A CG2   1 
ATOM   2558  N N     . PRO A 1 334 ? -8.992  43.694  11.604  1.00 28.23 ? 334  PRO A N     1 
ATOM   2559  C CA    . PRO A 1 334 ? -9.688  43.227  10.386  1.00 28.51 ? 334  PRO A CA    1 
ATOM   2560  C C     . PRO A 1 334 ? -10.890 44.086  9.997   1.00 28.71 ? 334  PRO A C     1 
ATOM   2561  O O     . PRO A 1 334 ? -11.380 43.984  8.861   1.00 28.67 ? 334  PRO A O     1 
ATOM   2562  C CB    . PRO A 1 334 ? -10.146 41.817  10.753  1.00 29.02 ? 334  PRO A CB    1 
ATOM   2563  C CG    . PRO A 1 334 ? -10.227 41.811  12.279  1.00 29.43 ? 334  PRO A CG    1 
ATOM   2564  C CD    . PRO A 1 334 ? -9.181  42.788  12.755  1.00 28.34 ? 334  PRO A CD    1 
ATOM   2565  N N     . ASN A 1 335 ? -11.341 44.938  10.921  1.00 28.25 ? 335  ASN A N     1 
ATOM   2566  C CA    . ASN A 1 335 ? -12.499 45.793  10.682  1.00 28.26 ? 335  ASN A CA    1 
ATOM   2567  C C     . ASN A 1 335 ? -12.202 47.287  10.700  1.00 27.72 ? 335  ASN A C     1 
ATOM   2568  O O     . ASN A 1 335 ? -13.101 48.077  11.003  1.00 28.44 ? 335  ASN A O     1 
ATOM   2569  C CB    . ASN A 1 335 ? -13.654 45.467  11.666  1.00 28.46 ? 335  ASN A CB    1 
ATOM   2570  C CG    . ASN A 1 335 ? -13.246 45.562  13.154  1.00 30.79 ? 335  ASN A CG    1 
ATOM   2571  O OD1   . ASN A 1 335 ? -13.990 45.103  14.033  1.00 35.07 ? 335  ASN A OD1   1 
ATOM   2572  N ND2   . ASN A 1 335 ? -12.078 46.134  13.441  1.00 30.22 ? 335  ASN A ND2   1 
ATOM   2573  N N     . TRP A 1 336 ? -10.965 47.683  10.398  1.00 26.43 ? 336  TRP A N     1 
ATOM   2574  C CA    . TRP A 1 336 ? -10.623 49.111  10.294  1.00 25.57 ? 336  TRP A CA    1 
ATOM   2575  C C     . TRP A 1 336 ? -9.773  49.371  9.042   1.00 25.23 ? 336  TRP A C     1 
ATOM   2576  O O     . TRP A 1 336 ? -8.786  48.659  8.809   1.00 24.88 ? 336  TRP A O     1 
ATOM   2577  C CB    . TRP A 1 336 ? -9.895  49.628  11.567  1.00 25.76 ? 336  TRP A CB    1 
ATOM   2578  C CG    . TRP A 1 336 ? -9.864  51.137  11.645  1.00 26.21 ? 336  TRP A CG    1 
ATOM   2579  C CD1   . TRP A 1 336 ? -10.771 51.961  12.293  1.00 26.31 ? 336  TRP A CD1   1 
ATOM   2580  C CD2   . TRP A 1 336 ? -8.915  52.007  11.018  1.00 26.26 ? 336  TRP A CD2   1 
ATOM   2581  N NE1   . TRP A 1 336 ? -10.428 53.277  12.100  1.00 25.48 ? 336  TRP A NE1   1 
ATOM   2582  C CE2   . TRP A 1 336 ? -9.302  53.333  11.313  1.00 26.52 ? 336  TRP A CE2   1 
ATOM   2583  C CE3   . TRP A 1 336 ? -7.773  51.795  10.229  1.00 27.36 ? 336  TRP A CE3   1 
ATOM   2584  C CZ2   . TRP A 1 336 ? -8.581  54.443  10.853  1.00 27.02 ? 336  TRP A CZ2   1 
ATOM   2585  C CZ3   . TRP A 1 336 ? -7.055  52.911  9.763   1.00 27.04 ? 336  TRP A CZ3   1 
ATOM   2586  C CH2   . TRP A 1 336 ? -7.464  54.212  10.082  1.00 26.23 ? 336  TRP A CH2   1 
ATOM   2587  N N     . PRO A 1 337 ? -10.106 50.422  8.262   1.00 24.65 ? 337  PRO A N     1 
ATOM   2588  C CA    . PRO A 1 337 ? -11.187 51.429  8.431   1.00 24.74 ? 337  PRO A CA    1 
ATOM   2589  C C     . PRO A 1 337 ? -12.649 50.911  8.348   1.00 24.41 ? 337  PRO A C     1 
ATOM   2590  O O     . PRO A 1 337 ? -13.528 51.471  9.000   1.00 24.34 ? 337  PRO A O     1 
ATOM   2591  C CB    . PRO A 1 337 ? -10.923 52.431  7.285   1.00 24.62 ? 337  PRO A CB    1 
ATOM   2592  C CG    . PRO A 1 337 ? -9.520  52.148  6.823   1.00 24.66 ? 337  PRO A CG    1 
ATOM   2593  C CD    . PRO A 1 337 ? -9.282  50.698  7.076   1.00 24.34 ? 337  PRO A CD    1 
ATOM   2594  N N     . THR A 1 338 ? -12.886 49.885  7.525   1.00 23.85 ? 338  THR A N     1 
ATOM   2595  C CA    . THR A 1 338 ? -14.222 49.356  7.253   1.00 22.82 ? 338  THR A CA    1 
ATOM   2596  C C     . THR A 1 338 ? -14.187 47.877  7.557   1.00 22.51 ? 338  THR A C     1 
ATOM   2597  O O     . THR A 1 338 ? -13.089 47.301  7.610   1.00 22.30 ? 338  THR A O     1 
ATOM   2598  C CB    . THR A 1 338 ? -14.668 49.577  5.751   1.00 22.97 ? 338  THR A CB    1 
ATOM   2599  O OG1   . THR A 1 338 ? -14.051 48.604  4.881   1.00 21.75 ? 338  THR A OG1   1 
ATOM   2600  C CG2   . THR A 1 338 ? -14.323 51.000  5.270   1.00 22.00 ? 338  THR A CG2   1 
ATOM   2601  N N     . PRO A 1 339 ? -15.381 47.243  7.743   1.00 22.55 ? 339  PRO A N     1 
ATOM   2602  C CA    . PRO A 1 339 ? -15.400 45.776  7.993   1.00 21.54 ? 339  PRO A CA    1 
ATOM   2603  C C     . PRO A 1 339 ? -14.833 44.976  6.830   1.00 21.44 ? 339  PRO A C     1 
ATOM   2604  O O     . PRO A 1 339 ? -14.401 43.834  7.029   1.00 22.18 ? 339  PRO A O     1 
ATOM   2605  C CB    . PRO A 1 339 ? -16.878 45.457  8.219   1.00 21.48 ? 339  PRO A CB    1 
ATOM   2606  C CG    . PRO A 1 339 ? -17.556 46.842  8.515   1.00 21.79 ? 339  PRO A CG    1 
ATOM   2607  C CD    . PRO A 1 339 ? -16.746 47.840  7.741   1.00 21.74 ? 339  PRO A CD    1 
ATOM   2608  N N     . ALA A 1 340 ? -14.771 45.577  5.639   1.00 20.99 ? 340  ALA A N     1 
ATOM   2609  C CA    . ALA A 1 340 ? -14.213 44.875  4.478   1.00 20.53 ? 340  ALA A CA    1 
ATOM   2610  C C     . ALA A 1 340 ? -12.692 44.776  4.469   1.00 20.52 ? 340  ALA A C     1 
ATOM   2611  O O     . ALA A 1 340 ? -12.120 44.195  3.528   1.00 20.69 ? 340  ALA A O     1 
ATOM   2612  C CB    . ALA A 1 340 ? -14.695 45.496  3.181   1.00 20.57 ? 340  ALA A CB    1 
ATOM   2613  N N     . ARG A 1 341 ? -12.039 45.341  5.485   1.00 19.57 ? 341  ARG A N     1 
ATOM   2614  C CA    . ARG A 1 341 ? -10.580 45.427  5.486   1.00 20.29 ? 341  ARG A CA    1 
ATOM   2615  C C     . ARG A 1 341 ? -9.869  44.066  5.348   1.00 20.32 ? 341  ARG A C     1 
ATOM   2616  O O     . ARG A 1 341 ? -8.965  43.911  4.512   1.00 20.64 ? 341  ARG A O     1 
ATOM   2617  C CB    . ARG A 1 341 ? -10.044 46.197  6.710   1.00 19.63 ? 341  ARG A CB    1 
ATOM   2618  C CG    . ARG A 1 341 ? -8.527  46.332  6.711   1.00 19.68 ? 341  ARG A CG    1 
ATOM   2619  C CD    . ARG A 1 341 ? -8.042  47.200  5.510   1.00 20.67 ? 341  ARG A CD    1 
ATOM   2620  N NE    . ARG A 1 341 ? -6.580  47.398  5.402   1.00 17.42 ? 341  ARG A NE    1 
ATOM   2621  C CZ    . ARG A 1 341 ? -5.842  48.130  6.226   1.00 15.62 ? 341  ARG A CZ    1 
ATOM   2622  N NH1   . ARG A 1 341 ? -6.391  48.715  7.265   1.00 16.50 ? 341  ARG A NH1   1 
ATOM   2623  N NH2   . ARG A 1 341 ? -4.536  48.255  6.033   1.00 16.46 ? 341  ARG A NH2   1 
ATOM   2624  N N     . MET A 1 342 ? -10.266 43.095  6.161   1.00 20.29 ? 342  MET A N     1 
ATOM   2625  C CA    . MET A 1 342 ? -9.629  41.797  6.105   1.00 21.16 ? 342  MET A CA    1 
ATOM   2626  C C     . MET A 1 342 ? -9.654  41.238  4.673   1.00 21.54 ? 342  MET A C     1 
ATOM   2627  O O     . MET A 1 342 ? -8.640  40.717  4.192   1.00 21.87 ? 342  MET A O     1 
ATOM   2628  C CB    . MET A 1 342 ? -10.262 40.822  7.074   1.00 20.67 ? 342  MET A CB    1 
ATOM   2629  C CG    . MET A 1 342 ? -9.618  39.441  7.019   1.00 22.06 ? 342  MET A CG    1 
ATOM   2630  S SD    . MET A 1 342 ? -10.392 38.284  8.166   1.00 21.76 ? 342  MET A SD    1 
ATOM   2631  C CE    . MET A 1 342 ? -11.637 37.612  7.040   1.00 18.88 ? 342  MET A CE    1 
ATOM   2632  N N     . CYS A 1 343 ? -10.787 41.383  3.983   1.00 21.25 ? 343  CYS A N     1 
ATOM   2633  C CA    . CYS A 1 343 ? -10.877 40.857  2.628   1.00 21.49 ? 343  CYS A CA    1 
ATOM   2634  C C     . CYS A 1 343 ? -10.144 41.704  1.606   1.00 20.93 ? 343  CYS A C     1 
ATOM   2635  O O     . CYS A 1 343 ? -9.748  41.197  0.555   1.00 21.63 ? 343  CYS A O     1 
ATOM   2636  C CB    . CYS A 1 343 ? -12.323 40.584  2.234   1.00 21.89 ? 343  CYS A CB    1 
ATOM   2637  S SG    . CYS A 1 343 ? -13.028 39.186  3.165   1.00 23.44 ? 343  CYS A SG    1 
ATOM   2638  N N     . GLN A 1 344 ? -9.940  42.979  1.925   1.00 20.74 ? 344  GLN A N     1 
ATOM   2639  C CA    . GLN A 1 344 ? -9.138  43.878  1.093   1.00 20.62 ? 344  GLN A CA    1 
ATOM   2640  C C     . GLN A 1 344 ? -7.683  43.474  1.165   1.00 21.36 ? 344  GLN A C     1 
ATOM   2641  O O     . GLN A 1 344 ? -6.975  43.516  0.139   1.00 22.30 ? 344  GLN A O     1 
ATOM   2642  C CB    . GLN A 1 344 ? -9.278  45.338  1.520   1.00 20.61 ? 344  GLN A CB    1 
ATOM   2643  C CG    . GLN A 1 344 ? -10.551 46.047  1.039   1.00 19.62 ? 344  GLN A CG    1 
ATOM   2644  C CD    . GLN A 1 344 ? -10.968 47.249  1.918   1.00 19.90 ? 344  GLN A CD    1 
ATOM   2645  O OE1   . GLN A 1 344 ? -11.932 47.937  1.615   1.00 21.21 ? 344  GLN A OE1   1 
ATOM   2646  N NE2   . GLN A 1 344 ? -10.247 47.492  2.994   1.00 20.83 ? 344  GLN A NE2   1 
ATOM   2647  N N     . VAL A 1 345 ? -7.236  43.070  2.362   1.00 21.11 ? 345  VAL A N     1 
ATOM   2648  C CA    . VAL A 1 345 ? -5.868  42.581  2.536   1.00 20.53 ? 345  VAL A CA    1 
ATOM   2649  C C     . VAL A 1 345 ? -5.720  41.277  1.742   1.00 20.61 ? 345  VAL A C     1 
ATOM   2650  O O     . VAL A 1 345 ? -4.788  41.132  0.937   1.00 20.89 ? 345  VAL A O     1 
ATOM   2651  C CB    . VAL A 1 345 ? -5.456  42.440  4.052   1.00 20.92 ? 345  VAL A CB    1 
ATOM   2652  C CG1   . VAL A 1 345 ? -4.004  41.992  4.204   1.00 20.01 ? 345  VAL A CG1   1 
ATOM   2653  C CG2   . VAL A 1 345 ? -5.671  43.758  4.810   1.00 19.55 ? 345  VAL A CG2   1 
ATOM   2654  N N     . VAL A 1 346 ? -6.655  40.345  1.932   1.00 20.20 ? 346  VAL A N     1 
ATOM   2655  C CA    . VAL A 1 346 ? -6.673  39.105  1.139   1.00 19.60 ? 346  VAL A CA    1 
ATOM   2656  C C     . VAL A 1 346 ? -6.517  39.406  -0.369  1.00 20.34 ? 346  VAL A C     1 
ATOM   2657  O O     . VAL A 1 346 ? -5.620  38.867  -1.040  1.00 19.09 ? 346  VAL A O     1 
ATOM   2658  C CB    . VAL A 1 346 ? -7.956  38.286  1.407   1.00 19.74 ? 346  VAL A CB    1 
ATOM   2659  C CG1   . VAL A 1 346 ? -8.244  37.252  0.287   1.00 15.40 ? 346  VAL A CG1   1 
ATOM   2660  C CG2   . VAL A 1 346 ? -7.937  37.661  2.853   1.00 19.32 ? 346  VAL A CG2   1 
ATOM   2661  N N     . ASP A 1 347 ? -7.386  40.283  -0.874  1.00 21.21 ? 347  ASP A N     1 
ATOM   2662  C CA    . ASP A 1 347 ? -7.362  40.709  -2.282  1.00 22.14 ? 347  ASP A CA    1 
ATOM   2663  C C     . ASP A 1 347 ? -6.048  41.382  -2.691  1.00 21.78 ? 347  ASP A C     1 
ATOM   2664  O O     . ASP A 1 347 ? -5.491  41.070  -3.737  1.00 21.22 ? 347  ASP A O     1 
ATOM   2665  C CB    . ASP A 1 347 ? -8.538  41.664  -2.575  1.00 22.26 ? 347  ASP A CB    1 
ATOM   2666  C CG    . ASP A 1 347 ? -9.822  40.937  -2.931  1.00 24.17 ? 347  ASP A CG    1 
ATOM   2667  O OD1   . ASP A 1 347 ? -9.841  39.679  -2.913  1.00 24.07 ? 347  ASP A OD1   1 
ATOM   2668  O OD2   . ASP A 1 347 ? -10.823 41.646  -3.236  1.00 26.48 ? 347  ASP A OD2   1 
ATOM   2669  N N     . LYS A 1 348 ? -5.570  42.309  -1.862  1.00 22.32 ? 348  LYS A N     1 
ATOM   2670  C CA    . LYS A 1 348 ? -4.393  43.106  -2.185  1.00 22.40 ? 348  LYS A CA    1 
ATOM   2671  C C     . LYS A 1 348 ? -3.167  42.237  -2.313  1.00 22.89 ? 348  LYS A C     1 
ATOM   2672  O O     . LYS A 1 348 ? -2.369  42.417  -3.247  1.00 23.45 ? 348  LYS A O     1 
ATOM   2673  C CB    . LYS A 1 348 ? -4.165  44.187  -1.139  1.00 22.26 ? 348  LYS A CB    1 
ATOM   2674  C CG    . LYS A 1 348 ? -3.030  45.168  -1.469  1.00 23.11 ? 348  LYS A CG    1 
ATOM   2675  C CD    . LYS A 1 348 ? -2.814  46.167  -0.327  1.00 22.96 ? 348  LYS A CD    1 
ATOM   2676  C CE    . LYS A 1 348 ? -1.503  46.922  -0.451  1.00 23.32 ? 348  LYS A CE    1 
ATOM   2677  N NZ    . LYS A 1 348 ? -1.385  47.968  0.610   1.00 22.41 ? 348  LYS A NZ    1 
ATOM   2678  N N     . HIS A 1 349 ? -3.005  41.281  -1.397  1.00 22.74 ? 349  HIS A N     1 
ATOM   2679  C CA    . HIS A 1 349 ? -1.776  40.468  -1.402  1.00 22.21 ? 349  HIS A CA    1 
ATOM   2680  C C     . HIS A 1 349 ? -1.996  39.072  -1.960  1.00 21.92 ? 349  HIS A C     1 
ATOM   2681  O O     . HIS A 1 349 ? -1.115  38.204  -1.892  1.00 21.57 ? 349  HIS A O     1 
ATOM   2682  C CB    . HIS A 1 349 ? -1.148  40.455  -0.007  1.00 21.60 ? 349  HIS A CB    1 
ATOM   2683  C CG    . HIS A 1 349 ? -0.816  41.822  0.499   1.00 22.47 ? 349  HIS A CG    1 
ATOM   2684  N ND1   . HIS A 1 349 ? 0.181   42.599  -0.058  1.00 23.33 ? 349  HIS A ND1   1 
ATOM   2685  C CD2   . HIS A 1 349 ? -1.356  42.561  1.498   1.00 22.74 ? 349  HIS A CD2   1 
ATOM   2686  C CE1   . HIS A 1 349 ? 0.257   43.744  0.593   1.00 24.39 ? 349  HIS A CE1   1 
ATOM   2687  N NE2   . HIS A 1 349 ? -0.669  43.751  1.537   1.00 23.77 ? 349  HIS A NE2   1 
ATOM   2688  N N     . GLN A 1 350 ? -3.189  38.876  -2.528  1.00 22.13 ? 350  GLN A N     1 
ATOM   2689  C CA    . GLN A 1 350 ? -3.573  37.605  -3.146  1.00 21.51 ? 350  GLN A CA    1 
ATOM   2690  C C     . GLN A 1 350 ? -3.310  36.452  -2.158  1.00 21.10 ? 350  GLN A C     1 
ATOM   2691  O O     . GLN A 1 350 ? -2.631  35.472  -2.481  1.00 21.12 ? 350  GLN A O     1 
ATOM   2692  C CB    . GLN A 1 350 ? -2.824  37.414  -4.486  1.00 21.67 ? 350  GLN A CB    1 
ATOM   2693  C CG    . GLN A 1 350 ? -3.245  38.375  -5.577  1.00 21.50 ? 350  GLN A CG    1 
ATOM   2694  C CD    . GLN A 1 350 ? -4.663  38.058  -6.074  1.00 25.57 ? 350  GLN A CD    1 
ATOM   2695  O OE1   . GLN A 1 350 ? -5.631  38.738  -5.708  1.00 26.19 ? 350  GLN A OE1   1 
ATOM   2696  N NE2   . GLN A 1 350 ? -4.797  36.993  -6.861  1.00 24.72 ? 350  GLN A NE2   1 
ATOM   2697  N N     . VAL A 1 351 ? -3.844  36.589  -0.945  1.00 20.51 ? 351  VAL A N     1 
ATOM   2698  C CA    . VAL A 1 351 ? -3.714  35.542  0.073   1.00 19.53 ? 351  VAL A CA    1 
ATOM   2699  C C     . VAL A 1 351 ? -4.399  34.229  -0.358  1.00 19.99 ? 351  VAL A C     1 
ATOM   2700  O O     . VAL A 1 351 ? -5.534  34.229  -0.833  1.00 20.57 ? 351  VAL A O     1 
ATOM   2701  C CB    . VAL A 1 351 ? -4.214  36.023  1.450   1.00 19.28 ? 351  VAL A CB    1 
ATOM   2702  C CG1   . VAL A 1 351 ? -4.120  34.894  2.487   1.00 19.46 ? 351  VAL A CG1   1 
ATOM   2703  C CG2   . VAL A 1 351 ? -3.426  37.277  1.924   1.00 17.14 ? 351  VAL A CG2   1 
ATOM   2704  N N     . ASN A 1 352 ? -3.695  33.114  -0.200  1.00 19.87 ? 352  ASN A N     1 
ATOM   2705  C CA    . ASN A 1 352 ? -4.244  31.806  -0.534  1.00 19.86 ? 352  ASN A CA    1 
ATOM   2706  C C     . ASN A 1 352 ? -4.732  31.052  0.710   1.00 20.08 ? 352  ASN A C     1 
ATOM   2707  O O     . ASN A 1 352 ? -5.718  30.313  0.665   1.00 20.24 ? 352  ASN A O     1 
ATOM   2708  C CB    . ASN A 1 352 ? -3.191  30.988  -1.278  1.00 19.80 ? 352  ASN A CB    1 
ATOM   2709  C CG    . ASN A 1 352 ? -2.653  31.710  -2.527  1.00 20.92 ? 352  ASN A CG    1 
ATOM   2710  O OD1   . ASN A 1 352 ? -1.438  31.897  -2.681  1.00 20.42 ? 352  ASN A OD1   1 
ATOM   2711  N ND2   . ASN A 1 352 ? -3.561  32.128  -3.413  1.00 20.20 ? 352  ASN A ND2   1 
ATOM   2712  N N     . ILE A 1 353 ? -4.034  31.246  1.823   1.00 20.02 ? 353  ILE A N     1 
ATOM   2713  C CA    . ILE A 1 353 ? -4.368  30.583  3.086   1.00 19.76 ? 353  ILE A CA    1 
ATOM   2714  C C     . ILE A 1 353 ? -4.627  31.644  4.148   1.00 20.25 ? 353  ILE A C     1 
ATOM   2715  O O     . ILE A 1 353 ? -3.742  32.459  4.418   1.00 21.02 ? 353  ILE A O     1 
ATOM   2716  C CB    . ILE A 1 353 ? -3.205  29.697  3.574   1.00 19.63 ? 353  ILE A CB    1 
ATOM   2717  C CG1   . ILE A 1 353 ? -2.748  28.748  2.444   1.00 19.00 ? 353  ILE A CG1   1 
ATOM   2718  C CG2   . ILE A 1 353 ? -3.601  28.964  4.871   1.00 16.65 ? 353  ILE A CG2   1 
ATOM   2719  C CD1   . ILE A 1 353 ? -1.293  28.203  2.580   1.00 18.35 ? 353  ILE A CD1   1 
ATOM   2720  N N     . LEU A 1 354 ? -5.822  31.634  4.742   1.00 19.75 ? 354  LEU A N     1 
ATOM   2721  C CA    . LEU A 1 354 ? -6.163  32.580  5.816   1.00 19.47 ? 354  LEU A CA    1 
ATOM   2722  C C     . LEU A 1 354 ? -6.500  31.842  7.120   1.00 19.78 ? 354  LEU A C     1 
ATOM   2723  O O     . LEU A 1 354 ? -7.255  30.861  7.119   1.00 19.44 ? 354  LEU A O     1 
ATOM   2724  C CB    . LEU A 1 354 ? -7.316  33.505  5.393   1.00 19.51 ? 354  LEU A CB    1 
ATOM   2725  C CG    . LEU A 1 354 ? -7.927  34.456  6.445   1.00 18.86 ? 354  LEU A CG    1 
ATOM   2726  C CD1   . LEU A 1 354 ? -7.016  35.634  6.754   1.00 16.03 ? 354  LEU A CD1   1 
ATOM   2727  C CD2   . LEU A 1 354 ? -9.266  34.946  5.992   1.00 18.92 ? 354  LEU A CD2   1 
ATOM   2728  N N     . TYR A 1 355 ? -5.944  32.334  8.229   1.00 19.63 ? 355  TYR A N     1 
ATOM   2729  C CA    . TYR A 1 355 ? -6.018  31.646  9.515   1.00 19.06 ? 355  TYR A CA    1 
ATOM   2730  C C     . TYR A 1 355 ? -6.308  32.702  10.566  1.00 19.57 ? 355  TYR A C     1 
ATOM   2731  O O     . TYR A 1 355 ? -5.429  33.529  10.902  1.00 20.11 ? 355  TYR A O     1 
ATOM   2732  C CB    . TYR A 1 355 ? -4.683  30.954  9.796   1.00 18.71 ? 355  TYR A CB    1 
ATOM   2733  C CG    . TYR A 1 355 ? -4.542  30.150  11.087  1.00 19.17 ? 355  TYR A CG    1 
ATOM   2734  C CD1   . TYR A 1 355 ? -5.573  29.318  11.556  1.00 16.27 ? 355  TYR A CD1   1 
ATOM   2735  C CD2   . TYR A 1 355 ? -3.327  30.179  11.819  1.00 19.89 ? 355  TYR A CD2   1 
ATOM   2736  C CE1   . TYR A 1 355 ? -5.408  28.580  12.715  1.00 16.69 ? 355  TYR A CE1   1 
ATOM   2737  C CE2   . TYR A 1 355 ? -3.155  29.427  12.989  1.00 16.48 ? 355  TYR A CE2   1 
ATOM   2738  C CZ    . TYR A 1 355 ? -4.188  28.624  13.425  1.00 17.62 ? 355  TYR A CZ    1 
ATOM   2739  O OH    . TYR A 1 355 ? -4.031  27.880  14.596  1.00 19.16 ? 355  TYR A OH    1 
ATOM   2740  N N     . THR A 1 356 ? -7.527  32.667  11.100  1.00 18.97 ? 356  THR A N     1 
ATOM   2741  C CA    . THR A 1 356 ? -7.957  33.703  12.009  1.00 19.27 ? 356  THR A CA    1 
ATOM   2742  C C     . THR A 1 356 ? -8.775  33.196  13.225  1.00 19.40 ? 356  THR A C     1 
ATOM   2743  O O     . THR A 1 356 ? -8.774  31.997  13.509  1.00 19.57 ? 356  THR A O     1 
ATOM   2744  C CB    . THR A 1 356 ? -8.629  34.859  11.232  1.00 19.29 ? 356  THR A CB    1 
ATOM   2745  O OG1   . THR A 1 356 ? -8.734  36.026  12.079  1.00 18.99 ? 356  THR A OG1   1 
ATOM   2746  C CG2   . THR A 1 356 ? -9.994  34.426  10.639  1.00 18.92 ? 356  THR A CG2   1 
ATOM   2747  N N     . ALA A 1 357 ? -9.424  34.109  13.945  1.00 19.30 ? 357  ALA A N     1 
ATOM   2748  C CA    . ALA A 1 357 ? -10.037 33.815  15.247  1.00 19.88 ? 357  ALA A CA    1 
ATOM   2749  C C     . ALA A 1 357 ? -11.562 33.872  15.147  1.00 20.06 ? 357  ALA A C     1 
ATOM   2750  O O     . ALA A 1 357 ? -12.093 34.730  14.442  1.00 20.60 ? 357  ALA A O     1 
ATOM   2751  C CB    . ALA A 1 357 ? -9.562  34.824  16.295  1.00 19.49 ? 357  ALA A CB    1 
ATOM   2752  N N     . PRO A 1 358 ? -12.268 32.964  15.844  1.00 20.00 ? 358  PRO A N     1 
ATOM   2753  C CA    . PRO A 1 358 ? -13.728 33.093  15.911  1.00 20.49 ? 358  PRO A CA    1 
ATOM   2754  C C     . PRO A 1 358 ? -14.230 34.466  16.392  1.00 20.60 ? 358  PRO A C     1 
ATOM   2755  O O     . PRO A 1 358 ? -15.298 34.898  15.964  1.00 20.99 ? 358  PRO A O     1 
ATOM   2756  C CB    . PRO A 1 358 ? -14.160 31.936  16.851  1.00 20.51 ? 358  PRO A CB    1 
ATOM   2757  C CG    . PRO A 1 358 ? -13.043 30.919  16.748  1.00 19.10 ? 358  PRO A CG    1 
ATOM   2758  C CD    . PRO A 1 358 ? -11.781 31.759  16.545  1.00 20.06 ? 358  PRO A CD    1 
ATOM   2759  N N     . THR A 1 359 ? -13.484 35.144  17.255  1.00 20.89 ? 359  THR A N     1 
ATOM   2760  C CA    . THR A 1 359 ? -13.884 36.481  17.702  1.00 22.24 ? 359  THR A CA    1 
ATOM   2761  C C     . THR A 1 359 ? -13.902 37.468  16.542  1.00 22.35 ? 359  THR A C     1 
ATOM   2762  O O     . THR A 1 359 ? -14.864 38.220  16.395  1.00 24.13 ? 359  THR A O     1 
ATOM   2763  C CB    . THR A 1 359 ? -13.040 36.998  18.883  1.00 22.61 ? 359  THR A CB    1 
ATOM   2764  O OG1   . THR A 1 359 ? -13.428 36.295  20.066  1.00 25.21 ? 359  THR A OG1   1 
ATOM   2765  C CG2   . THR A 1 359 ? -13.281 38.485  19.128  1.00 23.50 ? 359  THR A CG2   1 
ATOM   2766  N N     . ALA A 1 360 ? -12.878 37.436  15.699  1.00 21.77 ? 360  ALA A N     1 
ATOM   2767  C CA    . ALA A 1 360 ? -12.902 38.168  14.433  1.00 21.27 ? 360  ALA A CA    1 
ATOM   2768  C C     . ALA A 1 360 ? -14.089 37.804  13.537  1.00 20.89 ? 360  ALA A C     1 
ATOM   2769  O O     . ALA A 1 360 ? -14.815 38.692  13.080  1.00 20.88 ? 360  ALA A O     1 
ATOM   2770  C CB    . ALA A 1 360 ? -11.580 38.000  13.675  1.00 21.13 ? 360  ALA A CB    1 
ATOM   2771  N N     . ILE A 1 361 ? -14.289 36.510  13.295  1.00 20.35 ? 361  ILE A N     1 
ATOM   2772  C CA    . ILE A 1 361 ? -15.370 36.035  12.420  1.00 19.77 ? 361  ILE A CA    1 
ATOM   2773  C C     . ILE A 1 361 ? -16.752 36.532  12.885  1.00 20.12 ? 361  ILE A C     1 
ATOM   2774  O O     . ILE A 1 361 ? -17.560 37.032  12.077  1.00 19.65 ? 361  ILE A O     1 
ATOM   2775  C CB    . ILE A 1 361 ? -15.374 34.470  12.302  1.00 19.94 ? 361  ILE A CB    1 
ATOM   2776  C CG1   . ILE A 1 361 ? -14.102 33.983  11.606  1.00 18.88 ? 361  ILE A CG1   1 
ATOM   2777  C CG2   . ILE A 1 361 ? -16.669 33.953  11.599  1.00 17.13 ? 361  ILE A CG2   1 
ATOM   2778  C CD1   . ILE A 1 361 ? -13.482 32.721  12.210  1.00 18.41 ? 361  ILE A CD1   1 
ATOM   2779  N N     . ARG A 1 362 ? -17.015 36.381  14.182  1.00 19.74 ? 362  ARG A N     1 
ATOM   2780  C CA    . ARG A 1 362 ? -18.234 36.897  14.776  1.00 20.08 ? 362  ARG A CA    1 
ATOM   2781  C C     . ARG A 1 362 ? -18.358 38.410  14.563  1.00 19.76 ? 362  ARG A C     1 
ATOM   2782  O O     . ARG A 1 362 ? -19.428 38.906  14.222  1.00 19.20 ? 362  ARG A O     1 
ATOM   2783  C CB    . ARG A 1 362 ? -18.274 36.564  16.266  1.00 20.31 ? 362  ARG A CB    1 
ATOM   2784  C CG    . ARG A 1 362 ? -18.653 35.124  16.554  1.00 21.55 ? 362  ARG A CG    1 
ATOM   2785  C CD    . ARG A 1 362 ? -18.971 34.953  18.018  1.00 24.25 ? 362  ARG A CD    1 
ATOM   2786  N NE    . ARG A 1 362 ? -17.838 35.352  18.877  1.00 27.57 ? 362  ARG A NE    1 
ATOM   2787  C CZ    . ARG A 1 362 ? -16.910 34.516  19.338  1.00 27.16 ? 362  ARG A CZ    1 
ATOM   2788  N NH1   . ARG A 1 362 ? -16.976 33.219  19.048  1.00 27.13 ? 362  ARG A NH1   1 
ATOM   2789  N NH2   . ARG A 1 362 ? -15.926 34.979  20.108  1.00 28.17 ? 362  ARG A NH2   1 
ATOM   2790  N N     . ALA A 1 363 ? -17.246 39.124  14.742  1.00 19.91 ? 363  ALA A N     1 
ATOM   2791  C CA    . ALA A 1 363 ? -17.224 40.556  14.543  1.00 20.47 ? 363  ALA A CA    1 
ATOM   2792  C C     . ALA A 1 363 ? -17.564 40.978  13.087  1.00 20.91 ? 363  ALA A C     1 
ATOM   2793  O O     . ALA A 1 363 ? -18.338 41.913  12.865  1.00 21.63 ? 363  ALA A O     1 
ATOM   2794  C CB    . ALA A 1 363 ? -15.881 41.127  15.018  1.00 19.90 ? 363  ALA A CB    1 
ATOM   2795  N N     . LEU A 1 364 ? -17.016 40.272  12.112  1.00 21.18 ? 364  LEU A N     1 
ATOM   2796  C CA    . LEU A 1 364 ? -17.286 40.551  10.712  1.00 22.19 ? 364  LEU A CA    1 
ATOM   2797  C C     . LEU A 1 364 ? -18.685 40.102  10.329  1.00 22.59 ? 364  LEU A C     1 
ATOM   2798  O O     . LEU A 1 364 ? -19.336 40.684  9.466   1.00 22.83 ? 364  LEU A O     1 
ATOM   2799  C CB    . LEU A 1 364 ? -16.270 39.822  9.832   1.00 22.19 ? 364  LEU A CB    1 
ATOM   2800  C CG    . LEU A 1 364 ? -14.773 40.145  9.928   1.00 23.33 ? 364  LEU A CG    1 
ATOM   2801  C CD1   . LEU A 1 364 ? -14.072 39.415  8.817   1.00 23.09 ? 364  LEU A CD1   1 
ATOM   2802  C CD2   . LEU A 1 364 ? -14.467 41.643  9.865   1.00 23.92 ? 364  LEU A CD2   1 
ATOM   2803  N N     . MET A 1 365 ? -19.124 39.038  10.982  1.00 23.24 ? 365  MET A N     1 
ATOM   2804  C CA    . MET A 1 365 ? -20.437 38.457  10.785  1.00 23.95 ? 365  MET A CA    1 
ATOM   2805  C C     . MET A 1 365 ? -21.574 39.397  11.199  1.00 22.78 ? 365  MET A C     1 
ATOM   2806  O O     . MET A 1 365 ? -22.623 39.433  10.549  1.00 22.25 ? 365  MET A O     1 
ATOM   2807  C CB    . MET A 1 365 ? -20.524 37.181  11.610  1.00 23.61 ? 365  MET A CB    1 
ATOM   2808  C CG    . MET A 1 365 ? -21.644 36.295  11.199  1.00 26.27 ? 365  MET A CG    1 
ATOM   2809  S SD    . MET A 1 365 ? -21.477 34.706  12.012  1.00 26.97 ? 365  MET A SD    1 
ATOM   2810  C CE    . MET A 1 365 ? -23.062 34.071  11.567  1.00 23.01 ? 365  MET A CE    1 
ATOM   2811  N N     . ALA A 1 366 ? -21.366 40.128  12.294  1.00 21.81 ? 366  ALA A N     1 
ATOM   2812  C CA    . ALA A 1 366 ? -22.379 41.047  12.807  1.00 21.41 ? 366  ALA A CA    1 
ATOM   2813  C C     . ALA A 1 366 ? -22.627 42.136  11.771  1.00 21.29 ? 366  ALA A C     1 
ATOM   2814  O O     . ALA A 1 366 ? -23.711 42.703  11.709  1.00 20.54 ? 366  ALA A O     1 
ATOM   2815  C CB    . ALA A 1 366 ? -21.955 41.637  14.135  1.00 20.56 ? 366  ALA A CB    1 
ATOM   2816  N N     . GLU A 1 367 ? -21.620 42.379  10.936  1.00 21.58 ? 367  GLU A N     1 
ATOM   2817  C CA    . GLU A 1 367 ? -21.706 43.390  9.879   1.00 22.35 ? 367  GLU A CA    1 
ATOM   2818  C C     . GLU A 1 367 ? -22.285 42.893  8.557   1.00 22.00 ? 367  GLU A C     1 
ATOM   2819  O O     . GLU A 1 367 ? -22.580 43.709  7.700   1.00 22.76 ? 367  GLU A O     1 
ATOM   2820  C CB    . GLU A 1 367 ? -20.347 44.027  9.612   1.00 22.45 ? 367  GLU A CB    1 
ATOM   2821  C CG    . GLU A 1 367 ? -19.656 44.580  10.842  1.00 25.71 ? 367  GLU A CG    1 
ATOM   2822  C CD    . GLU A 1 367 ? -20.408 45.737  11.492  1.00 31.44 ? 367  GLU A CD    1 
ATOM   2823  O OE1   . GLU A 1 367 ? -20.497 46.823  10.869  1.00 33.92 ? 367  GLU A OE1   1 
ATOM   2824  O OE2   . GLU A 1 367 ? -20.880 45.567  12.654  1.00 35.36 ? 367  GLU A OE2   1 
ATOM   2825  N N     . GLY A 1 368 ? -22.456 41.580  8.386   1.00 21.72 ? 368  GLY A N     1 
ATOM   2826  C CA    . GLY A 1 368 ? -23.038 41.031  7.155   1.00 20.87 ? 368  GLY A CA    1 
ATOM   2827  C C     . GLY A 1 368 ? -22.152 41.164  5.911   1.00 20.80 ? 368  GLY A C     1 
ATOM   2828  O O     . GLY A 1 368 ? -20.917 41.000  5.980   1.00 20.41 ? 368  GLY A O     1 
ATOM   2829  N N     . ASP A 1 369 ? -22.784 41.459  4.766   1.00 20.16 ? 369  ASP A N     1 
ATOM   2830  C CA    . ASP A 1 369 ? -22.065 41.611  3.490   1.00 19.23 ? 369  ASP A CA    1 
ATOM   2831  C C     . ASP A 1 369 ? -21.113 42.834  3.468   1.00 19.09 ? 369  ASP A C     1 
ATOM   2832  O O     . ASP A 1 369 ? -20.324 43.006  2.533   1.00 18.05 ? 369  ASP A O     1 
ATOM   2833  C CB    . ASP A 1 369 ? -23.060 41.649  2.331   1.00 18.45 ? 369  ASP A CB    1 
ATOM   2834  C CG    . ASP A 1 369 ? -23.700 40.295  2.072   1.00 19.59 ? 369  ASP A CG    1 
ATOM   2835  O OD1   . ASP A 1 369 ? -23.204 39.284  2.626   1.00 20.19 ? 369  ASP A OD1   1 
ATOM   2836  O OD2   . ASP A 1 369 ? -24.703 40.230  1.315   1.00 19.10 ? 369  ASP A OD2   1 
ATOM   2837  N N     . LYS A 1 370 ? -21.195 43.664  4.513   1.00 19.13 ? 370  LYS A N     1 
ATOM   2838  C CA    . LYS A 1 370 ? -20.284 44.777  4.686   1.00 20.30 ? 370  LYS A CA    1 
ATOM   2839  C C     . LYS A 1 370 ? -18.866 44.243  4.897   1.00 20.16 ? 370  LYS A C     1 
ATOM   2840  O O     . LYS A 1 370 ? -17.891 44.956  4.648   1.00 20.10 ? 370  LYS A O     1 
ATOM   2841  C CB    . LYS A 1 370 ? -20.719 45.708  5.834   1.00 20.01 ? 370  LYS A CB    1 
ATOM   2842  C CG    . LYS A 1 370 ? -21.859 46.674  5.446   1.00 22.25 ? 370  LYS A CG    1 
ATOM   2843  C CD    . LYS A 1 370 ? -22.031 47.892  6.406   1.00 21.93 ? 370  LYS A CD    1 
ATOM   2844  C CE    . LYS A 1 370 ? -22.433 47.479  7.842   1.00 25.00 ? 370  LYS A CE    1 
ATOM   2845  N NZ    . LYS A 1 370 ? -22.893 48.635  8.662   1.00 23.22 ? 370  LYS A NZ    1 
ATOM   2846  N N     . ALA A 1 371 ? -18.767 42.982  5.320   1.00 19.90 ? 371  ALA A N     1 
ATOM   2847  C CA    . ALA A 1 371 ? -17.477 42.327  5.507   1.00 20.50 ? 371  ALA A CA    1 
ATOM   2848  C C     . ALA A 1 371 ? -16.808 41.854  4.190   1.00 20.53 ? 371  ALA A C     1 
ATOM   2849  O O     . ALA A 1 371 ? -15.585 41.729  4.121   1.00 20.03 ? 371  ALA A O     1 
ATOM   2850  C CB    . ALA A 1 371 ? -17.614 41.166  6.499   1.00 20.74 ? 371  ALA A CB    1 
ATOM   2851  N N     . ILE A 1 372 ? -17.609 41.619  3.158   1.00 20.84 ? 372  ILE A N     1 
ATOM   2852  C CA    . ILE A 1 372 ? -17.097 41.136  1.889   1.00 21.75 ? 372  ILE A CA    1 
ATOM   2853  C C     . ILE A 1 372 ? -17.312 42.122  0.725   1.00 22.92 ? 372  ILE A C     1 
ATOM   2854  O O     . ILE A 1 372 ? -16.919 41.828  -0.423  1.00 23.12 ? 372  ILE A O     1 
ATOM   2855  C CB    . ILE A 1 372 ? -17.706 39.759  1.512   1.00 21.57 ? 372  ILE A CB    1 
ATOM   2856  C CG1   . ILE A 1 372 ? -19.210 39.853  1.270   1.00 20.42 ? 372  ILE A CG1   1 
ATOM   2857  C CG2   . ILE A 1 372 ? -17.401 38.728  2.592   1.00 23.30 ? 372  ILE A CG2   1 
ATOM   2858  C CD1   . ILE A 1 372 ? -19.820 38.615  0.645   1.00 20.71 ? 372  ILE A CD1   1 
ATOM   2859  N N     . GLU A 1 373 ? -17.934 43.268  1.016   1.00 22.93 ? 373  GLU A N     1 
ATOM   2860  C CA    . GLU A 1 373 ? -18.394 44.196  -0.027  1.00 23.39 ? 373  GLU A CA    1 
ATOM   2861  C C     . GLU A 1 373 ? -17.261 44.792  -0.853  1.00 22.79 ? 373  GLU A C     1 
ATOM   2862  O O     . GLU A 1 373 ? -16.283 45.301  -0.314  1.00 22.50 ? 373  GLU A O     1 
ATOM   2863  C CB    . GLU A 1 373 ? -19.214 45.311  0.607   1.00 24.12 ? 373  GLU A CB    1 
ATOM   2864  C CG    . GLU A 1 373 ? -19.831 46.306  -0.346  1.00 26.96 ? 373  GLU A CG    1 
ATOM   2865  C CD    . GLU A 1 373 ? -20.410 47.500  0.398   1.00 31.86 ? 373  GLU A CD    1 
ATOM   2866  O OE1   . GLU A 1 373 ? -20.877 47.320  1.547   1.00 36.04 ? 373  GLU A OE1   1 
ATOM   2867  O OE2   . GLU A 1 373 ? -20.398 48.618  -0.150  1.00 33.00 ? 373  GLU A OE2   1 
ATOM   2868  N N     . GLY A 1 374 ? -17.417 44.727  -2.173  1.00 22.99 ? 374  GLY A N     1 
ATOM   2869  C CA    . GLY A 1 374 ? -16.418 45.242  -3.118  1.00 22.71 ? 374  GLY A CA    1 
ATOM   2870  C C     . GLY A 1 374 ? -15.152 44.405  -3.160  1.00 22.69 ? 374  GLY A C     1 
ATOM   2871  O O     . GLY A 1 374 ? -14.156 44.851  -3.737  1.00 23.02 ? 374  GLY A O     1 
ATOM   2872  N N     . THR A 1 375 ? -15.174 43.215  -2.528  1.00 21.74 ? 375  THR A N     1 
ATOM   2873  C CA    . THR A 1 375 ? -14.023 42.302  -2.542  1.00 20.48 ? 375  THR A CA    1 
ATOM   2874  C C     . THR A 1 375 ? -14.275 41.075  -3.387  1.00 20.89 ? 375  THR A C     1 
ATOM   2875  O O     . THR A 1 375 ? -15.387 40.799  -3.799  1.00 20.32 ? 375  THR A O     1 
ATOM   2876  C CB    . THR A 1 375 ? -13.458 41.896  -1.112  1.00 20.37 ? 375  THR A CB    1 
ATOM   2877  O OG1   . THR A 1 375 ? -14.289 40.899  -0.484  1.00 18.70 ? 375  THR A OG1   1 
ATOM   2878  C CG2   . THR A 1 375 ? -13.271 43.111  -0.223  1.00 17.30 ? 375  THR A CG2   1 
ATOM   2879  N N     . ASP A 1 376 ? -13.203 40.346  -3.646  1.00 21.97 ? 376  ASP A N     1 
ATOM   2880  C CA    . ASP A 1 376 ? -13.211 39.262  -4.611  1.00 22.49 ? 376  ASP A CA    1 
ATOM   2881  C C     . ASP A 1 376 ? -13.109 37.943  -3.872  1.00 21.93 ? 376  ASP A C     1 
ATOM   2882  O O     . ASP A 1 376 ? -13.991 37.086  -4.009  1.00 22.46 ? 376  ASP A O     1 
ATOM   2883  C CB    . ASP A 1 376 ? -12.013 39.433  -5.551  1.00 23.03 ? 376  ASP A CB    1 
ATOM   2884  C CG    . ASP A 1 376 ? -12.074 38.516  -6.736  1.00 25.19 ? 376  ASP A CG    1 
ATOM   2885  O OD1   . ASP A 1 376 ? -11.943 37.286  -6.593  1.00 25.53 ? 376  ASP A OD1   1 
ATOM   2886  O OD2   . ASP A 1 376 ? -12.246 39.044  -7.843  1.00 32.20 ? 376  ASP A OD2   1 
ATOM   2887  N N     . ARG A 1 377 ? -12.024 37.823  -3.097  1.00 21.46 ? 377  ARG A N     1 
ATOM   2888  C CA    . ARG A 1 377 ? -11.653 36.659  -2.290  1.00 21.32 ? 377  ARG A CA    1 
ATOM   2889  C C     . ARG A 1 377 ? -11.289 35.378  -3.062  1.00 21.73 ? 377  ARG A C     1 
ATOM   2890  O O     . ARG A 1 377 ? -11.159 34.315  -2.432  1.00 21.68 ? 377  ARG A O     1 
ATOM   2891  C CB    . ARG A 1 377 ? -12.722 36.327  -1.240  1.00 21.44 ? 377  ARG A CB    1 
ATOM   2892  C CG    . ARG A 1 377 ? -12.950 37.366  -0.146  1.00 20.39 ? 377  ARG A CG    1 
ATOM   2893  C CD    . ARG A 1 377 ? -14.417 37.398  0.259   1.00 19.30 ? 377  ARG A CD    1 
ATOM   2894  N NE    . ARG A 1 377 ? -15.192 38.146  -0.752  1.00 20.40 ? 377  ARG A NE    1 
ATOM   2895  C CZ    . ARG A 1 377 ? -16.320 37.736  -1.315  1.00 18.31 ? 377  ARG A CZ    1 
ATOM   2896  N NH1   . ARG A 1 377 ? -16.882 36.572  -0.968  1.00 18.57 ? 377  ARG A NH1   1 
ATOM   2897  N NH2   . ARG A 1 377 ? -16.884 38.506  -2.229  1.00 18.87 ? 377  ARG A NH2   1 
ATOM   2898  N N     . SER A 1 378 ? -11.113 35.463  -4.386  1.00 21.19 ? 378  SER A N     1 
ATOM   2899  C CA    . SER A 1 378 ? -10.944 34.248  -5.203  1.00 21.63 ? 378  SER A CA    1 
ATOM   2900  C C     . SER A 1 378 ? -9.609  33.578  -4.996  1.00 21.34 ? 378  SER A C     1 
ATOM   2901  O O     . SER A 1 378 ? -9.484  32.385  -5.278  1.00 21.85 ? 378  SER A O     1 
ATOM   2902  C CB    . SER A 1 378 ? -11.108 34.501  -6.712  1.00 21.39 ? 378  SER A CB    1 
ATOM   2903  O OG    . SER A 1 378 ? -12.432 34.867  -6.999  1.00 22.76 ? 378  SER A OG    1 
ATOM   2904  N N     . SER A 1 379 ? -8.615  34.332  -4.540  1.00 19.93 ? 379  SER A N     1 
ATOM   2905  C CA    . SER A 1 379 ? -7.292  33.765  -4.360  1.00 19.31 ? 379  SER A CA    1 
ATOM   2906  C C     . SER A 1 379 ? -7.243  32.689  -3.249  1.00 19.64 ? 379  SER A C     1 
ATOM   2907  O O     . SER A 1 379 ? -6.332  31.855  -3.228  1.00 19.44 ? 379  SER A O     1 
ATOM   2908  C CB    . SER A 1 379 ? -6.257  34.875  -4.117  1.00 19.01 ? 379  SER A CB    1 
ATOM   2909  O OG    . SER A 1 379 ? -6.513  35.605  -2.920  1.00 17.18 ? 379  SER A OG    1 
ATOM   2910  N N     . LEU A 1 380 ? -8.227  32.709  -2.348  1.00 19.89 ? 380  LEU A N     1 
ATOM   2911  C CA    . LEU A 1 380 ? -8.227  31.854  -1.157  1.00 20.30 ? 380  LEU A CA    1 
ATOM   2912  C C     . LEU A 1 380 ? -8.486  30.405  -1.549  1.00 20.84 ? 380  LEU A C     1 
ATOM   2913  O O     . LEU A 1 380 ? -9.356  30.144  -2.377  1.00 21.19 ? 380  LEU A O     1 
ATOM   2914  C CB    . LEU A 1 380 ? -9.287  32.325  -0.151  1.00 19.95 ? 380  LEU A CB    1 
ATOM   2915  C CG    . LEU A 1 380 ? -9.047  33.524  0.805   1.00 20.90 ? 380  LEU A CG    1 
ATOM   2916  C CD1   . LEU A 1 380 ? -10.252 33.839  1.662   1.00 19.01 ? 380  LEU A CD1   1 
ATOM   2917  C CD2   . LEU A 1 380 ? -7.857  33.356  1.736   1.00 21.54 ? 380  LEU A CD2   1 
ATOM   2918  N N     . ARG A 1 381 ? -7.723  29.476  -0.960  1.00 21.47 ? 381  ARG A N     1 
ATOM   2919  C CA    . ARG A 1 381 ? -7.929  28.020  -1.104  1.00 21.85 ? 381  ARG A CA    1 
ATOM   2920  C C     . ARG A 1 381 ? -8.252  27.326  0.238   1.00 21.87 ? 381  ARG A C     1 
ATOM   2921  O O     . ARG A 1 381 ? -8.995  26.347  0.272   1.00 22.35 ? 381  ARG A O     1 
ATOM   2922  C CB    . ARG A 1 381 ? -6.710  27.365  -1.774  1.00 21.20 ? 381  ARG A CB    1 
ATOM   2923  C CG    . ARG A 1 381 ? -6.632  27.625  -3.280  1.00 22.82 ? 381  ARG A CG    1 
ATOM   2924  C CD    . ARG A 1 381 ? -5.454  26.902  -3.985  1.00 23.78 ? 381  ARG A CD    1 
ATOM   2925  N NE    . ARG A 1 381 ? -4.153  27.542  -3.708  1.00 28.16 ? 381  ARG A NE    1 
ATOM   2926  C CZ    . ARG A 1 381 ? -3.557  28.446  -4.494  1.00 29.00 ? 381  ARG A CZ    1 
ATOM   2927  N NH1   . ARG A 1 381 ? -4.130  28.844  -5.632  1.00 26.88 ? 381  ARG A NH1   1 
ATOM   2928  N NH2   . ARG A 1 381 ? -2.382  28.960  -4.134  1.00 26.99 ? 381  ARG A NH2   1 
ATOM   2929  N N     . ILE A 1 382 ? -7.698  27.842  1.336   1.00 21.90 ? 382  ILE A N     1 
ATOM   2930  C CA    . ILE A 1 382 ? -7.811  27.230  2.671   1.00 21.71 ? 382  ILE A CA    1 
ATOM   2931  C C     . ILE A 1 382 ? -8.145  28.293  3.711   1.00 21.90 ? 382  ILE A C     1 
ATOM   2932  O O     . ILE A 1 382 ? -7.537  29.367  3.734   1.00 22.04 ? 382  ILE A O     1 
ATOM   2933  C CB    . ILE A 1 382 ? -6.461  26.568  3.144   1.00 22.43 ? 382  ILE A CB    1 
ATOM   2934  C CG1   . ILE A 1 382 ? -5.909  25.559  2.107   1.00 21.59 ? 382  ILE A CG1   1 
ATOM   2935  C CG2   . ILE A 1 382 ? -6.592  25.983  4.558   1.00 19.46 ? 382  ILE A CG2   1 
ATOM   2936  C CD1   . ILE A 1 382 ? -6.789  24.348  1.906   1.00 21.74 ? 382  ILE A CD1   1 
ATOM   2937  N N     . LEU A 1 383 ? -9.103  27.978  4.575   1.00 21.73 ? 383  LEU A N     1 
ATOM   2938  C CA    . LEU A 1 383 ? -9.383  28.797  5.747   1.00 21.74 ? 383  LEU A CA    1 
ATOM   2939  C C     . LEU A 1 383 ? -9.023  28.041  7.021   1.00 22.00 ? 383  LEU A C     1 
ATOM   2940  O O     . LEU A 1 383 ? -8.958  26.809  7.025   1.00 22.38 ? 383  LEU A O     1 
ATOM   2941  C CB    . LEU A 1 383 ? -10.846 29.243  5.796   1.00 20.72 ? 383  LEU A CB    1 
ATOM   2942  C CG    . LEU A 1 383 ? -11.415 30.030  4.626   1.00 20.15 ? 383  LEU A CG    1 
ATOM   2943  C CD1   . LEU A 1 383 ? -12.927 30.254  4.857   1.00 18.87 ? 383  LEU A CD1   1 
ATOM   2944  C CD2   . LEU A 1 383 ? -10.686 31.356  4.436   1.00 17.63 ? 383  LEU A CD2   1 
ATOM   2945  N N     . GLY A 1 384 ? -8.806  28.797  8.097   1.00 22.47 ? 384  GLY A N     1 
ATOM   2946  C CA    . GLY A 1 384 ? -8.465  28.250  9.394   1.00 22.15 ? 384  GLY A CA    1 
ATOM   2947  C C     . GLY A 1 384 ? -9.046  29.072  10.516  1.00 22.62 ? 384  GLY A C     1 
ATOM   2948  O O     . GLY A 1 384 ? -9.271  30.275  10.385  1.00 22.75 ? 384  GLY A O     1 
ATOM   2949  N N     . SER A 1 385 ? -9.291  28.402  11.635  1.00 23.03 ? 385  SER A N     1 
ATOM   2950  C CA    . SER A 1 385 ? -9.867  29.018  12.820  1.00 22.89 ? 385  SER A CA    1 
ATOM   2951  C C     . SER A 1 385 ? -9.152  28.440  14.052  1.00 23.58 ? 385  SER A C     1 
ATOM   2952  O O     . SER A 1 385 ? -8.881  27.225  14.113  1.00 23.88 ? 385  SER A O     1 
ATOM   2953  C CB    . SER A 1 385 ? -11.370 28.718  12.878  1.00 22.89 ? 385  SER A CB    1 
ATOM   2954  O OG    . SER A 1 385 ? -11.960 29.282  14.043  1.00 21.86 ? 385  SER A OG    1 
ATOM   2955  N N     . VAL A 1 386 ? -8.872  29.313  15.017  1.00 23.38 ? 386  VAL A N     1 
ATOM   2956  C CA    . VAL A 1 386 ? -8.095  28.991  16.209  1.00 23.43 ? 386  VAL A CA    1 
ATOM   2957  C C     . VAL A 1 386 ? -8.529  29.794  17.458  1.00 23.67 ? 386  VAL A C     1 
ATOM   2958  O O     . VAL A 1 386 ? -8.987  30.922  17.346  1.00 23.24 ? 386  VAL A O     1 
ATOM   2959  C CB    . VAL A 1 386 ? -6.569  29.273  15.951  1.00 23.46 ? 386  VAL A CB    1 
ATOM   2960  C CG1   . VAL A 1 386 ? -6.324  30.724  15.598  1.00 22.18 ? 386  VAL A CG1   1 
ATOM   2961  C CG2   . VAL A 1 386 ? -5.710  28.877  17.158  1.00 22.46 ? 386  VAL A CG2   1 
ATOM   2962  N N     . GLY A 1 387 ? -8.360  29.196  18.638  1.00 24.57 ? 387  GLY A N     1 
ATOM   2963  C CA    . GLY A 1 387 ? -8.271  29.941  19.904  1.00 25.27 ? 387  GLY A CA    1 
ATOM   2964  C C     . GLY A 1 387 ? -9.482  29.860  20.818  1.00 26.47 ? 387  GLY A C     1 
ATOM   2965  O O     . GLY A 1 387 ? -9.434  30.288  22.008  1.00 25.37 ? 387  GLY A O     1 
ATOM   2966  N N     . GLU A 1 388 ? -10.578 29.356  20.254  1.00 26.32 ? 388  GLU A N     1 
ATOM   2967  C CA    . GLU A 1 388 ? -11.830 29.290  20.963  1.00 28.20 ? 388  GLU A CA    1 
ATOM   2968  C C     . GLU A 1 388 ? -12.813 28.453  20.167  1.00 27.91 ? 388  GLU A C     1 
ATOM   2969  O O     . GLU A 1 388 ? -12.676 28.316  18.934  1.00 28.45 ? 388  GLU A O     1 
ATOM   2970  C CB    . GLU A 1 388 ? -12.400 30.701  21.248  1.00 28.36 ? 388  GLU A CB    1 
ATOM   2971  C CG    . GLU A 1 388 ? -12.671 31.528  20.011  1.00 30.47 ? 388  GLU A CG    1 
ATOM   2972  C CD    . GLU A 1 388 ? -12.927 33.021  20.280  1.00 30.56 ? 388  GLU A CD    1 
ATOM   2973  O OE1   . GLU A 1 388 ? -13.827 33.334  21.107  1.00 33.40 ? 388  GLU A OE1   1 
ATOM   2974  O OE2   . GLU A 1 388 ? -12.250 33.863  19.620  1.00 29.87 ? 388  GLU A OE2   1 
ATOM   2975  N N     . PRO A 1 389 ? -13.818 27.893  20.858  1.00 27.32 ? 389  PRO A N     1 
ATOM   2976  C CA    . PRO A 1 389 ? -14.742 27.071  20.087  1.00 26.79 ? 389  PRO A CA    1 
ATOM   2977  C C     . PRO A 1 389 ? -15.421 27.987  19.100  1.00 26.40 ? 389  PRO A C     1 
ATOM   2978  O O     . PRO A 1 389 ? -15.694 29.134  19.433  1.00 25.38 ? 389  PRO A O     1 
ATOM   2979  C CB    . PRO A 1 389 ? -15.768 26.582  21.134  1.00 26.68 ? 389  PRO A CB    1 
ATOM   2980  C CG    . PRO A 1 389 ? -15.143 26.803  22.453  1.00 26.70 ? 389  PRO A CG    1 
ATOM   2981  C CD    . PRO A 1 389 ? -14.191 27.981  22.284  1.00 26.96 ? 389  PRO A CD    1 
ATOM   2982  N N     . ILE A 1 390 ? -15.661 27.475  17.893  1.00 26.41 ? 390  ILE A N     1 
ATOM   2983  C CA    . ILE A 1 390 ? -16.447 28.184  16.887  1.00 25.57 ? 390  ILE A CA    1 
ATOM   2984  C C     . ILE A 1 390 ? -17.834 27.547  16.752  1.00 25.60 ? 390  ILE A C     1 
ATOM   2985  O O     . ILE A 1 390 ? -17.947 26.369  16.474  1.00 26.32 ? 390  ILE A O     1 
ATOM   2986  C CB    . ILE A 1 390 ? -15.675 28.258  15.528  1.00 25.32 ? 390  ILE A CB    1 
ATOM   2987  C CG1   . ILE A 1 390 ? -16.343 29.259  14.584  1.00 24.97 ? 390  ILE A CG1   1 
ATOM   2988  C CG2   . ILE A 1 390 ? -15.458 26.870  14.927  1.00 23.27 ? 390  ILE A CG2   1 
ATOM   2989  C CD1   . ILE A 1 390 ? -15.556 29.567  13.325  1.00 25.60 ? 390  ILE A CD1   1 
ATOM   2990  N N     . ASN A 1 391 ? -18.884 28.323  16.978  1.00 25.87 ? 391  ASN A N     1 
ATOM   2991  C CA    . ASN A 1 391 ? -20.256 27.873  16.752  1.00 26.14 ? 391  ASN A CA    1 
ATOM   2992  C C     . ASN A 1 391 ? -20.519 27.533  15.273  1.00 25.51 ? 391  ASN A C     1 
ATOM   2993  O O     . ASN A 1 391 ? -20.024 28.230  14.381  1.00 26.05 ? 391  ASN A O     1 
ATOM   2994  C CB    . ASN A 1 391 ? -21.238 28.946  17.281  1.00 27.47 ? 391  ASN A CB    1 
ATOM   2995  C CG    . ASN A 1 391 ? -22.506 29.099  16.409  1.00 29.37 ? 391  ASN A CG    1 
ATOM   2996  O OD1   . ASN A 1 391 ? -22.525 29.922  15.501  1.00 34.30 ? 391  ASN A OD1   1 
ATOM   2997  N ND2   . ASN A 1 391 ? -23.536 28.303  16.669  1.00 28.36 ? 391  ASN A ND2   1 
ATOM   2998  N N     . PRO A 1 392 ? -21.287 26.451  15.002  1.00 24.98 ? 392  PRO A N     1 
ATOM   2999  C CA    . PRO A 1 392 ? -21.632 26.081  13.616  1.00 24.20 ? 392  PRO A CA    1 
ATOM   3000  C C     . PRO A 1 392 ? -22.069 27.241  12.705  1.00 24.15 ? 392  PRO A C     1 
ATOM   3001  O O     . PRO A 1 392 ? -21.638 27.295  11.557  1.00 23.41 ? 392  PRO A O     1 
ATOM   3002  C CB    . PRO A 1 392 ? -22.775 25.070  13.792  1.00 23.79 ? 392  PRO A CB    1 
ATOM   3003  C CG    . PRO A 1 392 ? -22.528 24.459  15.111  1.00 24.22 ? 392  PRO A CG    1 
ATOM   3004  C CD    . PRO A 1 392 ? -21.839 25.487  15.978  1.00 24.63 ? 392  PRO A CD    1 
ATOM   3005  N N     . GLU A 1 393 ? -22.899 28.148  13.215  1.00 24.41 ? 393  GLU A N     1 
ATOM   3006  C CA    . GLU A 1 393 ? -23.451 29.255  12.414  1.00 25.91 ? 393  GLU A CA    1 
ATOM   3007  C C     . GLU A 1 393 ? -22.335 30.206  11.958  1.00 24.90 ? 393  GLU A C     1 
ATOM   3008  O O     . GLU A 1 393 ? -22.267 30.602  10.788  1.00 25.29 ? 393  GLU A O     1 
ATOM   3009  C CB    . GLU A 1 393 ? -24.581 29.992  13.185  1.00 26.05 ? 393  GLU A CB    1 
ATOM   3010  C CG    . GLU A 1 393 ? -25.937 29.197  13.267  1.00 27.57 ? 393  GLU A CG    1 
ATOM   3011  C CD    . GLU A 1 393 ? -27.022 29.852  14.176  1.00 28.92 ? 393  GLU A CD    1 
ATOM   3012  O OE1   . GLU A 1 393 ? -26.782 30.919  14.808  1.00 32.51 ? 393  GLU A OE1   1 
ATOM   3013  O OE2   . GLU A 1 393 ? -28.129 29.273  14.271  1.00 31.81 ? 393  GLU A OE2   1 
ATOM   3014  N N     . ALA A 1 394 ? -21.430 30.513  12.877  1.00 23.98 ? 394  ALA A N     1 
ATOM   3015  C CA    . ALA A 1 394 ? -20.207 31.262  12.565  1.00 23.16 ? 394  ALA A CA    1 
ATOM   3016  C C     . ALA A 1 394 ? -19.325 30.521  11.551  1.00 22.71 ? 394  ALA A C     1 
ATOM   3017  O O     . ALA A 1 394 ? -18.817 31.127  10.599  1.00 22.43 ? 394  ALA A O     1 
ATOM   3018  C CB    . ALA A 1 394 ? -19.412 31.563  13.865  1.00 22.51 ? 394  ALA A CB    1 
ATOM   3019  N N     . TRP A 1 395 ? -19.148 29.213  11.774  1.00 21.71 ? 395  TRP A N     1 
ATOM   3020  C CA    . TRP A 1 395 ? -18.370 28.358  10.893  1.00 20.81 ? 395  TRP A CA    1 
ATOM   3021  C C     . TRP A 1 395 ? -18.976 28.368  9.489   1.00 20.98 ? 395  TRP A C     1 
ATOM   3022  O O     . TRP A 1 395 ? -18.272 28.591  8.492   1.00 21.18 ? 395  TRP A O     1 
ATOM   3023  C CB    . TRP A 1 395 ? -18.338 26.947  11.460  1.00 19.68 ? 395  TRP A CB    1 
ATOM   3024  C CG    . TRP A 1 395 ? -17.355 25.999  10.814  1.00 19.57 ? 395  TRP A CG    1 
ATOM   3025  C CD1   . TRP A 1 395 ? -16.176 25.565  11.353  1.00 18.45 ? 395  TRP A CD1   1 
ATOM   3026  C CD2   . TRP A 1 395 ? -17.487 25.315  9.537   1.00 18.64 ? 395  TRP A CD2   1 
ATOM   3027  N NE1   . TRP A 1 395 ? -15.565 24.679  10.495  1.00 19.78 ? 395  TRP A NE1   1 
ATOM   3028  C CE2   . TRP A 1 395 ? -16.341 24.511  9.377   1.00 18.06 ? 395  TRP A CE2   1 
ATOM   3029  C CE3   . TRP A 1 395 ? -18.448 25.324  8.519   1.00 18.26 ? 395  TRP A CE3   1 
ATOM   3030  C CZ2   . TRP A 1 395 ? -16.126 23.714  8.237   1.00 18.00 ? 395  TRP A CZ2   1 
ATOM   3031  C CZ3   . TRP A 1 395 ? -18.228 24.542  7.387   1.00 18.64 ? 395  TRP A CZ3   1 
ATOM   3032  C CH2   . TRP A 1 395 ? -17.073 23.733  7.267   1.00 17.37 ? 395  TRP A CH2   1 
ATOM   3033  N N     . GLU A 1 396 ? -20.283 28.132  9.415   1.00 20.97 ? 396  GLU A N     1 
ATOM   3034  C CA    . GLU A 1 396 ? -21.017 28.266  8.158   1.00 21.04 ? 396  GLU A CA    1 
ATOM   3035  C C     . GLU A 1 396 ? -20.835 29.631  7.462   1.00 20.65 ? 396  GLU A C     1 
ATOM   3036  O O     . GLU A 1 396 ? -20.569 29.679  6.272   1.00 21.30 ? 396  GLU A O     1 
ATOM   3037  C CB    . GLU A 1 396 ? -22.502 27.942  8.346   1.00 20.85 ? 396  GLU A CB    1 
ATOM   3038  C CG    . GLU A 1 396 ? -22.815 26.463  8.624   1.00 22.55 ? 396  GLU A CG    1 
ATOM   3039  C CD    . GLU A 1 396 ? -22.375 25.533  7.504   1.00 24.30 ? 396  GLU A CD    1 
ATOM   3040  O OE1   . GLU A 1 396 ? -22.106 26.032  6.402   1.00 24.82 ? 396  GLU A OE1   1 
ATOM   3041  O OE2   . GLU A 1 396 ? -22.296 24.295  7.724   1.00 27.41 ? 396  GLU A OE2   1 
ATOM   3042  N N     . TRP A 1 397 ? -20.965 30.732  8.190   1.00 19.89 ? 397  TRP A N     1 
ATOM   3043  C CA    . TRP A 1 397 ? -20.822 32.058  7.578   1.00 19.27 ? 397  TRP A CA    1 
ATOM   3044  C C     . TRP A 1 397 ? -19.418 32.263  7.006   1.00 19.32 ? 397  TRP A C     1 
ATOM   3045  O O     . TRP A 1 397 ? -19.230 32.817  5.918   1.00 18.34 ? 397  TRP A O     1 
ATOM   3046  C CB    . TRP A 1 397 ? -21.144 33.150  8.617   1.00 19.31 ? 397  TRP A CB    1 
ATOM   3047  C CG    . TRP A 1 397 ? -21.169 34.538  8.058   1.00 18.38 ? 397  TRP A CG    1 
ATOM   3048  C CD1   . TRP A 1 397 ? -22.264 35.222  7.585   1.00 17.47 ? 397  TRP A CD1   1 
ATOM   3049  C CD2   . TRP A 1 397 ? -20.054 35.417  7.922   1.00 16.75 ? 397  TRP A CD2   1 
ATOM   3050  N NE1   . TRP A 1 397 ? -21.895 36.479  7.162   1.00 17.77 ? 397  TRP A NE1   1 
ATOM   3051  C CE2   . TRP A 1 397 ? -20.540 36.621  7.341   1.00 18.48 ? 397  TRP A CE2   1 
ATOM   3052  C CE3   . TRP A 1 397 ? -18.683 35.298  8.207   1.00 17.60 ? 397  TRP A CE3   1 
ATOM   3053  C CZ2   . TRP A 1 397 ? -19.695 37.714  7.048   1.00 18.64 ? 397  TRP A CZ2   1 
ATOM   3054  C CZ3   . TRP A 1 397 ? -17.842 36.370  7.926   1.00 18.02 ? 397  TRP A CZ3   1 
ATOM   3055  C CH2   . TRP A 1 397 ? -18.354 37.574  7.351   1.00 18.76 ? 397  TRP A CH2   1 
ATOM   3056  N N     . TYR A 1 398 ? -18.432 31.818  7.781   1.00 19.84 ? 398  TYR A N     1 
ATOM   3057  C CA    . TYR A 1 398 ? -17.019 31.926  7.440   1.00 19.49 ? 398  TYR A CA    1 
ATOM   3058  C C     . TYR A 1 398 ? -16.737 31.123  6.154   1.00 19.62 ? 398  TYR A C     1 
ATOM   3059  O O     . TYR A 1 398 ? -16.165 31.665  5.180   1.00 19.40 ? 398  TYR A O     1 
ATOM   3060  C CB    . TYR A 1 398 ? -16.197 31.458  8.646   1.00 18.88 ? 398  TYR A CB    1 
ATOM   3061  C CG    . TYR A 1 398 ? -14.692 31.554  8.548   1.00 19.58 ? 398  TYR A CG    1 
ATOM   3062  C CD1   . TYR A 1 398 ? -14.057 32.720  8.084   1.00 17.10 ? 398  TYR A CD1   1 
ATOM   3063  C CD2   . TYR A 1 398 ? -13.886 30.482  8.970   1.00 19.44 ? 398  TYR A CD2   1 
ATOM   3064  C CE1   . TYR A 1 398 ? -12.670 32.792  8.023   1.00 17.06 ? 398  TYR A CE1   1 
ATOM   3065  C CE2   . TYR A 1 398 ? -12.480 30.546  8.906   1.00 18.21 ? 398  TYR A CE2   1 
ATOM   3066  C CZ    . TYR A 1 398 ? -11.877 31.702  8.446   1.00 18.50 ? 398  TYR A CZ    1 
ATOM   3067  O OH    . TYR A 1 398 ? -10.476 31.774  8.395   1.00 19.53 ? 398  TYR A OH    1 
ATOM   3068  N N     . TRP A 1 399 ? -17.208 29.873  6.139   1.00 19.83 ? 399  TRP A N     1 
ATOM   3069  C CA    . TRP A 1 399 ? -17.053 28.948  5.004   1.00 20.59 ? 399  TRP A CA    1 
ATOM   3070  C C     . TRP A 1 399 ? -17.700 29.492  3.728   1.00 20.80 ? 399  TRP A C     1 
ATOM   3071  O O     . TRP A 1 399 ? -17.147 29.384  2.631   1.00 20.11 ? 399  TRP A O     1 
ATOM   3072  C CB    . TRP A 1 399 ? -17.671 27.579  5.372   1.00 21.14 ? 399  TRP A CB    1 
ATOM   3073  C CG    . TRP A 1 399 ? -17.594 26.507  4.311   1.00 21.11 ? 399  TRP A CG    1 
ATOM   3074  C CD1   . TRP A 1 399 ? -16.512 25.721  4.013   1.00 20.87 ? 399  TRP A CD1   1 
ATOM   3075  C CD2   . TRP A 1 399 ? -18.650 26.089  3.426   1.00 21.30 ? 399  TRP A CD2   1 
ATOM   3076  N NE1   . TRP A 1 399 ? -16.823 24.852  2.994   1.00 20.75 ? 399  TRP A NE1   1 
ATOM   3077  C CE2   . TRP A 1 399 ? -18.124 25.053  2.611   1.00 21.22 ? 399  TRP A CE2   1 
ATOM   3078  C CE3   . TRP A 1 399 ? -19.992 26.480  3.253   1.00 22.12 ? 399  TRP A CE3   1 
ATOM   3079  C CZ2   . TRP A 1 399 ? -18.889 24.402  1.621   1.00 22.20 ? 399  TRP A CZ2   1 
ATOM   3080  C CZ3   . TRP A 1 399 ? -20.763 25.841  2.268   1.00 21.94 ? 399  TRP A CZ3   1 
ATOM   3081  C CH2   . TRP A 1 399 ? -20.203 24.803  1.461   1.00 21.77 ? 399  TRP A CH2   1 
ATOM   3082  N N     . LYS A 1 400 ? -18.872 30.095  3.907   1.00 21.20 ? 400  LYS A N     1 
ATOM   3083  C CA    . LYS A 1 400 ? -19.687 30.575  2.809   1.00 21.41 ? 400  LYS A CA    1 
ATOM   3084  C C     . LYS A 1 400 ? -19.230 31.938  2.297   1.00 21.51 ? 400  LYS A C     1 
ATOM   3085  O O     . LYS A 1 400 ? -18.992 32.124  1.097   1.00 22.10 ? 400  LYS A O     1 
ATOM   3086  C CB    . LYS A 1 400 ? -21.162 30.633  3.230   1.00 20.82 ? 400  LYS A CB    1 
ATOM   3087  C CG    . LYS A 1 400 ? -22.057 31.264  2.177   1.00 21.58 ? 400  LYS A CG    1 
ATOM   3088  C CD    . LYS A 1 400 ? -23.477 31.375  2.637   1.00 22.91 ? 400  LYS A CD    1 
ATOM   3089  C CE    . LYS A 1 400 ? -24.378 31.743  1.470   1.00 25.96 ? 400  LYS A CE    1 
ATOM   3090  N NZ    . LYS A 1 400 ? -25.734 32.196  1.927   1.00 27.30 ? 400  LYS A NZ    1 
ATOM   3091  N N     . LYS A 1 401 ? -19.120 32.887  3.212   1.00 21.11 ? 401  LYS A N     1 
ATOM   3092  C CA    . LYS A 1 401 ? -18.889 34.278  2.857   1.00 21.16 ? 401  LYS A CA    1 
ATOM   3093  C C     . LYS A 1 401 ? -17.419 34.584  2.537   1.00 21.33 ? 401  LYS A C     1 
ATOM   3094  O O     . LYS A 1 401 ? -17.118 35.249  1.542   1.00 20.77 ? 401  LYS A O     1 
ATOM   3095  C CB    . LYS A 1 401 ? -19.419 35.183  3.987   1.00 20.86 ? 401  LYS A CB    1 
ATOM   3096  C CG    . LYS A 1 401 ? -20.939 35.101  4.144   1.00 20.62 ? 401  LYS A CG    1 
ATOM   3097  C CD    . LYS A 1 401 ? -21.633 35.845  2.997   1.00 19.57 ? 401  LYS A CD    1 
ATOM   3098  C CE    . LYS A 1 401 ? -23.107 35.523  2.900   1.00 19.03 ? 401  LYS A CE    1 
ATOM   3099  N NZ    . LYS A 1 401 ? -23.788 36.600  2.130   1.00 19.18 ? 401  LYS A NZ    1 
ATOM   3100  N N     . ILE A 1 402 ? -16.517 34.119  3.404   1.00 21.76 ? 402  ILE A N     1 
ATOM   3101  C CA    . ILE A 1 402 ? -15.093 34.346  3.226   1.00 22.27 ? 402  ILE A CA    1 
ATOM   3102  C C     . ILE A 1 402 ? -14.472 33.344  2.208   1.00 22.70 ? 402  ILE A C     1 
ATOM   3103  O O     . ILE A 1 402 ? -13.805 33.762  1.243   1.00 22.74 ? 402  ILE A O     1 
ATOM   3104  C CB    . ILE A 1 402 ? -14.345 34.323  4.578   1.00 22.59 ? 402  ILE A CB    1 
ATOM   3105  C CG1   . ILE A 1 402 ? -15.013 35.263  5.611   1.00 21.85 ? 402  ILE A CG1   1 
ATOM   3106  C CG2   . ILE A 1 402 ? -12.825 34.582  4.383   1.00 22.28 ? 402  ILE A CG2   1 
ATOM   3107  C CD1   . ILE A 1 402 ? -15.221 36.724  5.181   1.00 22.45 ? 402  ILE A CD1   1 
ATOM   3108  N N     . GLY A 1 403 ? -14.725 32.051  2.408   1.00 22.52 ? 403  GLY A N     1 
ATOM   3109  C CA    . GLY A 1 403 ? -14.216 31.007  1.532   1.00 23.27 ? 403  GLY A CA    1 
ATOM   3110  C C     . GLY A 1 403 ? -15.073 30.718  0.308   1.00 24.40 ? 403  GLY A C     1 
ATOM   3111  O O     . GLY A 1 403 ? -14.734 29.833  -0.487  1.00 23.97 ? 403  GLY A O     1 
ATOM   3112  N N     . LYS A 1 404 ? -16.180 31.447  0.138   1.00 25.42 ? 404  LYS A N     1 
ATOM   3113  C CA    . LYS A 1 404 ? -17.036 31.291  -1.059  1.00 26.96 ? 404  LYS A CA    1 
ATOM   3114  C C     . LYS A 1 404 ? -17.492 29.849  -1.302  1.00 27.00 ? 404  LYS A C     1 
ATOM   3115  O O     . LYS A 1 404 ? -17.802 29.470  -2.445  1.00 27.65 ? 404  LYS A O     1 
ATOM   3116  C CB    . LYS A 1 404 ? -16.343 31.821  -2.326  1.00 27.07 ? 404  LYS A CB    1 
ATOM   3117  C CG    . LYS A 1 404 ? -16.024 33.316  -2.301  1.00 28.56 ? 404  LYS A CG    1 
ATOM   3118  C CD    . LYS A 1 404 ? -15.082 33.693  -3.454  1.00 28.26 ? 404  LYS A CD    1 
ATOM   3119  C CE    . LYS A 1 404 ? -15.834 34.341  -4.596  1.00 31.10 ? 404  LYS A CE    1 
ATOM   3120  N NZ    . LYS A 1 404 ? -15.023 34.275  -5.832  1.00 30.49 ? 404  LYS A NZ    1 
ATOM   3121  N N     . GLU A 1 405 ? -17.541 29.064  -0.223  1.00 26.94 ? 405  GLU A N     1 
ATOM   3122  C CA    . GLU A 1 405 ? -18.029 27.676  -0.235  1.00 27.64 ? 405  GLU A CA    1 
ATOM   3123  C C     . GLU A 1 405 ? -17.047 26.731  -0.914  1.00 26.91 ? 405  GLU A C     1 
ATOM   3124  O O     . GLU A 1 405 ? -17.351 25.575  -1.136  1.00 27.18 ? 405  GLU A O     1 
ATOM   3125  C CB    . GLU A 1 405 ? -19.431 27.556  -0.874  1.00 27.77 ? 405  GLU A CB    1 
ATOM   3126  C CG    . GLU A 1 405 ? -20.510 28.482  -0.301  1.00 28.81 ? 405  GLU A CG    1 
ATOM   3127  C CD    . GLU A 1 405 ? -21.902 28.186  -0.857  1.00 29.47 ? 405  GLU A CD    1 
ATOM   3128  O OE1   . GLU A 1 405 ? -22.547 29.098  -1.418  1.00 32.02 ? 405  GLU A OE1   1 
ATOM   3129  O OE2   . GLU A 1 405 ? -22.354 27.035  -0.735  1.00 31.84 ? 405  GLU A OE2   1 
ATOM   3130  N N     . LYS A 1 406 ? -15.855 27.225  -1.206  1.00 26.86 ? 406  LYS A N     1 
ATOM   3131  C CA    . LYS A 1 406 ? -14.845 26.440  -1.897  1.00 26.78 ? 406  LYS A CA    1 
ATOM   3132  C C     . LYS A 1 406 ? -13.667 26.037  -1.022  1.00 25.77 ? 406  LYS A C     1 
ATOM   3133  O O     . LYS A 1 406 ? -12.816 25.252  -1.471  1.00 25.51 ? 406  LYS A O     1 
ATOM   3134  C CB    . LYS A 1 406 ? -14.317 27.200  -3.121  1.00 27.37 ? 406  LYS A CB    1 
ATOM   3135  C CG    . LYS A 1 406 ? -15.295 27.313  -4.271  1.00 29.90 ? 406  LYS A CG    1 
ATOM   3136  C CD    . LYS A 1 406 ? -14.841 28.425  -5.196  1.00 35.25 ? 406  LYS A CD    1 
ATOM   3137  C CE    . LYS A 1 406 ? -15.571 28.379  -6.519  1.00 39.33 ? 406  LYS A CE    1 
ATOM   3138  N NZ    . LYS A 1 406 ? -14.922 29.319  -7.491  1.00 42.33 ? 406  LYS A NZ    1 
ATOM   3139  N N     . CYS A 1 407 ? -13.610 26.559  0.210   1.00 24.41 ? 407  CYS A N     1 
ATOM   3140  C CA    . CYS A 1 407 ? -12.425 26.379  1.044   1.00 22.91 ? 407  CYS A CA    1 
ATOM   3141  C C     . CYS A 1 407 ? -12.624 25.513  2.280   1.00 22.70 ? 407  CYS A C     1 
ATOM   3142  O O     . CYS A 1 407 ? -13.432 25.841  3.150   1.00 23.35 ? 407  CYS A O     1 
ATOM   3143  C CB    . CYS A 1 407 ? -11.862 27.726  1.477   1.00 22.67 ? 407  CYS A CB    1 
ATOM   3144  S SG    . CYS A 1 407 ? -11.419 28.795  0.142   1.00 20.75 ? 407  CYS A SG    1 
ATOM   3145  N N     . PRO A 1 408 ? -11.848 24.421  2.394   1.00 22.20 ? 408  PRO A N     1 
ATOM   3146  C CA    . PRO A 1 408 ? -11.819 23.710  3.667   1.00 21.72 ? 408  PRO A CA    1 
ATOM   3147  C C     . PRO A 1 408 ? -11.523 24.668  4.800   1.00 21.87 ? 408  PRO A C     1 
ATOM   3148  O O     . PRO A 1 408 ? -10.670 25.526  4.648   1.00 22.37 ? 408  PRO A O     1 
ATOM   3149  C CB    . PRO A 1 408 ? -10.651 22.744  3.474   1.00 21.49 ? 408  PRO A CB    1 
ATOM   3150  C CG    . PRO A 1 408 ? -10.680 22.446  2.037   1.00 20.09 ? 408  PRO A CG    1 
ATOM   3151  C CD    . PRO A 1 408 ? -10.974 23.766  1.399   1.00 21.59 ? 408  PRO A CD    1 
ATOM   3152  N N     . VAL A 1 409 ? -12.243 24.549  5.912   1.00 21.81 ? 409  VAL A N     1 
ATOM   3153  C CA    . VAL A 1 409 ? -11.905 25.294  7.116   1.00 21.22 ? 409  VAL A CA    1 
ATOM   3154  C C     . VAL A 1 409 ? -11.199 24.339  8.072   1.00 21.66 ? 409  VAL A C     1 
ATOM   3155  O O     . VAL A 1 409 ? -11.775 23.327  8.443   1.00 21.38 ? 409  VAL A O     1 
ATOM   3156  C CB    . VAL A 1 409 ? -13.177 25.873  7.839   1.00 21.53 ? 409  VAL A CB    1 
ATOM   3157  C CG1   . VAL A 1 409 ? -12.826 26.391  9.282   1.00 19.18 ? 409  VAL A CG1   1 
ATOM   3158  C CG2   . VAL A 1 409 ? -13.813 26.972  7.022   1.00 19.84 ? 409  VAL A CG2   1 
ATOM   3159  N N     . VAL A 1 410 ? -9.968  24.667  8.469   1.00 22.12 ? 410  VAL A N     1 
ATOM   3160  C CA    . VAL A 1 410 ? -9.266  23.898  9.504   1.00 22.60 ? 410  VAL A CA    1 
ATOM   3161  C C     . VAL A 1 410 ? -9.419  24.542  10.902  1.00 22.94 ? 410  VAL A C     1 
ATOM   3162  O O     . VAL A 1 410 ? -8.898  25.634  11.150  1.00 22.95 ? 410  VAL A O     1 
ATOM   3163  C CB    . VAL A 1 410 ? -7.769  23.578  9.156   1.00 22.33 ? 410  VAL A CB    1 
ATOM   3164  C CG1   . VAL A 1 410 ? -7.677  22.750  7.887   1.00 22.41 ? 410  VAL A CG1   1 
ATOM   3165  C CG2   . VAL A 1 410 ? -6.916  24.832  9.045   1.00 22.73 ? 410  VAL A CG2   1 
ATOM   3166  N N     . ASP A 1 411 ? -10.184 23.876  11.778  1.00 22.59 ? 411  ASP A N     1 
ATOM   3167  C CA    . ASP A 1 411 ? -10.381 24.326  13.125  1.00 22.64 ? 411  ASP A CA    1 
ATOM   3168  C C     . ASP A 1 411 ? -9.320  23.646  13.967  1.00 22.62 ? 411  ASP A C     1 
ATOM   3169  O O     . ASP A 1 411 ? -9.442  22.460  14.292  1.00 22.95 ? 411  ASP A O     1 
ATOM   3170  C CB    . ASP A 1 411 ? -11.789 23.953  13.613  1.00 23.28 ? 411  ASP A CB    1 
ATOM   3171  C CG    . ASP A 1 411 ? -12.097 24.439  15.063  1.00 23.39 ? 411  ASP A CG    1 
ATOM   3172  O OD1   . ASP A 1 411 ? -11.336 25.235  15.703  1.00 20.35 ? 411  ASP A OD1   1 
ATOM   3173  O OD2   . ASP A 1 411 ? -13.146 23.996  15.549  1.00 23.75 ? 411  ASP A OD2   1 
ATOM   3174  N N     . THR A 1 412 ? -8.283  24.408  14.318  1.00 21.99 ? 412  THR A N     1 
ATOM   3175  C CA    . THR A 1 412 ? -7.104  23.859  15.000  1.00 21.09 ? 412  THR A CA    1 
ATOM   3176  C C     . THR A 1 412 ? -7.174  24.027  16.524  1.00 20.65 ? 412  THR A C     1 
ATOM   3177  O O     . THR A 1 412 ? -7.073  25.155  17.019  1.00 20.39 ? 412  THR A O     1 
ATOM   3178  C CB    . THR A 1 412 ? -5.811  24.546  14.518  1.00 20.98 ? 412  THR A CB    1 
ATOM   3179  O OG1   . THR A 1 412 ? -5.883  25.951  14.833  1.00 20.54 ? 412  THR A OG1   1 
ATOM   3180  C CG2   . THR A 1 412 ? -5.579  24.329  13.013  1.00 19.73 ? 412  THR A CG2   1 
ATOM   3181  N N     . TRP A 1 413 ? -7.317  22.912  17.254  1.00 19.68 ? 413  TRP A N     1 
ATOM   3182  C CA    . TRP A 1 413 ? -7.252  22.950  18.721  1.00 19.11 ? 413  TRP A CA    1 
ATOM   3183  C C     . TRP A 1 413 ? -5.843  22.660  19.205  1.00 19.21 ? 413  TRP A C     1 
ATOM   3184  O O     . TRP A 1 413 ? -5.220  21.683  18.778  1.00 19.75 ? 413  TRP A O     1 
ATOM   3185  C CB    . TRP A 1 413 ? -8.257  22.017  19.428  1.00 18.61 ? 413  TRP A CB    1 
ATOM   3186  C CG    . TRP A 1 413 ? -8.065  22.085  20.934  1.00 18.52 ? 413  TRP A CG    1 
ATOM   3187  C CD1   . TRP A 1 413 ? -8.538  23.044  21.781  1.00 18.72 ? 413  TRP A CD1   1 
ATOM   3188  C CD2   . TRP A 1 413 ? -7.270  21.206  21.741  1.00 18.38 ? 413  TRP A CD2   1 
ATOM   3189  N NE1   . TRP A 1 413 ? -8.118  22.802  23.066  1.00 18.60 ? 413  TRP A NE1   1 
ATOM   3190  C CE2   . TRP A 1 413 ? -7.332  21.684  23.067  1.00 18.55 ? 413  TRP A CE2   1 
ATOM   3191  C CE3   . TRP A 1 413 ? -6.529  20.048  21.472  1.00 18.23 ? 413  TRP A CE3   1 
ATOM   3192  C CZ2   . TRP A 1 413 ? -6.688  21.040  24.126  1.00 19.66 ? 413  TRP A CZ2   1 
ATOM   3193  C CZ3   . TRP A 1 413 ? -5.878  19.423  22.516  1.00 19.59 ? 413  TRP A CZ3   1 
ATOM   3194  C CH2   . TRP A 1 413 ? -5.964  19.915  23.833  1.00 18.60 ? 413  TRP A CH2   1 
ATOM   3195  N N     . TRP A 1 414 ? -5.362  23.542  20.083  1.00 18.91 ? 414  TRP A N     1 
ATOM   3196  C CA    . TRP A 1 414 ? -4.091  23.447  20.745  1.00 19.03 ? 414  TRP A CA    1 
ATOM   3197  C C     . TRP A 1 414 ? -3.983  24.485  21.868  1.00 19.98 ? 414  TRP A C     1 
ATOM   3198  O O     . TRP A 1 414 ? -4.977  25.136  22.238  1.00 19.65 ? 414  TRP A O     1 
ATOM   3199  C CB    . TRP A 1 414 ? -2.906  23.525  19.767  1.00 19.33 ? 414  TRP A CB    1 
ATOM   3200  C CG    . TRP A 1 414 ? -2.750  24.777  18.941  1.00 18.66 ? 414  TRP A CG    1 
ATOM   3201  C CD1   . TRP A 1 414 ? -3.607  25.257  17.994  1.00 17.81 ? 414  TRP A CD1   1 
ATOM   3202  C CD2   . TRP A 1 414 ? -1.624  25.688  18.970  1.00 20.24 ? 414  TRP A CD2   1 
ATOM   3203  N NE1   . TRP A 1 414 ? -3.091  26.426  17.436  1.00 19.00 ? 414  TRP A NE1   1 
ATOM   3204  C CE2   . TRP A 1 414 ? -1.883  26.709  18.023  1.00 20.67 ? 414  TRP A CE2   1 
ATOM   3205  C CE3   . TRP A 1 414 ? -0.439  25.759  19.737  1.00 18.03 ? 414  TRP A CE3   1 
ATOM   3206  C CZ2   . TRP A 1 414 ? -0.987  27.794  17.818  1.00 20.97 ? 414  TRP A CZ2   1 
ATOM   3207  C CZ3   . TRP A 1 414 ? 0.449   26.816  19.522  1.00 17.44 ? 414  TRP A CZ3   1 
ATOM   3208  C CH2   . TRP A 1 414 ? 0.176   27.810  18.567  1.00 18.43 ? 414  TRP A CH2   1 
ATOM   3209  N N     . GLN A 1 415 ? -2.777  24.607  22.427  1.00 20.25 ? 415  GLN A N     1 
ATOM   3210  C CA    . GLN A 1 415 ? -2.538  25.465  23.576  1.00 20.71 ? 415  GLN A CA    1 
ATOM   3211  C C     . GLN A 1 415 ? -1.130  26.020  23.526  1.00 21.01 ? 415  GLN A C     1 
ATOM   3212  O O     . GLN A 1 415 ? -0.288  25.496  22.803  1.00 21.84 ? 415  GLN A O     1 
ATOM   3213  C CB    . GLN A 1 415 ? -2.659  24.657  24.870  1.00 20.52 ? 415  GLN A CB    1 
ATOM   3214  C CG    . GLN A 1 415 ? -3.932  23.852  25.029  1.00 21.07 ? 415  GLN A CG    1 
ATOM   3215  C CD    . GLN A 1 415 ? -3.957  23.124  26.365  1.00 20.90 ? 415  GLN A CD    1 
ATOM   3216  O OE1   . GLN A 1 415 ? -3.147  22.250  26.588  1.00 22.59 ? 415  GLN A OE1   1 
ATOM   3217  N NE2   . GLN A 1 415 ? -4.873  23.501  27.258  1.00 20.95 ? 415  GLN A NE2   1 
ATOM   3218  N N     . THR A 1 416 ? -0.852  27.038  24.337  1.00 21.17 ? 416  THR A N     1 
ATOM   3219  C CA    . THR A 1 416 ? 0.527   27.488  24.541  1.00 21.05 ? 416  THR A CA    1 
ATOM   3220  C C     . THR A 1 416 ? 1.451   26.323  24.968  1.00 21.59 ? 416  THR A C     1 
ATOM   3221  O O     . THR A 1 416 ? 2.553   26.167  24.461  1.00 21.53 ? 416  THR A O     1 
ATOM   3222  C CB    . THR A 1 416 ? 0.588   28.580  25.612  1.00 21.01 ? 416  THR A CB    1 
ATOM   3223  O OG1   . THR A 1 416 ? -0.413  29.559  25.327  1.00 19.95 ? 416  THR A OG1   1 
ATOM   3224  C CG2   . THR A 1 416 ? 1.989   29.226  25.657  1.00 19.44 ? 416  THR A CG2   1 
ATOM   3225  N N     . GLU A 1 417 ? 0.982   25.511  25.904  1.00 21.98 ? 417  GLU A N     1 
ATOM   3226  C CA    . GLU A 1 417 ? 1.766   24.419  26.422  1.00 22.23 ? 417  GLU A CA    1 
ATOM   3227  C C     . GLU A 1 417 ? 2.016   23.340  25.370  1.00 22.68 ? 417  GLU A C     1 
ATOM   3228  O O     . GLU A 1 417 ? 2.860   22.479  25.582  1.00 23.60 ? 417  GLU A O     1 
ATOM   3229  C CB    . GLU A 1 417 ? 1.075   23.796  27.641  1.00 22.54 ? 417  GLU A CB    1 
ATOM   3230  C CG    . GLU A 1 417 ? 0.848   24.733  28.834  1.00 22.25 ? 417  GLU A CG    1 
ATOM   3231  C CD    . GLU A 1 417 ? -0.465  25.560  28.754  1.00 23.06 ? 417  GLU A CD    1 
ATOM   3232  O OE1   . GLU A 1 417 ? -1.055  25.725  27.665  1.00 23.98 ? 417  GLU A OE1   1 
ATOM   3233  O OE2   . GLU A 1 417 ? -0.915  26.061  29.806  1.00 22.51 ? 417  GLU A OE2   1 
ATOM   3234  N N     . THR A 1 418 ? 1.302   23.361  24.242  1.00 22.84 ? 418  THR A N     1 
ATOM   3235  C CA    . THR A 1 418 ? 1.463   22.256  23.284  1.00 23.01 ? 418  THR A CA    1 
ATOM   3236  C C     . THR A 1 418 ? 2.354   22.545  22.054  1.00 23.39 ? 418  THR A C     1 
ATOM   3237  O O     . THR A 1 418 ? 2.616   21.634  21.244  1.00 23.74 ? 418  THR A O     1 
ATOM   3238  C CB    . THR A 1 418 ? 0.103   21.596  22.837  1.00 23.20 ? 418  THR A CB    1 
ATOM   3239  O OG1   . THR A 1 418 ? -0.504  22.352  21.770  1.00 21.85 ? 418  THR A OG1   1 
ATOM   3240  C CG2   . THR A 1 418 ? -0.865  21.420  24.033  1.00 21.33 ? 418  THR A CG2   1 
ATOM   3241  N N     . GLY A 1 419 ? 2.804   23.791  21.914  1.00 22.70 ? 419  GLY A N     1 
ATOM   3242  C CA    . GLY A 1 419 ? 3.724   24.149  20.837  1.00 23.07 ? 419  GLY A CA    1 
ATOM   3243  C C     . GLY A 1 419 ? 3.129   24.279  19.440  1.00 23.24 ? 419  GLY A C     1 
ATOM   3244  O O     . GLY A 1 419 ? 3.464   25.219  18.711  1.00 23.76 ? 419  GLY A O     1 
ATOM   3245  N N     . GLY A 1 420 ? 2.267   23.336  19.055  1.00 22.66 ? 420  GLY A N     1 
ATOM   3246  C CA    . GLY A 1 420 ? 1.630   23.355  17.744  1.00 21.98 ? 420  GLY A CA    1 
ATOM   3247  C C     . GLY A 1 420 ? 0.293   22.641  17.748  1.00 21.89 ? 420  GLY A C     1 
ATOM   3248  O O     . GLY A 1 420 ? -0.197  22.254  18.819  1.00 21.18 ? 420  GLY A O     1 
ATOM   3249  N N     . PHE A 1 421 ? -0.289  22.457  16.556  1.00 21.31 ? 421  PHE A N     1 
ATOM   3250  C CA    . PHE A 1 421 ? -1.642  21.852  16.415  1.00 21.41 ? 421  PHE A CA    1 
ATOM   3251  C C     . PHE A 1 421 ? -1.772  20.477  17.082  1.00 21.26 ? 421  PHE A C     1 
ATOM   3252  O O     . PHE A 1 421 ? -0.859  19.660  16.986  1.00 21.37 ? 421  PHE A O     1 
ATOM   3253  C CB    . PHE A 1 421 ? -2.075  21.770  14.943  1.00 20.88 ? 421  PHE A CB    1 
ATOM   3254  C CG    . PHE A 1 421 ? -2.034  23.078  14.231  1.00 21.10 ? 421  PHE A CG    1 
ATOM   3255  C CD1   . PHE A 1 421 ? -1.803  23.120  12.853  1.00 20.47 ? 421  PHE A CD1   1 
ATOM   3256  C CD2   . PHE A 1 421 ? -2.205  24.284  14.932  1.00 21.22 ? 421  PHE A CD2   1 
ATOM   3257  C CE1   . PHE A 1 421 ? -1.746  24.323  12.166  1.00 19.93 ? 421  PHE A CE1   1 
ATOM   3258  C CE2   . PHE A 1 421 ? -2.139  25.503  14.266  1.00 20.71 ? 421  PHE A CE2   1 
ATOM   3259  C CZ    . PHE A 1 421 ? -1.915  25.519  12.864  1.00 21.79 ? 421  PHE A CZ    1 
ATOM   3260  N N     . MET A 1 422 ? -2.891  20.240  17.764  1.00 21.27 ? 422  MET A N     1 
ATOM   3261  C CA    . MET A 1 422 ? -3.087  18.998  18.524  1.00 21.23 ? 422  MET A CA    1 
ATOM   3262  C C     . MET A 1 422 ? -4.245  18.188  17.982  1.00 21.62 ? 422  MET A C     1 
ATOM   3263  O O     . MET A 1 422 ? -4.118  16.977  17.785  1.00 22.34 ? 422  MET A O     1 
ATOM   3264  C CB    . MET A 1 422 ? -3.313  19.290  20.002  1.00 21.22 ? 422  MET A CB    1 
ATOM   3265  C CG    . MET A 1 422 ? -2.088  19.887  20.690  1.00 21.46 ? 422  MET A CG    1 
ATOM   3266  S SD    . MET A 1 422 ? -0.634  18.772  20.766  1.00 22.43 ? 422  MET A SD    1 
ATOM   3267  C CE    . MET A 1 422 ? -1.227  17.585  22.020  1.00 16.06 ? 422  MET A CE    1 
ATOM   3268  N N     . ILE A 1 423 ? -5.374  18.849  17.728  1.00 21.15 ? 423  ILE A N     1 
ATOM   3269  C CA    . ILE A 1 423 ? -6.523  18.180  17.126  1.00 20.44 ? 423  ILE A CA    1 
ATOM   3270  C C     . ILE A 1 423 ? -7.006  19.070  16.015  1.00 21.06 ? 423  ILE A C     1 
ATOM   3271  O O     . ILE A 1 423 ? -7.412  20.216  16.257  1.00 22.70 ? 423  ILE A O     1 
ATOM   3272  C CB    . ILE A 1 423 ? -7.642  17.912  18.154  1.00 19.96 ? 423  ILE A CB    1 
ATOM   3273  C CG1   . ILE A 1 423 ? -7.124  16.949  19.240  1.00 18.39 ? 423  ILE A CG1   1 
ATOM   3274  C CG2   . ILE A 1 423 ? -8.898  17.378  17.462  1.00 19.16 ? 423  ILE A CG2   1 
ATOM   3275  C CD1   . ILE A 1 423 ? -8.027  16.789  20.424  1.00 17.58 ? 423  ILE A CD1   1 
ATOM   3276  N N     . THR A 1 424 ? -6.962  18.559  14.791  1.00 20.53 ? 424  THR A N     1 
ATOM   3277  C CA    . THR A 1 424 ? -7.175  19.411  13.636  1.00 20.50 ? 424  THR A CA    1 
ATOM   3278  C C     . THR A 1 424 ? -7.532  18.622  12.372  1.00 20.73 ? 424  THR A C     1 
ATOM   3279  O O     . THR A 1 424 ? -7.017  17.518  12.154  1.00 21.21 ? 424  THR A O     1 
ATOM   3280  C CB    . THR A 1 424 ? -5.937  20.332  13.375  1.00 20.06 ? 424  THR A CB    1 
ATOM   3281  O OG1   . THR A 1 424 ? -6.163  21.135  12.203  1.00 19.51 ? 424  THR A OG1   1 
ATOM   3282  C CG2   . THR A 1 424 ? -4.665  19.502  13.212  1.00 18.89 ? 424  THR A CG2   1 
ATOM   3283  N N     . PRO A 1 425 ? -8.443  19.171  11.556  1.00 20.59 ? 425  PRO A N     1 
ATOM   3284  C CA    . PRO A 1 425 ? -8.585  18.585  10.238  1.00 20.47 ? 425  PRO A CA    1 
ATOM   3285  C C     . PRO A 1 425 ? -7.322  18.775  9.376   1.00 20.57 ? 425  PRO A C     1 
ATOM   3286  O O     . PRO A 1 425 ? -6.522  19.696  9.579   1.00 20.69 ? 425  PRO A O     1 
ATOM   3287  C CB    . PRO A 1 425 ? -9.779  19.332  9.626   1.00 20.55 ? 425  PRO A CB    1 
ATOM   3288  C CG    . PRO A 1 425 ? -10.034 20.517  10.504  1.00 20.87 ? 425  PRO A CG    1 
ATOM   3289  C CD    . PRO A 1 425 ? -9.371  20.297  11.807  1.00 20.32 ? 425  PRO A CD    1 
ATOM   3290  N N     . LEU A 1 426 ? -7.122  17.842  8.468   1.00 20.64 ? 426  LEU A N     1 
ATOM   3291  C CA    . LEU A 1 426 ? -6.182  17.997  7.400   1.00 21.43 ? 426  LEU A CA    1 
ATOM   3292  C C     . LEU A 1 426 ? -7.090  18.168  6.202   1.00 21.40 ? 426  LEU A C     1 
ATOM   3293  O O     . LEU A 1 426 ? -7.972  17.333  5.966   1.00 21.42 ? 426  LEU A O     1 
ATOM   3294  C CB    . LEU A 1 426 ? -5.243  16.778  7.285   1.00 21.45 ? 426  LEU A CB    1 
ATOM   3295  C CG    . LEU A 1 426 ? -4.008  16.878  8.210   1.00 22.74 ? 426  LEU A CG    1 
ATOM   3296  C CD1   . LEU A 1 426 ? -4.385  16.782  9.688   1.00 21.98 ? 426  LEU A CD1   1 
ATOM   3297  C CD2   . LEU A 1 426 ? -2.929  15.862  7.886   1.00 22.08 ? 426  LEU A CD2   1 
ATOM   3298  N N     . PRO A 1 427 ? -6.910  19.280  5.469   1.00 21.12 ? 427  PRO A N     1 
ATOM   3299  C CA    . PRO A 1 427 ? -7.884  19.703  4.461   1.00 20.94 ? 427  PRO A CA    1 
ATOM   3300  C C     . PRO A 1 427 ? -8.135  18.676  3.314   1.00 21.08 ? 427  PRO A C     1 
ATOM   3301  O O     . PRO A 1 427 ? -9.214  18.686  2.705   1.00 21.42 ? 427  PRO A O     1 
ATOM   3302  C CB    . PRO A 1 427 ? -7.303  21.040  3.929   1.00 20.21 ? 427  PRO A CB    1 
ATOM   3303  C CG    . PRO A 1 427 ? -5.908  21.067  4.294   1.00 20.31 ? 427  PRO A CG    1 
ATOM   3304  C CD    . PRO A 1 427 ? -5.757  20.198  5.549   1.00 21.16 ? 427  PRO A CD    1 
ATOM   3305  N N     . GLY A 1 428 ? -7.162  17.814  3.027   1.00 21.05 ? 428  GLY A N     1 
ATOM   3306  C CA    . GLY A 1 428 ? -7.319  16.821  1.964   1.00 20.24 ? 428  GLY A CA    1 
ATOM   3307  C C     . GLY A 1 428 ? -7.569  15.414  2.463   1.00 19.59 ? 428  GLY A C     1 
ATOM   3308  O O     . GLY A 1 428 ? -7.722  14.505  1.668   1.00 19.96 ? 428  GLY A O     1 
ATOM   3309  N N     . ALA A 1 429 ? -7.607  15.238  3.777   1.00 19.11 ? 429  ALA A N     1 
ATOM   3310  C CA    . ALA A 1 429 ? -7.702  13.929  4.381   1.00 18.86 ? 429  ALA A CA    1 
ATOM   3311  C C     . ALA A 1 429 ? -9.024  13.685  5.104   1.00 19.47 ? 429  ALA A C     1 
ATOM   3312  O O     . ALA A 1 429 ? -9.564  12.583  5.043   1.00 19.61 ? 429  ALA A O     1 
ATOM   3313  C CB    . ALA A 1 429 ? -6.537  13.714  5.335   1.00 18.36 ? 429  ALA A CB    1 
ATOM   3314  N N     . ILE A 1 430 ? -9.534  14.721  5.777   1.00 20.20 ? 430  ILE A N     1 
ATOM   3315  C CA    . ILE A 1 430 ? -10.616 14.612  6.780   1.00 20.26 ? 430  ILE A CA    1 
ATOM   3316  C C     . ILE A 1 430 ? -11.826 15.433  6.309   1.00 20.41 ? 430  ILE A C     1 
ATOM   3317  O O     . ILE A 1 430 ? -11.672 16.583  5.887   1.00 20.15 ? 430  ILE A O     1 
ATOM   3318  C CB    . ILE A 1 430 ? -10.134 15.085  8.224   1.00 20.33 ? 430  ILE A CB    1 
ATOM   3319  C CG1   . ILE A 1 430 ? -9.044  14.158  8.763   1.00 20.82 ? 430  ILE A CG1   1 
ATOM   3320  C CG2   . ILE A 1 430 ? -11.276 15.114  9.237   1.00 18.97 ? 430  ILE A CG2   1 
ATOM   3321  C CD1   . ILE A 1 430 ? -8.293  14.704  9.985   1.00 20.26 ? 430  ILE A CD1   1 
ATOM   3322  N N     . GLU A 1 431 ? -13.014 14.822  6.375   1.00 20.46 ? 431  GLU A N     1 
ATOM   3323  C CA    . GLU A 1 431 ? -14.259 15.482  6.013   1.00 20.99 ? 431  GLU A CA    1 
ATOM   3324  C C     . GLU A 1 431 ? -14.709 16.321  7.180   1.00 20.51 ? 431  GLU A C     1 
ATOM   3325  O O     . GLU A 1 431 ? -14.681 15.832  8.297   1.00 21.51 ? 431  GLU A O     1 
ATOM   3326  C CB    . GLU A 1 431 ? -15.346 14.457  5.687   1.00 20.81 ? 431  GLU A CB    1 
ATOM   3327  C CG    . GLU A 1 431 ? -15.160 13.777  4.350   1.00 23.29 ? 431  GLU A CG    1 
ATOM   3328  C CD    . GLU A 1 431 ? -16.329 12.890  3.968   1.00 24.90 ? 431  GLU A CD    1 
ATOM   3329  O OE1   . GLU A 1 431 ? -16.749 12.068  4.809   1.00 26.63 ? 431  GLU A OE1   1 
ATOM   3330  O OE2   . GLU A 1 431 ? -16.823 13.014  2.822   1.00 27.40 ? 431  GLU A OE2   1 
ATOM   3331  N N     . LEU A 1 432 ? -15.173 17.544  6.915   1.00 19.77 ? 432  LEU A N     1 
ATOM   3332  C CA    . LEU A 1 432 ? -15.428 18.527  7.969   1.00 19.15 ? 432  LEU A CA    1 
ATOM   3333  C C     . LEU A 1 432 ? -16.811 18.498  8.574   1.00 19.52 ? 432  LEU A C     1 
ATOM   3334  O O     . LEU A 1 432 ? -17.804 18.194  7.905   1.00 19.56 ? 432  LEU A O     1 
ATOM   3335  C CB    . LEU A 1 432 ? -15.151 19.959  7.486   1.00 19.04 ? 432  LEU A CB    1 
ATOM   3336  C CG    . LEU A 1 432 ? -13.875 20.211  6.683   1.00 16.98 ? 432  LEU A CG    1 
ATOM   3337  C CD1   . LEU A 1 432 ? -13.864 21.605  6.097   1.00 14.31 ? 432  LEU A CD1   1 
ATOM   3338  C CD2   . LEU A 1 432 ? -12.680 19.968  7.562   1.00 17.73 ? 432  LEU A CD2   1 
ATOM   3339  N N     . LYS A 1 433 ? -16.842 18.830  9.862   1.00 19.64 ? 433  LYS A N     1 
ATOM   3340  C CA    . LYS A 1 433 ? -18.061 19.093  10.594  1.00 20.07 ? 433  LYS A CA    1 
ATOM   3341  C C     . LYS A 1 433 ? -17.956 20.461  11.268  1.00 20.77 ? 433  LYS A C     1 
ATOM   3342  O O     . LYS A 1 433 ? -17.023 20.706  12.046  1.00 21.14 ? 433  LYS A O     1 
ATOM   3343  C CB    . LYS A 1 433 ? -18.283 18.010  11.660  1.00 19.96 ? 433  LYS A CB    1 
ATOM   3344  C CG    . LYS A 1 433 ? -18.528 16.615  11.124  1.00 17.88 ? 433  LYS A CG    1 
ATOM   3345  C CD    . LYS A 1 433 ? -18.793 15.673  12.270  1.00 16.15 ? 433  LYS A CD    1 
ATOM   3346  C CE    . LYS A 1 433 ? -18.633 14.231  11.846  1.00 17.68 ? 433  LYS A CE    1 
ATOM   3347  N NZ    . LYS A 1 433 ? -19.411 13.413  12.816  1.00 21.29 ? 433  LYS A NZ    1 
ATOM   3348  N N     . ALA A 1 434 ? -18.917 21.334  10.961  1.00 20.90 ? 434  ALA A N     1 
ATOM   3349  C CA    . ALA A 1 434 ? -19.022 22.681  11.527  1.00 21.04 ? 434  ALA A CA    1 
ATOM   3350  C C     . ALA A 1 434 ? -18.991 22.748  13.078  1.00 21.23 ? 434  ALA A C     1 
ATOM   3351  O O     . ALA A 1 434 ? -19.945 22.324  13.770  1.00 22.34 ? 434  ALA A O     1 
ATOM   3352  C CB    . ALA A 1 434 ? -20.287 23.359  10.987  1.00 20.46 ? 434  ALA A CB    1 
ATOM   3353  N N     . GLY A 1 435 ? -17.922 23.314  13.621  1.00 20.75 ? 435  GLY A N     1 
ATOM   3354  C CA    . GLY A 1 435 ? -17.756 23.378  15.069  1.00 20.21 ? 435  GLY A CA    1 
ATOM   3355  C C     . GLY A 1 435 ? -16.824 22.299  15.615  1.00 20.49 ? 435  GLY A C     1 
ATOM   3356  O O     . GLY A 1 435 ? -16.496 22.313  16.804  1.00 20.18 ? 435  GLY A O     1 
ATOM   3357  N N     . SER A 1 436 ? -16.388 21.360  14.763  1.00 20.58 ? 436  SER A N     1 
ATOM   3358  C CA    . SER A 1 436 ? -15.516 20.278  15.220  1.00 20.38 ? 436  SER A CA    1 
ATOM   3359  C C     . SER A 1 436 ? -14.046 20.433  14.816  1.00 20.66 ? 436  SER A C     1 
ATOM   3360  O O     . SER A 1 436 ? -13.732 20.683  13.651  1.00 20.94 ? 436  SER A O     1 
ATOM   3361  C CB    . SER A 1 436 ? -16.033 18.898  14.785  1.00 20.39 ? 436  SER A CB    1 
ATOM   3362  O OG    . SER A 1 436 ? -15.141 17.868  15.225  1.00 19.25 ? 436  SER A OG    1 
ATOM   3363  N N     . ALA A 1 437 ? -13.146 20.270  15.781  1.00 20.13 ? 437  ALA A N     1 
ATOM   3364  C CA    . ALA A 1 437 ? -11.736 20.223  15.464  1.00 20.50 ? 437  ALA A CA    1 
ATOM   3365  C C     . ALA A 1 437 ? -11.328 18.887  14.803  1.00 20.78 ? 437  ALA A C     1 
ATOM   3366  O O     . ALA A 1 437 ? -10.220 18.768  14.265  1.00 21.11 ? 437  ALA A O     1 
ATOM   3367  C CB    . ALA A 1 437 ? -10.913 20.504  16.691  1.00 20.54 ? 437  ALA A CB    1 
ATOM   3368  N N     . THR A 1 438 ? -12.238 17.907  14.834  1.00 21.05 ? 438  THR A N     1 
ATOM   3369  C CA    . THR A 1 438 ? -12.088 16.583  14.189  1.00 21.31 ? 438  THR A CA    1 
ATOM   3370  C C     . THR A 1 438 ? -11.104 15.620  14.887  1.00 21.28 ? 438  THR A C     1 
ATOM   3371  O O     . THR A 1 438 ? -11.307 15.249  16.053  1.00 21.54 ? 438  THR A O     1 
ATOM   3372  C CB    . THR A 1 438 ? -11.791 16.661  12.649  1.00 20.64 ? 438  THR A CB    1 
ATOM   3373  O OG1   . THR A 1 438 ? -10.458 17.122  12.455  1.00 22.68 ? 438  THR A OG1   1 
ATOM   3374  C CG2   . THR A 1 438 ? -12.739 17.619  11.930  1.00 20.97 ? 438  THR A CG2   1 
ATOM   3375  N N     . ARG A 1 439 ? -10.064 15.203  14.163  1.00 21.33 ? 439  ARG A N     1 
ATOM   3376  C CA    . ARG A 1 439 ? -9.178  14.112  14.600  1.00 21.67 ? 439  ARG A CA    1 
ATOM   3377  C C     . ARG A 1 439 ? -7.857  14.617  15.163  1.00 22.05 ? 439  ARG A C     1 
ATOM   3378  O O     . ARG A 1 439 ? -7.433  15.715  14.819  1.00 22.86 ? 439  ARG A O     1 
ATOM   3379  C CB    . ARG A 1 439 ? -8.878  13.159  13.433  1.00 20.96 ? 439  ARG A CB    1 
ATOM   3380  C CG    . ARG A 1 439 ? -10.111 12.544  12.838  1.00 20.64 ? 439  ARG A CG    1 
ATOM   3381  C CD    . ARG A 1 439 ? -9.784  11.322  11.990  1.00 21.00 ? 439  ARG A CD    1 
ATOM   3382  N NE    . ARG A 1 439 ? -10.995 10.731  11.452  1.00 19.40 ? 439  ARG A NE    1 
ATOM   3383  C CZ    . ARG A 1 439 ? -11.882 10.023  12.146  1.00 20.35 ? 439  ARG A CZ    1 
ATOM   3384  N NH1   . ARG A 1 439 ? -11.721 9.790   13.456  1.00 16.94 ? 439  ARG A NH1   1 
ATOM   3385  N NH2   . ARG A 1 439 ? -12.961 9.569   11.517  1.00 19.84 ? 439  ARG A NH2   1 
ATOM   3386  N N     . PRO A 1 440 ? -7.191  13.800  16.011  1.00 22.39 ? 440  PRO A N     1 
ATOM   3387  C CA    . PRO A 1 440 ? -5.831  14.161  16.455  1.00 22.10 ? 440  PRO A CA    1 
ATOM   3388  C C     . PRO A 1 440 ? -4.772  14.200  15.345  1.00 22.14 ? 440  PRO A C     1 
ATOM   3389  O O     . PRO A 1 440 ? -4.881  13.507  14.316  1.00 21.60 ? 440  PRO A O     1 
ATOM   3390  C CB    . PRO A 1 440 ? -5.485  13.070  17.489  1.00 21.67 ? 440  PRO A CB    1 
ATOM   3391  C CG    . PRO A 1 440 ? -6.407  11.919  17.158  1.00 21.86 ? 440  PRO A CG    1 
ATOM   3392  C CD    . PRO A 1 440 ? -7.663  12.532  16.631  1.00 21.75 ? 440  PRO A CD    1 
ATOM   3393  N N     . PHE A 1 441 ? -3.748  15.024  15.582  1.00 22.71 ? 441  PHE A N     1 
ATOM   3394  C CA    . PHE A 1 441 ? -2.596  15.126  14.705  1.00 22.59 ? 441  PHE A CA    1 
ATOM   3395  C C     . PHE A 1 441 ? -1.630  13.946  14.934  1.00 23.38 ? 441  PHE A C     1 
ATOM   3396  O O     . PHE A 1 441 ? -1.741  13.206  15.940  1.00 23.56 ? 441  PHE A O     1 
ATOM   3397  C CB    . PHE A 1 441 ? -1.899  16.474  14.897  1.00 21.84 ? 441  PHE A CB    1 
ATOM   3398  C CG    . PHE A 1 441 ? -0.943  16.817  13.786  1.00 22.59 ? 441  PHE A CG    1 
ATOM   3399  C CD1   . PHE A 1 441 ? -1.417  17.155  12.522  1.00 20.46 ? 441  PHE A CD1   1 
ATOM   3400  C CD2   . PHE A 1 441 ? 0.441   16.748  13.985  1.00 22.07 ? 441  PHE A CD2   1 
ATOM   3401  C CE1   . PHE A 1 441 ? -0.539  17.433  11.490  1.00 19.62 ? 441  PHE A CE1   1 
ATOM   3402  C CE2   . PHE A 1 441 ? 1.312   17.036  12.953  1.00 20.30 ? 441  PHE A CE2   1 
ATOM   3403  C CZ    . PHE A 1 441 ? 0.820   17.378  11.698  1.00 18.84 ? 441  PHE A CZ    1 
ATOM   3404  N N     . PHE A 1 442 ? -0.709  13.749  13.983  1.00 23.38 ? 442  PHE A N     1 
ATOM   3405  C CA    . PHE A 1 442 ? 0.353   12.755  14.118  1.00 23.15 ? 442  PHE A CA    1 
ATOM   3406  C C     . PHE A 1 442 ? 1.091   12.977  15.447  1.00 24.10 ? 442  PHE A C     1 
ATOM   3407  O O     . PHE A 1 442 ? 1.489   14.109  15.769  1.00 24.34 ? 442  PHE A O     1 
ATOM   3408  C CB    . PHE A 1 442 ? 1.333   12.836  12.935  1.00 22.69 ? 442  PHE A CB    1 
ATOM   3409  C CG    . PHE A 1 442 ? 0.668   12.878  11.566  1.00 21.02 ? 442  PHE A CG    1 
ATOM   3410  C CD1   . PHE A 1 442 ? 1.118   13.755  10.595  1.00 19.36 ? 442  PHE A CD1   1 
ATOM   3411  C CD2   . PHE A 1 442 ? -0.420  12.052  11.256  1.00 21.32 ? 442  PHE A CD2   1 
ATOM   3412  C CE1   . PHE A 1 442 ? 0.492   13.813  9.327   1.00 20.58 ? 442  PHE A CE1   1 
ATOM   3413  C CE2   . PHE A 1 442 ? -1.051  12.095  9.974   1.00 19.95 ? 442  PHE A CE2   1 
ATOM   3414  C CZ    . PHE A 1 442 ? -0.594  12.965  9.019   1.00 19.66 ? 442  PHE A CZ    1 
ATOM   3415  N N     . GLY A 1 443 ? 1.225   11.901  16.230  1.00 24.40 ? 443  GLY A N     1 
ATOM   3416  C CA    . GLY A 1 443 ? 1.948   11.933  17.495  1.00 23.69 ? 443  GLY A CA    1 
ATOM   3417  C C     . GLY A 1 443 ? 1.073   12.167  18.708  1.00 23.96 ? 443  GLY A C     1 
ATOM   3418  O O     . GLY A 1 443 ? 1.520   11.990  19.844  1.00 24.37 ? 443  GLY A O     1 
ATOM   3419  N N     . VAL A 1 444 ? -0.179  12.557  18.474  1.00 24.25 ? 444  VAL A N     1 
ATOM   3420  C CA    . VAL A 1 444 ? -1.076  13.051  19.538  1.00 23.31 ? 444  VAL A CA    1 
ATOM   3421  C C     . VAL A 1 444 ? -2.090  11.985  19.905  1.00 23.29 ? 444  VAL A C     1 
ATOM   3422  O O     . VAL A 1 444 ? -2.828  11.513  19.059  1.00 23.57 ? 444  VAL A O     1 
ATOM   3423  C CB    . VAL A 1 444 ? -1.759  14.411  19.135  1.00 23.24 ? 444  VAL A CB    1 
ATOM   3424  C CG1   . VAL A 1 444 ? -2.829  14.849  20.136  1.00 21.95 ? 444  VAL A CG1   1 
ATOM   3425  C CG2   . VAL A 1 444 ? -0.706  15.511  18.940  1.00 22.24 ? 444  VAL A CG2   1 
ATOM   3426  N N     . GLN A 1 445 ? -2.087  11.620  21.182  1.00 23.43 ? 445  GLN A N     1 
ATOM   3427  C CA    . GLN A 1 445 ? -2.945  10.606  21.776  1.00 23.75 ? 445  GLN A CA    1 
ATOM   3428  C C     . GLN A 1 445 ? -3.922  11.253  22.781  1.00 22.30 ? 445  GLN A C     1 
ATOM   3429  O O     . GLN A 1 445 ? -3.672  11.278  23.969  1.00 21.10 ? 445  GLN A O     1 
ATOM   3430  C CB    . GLN A 1 445 ? -2.087  9.538   22.482  1.00 23.22 ? 445  GLN A CB    1 
ATOM   3431  C CG    . GLN A 1 445 ? -1.791  8.328   21.631  1.00 26.09 ? 445  GLN A CG    1 
ATOM   3432  C CD    . GLN A 1 445 ? -0.549  7.517   22.065  1.00 26.57 ? 445  GLN A CD    1 
ATOM   3433  O OE1   . GLN A 1 445 ? -0.645  6.308   22.332  1.00 29.74 ? 445  GLN A OE1   1 
ATOM   3434  N NE2   . GLN A 1 445 ? 0.621   8.174   22.091  1.00 28.59 ? 445  GLN A NE2   1 
ATOM   3435  N N     . PRO A 1 446 ? -5.064  11.752  22.298  1.00 22.55 ? 446  PRO A N     1 
ATOM   3436  C CA    . PRO A 1 446 ? -6.026  12.306  23.255  1.00 21.88 ? 446  PRO A CA    1 
ATOM   3437  C C     . PRO A 1 446 ? -6.845  11.212  23.947  1.00 22.00 ? 446  PRO A C     1 
ATOM   3438  O O     . PRO A 1 446 ? -6.934  10.079  23.447  1.00 21.50 ? 446  PRO A O     1 
ATOM   3439  C CB    . PRO A 1 446 ? -6.946  13.135  22.362  1.00 21.68 ? 446  PRO A CB    1 
ATOM   3440  C CG    . PRO A 1 446 ? -6.947  12.395  21.060  1.00 21.41 ? 446  PRO A CG    1 
ATOM   3441  C CD    . PRO A 1 446 ? -5.563  11.825  20.901  1.00 21.92 ? 446  PRO A CD    1 
ATOM   3442  N N     . ALA A 1 447 ? -7.435  11.566  25.091  1.00 21.74 ? 447  ALA A N     1 
ATOM   3443  C CA    . ALA A 1 447 ? -8.402  10.724  25.769  1.00 21.38 ? 447  ALA A CA    1 
ATOM   3444  C C     . ALA A 1 447 ? -9.334  11.620  26.592  1.00 21.81 ? 447  ALA A C     1 
ATOM   3445  O O     . ALA A 1 447 ? -9.022  12.788  26.885  1.00 21.86 ? 447  ALA A O     1 
ATOM   3446  C CB    . ALA A 1 447 ? -7.713  9.667   26.645  1.00 20.56 ? 447  ALA A CB    1 
ATOM   3447  N N     . LEU A 1 448 ? -10.492 11.071  26.933  1.00 21.93 ? 448  LEU A N     1 
ATOM   3448  C CA    . LEU A 1 448 ? -11.482 11.767  27.729  1.00 22.46 ? 448  LEU A CA    1 
ATOM   3449  C C     . LEU A 1 448 ? -11.640 10.944  28.981  1.00 22.55 ? 448  LEU A C     1 
ATOM   3450  O O     . LEU A 1 448 ? -11.859 9.742   28.906  1.00 22.81 ? 448  LEU A O     1 
ATOM   3451  C CB    . LEU A 1 448 ? -12.813 11.896  26.976  1.00 22.12 ? 448  LEU A CB    1 
ATOM   3452  C CG    . LEU A 1 448 ? -12.810 12.708  25.667  1.00 22.50 ? 448  LEU A CG    1 
ATOM   3453  C CD1   . LEU A 1 448 ? -14.125 12.548  24.908  1.00 22.24 ? 448  LEU A CD1   1 
ATOM   3454  C CD2   . LEU A 1 448 ? -12.464 14.202  25.867  1.00 20.15 ? 448  LEU A CD2   1 
ATOM   3455  N N     . VAL A 1 449 ? -11.476 11.600  30.126  1.00 22.82 ? 449  VAL A N     1 
ATOM   3456  C CA    . VAL A 1 449 ? -11.586 10.968  31.430  1.00 22.78 ? 449  VAL A CA    1 
ATOM   3457  C C     . VAL A 1 449 ? -12.637 11.689  32.273  1.00 23.40 ? 449  VAL A C     1 
ATOM   3458  O O     . VAL A 1 449 ? -12.823 12.916  32.144  1.00 23.50 ? 449  VAL A O     1 
ATOM   3459  C CB    . VAL A 1 449 ? -10.215 10.953  32.155  1.00 22.92 ? 449  VAL A CB    1 
ATOM   3460  C CG1   . VAL A 1 449 ? -9.150  10.375  31.237  1.00 22.88 ? 449  VAL A CG1   1 
ATOM   3461  C CG2   . VAL A 1 449 ? -9.799  12.344  32.614  1.00 21.56 ? 449  VAL A CG2   1 
ATOM   3462  N N     . ASP A 1 450 ? -13.333 10.946  33.135  1.00 23.67 ? 450  ASP A N     1 
ATOM   3463  C CA    . ASP A 1 450 ? -14.243 11.592  34.090  1.00 23.35 ? 450  ASP A CA    1 
ATOM   3464  C C     . ASP A 1 450 ? -13.426 12.319  35.162  1.00 23.54 ? 450  ASP A C     1 
ATOM   3465  O O     . ASP A 1 450 ? -12.188 12.241  35.167  1.00 22.57 ? 450  ASP A O     1 
ATOM   3466  C CB    . ASP A 1 450 ? -15.249 10.603  34.697  1.00 23.26 ? 450  ASP A CB    1 
ATOM   3467  C CG    . ASP A 1 450 ? -14.586 9.490   35.505  1.00 22.62 ? 450  ASP A CG    1 
ATOM   3468  O OD1   . ASP A 1 450 ? -13.427 9.647   35.936  1.00 21.20 ? 450  ASP A OD1   1 
ATOM   3469  O OD2   . ASP A 1 450 ? -15.243 8.452   35.717  1.00 21.02 ? 450  ASP A OD2   1 
ATOM   3470  N N     . ASN A 1 451 ? -14.123 13.035  36.045  1.00 24.21 ? 451  ASN A N     1 
ATOM   3471  C CA    . ASN A 1 451 ? -13.479 13.820  37.100  1.00 25.30 ? 451  ASN A CA    1 
ATOM   3472  C C     . ASN A 1 451 ? -12.634 12.986  38.050  1.00 26.04 ? 451  ASN A C     1 
ATOM   3473  O O     . ASN A 1 451 ? -11.809 13.533  38.770  1.00 26.15 ? 451  ASN A O     1 
ATOM   3474  C CB    . ASN A 1 451 ? -14.517 14.586  37.916  1.00 25.29 ? 451  ASN A CB    1 
ATOM   3475  C CG    . ASN A 1 451 ? -14.977 15.862  37.245  1.00 25.40 ? 451  ASN A CG    1 
ATOM   3476  O OD1   . ASN A 1 451 ? -14.422 16.321  36.229  1.00 25.49 ? 451  ASN A OD1   1 
ATOM   3477  N ND2   . ASN A 1 451 ? -16.006 16.450  37.816  1.00 25.45 ? 451  ASN A ND2   1 
ATOM   3478  N N     . GLU A 1 452 ? -12.865 11.671  38.035  1.00 26.88 ? 452  GLU A N     1 
ATOM   3479  C CA    . GLU A 1 452 ? -12.173 10.694  38.879  1.00 27.92 ? 452  GLU A CA    1 
ATOM   3480  C C     . GLU A 1 452 ? -10.977 10.047  38.150  1.00 27.94 ? 452  GLU A C     1 
ATOM   3481  O O     . GLU A 1 452 ? -10.162 9.380   38.755  1.00 27.76 ? 452  GLU A O     1 
ATOM   3482  C CB    . GLU A 1 452 ? -13.163 9.626   39.384  1.00 28.01 ? 452  GLU A CB    1 
ATOM   3483  C CG    . GLU A 1 452 ? -14.264 10.146  40.373  1.00 30.73 ? 452  GLU A CG    1 
ATOM   3484  C CD    . GLU A 1 452 ? -15.366 11.034  39.721  1.00 33.53 ? 452  GLU A CD    1 
ATOM   3485  O OE1   . GLU A 1 452 ? -15.884 10.687  38.627  1.00 33.87 ? 452  GLU A OE1   1 
ATOM   3486  O OE2   . GLU A 1 452 ? -15.726 12.083  40.317  1.00 33.15 ? 452  GLU A OE2   1 
ATOM   3487  N N     . GLY A 1 453 ? -10.868 10.254  36.846  1.00 28.58 ? 453  GLY A N     1 
ATOM   3488  C CA    . GLY A 1 453 ? -9.696  9.792   36.118  1.00 29.32 ? 453  GLY A CA    1 
ATOM   3489  C C     . GLY A 1 453 ? -9.891  8.556   35.270  1.00 29.96 ? 453  GLY A C     1 
ATOM   3490  O O     . GLY A 1 453 ? -8.945  8.094   34.633  1.00 30.36 ? 453  GLY A O     1 
ATOM   3491  N N     . HIS A 1 454 ? -11.115 8.030   35.260  1.00 30.57 ? 454  HIS A N     1 
ATOM   3492  C CA    . HIS A 1 454 ? -11.496 6.847   34.476  1.00 31.11 ? 454  HIS A CA    1 
ATOM   3493  C C     . HIS A 1 454 ? -11.705 7.179   33.016  1.00 31.05 ? 454  HIS A C     1 
ATOM   3494  O O     . HIS A 1 454 ? -12.551 8.015   32.702  1.00 31.23 ? 454  HIS A O     1 
ATOM   3495  C CB    . HIS A 1 454 ? -12.805 6.274   34.993  1.00 31.08 ? 454  HIS A CB    1 
ATOM   3496  C CG    . HIS A 1 454 ? -12.817 6.044   36.468  1.00 32.69 ? 454  HIS A CG    1 
ATOM   3497  N ND1   . HIS A 1 454 ? -13.927 6.286   37.248  1.00 33.37 ? 454  HIS A ND1   1 
ATOM   3498  C CD2   . HIS A 1 454 ? -11.854 5.594   37.306  1.00 33.23 ? 454  HIS A CD2   1 
ATOM   3499  C CE1   . HIS A 1 454 ? -13.651 5.985   38.502  1.00 33.83 ? 454  HIS A CE1   1 
ATOM   3500  N NE2   . HIS A 1 454 ? -12.398 5.566   38.564  1.00 34.90 ? 454  HIS A NE2   1 
ATOM   3501  N N     . PRO A 1 455 ? -10.937 6.524   32.120  1.00 31.13 ? 455  PRO A N     1 
ATOM   3502  C CA    . PRO A 1 455 ? -11.106 6.713   30.667  1.00 30.70 ? 455  PRO A CA    1 
ATOM   3503  C C     . PRO A 1 455 ? -12.528 6.391   30.215  1.00 30.48 ? 455  PRO A C     1 
ATOM   3504  O O     . PRO A 1 455 ? -13.094 5.354   30.588  1.00 30.26 ? 455  PRO A O     1 
ATOM   3505  C CB    . PRO A 1 455 ? -10.090 5.729   30.054  1.00 30.72 ? 455  PRO A CB    1 
ATOM   3506  C CG    . PRO A 1 455 ? -9.041  5.551   31.138  1.00 30.93 ? 455  PRO A CG    1 
ATOM   3507  C CD    . PRO A 1 455 ? -9.827  5.595   32.434  1.00 30.92 ? 455  PRO A CD    1 
ATOM   3508  N N     . GLN A 1 456 ? -13.092 7.312   29.444  1.00 30.05 ? 456  GLN A N     1 
ATOM   3509  C CA    . GLN A 1 456 ? -14.412 7.185   28.866  1.00 29.71 ? 456  GLN A CA    1 
ATOM   3510  C C     . GLN A 1 456 ? -14.267 6.738   27.423  1.00 30.07 ? 456  GLN A C     1 
ATOM   3511  O O     . GLN A 1 456 ? -13.565 7.385   26.636  1.00 30.10 ? 456  GLN A O     1 
ATOM   3512  C CB    . GLN A 1 456 ? -15.131 8.540   28.914  1.00 29.65 ? 456  GLN A CB    1 
ATOM   3513  C CG    . GLN A 1 456 ? -15.313 9.119   30.314  1.00 28.80 ? 456  GLN A CG    1 
ATOM   3514  C CD    . GLN A 1 456 ? -15.929 8.119   31.269  1.00 27.83 ? 456  GLN A CD    1 
ATOM   3515  O OE1   . GLN A 1 456 ? -15.297 7.710   32.256  1.00 27.74 ? 456  GLN A OE1   1 
ATOM   3516  N NE2   . GLN A 1 456 ? -17.157 7.702   30.973  1.00 24.18 ? 456  GLN A NE2   1 
ATOM   3517  N N     . GLU A 1 457 ? -14.923 5.630   27.071  1.00 30.50 ? 457  GLU A N     1 
ATOM   3518  C CA    . GLU A 1 457 ? -14.834 5.076   25.696  1.00 30.32 ? 457  GLU A CA    1 
ATOM   3519  C C     . GLU A 1 457 ? -16.072 5.398   24.854  1.00 29.27 ? 457  GLU A C     1 
ATOM   3520  O O     . GLU A 1 457 ? -17.113 5.784   25.389  1.00 29.03 ? 457  GLU A O     1 
ATOM   3521  C CB    . GLU A 1 457 ? -14.611 3.556   25.716  1.00 30.60 ? 457  GLU A CB    1 
ATOM   3522  C CG    . GLU A 1 457 ? -13.784 3.034   26.892  1.00 33.10 ? 457  GLU A CG    1 
ATOM   3523  C CD    . GLU A 1 457 ? -12.264 3.091   26.683  1.00 36.98 ? 457  GLU A CD    1 
ATOM   3524  O OE1   . GLU A 1 457 ? -11.749 3.816   25.784  1.00 36.62 ? 457  GLU A OE1   1 
ATOM   3525  O OE2   . GLU A 1 457 ? -11.573 2.395   27.466  1.00 40.29 ? 457  GLU A OE2   1 
ATOM   3526  N N     . GLY A 1 458 ? -15.938 5.231   23.538  1.00 28.23 ? 458  GLY A N     1 
ATOM   3527  C CA    . GLY A 1 458 ? -17.027 5.467   22.598  1.00 26.40 ? 458  GLY A CA    1 
ATOM   3528  C C     . GLY A 1 458 ? -17.336 6.942   22.437  1.00 25.46 ? 458  GLY A C     1 
ATOM   3529  O O     . GLY A 1 458 ? -16.491 7.785   22.724  1.00 24.98 ? 458  GLY A O     1 
ATOM   3530  N N     . ALA A 1 459 ? -18.544 7.240   21.951  1.00 24.73 ? 459  ALA A N     1 
ATOM   3531  C CA    . ALA A 1 459 ? -19.068 8.600   21.901  1.00 24.05 ? 459  ALA A CA    1 
ATOM   3532  C C     . ALA A 1 459 ? -19.414 9.009   23.311  1.00 23.58 ? 459  ALA A C     1 
ATOM   3533  O O     . ALA A 1 459 ? -20.160 8.341   24.011  1.00 23.40 ? 459  ALA A O     1 
ATOM   3534  C CB    . ALA A 1 459 ? -20.294 8.696   20.985  1.00 23.76 ? 459  ALA A CB    1 
ATOM   3535  N N     . THR A 1 460 ? -18.861 10.120  23.744  1.00 23.71 ? 460  THR A N     1 
ATOM   3536  C CA    . THR A 1 460 ? -18.862 10.398  25.161  1.00 23.43 ? 460  THR A CA    1 
ATOM   3537  C C     . THR A 1 460 ? -18.291 11.800  25.370  1.00 23.61 ? 460  THR A C     1 
ATOM   3538  O O     . THR A 1 460 ? -17.848 12.424  24.421  1.00 22.47 ? 460  THR A O     1 
ATOM   3539  C CB    . THR A 1 460 ? -18.041 9.286   25.926  1.00 23.05 ? 460  THR A CB    1 
ATOM   3540  O OG1   . THR A 1 460 ? -18.335 9.333   27.316  1.00 24.39 ? 460  THR A OG1   1 
ATOM   3541  C CG2   . THR A 1 460 ? -16.545 9.437   25.720  1.00 22.01 ? 460  THR A CG2   1 
ATOM   3542  N N     . GLU A 1 461 ? -18.324 12.290  26.609  1.00 24.25 ? 461  GLU A N     1 
ATOM   3543  C CA    . GLU A 1 461 ? -17.585 13.493  26.962  1.00 24.87 ? 461  GLU A CA    1 
ATOM   3544  C C     . GLU A 1 461 ? -16.829 13.291  28.277  1.00 24.16 ? 461  GLU A C     1 
ATOM   3545  O O     . GLU A 1 461 ? -17.087 12.332  29.012  1.00 23.66 ? 461  GLU A O     1 
ATOM   3546  C CB    . GLU A 1 461 ? -18.501 14.732  26.995  1.00 25.22 ? 461  GLU A CB    1 
ATOM   3547  C CG    . GLU A 1 461 ? -19.496 14.782  28.136  1.00 30.30 ? 461  GLU A CG    1 
ATOM   3548  C CD    . GLU A 1 461 ? -20.816 15.501  27.771  1.00 38.37 ? 461  GLU A CD    1 
ATOM   3549  O OE1   . GLU A 1 461 ? -21.098 15.735  26.552  1.00 40.88 ? 461  GLU A OE1   1 
ATOM   3550  O OE2   . GLU A 1 461 ? -21.590 15.816  28.718  1.00 39.70 ? 461  GLU A OE2   1 
ATOM   3551  N N     . GLY A 1 462 ? -15.877 14.188  28.535  1.00 23.82 ? 462  GLY A N     1 
ATOM   3552  C CA    . GLY A 1 462 ? -15.145 14.267  29.801  1.00 22.38 ? 462  GLY A CA    1 
ATOM   3553  C C     . GLY A 1 462 ? -14.008 15.277  29.697  1.00 22.12 ? 462  GLY A C     1 
ATOM   3554  O O     . GLY A 1 462 ? -14.003 16.159  28.813  1.00 21.47 ? 462  GLY A O     1 
ATOM   3555  N N     . ASN A 1 463 ? -13.046 15.141  30.609  1.00 21.72 ? 463  ASN A N     1 
ATOM   3556  C CA    . ASN A 1 463 ? -11.848 15.969  30.657  1.00 21.39 ? 463  ASN A CA    1 
ATOM   3557  C C     . ASN A 1 463 ? -10.876 15.546  29.583  1.00 20.92 ? 463  ASN A C     1 
ATOM   3558  O O     . ASN A 1 463 ? -10.558 14.369  29.476  1.00 21.28 ? 463  ASN A O     1 
ATOM   3559  C CB    . ASN A 1 463 ? -11.204 15.857  32.044  1.00 21.50 ? 463  ASN A CB    1 
ATOM   3560  C CG    . ASN A 1 463 ? -12.162 16.272  33.153  1.00 22.13 ? 463  ASN A CG    1 
ATOM   3561  O OD1   . ASN A 1 463 ? -12.612 17.408  33.182  1.00 23.78 ? 463  ASN A OD1   1 
ATOM   3562  N ND2   . ASN A 1 463 ? -12.501 15.349  34.045  1.00 21.06 ? 463  ASN A ND2   1 
ATOM   3563  N N     . LEU A 1 464 ? -10.418 16.499  28.778  1.00 20.35 ? 464  LEU A N     1 
ATOM   3564  C CA    . LEU A 1 464 ? -9.492  16.200  27.677  1.00 19.83 ? 464  LEU A CA    1 
ATOM   3565  C C     . LEU A 1 464 ? -8.046  16.108  28.141  1.00 19.72 ? 464  LEU A C     1 
ATOM   3566  O O     . LEU A 1 464 ? -7.477  17.099  28.669  1.00 20.62 ? 464  LEU A O     1 
ATOM   3567  C CB    . LEU A 1 464 ? -9.624  17.244  26.575  1.00 19.79 ? 464  LEU A CB    1 
ATOM   3568  C CG    . LEU A 1 464 ? -8.708  17.183  25.359  1.00 18.89 ? 464  LEU A CG    1 
ATOM   3569  C CD1   . LEU A 1 464 ? -8.786  15.851  24.587  1.00 18.44 ? 464  LEU A CD1   1 
ATOM   3570  C CD2   . LEU A 1 464 ? -9.106  18.335  24.489  1.00 15.75 ? 464  LEU A CD2   1 
ATOM   3571  N N     . VAL A 1 465 ? -7.465  14.915  27.982  1.00 18.99 ? 465  VAL A N     1 
ATOM   3572  C CA    . VAL A 1 465 ? -6.076  14.666  28.367  1.00 18.83 ? 465  VAL A CA    1 
ATOM   3573  C C     . VAL A 1 465 ? -5.277  14.172  27.152  1.00 19.65 ? 465  VAL A C     1 
ATOM   3574  O O     . VAL A 1 465 ? -5.864  13.814  26.133  1.00 19.97 ? 465  VAL A O     1 
ATOM   3575  C CB    . VAL A 1 465 ? -5.950  13.667  29.537  1.00 18.46 ? 465  VAL A CB    1 
ATOM   3576  C CG1   . VAL A 1 465 ? -6.569  14.232  30.831  1.00 17.08 ? 465  VAL A CG1   1 
ATOM   3577  C CG2   . VAL A 1 465 ? -6.545  12.285  29.158  1.00 18.32 ? 465  VAL A CG2   1 
ATOM   3578  N N     . ILE A 1 466 ? -3.949  14.192  27.245  1.00 19.92 ? 466  ILE A N     1 
ATOM   3579  C CA    . ILE A 1 466 ? -3.088  13.640  26.194  1.00 20.28 ? 466  ILE A CA    1 
ATOM   3580  C C     . ILE A 1 466 ? -2.193  12.645  26.908  1.00 21.70 ? 466  ILE A C     1 
ATOM   3581  O O     . ILE A 1 466 ? -1.582  12.974  27.945  1.00 22.06 ? 466  ILE A O     1 
ATOM   3582  C CB    . ILE A 1 466 ? -2.267  14.726  25.461  1.00 20.11 ? 466  ILE A CB    1 
ATOM   3583  C CG1   . ILE A 1 466 ? -3.171  15.902  24.986  1.00 19.49 ? 466  ILE A CG1   1 
ATOM   3584  C CG2   . ILE A 1 466 ? -1.470  14.125  24.302  1.00 18.76 ? 466  ILE A CG2   1 
ATOM   3585  C CD1   . ILE A 1 466 ? -4.270  15.536  23.966  1.00 16.56 ? 466  ILE A CD1   1 
ATOM   3586  N N     . THR A 1 467 ? -2.163  11.415  26.395  1.00 22.54 ? 467  THR A N     1 
ATOM   3587  C CA    . THR A 1 467 ? -1.684  10.293  27.193  1.00 23.21 ? 467  THR A CA    1 
ATOM   3588  C C     . THR A 1 467 ? -0.225  9.993   26.977  1.00 23.36 ? 467  THR A C     1 
ATOM   3589  O O     . THR A 1 467 ? 0.339   9.195   27.695  1.00 23.86 ? 467  THR A O     1 
ATOM   3590  C CB    . THR A 1 467 ? -2.586  9.007   27.063  1.00 23.64 ? 467  THR A CB    1 
ATOM   3591  O OG1   . THR A 1 467 ? -2.634  8.551   25.705  1.00 23.64 ? 467  THR A OG1   1 
ATOM   3592  C CG2   . THR A 1 467 ? -4.017  9.298   27.575  1.00 23.42 ? 467  THR A CG2   1 
ATOM   3593  N N     . ASP A 1 468 ? 0.388   10.661  26.008  1.00 23.58 ? 468  ASP A N     1 
ATOM   3594  C CA    . ASP A 1 468 ? 1.819   10.515  25.763  1.00 24.03 ? 468  ASP A CA    1 
ATOM   3595  C C     . ASP A 1 468 ? 2.350   11.827  25.189  1.00 23.23 ? 468  ASP A C     1 
ATOM   3596  O O     . ASP A 1 468 ? 1.574   12.708  24.839  1.00 22.81 ? 468  ASP A O     1 
ATOM   3597  C CB    . ASP A 1 468 ? 2.072   9.348   24.793  1.00 24.19 ? 468  ASP A CB    1 
ATOM   3598  C CG    . ASP A 1 468 ? 3.462   8.747   24.933  1.00 26.73 ? 468  ASP A CG    1 
ATOM   3599  O OD1   . ASP A 1 468 ? 4.368   9.374   25.547  1.00 28.55 ? 468  ASP A OD1   1 
ATOM   3600  O OD2   . ASP A 1 468 ? 3.655   7.632   24.412  1.00 29.32 ? 468  ASP A OD2   1 
ATOM   3601  N N     . SER A 1 469 ? 3.667   11.958  25.092  1.00 22.70 ? 469  SER A N     1 
ATOM   3602  C CA    . SER A 1 469 ? 4.263   13.214  24.606  1.00 22.70 ? 469  SER A CA    1 
ATOM   3603  C C     . SER A 1 469 ? 4.247   13.330  23.076  1.00 22.24 ? 469  SER A C     1 
ATOM   3604  O O     . SER A 1 469 ? 3.946   12.366  22.364  1.00 22.27 ? 469  SER A O     1 
ATOM   3605  C CB    . SER A 1 469 ? 5.690   13.381  25.146  1.00 22.46 ? 469  SER A CB    1 
ATOM   3606  O OG    . SER A 1 469 ? 6.138   14.711  25.000  1.00 23.32 ? 469  SER A OG    1 
ATOM   3607  N N     . TRP A 1 470 ? 4.535   14.535  22.595  1.00 21.48 ? 470  TRP A N     1 
ATOM   3608  C CA    . TRP A 1 470 ? 4.665   14.839  21.176  1.00 20.62 ? 470  TRP A CA    1 
ATOM   3609  C C     . TRP A 1 470 ? 5.790   15.892  21.163  1.00 20.45 ? 470  TRP A C     1 
ATOM   3610  O O     . TRP A 1 470 ? 6.122   16.457  22.220  1.00 20.89 ? 470  TRP A O     1 
ATOM   3611  C CB    . TRP A 1 470 ? 3.340   15.387  20.595  1.00 20.23 ? 470  TRP A CB    1 
ATOM   3612  C CG    . TRP A 1 470 ? 2.933   16.671  21.292  1.00 20.01 ? 470  TRP A CG    1 
ATOM   3613  C CD1   . TRP A 1 470 ? 3.133   17.956  20.850  1.00 18.43 ? 470  TRP A CD1   1 
ATOM   3614  C CD2   . TRP A 1 470 ? 2.318   16.779  22.588  1.00 17.94 ? 470  TRP A CD2   1 
ATOM   3615  N NE1   . TRP A 1 470 ? 2.664   18.854  21.793  1.00 18.31 ? 470  TRP A NE1   1 
ATOM   3616  C CE2   . TRP A 1 470 ? 2.166   18.158  22.867  1.00 18.45 ? 470  TRP A CE2   1 
ATOM   3617  C CE3   . TRP A 1 470 ? 1.870   15.840  23.535  1.00 18.26 ? 470  TRP A CE3   1 
ATOM   3618  C CZ2   . TRP A 1 470 ? 1.583   18.627  24.065  1.00 19.77 ? 470  TRP A CZ2   1 
ATOM   3619  C CZ3   . TRP A 1 470 ? 1.293   16.302  24.736  1.00 18.79 ? 470  TRP A CZ3   1 
ATOM   3620  C CH2   . TRP A 1 470 ? 1.157   17.686  24.984  1.00 19.51 ? 470  TRP A CH2   1 
ATOM   3621  N N     . PRO A 1 471 ? 6.425   16.108  20.001  1.00 20.07 ? 471  PRO A N     1 
ATOM   3622  C CA    . PRO A 1 471 ? 7.610   16.965  19.915  1.00 20.18 ? 471  PRO A CA    1 
ATOM   3623  C C     . PRO A 1 471 ? 7.489   18.454  20.283  1.00 20.68 ? 471  PRO A C     1 
ATOM   3624  O O     . PRO A 1 471 ? 8.477   19.024  20.750  1.00 21.02 ? 471  PRO A O     1 
ATOM   3625  C CB    . PRO A 1 471 ? 8.052   16.788  18.456  1.00 20.04 ? 471  PRO A CB    1 
ATOM   3626  C CG    . PRO A 1 471 ? 7.488   15.441  18.077  1.00 19.18 ? 471  PRO A CG    1 
ATOM   3627  C CD    . PRO A 1 471 ? 6.154   15.449  18.711  1.00 19.81 ? 471  PRO A CD    1 
ATOM   3628  N N     . GLY A 1 472 ? 6.334   19.089  20.056  1.00 20.58 ? 472  GLY A N     1 
ATOM   3629  C CA    . GLY A 1 472 ? 6.199   20.527  20.325  1.00 20.10 ? 472  GLY A CA    1 
ATOM   3630  C C     . GLY A 1 472 ? 5.810   20.854  21.761  1.00 20.88 ? 472  GLY A C     1 
ATOM   3631  O O     . GLY A 1 472 ? 5.666   22.032  22.127  1.00 20.92 ? 472  GLY A O     1 
ATOM   3632  N N     . GLN A 1 473 ? 5.646   19.821  22.594  1.00 20.64 ? 473  GLN A N     1 
ATOM   3633  C CA    . GLN A 1 473 ? 5.213   20.021  23.967  1.00 20.52 ? 473  GLN A CA    1 
ATOM   3634  C C     . GLN A 1 473 ? 6.157   20.951  24.737  1.00 20.59 ? 473  GLN A C     1 
ATOM   3635  O O     . GLN A 1 473 ? 7.378   20.851  24.611  1.00 19.88 ? 473  GLN A O     1 
ATOM   3636  C CB    . GLN A 1 473 ? 5.078   18.675  24.689  1.00 20.56 ? 473  GLN A CB    1 
ATOM   3637  C CG    . GLN A 1 473 ? 4.479   18.804  26.069  1.00 19.85 ? 473  GLN A CG    1 
ATOM   3638  C CD    . GLN A 1 473 ? 4.154   17.486  26.724  1.00 19.55 ? 473  GLN A CD    1 
ATOM   3639  O OE1   . GLN A 1 473 ? 4.540   16.414  26.258  1.00 19.32 ? 473  GLN A OE1   1 
ATOM   3640  N NE2   . GLN A 1 473 ? 3.440   17.559  27.830  1.00 20.31 ? 473  GLN A NE2   1 
ATOM   3641  N N     . ALA A 1 474 ? 5.566   21.853  25.531  1.00 20.81 ? 474  ALA A N     1 
ATOM   3642  C CA    . ALA A 1 474 ? 6.317   22.711  26.440  1.00 20.88 ? 474  ALA A CA    1 
ATOM   3643  C C     . ALA A 1 474 ? 7.086   21.830  27.410  1.00 21.44 ? 474  ALA A C     1 
ATOM   3644  O O     . ALA A 1 474 ? 6.563   20.810  27.870  1.00 21.43 ? 474  ALA A O     1 
ATOM   3645  C CB    . ALA A 1 474 ? 5.400   23.669  27.180  1.00 20.07 ? 474  ALA A CB    1 
ATOM   3646  N N     . ARG A 1 475 ? 8.327   22.223  27.705  1.00 22.15 ? 475  ARG A N     1 
ATOM   3647  C CA    . ARG A 1 475 ? 9.247   21.376  28.486  1.00 22.77 ? 475  ARG A CA    1 
ATOM   3648  C C     . ARG A 1 475 ? 9.188   21.686  29.967  1.00 22.86 ? 475  ARG A C     1 
ATOM   3649  O O     . ARG A 1 475 ? 9.535   20.839  30.781  1.00 23.23 ? 475  ARG A O     1 
ATOM   3650  C CB    . ARG A 1 475 ? 10.708  21.532  28.010  1.00 22.33 ? 475  ARG A CB    1 
ATOM   3651  C CG    . ARG A 1 475 ? 10.942  21.220  26.570  1.00 22.22 ? 475  ARG A CG    1 
ATOM   3652  C CD    . ARG A 1 475 ? 10.497  19.822  26.212  1.00 19.32 ? 475  ARG A CD    1 
ATOM   3653  N NE    . ARG A 1 475 ? 11.282  19.385  25.072  1.00 20.63 ? 475  ARG A NE    1 
ATOM   3654  C CZ    . ARG A 1 475 ? 10.822  19.176  23.836  1.00 20.40 ? 475  ARG A CZ    1 
ATOM   3655  N NH1   . ARG A 1 475 ? 9.532   19.305  23.545  1.00 16.29 ? 475  ARG A NH1   1 
ATOM   3656  N NH2   . ARG A 1 475 ? 11.683  18.805  22.887  1.00 20.20 ? 475  ARG A NH2   1 
ATOM   3657  N N     . THR A 1 476 ? 8.790   22.908  30.307  1.00 23.19 ? 476  THR A N     1 
ATOM   3658  C CA    . THR A 1 476 ? 8.687   23.305  31.699  1.00 24.21 ? 476  THR A CA    1 
ATOM   3659  C C     . THR A 1 476 ? 8.004   24.682  31.873  1.00 23.98 ? 476  THR A C     1 
ATOM   3660  O O     . THR A 1 476 ? 7.570   25.295  30.886  1.00 23.77 ? 476  THR A O     1 
ATOM   3661  C CB    . THR A 1 476 ? 10.094  23.250  32.385  1.00 24.65 ? 476  THR A CB    1 
ATOM   3662  O OG1   . THR A 1 476 ? 9.954   23.329  33.810  1.00 25.89 ? 476  THR A OG1   1 
ATOM   3663  C CG2   . THR A 1 476 ? 11.036  24.356  31.845  1.00 26.22 ? 476  THR A CG2   1 
ATOM   3664  N N     . LEU A 1 477 ? 7.888   25.115  33.131  1.00 23.60 ? 477  LEU A N     1 
ATOM   3665  C CA    . LEU A 1 477 ? 7.585   26.489  33.499  1.00 23.41 ? 477  LEU A CA    1 
ATOM   3666  C C     . LEU A 1 477 ? 8.876   27.115  33.998  1.00 24.02 ? 477  LEU A C     1 
ATOM   3667  O O     . LEU A 1 477 ? 9.568   26.538  34.824  1.00 23.89 ? 477  LEU A O     1 
ATOM   3668  C CB    . LEU A 1 477 ? 6.537   26.544  34.603  1.00 22.84 ? 477  LEU A CB    1 
ATOM   3669  C CG    . LEU A 1 477 ? 5.139   26.030  34.238  1.00 21.94 ? 477  LEU A CG    1 
ATOM   3670  C CD1   . LEU A 1 477 ? 4.199   26.045  35.452  1.00 17.92 ? 477  LEU A CD1   1 
ATOM   3671  C CD2   . LEU A 1 477 ? 4.573   26.870  33.072  1.00 18.76 ? 477  LEU A CD2   1 
ATOM   3672  N N     . PHE A 1 478 ? 9.182   28.310  33.500  1.00 24.18 ? 478  PHE A N     1 
ATOM   3673  C CA    . PHE A 1 478 ? 10.446  28.964  33.762  1.00 23.88 ? 478  PHE A CA    1 
ATOM   3674  C C     . PHE A 1 478 ? 10.821  29.054  35.259  1.00 24.03 ? 478  PHE A C     1 
ATOM   3675  O O     . PHE A 1 478 ? 10.101  29.645  36.059  1.00 23.33 ? 478  PHE A O     1 
ATOM   3676  C CB    . PHE A 1 478 ? 10.466  30.346  33.095  1.00 24.48 ? 478  PHE A CB    1 
ATOM   3677  C CG    . PHE A 1 478 ? 11.743  31.101  33.326  1.00 24.81 ? 478  PHE A CG    1 
ATOM   3678  C CD1   . PHE A 1 478 ? 12.914  30.729  32.669  1.00 26.36 ? 478  PHE A CD1   1 
ATOM   3679  C CD2   . PHE A 1 478 ? 11.781  32.161  34.216  1.00 25.06 ? 478  PHE A CD2   1 
ATOM   3680  C CE1   . PHE A 1 478 ? 14.114  31.414  32.895  1.00 25.96 ? 478  PHE A CE1   1 
ATOM   3681  C CE2   . PHE A 1 478 ? 12.969  32.832  34.455  1.00 27.78 ? 478  PHE A CE2   1 
ATOM   3682  C CZ    . PHE A 1 478 ? 14.139  32.457  33.783  1.00 25.56 ? 478  PHE A CZ    1 
ATOM   3683  N N     . GLY A 1 479 ? 11.967  28.456  35.604  1.00 23.61 ? 479  GLY A N     1 
ATOM   3684  C CA    . GLY A 1 479 ? 12.440  28.364  36.961  1.00 23.20 ? 479  GLY A CA    1 
ATOM   3685  C C     . GLY A 1 479 ? 11.477  27.662  37.896  1.00 23.73 ? 479  GLY A C     1 
ATOM   3686  O O     . GLY A 1 479 ? 11.447  27.973  39.084  1.00 25.00 ? 479  GLY A O     1 
ATOM   3687  N N     . ASP A 1 480 ? 10.671  26.727  37.397  1.00 23.25 ? 480  ASP A N     1 
ATOM   3688  C CA    . ASP A 1 480 ? 9.738   26.024  38.275  1.00 23.00 ? 480  ASP A CA    1 
ATOM   3689  C C     . ASP A 1 480 ? 9.157   24.774  37.659  1.00 22.96 ? 480  ASP A C     1 
ATOM   3690  O O     . ASP A 1 480 ? 7.946   24.692  37.401  1.00 22.91 ? 480  ASP A O     1 
ATOM   3691  C CB    . ASP A 1 480 ? 8.624   26.943  38.800  1.00 22.36 ? 480  ASP A CB    1 
ATOM   3692  C CG    . ASP A 1 480 ? 8.089   26.496  40.161  1.00 23.97 ? 480  ASP A CG    1 
ATOM   3693  O OD1   . ASP A 1 480 ? 8.257   25.296  40.529  1.00 23.99 ? 480  ASP A OD1   1 
ATOM   3694  O OD2   . ASP A 1 480 ? 7.489   27.350  40.871  1.00 25.38 ? 480  ASP A OD2   1 
ATOM   3695  N N     . HIS A 1 481 ? 10.035  23.787  37.492  1.00 23.14 ? 481  HIS A N     1 
ATOM   3696  C CA    . HIS A 1 481 ? 9.667   22.462  37.023  1.00 23.19 ? 481  HIS A CA    1 
ATOM   3697  C C     . HIS A 1 481 ? 8.743   21.704  37.970  1.00 23.07 ? 481  HIS A C     1 
ATOM   3698  O O     . HIS A 1 481 ? 7.923   20.896  37.520  1.00 23.01 ? 481  HIS A O     1 
ATOM   3699  C CB    . HIS A 1 481 ? 10.896  21.617  36.691  1.00 23.14 ? 481  HIS A CB    1 
ATOM   3700  C CG    . HIS A 1 481 ? 10.579  20.436  35.829  1.00 24.44 ? 481  HIS A CG    1 
ATOM   3701  N ND1   . HIS A 1 481 ? 10.286  20.555  34.486  1.00 25.12 ? 481  HIS A ND1   1 
ATOM   3702  C CD2   . HIS A 1 481 ? 10.450  19.119  36.129  1.00 25.63 ? 481  HIS A CD2   1 
ATOM   3703  C CE1   . HIS A 1 481 ? 10.017  19.358  33.991  1.00 25.69 ? 481  HIS A CE1   1 
ATOM   3704  N NE2   . HIS A 1 481 ? 10.110  18.469  34.966  1.00 25.71 ? 481  HIS A NE2   1 
ATOM   3705  N N     . GLU A 1 482 ? 8.855   21.966  39.267  1.00 23.04 ? 482  GLU A N     1 
ATOM   3706  C CA    . GLU A 1 482 ? 7.952   21.339  40.223  1.00 23.11 ? 482  GLU A CA    1 
ATOM   3707  C C     . GLU A 1 482 ? 6.513   21.808  40.032  1.00 23.16 ? 482  GLU A C     1 
ATOM   3708  O O     . GLU A 1 482 ? 5.593   20.993  40.084  1.00 23.90 ? 482  GLU A O     1 
ATOM   3709  C CB    . GLU A 1 482 ? 8.427   21.563  41.650  1.00 23.77 ? 482  GLU A CB    1 
ATOM   3710  C CG    . GLU A 1 482 ? 9.872   21.102  41.862  1.00 25.27 ? 482  GLU A CG    1 
ATOM   3711  C CD    . GLU A 1 482 ? 10.183  20.729  43.289  1.00 27.36 ? 482  GLU A CD    1 
ATOM   3712  O OE1   . GLU A 1 482 ? 9.228   20.591  44.087  1.00 27.47 ? 482  GLU A OE1   1 
ATOM   3713  O OE2   . GLU A 1 482 ? 11.391  20.564  43.597  1.00 28.56 ? 482  GLU A OE2   1 
ATOM   3714  N N     . ARG A 1 483 ? 6.304   23.093  39.754  1.00 22.80 ? 483  ARG A N     1 
ATOM   3715  C CA    . ARG A 1 483 ? 4.937   23.569  39.482  1.00 22.92 ? 483  ARG A CA    1 
ATOM   3716  C C     . ARG A 1 483 ? 4.406   23.099  38.125  1.00 22.87 ? 483  ARG A C     1 
ATOM   3717  O O     . ARG A 1 483 ? 3.196   22.968  37.932  1.00 23.04 ? 483  ARG A O     1 
ATOM   3718  C CB    . ARG A 1 483 ? 4.846   25.092  39.607  1.00 22.95 ? 483  ARG A CB    1 
ATOM   3719  C CG    . ARG A 1 483 ? 3.450   25.661  39.386  1.00 23.59 ? 483  ARG A CG    1 
ATOM   3720  C CD    . ARG A 1 483 ? 3.451   27.174  39.424  1.00 25.99 ? 483  ARG A CD    1 
ATOM   3721  N N     . PHE A 1 484 ? 5.318   22.842  37.188  1.00 22.86 ? 484  PHE A N     1 
ATOM   3722  C CA    . PHE A 1 484 ? 4.971   22.327  35.868  1.00 22.31 ? 484  PHE A CA    1 
ATOM   3723  C C     . PHE A 1 484 ? 4.283   20.972  36.017  1.00 22.63 ? 484  PHE A C     1 
ATOM   3724  O O     . PHE A 1 484 ? 3.248   20.717  35.416  1.00 21.92 ? 484  PHE A O     1 
ATOM   3725  C CB    . PHE A 1 484 ? 6.242   22.213  35.023  1.00 21.81 ? 484  PHE A CB    1 
ATOM   3726  C CG    . PHE A 1 484 ? 6.021   21.701  33.608  1.00 21.19 ? 484  PHE A CG    1 
ATOM   3727  C CD1   . PHE A 1 484 ? 5.310   22.457  32.675  1.00 20.23 ? 484  PHE A CD1   1 
ATOM   3728  C CD2   . PHE A 1 484 ? 6.599   20.505  33.196  1.00 18.75 ? 484  PHE A CD2   1 
ATOM   3729  C CE1   . PHE A 1 484 ? 5.151   22.017  31.369  1.00 20.74 ? 484  PHE A CE1   1 
ATOM   3730  C CE2   . PHE A 1 484 ? 6.444   20.050  31.894  1.00 20.71 ? 484  PHE A CE2   1 
ATOM   3731  C CZ    . PHE A 1 484 ? 5.714   20.805  30.971  1.00 21.02 ? 484  PHE A CZ    1 
ATOM   3732  N N     . GLU A 1 485 ? 4.883   20.110  36.825  1.00 23.26 ? 485  GLU A N     1 
ATOM   3733  C CA    . GLU A 1 485 ? 4.307   18.827  37.129  1.00 24.65 ? 485  GLU A CA    1 
ATOM   3734  C C     . GLU A 1 485 ? 2.984   19.023  37.893  1.00 24.87 ? 485  GLU A C     1 
ATOM   3735  O O     . GLU A 1 485 ? 1.965   18.451  37.501  1.00 25.43 ? 485  GLU A O     1 
ATOM   3736  C CB    . GLU A 1 485 ? 5.298   17.969  37.935  1.00 24.09 ? 485  GLU A CB    1 
ATOM   3737  C CG    . GLU A 1 485 ? 4.776   16.559  38.218  1.00 25.83 ? 485  GLU A CG    1 
ATOM   3738  C CD    . GLU A 1 485 ? 5.632   15.742  39.184  1.00 26.58 ? 485  GLU A CD    1 
ATOM   3739  O OE1   . GLU A 1 485 ? 6.827   16.073  39.414  1.00 29.42 ? 485  GLU A OE1   1 
ATOM   3740  O OE2   . GLU A 1 485 ? 5.092   14.745  39.710  1.00 29.85 ? 485  GLU A OE2   1 
ATOM   3741  N N     . GLN A 1 486 ? 3.003   19.832  38.955  1.00 24.78 ? 486  GLN A N     1 
ATOM   3742  C CA    . GLN A 1 486 ? 1.812   20.097  39.752  1.00 25.84 ? 486  GLN A CA    1 
ATOM   3743  C C     . GLN A 1 486 ? 0.647   20.528  38.840  1.00 25.13 ? 486  GLN A C     1 
ATOM   3744  O O     . GLN A 1 486 ? -0.451  19.945  38.880  1.00 24.77 ? 486  GLN A O     1 
ATOM   3745  C CB    . GLN A 1 486 ? 2.094   21.166  40.834  1.00 26.39 ? 486  GLN A CB    1 
ATOM   3746  C CG    . GLN A 1 486 ? 0.828   21.769  41.491  1.00 31.69 ? 486  GLN A CG    1 
ATOM   3747  C CD    . GLN A 1 486 ? 0.804   23.339  41.560  1.00 38.89 ? 486  GLN A CD    1 
ATOM   3748  O OE1   . GLN A 1 486 ? -0.081  23.993  40.942  1.00 39.89 ? 486  GLN A OE1   1 
ATOM   3749  N NE2   . GLN A 1 486 ? 1.757   23.937  42.329  1.00 38.03 ? 486  GLN A NE2   1 
ATOM   3750  N N     . THR A 1 487 ? 0.903   21.526  38.001  1.00 24.03 ? 487  THR A N     1 
ATOM   3751  C CA    . THR A 1 487 ? -0.133  22.087  37.177  1.00 23.44 ? 487  THR A CA    1 
ATOM   3752  C C     . THR A 1 487 ? -0.686  21.117  36.138  1.00 23.57 ? 487  THR A C     1 
ATOM   3753  O O     . THR A 1 487 ? -1.898  20.981  36.036  1.00 24.45 ? 487  THR A O     1 
ATOM   3754  C CB    . THR A 1 487 ? 0.334   23.359  36.507  1.00 23.55 ? 487  THR A CB    1 
ATOM   3755  O OG1   . THR A 1 487 ? 0.618   24.329  37.520  1.00 24.53 ? 487  THR A OG1   1 
ATOM   3756  C CG2   . THR A 1 487 ? -0.735  23.904  35.577  1.00 22.37 ? 487  THR A CG2   1 
ATOM   3757  N N     . TYR A 1 488 ? 0.166   20.443  35.378  1.00 22.56 ? 488  TYR A N     1 
ATOM   3758  C CA    . TYR A 1 488 ? -0.328  19.674  34.244  1.00 22.05 ? 488  TYR A CA    1 
ATOM   3759  C C     . TYR A 1 488 ? -0.368  18.169  34.441  1.00 22.74 ? 488  TYR A C     1 
ATOM   3760  O O     . TYR A 1 488 ? -1.138  17.513  33.742  1.00 23.95 ? 488  TYR A O     1 
ATOM   3761  C CB    . TYR A 1 488 ? 0.447   20.010  32.963  1.00 21.19 ? 488  TYR A CB    1 
ATOM   3762  C CG    . TYR A 1 488 ? 0.467   21.492  32.676  1.00 20.19 ? 488  TYR A CG    1 
ATOM   3763  C CD1   . TYR A 1 488 ? 1.589   22.265  32.990  1.00 17.29 ? 488  TYR A CD1   1 
ATOM   3764  C CD2   . TYR A 1 488 ? -0.657  22.130  32.119  1.00 18.62 ? 488  TYR A CD2   1 
ATOM   3765  C CE1   . TYR A 1 488 ? 1.604   23.620  32.756  1.00 18.89 ? 488  TYR A CE1   1 
ATOM   3766  C CE2   . TYR A 1 488 ? -0.666  23.498  31.884  1.00 19.17 ? 488  TYR A CE2   1 
ATOM   3767  C CZ    . TYR A 1 488 ? 0.469   24.249  32.196  1.00 20.71 ? 488  TYR A CZ    1 
ATOM   3768  O OH    . TYR A 1 488 ? 0.473   25.621  31.955  1.00 20.23 ? 488  TYR A OH    1 
ATOM   3769  N N     . PHE A 1 489 ? 0.440   17.606  35.344  1.00 22.46 ? 489  PHE A N     1 
ATOM   3770  C CA    . PHE A 1 489 ? 0.549   16.135  35.436  1.00 22.73 ? 489  PHE A CA    1 
ATOM   3771  C C     . PHE A 1 489 ? 0.140   15.514  36.797  1.00 23.61 ? 489  PHE A C     1 
ATOM   3772  O O     . PHE A 1 489 ? 0.513   14.359  37.088  1.00 23.99 ? 489  PHE A O     1 
ATOM   3773  C CB    . PHE A 1 489 ? 1.961   15.680  35.057  1.00 21.78 ? 489  PHE A CB    1 
ATOM   3774  C CG    . PHE A 1 489 ? 2.445   16.230  33.741  1.00 22.03 ? 489  PHE A CG    1 
ATOM   3775  C CD1   . PHE A 1 489 ? 3.182   17.430  33.690  1.00 21.24 ? 489  PHE A CD1   1 
ATOM   3776  C CD2   . PHE A 1 489 ? 2.175   15.556  32.545  1.00 20.47 ? 489  PHE A CD2   1 
ATOM   3777  C CE1   . PHE A 1 489 ? 3.635   17.962  32.468  1.00 20.81 ? 489  PHE A CE1   1 
ATOM   3778  C CE2   . PHE A 1 489 ? 2.619   16.073  31.321  1.00 21.27 ? 489  PHE A CE2   1 
ATOM   3779  C CZ    . PHE A 1 489 ? 3.355   17.279  31.275  1.00 20.21 ? 489  PHE A CZ    1 
ATOM   3780  N N     . SER A 1 490 ? -0.622  16.250  37.620  1.00 23.51 ? 490  SER A N     1 
ATOM   3781  C CA    . SER A 1 490 ? -0.983  15.769  38.969  1.00 23.95 ? 490  SER A CA    1 
ATOM   3782  C C     . SER A 1 490 ? -2.453  15.414  39.126  1.00 23.85 ? 490  SER A C     1 
ATOM   3783  O O     . SER A 1 490 ? -2.806  14.558  39.926  1.00 23.33 ? 490  SER A O     1 
ATOM   3784  C CB    . SER A 1 490 ? -0.591  16.799  40.045  1.00 24.27 ? 490  SER A CB    1 
ATOM   3785  O OG    . SER A 1 490 ? -1.341  17.992  39.869  1.00 23.44 ? 490  SER A OG    1 
ATOM   3786  N N     . THR A 1 491 ? -3.316  16.096  38.384  1.00 24.60 ? 491  THR A N     1 
ATOM   3787  C CA    . THR A 1 491 ? -4.764  15.801  38.426  1.00 25.01 ? 491  THR A CA    1 
ATOM   3788  C C     . THR A 1 491 ? -5.093  14.385  37.908  1.00 24.79 ? 491  THR A C     1 
ATOM   3789  O O     . THR A 1 491 ? -5.874  13.654  38.513  1.00 23.82 ? 491  THR A O     1 
ATOM   3790  C CB    . THR A 1 491 ? -5.573  16.869  37.637  1.00 25.22 ? 491  THR A CB    1 
ATOM   3791  O OG1   . THR A 1 491 ? -5.333  18.170  38.206  1.00 24.62 ? 491  THR A OG1   1 
ATOM   3792  C CG2   . THR A 1 491 ? -7.086  16.552  37.665  1.00 25.51 ? 491  THR A CG2   1 
ATOM   3793  N N     . PHE A 1 492 ? -4.497  14.026  36.777  1.00 25.16 ? 492  PHE A N     1 
ATOM   3794  C CA    . PHE A 1 492 ? -4.654  12.694  36.207  1.00 26.19 ? 492  PHE A CA    1 
ATOM   3795  C C     . PHE A 1 492 ? -3.265  12.149  35.964  1.00 26.84 ? 492  PHE A C     1 
ATOM   3796  O O     . PHE A 1 492 ? -2.587  12.545  35.014  1.00 27.01 ? 492  PHE A O     1 
ATOM   3797  C CB    . PHE A 1 492 ? -5.475  12.736  34.910  1.00 26.15 ? 492  PHE A CB    1 
ATOM   3798  C CG    . PHE A 1 492 ? -6.789  13.474  35.049  1.00 26.70 ? 492  PHE A CG    1 
ATOM   3799  C CD1   . PHE A 1 492 ? -6.985  14.697  34.407  1.00 25.01 ? 492  PHE A CD1   1 
ATOM   3800  C CD2   . PHE A 1 492 ? -7.814  12.959  35.863  1.00 26.16 ? 492  PHE A CD2   1 
ATOM   3801  C CE1   . PHE A 1 492 ? -8.193  15.393  34.540  1.00 25.31 ? 492  PHE A CE1   1 
ATOM   3802  C CE2   . PHE A 1 492 ? -9.020  13.648  36.018  1.00 27.59 ? 492  PHE A CE2   1 
ATOM   3803  C CZ    . PHE A 1 492 ? -9.213  14.876  35.342  1.00 26.56 ? 492  PHE A CZ    1 
ATOM   3804  N N     . LYS A 1 493 ? -2.848  11.262  36.864  1.00 27.82 ? 493  LYS A N     1 
ATOM   3805  C CA    . LYS A 1 493 ? -1.507  10.713  36.917  1.00 28.77 ? 493  LYS A CA    1 
ATOM   3806  C C     . LYS A 1 493 ? -1.085  10.164  35.576  1.00 29.24 ? 493  LYS A C     1 
ATOM   3807  O O     . LYS A 1 493 ? -1.879  9.499   34.893  1.00 28.98 ? 493  LYS A O     1 
ATOM   3808  C CB    . LYS A 1 493 ? -1.457  9.608   37.972  1.00 29.12 ? 493  LYS A CB    1 
ATOM   3809  C CG    . LYS A 1 493 ? -0.913  10.039  39.358  1.00 31.11 ? 493  LYS A CG    1 
ATOM   3810  C CD    . LYS A 1 493 ? -1.588  11.294  39.927  1.00 33.01 ? 493  LYS A CD    1 
ATOM   3811  C CE    . LYS A 1 493 ? -0.643  11.998  40.916  1.00 34.66 ? 493  LYS A CE    1 
ATOM   3812  N NZ    . LYS A 1 493 ? -1.318  13.041  41.733  1.00 33.73 ? 493  LYS A NZ    1 
ATOM   3813  N N     . ASN A 1 494 ? 0.154   10.469  35.190  1.00 29.63 ? 494  ASN A N     1 
ATOM   3814  C CA    . ASN A 1 494 ? 0.730   9.958   33.934  1.00 30.30 ? 494  ASN A CA    1 
ATOM   3815  C C     . ASN A 1 494 ? 0.060   10.451  32.660  1.00 29.67 ? 494  ASN A C     1 
ATOM   3816  O O     . ASN A 1 494 ? 0.158   9.819   31.597  1.00 28.85 ? 494  ASN A O     1 
ATOM   3817  C CB    . ASN A 1 494 ? 0.797   8.429   33.932  1.00 30.71 ? 494  ASN A CB    1 
ATOM   3818  C CG    . ASN A 1 494 ? 2.214   7.925   33.852  1.00 33.62 ? 494  ASN A CG    1 
ATOM   3819  O OD1   . ASN A 1 494 ? 2.851   7.978   32.789  1.00 34.25 ? 494  ASN A OD1   1 
ATOM   3820  N ND2   . ASN A 1 494 ? 2.731   7.438   34.987  1.00 35.93 ? 494  ASN A ND2   1 
ATOM   3821  N N     . MET A 1 495 ? -0.617  11.586  32.782  1.00 29.46 ? 495  MET A N     1 
ATOM   3822  C CA    . MET A 1 495 ? -1.354  12.174  31.670  1.00 29.59 ? 495  MET A CA    1 
ATOM   3823  C C     . MET A 1 495 ? -1.173  13.679  31.660  1.00 27.71 ? 495  MET A C     1 
ATOM   3824  O O     . MET A 1 495 ? -1.015  14.300  32.715  1.00 27.57 ? 495  MET A O     1 
ATOM   3825  C CB    . MET A 1 495 ? -2.840  11.810  31.788  1.00 29.08 ? 495  MET A CB    1 
ATOM   3826  C CG    . MET A 1 495 ? -3.069  10.316  31.765  1.00 30.93 ? 495  MET A CG    1 
ATOM   3827  S SD    . MET A 1 495 ? -4.792  9.817   31.782  1.00 34.27 ? 495  MET A SD    1 
ATOM   3828  C CE    . MET A 1 495 ? -5.043  9.384   33.525  1.00 36.78 ? 495  MET A CE    1 
ATOM   3829  N N     . TYR A 1 496 ? -1.214  14.268  30.468  1.00 26.26 ? 496  TYR A N     1 
ATOM   3830  C CA    . TYR A 1 496 ? -1.232  15.726  30.346  1.00 24.22 ? 496  TYR A CA    1 
ATOM   3831  C C     . TYR A 1 496 ? -2.684  16.229  30.360  1.00 23.27 ? 496  TYR A C     1 
ATOM   3832  O O     . TYR A 1 496 ? -3.449  15.947  29.441  1.00 23.24 ? 496  TYR A O     1 
ATOM   3833  C CB    . TYR A 1 496 ? -0.446  16.203  29.086  1.00 23.78 ? 496  TYR A CB    1 
ATOM   3834  C CG    . TYR A 1 496 ? -0.655  17.670  28.788  1.00 23.48 ? 496  TYR A CG    1 
ATOM   3835  C CD1   . TYR A 1 496 ? 0.107   18.652  29.448  1.00 22.99 ? 496  TYR A CD1   1 
ATOM   3836  C CD2   . TYR A 1 496 ? -1.661  18.089  27.902  1.00 22.51 ? 496  TYR A CD2   1 
ATOM   3837  C CE1   . TYR A 1 496 ? -0.114  20.005  29.219  1.00 21.47 ? 496  TYR A CE1   1 
ATOM   3838  C CE2   . TYR A 1 496 ? -1.882  19.440  27.667  1.00 22.52 ? 496  TYR A CE2   1 
ATOM   3839  C CZ    . TYR A 1 496 ? -1.102  20.387  28.321  1.00 21.83 ? 496  TYR A CZ    1 
ATOM   3840  O OH    . TYR A 1 496 ? -1.321  21.714  28.105  1.00 21.15 ? 496  TYR A OH    1 
ATOM   3841  N N     . PHE A 1 497 ? -3.058  16.972  31.398  1.00 22.62 ? 497  PHE A N     1 
ATOM   3842  C CA    . PHE A 1 497 ? -4.392  17.566  31.484  1.00 22.47 ? 497  PHE A CA    1 
ATOM   3843  C C     . PHE A 1 497 ? -4.454  18.972  30.871  1.00 23.09 ? 497  PHE A C     1 
ATOM   3844  O O     . PHE A 1 497 ? -3.831  19.924  31.367  1.00 24.06 ? 497  PHE A O     1 
ATOM   3845  C CB    . PHE A 1 497 ? -4.905  17.571  32.923  1.00 22.73 ? 497  PHE A CB    1 
ATOM   3846  C CG    . PHE A 1 497 ? -6.285  18.152  33.069  1.00 23.27 ? 497  PHE A CG    1 
ATOM   3847  C CD1   . PHE A 1 497 ? -7.267  17.926  32.087  1.00 23.93 ? 497  PHE A CD1   1 
ATOM   3848  C CD2   . PHE A 1 497 ? -6.615  18.911  34.195  1.00 24.89 ? 497  PHE A CD2   1 
ATOM   3849  C CE1   . PHE A 1 497 ? -8.547  18.477  32.199  1.00 24.04 ? 497  PHE A CE1   1 
ATOM   3850  C CE2   . PHE A 1 497 ? -7.927  19.459  34.351  1.00 25.16 ? 497  PHE A CE2   1 
ATOM   3851  C CZ    . PHE A 1 497 ? -8.886  19.237  33.348  1.00 25.85 ? 497  PHE A CZ    1 
ATOM   3852  N N     . SER A 1 498 ? -5.218  19.100  29.787  1.00 23.24 ? 498  SER A N     1 
ATOM   3853  C CA    . SER A 1 498 ? -5.273  20.323  29.003  1.00 22.82 ? 498  SER A CA    1 
ATOM   3854  C C     . SER A 1 498 ? -6.022  21.462  29.724  1.00 22.92 ? 498  SER A C     1 
ATOM   3855  O O     . SER A 1 498 ? -5.810  22.639  29.408  1.00 23.46 ? 498  SER A O     1 
ATOM   3856  C CB    . SER A 1 498 ? -5.960  20.032  27.673  1.00 22.63 ? 498  SER A CB    1 
ATOM   3857  O OG    . SER A 1 498 ? -7.302  19.626  27.910  1.00 23.04 ? 498  SER A OG    1 
ATOM   3858  N N     . GLY A 1 499 ? -6.886  21.116  30.679  1.00 22.01 ? 499  GLY A N     1 
ATOM   3859  C CA    . GLY A 1 499 ? -7.794  22.088  31.274  1.00 21.90 ? 499  GLY A CA    1 
ATOM   3860  C C     . GLY A 1 499 ? -9.090  22.307  30.496  1.00 22.09 ? 499  GLY A C     1 
ATOM   3861  O O     . GLY A 1 499 ? -9.966  23.041  30.953  1.00 22.25 ? 499  GLY A O     1 
ATOM   3862  N N     . ASP A 1 500 ? -9.209  21.668  29.327  1.00 22.01 ? 500  ASP A N     1 
ATOM   3863  C CA    . ASP A 1 500 ? -10.431 21.653  28.527  1.00 21.80 ? 500  ASP A CA    1 
ATOM   3864  C C     . ASP A 1 500 ? -11.357 20.456  28.751  1.00 21.96 ? 500  ASP A C     1 
ATOM   3865  O O     . ASP A 1 500 ? -10.921 19.339  29.057  1.00 22.42 ? 500  ASP A O     1 
ATOM   3866  C CB    . ASP A 1 500 ? -10.080 21.686  27.031  1.00 21.71 ? 500  ASP A CB    1 
ATOM   3867  C CG    . ASP A 1 500 ? -9.618  23.047  26.561  1.00 23.02 ? 500  ASP A CG    1 
ATOM   3868  O OD1   . ASP A 1 500 ? -10.293 24.040  26.926  1.00 23.29 ? 500  ASP A OD1   1 
ATOM   3869  O OD2   . ASP A 1 500 ? -8.591  23.118  25.812  1.00 22.76 ? 500  ASP A OD2   1 
ATOM   3870  N N     . GLY A 1 501 ? -12.644 20.694  28.542  1.00 22.16 ? 501  GLY A N     1 
ATOM   3871  C CA    . GLY A 1 501 ? -13.603 19.618  28.309  1.00 22.55 ? 501  GLY A CA    1 
ATOM   3872  C C     . GLY A 1 501 ? -13.823 19.375  26.820  1.00 22.53 ? 501  GLY A C     1 
ATOM   3873  O O     . GLY A 1 501 ? -13.664 20.293  25.991  1.00 22.38 ? 501  GLY A O     1 
ATOM   3874  N N     . ALA A 1 502 ? -14.154 18.134  26.473  1.00 22.19 ? 502  ALA A N     1 
ATOM   3875  C CA    . ALA A 1 502 ? -14.523 17.794  25.093  1.00 23.01 ? 502  ALA A CA    1 
ATOM   3876  C C     . ALA A 1 502 ? -15.491 16.629  25.024  1.00 23.42 ? 502  ALA A C     1 
ATOM   3877  O O     . ALA A 1 502 ? -15.499 15.768  25.898  1.00 24.04 ? 502  ALA A O     1 
ATOM   3878  C CB    . ALA A 1 502 ? -13.302 17.514  24.244  1.00 21.99 ? 502  ALA A CB    1 
ATOM   3879  N N     . ARG A 1 503 ? -16.305 16.606  23.979  1.00 24.52 ? 503  ARG A N     1 
ATOM   3880  C CA    . ARG A 1 503 ? -17.019 15.389  23.600  1.00 25.65 ? 503  ARG A CA    1 
ATOM   3881  C C     . ARG A 1 503 ? -16.438 14.734  22.336  1.00 25.27 ? 503  ARG A C     1 
ATOM   3882  O O     . ARG A 1 503 ? -15.875 15.409  21.481  1.00 25.83 ? 503  ARG A O     1 
ATOM   3883  C CB    . ARG A 1 503 ? -18.539 15.627  23.515  1.00 25.82 ? 503  ARG A CB    1 
ATOM   3884  C CG    . ARG A 1 503 ? -19.124 15.806  22.163  1.00 27.84 ? 503  ARG A CG    1 
ATOM   3885  C CD    . ARG A 1 503 ? -20.653 15.968  22.233  1.00 27.01 ? 503  ARG A CD    1 
ATOM   3886  N NE    . ARG A 1 503 ? -21.126 16.796  21.118  1.00 32.89 ? 503  ARG A NE    1 
ATOM   3887  C CZ    . ARG A 1 503 ? -21.002 18.142  21.057  1.00 36.28 ? 503  ARG A CZ    1 
ATOM   3888  N NH1   . ARG A 1 503 ? -20.398 18.829  22.040  1.00 33.11 ? 503  ARG A NH1   1 
ATOM   3889  N NH2   . ARG A 1 503 ? -21.482 18.821  19.998  1.00 36.36 ? 503  ARG A NH2   1 
ATOM   3890  N N     . ARG A 1 504 ? -16.513 13.411  22.271  1.00 25.20 ? 504  ARG A N     1 
ATOM   3891  C CA    . ARG A 1 504 ? -16.186 12.640  21.064  1.00 24.97 ? 504  ARG A CA    1 
ATOM   3892  C C     . ARG A 1 504 ? -17.491 12.094  20.488  1.00 25.16 ? 504  ARG A C     1 
ATOM   3893  O O     . ARG A 1 504 ? -18.383 11.679  21.241  1.00 25.74 ? 504  ARG A O     1 
ATOM   3894  C CB    . ARG A 1 504 ? -15.219 11.503  21.412  1.00 24.75 ? 504  ARG A CB    1 
ATOM   3895  C CG    . ARG A 1 504 ? -14.500 10.842  20.231  1.00 24.71 ? 504  ARG A CG    1 
ATOM   3896  C CD    . ARG A 1 504 ? -13.444 9.776   20.681  1.00 24.70 ? 504  ARG A CD    1 
ATOM   3897  N NE    . ARG A 1 504 ? -13.893 8.927   21.799  1.00 23.61 ? 504  ARG A NE    1 
ATOM   3898  C CZ    . ARG A 1 504 ? -13.269 8.755   22.973  1.00 23.37 ? 504  ARG A CZ    1 
ATOM   3899  N NH1   . ARG A 1 504 ? -12.112 9.348   23.257  1.00 21.67 ? 504  ARG A NH1   1 
ATOM   3900  N NH2   . ARG A 1 504 ? -13.818 7.956   23.887  1.00 25.22 ? 504  ARG A NH2   1 
ATOM   3901  N N     . ASP A 1 505 ? -17.630 12.123  19.170  1.00 25.17 ? 505  ASP A N     1 
ATOM   3902  C CA    . ASP A 1 505 ? -18.820 11.572  18.544  1.00 25.44 ? 505  ASP A CA    1 
ATOM   3903  C C     . ASP A 1 505 ? -18.592 10.141  18.042  1.00 26.37 ? 505  ASP A C     1 
ATOM   3904  O O     . ASP A 1 505 ? -17.516 9.575   18.247  1.00 26.88 ? 505  ASP A O     1 
ATOM   3905  C CB    . ASP A 1 505 ? -19.371 12.511  17.465  1.00 25.45 ? 505  ASP A CB    1 
ATOM   3906  C CG    . ASP A 1 505 ? -18.428 12.698  16.273  1.00 25.18 ? 505  ASP A CG    1 
ATOM   3907  O OD1   . ASP A 1 505 ? -17.509 11.877  16.051  1.00 25.26 ? 505  ASP A OD1   1 
ATOM   3908  O OD2   . ASP A 1 505 ? -18.647 13.667  15.530  1.00 22.83 ? 505  ASP A OD2   1 
ATOM   3909  N N     . GLU A 1 506 ? -19.597 9.561   17.383  1.00 27.22 ? 506  GLU A N     1 
ATOM   3910  C CA    . GLU A 1 506 ? -19.541 8.173   16.913  1.00 27.42 ? 506  GLU A CA    1 
ATOM   3911  C C     . GLU A 1 506 ? -18.428 7.953   15.879  1.00 27.58 ? 506  GLU A C     1 
ATOM   3912  O O     . GLU A 1 506 ? -17.953 6.820   15.684  1.00 27.75 ? 506  GLU A O     1 
ATOM   3913  C CB    . GLU A 1 506 ? -20.899 7.755   16.334  1.00 27.66 ? 506  GLU A CB    1 
ATOM   3914  C CG    . GLU A 1 506 ? -22.048 7.601   17.353  1.00 30.98 ? 506  GLU A CG    1 
ATOM   3915  C CD    . GLU A 1 506 ? -22.607 8.948   17.855  1.00 35.59 ? 506  GLU A CD    1 
ATOM   3916  O OE1   . GLU A 1 506 ? -23.056 9.030   19.027  1.00 36.46 ? 506  GLU A OE1   1 
ATOM   3917  O OE2   . GLU A 1 506 ? -22.579 9.933   17.081  1.00 38.39 ? 506  GLU A OE2   1 
ATOM   3918  N N     . ASP A 1 507 ? -18.013 9.040   15.215  1.00 27.40 ? 507  ASP A N     1 
ATOM   3919  C CA    . ASP A 1 507 ? -16.968 8.993   14.192  1.00 26.36 ? 507  ASP A CA    1 
ATOM   3920  C C     . ASP A 1 507 ? -15.571 9.177   14.748  1.00 26.30 ? 507  ASP A C     1 
ATOM   3921  O O     . ASP A 1 507 ? -14.594 9.112   13.986  1.00 26.49 ? 507  ASP A O     1 
ATOM   3922  C CB    . ASP A 1 507 ? -17.207 10.084  13.155  1.00 26.42 ? 507  ASP A CB    1 
ATOM   3923  C CG    . ASP A 1 507 ? -18.229 9.694   12.123  1.00 27.05 ? 507  ASP A CG    1 
ATOM   3924  O OD1   . ASP A 1 507 ? -18.204 8.543   11.627  1.00 28.11 ? 507  ASP A OD1   1 
ATOM   3925  O OD2   . ASP A 1 507 ? -19.059 10.553  11.797  1.00 28.46 ? 507  ASP A OD2   1 
ATOM   3926  N N     . GLY A 1 508 ? -15.457 9.431   16.054  1.00 25.67 ? 508  GLY A N     1 
ATOM   3927  C CA    . GLY A 1 508 ? -14.144 9.677   16.656  1.00 25.38 ? 508  GLY A CA    1 
ATOM   3928  C C     . GLY A 1 508 ? -13.675 11.130  16.521  1.00 25.51 ? 508  GLY A C     1 
ATOM   3929  O O     . GLY A 1 508 ? -12.506 11.437  16.785  1.00 25.57 ? 508  GLY A O     1 
ATOM   3930  N N     . TYR A 1 509 ? -14.588 12.013  16.101  1.00 24.97 ? 509  TYR A N     1 
ATOM   3931  C CA    . TYR A 1 509 ? -14.352 13.456  16.048  1.00 25.04 ? 509  TYR A CA    1 
ATOM   3932  C C     . TYR A 1 509 ? -14.523 14.130  17.412  1.00 24.81 ? 509  TYR A C     1 
ATOM   3933  O O     . TYR A 1 509 ? -15.500 13.874  18.117  1.00 24.79 ? 509  TYR A O     1 
ATOM   3934  C CB    . TYR A 1 509 ? -15.315 14.118  15.059  1.00 25.35 ? 509  TYR A CB    1 
ATOM   3935  C CG    . TYR A 1 509 ? -14.987 13.948  13.590  1.00 25.32 ? 509  TYR A CG    1 
ATOM   3936  C CD1   . TYR A 1 509 ? -14.535 12.732  13.081  1.00 24.74 ? 509  TYR A CD1   1 
ATOM   3937  C CD2   . TYR A 1 509 ? -15.177 15.012  12.698  1.00 26.77 ? 509  TYR A CD2   1 
ATOM   3938  C CE1   . TYR A 1 509 ? -14.251 12.577  11.725  1.00 26.01 ? 509  TYR A CE1   1 
ATOM   3939  C CE2   . TYR A 1 509 ? -14.904 14.875  11.330  1.00 26.18 ? 509  TYR A CE2   1 
ATOM   3940  C CZ    . TYR A 1 509 ? -14.436 13.660  10.857  1.00 26.56 ? 509  TYR A CZ    1 
ATOM   3941  O OH    . TYR A 1 509 ? -14.180 13.521  9.523   1.00 26.90 ? 509  TYR A OH    1 
ATOM   3942  N N     . TYR A 1 510 ? -13.588 15.016  17.756  1.00 24.57 ? 510  TYR A N     1 
ATOM   3943  C CA    . TYR A 1 510 ? -13.664 15.811  18.989  1.00 24.28 ? 510  TYR A CA    1 
ATOM   3944  C C     . TYR A 1 510 ? -14.339 17.182  18.824  1.00 24.42 ? 510  TYR A C     1 
ATOM   3945  O O     . TYR A 1 510 ? -14.168 17.879  17.811  1.00 24.68 ? 510  TYR A O     1 
ATOM   3946  C CB    . TYR A 1 510 ? -12.269 15.982  19.606  1.00 24.28 ? 510  TYR A CB    1 
ATOM   3947  C CG    . TYR A 1 510 ? -11.668 14.689  20.116  1.00 23.22 ? 510  TYR A CG    1 
ATOM   3948  C CD1   . TYR A 1 510 ? -11.033 13.791  19.238  1.00 22.29 ? 510  TYR A CD1   1 
ATOM   3949  C CD2   . TYR A 1 510 ? -11.738 14.361  21.464  1.00 22.02 ? 510  TYR A CD2   1 
ATOM   3950  C CE1   . TYR A 1 510 ? -10.493 12.606  19.695  1.00 22.58 ? 510  TYR A CE1   1 
ATOM   3951  C CE2   . TYR A 1 510 ? -11.202 13.162  21.945  1.00 22.87 ? 510  TYR A CE2   1 
ATOM   3952  C CZ    . TYR A 1 510 ? -10.587 12.288  21.060  1.00 23.79 ? 510  TYR A CZ    1 
ATOM   3953  O OH    . TYR A 1 510 ? -10.047 11.118  21.537  1.00 22.53 ? 510  TYR A OH    1 
ATOM   3954  N N     . TRP A 1 511 ? -15.105 17.548  19.845  1.00 24.35 ? 511  TRP A N     1 
ATOM   3955  C CA    . TRP A 1 511 ? -15.801 18.817  19.934  1.00 24.25 ? 511  TRP A CA    1 
ATOM   3956  C C     . TRP A 1 511 ? -15.375 19.443  21.263  1.00 25.30 ? 511  TRP A C     1 
ATOM   3957  O O     . TRP A 1 511 ? -15.806 19.004  22.335  1.00 24.81 ? 511  TRP A O     1 
ATOM   3958  C CB    . TRP A 1 511 ? -17.320 18.601  19.899  1.00 23.21 ? 511  TRP A CB    1 
ATOM   3959  C CG    . TRP A 1 511 ? -17.805 17.886  18.689  1.00 22.13 ? 511  TRP A CG    1 
ATOM   3960  C CD1   . TRP A 1 511 ? -17.674 16.556  18.428  1.00 22.22 ? 511  TRP A CD1   1 
ATOM   3961  C CD2   . TRP A 1 511 ? -18.487 18.455  17.555  1.00 23.12 ? 511  TRP A CD2   1 
ATOM   3962  N NE1   . TRP A 1 511 ? -18.244 16.247  17.200  1.00 23.20 ? 511  TRP A NE1   1 
ATOM   3963  C CE2   . TRP A 1 511 ? -18.752 17.393  16.645  1.00 22.43 ? 511  TRP A CE2   1 
ATOM   3964  C CE3   . TRP A 1 511 ? -18.888 19.757  17.206  1.00 23.88 ? 511  TRP A CE3   1 
ATOM   3965  C CZ2   . TRP A 1 511 ? -19.402 17.593  15.415  1.00 20.51 ? 511  TRP A CZ2   1 
ATOM   3966  C CZ3   . TRP A 1 511 ? -19.556 19.948  15.969  1.00 22.17 ? 511  TRP A CZ3   1 
ATOM   3967  C CH2   . TRP A 1 511 ? -19.809 18.871  15.106  1.00 20.93 ? 511  TRP A CH2   1 
ATOM   3968  N N     . ILE A 1 512 ? -14.487 20.436  21.183  1.00 26.43 ? 512  ILE A N     1 
ATOM   3969  C CA    . ILE A 1 512 ? -13.902 21.055  22.372  1.00 27.31 ? 512  ILE A CA    1 
ATOM   3970  C C     . ILE A 1 512 ? -14.837 22.100  22.890  1.00 27.57 ? 512  ILE A C     1 
ATOM   3971  O O     . ILE A 1 512 ? -15.118 23.088  22.200  1.00 28.25 ? 512  ILE A O     1 
ATOM   3972  C CB    . ILE A 1 512 ? -12.527 21.712  22.127  1.00 27.66 ? 512  ILE A CB    1 
ATOM   3973  C CG1   . ILE A 1 512 ? -11.414 20.659  22.001  1.00 28.01 ? 512  ILE A CG1   1 
ATOM   3974  C CG2   . ILE A 1 512 ? -12.186 22.639  23.328  1.00 28.30 ? 512  ILE A CG2   1 
ATOM   3975  C CD1   . ILE A 1 512 ? -11.517 19.768  20.783  1.00 30.91 ? 512  ILE A CD1   1 
ATOM   3976  N N     . THR A 1 513 ? -15.310 21.888  24.114  1.00 27.46 ? 513  THR A N     1 
ATOM   3977  C CA    . THR A 1 513 ? -16.349 22.739  24.664  1.00 27.06 ? 513  THR A CA    1 
ATOM   3978  C C     . THR A 1 513 ? -15.821 23.815  25.631  1.00 26.97 ? 513  THR A C     1 
ATOM   3979  O O     . THR A 1 513 ? -16.598 24.581  26.186  1.00 28.26 ? 513  THR A O     1 
ATOM   3980  C CB    . THR A 1 513 ? -17.469 21.898  25.291  1.00 26.96 ? 513  THR A CB    1 
ATOM   3981  O OG1   . THR A 1 513 ? -16.898 20.986  26.218  1.00 26.70 ? 513  THR A OG1   1 
ATOM   3982  C CG2   . THR A 1 513 ? -18.195 21.081  24.196  1.00 27.30 ? 513  THR A CG2   1 
ATOM   3983  N N     . GLY A 1 514 ? -14.512 23.906  25.810  1.00 25.82 ? 514  GLY A N     1 
ATOM   3984  C CA    . GLY A 1 514 ? -13.966 24.962  26.634  1.00 24.82 ? 514  GLY A CA    1 
ATOM   3985  C C     . GLY A 1 514 ? -13.345 24.538  27.952  1.00 24.60 ? 514  GLY A C     1 
ATOM   3986  O O     . GLY A 1 514 ? -13.413 23.369  28.375  1.00 23.92 ? 514  GLY A O     1 
ATOM   3987  N N     . ARG A 1 515 ? -12.716 25.516  28.597  1.00 24.03 ? 515  ARG A N     1 
ATOM   3988  C CA    . ARG A 1 515 ? -12.056 25.303  29.866  1.00 23.56 ? 515  ARG A CA    1 
ATOM   3989  C C     . ARG A 1 515 ? -13.018 24.694  30.890  1.00 23.76 ? 515  ARG A C     1 
ATOM   3990  O O     . ARG A 1 515 ? -14.190 25.092  30.963  1.00 23.53 ? 515  ARG A O     1 
ATOM   3991  C CB    . ARG A 1 515 ? -11.497 26.632  30.359  1.00 23.38 ? 515  ARG A CB    1 
ATOM   3992  C CG    . ARG A 1 515 ? -10.422 27.224  29.442  1.00 22.72 ? 515  ARG A CG    1 
ATOM   3993  C CD    . ARG A 1 515 ? -9.357  26.180  29.119  1.00 24.11 ? 515  ARG A CD    1 
ATOM   3994  N NE    . ARG A 1 515 ? -8.395  25.971  30.200  1.00 22.94 ? 515  ARG A NE    1 
ATOM   3995  C CZ    . ARG A 1 515 ? -7.085  26.059  30.017  1.00 24.66 ? 515  ARG A CZ    1 
ATOM   3996  N NH1   . ARG A 1 515 ? -6.649  26.344  28.801  1.00 24.20 ? 515  ARG A NH1   1 
ATOM   3997  N NH2   . ARG A 1 515 ? -6.215  25.859  31.019  1.00 23.66 ? 515  ARG A NH2   1 
ATOM   3998  N N     . VAL A 1 516 ? -12.539 23.713  31.653  1.00 23.52 ? 516  VAL A N     1 
ATOM   3999  C CA    . VAL A 1 516 ? -13.317 23.185  32.797  1.00 23.30 ? 516  VAL A CA    1 
ATOM   4000  C C     . VAL A 1 516 ? -12.661 23.628  34.096  1.00 23.40 ? 516  VAL A C     1 
ATOM   4001  O O     . VAL A 1 516 ? -13.078 23.261  35.184  1.00 22.54 ? 516  VAL A O     1 
ATOM   4002  C CB    . VAL A 1 516 ? -13.487 21.615  32.799  1.00 22.98 ? 516  VAL A CB    1 
ATOM   4003  C CG1   . VAL A 1 516 ? -14.445 21.161  31.691  1.00 22.71 ? 516  VAL A CG1   1 
ATOM   4004  C CG2   . VAL A 1 516 ? -12.137 20.891  32.746  1.00 20.62 ? 516  VAL A CG2   1 
ATOM   4005  N N     . ASP A 1 517 ? -11.592 24.384  33.968  1.00 23.90 ? 517  ASP A N     1 
ATOM   4006  C CA    . ASP A 1 517 ? -10.990 24.969  35.149  1.00 24.99 ? 517  ASP A CA    1 
ATOM   4007  C C     . ASP A 1 517 ? -11.363 26.459  35.171  1.00 25.63 ? 517  ASP A C     1 
ATOM   4008  O O     . ASP A 1 517 ? -12.262 26.905  34.433  1.00 25.79 ? 517  ASP A O     1 
ATOM   4009  C CB    . ASP A 1 517 ? -9.481  24.718  35.186  1.00 24.43 ? 517  ASP A CB    1 
ATOM   4010  C CG    . ASP A 1 517 ? -8.780  25.142  33.912  1.00 24.03 ? 517  ASP A CG    1 
ATOM   4011  O OD1   . ASP A 1 517 ? -7.571  24.866  33.805  1.00 21.74 ? 517  ASP A OD1   1 
ATOM   4012  O OD2   . ASP A 1 517 ? -9.426  25.763  33.028  1.00 24.56 ? 517  ASP A OD2   1 
ATOM   4013  N N     . ASP A 1 518 ? -10.683 27.227  36.005  1.00 25.85 ? 518  ASP A N     1 
ATOM   4014  C CA    . ASP A 1 518 ? -11.114 28.575  36.249  1.00 25.77 ? 518  ASP A CA    1 
ATOM   4015  C C     . ASP A 1 518 ? -10.368 29.577  35.399  1.00 25.43 ? 518  ASP A C     1 
ATOM   4016  O O     . ASP A 1 518 ? -9.784  30.556  35.892  1.00 25.75 ? 518  ASP A O     1 
ATOM   4017  C CB    . ASP A 1 518 ? -11.049 28.839  37.741  1.00 26.51 ? 518  ASP A CB    1 
ATOM   4018  C CG    . ASP A 1 518 ? -12.314 28.389  38.432  1.00 28.50 ? 518  ASP A CG    1 
ATOM   4019  O OD1   . ASP A 1 518 ? -13.387 28.972  38.107  1.00 32.33 ? 518  ASP A OD1   1 
ATOM   4020  O OD2   . ASP A 1 518 ? -12.246 27.452  39.251  1.00 26.46 ? 518  ASP A OD2   1 
ATOM   4021  N N     . VAL A 1 519 ? -10.397 29.289  34.102  1.00 25.16 ? 519  VAL A N     1 
ATOM   4022  C CA    . VAL A 1 519 ? -9.734  30.075  33.082  1.00 24.73 ? 519  VAL A CA    1 
ATOM   4023  C C     . VAL A 1 519 ? -10.816 30.520  32.126  1.00 24.55 ? 519  VAL A C     1 
ATOM   4024  O O     . VAL A 1 519 ? -11.648 29.722  31.721  1.00 24.30 ? 519  VAL A O     1 
ATOM   4025  C CB    . VAL A 1 519 ? -8.655  29.242  32.332  1.00 24.79 ? 519  VAL A CB    1 
ATOM   4026  C CG1   . VAL A 1 519 ? -8.118  29.994  31.115  1.00 24.70 ? 519  VAL A CG1   1 
ATOM   4027  C CG2   . VAL A 1 519 ? -7.513  28.862  33.260  1.00 24.03 ? 519  VAL A CG2   1 
ATOM   4028  N N     . LEU A 1 520 ? -10.803 31.801  31.778  1.00 24.88 ? 520  LEU A N     1 
ATOM   4029  C CA    . LEU A 1 520 ? -11.760 32.359  30.837  1.00 25.27 ? 520  LEU A CA    1 
ATOM   4030  C C     . LEU A 1 520 ? -11.177 32.442  29.434  1.00 25.30 ? 520  LEU A C     1 
ATOM   4031  O O     . LEU A 1 520 ? -9.959  32.341  29.241  1.00 24.72 ? 520  LEU A O     1 
ATOM   4032  C CB    . LEU A 1 520 ? -12.250 33.749  31.269  1.00 25.44 ? 520  LEU A CB    1 
ATOM   4033  C CG    . LEU A 1 520 ? -12.840 33.968  32.670  1.00 27.03 ? 520  LEU A CG    1 
ATOM   4034  C CD1   . LEU A 1 520 ? -12.969 35.447  32.999  1.00 27.60 ? 520  LEU A CD1   1 
ATOM   4035  C CD2   . LEU A 1 520 ? -14.167 33.265  32.843  1.00 28.39 ? 520  LEU A CD2   1 
ATOM   4036  N N     . ASN A 1 521 ? -12.080 32.586  28.467  1.00 25.19 ? 521  ASN A N     1 
ATOM   4037  C CA    . ASN A 1 521 ? -11.737 32.912  27.109  1.00 25.69 ? 521  ASN A CA    1 
ATOM   4038  C C     . ASN A 1 521 ? -12.506 34.158  26.707  1.00 25.28 ? 521  ASN A C     1 
ATOM   4039  O O     . ASN A 1 521 ? -13.701 34.102  26.435  1.00 26.08 ? 521  ASN A O     1 
ATOM   4040  C CB    . ASN A 1 521 ? -12.100 31.753  26.204  1.00 26.51 ? 521  ASN A CB    1 
ATOM   4041  C CG    . ASN A 1 521 ? -11.376 31.804  24.856  1.00 29.46 ? 521  ASN A CG    1 
ATOM   4042  O OD1   . ASN A 1 521 ? -10.661 30.858  24.498  1.00 33.35 ? 521  ASN A OD1   1 
ATOM   4043  N ND2   . ASN A 1 521 ? -11.594 32.886  24.084  1.00 30.89 ? 521  ASN A ND2   1 
ATOM   4044  N N     . VAL A 1 522 ? -11.827 35.290  26.690  1.00 25.20 ? 522  VAL A N     1 
ATOM   4045  C CA    . VAL A 1 522 ? -12.488 36.564  26.466  1.00 25.44 ? 522  VAL A CA    1 
ATOM   4046  C C     . VAL A 1 522 ? -11.889 37.161  25.205  1.00 25.07 ? 522  VAL A C     1 
ATOM   4047  O O     . VAL A 1 522 ? -10.690 37.433  25.175  1.00 25.20 ? 522  VAL A O     1 
ATOM   4048  C CB    . VAL A 1 522 ? -12.328 37.518  27.690  1.00 25.74 ? 522  VAL A CB    1 
ATOM   4049  C CG1   . VAL A 1 522 ? -13.080 38.816  27.444  1.00 27.44 ? 522  VAL A CG1   1 
ATOM   4050  C CG2   . VAL A 1 522 ? -12.849 36.867  28.977  1.00 24.88 ? 522  VAL A CG2   1 
ATOM   4051  N N     . SER A 1 523 ? -12.716 37.330  24.167  1.00 24.74 ? 523  SER A N     1 
ATOM   4052  C CA    . SER A 1 523 ? -12.257 37.693  22.819  1.00 24.78 ? 523  SER A CA    1 
ATOM   4053  C C     . SER A 1 523 ? -11.026 36.865  22.393  1.00 25.12 ? 523  SER A C     1 
ATOM   4054  O O     . SER A 1 523 ? -10.094 37.381  21.757  1.00 24.78 ? 523  SER A O     1 
ATOM   4055  C CB    . SER A 1 523 ? -11.927 39.188  22.713  1.00 25.13 ? 523  SER A CB    1 
ATOM   4056  O OG    . SER A 1 523 ? -12.848 40.005  23.407  1.00 25.73 ? 523  SER A OG    1 
ATOM   4057  N N     . GLY A 1 524 ? -11.012 35.588  22.773  1.00 24.80 ? 524  GLY A N     1 
ATOM   4058  C CA    . GLY A 1 524 ? -9.904  34.713  22.416  1.00 24.69 ? 524  GLY A CA    1 
ATOM   4059  C C     . GLY A 1 524 ? -8.654  34.901  23.258  1.00 24.83 ? 524  GLY A C     1 
ATOM   4060  O O     . GLY A 1 524 ? -7.591  34.411  22.882  1.00 24.50 ? 524  GLY A O     1 
ATOM   4061  N N     . HIS A 1 525 ? -8.765  35.621  24.376  1.00 24.35 ? 525  HIS A N     1 
ATOM   4062  C CA    . HIS A 1 525 ? -7.653  35.728  25.314  1.00 24.65 ? 525  HIS A CA    1 
ATOM   4063  C C     . HIS A 1 525 ? -7.931  34.821  26.498  1.00 24.21 ? 525  HIS A C     1 
ATOM   4064  O O     . HIS A 1 525 ? -9.019  34.857  27.066  1.00 24.46 ? 525  HIS A O     1 
ATOM   4065  C CB    . HIS A 1 525 ? -7.402  37.171  25.786  1.00 24.81 ? 525  HIS A CB    1 
ATOM   4066  C CG    . HIS A 1 525 ? -7.114  38.130  24.673  1.00 27.48 ? 525  HIS A CG    1 
ATOM   4067  N ND1   . HIS A 1 525 ? -7.927  39.210  24.388  1.00 29.83 ? 525  HIS A ND1   1 
ATOM   4068  C CD2   . HIS A 1 525 ? -6.129  38.146  23.743  1.00 29.61 ? 525  HIS A CD2   1 
ATOM   4069  C CE1   . HIS A 1 525 ? -7.455  39.852  23.333  1.00 29.32 ? 525  HIS A CE1   1 
ATOM   4070  N NE2   . HIS A 1 525 ? -6.368  39.223  22.918  1.00 30.20 ? 525  HIS A NE2   1 
ATOM   4071  N N     . ARG A 1 526 ? -6.934  34.008  26.844  1.00 23.48 ? 526  ARG A N     1 
ATOM   4072  C CA    . ARG A 1 526 ? -6.984  33.090  27.965  1.00 22.97 ? 526  ARG A CA    1 
ATOM   4073  C C     . ARG A 1 526 ? -6.677  33.901  29.222  1.00 22.99 ? 526  ARG A C     1 
ATOM   4074  O O     . ARG A 1 526 ? -5.611  34.477  29.323  1.00 23.24 ? 526  ARG A O     1 
ATOM   4075  C CB    . ARG A 1 526 ? -5.947  31.985  27.701  1.00 22.90 ? 526  ARG A CB    1 
ATOM   4076  C CG    . ARG A 1 526 ? -5.589  31.056  28.842  1.00 22.63 ? 526  ARG A CG    1 
ATOM   4077  C CD    . ARG A 1 526 ? -4.674  29.934  28.313  1.00 23.17 ? 526  ARG A CD    1 
ATOM   4078  N NE    . ARG A 1 526 ? -4.112  29.134  29.398  1.00 22.26 ? 526  ARG A NE    1 
ATOM   4079  C CZ    . ARG A 1 526 ? -3.309  28.081  29.245  1.00 22.51 ? 526  ARG A CZ    1 
ATOM   4080  N NH1   . ARG A 1 526 ? -2.935  27.660  28.040  1.00 20.09 ? 526  ARG A NH1   1 
ATOM   4081  N NH2   . ARG A 1 526 ? -2.869  27.444  30.321  1.00 22.16 ? 526  ARG A NH2   1 
ATOM   4082  N N     . LEU A 1 527 ? -7.621  33.958  30.160  1.00 23.48 ? 527  LEU A N     1 
ATOM   4083  C CA    . LEU A 1 527 ? -7.485  34.701  31.442  1.00 23.73 ? 527  LEU A CA    1 
ATOM   4084  C C     . LEU A 1 527 ? -7.898  33.867  32.634  1.00 23.29 ? 527  LEU A C     1 
ATOM   4085  O O     . LEU A 1 527 ? -8.937  33.229  32.604  1.00 23.86 ? 527  LEU A O     1 
ATOM   4086  C CB    . LEU A 1 527 ? -8.363  35.970  31.447  1.00 23.83 ? 527  LEU A CB    1 
ATOM   4087  C CG    . LEU A 1 527 ? -7.863  37.086  30.524  1.00 25.07 ? 527  LEU A CG    1 
ATOM   4088  C CD1   . LEU A 1 527 ? -8.874  38.217  30.441  1.00 24.31 ? 527  LEU A CD1   1 
ATOM   4089  C CD2   . LEU A 1 527 ? -6.468  37.580  30.989  1.00 25.73 ? 527  LEU A CD2   1 
ATOM   4090  N N     . GLY A 1 528 ? -7.114  33.884  33.701  1.00 22.97 ? 528  GLY A N     1 
ATOM   4091  C CA    . GLY A 1 528 ? -7.524  33.199  34.926  1.00 22.60 ? 528  GLY A CA    1 
ATOM   4092  C C     . GLY A 1 528 ? -8.437  34.104  35.720  1.00 22.96 ? 528  GLY A C     1 
ATOM   4093  O O     . GLY A 1 528 ? -8.214  35.316  35.773  1.00 22.90 ? 528  GLY A O     1 
ATOM   4094  N N     . THR A 1 529 ? -9.474  33.529  36.329  1.00 23.67 ? 529  THR A N     1 
ATOM   4095  C CA    . THR A 1 529 ? -10.430 34.297  37.167  1.00 23.86 ? 529  THR A CA    1 
ATOM   4096  C C     . THR A 1 529 ? -9.722  34.827  38.427  1.00 23.95 ? 529  THR A C     1 
ATOM   4097  O O     . THR A 1 529 ? -9.910  35.982  38.827  1.00 22.69 ? 529  THR A O     1 
ATOM   4098  C CB    . THR A 1 529 ? -11.691 33.466  37.555  1.00 24.02 ? 529  THR A CB    1 
ATOM   4099  O OG1   . THR A 1 529 ? -11.293 32.207  38.124  1.00 25.56 ? 529  THR A OG1   1 
ATOM   4100  C CG2   . THR A 1 529 ? -12.571 33.201  36.335  1.00 24.47 ? 529  THR A CG2   1 
ATOM   4101  N N     . ALA A 1 530 ? -8.864  33.978  39.000  1.00 24.41 ? 530  ALA A N     1 
ATOM   4102  C CA    . ALA A 1 530 ? -8.081  34.335  40.175  1.00 25.26 ? 530  ALA A CA    1 
ATOM   4103  C C     . ALA A 1 530 ? -7.254  35.595  39.998  1.00 25.36 ? 530  ALA A C     1 
ATOM   4104  O O     . ALA A 1 530 ? -7.210  36.405  40.911  1.00 26.31 ? 530  ALA A O     1 
ATOM   4105  C CB    . ALA A 1 530 ? -7.203  33.162  40.635  1.00 25.40 ? 530  ALA A CB    1 
ATOM   4106  N N     . GLU A 1 531 ? -6.635  35.796  38.833  1.00 25.62 ? 531  GLU A N     1 
ATOM   4107  C CA    . GLU A 1 531 ? -5.823  37.009  38.621  1.00 25.96 ? 531  GLU A CA    1 
ATOM   4108  C C     . GLU A 1 531 ? -6.648  38.313  38.514  1.00 25.24 ? 531  GLU A C     1 
ATOM   4109  O O     . GLU A 1 531 ? -6.161  39.396  38.841  1.00 25.29 ? 531  GLU A O     1 
ATOM   4110  C CB    . GLU A 1 531 ? -4.857  36.840  37.445  1.00 25.65 ? 531  GLU A CB    1 
ATOM   4111  C CG    . GLU A 1 531 ? -5.458  37.013  36.023  1.00 27.63 ? 531  GLU A CG    1 
ATOM   4112  C CD    . GLU A 1 531 ? -4.422  36.651  34.931  1.00 28.28 ? 531  GLU A CD    1 
ATOM   4113  O OE1   . GLU A 1 531 ? -3.425  37.425  34.766  1.00 27.53 ? 531  GLU A OE1   1 
ATOM   4114  O OE2   . GLU A 1 531 ? -4.595  35.578  34.282  1.00 29.56 ? 531  GLU A OE2   1 
ATOM   4115  N N     . ILE A 1 532 ? -7.896  38.196  38.073  1.00 24.75 ? 532  ILE A N     1 
ATOM   4116  C CA    . ILE A 1 532 ? -8.789  39.350  37.973  1.00 24.40 ? 532  ILE A CA    1 
ATOM   4117  C C     . ILE A 1 532 ? -9.299  39.689  39.382  1.00 24.75 ? 532  ILE A C     1 
ATOM   4118  O O     . ILE A 1 532 ? -9.407  40.864  39.762  1.00 24.39 ? 532  ILE A O     1 
ATOM   4119  C CB    . ILE A 1 532 ? -9.949  39.098  36.963  1.00 24.17 ? 532  ILE A CB    1 
ATOM   4120  C CG1   . ILE A 1 532 ? -9.373  38.610  35.623  1.00 24.51 ? 532  ILE A CG1   1 
ATOM   4121  C CG2   . ILE A 1 532 ? -10.817 40.356  36.795  1.00 23.57 ? 532  ILE A CG2   1 
ATOM   4122  C CD1   . ILE A 1 532 ? -10.374 38.349  34.516  1.00 24.01 ? 532  ILE A CD1   1 
ATOM   4123  N N     . GLU A 1 533 ? -9.554  38.641  40.162  1.00 24.87 ? 533  GLU A N     1 
ATOM   4124  C CA    . GLU A 1 533 ? -9.988  38.789  41.524  1.00 25.19 ? 533  GLU A CA    1 
ATOM   4125  C C     . GLU A 1 533 ? -8.913  39.499  42.341  1.00 26.15 ? 533  GLU A C     1 
ATOM   4126  O O     . GLU A 1 533 ? -9.237  40.421  43.095  1.00 26.40 ? 533  GLU A O     1 
ATOM   4127  C CB    . GLU A 1 533 ? -10.384 37.438  42.127  1.00 25.14 ? 533  GLU A CB    1 
ATOM   4128  C CG    . GLU A 1 533 ? -11.662 36.851  41.526  1.00 24.04 ? 533  GLU A CG    1 
ATOM   4129  C CD    . GLU A 1 533 ? -11.887 35.377  41.896  1.00 25.09 ? 533  GLU A CD    1 
ATOM   4130  O OE1   . GLU A 1 533 ? -11.154 34.819  42.729  1.00 23.71 ? 533  GLU A OE1   1 
ATOM   4131  O OE2   . GLU A 1 533 ? -12.820 34.764  41.359  1.00 26.00 ? 533  GLU A OE2   1 
ATOM   4132  N N     . SER A 1 534 ? -7.650  39.088  42.167  1.00 26.63 ? 534  SER A N     1 
ATOM   4133  C CA    . SER A 1 534 ? -6.487  39.763  42.767  1.00 26.96 ? 534  SER A CA    1 
ATOM   4134  C C     . SER A 1 534 ? -6.393  41.251  42.411  1.00 26.72 ? 534  SER A C     1 
ATOM   4135  O O     . SER A 1 534 ? -6.130  42.101  43.273  1.00 25.72 ? 534  SER A O     1 
ATOM   4136  C CB    . SER A 1 534 ? -5.189  39.102  42.292  1.00 27.31 ? 534  SER A CB    1 
ATOM   4137  O OG    . SER A 1 534 ? -4.904  37.972  43.074  1.00 28.56 ? 534  SER A OG    1 
ATOM   4138  N N     . ALA A 1 535 ? -6.563  41.531  41.123  1.00 26.65 ? 535  ALA A N     1 
ATOM   4139  C CA    . ALA A 1 535 ? -6.486  42.888  40.603  1.00 27.27 ? 535  ALA A CA    1 
ATOM   4140  C C     . ALA A 1 535 ? -7.593  43.717  41.239  1.00 27.23 ? 535  ALA A C     1 
ATOM   4141  O O     . ALA A 1 535 ? -7.347  44.837  41.710  1.00 28.00 ? 535  ALA A O     1 
ATOM   4142  C CB    . ALA A 1 535 ? -6.581  42.901  39.070  1.00 26.83 ? 535  ALA A CB    1 
ATOM   4143  N N     . LEU A 1 536 ? -8.796  43.147  41.290  1.00 26.99 ? 536  LEU A N     1 
ATOM   4144  C CA    . LEU A 1 536 ? -9.918  43.770  42.004  1.00 26.84 ? 536  LEU A CA    1 
ATOM   4145  C C     . LEU A 1 536 ? -9.619  44.031  43.479  1.00 26.66 ? 536  LEU A C     1 
ATOM   4146  O O     . LEU A 1 536 ? -9.861  45.122  43.961  1.00 27.07 ? 536  LEU A O     1 
ATOM   4147  C CB    . LEU A 1 536 ? -11.188 42.935  41.864  1.00 26.80 ? 536  LEU A CB    1 
ATOM   4148  C CG    . LEU A 1 536 ? -11.824 42.983  40.473  1.00 26.34 ? 536  LEU A CG    1 
ATOM   4149  C CD1   . LEU A 1 536 ? -12.926 41.950  40.337  1.00 23.97 ? 536  LEU A CD1   1 
ATOM   4150  C CD2   . LEU A 1 536 ? -12.354 44.394  40.175  1.00 25.96 ? 536  LEU A CD2   1 
ATOM   4151  N N     . VAL A 1 537 ? -9.073  43.032  44.176  1.00 26.38 ? 537  VAL A N     1 
ATOM   4152  C CA    . VAL A 1 537 ? -8.864  43.090  45.619  1.00 25.36 ? 537  VAL A CA    1 
ATOM   4153  C C     . VAL A 1 537 ? -7.733  44.069  45.987  1.00 26.08 ? 537  VAL A C     1 
ATOM   4154  O O     . VAL A 1 537 ? -7.684  44.563  47.115  1.00 26.05 ? 537  VAL A O     1 
ATOM   4155  C CB    . VAL A 1 537 ? -8.640  41.663  46.199  1.00 25.32 ? 537  VAL A CB    1 
ATOM   4156  C CG1   . VAL A 1 537 ? -8.254  41.685  47.680  1.00 23.72 ? 537  VAL A CG1   1 
ATOM   4157  C CG2   . VAL A 1 537 ? -9.888  40.814  46.000  1.00 24.06 ? 537  VAL A CG2   1 
ATOM   4158  N N     . ALA A 1 538 ? -6.851  44.379  45.032  1.00 26.32 ? 538  ALA A N     1 
ATOM   4159  C CA    . ALA A 1 538 ? -5.737  45.312  45.275  1.00 26.34 ? 538  ALA A CA    1 
ATOM   4160  C C     . ALA A 1 538 ? -6.251  46.744  45.395  1.00 26.80 ? 538  ALA A C     1 
ATOM   4161  O O     . ALA A 1 538 ? -5.581  47.616  45.980  1.00 26.92 ? 538  ALA A O     1 
ATOM   4162  C CB    . ALA A 1 538 ? -4.690  45.205  44.189  1.00 25.86 ? 538  ALA A CB    1 
ATOM   4163  N N     . HIS A 1 539 ? -7.455  46.966  44.858  1.00 27.09 ? 539  HIS A N     1 
ATOM   4164  C CA    . HIS A 1 539 ? -8.155  48.246  44.972  1.00 27.26 ? 539  HIS A CA    1 
ATOM   4165  C C     . HIS A 1 539 ? -8.526  48.534  46.437  1.00 27.42 ? 539  HIS A C     1 
ATOM   4166  O O     . HIS A 1 539 ? -9.199  47.719  47.092  1.00 27.52 ? 539  HIS A O     1 
ATOM   4167  C CB    . HIS A 1 539 ? -9.405  48.268  44.078  1.00 26.80 ? 539  HIS A CB    1 
ATOM   4168  C CG    . HIS A 1 539 ? -10.010 49.625  43.929  1.00 27.76 ? 539  HIS A CG    1 
ATOM   4169  N ND1   . HIS A 1 539 ? -10.676 50.263  44.958  1.00 30.02 ? 539  HIS A ND1   1 
ATOM   4170  C CD2   . HIS A 1 539 ? -10.035 50.479  42.879  1.00 29.20 ? 539  HIS A CD2   1 
ATOM   4171  C CE1   . HIS A 1 539 ? -11.094 51.446  44.543  1.00 30.09 ? 539  HIS A CE1   1 
ATOM   4172  N NE2   . HIS A 1 539 ? -10.710 51.605  43.287  1.00 30.11 ? 539  HIS A NE2   1 
ATOM   4173  N N     . PRO A 1 540 ? -8.104  49.703  46.949  1.00 27.53 ? 540  PRO A N     1 
ATOM   4174  C CA    . PRO A 1 540 ? -8.246  50.054  48.385  1.00 27.50 ? 540  PRO A CA    1 
ATOM   4175  C C     . PRO A 1 540 ? -9.685  50.129  48.919  1.00 27.46 ? 540  PRO A C     1 
ATOM   4176  O O     . PRO A 1 540 ? -9.874  50.164  50.136  1.00 26.62 ? 540  PRO A O     1 
ATOM   4177  C CB    . PRO A 1 540 ? -7.572  51.424  48.486  1.00 27.51 ? 540  PRO A CB    1 
ATOM   4178  C CG    . PRO A 1 540 ? -7.587  51.969  47.079  1.00 28.07 ? 540  PRO A CG    1 
ATOM   4179  C CD    . PRO A 1 540 ? -7.451  50.777  46.174  1.00 27.38 ? 540  PRO A CD    1 
ATOM   4180  N N     . LYS A 1 541 ? -10.679 50.141  48.022  1.00 27.81 ? 541  LYS A N     1 
ATOM   4181  C CA    . LYS A 1 541 ? -12.101 50.134  48.430  1.00 27.95 ? 541  LYS A CA    1 
ATOM   4182  C C     . LYS A 1 541 ? -12.742 48.753  48.378  1.00 27.46 ? 541  LYS A C     1 
ATOM   4183  O O     . LYS A 1 541 ? -13.890 48.594  48.820  1.00 27.75 ? 541  LYS A O     1 
ATOM   4184  C CB    . LYS A 1 541 ? -12.946 51.105  47.592  1.00 28.08 ? 541  LYS A CB    1 
ATOM   4185  C CG    . LYS A 1 541 ? -12.753 52.560  47.948  1.00 29.67 ? 541  LYS A CG    1 
ATOM   4186  C CD    . LYS A 1 541 ? -13.671 53.459  47.132  1.00 32.10 ? 541  LYS A CD    1 
ATOM   4187  C CE    . LYS A 1 541 ? -13.597 54.901  47.637  1.00 34.27 ? 541  LYS A CE    1 
ATOM   4188  N NZ    . LYS A 1 541 ? -14.934 55.580  47.590  1.00 35.87 ? 541  LYS A NZ    1 
ATOM   4189  N N     . ILE A 1 542 ? -12.013 47.772  47.841  1.00 26.64 ? 542  ILE A N     1 
ATOM   4190  C CA    . ILE A 1 542 ? -12.556 46.428  47.603  1.00 25.97 ? 542  ILE A CA    1 
ATOM   4191  C C     . ILE A 1 542 ? -12.046 45.402  48.627  1.00 26.49 ? 542  ILE A C     1 
ATOM   4192  O O     . ILE A 1 542 ? -10.825 45.215  48.816  1.00 25.74 ? 542  ILE A O     1 
ATOM   4193  C CB    . ILE A 1 542 ? -12.265 45.946  46.165  1.00 26.28 ? 542  ILE A CB    1 
ATOM   4194  C CG1   . ILE A 1 542 ? -13.047 46.819  45.163  1.00 26.20 ? 542  ILE A CG1   1 
ATOM   4195  C CG2   . ILE A 1 542 ? -12.566 44.456  46.014  1.00 24.45 ? 542  ILE A CG2   1 
ATOM   4196  C CD1   . ILE A 1 542 ? -12.915 46.407  43.713  1.00 25.59 ? 542  ILE A CD1   1 
ATOM   4197  N N     . ALA A 1 543 ? -13.005 44.761  49.290  1.00 26.09 ? 543  ALA A N     1 
ATOM   4198  C CA    . ALA A 1 543 ? -12.739 43.720  50.265  1.00 26.21 ? 543  ALA A CA    1 
ATOM   4199  C C     . ALA A 1 543 ? -12.518 42.347  49.601  1.00 26.32 ? 543  ALA A C     1 
ATOM   4200  O O     . ALA A 1 543 ? -11.538 41.645  49.875  1.00 26.49 ? 543  ALA A O     1 
ATOM   4201  C CB    . ALA A 1 543 ? -13.909 43.655  51.262  1.00 25.95 ? 543  ALA A CB    1 
ATOM   4202  N N     . GLU A 1 544 ? -13.417 42.001  48.685  1.00 26.15 ? 544  GLU A N     1 
ATOM   4203  C CA    . GLU A 1 544 ? -13.624 40.630  48.273  1.00 25.86 ? 544  GLU A CA    1 
ATOM   4204  C C     . GLU A 1 544 ? -14.184 40.647  46.859  1.00 25.54 ? 544  GLU A C     1 
ATOM   4205  O O     . GLU A 1 544 ? -15.028 41.473  46.540  1.00 25.43 ? 544  GLU A O     1 
ATOM   4206  C CB    . GLU A 1 544 ? -14.652 40.017  49.221  1.00 26.00 ? 544  GLU A CB    1 
ATOM   4207  C CG    . GLU A 1 544 ? -14.500 38.566  49.537  1.00 27.00 ? 544  GLU A CG    1 
ATOM   4208  C CD    . GLU A 1 544 ? -14.957 38.234  50.952  1.00 27.97 ? 544  GLU A CD    1 
ATOM   4209  O OE1   . GLU A 1 544 ? -16.078 38.596  51.386  1.00 29.87 ? 544  GLU A OE1   1 
ATOM   4210  O OE2   . GLU A 1 544 ? -14.175 37.591  51.652  1.00 29.92 ? 544  GLU A OE2   1 
ATOM   4211  N N     . ALA A 1 545 ? -13.705 39.740  46.012  1.00 25.41 ? 545  ALA A N     1 
ATOM   4212  C CA    . ALA A 1 545 ? -14.231 39.601  44.652  1.00 25.09 ? 545  ALA A CA    1 
ATOM   4213  C C     . ALA A 1 545 ? -14.304 38.144  44.216  1.00 24.36 ? 545  ALA A C     1 
ATOM   4214  O O     . ALA A 1 545 ? -13.443 37.359  44.564  1.00 23.84 ? 545  ALA A O     1 
ATOM   4215  C CB    . ALA A 1 545 ? -13.401 40.422  43.637  1.00 24.98 ? 545  ALA A CB    1 
ATOM   4216  N N     . ALA A 1 546 ? -15.342 37.816  43.446  1.00 23.95 ? 546  ALA A N     1 
ATOM   4217  C CA    . ALA A 1 546 ? -15.456 36.539  42.750  1.00 23.44 ? 546  ALA A CA    1 
ATOM   4218  C C     . ALA A 1 546 ? -15.832 36.875  41.330  1.00 23.69 ? 546  ALA A C     1 
ATOM   4219  O O     . ALA A 1 546 ? -16.787 37.640  41.088  1.00 23.40 ? 546  ALA A O     1 
ATOM   4220  C CB    . ALA A 1 546 ? -16.524 35.682  43.373  1.00 23.43 ? 546  ALA A CB    1 
ATOM   4221  N N     . VAL A 1 547 ? -15.078 36.296  40.397  1.00 23.41 ? 547  VAL A N     1 
ATOM   4222  C CA    . VAL A 1 547 ? -15.196 36.583  38.987  1.00 23.07 ? 547  VAL A CA    1 
ATOM   4223  C C     . VAL A 1 547 ? -15.557 35.285  38.317  1.00 23.64 ? 547  VAL A C     1 
ATOM   4224  O O     . VAL A 1 547 ? -14.914 34.253  38.541  1.00 23.86 ? 547  VAL A O     1 
ATOM   4225  C CB    . VAL A 1 547 ? -13.848 37.071  38.393  1.00 23.28 ? 547  VAL A CB    1 
ATOM   4226  C CG1   . VAL A 1 547 ? -13.876 37.091  36.849  1.00 22.79 ? 547  VAL A CG1   1 
ATOM   4227  C CG2   . VAL A 1 547 ? -13.451 38.451  38.951  1.00 23.98 ? 547  VAL A CG2   1 
ATOM   4228  N N     . VAL A 1 548 ? -16.586 35.364  37.476  1.00 23.97 ? 548  VAL A N     1 
ATOM   4229  C CA    . VAL A 1 548 ? -17.024 34.290  36.617  1.00 23.63 ? 548  VAL A CA    1 
ATOM   4230  C C     . VAL A 1 548 ? -17.145 34.800  35.158  1.00 24.26 ? 548  VAL A C     1 
ATOM   4231  O O     . VAL A 1 548 ? -17.193 36.032  34.897  1.00 23.58 ? 548  VAL A O     1 
ATOM   4232  C CB    . VAL A 1 548 ? -18.408 33.732  37.093  1.00 23.86 ? 548  VAL A CB    1 
ATOM   4233  C CG1   . VAL A 1 548 ? -18.348 33.259  38.526  1.00 22.28 ? 548  VAL A CG1   1 
ATOM   4234  C CG2   . VAL A 1 548 ? -19.511 34.772  36.917  1.00 23.23 ? 548  VAL A CG2   1 
ATOM   4235  N N     . GLY A 1 549 ? -17.204 33.844  34.217  1.00 24.69 ? 549  GLY A N     1 
ATOM   4236  C CA    . GLY A 1 549 ? -17.534 34.121  32.816  1.00 24.94 ? 549  GLY A CA    1 
ATOM   4237  C C     . GLY A 1 549 ? -19.013 33.879  32.504  1.00 25.73 ? 549  GLY A C     1 
ATOM   4238  O O     . GLY A 1 549 ? -19.664 33.004  33.088  1.00 24.81 ? 549  GLY A O     1 
ATOM   4239  N N     . ILE A 1 550 ? -19.538 34.665  31.572  1.00 26.52 ? 550  ILE A N     1 
ATOM   4240  C CA    . ILE A 1 550 ? -20.899 34.512  31.080  1.00 27.82 ? 550  ILE A CA    1 
ATOM   4241  C C     . ILE A 1 550 ? -20.856 34.541  29.567  1.00 27.87 ? 550  ILE A C     1 
ATOM   4242  O O     . ILE A 1 550 ? -20.021 35.242  29.005  1.00 28.78 ? 550  ILE A O     1 
ATOM   4243  C CB    . ILE A 1 550 ? -21.813 35.658  31.576  1.00 27.99 ? 550  ILE A CB    1 
ATOM   4244  C CG1   . ILE A 1 550 ? -21.252 37.037  31.164  1.00 29.29 ? 550  ILE A CG1   1 
ATOM   4245  C CG2   . ILE A 1 550 ? -21.983 35.572  33.086  1.00 28.33 ? 550  ILE A CG2   1 
ATOM   4246  C CD1   . ILE A 1 550 ? -22.299 38.187  31.145  1.00 29.12 ? 550  ILE A CD1   1 
ATOM   4247  N N     . PRO A 1 551 ? -21.756 33.797  28.894  1.00 28.09 ? 551  PRO A N     1 
ATOM   4248  C CA    . PRO A 1 551 ? -21.739 33.778  27.418  1.00 27.86 ? 551  PRO A CA    1 
ATOM   4249  C C     . PRO A 1 551 ? -21.830 35.181  26.829  1.00 27.82 ? 551  PRO A C     1 
ATOM   4250  O O     . PRO A 1 551 ? -22.468 36.065  27.402  1.00 28.44 ? 551  PRO A O     1 
ATOM   4251  C CB    . PRO A 1 551 ? -22.992 32.978  27.054  1.00 27.55 ? 551  PRO A CB    1 
ATOM   4252  C CG    . PRO A 1 551 ? -23.288 32.137  28.267  1.00 27.89 ? 551  PRO A CG    1 
ATOM   4253  C CD    . PRO A 1 551 ? -22.831 32.948  29.453  1.00 28.04 ? 551  PRO A CD    1 
ATOM   4254  N N     . HIS A 1 552 ? -21.165 35.401  25.712  1.00 27.61 ? 552  HIS A N     1 
ATOM   4255  C CA    . HIS A 1 552 ? -21.201 36.703  25.072  1.00 27.47 ? 552  HIS A CA    1 
ATOM   4256  C C     . HIS A 1 552 ? -21.168 36.492  23.559  1.00 27.28 ? 552  HIS A C     1 
ATOM   4257  O O     . HIS A 1 552 ? -20.329 35.737  23.063  1.00 26.98 ? 552  HIS A O     1 
ATOM   4258  C CB    . HIS A 1 552 ? -20.029 37.566  25.539  1.00 27.44 ? 552  HIS A CB    1 
ATOM   4259  C CG    . HIS A 1 552 ? -20.113 38.981  25.060  1.00 28.81 ? 552  HIS A CG    1 
ATOM   4260  N ND1   . HIS A 1 552 ? -20.618 40.004  25.836  1.00 30.31 ? 552  HIS A ND1   1 
ATOM   4261  C CD2   . HIS A 1 552 ? -19.789 39.538  23.870  1.00 30.24 ? 552  HIS A CD2   1 
ATOM   4262  C CE1   . HIS A 1 552 ? -20.594 41.131  25.149  1.00 30.37 ? 552  HIS A CE1   1 
ATOM   4263  N NE2   . HIS A 1 552 ? -20.097 40.875  23.950  1.00 32.37 ? 552  HIS A NE2   1 
ATOM   4264  N N     . ALA A 1 553 ? -22.070 37.158  22.837  1.00 26.65 ? 553  ALA A N     1 
ATOM   4265  C CA    . ALA A 1 553 ? -22.245 36.910  21.406  1.00 26.73 ? 553  ALA A CA    1 
ATOM   4266  C C     . ALA A 1 553 ? -21.041 37.285  20.544  1.00 26.83 ? 553  ALA A C     1 
ATOM   4267  O O     . ALA A 1 553 ? -20.847 36.715  19.470  1.00 27.33 ? 553  ALA A O     1 
ATOM   4268  C CB    . ALA A 1 553 ? -23.534 37.571  20.871  1.00 26.27 ? 553  ALA A CB    1 
ATOM   4269  N N     . ILE A 1 554 ? -20.248 38.256  20.971  1.00 27.14 ? 554  ILE A N     1 
ATOM   4270  C CA    . ILE A 1 554 ? -19.025 38.539  20.215  1.00 27.71 ? 554  ILE A CA    1 
ATOM   4271  C C     . ILE A 1 554 ? -17.750 38.053  20.902  1.00 27.50 ? 554  ILE A C     1 
ATOM   4272  O O     . ILE A 1 554 ? -16.929 37.364  20.261  1.00 27.32 ? 554  ILE A O     1 
ATOM   4273  C CB    . ILE A 1 554 ? -18.886 40.009  19.751  1.00 28.22 ? 554  ILE A CB    1 
ATOM   4274  C CG1   . ILE A 1 554 ? -20.160 40.453  19.017  1.00 28.70 ? 554  ILE A CG1   1 
ATOM   4275  C CG2   . ILE A 1 554 ? -17.638 40.162  18.790  1.00 28.32 ? 554  ILE A CG2   1 
ATOM   4276  C CD1   . ILE A 1 554 ? -20.316 39.834  17.578  1.00 28.22 ? 554  ILE A CD1   1 
ATOM   4277  N N     . LYS A 1 555 ? -17.605 38.383  22.192  1.00 26.70 ? 555  LYS A N     1 
ATOM   4278  C CA    . LYS A 1 555 ? -16.391 38.052  22.934  1.00 26.13 ? 555  LYS A CA    1 
ATOM   4279  C C     . LYS A 1 555 ? -16.285 36.579  23.307  1.00 25.58 ? 555  LYS A C     1 
ATOM   4280  O O     . LYS A 1 555 ? -15.222 36.145  23.762  1.00 25.30 ? 555  LYS A O     1 
ATOM   4281  C CB    . LYS A 1 555 ? -16.293 38.870  24.207  1.00 26.45 ? 555  LYS A CB    1 
ATOM   4282  C CG    . LYS A 1 555 ? -16.338 40.364  24.034  1.00 26.99 ? 555  LYS A CG    1 
ATOM   4283  C CD    . LYS A 1 555 ? -16.244 41.017  25.401  1.00 27.72 ? 555  LYS A CD    1 
ATOM   4284  C CE    . LYS A 1 555 ? -16.151 42.501  25.225  1.00 29.78 ? 555  LYS A CE    1 
ATOM   4285  N NZ    . LYS A 1 555 ? -16.336 43.177  26.502  1.00 30.80 ? 555  LYS A NZ    1 
ATOM   4286  N N     . GLY A 1 556 ? -17.384 35.833  23.159  1.00 24.75 ? 556  GLY A N     1 
ATOM   4287  C CA    . GLY A 1 556 ? -17.435 34.418  23.563  1.00 24.47 ? 556  GLY A CA    1 
ATOM   4288  C C     . GLY A 1 556 ? -17.791 34.270  25.032  1.00 24.43 ? 556  GLY A C     1 
ATOM   4289  O O     . GLY A 1 556 ? -18.813 33.682  25.381  1.00 24.06 ? 556  GLY A O     1 
ATOM   4290  N N     . GLN A 1 557 ? -16.939 34.813  25.893  1.00 24.99 ? 557  GLN A N     1 
ATOM   4291  C CA    . GLN A 1 557 ? -17.260 35.009  27.310  1.00 25.88 ? 557  GLN A CA    1 
ATOM   4292  C C     . GLN A 1 557 ? -16.983 36.452  27.695  1.00 26.11 ? 557  GLN A C     1 
ATOM   4293  O O     . GLN A 1 557 ? -16.058 37.076  27.180  1.00 26.10 ? 557  GLN A O     1 
ATOM   4294  C CB    . GLN A 1 557 ? -16.390 34.138  28.216  1.00 26.24 ? 557  GLN A CB    1 
ATOM   4295  C CG    . GLN A 1 557 ? -16.702 32.668  28.230  1.00 27.57 ? 557  GLN A CG    1 
ATOM   4296  C CD    . GLN A 1 557 ? -16.010 32.004  29.402  1.00 31.41 ? 557  GLN A CD    1 
ATOM   4297  O OE1   . GLN A 1 557 ? -14.775 31.863  29.413  1.00 32.12 ? 557  GLN A OE1   1 
ATOM   4298  N NE2   . GLN A 1 557 ? -16.796 31.627  30.426  1.00 31.17 ? 557  GLN A NE2   1 
ATOM   4299  N N     . ALA A 1 558 ? -17.787 36.979  28.603  1.00 26.29 ? 558  ALA A N     1 
ATOM   4300  C CA    . ALA A 1 558 ? -17.484 38.259  29.225  1.00 26.14 ? 558  ALA A CA    1 
ATOM   4301  C C     . ALA A 1 558 ? -17.104 37.993  30.680  1.00 25.84 ? 558  ALA A C     1 
ATOM   4302  O O     . ALA A 1 558 ? -17.358 36.923  31.218  1.00 25.32 ? 558  ALA A O     1 
ATOM   4303  C CB    . ALA A 1 558 ? -18.696 39.212  29.138  1.00 26.33 ? 558  ALA A CB    1 
ATOM   4304  N N     . ILE A 1 559 ? -16.479 38.988  31.287  1.00 26.23 ? 559  ILE A N     1 
ATOM   4305  C CA    . ILE A 1 559 ? -16.012 38.932  32.649  1.00 26.28 ? 559  ILE A CA    1 
ATOM   4306  C C     . ILE A 1 559 ? -17.038 39.644  33.495  1.00 26.05 ? 559  ILE A C     1 
ATOM   4307  O O     . ILE A 1 559 ? -17.309 40.840  33.284  1.00 25.77 ? 559  ILE A O     1 
ATOM   4308  C CB    . ILE A 1 559 ? -14.663 39.653  32.813  1.00 26.65 ? 559  ILE A CB    1 
ATOM   4309  C CG1   . ILE A 1 559 ? -13.588 38.997  31.957  1.00 25.14 ? 559  ILE A CG1   1 
ATOM   4310  C CG2   . ILE A 1 559 ? -14.286 39.721  34.307  1.00 27.15 ? 559  ILE A CG2   1 
ATOM   4311  C CD1   . ILE A 1 559 ? -12.435 39.932  31.602  1.00 24.78 ? 559  ILE A CD1   1 
ATOM   4312  N N     . TYR A 1 560 ? -17.620 38.877  34.424  1.00 26.05 ? 560  TYR A N     1 
ATOM   4313  C CA    . TYR A 1 560 ? -18.686 39.328  35.326  1.00 25.63 ? 560  TYR A CA    1 
ATOM   4314  C C     . TYR A 1 560 ? -18.090 39.189  36.716  1.00 25.74 ? 560  TYR A C     1 
ATOM   4315  O O     . TYR A 1 560 ? -17.708 38.089  37.140  1.00 25.27 ? 560  TYR A O     1 
ATOM   4316  C CB    . TYR A 1 560 ? -19.904 38.414  35.159  1.00 25.75 ? 560  TYR A CB    1 
ATOM   4317  C CG    . TYR A 1 560 ? -21.187 38.772  35.902  1.00 25.78 ? 560  TYR A CG    1 
ATOM   4318  C CD1   . TYR A 1 560 ? -21.282 38.637  37.281  1.00 26.20 ? 560  TYR A CD1   1 
ATOM   4319  C CD2   . TYR A 1 560 ? -22.343 39.177  35.194  1.00 27.17 ? 560  TYR A CD2   1 
ATOM   4320  C CE1   . TYR A 1 560 ? -22.476 38.932  37.948  1.00 26.13 ? 560  TYR A CE1   1 
ATOM   4321  C CE2   . TYR A 1 560 ? -23.536 39.477  35.850  1.00 25.04 ? 560  TYR A CE2   1 
ATOM   4322  C CZ    . TYR A 1 560 ? -23.587 39.356  37.226  1.00 25.12 ? 560  TYR A CZ    1 
ATOM   4323  O OH    . TYR A 1 560 ? -24.734 39.669  37.894  1.00 25.30 ? 560  TYR A OH    1 
ATOM   4324  N N     . ALA A 1 561 ? -17.985 40.314  37.413  1.00 26.31 ? 561  ALA A N     1 
ATOM   4325  C CA    . ALA A 1 561 ? -17.320 40.351  38.709  1.00 27.28 ? 561  ALA A CA    1 
ATOM   4326  C C     . ALA A 1 561 ? -18.280 40.685  39.847  1.00 27.79 ? 561  ALA A C     1 
ATOM   4327  O O     . ALA A 1 561 ? -18.906 41.751  39.868  1.00 28.75 ? 561  ALA A O     1 
ATOM   4328  C CB    . ALA A 1 561 ? -16.133 41.334  38.672  1.00 27.16 ? 561  ALA A CB    1 
ATOM   4329  N N     . TYR A 1 562 ? -18.416 39.749  40.778  1.00 28.26 ? 562  TYR A N     1 
ATOM   4330  C CA    . TYR A 1 562 ? -19.133 39.992  42.029  1.00 28.09 ? 562  TYR A CA    1 
ATOM   4331  C C     . TYR A 1 562 ? -18.143 40.648  42.969  1.00 28.60 ? 562  TYR A C     1 
ATOM   4332  O O     . TYR A 1 562 ? -17.097 40.058  43.278  1.00 29.05 ? 562  TYR A O     1 
ATOM   4333  C CB    . TYR A 1 562 ? -19.614 38.683  42.659  1.00 27.62 ? 562  TYR A CB    1 
ATOM   4334  C CG    . TYR A 1 562 ? -20.663 37.914  41.876  1.00 27.31 ? 562  TYR A CG    1 
ATOM   4335  C CD1   . TYR A 1 562 ? -20.295 36.969  40.897  1.00 25.64 ? 562  TYR A CD1   1 
ATOM   4336  C CD2   . TYR A 1 562 ? -22.026 38.101  42.141  1.00 26.38 ? 562  TYR A CD2   1 
ATOM   4337  C CE1   . TYR A 1 562 ? -21.265 36.258  40.187  1.00 26.22 ? 562  TYR A CE1   1 
ATOM   4338  C CE2   . TYR A 1 562 ? -23.000 37.384  41.449  1.00 26.06 ? 562  TYR A CE2   1 
ATOM   4339  C CZ    . TYR A 1 562 ? -22.615 36.473  40.478  1.00 26.97 ? 562  TYR A CZ    1 
ATOM   4340  O OH    . TYR A 1 562 ? -23.587 35.774  39.811  1.00 27.93 ? 562  TYR A OH    1 
ATOM   4341  N N     . VAL A 1 563 ? -18.473 41.853  43.431  1.00 28.88 ? 563  VAL A N     1 
ATOM   4342  C CA    . VAL A 1 563 ? -17.556 42.649  44.237  1.00 28.95 ? 563  VAL A CA    1 
ATOM   4343  C C     . VAL A 1 563 ? -18.150 43.033  45.592  1.00 28.94 ? 563  VAL A C     1 
ATOM   4344  O O     . VAL A 1 563 ? -19.280 43.540  45.674  1.00 28.68 ? 563  VAL A O     1 
ATOM   4345  C CB    . VAL A 1 563 ? -17.086 43.930  43.479  1.00 29.13 ? 563  VAL A CB    1 
ATOM   4346  C CG1   . VAL A 1 563 ? -16.189 44.792  44.386  1.00 28.79 ? 563  VAL A CG1   1 
ATOM   4347  C CG2   . VAL A 1 563 ? -16.357 43.553  42.183  1.00 29.24 ? 563  VAL A CG2   1 
ATOM   4348  N N     . THR A 1 564 ? -17.368 42.793  46.643  1.00 28.88 ? 564  THR A N     1 
ATOM   4349  C CA    . THR A 1 564 ? -17.719 43.209  47.991  1.00 29.21 ? 564  THR A CA    1 
ATOM   4350  C C     . THR A 1 564 ? -16.753 44.331  48.414  1.00 30.00 ? 564  THR A C     1 
ATOM   4351  O O     . THR A 1 564 ? -15.532 44.143  48.442  1.00 30.54 ? 564  THR A O     1 
ATOM   4352  C CB    . THR A 1 564 ? -17.739 41.989  48.971  1.00 29.09 ? 564  THR A CB    1 
ATOM   4353  O OG1   . THR A 1 564 ? -18.767 41.077  48.568  1.00 28.40 ? 564  THR A OG1   1 
ATOM   4354  C CG2   . THR A 1 564 ? -17.982 42.401  50.419  1.00 27.75 ? 564  THR A CG2   1 
ATOM   4355  N N     . LEU A 1 565 ? -17.315 45.508  48.684  1.00 30.45 ? 565  LEU A N     1 
ATOM   4356  C CA    . LEU A 1 565 ? -16.565 46.677  49.170  1.00 30.74 ? 565  LEU A CA    1 
ATOM   4357  C C     . LEU A 1 565 ? -16.199 46.523  50.647  1.00 30.84 ? 565  LEU A C     1 
ATOM   4358  O O     . LEU A 1 565 ? -16.889 45.822  51.393  1.00 31.05 ? 565  LEU A O     1 
ATOM   4359  C CB    . LEU A 1 565 ? -17.395 47.958  48.977  1.00 30.38 ? 565  LEU A CB    1 
ATOM   4360  C CG    . LEU A 1 565 ? -17.780 48.364  47.546  1.00 30.57 ? 565  LEU A CG    1 
ATOM   4361  C CD1   . LEU A 1 565 ? -18.624 49.633  47.554  1.00 27.26 ? 565  LEU A CD1   1 
ATOM   4362  C CD2   . LEU A 1 565 ? -16.522 48.534  46.663  1.00 29.83 ? 565  LEU A CD2   1 
ATOM   4363  N N     . ASN A 1 566 ? -15.129 47.192  51.073  1.00 31.12 ? 566  ASN A N     1 
ATOM   4364  C CA    . ASN A 1 566 ? -14.799 47.266  52.495  1.00 31.41 ? 566  ASN A CA    1 
ATOM   4365  C C     . ASN A 1 566 ? -15.989 47.823  53.261  1.00 32.52 ? 566  ASN A C     1 
ATOM   4366  O O     . ASN A 1 566 ? -16.769 48.615  52.707  1.00 31.78 ? 566  ASN A O     1 
ATOM   4367  C CB    . ASN A 1 566 ? -13.543 48.106  52.738  1.00 30.86 ? 566  ASN A CB    1 
ATOM   4368  C CG    . ASN A 1 566 ? -12.274 47.414  52.245  1.00 30.58 ? 566  ASN A CG    1 
ATOM   4369  O OD1   . ASN A 1 566 ? -12.041 46.238  52.527  1.00 30.50 ? 566  ASN A OD1   1 
ATOM   4370  N ND2   . ASN A 1 566 ? -11.456 48.140  51.504  1.00 28.78 ? 566  ASN A ND2   1 
ATOM   4371  N N     . HIS A 1 567 ? -16.140 47.382  54.517  1.00 33.87 ? 567  HIS A N     1 
ATOM   4372  C CA    . HIS A 1 567 ? -17.246 47.817  55.371  1.00 35.41 ? 567  HIS A CA    1 
ATOM   4373  C C     . HIS A 1 567 ? -17.239 49.338  55.459  1.00 35.21 ? 567  HIS A C     1 
ATOM   4374  O O     . HIS A 1 567 ? -16.197 49.947  55.688  1.00 34.96 ? 567  HIS A O     1 
ATOM   4375  C CB    . HIS A 1 567 ? -17.205 47.140  56.762  1.00 36.20 ? 567  HIS A CB    1 
ATOM   4376  C CG    . HIS A 1 567 ? -17.649 45.698  56.754  1.00 39.55 ? 567  HIS A CG    1 
ATOM   4377  N ND1   . HIS A 1 567 ? -18.790 45.261  57.400  1.00 42.39 ? 567  HIS A ND1   1 
ATOM   4378  C CD2   . HIS A 1 567 ? -17.107 44.595  56.175  1.00 41.90 ? 567  HIS A CD2   1 
ATOM   4379  C CE1   . HIS A 1 567 ? -18.929 43.956  57.224  1.00 42.57 ? 567  HIS A CE1   1 
ATOM   4380  N NE2   . HIS A 1 567 ? -17.921 43.527  56.484  1.00 42.34 ? 567  HIS A NE2   1 
ATOM   4381  N N     . GLY A 1 568 ? -18.400 49.935  55.197  1.00 35.53 ? 568  GLY A N     1 
ATOM   4382  C CA    . GLY A 1 568 ? -18.564 51.386  55.232  1.00 35.81 ? 568  GLY A CA    1 
ATOM   4383  C C     . GLY A 1 568 ? -18.430 52.087  53.892  1.00 36.00 ? 568  GLY A C     1 
ATOM   4384  O O     . GLY A 1 568 ? -18.537 53.317  53.837  1.00 36.11 ? 568  GLY A O     1 
ATOM   4385  N N     . GLU A 1 569 ? -18.194 51.315  52.824  1.00 35.80 ? 569  GLU A N     1 
ATOM   4386  C CA    . GLU A 1 569 ? -18.062 51.847  51.455  1.00 35.88 ? 569  GLU A CA    1 
ATOM   4387  C C     . GLU A 1 569 ? -19.372 51.752  50.676  1.00 36.10 ? 569  GLU A C     1 
ATOM   4388  O O     . GLU A 1 569 ? -20.094 50.760  50.778  1.00 36.33 ? 569  GLU A O     1 
ATOM   4389  C CB    . GLU A 1 569 ? -16.959 51.110  50.665  1.00 35.57 ? 569  GLU A CB    1 
ATOM   4390  C CG    . GLU A 1 569 ? -15.521 51.432  51.059  1.00 35.44 ? 569  GLU A CG    1 
ATOM   4391  C CD    . GLU A 1 569 ? -15.152 52.925  50.927  1.00 35.98 ? 569  GLU A CD    1 
ATOM   4392  O OE1   . GLU A 1 569 ? -15.573 53.594  49.949  1.00 36.04 ? 569  GLU A OE1   1 
ATOM   4393  O OE2   . GLU A 1 569 ? -14.428 53.428  51.813  1.00 34.73 ? 569  GLU A OE2   1 
ATOM   4394  N N     . GLU A 1 570 ? -19.659 52.771  49.870  1.00 36.32 ? 570  GLU A N     1 
ATOM   4395  C CA    . GLU A 1 570 ? -20.885 52.792  49.070  1.00 36.37 ? 570  GLU A CA    1 
ATOM   4396  C C     . GLU A 1 570 ? -20.587 52.751  47.568  1.00 36.18 ? 570  GLU A C     1 
ATOM   4397  O O     . GLU A 1 570 ? -19.676 53.426  47.106  1.00 35.80 ? 570  GLU A O     1 
ATOM   4398  C CB    . GLU A 1 570 ? -21.740 54.023  49.414  1.00 36.61 ? 570  GLU A CB    1 
ATOM   4399  N N     . PRO A 1 571 ? -21.350 51.939  46.803  1.00 36.36 ? 571  PRO A N     1 
ATOM   4400  C CA    . PRO A 1 571 ? -21.232 51.994  45.344  1.00 36.30 ? 571  PRO A CA    1 
ATOM   4401  C C     . PRO A 1 571 ? -21.647 53.368  44.798  1.00 36.37 ? 571  PRO A C     1 
ATOM   4402  O O     . PRO A 1 571 ? -22.336 54.138  45.489  1.00 36.41 ? 571  PRO A O     1 
ATOM   4403  C CB    . PRO A 1 571 ? -22.227 50.925  44.859  1.00 36.25 ? 571  PRO A CB    1 
ATOM   4404  C CG    . PRO A 1 571 ? -22.545 50.091  46.044  1.00 36.05 ? 571  PRO A CG    1 
ATOM   4405  C CD    . PRO A 1 571 ? -22.346 50.939  47.245  1.00 36.13 ? 571  PRO A CD    1 
ATOM   4406  N N     . SER A 1 572 ? -21.225 53.647  43.561  1.00 36.18 ? 572  SER A N     1 
ATOM   4407  C CA    . SER A 1 572 ? -21.593 54.846  42.804  1.00 35.58 ? 572  SER A CA    1 
ATOM   4408  C C     . SER A 1 572 ? -21.375 54.551  41.324  1.00 35.45 ? 572  SER A C     1 
ATOM   4409  O O     . SER A 1 572 ? -20.814 53.520  40.990  1.00 35.27 ? 572  SER A O     1 
ATOM   4410  C CB    . SER A 1 572 ? -20.762 56.054  43.256  1.00 35.48 ? 572  SER A CB    1 
ATOM   4411  O OG    . SER A 1 572 ? -19.590 55.657  43.948  1.00 34.97 ? 572  SER A OG    1 
ATOM   4412  N N     . PRO A 1 573 ? -21.869 55.419  40.418  1.00 35.64 ? 573  PRO A N     1 
ATOM   4413  C CA    . PRO A 1 573 ? -21.421 55.309  39.010  1.00 35.40 ? 573  PRO A CA    1 
ATOM   4414  C C     . PRO A 1 573 ? -19.946 55.737  38.761  1.00 35.13 ? 573  PRO A C     1 
ATOM   4415  O O     . PRO A 1 573 ? -19.309 55.229  37.823  1.00 34.77 ? 573  PRO A O     1 
ATOM   4416  C CB    . PRO A 1 573 ? -22.410 56.211  38.243  1.00 35.59 ? 573  PRO A CB    1 
ATOM   4417  C CG    . PRO A 1 573 ? -23.516 56.523  39.226  1.00 35.49 ? 573  PRO A CG    1 
ATOM   4418  C CD    . PRO A 1 573 ? -22.878 56.481  40.585  1.00 35.51 ? 573  PRO A CD    1 
ATOM   4419  N N     . GLU A 1 574 ? -19.421 56.647  39.590  1.00 34.85 ? 574  GLU A N     1 
ATOM   4420  C CA    . GLU A 1 574 ? -17.997 57.011  39.565  1.00 34.90 ? 574  GLU A CA    1 
ATOM   4421  C C     . GLU A 1 574 ? -17.150 55.750  39.813  1.00 33.89 ? 574  GLU A C     1 
ATOM   4422  O O     . GLU A 1 574 ? -16.163 55.515  39.125  1.00 33.96 ? 574  GLU A O     1 
ATOM   4423  C CB    . GLU A 1 574 ? -17.687 58.088  40.621  1.00 35.32 ? 574  GLU A CB    1 
ATOM   4424  C CG    . GLU A 1 574 ? -16.961 59.352  40.116  1.00 38.37 ? 574  GLU A CG    1 
ATOM   4425  C CD    . GLU A 1 574 ? -15.500 59.554  40.655  1.00 42.59 ? 574  GLU A CD    1 
ATOM   4426  O OE1   . GLU A 1 574 ? -15.237 60.637  41.250  1.00 42.41 ? 574  GLU A OE1   1 
ATOM   4427  O OE2   . GLU A 1 574 ? -14.617 58.663  40.467  1.00 43.61 ? 574  GLU A OE2   1 
ATOM   4428  N N     . LEU A 1 575 ? -17.585 54.928  40.760  1.00 32.95 ? 575  LEU A N     1 
ATOM   4429  C CA    . LEU A 1 575 ? -16.823 53.773  41.228  1.00 32.48 ? 575  LEU A CA    1 
ATOM   4430  C C     . LEU A 1 575 ? -16.799 52.619  40.229  1.00 32.43 ? 575  LEU A C     1 
ATOM   4431  O O     . LEU A 1 575 ? -15.776 51.932  40.065  1.00 31.95 ? 575  LEU A O     1 
ATOM   4432  C CB    . LEU A 1 575 ? -17.369 53.281  42.576  1.00 32.13 ? 575  LEU A CB    1 
ATOM   4433  C CG    . LEU A 1 575 ? -16.473 52.304  43.347  1.00 32.17 ? 575  LEU A CG    1 
ATOM   4434  C CD1   . LEU A 1 575 ? -15.118 52.920  43.719  1.00 29.38 ? 575  LEU A CD1   1 
ATOM   4435  C CD2   . LEU A 1 575 ? -17.201 51.817  44.576  1.00 31.10 ? 575  LEU A CD2   1 
ATOM   4436  N N     . TYR A 1 576 ? -17.944 52.394  39.589  1.00 32.12 ? 576  TYR A N     1 
ATOM   4437  C CA    . TYR A 1 576 ? -18.050 51.427  38.502  1.00 31.70 ? 576  TYR A CA    1 
ATOM   4438  C C     . TYR A 1 576 ? -16.936 51.617  37.465  1.00 30.64 ? 576  TYR A C     1 
ATOM   4439  O O     . TYR A 1 576 ? -16.139 50.719  37.260  1.00 29.77 ? 576  TYR A O     1 
ATOM   4440  C CB    . TYR A 1 576 ? -19.414 51.565  37.844  1.00 32.47 ? 576  TYR A CB    1 
ATOM   4441  C CG    . TYR A 1 576 ? -19.900 50.331  37.138  1.00 33.71 ? 576  TYR A CG    1 
ATOM   4442  C CD1   . TYR A 1 576 ? -20.783 49.443  37.780  1.00 35.16 ? 576  TYR A CD1   1 
ATOM   4443  C CD2   . TYR A 1 576 ? -19.527 50.062  35.812  1.00 33.56 ? 576  TYR A CD2   1 
ATOM   4444  C CE1   . TYR A 1 576 ? -21.268 48.297  37.125  1.00 34.68 ? 576  TYR A CE1   1 
ATOM   4445  C CE2   . TYR A 1 576 ? -20.001 48.926  35.153  1.00 34.78 ? 576  TYR A CE2   1 
ATOM   4446  C CZ    . TYR A 1 576 ? -20.868 48.047  35.824  1.00 34.18 ? 576  TYR A CZ    1 
ATOM   4447  O OH    . TYR A 1 576 ? -21.349 46.930  35.185  1.00 34.68 ? 576  TYR A OH    1 
ATOM   4448  N N     . ALA A 1 577 ? -16.888 52.791  36.828  1.00 30.11 ? 577  ALA A N     1 
ATOM   4449  C CA    . ALA A 1 577 ? -15.844 53.125  35.847  1.00 29.97 ? 577  ALA A CA    1 
ATOM   4450  C C     . ALA A 1 577 ? -14.436 53.146  36.453  1.00 30.16 ? 577  ALA A C     1 
ATOM   4451  O O     . ALA A 1 577 ? -13.464 52.738  35.815  1.00 30.48 ? 577  ALA A O     1 
ATOM   4452  C CB    . ALA A 1 577 ? -16.138 54.446  35.201  1.00 30.00 ? 577  ALA A CB    1 
ATOM   4453  N N     . GLU A 1 578 ? -14.329 53.621  37.693  1.00 29.85 ? 578  GLU A N     1 
ATOM   4454  C CA    . GLU A 1 578 ? -13.050 53.657  38.386  1.00 28.95 ? 578  GLU A CA    1 
ATOM   4455  C C     . GLU A 1 578 ? -12.428 52.280  38.542  1.00 27.97 ? 578  GLU A C     1 
ATOM   4456  O O     . GLU A 1 578 ? -11.252 52.099  38.226  1.00 27.57 ? 578  GLU A O     1 
ATOM   4457  C CB    . GLU A 1 578 ? -13.195 54.306  39.757  1.00 29.01 ? 578  GLU A CB    1 
ATOM   4458  C CG    . GLU A 1 578 ? -11.857 54.625  40.399  1.00 31.12 ? 578  GLU A CG    1 
ATOM   4459  C CD    . GLU A 1 578 ? -11.990 54.887  41.872  1.00 34.61 ? 578  GLU A CD    1 
ATOM   4460  O OE1   . GLU A 1 578 ? -12.741 55.827  42.258  1.00 35.78 ? 578  GLU A OE1   1 
ATOM   4461  O OE2   . GLU A 1 578 ? -11.351 54.139  42.640  1.00 34.24 ? 578  GLU A OE2   1 
ATOM   4462  N N     . VAL A 1 579 ? -13.221 51.341  39.064  1.00 27.33 ? 579  VAL A N     1 
ATOM   4463  C CA    . VAL A 1 579 ? -12.820 49.946  39.318  1.00 26.88 ? 579  VAL A CA    1 
ATOM   4464  C C     . VAL A 1 579 ? -12.415 49.252  38.002  1.00 27.15 ? 579  VAL A C     1 
ATOM   4465  O O     . VAL A 1 579 ? -11.375 48.605  37.923  1.00 27.27 ? 579  VAL A O     1 
ATOM   4466  C CB    . VAL A 1 579 ? -13.992 49.170  40.001  1.00 27.05 ? 579  VAL A CB    1 
ATOM   4467  C CG1   . VAL A 1 579 ? -13.781 47.651  39.984  1.00 25.24 ? 579  VAL A CG1   1 
ATOM   4468  C CG2   . VAL A 1 579 ? -14.254 49.695  41.430  1.00 26.44 ? 579  VAL A CG2   1 
ATOM   4469  N N     . ARG A 1 580 ? -13.247 49.416  36.974  1.00 26.99 ? 580  ARG A N     1 
ATOM   4470  C CA    . ARG A 1 580 ? -12.937 48.985  35.615  1.00 26.60 ? 580  ARG A CA    1 
ATOM   4471  C C     . ARG A 1 580 ? -11.578 49.509  35.123  1.00 26.02 ? 580  ARG A C     1 
ATOM   4472  O O     . ARG A 1 580 ? -10.734 48.730  34.679  1.00 25.04 ? 580  ARG A O     1 
ATOM   4473  C CB    . ARG A 1 580 ? -14.067 49.373  34.652  1.00 26.78 ? 580  ARG A CB    1 
ATOM   4474  C CG    . ARG A 1 580 ? -15.431 48.739  34.996  1.00 27.57 ? 580  ARG A CG    1 
ATOM   4475  C CD    . ARG A 1 580 ? -16.132 48.125  33.763  1.00 30.32 ? 580  ARG A CD    1 
ATOM   4476  N NE    . ARG A 1 580 ? -16.309 49.054  32.650  1.00 32.34 ? 580  ARG A NE    1 
ATOM   4477  C CZ    . ARG A 1 580 ? -16.223 48.726  31.362  1.00 34.65 ? 580  ARG A CZ    1 
ATOM   4478  N NH1   . ARG A 1 580 ? -15.946 47.482  30.990  1.00 35.50 ? 580  ARG A NH1   1 
ATOM   4479  N NH2   . ARG A 1 580 ? -16.410 49.656  30.433  1.00 36.22 ? 580  ARG A NH2   1 
ATOM   4480  N N     . ASN A 1 581 ? -11.378 50.825  35.210  1.00 25.45 ? 581  ASN A N     1 
ATOM   4481  C CA    . ASN A 1 581 ? -10.089 51.460  34.889  1.00 24.74 ? 581  ASN A CA    1 
ATOM   4482  C C     . ASN A 1 581 ? -8.924  50.933  35.756  1.00 24.63 ? 581  ASN A C     1 
ATOM   4483  O O     . ASN A 1 581 ? -7.774  50.851  35.294  1.00 25.07 ? 581  ASN A O     1 
ATOM   4484  C CB    . ASN A 1 581 ? -10.196 52.989  35.022  1.00 24.70 ? 581  ASN A CB    1 
ATOM   4485  C CG    . ASN A 1 581 ? -10.978 53.653  33.856  1.00 25.55 ? 581  ASN A CG    1 
ATOM   4486  O OD1   . ASN A 1 581 ? -11.232 53.035  32.817  1.00 27.98 ? 581  ASN A OD1   1 
ATOM   4487  N ND2   . ASN A 1 581 ? -11.341 54.919  34.033  1.00 23.02 ? 581  ASN A ND2   1 
ATOM   4488  N N     . TRP A 1 582 ? -9.221  50.584  37.009  1.00 24.12 ? 582  TRP A N     1 
ATOM   4489  C CA    . TRP A 1 582 ? -8.250  49.927  37.891  1.00 23.20 ? 582  TRP A CA    1 
ATOM   4490  C C     . TRP A 1 582 ? -7.792  48.584  37.291  1.00 23.16 ? 582  TRP A C     1 
ATOM   4491  O O     . TRP A 1 582 ? -6.601  48.353  37.120  1.00 22.74 ? 582  TRP A O     1 
ATOM   4492  C CB    . TRP A 1 582 ? -8.828  49.754  39.300  1.00 22.24 ? 582  TRP A CB    1 
ATOM   4493  C CG    . TRP A 1 582 ? -7.927  49.050  40.267  1.00 22.41 ? 582  TRP A CG    1 
ATOM   4494  C CD1   . TRP A 1 582 ? -7.890  47.700  40.550  1.00 20.00 ? 582  TRP A CD1   1 
ATOM   4495  C CD2   . TRP A 1 582 ? -6.927  49.664  41.104  1.00 22.78 ? 582  TRP A CD2   1 
ATOM   4496  N NE1   . TRP A 1 582 ? -6.923  47.448  41.501  1.00 20.46 ? 582  TRP A NE1   1 
ATOM   4497  C CE2   . TRP A 1 582 ? -6.322  48.629  41.860  1.00 20.40 ? 582  TRP A CE2   1 
ATOM   4498  C CE3   . TRP A 1 582 ? -6.491  50.994  41.293  1.00 21.70 ? 582  TRP A CE3   1 
ATOM   4499  C CZ2   . TRP A 1 582 ? -5.299  48.876  42.777  1.00 20.65 ? 582  TRP A CZ2   1 
ATOM   4500  C CZ3   . TRP A 1 582 ? -5.475  51.236  42.215  1.00 20.62 ? 582  TRP A CZ3   1 
ATOM   4501  C CH2   . TRP A 1 582 ? -4.883  50.179  42.936  1.00 20.69 ? 582  TRP A CH2   1 
ATOM   4502  N N     . VAL A 1 583 ? -8.728  47.699  36.959  1.00 23.98 ? 583  VAL A N     1 
ATOM   4503  C CA    . VAL A 1 583 ? -8.330  46.429  36.333  1.00 24.71 ? 583  VAL A CA    1 
ATOM   4504  C C     . VAL A 1 583 ? -7.559  46.620  35.001  1.00 25.61 ? 583  VAL A C     1 
ATOM   4505  O O     . VAL A 1 583 ? -6.617  45.879  34.701  1.00 26.10 ? 583  VAL A O     1 
ATOM   4506  C CB    . VAL A 1 583 ? -9.503  45.476  36.126  1.00 24.63 ? 583  VAL A CB    1 
ATOM   4507  C CG1   . VAL A 1 583 ? -8.988  44.126  35.477  1.00 23.60 ? 583  VAL A CG1   1 
ATOM   4508  C CG2   . VAL A 1 583 ? -10.230 45.231  37.454  1.00 23.20 ? 583  VAL A CG2   1 
ATOM   4509  N N     . GLU A 1 584 ? -7.959  47.619  34.223  1.00 26.40 ? 584  GLU A N     1 
ATOM   4510  C CA    . GLU A 1 584 ? -7.293  47.926  32.977  1.00 28.11 ? 584  GLU A CA    1 
ATOM   4511  C C     . GLU A 1 584 ? -5.857  48.371  33.240  1.00 28.41 ? 584  GLU A C     1 
ATOM   4512  O O     . GLU A 1 584 ? -4.984  48.152  32.422  1.00 29.15 ? 584  GLU A O     1 
ATOM   4513  C CB    . GLU A 1 584 ? -8.067  48.992  32.208  1.00 28.03 ? 584  GLU A CB    1 
ATOM   4514  C CG    . GLU A 1 584 ? -7.357  49.511  30.980  1.00 29.98 ? 584  GLU A CG    1 
ATOM   4515  C CD    . GLU A 1 584 ? -8.262  50.350  30.095  1.00 33.44 ? 584  GLU A CD    1 
ATOM   4516  O OE1   . GLU A 1 584 ? -7.837  51.454  29.722  1.00 33.50 ? 584  GLU A OE1   1 
ATOM   4517  O OE2   . GLU A 1 584 ? -9.396  49.901  29.774  1.00 36.25 ? 584  GLU A OE2   1 
ATOM   4518  N N     . LYS A 1 585 ? -5.632  48.988  34.389  1.00 28.94 ? 585  LYS A N     1 
ATOM   4519  C CA    . LYS A 1 585 ? -4.312  49.451  34.782  1.00 30.01 ? 585  LYS A CA    1 
ATOM   4520  C C     . LYS A 1 585 ? -3.478  48.298  35.325  1.00 29.03 ? 585  LYS A C     1 
ATOM   4521  O O     . LYS A 1 585 ? -2.282  48.250  35.111  1.00 29.45 ? 585  LYS A O     1 
ATOM   4522  C CB    . LYS A 1 585 ? -4.409  50.603  35.807  1.00 29.73 ? 585  LYS A CB    1 
ATOM   4523  C CG    . LYS A 1 585 ? -3.077  50.932  36.467  1.00 32.12 ? 585  LYS A CG    1 
ATOM   4524  C CD    . LYS A 1 585 ? -3.202  51.947  37.629  1.00 32.77 ? 585  LYS A CD    1 
ATOM   4525  C CE    . LYS A 1 585 ? -2.622  51.407  38.954  1.00 35.23 ? 585  LYS A CE    1 
ATOM   4526  N NZ    . LYS A 1 585 ? -3.535  50.378  39.558  1.00 36.71 ? 585  LYS A NZ    1 
ATOM   4527  N N     . GLU A 1 586 ? -4.114  47.376  36.033  1.00 28.80 ? 586  GLU A N     1 
ATOM   4528  C CA    . GLU A 1 586 ? -3.405  46.246  36.635  1.00 28.28 ? 586  GLU A CA    1 
ATOM   4529  C C     . GLU A 1 586 ? -2.943  45.232  35.606  1.00 27.42 ? 586  GLU A C     1 
ATOM   4530  O O     . GLU A 1 586 ? -1.829  44.719  35.703  1.00 27.41 ? 586  GLU A O     1 
ATOM   4531  C CB    . GLU A 1 586 ? -4.284  45.557  37.676  1.00 28.40 ? 586  GLU A CB    1 
ATOM   4532  C CG    . GLU A 1 586 ? -4.470  46.383  38.944  1.00 29.91 ? 586  GLU A CG    1 
ATOM   4533  C CD    . GLU A 1 586 ? -3.229  46.396  39.828  1.00 32.97 ? 586  GLU A CD    1 
ATOM   4534  O OE1   . GLU A 1 586 ? -2.924  45.339  40.440  1.00 32.80 ? 586  GLU A OE1   1 
ATOM   4535  O OE2   . GLU A 1 586 ? -2.568  47.462  39.903  1.00 33.43 ? 586  GLU A OE2   1 
ATOM   4536  N N     . ILE A 1 587 ? -3.800  44.945  34.629  1.00 26.43 ? 587  ILE A N     1 
ATOM   4537  C CA    . ILE A 1 587 ? -3.520  43.897  33.654  1.00 25.93 ? 587  ILE A CA    1 
ATOM   4538  C C     . ILE A 1 587 ? -3.503  44.456  32.230  1.00 25.77 ? 587  ILE A C     1 
ATOM   4539  O O     . ILE A 1 587 ? -2.475  44.455  31.564  1.00 25.35 ? 587  ILE A O     1 
ATOM   4540  C CB    . ILE A 1 587 ? -4.501  42.694  33.792  1.00 25.68 ? 587  ILE A CB    1 
ATOM   4541  C CG1   . ILE A 1 587 ? -4.430  42.093  35.211  1.00 24.74 ? 587  ILE A CG1   1 
ATOM   4542  C CG2   . ILE A 1 587 ? -4.152  41.613  32.794  1.00 25.01 ? 587  ILE A CG2   1 
ATOM   4543  C CD1   . ILE A 1 587 ? -5.668  41.332  35.647  1.00 20.54 ? 587  ILE A CD1   1 
ATOM   4544  N N     . GLY A 1 588 ? -4.647  44.964  31.793  1.00 26.18 ? 588  GLY A N     1 
ATOM   4545  C CA    . GLY A 1 588 ? -4.779  45.549  30.469  1.00 25.47 ? 588  GLY A CA    1 
ATOM   4546  C C     . GLY A 1 588 ? -6.237  45.592  30.072  1.00 25.12 ? 588  GLY A C     1 
ATOM   4547  O O     . GLY A 1 588 ? -7.057  44.922  30.701  1.00 24.54 ? 588  GLY A O     1 
ATOM   4548  N N     . PRO A 1 589 ? -6.565  46.404  29.044  1.00 25.14 ? 589  PRO A N     1 
ATOM   4549  C CA    . PRO A 1 589 ? -7.921  46.478  28.497  1.00 25.56 ? 589  PRO A CA    1 
ATOM   4550  C C     . PRO A 1 589 ? -8.525  45.101  28.367  1.00 26.03 ? 589  PRO A C     1 
ATOM   4551  O O     . PRO A 1 589 ? -9.712  44.934  28.616  1.00 26.48 ? 589  PRO A O     1 
ATOM   4552  C CB    . PRO A 1 589 ? -7.716  47.099  27.108  1.00 24.91 ? 589  PRO A CB    1 
ATOM   4553  C CG    . PRO A 1 589 ? -6.486  47.962  27.272  1.00 25.24 ? 589  PRO A CG    1 
ATOM   4554  C CD    . PRO A 1 589 ? -5.641  47.336  28.356  1.00 25.09 ? 589  PRO A CD    1 
ATOM   4555  N N     . LEU A 1 590 ? -7.697  44.113  28.030  1.00 26.77 ? 590  LEU A N     1 
ATOM   4556  C CA    . LEU A 1 590 ? -8.172  42.745  27.761  1.00 27.23 ? 590  LEU A CA    1 
ATOM   4557  C C     . LEU A 1 590 ? -8.907  42.132  28.951  1.00 27.21 ? 590  LEU A C     1 
ATOM   4558  O O     . LEU A 1 590 ? -9.747  41.254  28.751  1.00 27.69 ? 590  LEU A O     1 
ATOM   4559  C CB    . LEU A 1 590 ? -7.019  41.831  27.288  1.00 27.57 ? 590  LEU A CB    1 
ATOM   4560  C CG    . LEU A 1 590 ? -5.832  41.480  28.220  1.00 28.07 ? 590  LEU A CG    1 
ATOM   4561  C CD1   . LEU A 1 590 ? -5.093  40.278  27.716  1.00 28.64 ? 590  LEU A CD1   1 
ATOM   4562  C CD2   . LEU A 1 590 ? -4.842  42.633  28.337  1.00 29.63 ? 590  LEU A CD2   1 
ATOM   4563  N N     . ALA A 1 591 ? -8.608  42.611  30.168  1.00 26.76 ? 591  ALA A N     1 
ATOM   4564  C CA    . ALA A 1 591 ? -9.144  42.027  31.406  1.00 26.78 ? 591  ALA A CA    1 
ATOM   4565  C C     . ALA A 1 591 ? -10.220 42.890  32.071  1.00 27.37 ? 591  ALA A C     1 
ATOM   4566  O O     . ALA A 1 591 ? -10.740 42.536  33.145  1.00 27.62 ? 591  ALA A O     1 
ATOM   4567  C CB    . ALA A 1 591 ? -8.019  41.699  32.412  1.00 25.43 ? 591  ALA A CB    1 
ATOM   4568  N N     . THR A 1 592 ? -10.549 44.023  31.457  1.00 28.03 ? 592  THR A N     1 
ATOM   4569  C CA    . THR A 1 592 ? -11.570 44.894  32.033  1.00 28.78 ? 592  THR A CA    1 
ATOM   4570  C C     . THR A 1 592 ? -12.892 44.102  32.133  1.00 29.34 ? 592  THR A C     1 
ATOM   4571  O O     . THR A 1 592 ? -13.328 43.526  31.141  1.00 29.21 ? 592  THR A O     1 
ATOM   4572  C CB    . THR A 1 592 ? -11.785 46.175  31.209  1.00 27.91 ? 592  THR A CB    1 
ATOM   4573  O OG1   . THR A 1 592 ? -10.544 46.861  31.044  1.00 29.40 ? 592  THR A OG1   1 
ATOM   4574  C CG2   . THR A 1 592 ? -12.747 47.111  31.930  1.00 28.74 ? 592  THR A CG2   1 
ATOM   4575  N N     . PRO A 1 593 ? -13.500 44.049  33.338  1.00 29.99 ? 593  PRO A N     1 
ATOM   4576  C CA    . PRO A 1 593 ? -14.795 43.400  33.532  1.00 30.88 ? 593  PRO A CA    1 
ATOM   4577  C C     . PRO A 1 593 ? -15.937 44.132  32.846  1.00 31.86 ? 593  PRO A C     1 
ATOM   4578  O O     . PRO A 1 593 ? -16.064 45.354  32.975  1.00 32.63 ? 593  PRO A O     1 
ATOM   4579  C CB    . PRO A 1 593 ? -14.991 43.460  35.052  1.00 30.59 ? 593  PRO A CB    1 
ATOM   4580  C CG    . PRO A 1 593 ? -13.640 43.731  35.602  1.00 29.83 ? 593  PRO A CG    1 
ATOM   4581  C CD    . PRO A 1 593 ? -12.974 44.571  34.613  1.00 29.87 ? 593  PRO A CD    1 
ATOM   4582  N N     . ASP A 1 594 ? -16.768 43.385  32.130  1.00 32.24 ? 594  ASP A N     1 
ATOM   4583  C CA    . ASP A 1 594 ? -17.934 43.953  31.471  1.00 32.32 ? 594  ASP A CA    1 
ATOM   4584  C C     . ASP A 1 594 ? -19.037 44.365  32.469  1.00 32.37 ? 594  ASP A C     1 
ATOM   4585  O O     . ASP A 1 594 ? -19.766 45.342  32.231  1.00 32.85 ? 594  ASP A O     1 
ATOM   4586  C CB    . ASP A 1 594 ? -18.476 42.950  30.459  1.00 32.75 ? 594  ASP A CB    1 
ATOM   4587  C CG    . ASP A 1 594 ? -17.433 42.549  29.428  1.00 34.93 ? 594  ASP A CG    1 
ATOM   4588  O OD1   . ASP A 1 594 ? -17.458 43.173  28.343  1.00 36.43 ? 594  ASP A OD1   1 
ATOM   4589  O OD2   . ASP A 1 594 ? -16.595 41.633  29.702  1.00 34.53 ? 594  ASP A OD2   1 
ATOM   4590  N N     . VAL A 1 595 ? -19.154 43.606  33.564  1.00 31.31 ? 595  VAL A N     1 
ATOM   4591  C CA    . VAL A 1 595 ? -20.178 43.805  34.598  1.00 29.93 ? 595  VAL A CA    1 
ATOM   4592  C C     . VAL A 1 595 ? -19.521 43.797  35.986  1.00 29.45 ? 595  VAL A C     1 
ATOM   4593  O O     . VAL A 1 595 ? -18.631 42.971  36.278  1.00 28.70 ? 595  VAL A O     1 
ATOM   4594  C CB    . VAL A 1 595 ? -21.285 42.691  34.545  1.00 29.96 ? 595  VAL A CB    1 
ATOM   4595  C CG1   . VAL A 1 595 ? -22.324 42.886  35.624  1.00 29.51 ? 595  VAL A CG1   1 
ATOM   4596  C CG2   . VAL A 1 595 ? -21.960 42.643  33.161  1.00 29.78 ? 595  VAL A CG2   1 
ATOM   4597  N N     . LEU A 1 596 ? -19.958 44.734  36.824  1.00 28.70 ? 596  LEU A N     1 
ATOM   4598  C CA    . LEU A 1 596 ? -19.577 44.785  38.222  1.00 28.28 ? 596  LEU A CA    1 
ATOM   4599  C C     . LEU A 1 596 ? -20.844 44.637  39.035  1.00 28.65 ? 596  LEU A C     1 
ATOM   4600  O O     . LEU A 1 596 ? -21.756 45.465  38.945  1.00 29.00 ? 596  LEU A O     1 
ATOM   4601  C CB    . LEU A 1 596 ? -18.862 46.085  38.574  1.00 27.70 ? 596  LEU A CB    1 
ATOM   4602  C CG    . LEU A 1 596 ? -17.448 46.296  38.005  1.00 27.79 ? 596  LEU A CG    1 
ATOM   4603  C CD1   . LEU A 1 596 ? -17.020 47.711  38.260  1.00 25.15 ? 596  LEU A CD1   1 
ATOM   4604  C CD2   . LEU A 1 596 ? -16.429 45.326  38.588  1.00 27.36 ? 596  LEU A CD2   1 
ATOM   4605  N N     . HIS A 1 597 ? -20.887 43.565  39.815  1.00 28.28 ? 597  HIS A N     1 
ATOM   4606  C CA    . HIS A 1 597 ? -22.030 43.224  40.624  1.00 28.23 ? 597  HIS A CA    1 
ATOM   4607  C C     . HIS A 1 597 ? -21.683 43.515  42.095  1.00 28.62 ? 597  HIS A C     1 
ATOM   4608  O O     . HIS A 1 597 ? -21.071 42.682  42.787  1.00 28.40 ? 597  HIS A O     1 
ATOM   4609  C CB    . HIS A 1 597 ? -22.372 41.739  40.392  1.00 28.16 ? 597  HIS A CB    1 
ATOM   4610  C CG    . HIS A 1 597 ? -23.613 41.264  41.090  1.00 26.87 ? 597  HIS A CG    1 
ATOM   4611  N ND1   . HIS A 1 597 ? -24.579 40.515  40.454  1.00 26.76 ? 597  HIS A ND1   1 
ATOM   4612  C CD2   . HIS A 1 597 ? -24.032 41.405  42.371  1.00 24.84 ? 597  HIS A CD2   1 
ATOM   4613  C CE1   . HIS A 1 597 ? -25.542 40.222  41.312  1.00 24.60 ? 597  HIS A CE1   1 
ATOM   4614  N NE2   . HIS A 1 597 ? -25.226 40.742  42.484  1.00 22.82 ? 597  HIS A NE2   1 
ATOM   4615  N N     . TRP A 1 598 ? -22.070 44.707  42.552  1.00 28.41 ? 598  TRP A N     1 
ATOM   4616  C CA    . TRP A 1 598 ? -21.935 45.107  43.944  1.00 28.61 ? 598  TRP A CA    1 
ATOM   4617  C C     . TRP A 1 598 ? -22.740 44.167  44.846  1.00 28.77 ? 598  TRP A C     1 
ATOM   4618  O O     . TRP A 1 598 ? -23.954 44.036  44.663  1.00 28.67 ? 598  TRP A O     1 
ATOM   4619  C CB    . TRP A 1 598 ? -22.432 46.548  44.120  1.00 29.12 ? 598  TRP A CB    1 
ATOM   4620  C CG    . TRP A 1 598 ? -21.854 47.565  43.137  1.00 29.12 ? 598  TRP A CG    1 
ATOM   4621  C CD1   . TRP A 1 598 ? -22.562 48.398  42.303  1.00 29.58 ? 598  TRP A CD1   1 
ATOM   4622  C CD2   . TRP A 1 598 ? -20.465 47.855  42.905  1.00 28.53 ? 598  TRP A CD2   1 
ATOM   4623  N NE1   . TRP A 1 598 ? -21.698 49.184  41.562  1.00 30.06 ? 598  TRP A NE1   1 
ATOM   4624  C CE2   . TRP A 1 598 ? -20.409 48.872  41.911  1.00 29.70 ? 598  TRP A CE2   1 
ATOM   4625  C CE3   . TRP A 1 598 ? -19.265 47.349  43.428  1.00 27.83 ? 598  TRP A CE3   1 
ATOM   4626  C CZ2   . TRP A 1 598 ? -19.200 49.397  41.443  1.00 29.42 ? 598  TRP A CZ2   1 
ATOM   4627  C CZ3   . TRP A 1 598 ? -18.066 47.859  42.961  1.00 29.00 ? 598  TRP A CZ3   1 
ATOM   4628  C CH2   . TRP A 1 598 ? -18.040 48.875  41.974  1.00 29.66 ? 598  TRP A CH2   1 
ATOM   4629  N N     . THR A 1 599 ? -22.076 43.503  45.795  1.00 28.78 ? 599  THR A N     1 
ATOM   4630  C CA    . THR A 1 599 ? -22.770 42.574  46.706  1.00 29.32 ? 599  THR A CA    1 
ATOM   4631  C C     . THR A 1 599 ? -22.149 42.403  48.105  1.00 30.00 ? 599  THR A C     1 
ATOM   4632  O O     . THR A 1 599 ? -20.935 42.519  48.254  1.00 29.98 ? 599  THR A O     1 
ATOM   4633  C CB    . THR A 1 599 ? -22.948 41.187  46.058  1.00 28.81 ? 599  THR A CB    1 
ATOM   4634  O OG1   . THR A 1 599 ? -24.030 40.512  46.695  1.00 28.08 ? 599  THR A OG1   1 
ATOM   4635  C CG2   . THR A 1 599 ? -21.675 40.332  46.165  1.00 29.54 ? 599  THR A CG2   1 
ATOM   4636  N N     . ASP A 1 600 ? -22.979 42.134  49.119  1.00 30.82 ? 600  ASP A N     1 
ATOM   4637  C CA    . ASP A 1 600 ? -22.476 41.626  50.420  1.00 32.15 ? 600  ASP A CA    1 
ATOM   4638  C C     . ASP A 1 600 ? -22.879 40.153  50.638  1.00 32.51 ? 600  ASP A C     1 
ATOM   4639  O O     . ASP A 1 600 ? -22.662 39.572  51.723  1.00 32.93 ? 600  ASP A O     1 
ATOM   4640  C CB    . ASP A 1 600 ? -22.935 42.508  51.611  1.00 32.47 ? 600  ASP A CB    1 
ATOM   4641  C CG    . ASP A 1 600 ? -22.483 43.984  51.481  1.00 34.10 ? 600  ASP A CG    1 
ATOM   4642  O OD1   . ASP A 1 600 ? -21.290 44.251  51.176  1.00 34.94 ? 600  ASP A OD1   1 
ATOM   4643  O OD2   . ASP A 1 600 ? -23.327 44.886  51.692  1.00 34.76 ? 600  ASP A OD2   1 
ATOM   4644  N N     . SER A 1 601 ? -23.448 39.561  49.589  1.00 32.73 ? 601  SER A N     1 
ATOM   4645  C CA    . SER A 1 601 ? -24.027 38.222  49.611  1.00 33.04 ? 601  SER A CA    1 
ATOM   4646  C C     . SER A 1 601 ? -23.218 37.124  48.877  1.00 33.71 ? 601  SER A C     1 
ATOM   4647  O O     . SER A 1 601 ? -23.817 36.237  48.248  1.00 33.85 ? 601  SER A O     1 
ATOM   4648  C CB    . SER A 1 601 ? -25.431 38.285  49.002  1.00 33.18 ? 601  SER A CB    1 
ATOM   4649  O OG    . SER A 1 601 ? -26.357 38.892  49.872  1.00 32.97 ? 601  SER A OG    1 
ATOM   4650  N N     . LEU A 1 602 ? -21.880 37.166  48.943  1.00 33.92 ? 602  LEU A N     1 
ATOM   4651  C CA    . LEU A 1 602 ? -21.062 36.081  48.381  1.00 33.47 ? 602  LEU A CA    1 
ATOM   4652  C C     . LEU A 1 602 ? -21.362 34.760  49.097  1.00 33.91 ? 602  LEU A C     1 
ATOM   4653  O O     . LEU A 1 602 ? -21.273 34.684  50.334  1.00 33.99 ? 602  LEU A O     1 
ATOM   4654  C CB    . LEU A 1 602 ? -19.561 36.408  48.439  1.00 33.27 ? 602  LEU A CB    1 
ATOM   4655  C CG    . LEU A 1 602 ? -18.934 37.368  47.405  1.00 32.56 ? 602  LEU A CG    1 
ATOM   4656  C CD1   . LEU A 1 602 ? -17.444 37.545  47.663  1.00 30.85 ? 602  LEU A CD1   1 
ATOM   4657  C CD2   . LEU A 1 602 ? -19.167 36.924  45.962  1.00 30.86 ? 602  LEU A CD2   1 
ATOM   4658  N N     . PRO A 1 603 ? -21.736 33.719  48.327  1.00 34.35 ? 603  PRO A N     1 
ATOM   4659  C CA    . PRO A 1 603 ? -22.143 32.426  48.880  1.00 34.93 ? 603  PRO A CA    1 
ATOM   4660  C C     . PRO A 1 603 ? -20.962 31.582  49.355  1.00 35.40 ? 603  PRO A C     1 
ATOM   4661  O O     . PRO A 1 603 ? -20.185 31.075  48.551  1.00 35.71 ? 603  PRO A O     1 
ATOM   4662  C CB    . PRO A 1 603 ? -22.849 31.756  47.700  1.00 34.70 ? 603  PRO A CB    1 
ATOM   4663  C CG    . PRO A 1 603 ? -22.169 32.298  46.516  1.00 34.56 ? 603  PRO A CG    1 
ATOM   4664  C CD    . PRO A 1 603 ? -21.788 33.714  46.854  1.00 34.56 ? 603  PRO A CD    1 
ATOM   4665  N N     . LYS A 1 604 ? -20.836 31.444  50.662  1.00 36.38 ? 604  LYS A N     1 
ATOM   4666  C CA    . LYS A 1 604 ? -19.717 30.728  51.253  1.00 37.49 ? 604  LYS A CA    1 
ATOM   4667  C C     . LYS A 1 604 ? -20.199 29.529  52.047  1.00 37.78 ? 604  LYS A C     1 
ATOM   4668  O O     . LYS A 1 604 ? -21.213 29.608  52.727  1.00 37.80 ? 604  LYS A O     1 
ATOM   4669  C CB    . LYS A 1 604 ? -18.901 31.657  52.159  1.00 37.63 ? 604  LYS A CB    1 
ATOM   4670  C CG    . LYS A 1 604 ? -18.164 32.767  51.404  1.00 39.14 ? 604  LYS A CG    1 
ATOM   4671  C CD    . LYS A 1 604 ? -17.702 33.867  52.362  1.00 42.14 ? 604  LYS A CD    1 
ATOM   4672  C CE    . LYS A 1 604 ? -16.770 34.854  51.679  1.00 42.65 ? 604  LYS A CE    1 
ATOM   4673  N NZ    . LYS A 1 604 ? -15.585 35.086  52.556  1.00 43.14 ? 604  LYS A NZ    1 
ATOM   4674  N N     . THR A 1 605 ? -19.472 28.418  51.940  1.00 38.47 ? 605  THR A N     1 
ATOM   4675  C CA    . THR A 1 605 ? -19.655 27.279  52.829  1.00 39.06 ? 605  THR A CA    1 
ATOM   4676  C C     . THR A 1 605 ? -19.336 27.736  54.248  1.00 39.64 ? 605  THR A C     1 
ATOM   4677  O O     . THR A 1 605 ? -18.693 28.777  54.449  1.00 39.59 ? 605  THR A O     1 
ATOM   4678  C CB    . THR A 1 605 ? -18.739 26.098  52.452  1.00 38.76 ? 605  THR A CB    1 
ATOM   4679  N N     . ARG A 1 606 ? -19.813 26.970  55.227  1.00 40.52 ? 606  ARG A N     1 
ATOM   4680  C CA    . ARG A 1 606 ? -19.435 27.178  56.624  1.00 41.26 ? 606  ARG A CA    1 
ATOM   4681  C C     . ARG A 1 606 ? -17.897 27.152  56.764  1.00 41.55 ? 606  ARG A C     1 
ATOM   4682  O O     . ARG A 1 606 ? -17.315 27.957  57.499  1.00 41.62 ? 606  ARG A O     1 
ATOM   4683  C CB    . ARG A 1 606 ? -20.115 26.139  57.529  1.00 41.17 ? 606  ARG A CB    1 
ATOM   4684  N N     . SER A 1 607 ? -17.256 26.254  56.015  1.00 41.87 ? 607  SER A N     1 
ATOM   4685  C CA    . SER A 1 607 ? -15.795 26.167  55.948  1.00 42.42 ? 607  SER A CA    1 
ATOM   4686  C C     . SER A 1 607 ? -15.096 27.399  55.327  1.00 42.51 ? 607  SER A C     1 
ATOM   4687  O O     . SER A 1 607 ? -13.871 27.546  55.441  1.00 42.38 ? 607  SER A O     1 
ATOM   4688  C CB    . SER A 1 607 ? -15.388 24.904  55.187  1.00 42.46 ? 607  SER A CB    1 
ATOM   4689  O OG    . SER A 1 607 ? -15.780 24.991  53.830  1.00 43.41 ? 607  SER A OG    1 
ATOM   4690  N N     . GLY A 1 608 ? -15.866 28.267  54.668  1.00 42.68 ? 608  GLY A N     1 
ATOM   4691  C CA    . GLY A 1 608 ? -15.317 29.487  54.065  1.00 42.44 ? 608  GLY A CA    1 
ATOM   4692  C C     . GLY A 1 608 ? -15.222 29.441  52.549  1.00 42.49 ? 608  GLY A C     1 
ATOM   4693  O O     . GLY A 1 608 ? -14.953 30.471  51.909  1.00 42.51 ? 608  GLY A O     1 
ATOM   4694  N N     . LYS A 1 609 ? -15.455 28.260  51.966  1.00 42.16 ? 609  LYS A N     1 
ATOM   4695  C CA    . LYS A 1 609 ? -15.400 28.086  50.504  1.00 42.00 ? 609  LYS A CA    1 
ATOM   4696  C C     . LYS A 1 609 ? -16.431 28.956  49.759  1.00 41.88 ? 609  LYS A C     1 
ATOM   4697  O O     . LYS A 1 609 ? -17.540 29.186  50.240  1.00 41.36 ? 609  LYS A O     1 
ATOM   4698  C CB    . LYS A 1 609 ? -15.567 26.609  50.129  1.00 41.79 ? 609  LYS A CB    1 
ATOM   4699  N N     . ILE A 1 610 ? -16.062 29.450  48.588  1.00 41.86 ? 610  ILE A N     1 
ATOM   4700  C CA    . ILE A 1 610 ? -17.018 30.214  47.782  1.00 42.39 ? 610  ILE A CA    1 
ATOM   4701  C C     . ILE A 1 610 ? -17.733 29.312  46.758  1.00 42.22 ? 610  ILE A C     1 
ATOM   4702  O O     . ILE A 1 610 ? -17.087 28.640  45.953  1.00 42.38 ? 610  ILE A O     1 
ATOM   4703  C CB    . ILE A 1 610 ? -16.361 31.480  47.139  1.00 42.38 ? 610  ILE A CB    1 
ATOM   4704  C CG1   . ILE A 1 610 ? -17.235 32.060  46.020  1.00 42.66 ? 610  ILE A CG1   1 
ATOM   4705  C CG2   . ILE A 1 610 ? -14.955 31.170  46.627  1.00 43.67 ? 610  ILE A CG2   1 
ATOM   4706  N N     . MET A 1 611 ? -19.064 29.286  46.816  1.00 42.12 ? 611  MET A N     1 
ATOM   4707  C CA    . MET A 1 611 ? -19.869 28.481  45.897  1.00 42.02 ? 611  MET A CA    1 
ATOM   4708  C C     . MET A 1 611 ? -19.827 29.148  44.546  1.00 41.73 ? 611  MET A C     1 
ATOM   4709  O O     . MET A 1 611 ? -20.661 30.009  44.251  1.00 42.35 ? 611  MET A O     1 
ATOM   4710  C CB    . MET A 1 611 ? -21.326 28.398  46.350  1.00 42.26 ? 611  MET A CB    1 
ATOM   4711  C CG    . MET A 1 611 ? -21.537 28.037  47.804  1.00 43.94 ? 611  MET A CG    1 
ATOM   4712  S SD    . MET A 1 611 ? -21.434 26.270  48.098  1.00 47.48 ? 611  MET A SD    1 
ATOM   4713  C CE    . MET A 1 611 ? -23.053 25.737  47.533  1.00 47.49 ? 611  MET A CE    1 
ATOM   4714  N N     . ARG A 1 612 ? -18.861 28.766  43.719  1.00 41.02 ? 612  ARG A N     1 
ATOM   4715  C CA    . ARG A 1 612 ? -18.657 29.457  42.454  1.00 40.37 ? 612  ARG A CA    1 
ATOM   4716  C C     . ARG A 1 612 ? -19.607 28.964  41.368  1.00 39.55 ? 612  ARG A C     1 
ATOM   4717  O O     . ARG A 1 612 ? -19.850 29.671  40.390  1.00 39.73 ? 612  ARG A O     1 
ATOM   4718  C CB    . ARG A 1 612 ? -17.203 29.346  41.994  1.00 40.41 ? 612  ARG A CB    1 
ATOM   4719  C CG    . ARG A 1 612 ? -16.156 29.882  42.984  1.00 40.98 ? 612  ARG A CG    1 
ATOM   4720  C CD    . ARG A 1 612 ? -14.746 29.763  42.388  1.00 41.33 ? 612  ARG A CD    1 
ATOM   4721  N NE    . ARG A 1 612 ? -14.821 30.062  40.960  1.00 45.03 ? 612  ARG A NE    1 
ATOM   4722  C CZ    . ARG A 1 612 ? -14.695 31.281  40.436  1.00 45.67 ? 612  ARG A CZ    1 
ATOM   4723  N NH1   . ARG A 1 612 ? -14.425 32.314  41.225  1.00 45.17 ? 612  ARG A NH1   1 
ATOM   4724  N NH2   . ARG A 1 612 ? -14.812 31.459  39.119  1.00 45.18 ? 612  ARG A NH2   1 
ATOM   4725  N N     . ARG A 1 613 ? -20.144 27.756  41.527  1.00 38.54 ? 613  ARG A N     1 
ATOM   4726  C CA    . ARG A 1 613 ? -21.118 27.242  40.558  1.00 37.63 ? 613  ARG A CA    1 
ATOM   4727  C C     . ARG A 1 613 ? -22.439 28.035  40.581  1.00 36.98 ? 613  ARG A C     1 
ATOM   4728  O O     . ARG A 1 613 ? -23.021 28.315  39.525  1.00 36.92 ? 613  ARG A O     1 
ATOM   4729  C CB    . ARG A 1 613 ? -21.358 25.734  40.720  1.00 37.45 ? 613  ARG A CB    1 
ATOM   4730  N N     . ILE A 1 614 ? -22.909 28.423  41.763  1.00 36.04 ? 614  ILE A N     1 
ATOM   4731  C CA    . ILE A 1 614 ? -24.157 29.162  41.786  1.00 35.57 ? 614  ILE A CA    1 
ATOM   4732  C C     . ILE A 1 614 ? -23.937 30.562  41.198  1.00 35.02 ? 614  ILE A C     1 
ATOM   4733  O O     . ILE A 1 614 ? -24.778 31.070  40.455  1.00 35.00 ? 614  ILE A O     1 
ATOM   4734  C CB    . ILE A 1 614 ? -24.911 29.111  43.164  1.00 35.72 ? 614  ILE A CB    1 
ATOM   4735  C CG1   . ILE A 1 614 ? -24.596 30.304  44.055  1.00 36.42 ? 614  ILE A CG1   1 
ATOM   4736  C CG2   . ILE A 1 614 ? -24.709 27.747  43.908  1.00 36.47 ? 614  ILE A CG2   1 
ATOM   4737  C CD1   . ILE A 1 614 ? -25.764 31.241  44.186  1.00 36.28 ? 614  ILE A CD1   1 
ATOM   4738  N N     . LEU A 1 615 ? -22.777 31.147  41.483  1.00 34.42 ? 615  LEU A N     1 
ATOM   4739  C CA    . LEU A 1 615 ? -22.400 32.450  40.941  1.00 33.91 ? 615  LEU A CA    1 
ATOM   4740  C C     . LEU A 1 615 ? -22.399 32.456  39.406  1.00 33.70 ? 615  LEU A C     1 
ATOM   4741  O O     . LEU A 1 615 ? -22.957 33.350  38.763  1.00 33.08 ? 615  LEU A O     1 
ATOM   4742  C CB    . LEU A 1 615 ? -21.039 32.869  41.494  1.00 33.44 ? 615  LEU A CB    1 
ATOM   4743  C CG    . LEU A 1 615 ? -21.034 33.148  43.003  1.00 34.49 ? 615  LEU A CG    1 
ATOM   4744  C CD1   . LEU A 1 615 ? -19.621 33.455  43.513  1.00 33.57 ? 615  LEU A CD1   1 
ATOM   4745  C CD2   . LEU A 1 615 ? -22.025 34.269  43.385  1.00 33.18 ? 615  LEU A CD2   1 
ATOM   4746  N N     . ARG A 1 616 ? -21.775 31.431  38.847  1.00 33.85 ? 616  ARG A N     1 
ATOM   4747  C CA    . ARG A 1 616 ? -21.769 31.179  37.422  1.00 34.66 ? 616  ARG A CA    1 
ATOM   4748  C C     . ARG A 1 616 ? -23.192 31.094  36.848  1.00 33.92 ? 616  ARG A C     1 
ATOM   4749  O O     . ARG A 1 616 ? -23.511 31.795  35.879  1.00 34.08 ? 616  ARG A O     1 
ATOM   4750  C CB    . ARG A 1 616 ? -21.006 29.881  37.151  1.00 35.27 ? 616  ARG A CB    1 
ATOM   4751  C CG    . ARG A 1 616 ? -20.559 29.727  35.703  1.00 39.71 ? 616  ARG A CG    1 
ATOM   4752  C CD    . ARG A 1 616 ? -19.508 28.622  35.550  1.00 45.55 ? 616  ARG A CD    1 
ATOM   4753  N NE    . ARG A 1 616 ? -18.283 28.909  36.308  1.00 47.55 ? 616  ARG A NE    1 
ATOM   4754  C CZ    . ARG A 1 616 ? -17.890 28.266  37.411  1.00 47.92 ? 616  ARG A CZ    1 
ATOM   4755  N NH1   . ARG A 1 616 ? -18.610 27.267  37.930  1.00 45.23 ? 616  ARG A NH1   1 
ATOM   4756  N NH2   . ARG A 1 616 ? -16.749 28.625  37.987  1.00 48.34 ? 616  ARG A NH2   1 
ATOM   4757  N N     . LYS A 1 617 ? -24.035 30.254  37.456  1.00 32.57 ? 617  LYS A N     1 
ATOM   4758  C CA    . LYS A 1 617 ? -25.427 30.099  37.030  1.00 31.90 ? 617  LYS A CA    1 
ATOM   4759  C C     . LYS A 1 617 ? -26.232 31.416  37.095  1.00 30.87 ? 617  LYS A C     1 
ATOM   4760  O O     . LYS A 1 617 ? -26.860 31.809  36.108  1.00 30.61 ? 617  LYS A O     1 
ATOM   4761  C CB    . LYS A 1 617 ? -26.124 28.962  37.806  1.00 32.07 ? 617  LYS A CB    1 
ATOM   4762  N N     . ILE A 1 618 ? -26.186 32.105  38.235  1.00 29.94 ? 618  ILE A N     1 
ATOM   4763  C CA    . ILE A 1 618 ? -26.870 33.402  38.394  1.00 28.93 ? 618  ILE A CA    1 
ATOM   4764  C C     . ILE A 1 618 ? -26.409 34.453  37.368  1.00 28.91 ? 618  ILE A C     1 
ATOM   4765  O O     . ILE A 1 618 ? -27.239 35.067  36.690  1.00 28.19 ? 618  ILE A O     1 
ATOM   4766  C CB    . ILE A 1 618 ? -26.755 33.937  39.840  1.00 28.97 ? 618  ILE A CB    1 
ATOM   4767  C CG1   . ILE A 1 618 ? -27.536 33.015  40.810  1.00 29.12 ? 618  ILE A CG1   1 
ATOM   4768  C CG2   . ILE A 1 618 ? -27.205 35.422  39.914  1.00 28.17 ? 618  ILE A CG2   1 
ATOM   4769  C CD1   . ILE A 1 618 ? -27.531 33.441  42.288  1.00 28.31 ? 618  ILE A CD1   1 
ATOM   4770  N N     . ALA A 1 619 ? -25.089 34.624  37.234  1.00 29.27 ? 619  ALA A N     1 
ATOM   4771  C CA    . ALA A 1 619 ? -24.510 35.537  36.230  1.00 29.82 ? 619  ALA A CA    1 
ATOM   4772  C C     . ALA A 1 619 ? -24.993 35.284  34.780  1.00 30.09 ? 619  ALA A C     1 
ATOM   4773  O O     . ALA A 1 619 ? -25.134 36.221  34.002  1.00 29.95 ? 619  ALA A O     1 
ATOM   4774  C CB    . ALA A 1 619 ? -22.984 35.521  36.300  1.00 29.76 ? 619  ALA A CB    1 
ATOM   4775  N N     . ALA A 1 620 ? -25.238 34.022  34.438  1.00 30.40 ? 620  ALA A N     1 
ATOM   4776  C CA    . ALA A 1 620 ? -25.787 33.650  33.142  1.00 31.21 ? 620  ALA A CA    1 
ATOM   4777  C C     . ALA A 1 620 ? -27.325 33.844  32.966  1.00 32.08 ? 620  ALA A C     1 
ATOM   4778  O O     . ALA A 1 620 ? -27.911 33.254  32.061  1.00 32.02 ? 620  ALA A O     1 
ATOM   4779  C CB    . ALA A 1 620 ? -25.392 32.214  32.820  1.00 31.06 ? 620  ALA A CB    1 
ATOM   4780  N N     . GLY A 1 621 ? -27.978 34.649  33.808  1.00 32.75 ? 621  GLY A N     1 
ATOM   4781  C CA    . GLY A 1 621 ? -29.410 34.937  33.628  1.00 33.73 ? 621  GLY A CA    1 
ATOM   4782  C C     . GLY A 1 621 ? -30.282 33.705  33.837  1.00 34.77 ? 621  GLY A C     1 
ATOM   4783  O O     . GLY A 1 621 ? -31.294 33.474  33.153  1.00 35.13 ? 621  GLY A O     1 
ATOM   4784  N N     . ASP A 1 622 ? -29.894 32.942  34.842  1.00 34.96 ? 622  ASP A N     1 
ATOM   4785  C CA    . ASP A 1 622 ? -30.348 31.609  35.054  1.00 35.04 ? 622  ASP A CA    1 
ATOM   4786  C C     . ASP A 1 622 ? -31.017 31.653  36.449  1.00 35.30 ? 622  ASP A C     1 
ATOM   4787  O O     . ASP A 1 622 ? -30.420 32.078  37.441  1.00 35.44 ? 622  ASP A O     1 
ATOM   4788  C CB    . ASP A 1 622 ? -29.088 30.756  34.930  1.00 35.15 ? 622  ASP A CB    1 
ATOM   4789  C CG    . ASP A 1 622 ? -29.301 29.304  35.188  1.00 35.85 ? 622  ASP A CG    1 
ATOM   4790  O OD1   . ASP A 1 622 ? -28.375 28.539  34.814  1.00 35.13 ? 622  ASP A OD1   1 
ATOM   4791  O OD2   . ASP A 1 622 ? -30.342 28.922  35.773  1.00 37.24 ? 622  ASP A OD2   1 
ATOM   4792  N N     . THR A 1 623 ? -32.286 31.265  36.502  1.00 35.40 ? 623  THR A N     1 
ATOM   4793  C CA    . THR A 1 623 ? -33.156 31.595  37.643  1.00 35.52 ? 623  THR A CA    1 
ATOM   4794  C C     . THR A 1 623 ? -33.620 30.403  38.528  1.00 35.11 ? 623  THR A C     1 
ATOM   4795  O O     . THR A 1 623 ? -34.372 30.588  39.484  1.00 34.50 ? 623  THR A O     1 
ATOM   4796  C CB    . THR A 1 623 ? -34.367 32.478  37.161  1.00 35.75 ? 623  THR A CB    1 
ATOM   4797  O OG1   . THR A 1 623 ? -35.310 32.649  38.222  1.00 35.88 ? 623  THR A OG1   1 
ATOM   4798  C CG2   . THR A 1 623 ? -35.082 31.846  35.931  1.00 36.77 ? 623  THR A CG2   1 
ATOM   4799  N N     . SER A 1 624 ? -33.153 29.196  38.201  1.00 35.17 ? 624  SER A N     1 
ATOM   4800  C CA    . SER A 1 624 ? -33.402 27.983  38.994  1.00 35.29 ? 624  SER A CA    1 
ATOM   4801  C C     . SER A 1 624 ? -32.460 26.838  38.591  1.00 35.69 ? 624  SER A C     1 
ATOM   4802  O O     . SER A 1 624 ? -32.004 26.061  39.438  1.00 36.17 ? 624  SER A O     1 
ATOM   4803  C CB    . SER A 1 624 ? -34.865 27.541  38.893  1.00 35.25 ? 624  SER A CB    1 
ATOM   4804  O OG    . SER A 1 624 ? -35.388 27.770  37.597  1.00 34.09 ? 624  SER A OG    1 
ATOM   4805  N N     . ALA A 1 633 ? -23.974 28.183  54.040  1.00 37.54 ? 633  ALA A N     1 
ATOM   4806  C CA    . ALA A 1 633 ? -23.818 28.767  55.381  1.00 37.98 ? 633  ALA A CA    1 
ATOM   4807  C C     . ALA A 1 633 ? -24.978 29.691  55.785  1.00 38.34 ? 633  ALA A C     1 
ATOM   4808  O O     . ALA A 1 633 ? -25.673 29.431  56.785  1.00 38.55 ? 633  ALA A O     1 
ATOM   4809  C CB    . ALA A 1 633 ? -22.488 29.494  55.504  1.00 37.70 ? 633  ALA A CB    1 
ATOM   4810  N N     . ASP A 1 634 ? -25.154 30.781  55.029  1.00 38.34 ? 634  ASP A N     1 
ATOM   4811  C CA    . ASP A 1 634 ? -26.376 31.604  55.080  1.00 37.99 ? 634  ASP A CA    1 
ATOM   4812  C C     . ASP A 1 634 ? -27.110 31.476  53.734  1.00 37.42 ? 634  ASP A C     1 
ATOM   4813  O O     . ASP A 1 634 ? -26.740 32.151  52.769  1.00 37.76 ? 634  ASP A O     1 
ATOM   4814  C CB    . ASP A 1 634 ? -26.030 33.075  55.373  1.00 38.17 ? 634  ASP A CB    1 
ATOM   4815  C CG    . ASP A 1 634 ? -27.247 34.003  55.293  1.00 37.77 ? 634  ASP A CG    1 
ATOM   4816  O OD1   . ASP A 1 634 ? -28.378 33.555  55.590  1.00 37.29 ? 634  ASP A OD1   1 
ATOM   4817  O OD2   . ASP A 1 634 ? -27.065 35.188  54.935  1.00 36.45 ? 634  ASP A OD2   1 
ATOM   4818  N N     . PRO A 1 635 ? -28.146 30.613  53.668  1.00 36.63 ? 635  PRO A N     1 
ATOM   4819  C CA    . PRO A 1 635 ? -28.818 30.243  52.404  1.00 36.08 ? 635  PRO A CA    1 
ATOM   4820  C C     . PRO A 1 635 ? -29.538 31.391  51.675  1.00 35.46 ? 635  PRO A C     1 
ATOM   4821  O O     . PRO A 1 635 ? -29.714 31.328  50.451  1.00 35.32 ? 635  PRO A O     1 
ATOM   4822  C CB    . PRO A 1 635 ? -29.843 29.175  52.835  1.00 36.10 ? 635  PRO A CB    1 
ATOM   4823  C CG    . PRO A 1 635 ? -29.425 28.739  54.215  1.00 36.50 ? 635  PRO A CG    1 
ATOM   4824  C CD    . PRO A 1 635 ? -28.751 29.934  54.829  1.00 36.83 ? 635  PRO A CD    1 
ATOM   4825  N N     . GLY A 1 636 ? -29.944 32.417  52.419  1.00 34.71 ? 636  GLY A N     1 
ATOM   4826  C CA    . GLY A 1 636 ? -30.706 33.535  51.872  1.00 33.77 ? 636  GLY A CA    1 
ATOM   4827  C C     . GLY A 1 636 ? -29.901 34.507  51.032  1.00 33.49 ? 636  GLY A C     1 
ATOM   4828  O O     . GLY A 1 636 ? -30.458 35.464  50.502  1.00 33.70 ? 636  GLY A O     1 
ATOM   4829  N N     . VAL A 1 637 ? -28.592 34.283  50.905  1.00 33.05 ? 637  VAL A N     1 
ATOM   4830  C CA    . VAL A 1 637 ? -27.762 35.083  49.977  1.00 32.43 ? 637  VAL A CA    1 
ATOM   4831  C C     . VAL A 1 637 ? -28.110 34.830  48.501  1.00 32.11 ? 637  VAL A C     1 
ATOM   4832  O O     . VAL A 1 637 ? -28.122 35.752  47.698  1.00 31.71 ? 637  VAL A O     1 
ATOM   4833  C CB    . VAL A 1 637 ? -26.225 34.890  50.193  1.00 32.20 ? 637  VAL A CB    1 
ATOM   4834  C CG1   . VAL A 1 637 ? -25.803 35.415  51.553  1.00 32.07 ? 637  VAL A CG1   1 
ATOM   4835  C CG2   . VAL A 1 637 ? -25.801 33.435  49.996  1.00 31.78 ? 637  VAL A CG2   1 
ATOM   4836  N N     . VAL A 1 638 ? -28.405 33.574  48.168  1.00 32.28 ? 638  VAL A N     1 
ATOM   4837  C CA    . VAL A 1 638 ? -28.810 33.185  46.816  1.00 32.37 ? 638  VAL A CA    1 
ATOM   4838  C C     . VAL A 1 638 ? -29.932 34.088  46.300  1.00 32.40 ? 638  VAL A C     1 
ATOM   4839  O O     . VAL A 1 638 ? -29.831 34.648  45.207  1.00 32.70 ? 638  VAL A O     1 
ATOM   4840  C CB    . VAL A 1 638 ? -29.280 31.698  46.742  1.00 32.38 ? 638  VAL A CB    1 
ATOM   4841  C CG1   . VAL A 1 638 ? -29.596 31.304  45.283  1.00 32.31 ? 638  VAL A CG1   1 
ATOM   4842  C CG2   . VAL A 1 638 ? -28.244 30.752  47.348  1.00 31.25 ? 638  VAL A CG2   1 
ATOM   4843  N N     . GLU A 1 639 ? -30.984 34.233  47.099  1.00 32.26 ? 639  GLU A N     1 
ATOM   4844  C CA    . GLU A 1 639 ? -32.144 35.034  46.722  1.00 32.22 ? 639  GLU A CA    1 
ATOM   4845  C C     . GLU A 1 639 ? -31.803 36.522  46.555  1.00 31.87 ? 639  GLU A C     1 
ATOM   4846  O O     . GLU A 1 639 ? -32.350 37.186  45.668  1.00 31.56 ? 639  GLU A O     1 
ATOM   4847  C CB    . GLU A 1 639 ? -33.297 34.828  47.725  1.00 32.51 ? 639  GLU A CB    1 
ATOM   4848  N N     . LYS A 1 640 ? -30.898 37.023  47.406  1.00 31.57 ? 640  LYS A N     1 
ATOM   4849  C CA    . LYS A 1 640 ? -30.444 38.423  47.365  1.00 31.01 ? 640  LYS A CA    1 
ATOM   4850  C C     . LYS A 1 640 ? -29.618 38.631  46.104  1.00 30.73 ? 640  LYS A C     1 
ATOM   4851  O O     . LYS A 1 640 ? -29.747 39.663  45.430  1.00 31.31 ? 640  LYS A O     1 
ATOM   4852  C CB    . LYS A 1 640 ? -29.637 38.804  48.620  1.00 30.48 ? 640  LYS A CB    1 
ATOM   4853  N N     . LEU A 1 641 ? -28.790 37.638  45.781  1.00 30.10 ? 641  LEU A N     1 
ATOM   4854  C CA    . LEU A 1 641 ? -27.993 37.653  44.556  1.00 29.44 ? 641  LEU A CA    1 
ATOM   4855  C C     . LEU A 1 641 ? -28.854 37.705  43.273  1.00 29.66 ? 641  LEU A C     1 
ATOM   4856  O O     . LEU A 1 641 ? -28.540 38.463  42.365  1.00 29.58 ? 641  LEU A O     1 
ATOM   4857  C CB    . LEU A 1 641 ? -27.002 36.484  44.534  1.00 29.07 ? 641  LEU A CB    1 
ATOM   4858  C CG    . LEU A 1 641 ? -25.869 36.438  45.569  1.00 27.85 ? 641  LEU A CG    1 
ATOM   4859  C CD1   . LEU A 1 641 ? -25.249 35.037  45.610  1.00 26.84 ? 641  LEU A CD1   1 
ATOM   4860  C CD2   . LEU A 1 641 ? -24.796 37.488  45.308  1.00 26.83 ? 641  LEU A CD2   1 
ATOM   4861  N N     . LEU A 1 642 ? -29.933 36.921  43.222  1.00 30.02 ? 642  LEU A N     1 
ATOM   4862  C CA    . LEU A 1 642 ? -30.934 36.990  42.140  1.00 30.87 ? 642  LEU A CA    1 
ATOM   4863  C C     . LEU A 1 642 ? -31.624 38.351  41.954  1.00 31.63 ? 642  LEU A C     1 
ATOM   4864  O O     . LEU A 1 642 ? -31.821 38.795  40.825  1.00 31.68 ? 642  LEU A O     1 
ATOM   4865  C CB    . LEU A 1 642 ? -32.022 35.928  42.323  1.00 30.47 ? 642  LEU A CB    1 
ATOM   4866  C CG    . LEU A 1 642 ? -31.840 34.481  41.872  1.00 30.32 ? 642  LEU A CG    1 
ATOM   4867  C CD1   . LEU A 1 642 ? -33.067 33.714  42.311  1.00 29.97 ? 642  LEU A CD1   1 
ATOM   4868  C CD2   . LEU A 1 642 ? -31.670 34.355  40.364  1.00 30.12 ? 642  LEU A CD2   1 
ATOM   4869  N N     . GLU A 1 643 ? -32.026 38.988  43.051  1.00 32.92 ? 643  GLU A N     1 
ATOM   4870  C CA    . GLU A 1 643 ? -32.593 40.331  42.988  1.00 34.27 ? 643  GLU A CA    1 
ATOM   4871  C C     . GLU A 1 643 ? -31.571 41.333  42.479  1.00 35.16 ? 643  GLU A C     1 
ATOM   4872  O O     . GLU A 1 643 ? -31.873 42.149  41.596  1.00 35.55 ? 643  GLU A O     1 
ATOM   4873  C CB    . GLU A 1 643 ? -33.042 40.786  44.361  1.00 34.38 ? 643  GLU A CB    1 
ATOM   4874  C CG    . GLU A 1 643 ? -34.453 40.401  44.739  1.00 36.01 ? 643  GLU A CG    1 
ATOM   4875  C CD    . GLU A 1 643 ? -34.716 40.693  46.205  1.00 36.86 ? 643  GLU A CD    1 
ATOM   4876  O OE1   . GLU A 1 643 ? -35.659 40.094  46.767  1.00 36.58 ? 643  GLU A OE1   1 
ATOM   4877  O OE2   . GLU A 1 643 ? -33.963 41.512  46.791  1.00 36.40 ? 643  GLU A OE2   1 
ATOM   4878  N N     . GLU A 1 644 ? -30.365 41.282  43.042  1.00 35.83 ? 644  GLU A N     1 
ATOM   4879  C CA    . GLU A 1 644 ? -29.307 42.211  42.636  1.00 36.71 ? 644  GLU A CA    1 
ATOM   4880  C C     . GLU A 1 644 ? -29.026 42.101  41.135  1.00 37.49 ? 644  GLU A C     1 
ATOM   4881  O O     . GLU A 1 644 ? -28.959 43.120  40.445  1.00 37.89 ? 644  GLU A O     1 
ATOM   4882  C CB    . GLU A 1 644 ? -28.033 41.986  43.444  1.00 36.79 ? 644  GLU A CB    1 
ATOM   4883  C CG    . GLU A 1 644 ? -28.170 42.277  44.931  1.00 36.20 ? 644  GLU A CG    1 
ATOM   4884  C CD    . GLU A 1 644 ? -26.977 41.776  45.740  1.00 35.36 ? 644  GLU A CD    1 
ATOM   4885  O OE1   . GLU A 1 644 ? -26.145 41.019  45.190  1.00 29.60 ? 644  GLU A OE1   1 
ATOM   4886  O OE2   . GLU A 1 644 ? -26.888 42.147  46.931  1.00 33.59 ? 644  GLU A OE2   1 
ATOM   4887  N N     . LYS A 1 645 ? -28.894 40.866  40.643  1.00 38.22 ? 645  LYS A N     1 
ATOM   4888  C CA    . LYS A 1 645 ? -28.780 40.586  39.208  1.00 38.59 ? 645  LYS A CA    1 
ATOM   4889  C C     . LYS A 1 645 ? -29.905 41.265  38.429  1.00 39.32 ? 645  LYS A C     1 
ATOM   4890  O O     . LYS A 1 645 ? -29.637 42.009  37.484  1.00 39.88 ? 645  LYS A O     1 
ATOM   4891  C CB    . LYS A 1 645 ? -28.799 39.081  38.935  1.00 38.28 ? 645  LYS A CB    1 
ATOM   4892  C CG    . LYS A 1 645 ? -27.904 38.636  37.792  1.00 37.76 ? 645  LYS A CG    1 
ATOM   4893  C CD    . LYS A 1 645 ? -28.437 39.029  36.430  1.00 38.57 ? 645  LYS A CD    1 
ATOM   4894  C CE    . LYS A 1 645 ? -27.555 38.477  35.314  1.00 39.12 ? 645  LYS A CE    1 
ATOM   4895  N NZ    . LYS A 1 645 ? -28.062 38.822  33.953  1.00 37.82 ? 645  LYS A NZ    1 
ATOM   4896  N N     . GLN A 1 646 ? -31.153 41.035  38.833  1.00 39.70 ? 646  GLN A N     1 
ATOM   4897  C CA    . GLN A 1 646 ? -32.294 41.611  38.118  1.00 40.44 ? 646  GLN A CA    1 
ATOM   4898  C C     . GLN A 1 646 ? -32.145 43.132  37.951  1.00 40.67 ? 646  GLN A C     1 
ATOM   4899  O O     . GLN A 1 646 ? -32.437 43.681  36.891  1.00 40.67 ? 646  GLN A O     1 
ATOM   4900  C CB    . GLN A 1 646 ? -33.622 41.258  38.815  1.00 40.48 ? 646  GLN A CB    1 
ATOM   4901  N N     . ALA A 1 647 ? -31.651 43.794  38.996  1.00 41.07 ? 647  ALA A N     1 
ATOM   4902  C CA    . ALA A 1 647 ? -31.550 45.255  39.037  1.00 41.19 ? 647  ALA A CA    1 
ATOM   4903  C C     . ALA A 1 647 ? -30.323 45.842  38.298  1.00 41.34 ? 647  ALA A C     1 
ATOM   4904  O O     . ALA A 1 647 ? -29.723 45.210  37.413  1.00 41.44 ? 647  ALA A O     1 
ATOM   4905  C CB    . ALA A 1 647 ? -31.582 45.726  40.490  1.00 40.92 ? 647  ALA A CB    1 
ATOM   4906  N N     . HIS B 1 5   ? -31.928 67.820  47.587  1.00 54.89 ? 5    HIS B N     1 
ATOM   4907  C CA    . HIS B 1 5   ? -30.716 68.684  47.384  1.00 54.91 ? 5    HIS B CA    1 
ATOM   4908  C C     . HIS B 1 5   ? -30.938 69.789  46.324  1.00 53.41 ? 5    HIS B C     1 
ATOM   4909  O O     . HIS B 1 5   ? -31.324 69.495  45.184  1.00 53.50 ? 5    HIS B O     1 
ATOM   4910  C CB    . HIS B 1 5   ? -29.500 67.806  46.996  1.00 55.83 ? 5    HIS B CB    1 
ATOM   4911  C CG    . HIS B 1 5   ? -28.183 68.533  47.012  1.00 58.55 ? 5    HIS B CG    1 
ATOM   4912  N ND1   . HIS B 1 5   ? -27.033 67.977  47.538  1.00 61.14 ? 5    HIS B ND1   1 
ATOM   4913  C CD2   . HIS B 1 5   ? -27.833 69.765  46.565  1.00 59.82 ? 5    HIS B CD2   1 
ATOM   4914  C CE1   . HIS B 1 5   ? -26.036 68.837  47.419  1.00 62.05 ? 5    HIS B CE1   1 
ATOM   4915  N NE2   . HIS B 1 5   ? -26.495 69.931  46.833  1.00 61.55 ? 5    HIS B NE2   1 
ATOM   4916  N N     . LYS B 1 6   ? -30.690 71.045  46.711  1.00 51.26 ? 6    LYS B N     1 
ATOM   4917  C CA    . LYS B 1 6   ? -30.627 72.171  45.764  1.00 49.24 ? 6    LYS B CA    1 
ATOM   4918  C C     . LYS B 1 6   ? -29.193 72.693  45.551  1.00 47.60 ? 6    LYS B C     1 
ATOM   4919  O O     . LYS B 1 6   ? -28.355 72.689  46.464  1.00 47.90 ? 6    LYS B O     1 
ATOM   4920  C CB    . LYS B 1 6   ? -31.553 73.328  46.184  1.00 49.19 ? 6    LYS B CB    1 
ATOM   4921  C CG    . LYS B 1 6   ? -32.913 73.343  45.488  1.00 49.08 ? 6    LYS B CG    1 
ATOM   4922  C CD    . LYS B 1 6   ? -33.719 74.607  45.820  1.00 49.67 ? 6    LYS B CD    1 
ATOM   4923  C CE    . LYS B 1 6   ? -35.201 74.498  45.395  1.00 50.00 ? 6    LYS B CE    1 
ATOM   4924  N NZ    . LYS B 1 6   ? -35.959 75.802  45.470  1.00 49.39 ? 6    LYS B NZ    1 
ATOM   4925  N N     . HIS B 1 7   ? -28.914 73.135  44.334  1.00 44.87 ? 7    HIS B N     1 
ATOM   4926  C CA    . HIS B 1 7   ? -27.663 73.795  44.053  1.00 42.10 ? 7    HIS B CA    1 
ATOM   4927  C C     . HIS B 1 7   ? -27.945 75.286  44.007  1.00 40.74 ? 7    HIS B C     1 
ATOM   4928  O O     . HIS B 1 7   ? -28.684 75.758  43.125  1.00 40.35 ? 7    HIS B O     1 
ATOM   4929  C CB    . HIS B 1 7   ? -27.029 73.266  42.748  1.00 41.96 ? 7    HIS B CB    1 
ATOM   4930  C CG    . HIS B 1 7   ? -26.494 71.871  42.869  1.00 40.22 ? 7    HIS B CG    1 
ATOM   4931  N ND1   . HIS B 1 7   ? -25.253 71.596  43.396  1.00 37.75 ? 7    HIS B ND1   1 
ATOM   4932  C CD2   . HIS B 1 7   ? -27.052 70.671  42.576  1.00 39.17 ? 7    HIS B CD2   1 
ATOM   4933  C CE1   . HIS B 1 7   ? -25.062 70.288  43.412  1.00 38.23 ? 7    HIS B CE1   1 
ATOM   4934  N NE2   . HIS B 1 7   ? -26.135 69.703  42.910  1.00 38.22 ? 7    HIS B NE2   1 
ATOM   4935  N N     . ALA B 1 8   ? -27.375 76.005  44.978  1.00 38.75 ? 8    ALA B N     1 
ATOM   4936  C CA    . ALA B 1 8   ? -27.491 77.460  45.076  1.00 37.35 ? 8    ALA B CA    1 
ATOM   4937  C C     . ALA B 1 8   ? -26.688 78.179  43.996  1.00 36.42 ? 8    ALA B C     1 
ATOM   4938  O O     . ALA B 1 8   ? -25.680 77.661  43.491  1.00 36.33 ? 8    ALA B O     1 
ATOM   4939  C CB    . ALA B 1 8   ? -27.059 77.940  46.447  1.00 37.51 ? 8    ALA B CB    1 
ATOM   4940  N N     . ILE B 1 9   ? -27.141 79.380  43.652  1.00 34.98 ? 9    ILE B N     1 
ATOM   4941  C CA    . ILE B 1 9   ? -26.500 80.186  42.620  1.00 33.81 ? 9    ILE B CA    1 
ATOM   4942  C C     . ILE B 1 9   ? -25.165 80.711  43.147  1.00 33.32 ? 9    ILE B C     1 
ATOM   4943  O O     . ILE B 1 9   ? -25.133 81.374  44.185  1.00 33.75 ? 9    ILE B O     1 
ATOM   4944  C CB    . ILE B 1 9   ? -27.422 81.345  42.171  1.00 33.50 ? 9    ILE B CB    1 
ATOM   4945  C CG1   . ILE B 1 9   ? -28.665 80.787  41.500  1.00 32.61 ? 9    ILE B CG1   1 
ATOM   4946  C CG2   . ILE B 1 9   ? -26.702 82.313  41.254  1.00 33.17 ? 9    ILE B CG2   1 
ATOM   4947  C CD1   . ILE B 1 9   ? -29.828 81.733  41.565  1.00 33.93 ? 9    ILE B CD1   1 
ATOM   4948  N N     . PRO B 1 10  ? -24.060 80.428  42.425  1.00 32.85 ? 10   PRO B N     1 
ATOM   4949  C CA    . PRO B 1 10  ? -22.742 80.818  42.936  1.00 31.97 ? 10   PRO B CA    1 
ATOM   4950  C C     . PRO B 1 10  ? -22.555 82.331  42.873  1.00 30.93 ? 10   PRO B C     1 
ATOM   4951  O O     . PRO B 1 10  ? -23.066 82.985  41.960  1.00 30.61 ? 10   PRO B O     1 
ATOM   4952  C CB    . PRO B 1 10  ? -21.763 80.115  41.986  1.00 31.90 ? 10   PRO B CB    1 
ATOM   4953  C CG    . PRO B 1 10  ? -22.605 79.212  41.105  1.00 32.24 ? 10   PRO B CG    1 
ATOM   4954  C CD    . PRO B 1 10  ? -23.969 79.776  41.102  1.00 32.53 ? 10   PRO B CD    1 
ATOM   4955  N N     . ALA B 1 11  ? -21.831 82.864  43.850  1.00 29.98 ? 11   ALA B N     1 
ATOM   4956  C CA    . ALA B 1 11  ? -21.604 84.306  43.979  1.00 29.46 ? 11   ALA B CA    1 
ATOM   4957  C C     . ALA B 1 11  ? -21.032 84.958  42.716  1.00 28.91 ? 11   ALA B C     1 
ATOM   4958  O O     . ALA B 1 11  ? -21.436 86.076  42.372  1.00 29.32 ? 11   ALA B O     1 
ATOM   4959  C CB    . ALA B 1 11  ? -20.722 84.597  45.180  1.00 29.45 ? 11   ALA B CB    1 
ATOM   4960  N N     . ASN B 1 12  ? -20.114 84.264  42.031  1.00 27.89 ? 12   ASN B N     1 
ATOM   4961  C CA    . ASN B 1 12  ? -19.583 84.725  40.751  1.00 26.91 ? 12   ASN B CA    1 
ATOM   4962  C C     . ASN B 1 12  ? -20.671 84.933  39.673  1.00 27.48 ? 12   ASN B C     1 
ATOM   4963  O O     . ASN B 1 12  ? -20.638 85.934  38.952  1.00 27.68 ? 12   ASN B O     1 
ATOM   4964  C CB    . ASN B 1 12  ? -18.462 83.802  40.241  1.00 26.46 ? 12   ASN B CB    1 
ATOM   4965  C CG    . ASN B 1 12  ? -18.984 82.465  39.691  1.00 24.72 ? 12   ASN B CG    1 
ATOM   4966  O OD1   . ASN B 1 12  ? -19.628 81.703  40.417  1.00 23.73 ? 12   ASN B OD1   1 
ATOM   4967  N ND2   . ASN B 1 12  ? -18.683 82.171  38.416  1.00 16.57 ? 12   ASN B ND2   1 
ATOM   4968  N N     . ILE B 1 13  ? -21.628 84.006  39.571  1.00 26.97 ? 13   ILE B N     1 
ATOM   4969  C CA    . ILE B 1 13  ? -22.727 84.162  38.630  1.00 27.40 ? 13   ILE B CA    1 
ATOM   4970  C C     . ILE B 1 13  ? -23.665 85.283  39.107  1.00 28.13 ? 13   ILE B C     1 
ATOM   4971  O O     . ILE B 1 13  ? -24.034 86.184  38.336  1.00 28.34 ? 13   ILE B O     1 
ATOM   4972  C CB    . ILE B 1 13  ? -23.506 82.810  38.417  1.00 27.40 ? 13   ILE B CB    1 
ATOM   4973  C CG1   . ILE B 1 13  ? -22.568 81.664  38.003  1.00 26.97 ? 13   ILE B CG1   1 
ATOM   4974  C CG2   . ILE B 1 13  ? -24.611 82.974  37.387  1.00 27.88 ? 13   ILE B CG2   1 
ATOM   4975  C CD1   . ILE B 1 13  ? -21.883 81.835  36.626  1.00 26.03 ? 13   ILE B CD1   1 
ATOM   4976  N N     . ALA B 1 14  ? -24.051 85.216  40.381  1.00 28.89 ? 14   ALA B N     1 
ATOM   4977  C CA    . ALA B 1 14  ? -24.837 86.262  41.038  1.00 29.63 ? 14   ALA B CA    1 
ATOM   4978  C C     . ALA B 1 14  ? -24.315 87.672  40.726  1.00 30.34 ? 14   ALA B C     1 
ATOM   4979  O O     . ALA B 1 14  ? -25.092 88.606  40.501  1.00 30.32 ? 14   ALA B O     1 
ATOM   4980  C CB    . ALA B 1 14  ? -24.858 86.021  42.554  1.00 29.14 ? 14   ALA B CB    1 
ATOM   4981  N N     . ASP B 1 15  ? -22.993 87.806  40.703  1.00 31.63 ? 15   ASP B N     1 
ATOM   4982  C CA    . ASP B 1 15  ? -22.336 89.086  40.483  1.00 33.07 ? 15   ASP B CA    1 
ATOM   4983  C C     . ASP B 1 15  ? -22.542 89.635  39.065  1.00 33.28 ? 15   ASP B C     1 
ATOM   4984  O O     . ASP B 1 15  ? -22.705 90.848  38.883  1.00 33.97 ? 15   ASP B O     1 
ATOM   4985  C CB    . ASP B 1 15  ? -20.843 88.958  40.774  1.00 33.71 ? 15   ASP B CB    1 
ATOM   4986  C CG    . ASP B 1 15  ? -20.046 90.155  40.264  1.00 36.80 ? 15   ASP B CG    1 
ATOM   4987  O OD1   . ASP B 1 15  ? -20.117 91.240  40.893  1.00 40.08 ? 15   ASP B OD1   1 
ATOM   4988  O OD2   . ASP B 1 15  ? -19.359 90.012  39.223  1.00 40.16 ? 15   ASP B OD2   1 
ATOM   4989  N N     . ARG B 1 16  ? -22.547 88.749  38.072  1.00 32.76 ? 16   ARG B N     1 
ATOM   4990  C CA    . ARG B 1 16  ? -22.540 89.161  36.680  1.00 32.75 ? 16   ARG B CA    1 
ATOM   4991  C C     . ARG B 1 16  ? -23.816 88.801  35.885  1.00 31.43 ? 16   ARG B C     1 
ATOM   4992  O O     . ARG B 1 16  ? -23.983 89.244  34.732  1.00 30.60 ? 16   ARG B O     1 
ATOM   4993  C CB    . ARG B 1 16  ? -21.288 88.588  35.983  1.00 33.23 ? 16   ARG B CB    1 
ATOM   4994  C CG    . ARG B 1 16  ? -21.309 87.042  35.798  1.00 35.27 ? 16   ARG B CG    1 
ATOM   4995  C CD    . ARG B 1 16  ? -19.945 86.496  35.377  1.00 35.40 ? 16   ARG B CD    1 
ATOM   4996  N NE    . ARG B 1 16  ? -19.849 86.335  33.923  1.00 41.98 ? 16   ARG B NE    1 
ATOM   4997  C CZ    . ARG B 1 16  ? -18.780 86.649  33.176  1.00 44.52 ? 16   ARG B CZ    1 
ATOM   4998  N NH1   . ARG B 1 16  ? -17.682 87.188  33.725  1.00 44.08 ? 16   ARG B NH1   1 
ATOM   4999  N NH2   . ARG B 1 16  ? -18.819 86.437  31.857  1.00 45.11 ? 16   ARG B NH2   1 
ATOM   5000  N N     . CYS B 1 17  ? -24.711 87.997  36.468  1.00 29.96 ? 17   CYS B N     1 
ATOM   5001  C CA    . CYS B 1 17  ? -25.864 87.536  35.687  1.00 28.48 ? 17   CYS B CA    1 
ATOM   5002  C C     . CYS B 1 17  ? -26.642 88.686  35.046  1.00 28.41 ? 17   CYS B C     1 
ATOM   5003  O O     . CYS B 1 17  ? -26.898 89.725  35.682  1.00 28.06 ? 17   CYS B O     1 
ATOM   5004  C CB    . CYS B 1 17  ? -26.799 86.641  36.492  1.00 28.29 ? 17   CYS B CB    1 
ATOM   5005  S SG    . CYS B 1 17  ? -27.521 87.418  37.947  1.00 26.11 ? 17   CYS B SG    1 
ATOM   5006  N N     . LEU B 1 18  ? -26.990 88.481  33.775  1.00 27.63 ? 18   LEU B N     1 
ATOM   5007  C CA    . LEU B 1 18  ? -27.896 89.349  33.039  1.00 27.19 ? 18   LEU B CA    1 
ATOM   5008  C C     . LEU B 1 18  ? -29.277 89.430  33.700  1.00 27.44 ? 18   LEU B C     1 
ATOM   5009  O O     . LEU B 1 18  ? -29.917 90.486  33.688  1.00 27.39 ? 18   LEU B O     1 
ATOM   5010  C CB    . LEU B 1 18  ? -28.023 88.855  31.596  1.00 26.68 ? 18   LEU B CB    1 
ATOM   5011  C CG    . LEU B 1 18  ? -26.718 88.843  30.799  1.00 26.62 ? 18   LEU B CG    1 
ATOM   5012  C CD1   . LEU B 1 18  ? -27.001 88.514  29.353  1.00 24.24 ? 18   LEU B CD1   1 
ATOM   5013  C CD2   . LEU B 1 18  ? -25.891 90.188  30.932  1.00 25.09 ? 18   LEU B CD2   1 
ATOM   5014  N N     . ILE B 1 19  ? -29.703 88.316  34.302  1.00 27.49 ? 19   ILE B N     1 
ATOM   5015  C CA    . ILE B 1 19  ? -31.029 88.177  34.901  1.00 27.18 ? 19   ILE B CA    1 
ATOM   5016  C C     . ILE B 1 19  ? -30.984 87.468  36.250  1.00 27.52 ? 19   ILE B C     1 
ATOM   5017  O O     . ILE B 1 19  ? -30.665 86.274  36.337  1.00 26.82 ? 19   ILE B O     1 
ATOM   5018  C CB    . ILE B 1 19  ? -32.032 87.494  33.909  1.00 27.23 ? 19   ILE B CB    1 
ATOM   5019  C CG1   . ILE B 1 19  ? -32.297 88.462  32.744  1.00 27.53 ? 19   ILE B CG1   1 
ATOM   5020  C CG2   . ILE B 1 19  ? -33.334 87.064  34.623  1.00 24.45 ? 19   ILE B CG2   1 
ATOM   5021  C CD1   . ILE B 1 19  ? -33.100 87.907  31.637  1.00 28.66 ? 19   ILE B CD1   1 
ATOM   5022  N N     . ASN B 1 20  ? -31.305 88.228  37.299  1.00 28.41 ? 20   ASN B N     1 
ATOM   5023  C CA    . ASN B 1 20  ? -31.302 87.706  38.670  1.00 29.22 ? 20   ASN B CA    1 
ATOM   5024  C C     . ASN B 1 20  ? -32.650 87.064  39.034  1.00 29.21 ? 20   ASN B C     1 
ATOM   5025  O O     . ASN B 1 20  ? -33.558 87.019  38.190  1.00 29.31 ? 20   ASN B O     1 
ATOM   5026  C CB    . ASN B 1 20  ? -30.842 88.771  39.682  1.00 29.14 ? 20   ASN B CB    1 
ATOM   5027  C CG    . ASN B 1 20  ? -31.770 89.981  39.756  1.00 31.22 ? 20   ASN B CG    1 
ATOM   5028  O OD1   . ASN B 1 20  ? -32.982 89.893  39.521  1.00 33.89 ? 20   ASN B OD1   1 
ATOM   5029  N ND2   . ASN B 1 20  ? -31.199 91.122  40.119  1.00 30.35 ? 20   ASN B ND2   1 
ATOM   5030  N N     . PRO B 1 21  ? -32.774 86.522  40.260  1.00 29.50 ? 21   PRO B N     1 
ATOM   5031  C CA    . PRO B 1 21  ? -34.060 85.913  40.621  1.00 29.89 ? 21   PRO B CA    1 
ATOM   5032  C C     . PRO B 1 21  ? -35.267 86.854  40.513  1.00 30.65 ? 21   PRO B C     1 
ATOM   5033  O O     . PRO B 1 21  ? -36.296 86.457  39.942  1.00 30.79 ? 21   PRO B O     1 
ATOM   5034  C CB    . PRO B 1 21  ? -33.832 85.461  42.065  1.00 29.58 ? 21   PRO B CB    1 
ATOM   5035  C CG    . PRO B 1 21  ? -32.320 85.240  42.146  1.00 28.45 ? 21   PRO B CG    1 
ATOM   5036  C CD    . PRO B 1 21  ? -31.782 86.377  41.347  1.00 29.34 ? 21   PRO B CD    1 
ATOM   5037  N N     . GLU B 1 22  ? -35.158 88.082  41.033  1.00 31.40 ? 22   GLU B N     1 
ATOM   5038  C CA    . GLU B 1 22  ? -36.313 88.996  41.019  1.00 32.18 ? 22   GLU B CA    1 
ATOM   5039  C C     . GLU B 1 22  ? -36.683 89.370  39.592  1.00 31.38 ? 22   GLU B C     1 
ATOM   5040  O O     . GLU B 1 22  ? -37.861 89.390  39.241  1.00 31.14 ? 22   GLU B O     1 
ATOM   5041  C CB    . GLU B 1 22  ? -36.130 90.241  41.913  1.00 32.62 ? 22   GLU B CB    1 
ATOM   5042  C CG    . GLU B 1 22  ? -37.005 91.440  41.466  1.00 36.77 ? 22   GLU B CG    1 
ATOM   5043  C CD    . GLU B 1 22  ? -37.681 92.195  42.607  1.00 42.33 ? 22   GLU B CD    1 
ATOM   5044  O OE1   . GLU B 1 22  ? -38.945 92.196  42.662  1.00 43.12 ? 22   GLU B OE1   1 
ATOM   5045  O OE2   . GLU B 1 22  ? -36.949 92.795  43.438  1.00 44.25 ? 22   GLU B OE2   1 
ATOM   5046  N N     . GLN B 1 23  ? -35.665 89.625  38.778  1.00 31.33 ? 23   GLN B N     1 
ATOM   5047  C CA    . GLN B 1 23  ? -35.843 89.939  37.357  1.00 31.19 ? 23   GLN B CA    1 
ATOM   5048  C C     . GLN B 1 23  ? -36.568 88.853  36.579  1.00 30.67 ? 23   GLN B C     1 
ATOM   5049  O O     . GLN B 1 23  ? -37.366 89.160  35.685  1.00 30.47 ? 23   GLN B O     1 
ATOM   5050  C CB    . GLN B 1 23  ? -34.492 90.212  36.698  1.00 31.48 ? 23   GLN B CB    1 
ATOM   5051  C CG    . GLN B 1 23  ? -34.028 91.640  36.861  1.00 32.20 ? 23   GLN B CG    1 
ATOM   5052  C CD    . GLN B 1 23  ? -32.537 91.776  36.734  1.00 34.28 ? 23   GLN B CD    1 
ATOM   5053  O OE1   . GLN B 1 23  ? -31.812 90.790  36.587  1.00 36.64 ? 23   GLN B OE1   1 
ATOM   5054  N NE2   . GLN B 1 23  ? -32.062 92.999  36.803  1.00 34.68 ? 23   GLN B NE2   1 
ATOM   5055  N N     . TYR B 1 24  ? -36.271 87.592  36.903  1.00 29.90 ? 24   TYR B N     1 
ATOM   5056  C CA    . TYR B 1 24  ? -36.991 86.468  36.318  1.00 29.12 ? 24   TYR B CA    1 
ATOM   5057  C C     . TYR B 1 24  ? -38.476 86.558  36.653  1.00 28.76 ? 24   TYR B C     1 
ATOM   5058  O O     . TYR B 1 24  ? -39.324 86.379  35.780  1.00 28.80 ? 24   TYR B O     1 
ATOM   5059  C CB    . TYR B 1 24  ? -36.459 85.099  36.798  1.00 28.94 ? 24   TYR B CB    1 
ATOM   5060  C CG    . TYR B 1 24  ? -37.344 83.974  36.285  1.00 28.16 ? 24   TYR B CG    1 
ATOM   5061  C CD1   . TYR B 1 24  ? -37.184 83.477  34.999  1.00 27.49 ? 24   TYR B CD1   1 
ATOM   5062  C CD2   . TYR B 1 24  ? -38.378 83.458  37.060  1.00 27.29 ? 24   TYR B CD2   1 
ATOM   5063  C CE1   . TYR B 1 24  ? -38.016 82.491  34.505  1.00 27.22 ? 24   TYR B CE1   1 
ATOM   5064  C CE2   . TYR B 1 24  ? -39.215 82.469  36.572  1.00 26.80 ? 24   TYR B CE2   1 
ATOM   5065  C CZ    . TYR B 1 24  ? -39.024 81.989  35.290  1.00 27.67 ? 24   TYR B CZ    1 
ATOM   5066  O OH    . TYR B 1 24  ? -39.835 81.001  34.786  1.00 27.67 ? 24   TYR B OH    1 
ATOM   5067  N N     . GLU B 1 25  ? -38.788 86.786  37.926  1.00 28.62 ? 25   GLU B N     1 
ATOM   5068  C CA    . GLU B 1 25  ? -40.191 86.828  38.367  1.00 28.57 ? 25   GLU B CA    1 
ATOM   5069  C C     . GLU B 1 25  ? -40.937 87.947  37.686  1.00 27.73 ? 25   GLU B C     1 
ATOM   5070  O O     . GLU B 1 25  ? -42.086 87.759  37.275  1.00 27.81 ? 25   GLU B O     1 
ATOM   5071  C CB    . GLU B 1 25  ? -40.331 86.950  39.886  1.00 28.20 ? 25   GLU B CB    1 
ATOM   5072  C CG    . GLU B 1 25  ? -39.748 85.793  40.691  1.00 31.58 ? 25   GLU B CG    1 
ATOM   5073  C CD    . GLU B 1 25  ? -40.427 84.433  40.444  1.00 35.89 ? 25   GLU B CD    1 
ATOM   5074  O OE1   . GLU B 1 25  ? -41.522 84.391  39.839  1.00 35.97 ? 25   GLU B OE1   1 
ATOM   5075  O OE2   . GLU B 1 25  ? -39.844 83.395  40.860  1.00 37.86 ? 25   GLU B OE2   1 
ATOM   5076  N N     . THR B 1 26  ? -40.266 89.089  37.544  1.00 27.42 ? 26   THR B N     1 
ATOM   5077  C CA    . THR B 1 26  ? -40.876 90.278  36.969  1.00 27.63 ? 26   THR B CA    1 
ATOM   5078  C C     . THR B 1 26  ? -41.110 90.121  35.462  1.00 27.85 ? 26   THR B C     1 
ATOM   5079  O O     . THR B 1 26  ? -42.209 90.388  34.977  1.00 27.89 ? 26   THR B O     1 
ATOM   5080  C CB    . THR B 1 26  ? -40.071 91.568  37.307  1.00 27.74 ? 26   THR B CB    1 
ATOM   5081  O OG1   . THR B 1 26  ? -40.068 91.780  38.725  1.00 27.06 ? 26   THR B OG1   1 
ATOM   5082  C CG2   . THR B 1 26  ? -40.694 92.811  36.639  1.00 27.97 ? 26   THR B CG2   1 
ATOM   5083  N N     . LYS B 1 27  ? -40.085 89.680  34.733  1.00 28.17 ? 27   LYS B N     1 
ATOM   5084  C CA    . LYS B 1 27  ? -40.192 89.533  33.288  1.00 28.73 ? 27   LYS B CA    1 
ATOM   5085  C C     . LYS B 1 27  ? -41.143 88.416  32.932  1.00 28.52 ? 27   LYS B C     1 
ATOM   5086  O O     . LYS B 1 27  ? -41.920 88.544  31.977  1.00 28.08 ? 27   LYS B O     1 
ATOM   5087  C CB    . LYS B 1 27  ? -38.845 89.246  32.634  1.00 29.10 ? 27   LYS B CB    1 
ATOM   5088  C CG    . LYS B 1 27  ? -37.838 90.360  32.748  1.00 31.59 ? 27   LYS B CG    1 
ATOM   5089  C CD    . LYS B 1 27  ? -36.686 90.142  31.754  1.00 33.52 ? 27   LYS B CD    1 
ATOM   5090  C CE    . LYS B 1 27  ? -35.732 91.323  31.821  1.00 34.55 ? 27   LYS B CE    1 
ATOM   5091  N NZ    . LYS B 1 27  ? -35.609 91.932  30.466  1.00 37.75 ? 27   LYS B NZ    1 
ATOM   5092  N N     . TYR B 1 28  ? -41.082 87.318  33.690  1.00 28.08 ? 28   TYR B N     1 
ATOM   5093  C CA    . TYR B 1 28  ? -41.957 86.197  33.390  1.00 27.91 ? 28   TYR B CA    1 
ATOM   5094  C C     . TYR B 1 28  ? -43.414 86.650  33.440  1.00 27.80 ? 28   TYR B C     1 
ATOM   5095  O O     . TYR B 1 28  ? -44.166 86.453  32.468  1.00 27.81 ? 28   TYR B O     1 
ATOM   5096  C CB    . TYR B 1 28  ? -41.738 84.976  34.303  1.00 27.83 ? 28   TYR B CB    1 
ATOM   5097  C CG    . TYR B 1 28  ? -42.670 83.854  33.904  1.00 26.98 ? 28   TYR B CG    1 
ATOM   5098  C CD1   . TYR B 1 28  ? -42.386 83.050  32.790  1.00 26.14 ? 28   TYR B CD1   1 
ATOM   5099  C CD2   . TYR B 1 28  ? -43.867 83.639  34.588  1.00 27.20 ? 28   TYR B CD2   1 
ATOM   5100  C CE1   . TYR B 1 28  ? -43.236 82.043  32.391  1.00 25.65 ? 28   TYR B CE1   1 
ATOM   5101  C CE2   . TYR B 1 28  ? -44.747 82.617  34.196  1.00 28.13 ? 28   TYR B CE2   1 
ATOM   5102  C CZ    . TYR B 1 28  ? -44.420 81.824  33.090  1.00 28.41 ? 28   TYR B CZ    1 
ATOM   5103  O OH    . TYR B 1 28  ? -45.285 80.824  32.688  1.00 28.29 ? 28   TYR B OH    1 
ATOM   5104  N N     . LYS B 1 29  ? -43.794 87.268  34.561  1.00 27.34 ? 29   LYS B N     1 
ATOM   5105  C CA    . LYS B 1 29  ? -45.172 87.695  34.780  1.00 27.26 ? 29   LYS B CA    1 
ATOM   5106  C C     . LYS B 1 29  ? -45.614 88.641  33.673  1.00 26.95 ? 29   LYS B C     1 
ATOM   5107  O O     . LYS B 1 29  ? -46.698 88.475  33.089  1.00 27.26 ? 29   LYS B O     1 
ATOM   5108  C CB    . LYS B 1 29  ? -45.350 88.333  36.173  1.00 27.93 ? 29   LYS B CB    1 
ATOM   5109  N N     . GLN B 1 30  ? -44.755 89.605  33.345  1.00 26.51 ? 30   GLN B N     1 
ATOM   5110  C CA    . GLN B 1 30  ? -45.083 90.550  32.278  1.00 25.52 ? 30   GLN B CA    1 
ATOM   5111  C C     . GLN B 1 30  ? -45.278 89.802  30.944  1.00 25.30 ? 30   GLN B C     1 
ATOM   5112  O O     . GLN B 1 30  ? -46.221 90.097  30.195  1.00 24.50 ? 30   GLN B O     1 
ATOM   5113  C CB    . GLN B 1 30  ? -44.061 91.700  32.166  1.00 24.87 ? 30   GLN B CB    1 
ATOM   5114  C CG    . GLN B 1 30  ? -44.637 92.925  31.444  1.00 24.56 ? 30   GLN B CG    1 
ATOM   5115  C CD    . GLN B 1 30  ? -43.608 93.803  30.699  1.00 25.07 ? 30   GLN B CD    1 
ATOM   5116  O OE1   . GLN B 1 30  ? -42.475 93.396  30.447  1.00 26.16 ? 30   GLN B OE1   1 
ATOM   5117  N NE2   . GLN B 1 30  ? -44.025 95.017  30.338  1.00 22.18 ? 30   GLN B NE2   1 
ATOM   5118  N N     . SER B 1 31  ? -44.396 88.839  30.671  1.00 25.31 ? 31   SER B N     1 
ATOM   5119  C CA    . SER B 1 31  ? -44.428 88.082  29.411  1.00 26.07 ? 31   SER B CA    1 
ATOM   5120  C C     . SER B 1 31  ? -45.728 87.290  29.279  1.00 27.04 ? 31   SER B C     1 
ATOM   5121  O O     . SER B 1 31  ? -46.210 87.062  28.169  1.00 26.70 ? 31   SER B O     1 
ATOM   5122  C CB    . SER B 1 31  ? -43.226 87.135  29.287  1.00 25.60 ? 31   SER B CB    1 
ATOM   5123  O OG    . SER B 1 31  ? -43.385 85.994  30.105  1.00 24.20 ? 31   SER B OG    1 
ATOM   5124  N N     . ILE B 1 32  ? -46.286 86.906  30.433  1.00 28.25 ? 32   ILE B N     1 
ATOM   5125  C CA    . ILE B 1 32  ? -47.531 86.146  30.512  1.00 29.01 ? 32   ILE B CA    1 
ATOM   5126  C C     . ILE B 1 32  ? -48.773 87.066  30.462  1.00 29.70 ? 32   ILE B C     1 
ATOM   5127  O O     . ILE B 1 32  ? -49.639 86.875  29.606  1.00 30.11 ? 32   ILE B O     1 
ATOM   5128  C CB    . ILE B 1 32  ? -47.490 85.136  31.717  1.00 29.38 ? 32   ILE B CB    1 
ATOM   5129  C CG1   . ILE B 1 32  ? -46.393 84.076  31.502  1.00 29.66 ? 32   ILE B CG1   1 
ATOM   5130  C CG2   . ILE B 1 32  ? -48.827 84.451  31.962  1.00 29.71 ? 32   ILE B CG2   1 
ATOM   5131  C CD1   . ILE B 1 32  ? -46.095 83.713  30.028  1.00 30.32 ? 32   ILE B CD1   1 
ATOM   5132  N N     . ASN B 1 33  ? -48.839 88.088  31.314  1.00 29.89 ? 33   ASN B N     1 
ATOM   5133  C CA    . ASN B 1 33  ? -49.986 89.013  31.307  1.00 30.38 ? 33   ASN B CA    1 
ATOM   5134  C C     . ASN B 1 33  ? -50.078 89.964  30.101  1.00 30.63 ? 33   ASN B C     1 
ATOM   5135  O O     . ASN B 1 33  ? -51.181 90.285  29.630  1.00 30.70 ? 33   ASN B O     1 
ATOM   5136  C CB    . ASN B 1 33  ? -50.021 89.834  32.598  1.00 30.80 ? 33   ASN B CB    1 
ATOM   5137  C CG    . ASN B 1 33  ? -50.085 88.959  33.863  1.00 32.14 ? 33   ASN B CG    1 
ATOM   5138  O OD1   . ASN B 1 33  ? -50.487 87.776  33.834  1.00 30.95 ? 33   ASN B OD1   1 
ATOM   5139  N ND2   . ASN B 1 33  ? -49.680 89.550  34.986  1.00 33.74 ? 33   ASN B ND2   1 
ATOM   5140  N N     . ASP B 1 34  ? -48.925 90.419  29.604  1.00 30.44 ? 34   ASP B N     1 
ATOM   5141  C CA    . ASP B 1 34  ? -48.891 91.387  28.519  1.00 29.74 ? 34   ASP B CA    1 
ATOM   5142  C C     . ASP B 1 34  ? -47.798 91.093  27.490  1.00 29.49 ? 34   ASP B C     1 
ATOM   5143  O O     . ASP B 1 34  ? -46.831 91.864  27.378  1.00 29.92 ? 34   ASP B O     1 
ATOM   5144  C CB    . ASP B 1 34  ? -48.693 92.776  29.113  1.00 30.13 ? 34   ASP B CB    1 
ATOM   5145  C CG    . ASP B 1 34  ? -49.017 93.894  28.141  1.00 30.45 ? 34   ASP B CG    1 
ATOM   5146  O OD1   . ASP B 1 34  ? -49.429 93.643  26.976  1.00 29.83 ? 34   ASP B OD1   1 
ATOM   5147  O OD2   . ASP B 1 34  ? -48.844 95.048  28.566  1.00 31.00 ? 34   ASP B OD2   1 
ATOM   5148  N N     . PRO B 1 35  ? -47.949 89.992  26.719  1.00 28.76 ? 35   PRO B N     1 
ATOM   5149  C CA    . PRO B 1 35  ? -46.938 89.616  25.718  1.00 28.17 ? 35   PRO B CA    1 
ATOM   5150  C C     . PRO B 1 35  ? -46.691 90.677  24.635  1.00 27.85 ? 35   PRO B C     1 
ATOM   5151  O O     . PRO B 1 35  ? -45.577 90.765  24.114  1.00 27.83 ? 35   PRO B O     1 
ATOM   5152  C CB    . PRO B 1 35  ? -47.496 88.325  25.097  1.00 27.72 ? 35   PRO B CB    1 
ATOM   5153  C CG    . PRO B 1 35  ? -48.902 88.235  25.499  1.00 27.75 ? 35   PRO B CG    1 
ATOM   5154  C CD    . PRO B 1 35  ? -49.074 89.039  26.751  1.00 28.72 ? 35   PRO B CD    1 
ATOM   5155  N N     . ASP B 1 36  ? -47.714 91.459  24.304  1.00 27.58 ? 36   ASP B N     1 
ATOM   5156  C CA    . ASP B 1 36  ? -47.599 92.536  23.312  1.00 28.15 ? 36   ASP B CA    1 
ATOM   5157  C C     . ASP B 1 36  ? -46.554 93.601  23.704  1.00 27.96 ? 36   ASP B C     1 
ATOM   5158  O O     . ASP B 1 36  ? -45.678 93.954  22.920  1.00 28.24 ? 36   ASP B O     1 
ATOM   5159  C CB    . ASP B 1 36  ? -48.974 93.173  23.055  1.00 27.97 ? 36   ASP B CB    1 
ATOM   5160  C CG    . ASP B 1 36  ? -49.774 92.426  22.002  1.00 30.17 ? 36   ASP B CG    1 
ATOM   5161  O OD1   . ASP B 1 36  ? -50.791 92.964  21.530  1.00 32.33 ? 36   ASP B OD1   1 
ATOM   5162  O OD2   . ASP B 1 36  ? -49.390 91.304  21.613  1.00 32.55 ? 36   ASP B OD2   1 
ATOM   5163  N N     . THR B 1 37  ? -46.666 94.114  24.923  1.00 27.88 ? 37   THR B N     1 
ATOM   5164  C CA    . THR B 1 37  ? -45.647 94.982  25.505  1.00 27.32 ? 37   THR B CA    1 
ATOM   5165  C C     . THR B 1 37  ? -44.318 94.231  25.720  1.00 27.15 ? 37   THR B C     1 
ATOM   5166  O O     . THR B 1 37  ? -43.261 94.695  25.261  1.00 27.00 ? 37   THR B O     1 
ATOM   5167  C CB    . THR B 1 37  ? -46.151 95.601  26.835  1.00 27.31 ? 37   THR B CB    1 
ATOM   5168  O OG1   . THR B 1 37  ? -47.411 96.245  26.607  1.00 25.26 ? 37   THR B OG1   1 
ATOM   5169  C CG2   . THR B 1 37  ? -45.143 96.583  27.406  1.00 26.82 ? 37   THR B CG2   1 
ATOM   5170  N N     . PHE B 1 38  ? -44.363 93.081  26.393  1.00 26.33 ? 38   PHE B N     1 
ATOM   5171  C CA    . PHE B 1 38  ? -43.122 92.360  26.674  1.00 26.58 ? 38   PHE B CA    1 
ATOM   5172  C C     . PHE B 1 38  ? -42.298 91.975  25.415  1.00 26.92 ? 38   PHE B C     1 
ATOM   5173  O O     . PHE B 1 38  ? -41.107 92.324  25.299  1.00 27.46 ? 38   PHE B O     1 
ATOM   5174  C CB    . PHE B 1 38  ? -43.367 91.137  27.553  1.00 26.35 ? 38   PHE B CB    1 
ATOM   5175  C CG    . PHE B 1 38  ? -42.127 90.329  27.804  1.00 26.18 ? 38   PHE B CG    1 
ATOM   5176  C CD1   . PHE B 1 38  ? -41.373 90.533  28.954  1.00 24.95 ? 38   PHE B CD1   1 
ATOM   5177  C CD2   . PHE B 1 38  ? -41.700 89.375  26.878  1.00 24.14 ? 38   PHE B CD2   1 
ATOM   5178  C CE1   . PHE B 1 38  ? -40.226 89.790  29.167  1.00 24.53 ? 38   PHE B CE1   1 
ATOM   5179  C CE2   . PHE B 1 38  ? -40.552 88.636  27.092  1.00 22.06 ? 38   PHE B CE2   1 
ATOM   5180  C CZ    . PHE B 1 38  ? -39.815 88.847  28.229  1.00 23.15 ? 38   PHE B CZ    1 
ATOM   5181  N N     . TRP B 1 39  ? -42.918 91.269  24.477  1.00 26.42 ? 39   TRP B N     1 
ATOM   5182  C CA    . TRP B 1 39  ? -42.208 90.864  23.263  1.00 26.50 ? 39   TRP B CA    1 
ATOM   5183  C C     . TRP B 1 39  ? -42.036 92.009  22.229  1.00 27.07 ? 39   TRP B C     1 
ATOM   5184  O O     . TRP B 1 39  ? -41.257 91.873  21.262  1.00 27.23 ? 39   TRP B O     1 
ATOM   5185  C CB    . TRP B 1 39  ? -42.867 89.626  22.642  1.00 25.73 ? 39   TRP B CB    1 
ATOM   5186  C CG    . TRP B 1 39  ? -42.630 88.350  23.430  1.00 25.39 ? 39   TRP B CG    1 
ATOM   5187  C CD1   . TRP B 1 39  ? -43.566 87.624  24.116  1.00 25.19 ? 39   TRP B CD1   1 
ATOM   5188  C CD2   . TRP B 1 39  ? -41.380 87.656  23.608  1.00 24.79 ? 39   TRP B CD2   1 
ATOM   5189  N NE1   . TRP B 1 39  ? -42.978 86.518  24.709  1.00 25.41 ? 39   TRP B NE1   1 
ATOM   5190  C CE2   . TRP B 1 39  ? -41.642 86.515  24.411  1.00 25.48 ? 39   TRP B CE2   1 
ATOM   5191  C CE3   . TRP B 1 39  ? -40.071 87.881  23.166  1.00 24.66 ? 39   TRP B CE3   1 
ATOM   5192  C CZ2   . TRP B 1 39  ? -40.641 85.607  24.773  1.00 24.82 ? 39   TRP B CZ2   1 
ATOM   5193  C CZ3   . TRP B 1 39  ? -39.077 86.977  23.531  1.00 24.28 ? 39   TRP B CZ3   1 
ATOM   5194  C CH2   . TRP B 1 39  ? -39.371 85.852  24.320  1.00 24.08 ? 39   TRP B CH2   1 
ATOM   5195  N N     . GLY B 1 40  ? -42.759 93.120  22.439  1.00 27.08 ? 40   GLY B N     1 
ATOM   5196  C CA    . GLY B 1 40  ? -42.622 94.327  21.631  1.00 26.95 ? 40   GLY B CA    1 
ATOM   5197  C C     . GLY B 1 40  ? -41.287 94.956  21.952  1.00 27.73 ? 40   GLY B C     1 
ATOM   5198  O O     . GLY B 1 40  ? -40.550 95.379  21.056  1.00 27.48 ? 40   GLY B O     1 
ATOM   5199  N N     . GLU B 1 41  ? -40.961 94.988  23.243  1.00 28.35 ? 41   GLU B N     1 
ATOM   5200  C CA    . GLU B 1 41  ? -39.698 95.550  23.717  1.00 28.89 ? 41   GLU B CA    1 
ATOM   5201  C C     . GLU B 1 41  ? -38.569 94.587  23.428  1.00 28.49 ? 41   GLU B C     1 
ATOM   5202  O O     . GLU B 1 41  ? -37.493 94.989  23.007  1.00 28.78 ? 41   GLU B O     1 
ATOM   5203  C CB    . GLU B 1 41  ? -39.754 95.841  25.230  1.00 28.82 ? 41   GLU B CB    1 
ATOM   5204  C CG    . GLU B 1 41  ? -40.952 96.695  25.641  1.00 30.17 ? 41   GLU B CG    1 
ATOM   5205  C CD    . GLU B 1 41  ? -40.950 97.101  27.119  1.00 30.37 ? 41   GLU B CD    1 
ATOM   5206  O OE1   . GLU B 1 41  ? -41.231 98.299  27.404  1.00 30.16 ? 41   GLU B OE1   1 
ATOM   5207  O OE2   . GLU B 1 41  ? -40.677 96.229  27.983  1.00 31.28 ? 41   GLU B OE2   1 
ATOM   5208  N N     . GLN B 1 42  ? -38.825 93.304  23.650  1.00 28.67 ? 42   GLN B N     1 
ATOM   5209  C CA    . GLN B 1 42  ? -37.766 92.299  23.627  1.00 28.18 ? 42   GLN B CA    1 
ATOM   5210  C C     . GLN B 1 42  ? -37.265 92.054  22.194  1.00 28.21 ? 42   GLN B C     1 
ATOM   5211  O O     . GLN B 1 42  ? -36.075 91.865  21.980  1.00 28.22 ? 42   GLN B O     1 
ATOM   5212  C CB    . GLN B 1 42  ? -38.254 91.030  24.341  1.00 27.69 ? 42   GLN B CB    1 
ATOM   5213  C CG    . GLN B 1 42  ? -37.218 90.148  25.062  1.00 26.31 ? 42   GLN B CG    1 
ATOM   5214  C CD    . GLN B 1 42  ? -35.785 90.678  25.070  1.00 25.41 ? 42   GLN B CD    1 
ATOM   5215  O OE1   . GLN B 1 42  ? -34.892 90.068  24.475  1.00 24.82 ? 42   GLN B OE1   1 
ATOM   5216  N NE2   . GLN B 1 42  ? -35.555 91.783  25.757  1.00 22.83 ? 42   GLN B NE2   1 
ATOM   5217  N N     . GLY B 1 43  ? -38.172 92.141  21.223  1.00 28.56 ? 43   GLY B N     1 
ATOM   5218  C CA    . GLY B 1 43  ? -37.843 92.021  19.797  1.00 28.54 ? 43   GLY B CA    1 
ATOM   5219  C C     . GLY B 1 43  ? -36.846 93.019  19.220  1.00 28.75 ? 43   GLY B C     1 
ATOM   5220  O O     . GLY B 1 43  ? -36.359 92.816  18.093  1.00 28.90 ? 43   GLY B O     1 
ATOM   5221  N N     . LYS B 1 44  ? -36.561 94.103  19.960  1.00 28.29 ? 44   LYS B N     1 
ATOM   5222  C CA    . LYS B 1 44  ? -35.522 95.084  19.583  1.00 28.02 ? 44   LYS B CA    1 
ATOM   5223  C C     . LYS B 1 44  ? -34.096 94.519  19.809  1.00 27.36 ? 44   LYS B C     1 
ATOM   5224  O O     . LYS B 1 44  ? -33.098 95.222  19.651  1.00 27.08 ? 44   LYS B O     1 
ATOM   5225  C CB    . LYS B 1 44  ? -35.683 96.437  20.332  1.00 28.73 ? 44   LYS B CB    1 
ATOM   5226  C CG    . LYS B 1 44  ? -37.072 97.129  20.290  1.00 29.63 ? 44   LYS B CG    1 
ATOM   5227  C CD    . LYS B 1 44  ? -37.662 97.215  18.867  1.00 32.72 ? 44   LYS B CD    1 
ATOM   5228  C CE    . LYS B 1 44  ? -39.007 98.001  18.810  1.00 32.54 ? 44   LYS B CE    1 
ATOM   5229  N NZ    . LYS B 1 44  ? -38.992 99.349  19.455  1.00 32.86 ? 44   LYS B NZ    1 
ATOM   5230  N N     . ILE B 1 45  ? -34.010 93.251  20.203  1.00 26.67 ? 45   ILE B N     1 
ATOM   5231  C CA    . ILE B 1 45  ? -32.733 92.536  20.230  1.00 25.86 ? 45   ILE B CA    1 
ATOM   5232  C C     . ILE B 1 45  ? -32.198 92.378  18.796  1.00 26.03 ? 45   ILE B C     1 
ATOM   5233  O O     . ILE B 1 45  ? -30.991 92.227  18.581  1.00 26.23 ? 45   ILE B O     1 
ATOM   5234  C CB    . ILE B 1 45  ? -32.868 91.162  20.932  1.00 25.85 ? 45   ILE B CB    1 
ATOM   5235  C CG1   . ILE B 1 45  ? -31.480 90.522  21.173  1.00 24.80 ? 45   ILE B CG1   1 
ATOM   5236  C CG2   . ILE B 1 45  ? -33.833 90.250  20.170  1.00 24.16 ? 45   ILE B CG2   1 
ATOM   5237  C CD1   . ILE B 1 45  ? -31.464 89.505  22.292  1.00 22.99 ? 45   ILE B CD1   1 
ATOM   5238  N N     . LEU B 1 46  ? -33.115 92.421  17.833  1.00 25.66 ? 46   LEU B N     1 
ATOM   5239  C CA    . LEU B 1 46  ? -32.791 92.407  16.420  1.00 25.53 ? 46   LEU B CA    1 
ATOM   5240  C C     . LEU B 1 46  ? -32.932 93.804  15.847  1.00 25.48 ? 46   LEU B C     1 
ATOM   5241  O O     . LEU B 1 46  ? -33.738 94.594  16.345  1.00 25.50 ? 46   LEU B O     1 
ATOM   5242  C CB    . LEU B 1 46  ? -33.729 91.455  15.662  1.00 25.08 ? 46   LEU B CB    1 
ATOM   5243  C CG    . LEU B 1 46  ? -33.878 90.013  16.140  1.00 25.11 ? 46   LEU B CG    1 
ATOM   5244  C CD1   . LEU B 1 46  ? -34.769 89.221  15.186  1.00 23.99 ? 46   LEU B CD1   1 
ATOM   5245  C CD2   . LEU B 1 46  ? -32.500 89.323  16.329  1.00 23.29 ? 46   LEU B CD2   1 
ATOM   5246  N N     . ASP B 1 47  ? -32.153 94.095  14.811  1.00 25.17 ? 47   ASP B N     1 
ATOM   5247  C CA    . ASP B 1 47  ? -32.377 95.272  13.974  1.00 25.88 ? 47   ASP B CA    1 
ATOM   5248  C C     . ASP B 1 47  ? -33.556 94.990  13.045  1.00 25.68 ? 47   ASP B C     1 
ATOM   5249  O O     . ASP B 1 47  ? -33.633 93.913  12.459  1.00 25.52 ? 47   ASP B O     1 
ATOM   5250  C CB    . ASP B 1 47  ? -31.134 95.582  13.096  1.00 26.72 ? 47   ASP B CB    1 
ATOM   5251  C CG    . ASP B 1 47  ? -29.943 96.195  13.886  1.00 27.63 ? 47   ASP B CG    1 
ATOM   5252  O OD1   . ASP B 1 47  ? -29.009 96.693  13.218  1.00 27.95 ? 47   ASP B OD1   1 
ATOM   5253  O OD2   . ASP B 1 47  ? -29.925 96.186  15.139  1.00 28.00 ? 47   ASP B OD2   1 
ATOM   5254  N N     . TRP B 1 48  ? -34.447 95.970  12.882  1.00 25.87 ? 48   TRP B N     1 
ATOM   5255  C CA    . TRP B 1 48  ? -35.579 95.859  11.939  1.00 25.89 ? 48   TRP B CA    1 
ATOM   5256  C C     . TRP B 1 48  ? -35.500 96.839  10.755  1.00 26.32 ? 48   TRP B C     1 
ATOM   5257  O O     . TRP B 1 48  ? -35.165 98.010  10.929  1.00 26.32 ? 48   TRP B O     1 
ATOM   5258  C CB    . TRP B 1 48  ? -36.917 95.968  12.684  1.00 25.15 ? 48   TRP B CB    1 
ATOM   5259  C CG    . TRP B 1 48  ? -37.120 94.816  13.648  1.00 24.71 ? 48   TRP B CG    1 
ATOM   5260  C CD1   . TRP B 1 48  ? -36.507 94.638  14.881  1.00 24.20 ? 48   TRP B CD1   1 
ATOM   5261  C CD2   . TRP B 1 48  ? -37.969 93.682  13.461  1.00 24.00 ? 48   TRP B CD2   1 
ATOM   5262  N NE1   . TRP B 1 48  ? -36.933 93.461  15.462  1.00 23.42 ? 48   TRP B NE1   1 
ATOM   5263  C CE2   . TRP B 1 48  ? -37.827 92.851  14.619  1.00 23.51 ? 48   TRP B CE2   1 
ATOM   5264  C CE3   . TRP B 1 48  ? -38.850 93.285  12.439  1.00 23.25 ? 48   TRP B CE3   1 
ATOM   5265  C CZ2   . TRP B 1 48  ? -38.524 91.644  14.774  1.00 23.01 ? 48   TRP B CZ2   1 
ATOM   5266  C CZ3   . TRP B 1 48  ? -39.547 92.079  12.595  1.00 24.59 ? 48   TRP B CZ3   1 
ATOM   5267  C CH2   . TRP B 1 48  ? -39.364 91.264  13.760  1.00 23.84 ? 48   TRP B CH2   1 
ATOM   5268  N N     . ILE B 1 49  ? -35.776 96.340  9.550   1.00 26.82 ? 49   ILE B N     1 
ATOM   5269  C CA    . ILE B 1 49  ? -35.845 97.174  8.349   1.00 27.02 ? 49   ILE B CA    1 
ATOM   5270  C C     . ILE B 1 49  ? -37.097 98.081  8.408   1.00 27.65 ? 49   ILE B C     1 
ATOM   5271  O O     . ILE B 1 49  ? -36.986 99.299  8.570   1.00 27.38 ? 49   ILE B O     1 
ATOM   5272  C CB    . ILE B 1 49  ? -35.755 96.325  7.054   1.00 26.90 ? 49   ILE B CB    1 
ATOM   5273  C CG1   . ILE B 1 49  ? -34.522 95.403  7.146   1.00 27.95 ? 49   ILE B CG1   1 
ATOM   5274  C CG2   . ILE B 1 49  ? -35.714 97.235  5.807   1.00 26.52 ? 49   ILE B CG2   1 
ATOM   5275  C CD1   . ILE B 1 49  ? -33.966 94.849  5.833   1.00 26.93 ? 49   ILE B CD1   1 
ATOM   5276  N N     . THR B 1 50  ? -38.290 97.505  8.300   1.00 28.59 ? 50   THR B N     1 
ATOM   5277  C CA    . THR B 1 50  ? -39.470 98.280  8.649   1.00 29.61 ? 50   THR B CA    1 
ATOM   5278  C C     . THR B 1 50  ? -40.006 97.696  9.960   1.00 30.02 ? 50   THR B C     1 
ATOM   5279  O O     . THR B 1 50  ? -40.184 96.477  10.067  1.00 29.44 ? 50   THR B O     1 
ATOM   5280  C CB    . THR B 1 50  ? -40.535 98.461  7.472   1.00 30.11 ? 50   THR B CB    1 
ATOM   5281  O OG1   . THR B 1 50  ? -41.730 97.708  7.722   1.00 31.73 ? 50   THR B OG1   1 
ATOM   5282  C CG2   . THR B 1 50  ? -39.960 98.122  6.087   1.00 29.03 ? 50   THR B CG2   1 
ATOM   5283  N N     . PRO B 1 51  ? -40.189 98.567  10.985  1.00 30.54 ? 51   PRO B N     1 
ATOM   5284  C CA    . PRO B 1 51  ? -40.572 98.169  12.353  1.00 30.46 ? 51   PRO B CA    1 
ATOM   5285  C C     . PRO B 1 51  ? -41.964 97.560  12.429  1.00 30.36 ? 51   PRO B C     1 
ATOM   5286  O O     . PRO B 1 51  ? -42.871 97.974  11.710  1.00 30.37 ? 51   PRO B O     1 
ATOM   5287  C CB    . PRO B 1 51  ? -40.541 99.492  13.129  1.00 30.48 ? 51   PRO B CB    1 
ATOM   5288  C CG    . PRO B 1 51  ? -40.759 100.543 12.088  1.00 31.14 ? 51   PRO B CG    1 
ATOM   5289  C CD    . PRO B 1 51  ? -40.033 100.032 10.869  1.00 30.67 ? 51   PRO B CD    1 
ATOM   5290  N N     . TYR B 1 52  ? -42.132 96.567  13.293  1.00 30.25 ? 52   TYR B N     1 
ATOM   5291  C CA    . TYR B 1 52  ? -43.466 96.014  13.515  1.00 30.14 ? 52   TYR B CA    1 
ATOM   5292  C C     . TYR B 1 52  ? -44.337 96.962  14.365  1.00 30.13 ? 52   TYR B C     1 
ATOM   5293  O O     . TYR B 1 52  ? -43.836 97.812  15.114  1.00 29.40 ? 52   TYR B O     1 
ATOM   5294  C CB    . TYR B 1 52  ? -43.380 94.626  14.164  1.00 29.68 ? 52   TYR B CB    1 
ATOM   5295  C CG    . TYR B 1 52  ? -42.473 94.579  15.379  1.00 29.17 ? 52   TYR B CG    1 
ATOM   5296  C CD1   . TYR B 1 52  ? -42.923 95.009  16.628  1.00 28.80 ? 52   TYR B CD1   1 
ATOM   5297  C CD2   . TYR B 1 52  ? -41.160 94.110  15.277  1.00 28.80 ? 52   TYR B CD2   1 
ATOM   5298  C CE1   . TYR B 1 52  ? -42.090 94.973  17.741  1.00 28.93 ? 52   TYR B CE1   1 
ATOM   5299  C CE2   . TYR B 1 52  ? -40.322 94.059  16.393  1.00 27.57 ? 52   TYR B CE2   1 
ATOM   5300  C CZ    . TYR B 1 52  ? -40.793 94.485  17.610  1.00 28.17 ? 52   TYR B CZ    1 
ATOM   5301  O OH    . TYR B 1 52  ? -39.970 94.443  18.702  1.00 29.05 ? 52   TYR B OH    1 
ATOM   5302  N N     . GLN B 1 53  ? -45.643 96.800  14.227  1.00 30.66 ? 53   GLN B N     1 
ATOM   5303  C CA    . GLN B 1 53  ? -46.609 97.413  15.116  1.00 31.25 ? 53   GLN B CA    1 
ATOM   5304  C C     . GLN B 1 53  ? -47.334 96.271  15.849  1.00 31.08 ? 53   GLN B C     1 
ATOM   5305  O O     . GLN B 1 53  ? -47.359 96.244  17.090  1.00 31.15 ? 53   GLN B O     1 
ATOM   5306  C CB    . GLN B 1 53  ? -47.586 98.293  14.322  1.00 31.83 ? 53   GLN B CB    1 
ATOM   5307  C CG    . GLN B 1 53  ? -47.790 99.702  14.918  1.00 33.92 ? 53   GLN B CG    1 
ATOM   5308  N N     . LYS B 1 54  ? -47.887 95.318  15.087  1.00 30.54 ? 54   LYS B N     1 
ATOM   5309  C CA    . LYS B 1 54  ? -48.571 94.154  15.663  1.00 30.17 ? 54   LYS B CA    1 
ATOM   5310  C C     . LYS B 1 54  ? -47.527 93.206  16.220  1.00 29.66 ? 54   LYS B C     1 
ATOM   5311  O O     . LYS B 1 54  ? -46.533 92.930  15.569  1.00 30.49 ? 54   LYS B O     1 
ATOM   5312  C CB    . LYS B 1 54  ? -49.447 93.442  14.619  1.00 30.12 ? 54   LYS B CB    1 
ATOM   5313  N N     . VAL B 1 55  ? -47.716 92.747  17.445  1.00 29.06 ? 55   VAL B N     1 
ATOM   5314  C CA    . VAL B 1 55  ? -46.777 91.810  18.043  1.00 28.05 ? 55   VAL B CA    1 
ATOM   5315  C C     . VAL B 1 55  ? -47.405 90.394  17.998  1.00 27.93 ? 55   VAL B C     1 
ATOM   5316  O O     . VAL B 1 55  ? -47.064 89.577  17.131  1.00 27.11 ? 55   VAL B O     1 
ATOM   5317  C CB    . VAL B 1 55  ? -46.370 92.246  19.488  1.00 28.27 ? 55   VAL B CB    1 
ATOM   5318  C CG1   . VAL B 1 55  ? -45.440 91.222  20.155  1.00 26.84 ? 55   VAL B CG1   1 
ATOM   5319  C CG2   . VAL B 1 55  ? -45.736 93.617  19.478  1.00 27.32 ? 55   VAL B CG2   1 
ATOM   5320  N N     . LYS B 1 56  ? -48.339 90.120  18.909  1.00 27.39 ? 56   LYS B N     1 
ATOM   5321  C CA    . LYS B 1 56  ? -48.890 88.784  19.023  1.00 27.28 ? 56   LYS B CA    1 
ATOM   5322  C C     . LYS B 1 56  ? -50.240 88.676  18.346  1.00 27.18 ? 56   LYS B C     1 
ATOM   5323  O O     . LYS B 1 56  ? -51.208 89.296  18.776  1.00 26.75 ? 56   LYS B O     1 
ATOM   5324  C CB    . LYS B 1 56  ? -48.989 88.359  20.486  1.00 27.26 ? 56   LYS B CB    1 
ATOM   5325  C CG    . LYS B 1 56  ? -49.612 86.984  20.687  1.00 26.86 ? 56   LYS B CG    1 
ATOM   5326  C CD    . LYS B 1 56  ? -49.443 86.550  22.114  1.00 27.52 ? 56   LYS B CD    1 
ATOM   5327  C CE    . LYS B 1 56  ? -49.824 85.097  22.319  1.00 26.76 ? 56   LYS B CE    1 
ATOM   5328  N NZ    . LYS B 1 56  ? -51.182 85.032  22.843  1.00 26.28 ? 56   LYS B NZ    1 
ATOM   5329  N N     . ASN B 1 57  ? -50.283 87.863  17.292  1.00 27.39 ? 57   ASN B N     1 
ATOM   5330  C CA    . ASN B 1 57  ? -51.532 87.515  16.593  1.00 27.30 ? 57   ASN B CA    1 
ATOM   5331  C C     . ASN B 1 57  ? -51.640 85.990  16.388  1.00 26.71 ? 57   ASN B C     1 
ATOM   5332  O O     . ASN B 1 57  ? -51.299 85.470  15.320  1.00 26.32 ? 57   ASN B O     1 
ATOM   5333  C CB    . ASN B 1 57  ? -51.618 88.269  15.249  1.00 27.14 ? 57   ASN B CB    1 
ATOM   5334  C CG    . ASN B 1 57  ? -52.996 88.169  14.605  1.00 27.21 ? 57   ASN B CG    1 
ATOM   5335  O OD1   . ASN B 1 57  ? -53.955 87.699  15.221  1.00 28.28 ? 57   ASN B OD1   1 
ATOM   5336  N ND2   . ASN B 1 57  ? -53.099 88.613  13.360  1.00 25.87 ? 57   ASN B ND2   1 
ATOM   5337  N N     . THR B 1 58  ? -52.091 85.282  17.425  1.00 26.19 ? 58   THR B N     1 
ATOM   5338  C CA    . THR B 1 58  ? -52.058 83.806  17.421  1.00 25.99 ? 58   THR B CA    1 
ATOM   5339  C C     . THR B 1 58  ? -53.370 83.151  17.883  1.00 25.67 ? 58   THR B C     1 
ATOM   5340  O O     . THR B 1 58  ? -54.178 83.771  18.593  1.00 25.78 ? 58   THR B O     1 
ATOM   5341  C CB    . THR B 1 58  ? -50.931 83.244  18.318  1.00 25.69 ? 58   THR B CB    1 
ATOM   5342  O OG1   . THR B 1 58  ? -51.170 83.657  19.655  1.00 26.19 ? 58   THR B OG1   1 
ATOM   5343  C CG2   . THR B 1 58  ? -49.566 83.745  17.896  1.00 25.66 ? 58   THR B CG2   1 
ATOM   5344  N N     . SER B 1 59  ? -53.563 81.895  17.472  1.00 24.73 ? 59   SER B N     1 
ATOM   5345  C CA    . SER B 1 59  ? -54.741 81.108  17.838  1.00 23.62 ? 59   SER B CA    1 
ATOM   5346  C C     . SER B 1 59  ? -54.539 79.599  17.642  1.00 23.48 ? 59   SER B C     1 
ATOM   5347  O O     . SER B 1 59  ? -54.087 79.142  16.573  1.00 22.15 ? 59   SER B O     1 
ATOM   5348  C CB    . SER B 1 59  ? -55.970 81.569  17.060  1.00 23.67 ? 59   SER B CB    1 
ATOM   5349  O OG    . SER B 1 59  ? -57.001 80.627  17.194  1.00 21.74 ? 59   SER B OG    1 
ATOM   5350  N N     . PHE B 1 60  ? -54.877 78.858  18.704  1.00 22.89 ? 60   PHE B N     1 
ATOM   5351  C CA    . PHE B 1 60  ? -54.828 77.397  18.739  1.00 22.70 ? 60   PHE B CA    1 
ATOM   5352  C C     . PHE B 1 60  ? -56.239 76.789  18.535  1.00 23.00 ? 60   PHE B C     1 
ATOM   5353  O O     . PHE B 1 60  ? -56.477 75.622  18.897  1.00 22.90 ? 60   PHE B O     1 
ATOM   5354  C CB    . PHE B 1 60  ? -54.267 76.906  20.097  1.00 22.42 ? 60   PHE B CB    1 
ATOM   5355  C CG    . PHE B 1 60  ? -52.804 77.216  20.332  1.00 21.21 ? 60   PHE B CG    1 
ATOM   5356  C CD1   . PHE B 1 60  ? -52.240 76.945  21.568  1.00 19.67 ? 60   PHE B CD1   1 
ATOM   5357  C CD2   . PHE B 1 60  ? -52.003 77.798  19.334  1.00 19.14 ? 60   PHE B CD2   1 
ATOM   5358  C CE1   . PHE B 1 60  ? -50.880 77.220  21.817  1.00 20.87 ? 60   PHE B CE1   1 
ATOM   5359  C CE2   . PHE B 1 60  ? -50.655 78.084  19.549  1.00 18.21 ? 60   PHE B CE2   1 
ATOM   5360  C CZ    . PHE B 1 60  ? -50.077 77.795  20.795  1.00 20.85 ? 60   PHE B CZ    1 
ATOM   5361  N N     . ALA B 1 61  ? -57.166 77.582  17.991  1.00 22.74 ? 61   ALA B N     1 
ATOM   5362  C CA    . ALA B 1 61  ? -58.575 77.206  17.916  1.00 23.13 ? 61   ALA B CA    1 
ATOM   5363  C C     . ALA B 1 61  ? -58.738 76.005  17.013  1.00 23.20 ? 61   ALA B C     1 
ATOM   5364  O O     . ALA B 1 61  ? -58.181 75.982  15.942  1.00 23.52 ? 61   ALA B O     1 
ATOM   5365  C CB    . ALA B 1 61  ? -59.426 78.376  17.394  1.00 23.39 ? 61   ALA B CB    1 
ATOM   5366  N N     . PRO B 1 62  ? -59.484 74.989  17.457  1.00 23.96 ? 62   PRO B N     1 
ATOM   5367  C CA    . PRO B 1 62  ? -59.677 73.776  16.654  1.00 24.73 ? 62   PRO B CA    1 
ATOM   5368  C C     . PRO B 1 62  ? -60.079 74.046  15.192  1.00 25.70 ? 62   PRO B C     1 
ATOM   5369  O O     . PRO B 1 62  ? -61.043 74.773  14.929  1.00 25.55 ? 62   PRO B O     1 
ATOM   5370  C CB    . PRO B 1 62  ? -60.786 73.047  17.413  1.00 25.00 ? 62   PRO B CB    1 
ATOM   5371  C CG    . PRO B 1 62  ? -60.582 73.484  18.846  1.00 23.86 ? 62   PRO B CG    1 
ATOM   5372  C CD    . PRO B 1 62  ? -60.169 74.906  18.760  1.00 23.20 ? 62   PRO B CD    1 
ATOM   5373  N N     . GLY B 1 63  ? -59.318 73.475  14.256  1.00 26.78 ? 63   GLY B N     1 
ATOM   5374  C CA    . GLY B 1 63  ? -59.551 73.659  12.817  1.00 27.78 ? 63   GLY B CA    1 
ATOM   5375  C C     . GLY B 1 63  ? -59.355 75.062  12.246  1.00 28.23 ? 63   GLY B C     1 
ATOM   5376  O O     . GLY B 1 63  ? -59.870 75.371  11.159  1.00 28.54 ? 63   GLY B O     1 
ATOM   5377  N N     . ASN B 1 64  ? -58.608 75.906  12.960  1.00 28.02 ? 64   ASN B N     1 
ATOM   5378  C CA    . ASN B 1 64  ? -58.336 77.273  12.521  1.00 28.14 ? 64   ASN B CA    1 
ATOM   5379  C C     . ASN B 1 64  ? -57.104 77.801  13.251  1.00 28.13 ? 64   ASN B C     1 
ATOM   5380  O O     . ASN B 1 64  ? -57.073 78.959  13.705  1.00 28.26 ? 64   ASN B O     1 
ATOM   5381  C CB    . ASN B 1 64  ? -59.555 78.187  12.763  1.00 28.38 ? 64   ASN B CB    1 
ATOM   5382  C CG    . ASN B 1 64  ? -59.567 79.458  11.858  1.00 29.62 ? 64   ASN B CG    1 
ATOM   5383  O OD1   . ASN B 1 64  ? -60.317 80.423  12.117  1.00 28.31 ? 64   ASN B OD1   1 
ATOM   5384  N ND2   . ASN B 1 64  ? -58.772 79.440  10.788  1.00 29.01 ? 64   ASN B ND2   1 
ATOM   5385  N N     . VAL B 1 65  ? -56.086 76.943  13.355  1.00 27.67 ? 65   VAL B N     1 
ATOM   5386  C CA    . VAL B 1 65  ? -54.813 77.292  13.998  1.00 27.03 ? 65   VAL B CA    1 
ATOM   5387  C C     . VAL B 1 65  ? -53.993 78.255  13.133  1.00 27.17 ? 65   VAL B C     1 
ATOM   5388  O O     . VAL B 1 65  ? -53.754 77.983  11.955  1.00 27.68 ? 65   VAL B O     1 
ATOM   5389  C CB    . VAL B 1 65  ? -53.993 76.017  14.362  1.00 27.07 ? 65   VAL B CB    1 
ATOM   5390  C CG1   . VAL B 1 65  ? -52.630 76.375  14.925  1.00 25.43 ? 65   VAL B CG1   1 
ATOM   5391  C CG2   . VAL B 1 65  ? -54.791 75.135  15.349  1.00 26.37 ? 65   VAL B CG2   1 
ATOM   5392  N N     . SER B 1 66  ? -53.581 79.386  13.720  1.00 27.03 ? 66   SER B N     1 
ATOM   5393  C CA    . SER B 1 66  ? -52.791 80.401  13.023  1.00 26.29 ? 66   SER B CA    1 
ATOM   5394  C C     . SER B 1 66  ? -51.866 81.120  13.989  1.00 26.09 ? 66   SER B C     1 
ATOM   5395  O O     . SER B 1 66  ? -52.315 81.685  14.982  1.00 26.83 ? 66   SER B O     1 
ATOM   5396  C CB    . SER B 1 66  ? -53.704 81.425  12.321  1.00 26.80 ? 66   SER B CB    1 
ATOM   5397  O OG    . SER B 1 66  ? -52.945 82.374  11.580  1.00 25.52 ? 66   SER B OG    1 
ATOM   5398  N N     . ILE B 1 67  ? -50.581 81.137  13.665  1.00 25.55 ? 67   ILE B N     1 
ATOM   5399  C CA    . ILE B 1 67  ? -49.556 81.718  14.526  1.00 25.09 ? 67   ILE B CA    1 
ATOM   5400  C C     . ILE B 1 67  ? -48.810 82.810  13.777  1.00 25.50 ? 67   ILE B C     1 
ATOM   5401  O O     . ILE B 1 67  ? -48.156 82.557  12.759  1.00 26.03 ? 67   ILE B O     1 
ATOM   5402  C CB    . ILE B 1 67  ? -48.562 80.627  15.041  1.00 24.81 ? 67   ILE B CB    1 
ATOM   5403  C CG1   . ILE B 1 67  ? -49.340 79.557  15.853  1.00 25.01 ? 67   ILE B CG1   1 
ATOM   5404  C CG2   . ILE B 1 67  ? -47.403 81.258  15.826  1.00 22.16 ? 67   ILE B CG2   1 
ATOM   5405  C CD1   . ILE B 1 67  ? -48.916 78.100  15.626  1.00 20.78 ? 67   ILE B CD1   1 
ATOM   5406  N N     . LYS B 1 68  ? -48.916 84.035  14.278  1.00 25.66 ? 68   LYS B N     1 
ATOM   5407  C CA    . LYS B 1 68  ? -48.192 85.142  13.690  1.00 25.69 ? 68   LYS B CA    1 
ATOM   5408  C C     . LYS B 1 68  ? -47.587 86.004  14.766  1.00 25.61 ? 68   LYS B C     1 
ATOM   5409  O O     . LYS B 1 68  ? -48.209 86.267  15.801  1.00 26.03 ? 68   LYS B O     1 
ATOM   5410  C CB    . LYS B 1 68  ? -49.104 85.967  12.776  1.00 26.25 ? 68   LYS B CB    1 
ATOM   5411  C CG    . LYS B 1 68  ? -49.440 85.282  11.459  1.00 27.23 ? 68   LYS B CG    1 
ATOM   5412  C CD    . LYS B 1 68  ? -50.687 85.873  10.824  1.00 29.40 ? 68   LYS B CD    1 
ATOM   5413  C CE    . LYS B 1 68  ? -50.896 85.281  9.432   1.00 32.42 ? 68   LYS B CE    1 
ATOM   5414  N NZ    . LYS B 1 68  ? -51.965 86.019  8.681   1.00 34.54 ? 68   LYS B NZ    1 
ATOM   5415  N N     . TRP B 1 69  ? -46.364 86.442  14.524  1.00 25.40 ? 69   TRP B N     1 
ATOM   5416  C CA    . TRP B 1 69  ? -45.678 87.317  15.447  1.00 25.13 ? 69   TRP B CA    1 
ATOM   5417  C C     . TRP B 1 69  ? -44.967 88.357  14.609  1.00 25.34 ? 69   TRP B C     1 
ATOM   5418  O O     . TRP B 1 69  ? -44.369 88.015  13.584  1.00 25.87 ? 69   TRP B O     1 
ATOM   5419  C CB    . TRP B 1 69  ? -44.652 86.533  16.266  1.00 25.31 ? 69   TRP B CB    1 
ATOM   5420  C CG    . TRP B 1 69  ? -45.211 85.695  17.394  1.00 25.06 ? 69   TRP B CG    1 
ATOM   5421  C CD1   . TRP B 1 69  ? -45.627 84.400  17.328  1.00 24.71 ? 69   TRP B CD1   1 
ATOM   5422  C CD2   . TRP B 1 69  ? -45.393 86.106  18.756  1.00 24.19 ? 69   TRP B CD2   1 
ATOM   5423  N NE1   . TRP B 1 69  ? -46.053 83.969  18.567  1.00 24.25 ? 69   TRP B NE1   1 
ATOM   5424  C CE2   . TRP B 1 69  ? -45.918 84.994  19.462  1.00 23.65 ? 69   TRP B CE2   1 
ATOM   5425  C CE3   . TRP B 1 69  ? -45.164 87.306  19.449  1.00 24.00 ? 69   TRP B CE3   1 
ATOM   5426  C CZ2   . TRP B 1 69  ? -46.217 85.040  20.825  1.00 23.68 ? 69   TRP B CZ2   1 
ATOM   5427  C CZ3   . TRP B 1 69  ? -45.460 87.355  20.811  1.00 25.55 ? 69   TRP B CZ3   1 
ATOM   5428  C CH2   . TRP B 1 69  ? -45.986 86.221  21.484  1.00 25.24 ? 69   TRP B CH2   1 
ATOM   5429  N N     . TYR B 1 70  ? -45.044 89.618  15.034  1.00 25.32 ? 70   TYR B N     1 
ATOM   5430  C CA    . TYR B 1 70  ? -44.389 90.752  14.361  1.00 25.35 ? 70   TYR B CA    1 
ATOM   5431  C C     . TYR B 1 70  ? -44.725 90.903  12.877  1.00 25.70 ? 70   TYR B C     1 
ATOM   5432  O O     . TYR B 1 70  ? -43.894 91.376  12.108  1.00 25.18 ? 70   TYR B O     1 
ATOM   5433  C CB    . TYR B 1 70  ? -42.871 90.662  14.511  1.00 24.84 ? 70   TYR B CB    1 
ATOM   5434  C CG    . TYR B 1 70  ? -42.367 90.444  15.908  1.00 24.18 ? 70   TYR B CG    1 
ATOM   5435  C CD1   . TYR B 1 70  ? -41.670 89.284  16.232  1.00 23.01 ? 70   TYR B CD1   1 
ATOM   5436  C CD2   . TYR B 1 70  ? -42.559 91.406  16.908  1.00 22.64 ? 70   TYR B CD2   1 
ATOM   5437  C CE1   . TYR B 1 70  ? -41.167 89.077  17.515  1.00 21.00 ? 70   TYR B CE1   1 
ATOM   5438  C CE2   . TYR B 1 70  ? -42.055 91.211  18.190  1.00 22.79 ? 70   TYR B CE2   1 
ATOM   5439  C CZ    . TYR B 1 70  ? -41.367 90.034  18.482  1.00 23.05 ? 70   TYR B CZ    1 
ATOM   5440  O OH    . TYR B 1 70  ? -40.873 89.812  19.748  1.00 24.48 ? 70   TYR B OH    1 
ATOM   5441  N N     . GLU B 1 71  ? -45.949 90.534  12.496  1.00 26.64 ? 71   GLU B N     1 
ATOM   5442  C CA    . GLU B 1 71  ? -46.273 90.237  11.097  1.00 27.70 ? 71   GLU B CA    1 
ATOM   5443  C C     . GLU B 1 71  ? -46.099 91.414  10.136  1.00 27.80 ? 71   GLU B C     1 
ATOM   5444  O O     . GLU B 1 71  ? -45.838 91.200  8.954   1.00 28.15 ? 71   GLU B O     1 
ATOM   5445  C CB    . GLU B 1 71  ? -47.680 89.642  10.966  1.00 27.90 ? 71   GLU B CB    1 
ATOM   5446  C CG    . GLU B 1 71  ? -48.798 90.633  11.216  1.00 30.77 ? 71   GLU B CG    1 
ATOM   5447  C CD    . GLU B 1 71  ? -50.080 89.958  11.639  1.00 35.40 ? 71   GLU B CD    1 
ATOM   5448  O OE1   . GLU B 1 71  ? -50.172 89.525  12.809  1.00 36.53 ? 71   GLU B OE1   1 
ATOM   5449  O OE2   . GLU B 1 71  ? -51.006 89.867  10.800  1.00 38.92 ? 71   GLU B OE2   1 
ATOM   5450  N N     . ASP B 1 72  ? -46.231 92.639  10.637  1.00 27.65 ? 72   ASP B N     1 
ATOM   5451  C CA    . ASP B 1 72  ? -46.077 93.810  9.791   1.00 28.17 ? 72   ASP B CA    1 
ATOM   5452  C C     . ASP B 1 72  ? -44.653 94.357  9.773   1.00 28.25 ? 72   ASP B C     1 
ATOM   5453  O O     . ASP B 1 72  ? -44.395 95.388  9.128   1.00 29.08 ? 72   ASP B O     1 
ATOM   5454  C CB    . ASP B 1 72  ? -47.092 94.912  10.137  1.00 28.44 ? 72   ASP B CB    1 
ATOM   5455  C CG    . ASP B 1 72  ? -47.170 95.212  11.634  1.00 30.12 ? 72   ASP B CG    1 
ATOM   5456  O OD1   . ASP B 1 72  ? -46.338 94.699  12.435  1.00 30.66 ? 72   ASP B OD1   1 
ATOM   5457  O OD2   . ASP B 1 72  ? -48.089 95.978  12.004  1.00 32.11 ? 72   ASP B OD2   1 
ATOM   5458  N N     . GLY B 1 73  ? -43.729 93.676  10.446  1.00 27.52 ? 73   GLY B N     1 
ATOM   5459  C CA    . GLY B 1 73  ? -42.325 94.062  10.392  1.00 26.94 ? 73   GLY B CA    1 
ATOM   5460  C C     . GLY B 1 73  ? -41.528 93.320  9.332   1.00 26.61 ? 73   GLY B C     1 
ATOM   5461  O O     . GLY B 1 73  ? -41.880 92.197  8.950   1.00 26.95 ? 73   GLY B O     1 
ATOM   5462  N N     . THR B 1 74  ? -40.458 93.955  8.854   1.00 26.27 ? 74   THR B N     1 
ATOM   5463  C CA    . THR B 1 74  ? -39.472 93.304  7.983   1.00 26.18 ? 74   THR B CA    1 
ATOM   5464  C C     . THR B 1 74  ? -38.050 93.388  8.538   1.00 25.73 ? 74   THR B C     1 
ATOM   5465  O O     . THR B 1 74  ? -37.701 94.311  9.282   1.00 25.64 ? 74   THR B O     1 
ATOM   5466  C CB    . THR B 1 74  ? -39.463 93.820  6.505   1.00 26.47 ? 74   THR B CB    1 
ATOM   5467  O OG1   . THR B 1 74  ? -38.786 95.083  6.430   1.00 27.50 ? 74   THR B OG1   1 
ATOM   5468  C CG2   . THR B 1 74  ? -40.888 93.925  5.928   1.00 26.15 ? 74   THR B CG2   1 
ATOM   5469  N N     . LEU B 1 75  ? -37.242 92.404  8.155   1.00 25.07 ? 75   LEU B N     1 
ATOM   5470  C CA    . LEU B 1 75  ? -35.902 92.237  8.677   1.00 25.11 ? 75   LEU B CA    1 
ATOM   5471  C C     . LEU B 1 75  ? -35.149 91.293  7.752   1.00 24.86 ? 75   LEU B C     1 
ATOM   5472  O O     . LEU B 1 75  ? -35.717 90.752  6.803   1.00 24.89 ? 75   LEU B O     1 
ATOM   5473  C CB    . LEU B 1 75  ? -35.948 91.658  10.103  1.00 25.05 ? 75   LEU B CB    1 
ATOM   5474  C CG    . LEU B 1 75  ? -36.243 90.168  10.348  1.00 24.50 ? 75   LEU B CG    1 
ATOM   5475  C CD1   . LEU B 1 75  ? -36.002 89.844  11.809  1.00 23.04 ? 75   LEU B CD1   1 
ATOM   5476  C CD2   . LEU B 1 75  ? -37.675 89.724  9.909   1.00 23.83 ? 75   LEU B CD2   1 
ATOM   5477  N N     . ASN B 1 76  ? -33.869 91.110  8.034   1.00 24.09 ? 76   ASN B N     1 
ATOM   5478  C CA    . ASN B 1 76  ? -33.067 90.101  7.368   1.00 23.65 ? 76   ASN B CA    1 
ATOM   5479  C C     . ASN B 1 76  ? -32.209 89.385  8.416   1.00 23.22 ? 76   ASN B C     1 
ATOM   5480  O O     . ASN B 1 76  ? -31.501 90.031  9.189   1.00 22.68 ? 76   ASN B O     1 
ATOM   5481  C CB    . ASN B 1 76  ? -32.215 90.743  6.257   1.00 23.70 ? 76   ASN B CB    1 
ATOM   5482  C CG    . ASN B 1 76  ? -31.645 89.717  5.284   1.00 23.34 ? 76   ASN B CG    1 
ATOM   5483  O OD1   . ASN B 1 76  ? -32.080 89.632  4.142   1.00 24.88 ? 76   ASN B OD1   1 
ATOM   5484  N ND2   . ASN B 1 76  ? -30.683 88.926  5.742   1.00 23.64 ? 76   ASN B ND2   1 
ATOM   5485  N N     . LEU B 1 77  ? -32.295 88.060  8.460   1.00 23.27 ? 77   LEU B N     1 
ATOM   5486  C CA    . LEU B 1 77  ? -31.571 87.301  9.486   1.00 23.57 ? 77   LEU B CA    1 
ATOM   5487  C C     . LEU B 1 77  ? -30.068 87.406  9.322   1.00 23.50 ? 77   LEU B C     1 
ATOM   5488  O O     . LEU B 1 77  ? -29.353 87.573  10.308  1.00 23.81 ? 77   LEU B O     1 
ATOM   5489  C CB    . LEU B 1 77  ? -31.999 85.830  9.500   1.00 23.81 ? 77   LEU B CB    1 
ATOM   5490  C CG    . LEU B 1 77  ? -31.144 84.827  10.280  1.00 22.89 ? 77   LEU B CG    1 
ATOM   5491  C CD1   . LEU B 1 77  ? -32.024 83.740  10.872  1.00 18.99 ? 77   LEU B CD1   1 
ATOM   5492  C CD2   . LEU B 1 77  ? -30.025 84.240  9.365   1.00 20.81 ? 77   LEU B CD2   1 
ATOM   5493  N N     . ALA B 1 78  ? -29.598 87.310  8.081   1.00 23.55 ? 78   ALA B N     1 
ATOM   5494  C CA    . ALA B 1 78  ? -28.179 87.487  7.769   1.00 23.78 ? 78   ALA B CA    1 
ATOM   5495  C C     . ALA B 1 78  ? -27.649 88.860  8.220   1.00 23.88 ? 78   ALA B C     1 
ATOM   5496  O O     . ALA B 1 78  ? -26.548 88.958  8.804   1.00 24.07 ? 78   ALA B O     1 
ATOM   5497  C CB    . ALA B 1 78  ? -27.934 87.284  6.293   1.00 23.44 ? 78   ALA B CB    1 
ATOM   5498  N N     . ALA B 1 79  ? -28.437 89.903  7.967   1.00 23.48 ? 79   ALA B N     1 
ATOM   5499  C CA    . ALA B 1 79  ? -28.066 91.254  8.384   1.00 23.96 ? 79   ALA B CA    1 
ATOM   5500  C C     . ALA B 1 79  ? -27.929 91.317  9.900   1.00 23.77 ? 79   ALA B C     1 
ATOM   5501  O O     . ALA B 1 79  ? -27.057 92.002  10.441  1.00 24.07 ? 79   ALA B O     1 
ATOM   5502  C CB    . ALA B 1 79  ? -29.106 92.288  7.883   1.00 24.00 ? 79   ALA B CB    1 
ATOM   5503  N N     . ASN B 1 80  ? -28.799 90.582  10.580  1.00 23.69 ? 80   ASN B N     1 
ATOM   5504  C CA    . ASN B 1 80  ? -28.763 90.493  12.027  1.00 23.34 ? 80   ASN B CA    1 
ATOM   5505  C C     . ASN B 1 80  ? -27.610 89.647  12.560  1.00 23.42 ? 80   ASN B C     1 
ATOM   5506  O O     . ASN B 1 80  ? -27.109 89.896  13.655  1.00 23.26 ? 80   ASN B O     1 
ATOM   5507  C CB    . ASN B 1 80  ? -30.111 90.015  12.543  1.00 23.01 ? 80   ASN B CB    1 
ATOM   5508  C CG    . ASN B 1 80  ? -31.072 91.159  12.746  1.00 23.13 ? 80   ASN B CG    1 
ATOM   5509  O OD1   . ASN B 1 80  ? -31.052 91.806  13.790  1.00 24.34 ? 80   ASN B OD1   1 
ATOM   5510  N ND2   . ASN B 1 80  ? -31.905 91.437  11.741  1.00 22.71 ? 80   ASN B ND2   1 
ATOM   5511  N N     . CYS B 1 81  ? -27.180 88.667  11.767  1.00 23.37 ? 81   CYS B N     1 
ATOM   5512  C CA    . CYS B 1 81  ? -26.169 87.698  12.210  1.00 23.08 ? 81   CYS B CA    1 
ATOM   5513  C C     . CYS B 1 81  ? -24.775 88.137  11.796  1.00 22.60 ? 81   CYS B C     1 
ATOM   5514  O O     . CYS B 1 81  ? -23.775 87.590  12.284  1.00 22.33 ? 81   CYS B O     1 
ATOM   5515  C CB    . CYS B 1 81  ? -26.483 86.294  11.654  1.00 22.21 ? 81   CYS B CB    1 
ATOM   5516  S SG    . CYS B 1 81  ? -27.871 85.523  12.501  1.00 24.15 ? 81   CYS B SG    1 
ATOM   5517  N N     . LEU B 1 82  ? -24.722 89.117  10.888  1.00 21.98 ? 82   LEU B N     1 
ATOM   5518  C CA    . LEU B 1 82  ? -23.472 89.466  10.207  1.00 21.60 ? 82   LEU B CA    1 
ATOM   5519  C C     . LEU B 1 82  ? -23.219 90.966  10.082  1.00 21.48 ? 82   LEU B C     1 
ATOM   5520  O O     . LEU B 1 82  ? -22.458 91.549  10.868  1.00 21.25 ? 82   LEU B O     1 
ATOM   5521  C CB    . LEU B 1 82  ? -23.427 88.809  8.815   1.00 21.18 ? 82   LEU B CB    1 
ATOM   5522  C CG    . LEU B 1 82  ? -23.523 87.289  8.766   1.00 20.29 ? 82   LEU B CG    1 
ATOM   5523  C CD1   . LEU B 1 82  ? -23.711 86.774  7.359   1.00 20.12 ? 82   LEU B CD1   1 
ATOM   5524  C CD2   . LEU B 1 82  ? -22.263 86.693  9.366   1.00 20.33 ? 82   LEU B CD2   1 
ATOM   5525  N N     . ASP B 1 83  ? -23.868 91.575  9.087   1.00 21.62 ? 83   ASP B N     1 
ATOM   5526  C CA    . ASP B 1 83  ? -23.650 92.983  8.732   1.00 21.68 ? 83   ASP B CA    1 
ATOM   5527  C C     . ASP B 1 83  ? -23.645 93.918  9.941   1.00 21.36 ? 83   ASP B C     1 
ATOM   5528  O O     . ASP B 1 83  ? -22.799 94.813  10.012  1.00 21.02 ? 83   ASP B O     1 
ATOM   5529  C CB    . ASP B 1 83  ? -24.657 93.472  7.683   1.00 21.62 ? 83   ASP B CB    1 
ATOM   5530  C CG    . ASP B 1 83  ? -24.865 92.476  6.535   1.00 22.85 ? 83   ASP B CG    1 
ATOM   5531  O OD1   . ASP B 1 83  ? -24.950 92.912  5.365   1.00 24.25 ? 83   ASP B OD1   1 
ATOM   5532  O OD2   . ASP B 1 83  ? -24.975 91.257  6.790   1.00 24.59 ? 83   ASP B OD2   1 
ATOM   5533  N N     . ARG B 1 84  ? -24.557 93.711  10.899  1.00 21.17 ? 84   ARG B N     1 
ATOM   5534  C CA    . ARG B 1 84  ? -24.711 94.698  11.993  1.00 20.84 ? 84   ARG B CA    1 
ATOM   5535  C C     . ARG B 1 84  ? -23.575 94.660  12.986  1.00 20.70 ? 84   ARG B C     1 
ATOM   5536  O O     . ARG B 1 84  ? -23.445 95.564  13.826  1.00 21.82 ? 84   ARG B O     1 
ATOM   5537  C CB    . ARG B 1 84  ? -26.066 94.588  12.719  1.00 20.75 ? 84   ARG B CB    1 
ATOM   5538  C CG    . ARG B 1 84  ? -26.310 93.283  13.514  1.00 20.74 ? 84   ARG B CG    1 
ATOM   5539  C CD    . ARG B 1 84  ? -27.555 93.430  14.331  1.00 19.57 ? 84   ARG B CD    1 
ATOM   5540  N NE    . ARG B 1 84  ? -27.865 92.268  15.145  1.00 19.63 ? 84   ARG B NE    1 
ATOM   5541  C CZ    . ARG B 1 84  ? -28.760 92.273  16.132  1.00 17.15 ? 84   ARG B CZ    1 
ATOM   5542  N NH1   . ARG B 1 84  ? -29.418 93.373  16.411  1.00 15.82 ? 84   ARG B NH1   1 
ATOM   5543  N NH2   . ARG B 1 84  ? -28.994 91.176  16.843  1.00 17.69 ? 84   ARG B NH2   1 
ATOM   5544  N N     . HIS B 1 85  ? -22.761 93.613  12.906  1.00 19.81 ? 85   HIS B N     1 
ATOM   5545  C CA    . HIS B 1 85  ? -21.667 93.443  13.843  1.00 19.35 ? 85   HIS B CA    1 
ATOM   5546  C C     . HIS B 1 85  ? -20.369 94.001  13.257  1.00 19.58 ? 85   HIS B C     1 
ATOM   5547  O O     . HIS B 1 85  ? -19.343 94.080  13.943  1.00 19.23 ? 85   HIS B O     1 
ATOM   5548  C CB    . HIS B 1 85  ? -21.509 91.978  14.225  1.00 18.63 ? 85   HIS B CB    1 
ATOM   5549  C CG    . HIS B 1 85  ? -22.759 91.366  14.778  1.00 18.67 ? 85   HIS B CG    1 
ATOM   5550  N ND1   . HIS B 1 85  ? -23.359 91.816  15.937  1.00 17.09 ? 85   HIS B ND1   1 
ATOM   5551  C CD2   . HIS B 1 85  ? -23.518 90.331  14.335  1.00 15.49 ? 85   HIS B CD2   1 
ATOM   5552  C CE1   . HIS B 1 85  ? -24.429 91.079  16.187  1.00 16.50 ? 85   HIS B CE1   1 
ATOM   5553  N NE2   . HIS B 1 85  ? -24.555 90.184  15.223  1.00 16.66 ? 85   HIS B NE2   1 
ATOM   5554  N N     . LEU B 1 86  ? -20.431 94.425  11.996  1.00 19.45 ? 86   LEU B N     1 
ATOM   5555  C CA    . LEU B 1 86  ? -19.223 94.770  11.273  1.00 19.21 ? 86   LEU B CA    1 
ATOM   5556  C C     . LEU B 1 86  ? -18.616 96.063  11.742  1.00 19.08 ? 86   LEU B C     1 
ATOM   5557  O O     . LEU B 1 86  ? -17.394 96.179  11.785  1.00 19.14 ? 86   LEU B O     1 
ATOM   5558  C CB    . LEU B 1 86  ? -19.447 94.795  9.760   1.00 19.11 ? 86   LEU B CB    1 
ATOM   5559  C CG    . LEU B 1 86  ? -19.793 93.459  9.104   1.00 19.54 ? 86   LEU B CG    1 
ATOM   5560  C CD1   . LEU B 1 86  ? -19.654 93.598  7.619   1.00 18.26 ? 86   LEU B CD1   1 
ATOM   5561  C CD2   . LEU B 1 86  ? -18.918 92.323  9.635   1.00 19.12 ? 86   LEU B CD2   1 
ATOM   5562  N N     . GLN B 1 87  ? -19.458 97.020  12.110  1.00 19.53 ? 87   GLN B N     1 
ATOM   5563  C CA    . GLN B 1 87  ? -18.978 98.370  12.411  1.00 20.03 ? 87   GLN B CA    1 
ATOM   5564  C C     . GLN B 1 87  ? -18.051 98.431  13.623  1.00 20.39 ? 87   GLN B C     1 
ATOM   5565  O O     . GLN B 1 87  ? -16.972 99.007  13.535  1.00 20.32 ? 87   GLN B O     1 
ATOM   5566  C CB    . GLN B 1 87  ? -20.120 99.375  12.588  1.00 19.81 ? 87   GLN B CB    1 
ATOM   5567  C CG    . GLN B 1 87  ? -19.604 100.810 12.802  1.00 19.43 ? 87   GLN B CG    1 
ATOM   5568  C CD    . GLN B 1 87  ? -20.711 101.805 13.046  1.00 18.61 ? 87   GLN B CD    1 
ATOM   5569  O OE1   . GLN B 1 87  ? -20.612 102.986 12.660  1.00 15.40 ? 87   GLN B OE1   1 
ATOM   5570  N NE2   . GLN B 1 87  ? -21.779 101.340 13.692  1.00 16.64 ? 87   GLN B NE2   1 
ATOM   5571  N N     . GLU B 1 88  ? -18.483 97.859  14.744  1.00 20.89 ? 88   GLU B N     1 
ATOM   5572  C CA    . GLU B 1 88  ? -17.668 97.857  15.961  1.00 21.61 ? 88   GLU B CA    1 
ATOM   5573  C C     . GLU B 1 88  ? -17.009 96.510  16.242  1.00 21.77 ? 88   GLU B C     1 
ATOM   5574  O O     . GLU B 1 88  ? -16.177 96.417  17.146  1.00 21.50 ? 88   GLU B O     1 
ATOM   5575  C CB    . GLU B 1 88  ? -18.502 98.272  17.177  1.00 21.26 ? 88   GLU B CB    1 
ATOM   5576  C CG    . GLU B 1 88  ? -19.209 99.605  17.033  1.00 21.59 ? 88   GLU B CG    1 
ATOM   5577  C CD    . GLU B 1 88  ? -20.023 99.950  18.261  1.00 23.25 ? 88   GLU B CD    1 
ATOM   5578  O OE1   . GLU B 1 88  ? -21.254 99.719  18.241  1.00 26.10 ? 88   GLU B OE1   1 
ATOM   5579  O OE2   . GLU B 1 88  ? -19.434 100.433 19.262  1.00 27.18 ? 88   GLU B OE2   1 
ATOM   5580  N N     . ASN B 1 89  ? -17.376 95.474  15.472  1.00 21.88 ? 89   ASN B N     1 
ATOM   5581  C CA    . ASN B 1 89  ? -16.943 94.093  15.767  1.00 21.87 ? 89   ASN B CA    1 
ATOM   5582  C C     . ASN B 1 89  ? -16.585 93.198  14.567  1.00 21.90 ? 89   ASN B C     1 
ATOM   5583  O O     . ASN B 1 89  ? -16.616 91.973  14.688  1.00 21.27 ? 89   ASN B O     1 
ATOM   5584  C CB    . ASN B 1 89  ? -17.967 93.390  16.691  1.00 21.31 ? 89   ASN B CB    1 
ATOM   5585  C CG    . ASN B 1 89  ? -17.817 93.817  18.162  1.00 21.52 ? 89   ASN B CG    1 
ATOM   5586  O OD1   . ASN B 1 89  ? -18.673 94.519  18.718  1.00 20.56 ? 89   ASN B OD1   1 
ATOM   5587  N ND2   . ASN B 1 89  ? -16.716 93.424  18.774  1.00 17.72 ? 89   ASN B ND2   1 
ATOM   5588  N N     . GLY B 1 90  ? -16.235 93.814  13.434  1.00 22.15 ? 90   GLY B N     1 
ATOM   5589  C CA    . GLY B 1 90  ? -15.732 93.100  12.246  1.00 23.30 ? 90   GLY B CA    1 
ATOM   5590  C C     . GLY B 1 90  ? -14.646 92.046  12.500  1.00 24.18 ? 90   GLY B C     1 
ATOM   5591  O O     . GLY B 1 90  ? -14.732 90.900  12.021  1.00 24.63 ? 90   GLY B O     1 
ATOM   5592  N N     . ASP B 1 91  ? -13.638 92.418  13.282  1.00 24.64 ? 91   ASP B N     1 
ATOM   5593  C CA    . ASP B 1 91  ? -12.535 91.516  13.594  1.00 25.18 ? 91   ASP B CA    1 
ATOM   5594  C C     . ASP B 1 91  ? -12.794 90.536  14.730  1.00 25.02 ? 91   ASP B C     1 
ATOM   5595  O O     . ASP B 1 91  ? -11.941 89.694  15.001  1.00 25.16 ? 91   ASP B O     1 
ATOM   5596  C CB    . ASP B 1 91  ? -11.270 92.319  13.883  1.00 25.32 ? 91   ASP B CB    1 
ATOM   5597  C CG    . ASP B 1 91  ? -11.022 93.380  12.842  1.00 26.64 ? 91   ASP B CG    1 
ATOM   5598  O OD1   . ASP B 1 91  ? -11.092 93.072  11.620  1.00 25.83 ? 91   ASP B OD1   1 
ATOM   5599  O OD2   . ASP B 1 91  ? -10.775 94.528  13.259  1.00 29.16 ? 91   ASP B OD2   1 
ATOM   5600  N N     . ARG B 1 92  ? -13.936 90.642  15.409  1.00 25.02 ? 92   ARG B N     1 
ATOM   5601  C CA    . ARG B 1 92  ? -14.281 89.624  16.414  1.00 25.70 ? 92   ARG B CA    1 
ATOM   5602  C C     . ARG B 1 92  ? -14.481 88.267  15.721  1.00 25.37 ? 92   ARG B C     1 
ATOM   5603  O O     . ARG B 1 92  ? -15.105 88.198  14.671  1.00 25.88 ? 92   ARG B O     1 
ATOM   5604  C CB    . ARG B 1 92  ? -15.532 90.018  17.194  1.00 25.66 ? 92   ARG B CB    1 
ATOM   5605  C CG    . ARG B 1 92  ? -16.223 88.878  17.990  1.00 28.22 ? 92   ARG B CG    1 
ATOM   5606  C CD    . ARG B 1 92  ? -16.994 89.454  19.167  1.00 30.80 ? 92   ARG B CD    1 
ATOM   5607  N NE    . ARG B 1 92  ? -16.063 90.173  20.049  1.00 35.32 ? 92   ARG B NE    1 
ATOM   5608  C CZ    . ARG B 1 92  ? -16.380 91.180  20.855  1.00 37.22 ? 92   ARG B CZ    1 
ATOM   5609  N NH1   . ARG B 1 92  ? -17.626 91.645  20.926  1.00 39.70 ? 92   ARG B NH1   1 
ATOM   5610  N NH2   . ARG B 1 92  ? -15.437 91.733  21.592  1.00 39.25 ? 92   ARG B NH2   1 
ATOM   5611  N N     . THR B 1 93  ? -13.932 87.207  16.297  1.00 24.96 ? 93   THR B N     1 
ATOM   5612  C CA    . THR B 1 93  ? -14.159 85.857  15.794  1.00 24.50 ? 93   THR B CA    1 
ATOM   5613  C C     . THR B 1 93  ? -15.606 85.428  15.913  1.00 24.51 ? 93   THR B C     1 
ATOM   5614  O O     . THR B 1 93  ? -16.143 85.329  17.012  1.00 24.86 ? 93   THR B O     1 
ATOM   5615  C CB    . THR B 1 93  ? -13.327 84.847  16.554  1.00 24.57 ? 93   THR B CB    1 
ATOM   5616  O OG1   . THR B 1 93  ? -11.958 85.264  16.503  1.00 22.64 ? 93   THR B OG1   1 
ATOM   5617  C CG2   . THR B 1 93  ? -13.516 83.445  15.931  1.00 23.39 ? 93   THR B CG2   1 
ATOM   5618  N N     . ALA B 1 94  ? -16.216 85.159  14.762  1.00 24.40 ? 94   ALA B N     1 
ATOM   5619  C CA    . ALA B 1 94  ? -17.596 84.698  14.670  1.00 23.62 ? 94   ALA B CA    1 
ATOM   5620  C C     . ALA B 1 94  ? -17.667 83.198  14.920  1.00 23.30 ? 94   ALA B C     1 
ATOM   5621  O O     . ALA B 1 94  ? -18.408 82.746  15.781  1.00 23.43 ? 94   ALA B O     1 
ATOM   5622  C CB    . ALA B 1 94  ? -18.189 85.061  13.300  1.00 23.25 ? 94   ALA B CB    1 
ATOM   5623  N N     . ILE B 1 95  ? -16.896 82.437  14.155  1.00 23.14 ? 95   ILE B N     1 
ATOM   5624  C CA    . ILE B 1 95  ? -16.828 80.987  14.294  1.00 22.79 ? 95   ILE B CA    1 
ATOM   5625  C C     . ILE B 1 95  ? -15.396 80.528  14.557  1.00 22.36 ? 95   ILE B C     1 
ATOM   5626  O O     . ILE B 1 95  ? -14.455 81.011  13.902  1.00 23.00 ? 95   ILE B O     1 
ATOM   5627  C CB    . ILE B 1 95  ? -17.368 80.275  13.013  1.00 22.86 ? 95   ILE B CB    1 
ATOM   5628  C CG1   . ILE B 1 95  ? -18.842 80.640  12.761  1.00 22.63 ? 95   ILE B CG1   1 
ATOM   5629  C CG2   . ILE B 1 95  ? -17.205 78.756  13.146  1.00 23.43 ? 95   ILE B CG2   1 
ATOM   5630  C CD1   . ILE B 1 95  ? -19.511 79.984  11.487  1.00 22.34 ? 95   ILE B CD1   1 
ATOM   5631  N N     . ILE B 1 96  ? -15.225 79.626  15.524  1.00 21.81 ? 96   ILE B N     1 
ATOM   5632  C CA    . ILE B 1 96  ? -13.965 78.878  15.705  1.00 20.61 ? 96   ILE B CA    1 
ATOM   5633  C C     . ILE B 1 96  ? -14.253 77.487  15.188  1.00 20.96 ? 96   ILE B C     1 
ATOM   5634  O O     . ILE B 1 96  ? -15.098 76.798  15.732  1.00 21.44 ? 96   ILE B O     1 
ATOM   5635  C CB    . ILE B 1 96  ? -13.514 78.768  17.210  1.00 20.65 ? 96   ILE B CB    1 
ATOM   5636  C CG1   . ILE B 1 96  ? -13.064 80.119  17.781  1.00 20.43 ? 96   ILE B CG1   1 
ATOM   5637  C CG2   . ILE B 1 96  ? -12.380 77.750  17.394  1.00 20.19 ? 96   ILE B CG2   1 
ATOM   5638  C CD1   . ILE B 1 96  ? -12.952 80.134  19.298  1.00 19.78 ? 96   ILE B CD1   1 
ATOM   5639  N N     . TRP B 1 97  ? -13.582 77.072  14.126  1.00 21.37 ? 97   TRP B N     1 
ATOM   5640  C CA    . TRP B 1 97  ? -13.703 75.698  13.673  1.00 21.78 ? 97   TRP B CA    1 
ATOM   5641  C C     . TRP B 1 97  ? -12.546 74.844  14.180  1.00 22.15 ? 97   TRP B C     1 
ATOM   5642  O O     . TRP B 1 97  ? -11.383 75.169  13.961  1.00 21.85 ? 97   TRP B O     1 
ATOM   5643  C CB    . TRP B 1 97  ? -13.789 75.640  12.151  1.00 21.83 ? 97   TRP B CB    1 
ATOM   5644  C CG    . TRP B 1 97  ? -13.922 74.257  11.588  1.00 21.93 ? 97   TRP B CG    1 
ATOM   5645  C CD1   . TRP B 1 97  ? -15.045 73.478  11.579  1.00 22.16 ? 97   TRP B CD1   1 
ATOM   5646  C CD2   . TRP B 1 97  ? -12.902 73.498  10.916  1.00 23.23 ? 97   TRP B CD2   1 
ATOM   5647  N NE1   . TRP B 1 97  ? -14.789 72.277  10.948  1.00 22.83 ? 97   TRP B NE1   1 
ATOM   5648  C CE2   . TRP B 1 97  ? -13.483 72.262  10.532  1.00 24.08 ? 97   TRP B CE2   1 
ATOM   5649  C CE3   . TRP B 1 97  ? -11.555 73.745  10.587  1.00 23.52 ? 97   TRP B CE3   1 
ATOM   5650  C CZ2   . TRP B 1 97  ? -12.756 71.269  9.839   1.00 23.20 ? 97   TRP B CZ2   1 
ATOM   5651  C CZ3   . TRP B 1 97  ? -10.836 72.752  9.904   1.00 22.13 ? 97   TRP B CZ3   1 
ATOM   5652  C CH2   . TRP B 1 97  ? -11.436 71.535  9.543   1.00 21.11 ? 97   TRP B CH2   1 
ATOM   5653  N N     . GLU B 1 98  ? -12.882 73.751  14.862  1.00 22.98 ? 98   GLU B N     1 
ATOM   5654  C CA    . GLU B 1 98  ? -11.891 72.769  15.318  1.00 23.29 ? 98   GLU B CA    1 
ATOM   5655  C C     . GLU B 1 98  ? -12.062 71.484  14.517  1.00 23.73 ? 98   GLU B C     1 
ATOM   5656  O O     . GLU B 1 98  ? -13.164 70.911  14.505  1.00 23.76 ? 98   GLU B O     1 
ATOM   5657  C CB    . GLU B 1 98  ? -12.098 72.486  16.811  1.00 23.55 ? 98   GLU B CB    1 
ATOM   5658  C CG    . GLU B 1 98  ? -11.315 71.305  17.375  1.00 22.88 ? 98   GLU B CG    1 
ATOM   5659  C CD    . GLU B 1 98  ? -9.836  71.601  17.592  1.00 23.05 ? 98   GLU B CD    1 
ATOM   5660  O OE1   . GLU B 1 98  ? -9.369  72.725  17.281  1.00 21.64 ? 98   GLU B OE1   1 
ATOM   5661  O OE2   . GLU B 1 98  ? -9.136  70.680  18.076  1.00 23.37 ? 98   GLU B OE2   1 
ATOM   5662  N N     . GLY B 1 99  ? -10.986 71.056  13.843  1.00 24.03 ? 99   GLY B N     1 
ATOM   5663  C CA    . GLY B 1 99  ? -10.982 69.850  12.984  1.00 24.00 ? 99   GLY B CA    1 
ATOM   5664  C C     . GLY B 1 99  ? -11.086 68.526  13.742  1.00 24.24 ? 99   GLY B C     1 
ATOM   5665  O O     . GLY B 1 99  ? -10.759 68.458  14.931  1.00 24.11 ? 99   GLY B O     1 
ATOM   5666  N N     . ASP B 1 100 ? -11.573 67.477  13.072  1.00 24.22 ? 100  ASP B N     1 
ATOM   5667  C CA    . ASP B 1 100 ? -11.465 66.121  13.609  1.00 25.15 ? 100  ASP B CA    1 
ATOM   5668  C C     . ASP B 1 100 ? -10.018 65.869  14.104  1.00 25.72 ? 100  ASP B C     1 
ATOM   5669  O O     . ASP B 1 100 ? -9.780  65.382  15.232  1.00 25.52 ? 100  ASP B O     1 
ATOM   5670  C CB    . ASP B 1 100 ? -11.881 65.050  12.578  1.00 24.77 ? 100  ASP B CB    1 
ATOM   5671  C CG    . ASP B 1 100 ? -12.100 63.676  13.231  1.00 25.79 ? 100  ASP B CG    1 
ATOM   5672  O OD1   . ASP B 1 100 ? -12.741 63.612  14.298  1.00 26.03 ? 100  ASP B OD1   1 
ATOM   5673  O OD2   . ASP B 1 100 ? -11.605 62.662  12.716  1.00 28.47 ? 100  ASP B OD2   1 
ATOM   5674  N N     . ASP B 1 101 ? -9.083  66.247  13.239  1.00 25.92 ? 101  ASP B N     1 
ATOM   5675  C CA    . ASP B 1 101 ? -7.670  66.266  13.498  1.00 26.74 ? 101  ASP B CA    1 
ATOM   5676  C C     . ASP B 1 101 ? -7.339  67.642  14.059  1.00 27.07 ? 101  ASP B C     1 
ATOM   5677  O O     . ASP B 1 101 ? -7.478  68.649  13.353  1.00 27.78 ? 101  ASP B O     1 
ATOM   5678  C CB    . ASP B 1 101 ? -6.969  66.029  12.159  1.00 27.04 ? 101  ASP B CB    1 
ATOM   5679  C CG    . ASP B 1 101 ? -5.486  66.347  12.180  1.00 28.17 ? 101  ASP B CG    1 
ATOM   5680  O OD1   . ASP B 1 101 ? -4.981  67.022  13.116  1.00 27.42 ? 101  ASP B OD1   1 
ATOM   5681  O OD2   . ASP B 1 101 ? -4.831  65.923  11.206  1.00 28.63 ? 101  ASP B OD2   1 
ATOM   5682  N N     . THR B 1 102 ? -6.881  67.691  15.313  1.00 27.25 ? 102  THR B N     1 
ATOM   5683  C CA    . THR B 1 102 ? -6.683  68.983  16.018  1.00 27.20 ? 102  THR B CA    1 
ATOM   5684  C C     . THR B 1 102 ? -5.733  69.990  15.324  1.00 27.77 ? 102  THR B C     1 
ATOM   5685  O O     . THR B 1 102 ? -5.891  71.207  15.471  1.00 27.78 ? 102  THR B O     1 
ATOM   5686  C CB    . THR B 1 102 ? -6.292  68.786  17.516  1.00 27.19 ? 102  THR B CB    1 
ATOM   5687  O OG1   . THR B 1 102 ? -6.378  70.041  18.193  1.00 26.44 ? 102  THR B OG1   1 
ATOM   5688  C CG2   . THR B 1 102 ? -4.889  68.197  17.671  1.00 25.48 ? 102  THR B CG2   1 
ATOM   5689  N N     . SER B 1 103 ? -4.768  69.477  14.556  1.00 28.13 ? 103  SER B N     1 
ATOM   5690  C CA    . SER B 1 103 ? -3.877  70.310  13.768  1.00 28.07 ? 103  SER B CA    1 
ATOM   5691  C C     . SER B 1 103 ? -4.629  71.155  12.730  1.00 28.67 ? 103  SER B C     1 
ATOM   5692  O O     . SER B 1 103 ? -4.060  72.089  12.161  1.00 28.95 ? 103  SER B O     1 
ATOM   5693  C CB    . SER B 1 103 ? -2.834  69.441  13.060  1.00 28.14 ? 103  SER B CB    1 
ATOM   5694  O OG    . SER B 1 103 ? -3.381  68.815  11.901  1.00 27.49 ? 103  SER B OG    1 
ATOM   5695  N N     . GLN B 1 104 ? -5.887  70.832  12.448  1.00 28.44 ? 104  GLN B N     1 
ATOM   5696  C CA    . GLN B 1 104 ? -6.623  71.651  11.487  1.00 28.91 ? 104  GLN B CA    1 
ATOM   5697  C C     . GLN B 1 104 ? -7.573  72.538  12.257  1.00 29.00 ? 104  GLN B C     1 
ATOM   5698  O O     . GLN B 1 104 ? -8.385  72.036  13.028  1.00 29.29 ? 104  GLN B O     1 
ATOM   5699  C CB    . GLN B 1 104 ? -7.383  70.777  10.468  1.00 28.50 ? 104  GLN B CB    1 
ATOM   5700  C CG    . GLN B 1 104 ? -6.506  69.954  9.508   1.00 28.59 ? 104  GLN B CG    1 
ATOM   5701  C CD    . GLN B 1 104 ? -7.329  69.030  8.560   1.00 29.98 ? 104  GLN B CD    1 
ATOM   5702  O OE1   . GLN B 1 104 ? -6.830  68.586  7.520   1.00 30.39 ? 104  GLN B OE1   1 
ATOM   5703  N NE2   . GLN B 1 104 ? -8.586  68.763  8.916   1.00 29.58 ? 104  GLN B NE2   1 
ATOM   5704  N N     . SER B 1 105 ? -7.467  73.852  12.092  1.00 29.71 ? 105  SER B N     1 
ATOM   5705  C CA    . SER B 1 105 ? -8.435  74.758  12.732  1.00 30.41 ? 105  SER B CA    1 
ATOM   5706  C C     . SER B 1 105 ? -8.390  76.238  12.305  1.00 30.74 ? 105  SER B C     1 
ATOM   5707  O O     . SER B 1 105 ? -7.322  76.851  12.280  1.00 30.93 ? 105  SER B O     1 
ATOM   5708  C CB    . SER B 1 105 ? -8.358  74.650  14.263  1.00 30.40 ? 105  SER B CB    1 
ATOM   5709  O OG    . SER B 1 105 ? -7.356  75.487  14.791  1.00 31.69 ? 105  SER B OG    1 
ATOM   5710  N N     . LYS B 1 106 ? -9.568  76.799  12.013  1.00 30.79 ? 106  LYS B N     1 
ATOM   5711  C CA    . LYS B 1 106 ? -9.727  78.224  11.700  1.00 30.73 ? 106  LYS B CA    1 
ATOM   5712  C C     . LYS B 1 106 ? -10.384 79.060  12.820  1.00 30.41 ? 106  LYS B C     1 
ATOM   5713  O O     . LYS B 1 106 ? -11.238 78.576  13.585  1.00 29.61 ? 106  LYS B O     1 
ATOM   5714  C CB    . LYS B 1 106 ? -10.588 78.406  10.448  1.00 30.84 ? 106  LYS B CB    1 
ATOM   5715  C CG    . LYS B 1 106 ? -10.122 77.717  9.162   1.00 31.52 ? 106  LYS B CG    1 
ATOM   5716  C CD    . LYS B 1 106 ? -11.149 77.989  8.056   1.00 31.73 ? 106  LYS B CD    1 
ATOM   5717  C CE    . LYS B 1 106 ? -11.110 76.947  6.939   1.00 35.53 ? 106  LYS B CE    1 
ATOM   5718  N NZ    . LYS B 1 106 ? -10.079 77.245  5.870   1.00 33.91 ? 106  LYS B NZ    1 
ATOM   5719  N N     . HIS B 1 107 ? -9.979  80.331  12.890  1.00 29.81 ? 107  HIS B N     1 
ATOM   5720  C CA    . HIS B 1 107 ? -10.787 81.366  13.521  1.00 28.99 ? 107  HIS B CA    1 
ATOM   5721  C C     . HIS B 1 107 ? -11.371 82.186  12.375  1.00 28.60 ? 107  HIS B C     1 
ATOM   5722  O O     . HIS B 1 107 ? -10.626 82.679  11.535  1.00 28.65 ? 107  HIS B O     1 
ATOM   5723  C CB    . HIS B 1 107 ? -9.948  82.226  14.467  1.00 28.75 ? 107  HIS B CB    1 
ATOM   5724  C CG    . HIS B 1 107 ? -9.497  81.499  15.702  1.00 28.95 ? 107  HIS B CG    1 
ATOM   5725  N ND1   . HIS B 1 107 ? -9.817  81.924  16.974  1.00 27.38 ? 107  HIS B ND1   1 
ATOM   5726  C CD2   . HIS B 1 107 ? -8.763  80.367  15.857  1.00 27.89 ? 107  HIS B CD2   1 
ATOM   5727  C CE1   . HIS B 1 107 ? -9.302  81.088  17.859  1.00 26.98 ? 107  HIS B CE1   1 
ATOM   5728  N NE2   . HIS B 1 107 ? -8.662  80.132  17.207  1.00 27.79 ? 107  HIS B NE2   1 
ATOM   5729  N N     . ILE B 1 108 ? -12.700 82.280  12.303  1.00 27.97 ? 108  ILE B N     1 
ATOM   5730  C CA    . ILE B 1 108 ? -13.354 83.078  11.254  1.00 27.14 ? 108  ILE B CA    1 
ATOM   5731  C C     . ILE B 1 108 ? -13.994 84.317  11.861  1.00 26.76 ? 108  ILE B C     1 
ATOM   5732  O O     . ILE B 1 108 ? -14.852 84.225  12.732  1.00 27.02 ? 108  ILE B O     1 
ATOM   5733  C CB    . ILE B 1 108 ? -14.379 82.256  10.430  1.00 26.93 ? 108  ILE B CB    1 
ATOM   5734  C CG1   . ILE B 1 108 ? -13.668 81.120  9.710   1.00 25.80 ? 108  ILE B CG1   1 
ATOM   5735  C CG2   . ILE B 1 108 ? -15.101 83.143  9.416   1.00 26.48 ? 108  ILE B CG2   1 
ATOM   5736  C CD1   . ILE B 1 108 ? -14.384 79.797  9.846   1.00 25.54 ? 108  ILE B CD1   1 
ATOM   5737  N N     . SER B 1 109 ? -13.552 85.481  11.413  1.00 26.09 ? 109  SER B N     1 
ATOM   5738  C CA    . SER B 1 109 ? -14.031 86.709  11.992  1.00 25.42 ? 109  SER B CA    1 
ATOM   5739  C C     . SER B 1 109 ? -15.370 87.023  11.382  1.00 25.05 ? 109  SER B C     1 
ATOM   5740  O O     . SER B 1 109 ? -15.764 86.433  10.367  1.00 24.81 ? 109  SER B O     1 
ATOM   5741  C CB    . SER B 1 109 ? -13.048 87.849  11.734  1.00 25.17 ? 109  SER B CB    1 
ATOM   5742  O OG    . SER B 1 109 ? -13.156 88.310  10.398  1.00 26.58 ? 109  SER B OG    1 
ATOM   5743  N N     . TYR B 1 110 ? -16.063 87.969  11.999  1.00 24.85 ? 110  TYR B N     1 
ATOM   5744  C CA    . TYR B 1 110 ? -17.318 88.450  11.464  1.00 24.93 ? 110  TYR B CA    1 
ATOM   5745  C C     . TYR B 1 110 ? -17.156 88.957  10.039  1.00 24.96 ? 110  TYR B C     1 
ATOM   5746  O O     . TYR B 1 110 ? -17.872 88.518  9.150   1.00 24.40 ? 110  TYR B O     1 
ATOM   5747  C CB    . TYR B 1 110 ? -17.974 89.473  12.401  1.00 24.51 ? 110  TYR B CB    1 
ATOM   5748  C CG    . TYR B 1 110 ? -18.877 88.784  13.353  1.00 24.93 ? 110  TYR B CG    1 
ATOM   5749  C CD1   . TYR B 1 110 ? -18.444 88.430  14.641  1.00 26.66 ? 110  TYR B CD1   1 
ATOM   5750  C CD2   . TYR B 1 110 ? -20.145 88.387  12.953  1.00 27.52 ? 110  TYR B CD2   1 
ATOM   5751  C CE1   . TYR B 1 110 ? -19.280 87.744  15.523  1.00 25.56 ? 110  TYR B CE1   1 
ATOM   5752  C CE2   . TYR B 1 110 ? -20.993 87.691  13.828  1.00 27.20 ? 110  TYR B CE2   1 
ATOM   5753  C CZ    . TYR B 1 110 ? -20.549 87.377  15.111  1.00 25.57 ? 110  TYR B CZ    1 
ATOM   5754  O OH    . TYR B 1 110 ? -21.399 86.707  15.954  1.00 24.87 ? 110  TYR B OH    1 
ATOM   5755  N N     . ARG B 1 111 ? -16.188 89.844  9.833   1.00 25.61 ? 111  ARG B N     1 
ATOM   5756  C CA    . ARG B 1 111 ? -15.879 90.343  8.508   1.00 26.98 ? 111  ARG B CA    1 
ATOM   5757  C C     . ARG B 1 111 ? -15.637 89.259  7.434   1.00 26.92 ? 111  ARG B C     1 
ATOM   5758  O O     . ARG B 1 111 ? -16.126 89.398  6.325   1.00 27.35 ? 111  ARG B O     1 
ATOM   5759  C CB    . ARG B 1 111 ? -14.725 91.349  8.572   1.00 27.41 ? 111  ARG B CB    1 
ATOM   5760  C CG    . ARG B 1 111 ? -14.405 92.016  7.240   1.00 29.71 ? 111  ARG B CG    1 
ATOM   5761  C CD    . ARG B 1 111 ? -13.691 93.355  7.428   1.00 33.86 ? 111  ARG B CD    1 
ATOM   5762  N NE    . ARG B 1 111 ? -14.627 94.437  7.762   1.00 36.96 ? 111  ARG B NE    1 
ATOM   5763  C CZ    . ARG B 1 111 ? -14.621 95.118  8.911   1.00 39.70 ? 111  ARG B CZ    1 
ATOM   5764  N NH1   . ARG B 1 111 ? -13.712 94.850  9.864   1.00 38.64 ? 111  ARG B NH1   1 
ATOM   5765  N NH2   . ARG B 1 111 ? -15.527 96.083  9.102   1.00 39.53 ? 111  ARG B NH2   1 
ATOM   5766  N N     . GLU B 1 112 ? -14.904 88.193  7.760   1.00 27.16 ? 112  GLU B N     1 
ATOM   5767  C CA    . GLU B 1 112 ? -14.620 87.110  6.782   1.00 27.62 ? 112  GLU B CA    1 
ATOM   5768  C C     . GLU B 1 112 ? -15.828 86.249  6.448   1.00 27.32 ? 112  GLU B C     1 
ATOM   5769  O O     . GLU B 1 112 ? -15.978 85.791  5.313   1.00 27.39 ? 112  GLU B O     1 
ATOM   5770  C CB    . GLU B 1 112 ? -13.474 86.204  7.250   1.00 27.79 ? 112  GLU B CB    1 
ATOM   5771  C CG    . GLU B 1 112 ? -12.228 86.961  7.533   1.00 29.34 ? 112  GLU B CG    1 
ATOM   5772  C CD    . GLU B 1 112 ? -11.196 86.153  8.266   1.00 33.13 ? 112  GLU B CD    1 
ATOM   5773  O OE1   . GLU B 1 112 ? -11.523 85.485  9.278   1.00 33.14 ? 112  GLU B OE1   1 
ATOM   5774  O OE2   . GLU B 1 112 ? -10.028 86.220  7.833   1.00 35.22 ? 112  GLU B OE2   1 
ATOM   5775  N N     . LEU B 1 113 ? -16.667 86.017  7.453   1.00 27.36 ? 113  LEU B N     1 
ATOM   5776  C CA    . LEU B 1 113 ? -17.907 85.263  7.295   1.00 26.97 ? 113  LEU B CA    1 
ATOM   5777  C C     . LEU B 1 113 ? -18.944 86.045  6.502   1.00 26.95 ? 113  LEU B C     1 
ATOM   5778  O O     . LEU B 1 113 ? -19.620 85.489  5.646   1.00 27.08 ? 113  LEU B O     1 
ATOM   5779  C CB    . LEU B 1 113 ? -18.454 84.877  8.669   1.00 27.29 ? 113  LEU B CB    1 
ATOM   5780  C CG    . LEU B 1 113 ? -19.674 83.957  8.737   1.00 27.04 ? 113  LEU B CG    1 
ATOM   5781  C CD1   . LEU B 1 113 ? -19.311 82.538  8.269   1.00 27.11 ? 113  LEU B CD1   1 
ATOM   5782  C CD2   . LEU B 1 113 ? -20.218 83.966  10.169  1.00 26.66 ? 113  LEU B CD2   1 
ATOM   5783  N N     . HIS B 1 114 ? -19.063 87.337  6.798   1.00 27.17 ? 114  HIS B N     1 
ATOM   5784  C CA    . HIS B 1 114 ? -19.895 88.251  6.026   1.00 27.27 ? 114  HIS B CA    1 
ATOM   5785  C C     . HIS B 1 114 ? -19.496 88.227  4.548   1.00 27.66 ? 114  HIS B C     1 
ATOM   5786  O O     . HIS B 1 114 ? -20.353 88.089  3.668   1.00 27.37 ? 114  HIS B O     1 
ATOM   5787  C CB    . HIS B 1 114 ? -19.781 89.680  6.578   1.00 27.13 ? 114  HIS B CB    1 
ATOM   5788  C CG    . HIS B 1 114 ? -20.449 90.714  5.720   1.00 26.95 ? 114  HIS B CG    1 
ATOM   5789  N ND1   . HIS B 1 114 ? -19.758 91.480  4.807   1.00 26.32 ? 114  HIS B ND1   1 
ATOM   5790  C CD2   . HIS B 1 114 ? -21.747 91.097  5.623   1.00 25.44 ? 114  HIS B CD2   1 
ATOM   5791  C CE1   . HIS B 1 114 ? -20.595 92.304  4.198   1.00 24.30 ? 114  HIS B CE1   1 
ATOM   5792  N NE2   . HIS B 1 114 ? -21.807 92.091  4.674   1.00 24.09 ? 114  HIS B NE2   1 
ATOM   5793  N N     . ARG B 1 115 ? -18.195 88.373  4.292   1.00 27.90 ? 115  ARG B N     1 
ATOM   5794  C CA    . ARG B 1 115 ? -17.658 88.358  2.930   1.00 28.33 ? 115  ARG B CA    1 
ATOM   5795  C C     . ARG B 1 115 ? -18.058 87.055  2.173   1.00 28.07 ? 115  ARG B C     1 
ATOM   5796  O O     . ARG B 1 115 ? -18.570 87.106  1.042   1.00 26.99 ? 115  ARG B O     1 
ATOM   5797  C CB    . ARG B 1 115 ? -16.138 88.562  2.974   1.00 28.14 ? 115  ARG B CB    1 
ATOM   5798  C CG    . ARG B 1 115 ? -15.405 88.045  1.764   1.00 30.81 ? 115  ARG B CG    1 
ATOM   5799  C CD    . ARG B 1 115 ? -14.059 88.736  1.575   1.00 36.95 ? 115  ARG B CD    1 
ATOM   5800  N NE    . ARG B 1 115 ? -13.765 88.998  0.153   1.00 41.24 ? 115  ARG B NE    1 
ATOM   5801  C CZ    . ARG B 1 115 ? -13.609 90.215  -0.390  1.00 42.60 ? 115  ARG B CZ    1 
ATOM   5802  N NH1   . ARG B 1 115 ? -13.696 91.321  0.354   1.00 42.14 ? 115  ARG B NH1   1 
ATOM   5803  N NH2   . ARG B 1 115 ? -13.346 90.328  -1.689  1.00 42.88 ? 115  ARG B NH2   1 
ATOM   5804  N N     . ASP B 1 116 ? -17.847 85.907  2.823   1.00 27.74 ? 116  ASP B N     1 
ATOM   5805  C CA    . ASP B 1 116 ? -18.080 84.618  2.190   1.00 28.05 ? 116  ASP B CA    1 
ATOM   5806  C C     . ASP B 1 116 ? -19.560 84.400  1.932   1.00 27.18 ? 116  ASP B C     1 
ATOM   5807  O O     . ASP B 1 116 ? -19.925 83.849  0.897   1.00 26.76 ? 116  ASP B O     1 
ATOM   5808  C CB    . ASP B 1 116 ? -17.498 83.463  3.016   1.00 28.81 ? 116  ASP B CB    1 
ATOM   5809  C CG    . ASP B 1 116 ? -15.971 83.288  2.824   1.00 32.35 ? 116  ASP B CG    1 
ATOM   5810  O OD1   . ASP B 1 116 ? -15.414 83.715  1.769   1.00 32.32 ? 116  ASP B OD1   1 
ATOM   5811  O OD2   . ASP B 1 116 ? -15.332 82.715  3.759   1.00 36.03 ? 116  ASP B OD2   1 
ATOM   5812  N N     . VAL B 1 117 ? -20.401 84.843  2.874   1.00 26.48 ? 117  VAL B N     1 
ATOM   5813  C CA    . VAL B 1 117 ? -21.869 84.815  2.713   1.00 25.50 ? 117  VAL B CA    1 
ATOM   5814  C C     . VAL B 1 117 ? -22.393 85.702  1.565   1.00 25.18 ? 117  VAL B C     1 
ATOM   5815  O O     . VAL B 1 117 ? -23.242 85.273  0.780   1.00 25.14 ? 117  VAL B O     1 
ATOM   5816  C CB    . VAL B 1 117 ? -22.607 85.087  4.064   1.00 25.63 ? 117  VAL B CB    1 
ATOM   5817  C CG1   . VAL B 1 117 ? -24.087 85.434  3.850   1.00 24.09 ? 117  VAL B CG1   1 
ATOM   5818  C CG2   . VAL B 1 117 ? -22.455 83.879  4.998   1.00 23.86 ? 117  VAL B CG2   1 
ATOM   5819  N N     . CYS B 1 118 ? -21.874 86.912  1.453   1.00 24.60 ? 118  CYS B N     1 
ATOM   5820  C CA    . CYS B 1 118 ? -22.184 87.742  0.306   1.00 25.16 ? 118  CYS B CA    1 
ATOM   5821  C C     . CYS B 1 118 ? -21.854 87.056  -1.039  1.00 24.98 ? 118  CYS B C     1 
ATOM   5822  O O     . CYS B 1 118 ? -22.683 87.017  -1.942  1.00 24.80 ? 118  CYS B O     1 
ATOM   5823  C CB    . CYS B 1 118 ? -21.467 89.088  0.419   1.00 25.22 ? 118  CYS B CB    1 
ATOM   5824  S SG    . CYS B 1 118 ? -22.057 90.122  1.754   1.00 26.49 ? 118  CYS B SG    1 
ATOM   5825  N N     . ARG B 1 119 ? -20.634 86.534  -1.155  1.00 25.26 ? 119  ARG B N     1 
ATOM   5826  C CA    . ARG B 1 119 ? -20.182 85.797  -2.327  1.00 25.49 ? 119  ARG B CA    1 
ATOM   5827  C C     . ARG B 1 119 ? -21.013 84.549  -2.635  1.00 24.87 ? 119  ARG B C     1 
ATOM   5828  O O     . ARG B 1 119 ? -21.239 84.205  -3.798  1.00 23.85 ? 119  ARG B O     1 
ATOM   5829  C CB    . ARG B 1 119 ? -18.740 85.383  -2.119  1.00 26.20 ? 119  ARG B CB    1 
ATOM   5830  C CG    . ARG B 1 119 ? -17.754 86.537  -2.282  1.00 30.19 ? 119  ARG B CG    1 
ATOM   5831  C CD    . ARG B 1 119 ? -16.346 86.049  -2.610  1.00 35.29 ? 119  ARG B CD    1 
ATOM   5832  N NE    . ARG B 1 119 ? -15.775 85.156  -1.591  1.00 38.11 ? 119  ARG B NE    1 
ATOM   5833  C CZ    . ARG B 1 119 ? -14.564 84.592  -1.683  1.00 40.60 ? 119  ARG B CZ    1 
ATOM   5834  N NH1   . ARG B 1 119 ? -13.793 84.819  -2.744  1.00 39.76 ? 119  ARG B NH1   1 
ATOM   5835  N NH2   . ARG B 1 119 ? -14.120 83.786  -0.718  1.00 40.72 ? 119  ARG B NH2   1 
ATOM   5836  N N     . PHE B 1 120 ? -21.459 83.875  -1.577  1.00 24.65 ? 120  PHE B N     1 
ATOM   5837  C CA    . PHE B 1 120 ? -22.262 82.685  -1.737  1.00 24.51 ? 120  PHE B CA    1 
ATOM   5838  C C     . PHE B 1 120 ? -23.743 82.972  -2.017  1.00 24.08 ? 120  PHE B C     1 
ATOM   5839  O O     . PHE B 1 120 ? -24.404 82.214  -2.753  1.00 24.03 ? 120  PHE B O     1 
ATOM   5840  C CB    . PHE B 1 120 ? -22.065 81.674  -0.601  1.00 24.47 ? 120  PHE B CB    1 
ATOM   5841  C CG    . PHE B 1 120 ? -22.525 80.295  -0.980  1.00 24.89 ? 120  PHE B CG    1 
ATOM   5842  C CD1   . PHE B 1 120 ? -21.782 79.529  -1.864  1.00 24.99 ? 120  PHE B CD1   1 
ATOM   5843  C CD2   . PHE B 1 120 ? -23.740 79.795  -0.513  1.00 25.98 ? 120  PHE B CD2   1 
ATOM   5844  C CE1   . PHE B 1 120 ? -22.221 78.268  -2.252  1.00 27.32 ? 120  PHE B CE1   1 
ATOM   5845  C CE2   . PHE B 1 120 ? -24.201 78.534  -0.890  1.00 26.76 ? 120  PHE B CE2   1 
ATOM   5846  C CZ    . PHE B 1 120 ? -23.435 77.761  -1.766  1.00 26.66 ? 120  PHE B CZ    1 
ATOM   5847  N N     . ALA B 1 121 ? -24.239 84.070  -1.457  1.00 23.65 ? 121  ALA B N     1 
ATOM   5848  C CA    . ALA B 1 121 ? -25.539 84.618  -1.835  1.00 23.44 ? 121  ALA B CA    1 
ATOM   5849  C C     . ALA B 1 121 ? -25.618 84.989  -3.336  1.00 23.43 ? 121  ALA B C     1 
ATOM   5850  O O     . ALA B 1 121 ? -26.645 84.750  -4.004  1.00 22.92 ? 121  ALA B O     1 
ATOM   5851  C CB    . ALA B 1 121 ? -25.861 85.824  -0.982  1.00 23.86 ? 121  ALA B CB    1 
ATOM   5852  N N     . ASN B 1 122 ? -24.546 85.575  -3.857  1.00 22.74 ? 122  ASN B N     1 
ATOM   5853  C CA    . ASN B 1 122 ? -24.510 85.958  -5.257  1.00 22.95 ? 122  ASN B CA    1 
ATOM   5854  C C     . ASN B 1 122 ? -24.430 84.707  -6.152  1.00 23.51 ? 122  ASN B C     1 
ATOM   5855  O O     . ASN B 1 122 ? -25.034 84.646  -7.250  1.00 23.10 ? 122  ASN B O     1 
ATOM   5856  C CB    . ASN B 1 122 ? -23.341 86.930  -5.510  1.00 22.77 ? 122  ASN B CB    1 
ATOM   5857  C CG    . ASN B 1 122 ? -23.717 88.376  -5.226  1.00 23.36 ? 122  ASN B CG    1 
ATOM   5858  O OD1   . ASN B 1 122 ? -24.853 88.793  -5.488  1.00 24.98 ? 122  ASN B OD1   1 
ATOM   5859  N ND2   . ASN B 1 122 ? -22.769 89.157  -4.707  1.00 21.72 ? 122  ASN B ND2   1 
ATOM   5860  N N     . THR B 1 123 ? -23.688 83.717  -5.645  1.00 23.57 ? 123  THR B N     1 
ATOM   5861  C CA    . THR B 1 123 ? -23.531 82.410  -6.252  1.00 23.95 ? 123  THR B CA    1 
ATOM   5862  C C     . THR B 1 123 ? -24.884 81.745  -6.433  1.00 24.45 ? 123  THR B C     1 
ATOM   5863  O O     . THR B 1 123 ? -25.203 81.260  -7.522  1.00 24.95 ? 123  THR B O     1 
ATOM   5864  C CB    . THR B 1 123 ? -22.576 81.512  -5.402  1.00 24.10 ? 123  THR B CB    1 
ATOM   5865  O OG1   . THR B 1 123 ? -21.242 82.064  -5.435  1.00 24.75 ? 123  THR B OG1   1 
ATOM   5866  C CG2   . THR B 1 123 ? -22.551 80.078  -5.908  1.00 22.29 ? 123  THR B CG2   1 
ATOM   5867  N N     . LEU B 1 124 ? -25.685 81.732  -5.377  1.00 25.13 ? 124  LEU B N     1 
ATOM   5868  C CA    . LEU B 1 124 ? -27.021 81.146  -5.458  1.00 25.83 ? 124  LEU B CA    1 
ATOM   5869  C C     . LEU B 1 124 ? -27.895 81.903  -6.494  1.00 25.95 ? 124  LEU B C     1 
ATOM   5870  O O     . LEU B 1 124 ? -28.514 81.294  -7.374  1.00 25.51 ? 124  LEU B O     1 
ATOM   5871  C CB    . LEU B 1 124 ? -27.675 81.105  -4.067  1.00 25.77 ? 124  LEU B CB    1 
ATOM   5872  C CG    . LEU B 1 124 ? -26.976 80.293  -2.954  1.00 27.58 ? 124  LEU B CG    1 
ATOM   5873  C CD1   . LEU B 1 124 ? -27.548 80.627  -1.552  1.00 27.41 ? 124  LEU B CD1   1 
ATOM   5874  C CD2   . LEU B 1 124 ? -27.004 78.768  -3.187  1.00 26.84 ? 124  LEU B CD2   1 
ATOM   5875  N N     . LEU B 1 125 ? -27.894 83.232  -6.400  1.00 25.91 ? 125  LEU B N     1 
ATOM   5876  C CA    . LEU B 1 125 ? -28.630 84.088  -7.326  1.00 26.06 ? 125  LEU B CA    1 
ATOM   5877  C C     . LEU B 1 125 ? -28.188 83.944  -8.784  1.00 26.80 ? 125  LEU B C     1 
ATOM   5878  O O     . LEU B 1 125 ? -29.027 84.008  -9.691  1.00 26.61 ? 125  LEU B O     1 
ATOM   5879  C CB    . LEU B 1 125 ? -28.518 85.549  -6.909  1.00 25.60 ? 125  LEU B CB    1 
ATOM   5880  C CG    . LEU B 1 125 ? -29.253 85.982  -5.641  1.00 23.75 ? 125  LEU B CG    1 
ATOM   5881  C CD1   . LEU B 1 125 ? -28.624 87.267  -5.120  1.00 20.00 ? 125  LEU B CD1   1 
ATOM   5882  C CD2   . LEU B 1 125 ? -30.778 86.105  -5.852  1.00 21.49 ? 125  LEU B CD2   1 
ATOM   5883  N N     . ASP B 1 126 ? -26.883 83.772  -9.005  1.00 27.51 ? 126  ASP B N     1 
ATOM   5884  C CA    . ASP B 1 126 ? -26.344 83.538  -10.353 1.00 28.18 ? 126  ASP B CA    1 
ATOM   5885  C C     . ASP B 1 126 ? -26.825 82.194  -10.882 1.00 28.23 ? 126  ASP B C     1 
ATOM   5886  O O     . ASP B 1 126 ? -26.913 81.984  -12.078 1.00 27.66 ? 126  ASP B O     1 
ATOM   5887  C CB    . ASP B 1 126 ? -24.810 83.581  -10.347 1.00 28.62 ? 126  ASP B CB    1 
ATOM   5888  C CG    . ASP B 1 126 ? -24.241 85.006  -10.148 1.00 30.36 ? 126  ASP B CG    1 
ATOM   5889  O OD1   . ASP B 1 126 ? -25.025 85.978  -9.959  1.00 30.85 ? 126  ASP B OD1   1 
ATOM   5890  O OD2   . ASP B 1 126 ? -22.990 85.149  -10.172 1.00 31.31 ? 126  ASP B OD2   1 
ATOM   5891  N N     . LEU B 1 127 ? -27.155 81.297  -9.960  1.00 29.14 ? 127  LEU B N     1 
ATOM   5892  C CA    . LEU B 1 127 ? -27.618 79.956  -10.293 1.00 29.64 ? 127  LEU B CA    1 
ATOM   5893  C C     . LEU B 1 127 ? -29.126 79.940  -10.513 1.00 29.69 ? 127  LEU B C     1 
ATOM   5894  O O     . LEU B 1 127 ? -29.698 78.899  -10.847 1.00 29.75 ? 127  LEU B O     1 
ATOM   5895  C CB    . LEU B 1 127 ? -27.243 78.993  -9.164  1.00 29.65 ? 127  LEU B CB    1 
ATOM   5896  C CG    . LEU B 1 127 ? -26.510 77.713  -9.544  1.00 30.55 ? 127  LEU B CG    1 
ATOM   5897  C CD1   . LEU B 1 127 ? -25.541 77.956  -10.708 1.00 31.96 ? 127  LEU B CD1   1 
ATOM   5898  C CD2   . LEU B 1 127 ? -25.759 77.166  -8.366  1.00 30.27 ? 127  LEU B CD2   1 
ATOM   5899  N N     . GLY B 1 128 ? -29.768 81.090  -10.318 1.00 29.41 ? 128  GLY B N     1 
ATOM   5900  C CA    . GLY B 1 128 ? -31.195 81.219  -10.585 1.00 29.64 ? 128  GLY B CA    1 
ATOM   5901  C C     . GLY B 1 128 ? -32.079 80.948  -9.379  1.00 29.80 ? 128  GLY B C     1 
ATOM   5902  O O     . GLY B 1 128 ? -33.298 80.959  -9.496  1.00 29.91 ? 128  GLY B O     1 
ATOM   5903  N N     . ILE B 1 129 ? -31.471 80.697  -8.223  1.00 29.45 ? 129  ILE B N     1 
ATOM   5904  C CA    . ILE B 1 129 ? -32.226 80.544  -6.991  1.00 29.24 ? 129  ILE B CA    1 
ATOM   5905  C C     . ILE B 1 129 ? -32.934 81.864  -6.652  1.00 29.81 ? 129  ILE B C     1 
ATOM   5906  O O     . ILE B 1 129 ? -32.389 82.952  -6.894  1.00 30.54 ? 129  ILE B O     1 
ATOM   5907  C CB    . ILE B 1 129 ? -31.313 80.050  -5.827  1.00 29.43 ? 129  ILE B CB    1 
ATOM   5908  C CG1   . ILE B 1 129 ? -30.548 78.782  -6.247  1.00 27.91 ? 129  ILE B CG1   1 
ATOM   5909  C CG2   . ILE B 1 129 ? -32.136 79.786  -4.533  1.00 27.57 ? 129  ILE B CG2   1 
ATOM   5910  C CD1   . ILE B 1 129 ? -31.442 77.560  -6.521  1.00 26.48 ? 129  ILE B CD1   1 
ATOM   5911  N N     . LYS B 1 130 ? -34.166 81.768  -6.157  1.00 29.49 ? 130  LYS B N     1 
ATOM   5912  C CA    . LYS B 1 130 ? -34.920 82.943  -5.731  1.00 30.14 ? 130  LYS B CA    1 
ATOM   5913  C C     . LYS B 1 130 ? -35.533 82.734  -4.345  1.00 29.56 ? 130  LYS B C     1 
ATOM   5914  O O     . LYS B 1 130 ? -35.657 81.603  -3.856  1.00 28.50 ? 130  LYS B O     1 
ATOM   5915  C CB    . LYS B 1 130 ? -36.045 83.269  -6.730  1.00 30.09 ? 130  LYS B CB    1 
ATOM   5916  C CG    . LYS B 1 130 ? -35.579 83.757  -8.119  1.00 32.49 ? 130  LYS B CG    1 
ATOM   5917  C CD    . LYS B 1 130 ? -36.756 84.080  -9.067  1.00 32.14 ? 130  LYS B CD    1 
ATOM   5918  C CE    . LYS B 1 130 ? -37.188 85.576  -9.003  1.00 36.23 ? 130  LYS B CE    1 
ATOM   5919  N NZ    . LYS B 1 130 ? -36.095 86.592  -9.278  1.00 33.97 ? 130  LYS B NZ    1 
ATOM   5920  N N     . LYS B 1 131 ? -35.945 83.844  -3.740  1.00 29.70 ? 131  LYS B N     1 
ATOM   5921  C CA    . LYS B 1 131 ? -36.758 83.834  -2.530  1.00 29.87 ? 131  LYS B CA    1 
ATOM   5922  C C     . LYS B 1 131 ? -37.806 82.735  -2.672  1.00 29.97 ? 131  LYS B C     1 
ATOM   5923  O O     . LYS B 1 131 ? -38.357 82.539  -3.759  1.00 30.99 ? 131  LYS B O     1 
ATOM   5924  C CB    . LYS B 1 131 ? -37.420 85.206  -2.324  1.00 29.57 ? 131  LYS B CB    1 
ATOM   5925  C CG    . LYS B 1 131 ? -38.289 85.300  -1.087  1.00 29.74 ? 131  LYS B CG    1 
ATOM   5926  C CD    . LYS B 1 131 ? -38.910 86.688  -0.940  1.00 29.62 ? 131  LYS B CD    1 
ATOM   5927  C CE    . LYS B 1 131 ? -39.489 86.895  0.454   1.00 26.76 ? 131  LYS B CE    1 
ATOM   5928  N NZ    . LYS B 1 131 ? -40.143 88.221  0.603   1.00 26.09 ? 131  LYS B NZ    1 
ATOM   5929  N N     . GLY B 1 132 ? -38.042 81.991  -1.593  1.00 29.80 ? 132  GLY B N     1 
ATOM   5930  C CA    . GLY B 1 132 ? -39.059 80.938  -1.584  1.00 28.52 ? 132  GLY B CA    1 
ATOM   5931  C C     . GLY B 1 132 ? -38.641 79.587  -2.120  1.00 28.00 ? 132  GLY B C     1 
ATOM   5932  O O     . GLY B 1 132 ? -39.326 78.603  -1.851  1.00 27.97 ? 132  GLY B O     1 
ATOM   5933  N N     . ASP B 1 133 ? -37.537 79.536  -2.885  1.00 27.57 ? 133  ASP B N     1 
ATOM   5934  C CA    . ASP B 1 133 ? -36.969 78.267  -3.381  1.00 26.74 ? 133  ASP B CA    1 
ATOM   5935  C C     . ASP B 1 133 ? -36.436 77.507  -2.188  1.00 26.09 ? 133  ASP B C     1 
ATOM   5936  O O     . ASP B 1 133 ? -35.913 78.106  -1.227  1.00 25.68 ? 133  ASP B O     1 
ATOM   5937  C CB    . ASP B 1 133 ? -35.792 78.484  -4.349  1.00 26.99 ? 133  ASP B CB    1 
ATOM   5938  C CG    . ASP B 1 133 ? -36.222 78.910  -5.756  1.00 28.45 ? 133  ASP B CG    1 
ATOM   5939  O OD1   . ASP B 1 133 ? -37.429 78.989  -6.058  1.00 29.30 ? 133  ASP B OD1   1 
ATOM   5940  O OD2   . ASP B 1 133 ? -35.322 79.172  -6.584  1.00 31.70 ? 133  ASP B OD2   1 
ATOM   5941  N N     . VAL B 1 134 ? -36.562 76.190  -2.244  1.00 25.40 ? 134  VAL B N     1 
ATOM   5942  C CA    . VAL B 1 134 ? -36.000 75.347  -1.196  1.00 24.82 ? 134  VAL B CA    1 
ATOM   5943  C C     . VAL B 1 134 ? -34.645 74.802  -1.654  1.00 24.60 ? 134  VAL B C     1 
ATOM   5944  O O     . VAL B 1 134 ? -34.465 74.393  -2.818  1.00 24.80 ? 134  VAL B O     1 
ATOM   5945  C CB    . VAL B 1 134 ? -36.962 74.217  -0.754  1.00 25.07 ? 134  VAL B CB    1 
ATOM   5946  C CG1   . VAL B 1 134 ? -36.317 73.363  0.339   1.00 25.70 ? 134  VAL B CG1   1 
ATOM   5947  C CG2   . VAL B 1 134 ? -38.311 74.797  -0.269  1.00 23.19 ? 134  VAL B CG2   1 
ATOM   5948  N N     . VAL B 1 135 ? -33.688 74.852  -0.734  1.00 23.79 ? 135  VAL B N     1 
ATOM   5949  C CA    . VAL B 1 135 ? -32.326 74.433  -0.994  1.00 22.95 ? 135  VAL B CA    1 
ATOM   5950  C C     . VAL B 1 135 ? -31.901 73.379  0.030   1.00 22.16 ? 135  VAL B C     1 
ATOM   5951  O O     . VAL B 1 135 ? -31.985 73.603  1.239   1.00 21.55 ? 135  VAL B O     1 
ATOM   5952  C CB    . VAL B 1 135 ? -31.367 75.655  -1.002  1.00 23.25 ? 135  VAL B CB    1 
ATOM   5953  C CG1   . VAL B 1 135 ? -29.934 75.203  -1.217  1.00 23.35 ? 135  VAL B CG1   1 
ATOM   5954  C CG2   . VAL B 1 135 ? -31.805 76.670  -2.089  1.00 22.03 ? 135  VAL B CG2   1 
ATOM   5955  N N     . ALA B 1 136 ? -31.483 72.221  -0.478  1.00 21.41 ? 136  ALA B N     1 
ATOM   5956  C CA    . ALA B 1 136 ? -31.021 71.105  0.354   1.00 20.53 ? 136  ALA B CA    1 
ATOM   5957  C C     . ALA B 1 136 ? -29.539 71.223  0.707   1.00 20.39 ? 136  ALA B C     1 
ATOM   5958  O O     . ALA B 1 136 ? -28.662 71.335  -0.172  1.00 19.49 ? 136  ALA B O     1 
ATOM   5959  C CB    . ALA B 1 136 ? -31.285 69.788  -0.333  1.00 19.83 ? 136  ALA B CB    1 
ATOM   5960  N N     . ILE B 1 137 ? -29.278 71.181  2.007   1.00 20.15 ? 137  ILE B N     1 
ATOM   5961  C CA    . ILE B 1 137 ? -27.927 71.200  2.534   1.00 20.14 ? 137  ILE B CA    1 
ATOM   5962  C C     . ILE B 1 137 ? -27.621 69.872  3.243   1.00 21.05 ? 137  ILE B C     1 
ATOM   5963  O O     . ILE B 1 137 ? -28.269 69.533  4.227   1.00 21.43 ? 137  ILE B O     1 
ATOM   5964  C CB    . ILE B 1 137 ? -27.673 72.443  3.451   1.00 19.91 ? 137  ILE B CB    1 
ATOM   5965  C CG1   . ILE B 1 137 ? -28.036 73.742  2.709   1.00 17.90 ? 137  ILE B CG1   1 
ATOM   5966  C CG2   . ILE B 1 137 ? -26.215 72.453  3.937   1.00 18.68 ? 137  ILE B CG2   1 
ATOM   5967  C CD1   . ILE B 1 137 ? -27.979 75.014  3.545   1.00 19.74 ? 137  ILE B CD1   1 
ATOM   5968  N N     . TYR B 1 138 ? -26.647 69.136  2.692   1.00 21.58 ? 138  TYR B N     1 
ATOM   5969  C CA    . TYR B 1 138 ? -26.196 67.825  3.149   1.00 21.75 ? 138  TYR B CA    1 
ATOM   5970  C C     . TYR B 1 138 ? -24.699 67.944  3.364   1.00 22.57 ? 138  TYR B C     1 
ATOM   5971  O O     . TYR B 1 138 ? -23.891 67.579  2.492   1.00 22.02 ? 138  TYR B O     1 
ATOM   5972  C CB    . TYR B 1 138 ? -26.474 66.789  2.057   1.00 21.46 ? 138  TYR B CB    1 
ATOM   5973  C CG    . TYR B 1 138 ? -26.284 65.330  2.438   1.00 20.50 ? 138  TYR B CG    1 
ATOM   5974  C CD1   . TYR B 1 138 ? -26.942 64.772  3.549   1.00 18.38 ? 138  TYR B CD1   1 
ATOM   5975  C CD2   . TYR B 1 138 ? -25.476 64.485  1.652   1.00 21.11 ? 138  TYR B CD2   1 
ATOM   5976  C CE1   . TYR B 1 138 ? -26.795 63.413  3.881   1.00 19.74 ? 138  TYR B CE1   1 
ATOM   5977  C CE2   . TYR B 1 138 ? -25.325 63.109  1.964   1.00 21.03 ? 138  TYR B CE2   1 
ATOM   5978  C CZ    . TYR B 1 138 ? -25.988 62.588  3.074   1.00 21.33 ? 138  TYR B CZ    1 
ATOM   5979  O OH    . TYR B 1 138 ? -25.827 61.269  3.384   1.00 21.15 ? 138  TYR B OH    1 
ATOM   5980  N N     . MET B 1 139 ? -24.346 68.479  4.527   1.00 23.57 ? 139  MET B N     1 
ATOM   5981  C CA    . MET B 1 139 ? -22.988 68.879  4.825   1.00 25.01 ? 139  MET B CA    1 
ATOM   5982  C C     . MET B 1 139 ? -22.493 68.260  6.127   1.00 25.86 ? 139  MET B C     1 
ATOM   5983  O O     . MET B 1 139 ? -23.300 67.814  6.988   1.00 25.43 ? 139  MET B O     1 
ATOM   5984  C CB    . MET B 1 139 ? -22.879 70.407  4.942   1.00 25.24 ? 139  MET B CB    1 
ATOM   5985  C CG    . MET B 1 139 ? -23.070 71.187  3.640   1.00 28.56 ? 139  MET B CG    1 
ATOM   5986  S SD    . MET B 1 139 ? -21.588 71.239  2.651   1.00 35.42 ? 139  MET B SD    1 
ATOM   5987  C CE    . MET B 1 139 ? -21.015 72.895  3.032   1.00 31.04 ? 139  MET B CE    1 
ATOM   5988  N N     . PRO B 1 140 ? -21.150 68.210  6.269   1.00 26.01 ? 140  PRO B N     1 
ATOM   5989  C CA    . PRO B 1 140 ? -20.564 67.884  7.556   1.00 25.63 ? 140  PRO B CA    1 
ATOM   5990  C C     . PRO B 1 140 ? -20.400 69.165  8.367   1.00 25.57 ? 140  PRO B C     1 
ATOM   5991  O O     . PRO B 1 140 ? -20.750 70.258  7.882   1.00 25.68 ? 140  PRO B O     1 
ATOM   5992  C CB    . PRO B 1 140 ? -19.203 67.274  7.176   1.00 25.33 ? 140  PRO B CB    1 
ATOM   5993  C CG    . PRO B 1 140 ? -18.836 67.911  5.875   1.00 25.95 ? 140  PRO B CG    1 
ATOM   5994  C CD    . PRO B 1 140 ? -20.124 68.432  5.223   1.00 25.69 ? 140  PRO B CD    1 
ATOM   5995  N N     . MET B 1 141 ? -19.859 69.019  9.578   1.00 25.35 ? 141  MET B N     1 
ATOM   5996  C CA    . MET B 1 141 ? -19.592 70.117  10.499  1.00 24.79 ? 141  MET B CA    1 
ATOM   5997  C C     . MET B 1 141 ? -18.348 70.902  10.103  1.00 25.31 ? 141  MET B C     1 
ATOM   5998  O O     . MET B 1 141 ? -17.306 70.848  10.771  1.00 25.63 ? 141  MET B O     1 
ATOM   5999  C CB    . MET B 1 141 ? -19.482 69.559  11.922  1.00 25.10 ? 141  MET B CB    1 
ATOM   6000  C CG    . MET B 1 141 ? -20.843 69.179  12.505  1.00 24.68 ? 141  MET B CG    1 
ATOM   6001  S SD    . MET B 1 141 ? -21.773 70.677  12.950  1.00 26.36 ? 141  MET B SD    1 
ATOM   6002  C CE    . MET B 1 141 ? -21.070 70.860  14.579  1.00 24.35 ? 141  MET B CE    1 
ATOM   6003  N N     . VAL B 1 142 ? -18.470 71.610  8.981   1.00 25.35 ? 142  VAL B N     1 
ATOM   6004  C CA    . VAL B 1 142 ? -17.473 72.553  8.489   1.00 24.65 ? 142  VAL B CA    1 
ATOM   6005  C C     . VAL B 1 142 ? -18.121 73.949  8.321   1.00 24.84 ? 142  VAL B C     1 
ATOM   6006  O O     . VAL B 1 142 ? -19.352 74.063  8.134   1.00 24.06 ? 142  VAL B O     1 
ATOM   6007  C CB    . VAL B 1 142 ? -16.810 72.064  7.155   1.00 24.97 ? 142  VAL B CB    1 
ATOM   6008  C CG1   . VAL B 1 142 ? -16.015 70.772  7.388   1.00 25.11 ? 142  VAL B CG1   1 
ATOM   6009  C CG2   . VAL B 1 142 ? -17.831 71.897  6.033   1.00 23.26 ? 142  VAL B CG2   1 
ATOM   6010  N N     . PRO B 1 143 ? -17.304 75.026  8.378   1.00 24.98 ? 143  PRO B N     1 
ATOM   6011  C CA    . PRO B 1 143 ? -17.912 76.361  8.392   1.00 25.25 ? 143  PRO B CA    1 
ATOM   6012  C C     . PRO B 1 143 ? -18.796 76.663  7.155   1.00 25.75 ? 143  PRO B C     1 
ATOM   6013  O O     . PRO B 1 143 ? -19.766 77.433  7.247   1.00 25.60 ? 143  PRO B O     1 
ATOM   6014  C CB    . PRO B 1 143 ? -16.690 77.285  8.446   1.00 25.61 ? 143  PRO B CB    1 
ATOM   6015  C CG    . PRO B 1 143 ? -15.594 76.429  9.019   1.00 24.25 ? 143  PRO B CG    1 
ATOM   6016  C CD    . PRO B 1 143 ? -15.829 75.102  8.427   1.00 24.58 ? 143  PRO B CD    1 
ATOM   6017  N N     . GLU B 1 144 ? -18.466 76.042  6.023   1.00 25.97 ? 144  GLU B N     1 
ATOM   6018  C CA    . GLU B 1 144 ? -19.182 76.261  4.768   1.00 26.17 ? 144  GLU B CA    1 
ATOM   6019  C C     . GLU B 1 144 ? -20.677 75.918  4.861   1.00 26.30 ? 144  GLU B C     1 
ATOM   6020  O O     . GLU B 1 144 ? -21.515 76.555  4.196   1.00 26.78 ? 144  GLU B O     1 
ATOM   6021  C CB    . GLU B 1 144 ? -18.520 75.476  3.622   1.00 26.54 ? 144  GLU B CB    1 
ATOM   6022  C CG    . GLU B 1 144 ? -17.147 76.004  3.169   1.00 25.72 ? 144  GLU B CG    1 
ATOM   6023  C CD    . GLU B 1 144 ? -15.980 75.466  3.991   1.00 25.83 ? 144  GLU B CD    1 
ATOM   6024  O OE1   . GLU B 1 144 ? -16.183 74.665  4.940   1.00 25.71 ? 144  GLU B OE1   1 
ATOM   6025  O OE2   . GLU B 1 144 ? -14.839 75.848  3.669   1.00 25.08 ? 144  GLU B OE2   1 
ATOM   6026  N N     . ALA B 1 145 ? -21.014 74.925  5.685   1.00 26.39 ? 145  ALA B N     1 
ATOM   6027  C CA    . ALA B 1 145 ? -22.430 74.580  5.953   1.00 26.21 ? 145  ALA B CA    1 
ATOM   6028  C C     . ALA B 1 145 ? -23.173 75.809  6.486   1.00 26.29 ? 145  ALA B C     1 
ATOM   6029  O O     . ALA B 1 145 ? -24.268 76.153  6.004   1.00 26.30 ? 145  ALA B O     1 
ATOM   6030  C CB    . ALA B 1 145 ? -22.528 73.420  6.924   1.00 25.31 ? 145  ALA B CB    1 
ATOM   6031  N N     . ALA B 1 146 ? -22.548 76.478  7.456   1.00 25.81 ? 146  ALA B N     1 
ATOM   6032  C CA    . ALA B 1 146 ? -23.052 77.740  8.007   1.00 25.82 ? 146  ALA B CA    1 
ATOM   6033  C C     . ALA B 1 146 ? -23.166 78.850  6.946   1.00 25.38 ? 146  ALA B C     1 
ATOM   6034  O O     . ALA B 1 146 ? -24.138 79.614  6.942   1.00 25.73 ? 146  ALA B O     1 
ATOM   6035  C CB    . ALA B 1 146 ? -22.161 78.193  9.181   1.00 25.46 ? 146  ALA B CB    1 
ATOM   6036  N N     . VAL B 1 147 ? -22.175 78.933  6.060   1.00 24.67 ? 147  VAL B N     1 
ATOM   6037  C CA    . VAL B 1 147 ? -22.187 79.892  4.949   1.00 24.23 ? 147  VAL B CA    1 
ATOM   6038  C C     . VAL B 1 147 ? -23.374 79.624  4.012   1.00 24.56 ? 147  VAL B C     1 
ATOM   6039  O O     . VAL B 1 147 ? -24.084 80.564  3.594   1.00 24.45 ? 147  VAL B O     1 
ATOM   6040  C CB    . VAL B 1 147 ? -20.873 79.838  4.134   1.00 23.76 ? 147  VAL B CB    1 
ATOM   6041  C CG1   . VAL B 1 147 ? -20.923 80.787  2.954   1.00 22.74 ? 147  VAL B CG1   1 
ATOM   6042  C CG2   . VAL B 1 147 ? -19.688 80.173  5.014   1.00 24.00 ? 147  VAL B CG2   1 
ATOM   6043  N N     . ALA B 1 148 ? -23.586 78.345  3.683   1.00 24.25 ? 148  ALA B N     1 
ATOM   6044  C CA    . ALA B 1 148 ? -24.681 77.951  2.793   1.00 23.59 ? 148  ALA B CA    1 
ATOM   6045  C C     . ALA B 1 148 ? -26.013 78.283  3.464   1.00 24.05 ? 148  ALA B C     1 
ATOM   6046  O O     . ALA B 1 148 ? -26.929 78.814  2.819   1.00 24.78 ? 148  ALA B O     1 
ATOM   6047  C CB    . ALA B 1 148 ? -24.582 76.485  2.453   1.00 22.62 ? 148  ALA B CB    1 
ATOM   6048  N N     . MET B 1 149 ? -26.103 78.016  4.770   1.00 23.60 ? 149  MET B N     1 
ATOM   6049  C CA    . MET B 1 149 ? -27.298 78.350  5.545   1.00 23.24 ? 149  MET B CA    1 
ATOM   6050  C C     . MET B 1 149 ? -27.528 79.859  5.690   1.00 23.27 ? 149  MET B C     1 
ATOM   6051  O O     . MET B 1 149 ? -28.655 80.329  5.572   1.00 22.94 ? 149  MET B O     1 
ATOM   6052  C CB    . MET B 1 149 ? -27.273 77.683  6.925   1.00 23.18 ? 149  MET B CB    1 
ATOM   6053  C CG    . MET B 1 149 ? -27.384 76.179  6.897   1.00 21.81 ? 149  MET B CG    1 
ATOM   6054  S SD    . MET B 1 149 ? -26.894 75.446  8.469   1.00 23.13 ? 149  MET B SD    1 
ATOM   6055  C CE    . MET B 1 149 ? -28.247 75.991  9.548   1.00 20.82 ? 149  MET B CE    1 
ATOM   6056  N N     . LEU B 1 150 ? -26.470 80.614  5.967   1.00 22.98 ? 150  LEU B N     1 
ATOM   6057  C CA    . LEU B 1 150 ? -26.601 82.066  6.045   1.00 23.13 ? 150  LEU B CA    1 
ATOM   6058  C C     . LEU B 1 150 ? -26.976 82.693  4.686   1.00 22.95 ? 150  LEU B C     1 
ATOM   6059  O O     . LEU B 1 150 ? -27.837 83.569  4.622   1.00 22.76 ? 150  LEU B O     1 
ATOM   6060  C CB    . LEU B 1 150 ? -25.329 82.708  6.652   1.00 23.01 ? 150  LEU B CB    1 
ATOM   6061  C CG    . LEU B 1 150 ? -25.185 82.533  8.182   1.00 24.73 ? 150  LEU B CG    1 
ATOM   6062  C CD1   . LEU B 1 150 ? -23.734 82.661  8.669   1.00 22.27 ? 150  LEU B CD1   1 
ATOM   6063  C CD2   . LEU B 1 150 ? -26.157 83.467  8.987   1.00 23.69 ? 150  LEU B CD2   1 
ATOM   6064  N N     . ALA B 1 151 ? -26.324 82.241  3.612   1.00 23.14 ? 151  ALA B N     1 
ATOM   6065  C CA    . ALA B 1 151 ? -26.569 82.756  2.253   1.00 22.88 ? 151  ALA B CA    1 
ATOM   6066  C C     . ALA B 1 151 ? -28.022 82.556  1.783   1.00 22.98 ? 151  ALA B C     1 
ATOM   6067  O O     . ALA B 1 151 ? -28.603 83.473  1.178   1.00 22.89 ? 151  ALA B O     1 
ATOM   6068  C CB    . ALA B 1 151 ? -25.605 82.126  1.271   1.00 23.03 ? 151  ALA B CB    1 
ATOM   6069  N N     . CYS B 1 152 ? -28.604 81.383  2.073   1.00 22.58 ? 152  CYS B N     1 
ATOM   6070  C CA    . CYS B 1 152 ? -30.015 81.109  1.740   1.00 23.00 ? 152  CYS B CA    1 
ATOM   6071  C C     . CYS B 1 152 ? -30.923 82.123  2.433   1.00 22.86 ? 152  CYS B C     1 
ATOM   6072  O O     . CYS B 1 152 ? -31.830 82.700  1.822   1.00 21.53 ? 152  CYS B O     1 
ATOM   6073  C CB    . CYS B 1 152 ? -30.415 79.703  2.176   1.00 23.05 ? 152  CYS B CB    1 
ATOM   6074  S SG    . CYS B 1 152 ? -29.603 78.405  1.246   1.00 26.05 ? 152  CYS B SG    1 
ATOM   6075  N N     . ALA B 1 153 ? -30.619 82.346  3.712   1.00 23.04 ? 153  ALA B N     1 
ATOM   6076  C CA    . ALA B 1 153 ? -31.403 83.190  4.591   1.00 23.73 ? 153  ALA B CA    1 
ATOM   6077  C C     . ALA B 1 153 ? -31.346 84.629  4.114   1.00 24.25 ? 153  ALA B C     1 
ATOM   6078  O O     . ALA B 1 153 ? -32.364 85.342  4.110   1.00 24.55 ? 153  ALA B O     1 
ATOM   6079  C CB    . ALA B 1 153 ? -30.904 83.065  6.008   1.00 23.13 ? 153  ALA B CB    1 
ATOM   6080  N N     . ARG B 1 154 ? -30.160 85.020  3.657   1.00 24.59 ? 154  ARG B N     1 
ATOM   6081  C CA    . ARG B 1 154 ? -29.900 86.369  3.177   1.00 24.94 ? 154  ARG B CA    1 
ATOM   6082  C C     . ARG B 1 154 ? -30.776 86.732  1.978   1.00 24.95 ? 154  ARG B C     1 
ATOM   6083  O O     . ARG B 1 154 ? -31.249 87.853  1.886   1.00 25.04 ? 154  ARG B O     1 
ATOM   6084  C CB    . ARG B 1 154 ? -28.411 86.518  2.815   1.00 24.97 ? 154  ARG B CB    1 
ATOM   6085  C CG    . ARG B 1 154 ? -27.933 87.946  2.816   1.00 24.87 ? 154  ARG B CG    1 
ATOM   6086  C CD    . ARG B 1 154 ? -26.510 88.105  2.280   1.00 25.01 ? 154  ARG B CD    1 
ATOM   6087  N NE    . ARG B 1 154 ? -26.172 89.527  2.165   1.00 26.10 ? 154  ARG B NE    1 
ATOM   6088  C CZ    . ARG B 1 154 ? -25.660 90.259  3.156   1.00 26.61 ? 154  ARG B CZ    1 
ATOM   6089  N NH1   . ARG B 1 154 ? -25.388 89.706  4.345   1.00 27.23 ? 154  ARG B NH1   1 
ATOM   6090  N NH2   . ARG B 1 154 ? -25.406 91.538  2.956   1.00 24.46 ? 154  ARG B NH2   1 
ATOM   6091  N N     . ILE B 1 155 ? -30.990 85.770  1.077   1.00 25.17 ? 155  ILE B N     1 
ATOM   6092  C CA    . ILE B 1 155 ? -31.752 85.994  -0.161  1.00 24.89 ? 155  ILE B CA    1 
ATOM   6093  C C     . ILE B 1 155 ? -33.201 85.561  -0.003  1.00 25.08 ? 155  ILE B C     1 
ATOM   6094  O O     . ILE B 1 155 ? -33.999 85.723  -0.916  1.00 25.99 ? 155  ILE B O     1 
ATOM   6095  C CB    . ILE B 1 155 ? -31.093 85.292  -1.425  1.00 25.07 ? 155  ILE B CB    1 
ATOM   6096  C CG1   . ILE B 1 155 ? -31.209 83.750  -1.337  1.00 25.08 ? 155  ILE B CG1   1 
ATOM   6097  C CG2   . ILE B 1 155 ? -29.626 85.767  -1.628  1.00 23.69 ? 155  ILE B CG2   1 
ATOM   6098  C CD1   . ILE B 1 155 ? -30.703 83.001  -2.548  1.00 24.65 ? 155  ILE B CD1   1 
ATOM   6099  N N     . GLY B 1 156 ? -33.536 84.982  1.145   1.00 25.19 ? 156  GLY B N     1 
ATOM   6100  C CA    . GLY B 1 156 ? -34.900 84.547  1.413   1.00 24.78 ? 156  GLY B CA    1 
ATOM   6101  C C     . GLY B 1 156 ? -35.235 83.174  0.872   1.00 25.04 ? 156  GLY B C     1 
ATOM   6102  O O     . GLY B 1 156 ? -36.409 82.793  0.814   1.00 25.71 ? 156  GLY B O     1 
ATOM   6103  N N     . ALA B 1 157 ? -34.218 82.429  0.453   1.00 24.68 ? 157  ALA B N     1 
ATOM   6104  C CA    . ALA B 1 157 ? -34.398 81.039  0.059   1.00 24.79 ? 157  ALA B CA    1 
ATOM   6105  C C     . ALA B 1 157 ? -34.654 80.224  1.335   1.00 24.92 ? 157  ALA B C     1 
ATOM   6106  O O     . ALA B 1 157 ? -34.350 80.678  2.445   1.00 25.26 ? 157  ALA B O     1 
ATOM   6107  C CB    . ALA B 1 157 ? -33.159 80.521  -0.700  1.00 24.09 ? 157  ALA B CB    1 
ATOM   6108  N N     . VAL B 1 158 ? -35.224 79.038  1.190   1.00 25.07 ? 158  VAL B N     1 
ATOM   6109  C CA    . VAL B 1 158 ? -35.564 78.230  2.360   1.00 25.54 ? 158  VAL B CA    1 
ATOM   6110  C C     . VAL B 1 158 ? -34.665 76.983  2.437   1.00 25.77 ? 158  VAL B C     1 
ATOM   6111  O O     . VAL B 1 158 ? -34.836 76.019  1.675   1.00 26.00 ? 158  VAL B O     1 
ATOM   6112  C CB    . VAL B 1 158 ? -37.077 77.866  2.371   1.00 25.63 ? 158  VAL B CB    1 
ATOM   6113  C CG1   . VAL B 1 158 ? -37.419 76.953  3.556   1.00 25.37 ? 158  VAL B CG1   1 
ATOM   6114  C CG2   . VAL B 1 158 ? -37.934 79.136  2.402   1.00 25.42 ? 158  VAL B CG2   1 
ATOM   6115  N N     . HIS B 1 159 ? -33.695 77.003  3.342   1.00 25.50 ? 159  HIS B N     1 
ATOM   6116  C CA    . HIS B 1 159 ? -32.842 75.845  3.474   1.00 25.00 ? 159  HIS B CA    1 
ATOM   6117  C C     . HIS B 1 159 ? -33.524 74.713  4.209   1.00 25.46 ? 159  HIS B C     1 
ATOM   6118  O O     . HIS B 1 159 ? -34.339 74.914  5.116   1.00 25.62 ? 159  HIS B O     1 
ATOM   6119  C CB    . HIS B 1 159 ? -31.480 76.159  4.081   1.00 24.86 ? 159  HIS B CB    1 
ATOM   6120  C CG    . HIS B 1 159 ? -31.505 76.642  5.508   1.00 25.03 ? 159  HIS B CG    1 
ATOM   6121  N ND1   . HIS B 1 159 ? -31.896 75.847  6.565   1.00 23.68 ? 159  HIS B ND1   1 
ATOM   6122  C CD2   . HIS B 1 159 ? -31.081 77.812  6.053   1.00 22.49 ? 159  HIS B CD2   1 
ATOM   6123  C CE1   . HIS B 1 159 ? -31.750 76.523  7.693   1.00 25.41 ? 159  HIS B CE1   1 
ATOM   6124  N NE2   . HIS B 1 159 ? -31.261 77.719  7.409   1.00 23.40 ? 159  HIS B NE2   1 
ATOM   6125  N N     . SER B 1 160 ? -33.187 73.515  3.759   1.00 25.31 ? 160  SER B N     1 
ATOM   6126  C CA    . SER B 1 160 ? -33.592 72.295  4.369   1.00 24.33 ? 160  SER B CA    1 
ATOM   6127  C C     . SER B 1 160 ? -32.290 71.535  4.608   1.00 24.72 ? 160  SER B C     1 
ATOM   6128  O O     . SER B 1 160 ? -31.720 70.940  3.685   1.00 25.26 ? 160  SER B O     1 
ATOM   6129  C CB    . SER B 1 160 ? -34.507 71.533  3.423   1.00 23.91 ? 160  SER B CB    1 
ATOM   6130  O OG    . SER B 1 160 ? -35.107 70.451  4.097   1.00 22.55 ? 160  SER B OG    1 
ATOM   6131  N N     . VAL B 1 161 ? -31.816 71.570  5.846   1.00 24.25 ? 161  VAL B N     1 
ATOM   6132  C CA    . VAL B 1 161 ? -30.605 70.898  6.185   1.00 24.31 ? 161  VAL B CA    1 
ATOM   6133  C C     . VAL B 1 161 ? -30.913 69.429  6.477   1.00 24.72 ? 161  VAL B C     1 
ATOM   6134  O O     . VAL B 1 161 ? -31.703 69.098  7.386   1.00 24.95 ? 161  VAL B O     1 
ATOM   6135  C CB    . VAL B 1 161 ? -29.852 71.587  7.365   1.00 24.55 ? 161  VAL B CB    1 
ATOM   6136  C CG1   . VAL B 1 161 ? -28.557 70.818  7.737   1.00 23.63 ? 161  VAL B CG1   1 
ATOM   6137  C CG2   . VAL B 1 161 ? -29.505 73.014  6.998   1.00 24.41 ? 161  VAL B CG2   1 
ATOM   6138  N N     . ILE B 1 162 ? -30.298 68.570  5.662   1.00 24.06 ? 162  ILE B N     1 
ATOM   6139  C CA    . ILE B 1 162 ? -30.314 67.133  5.863   1.00 23.76 ? 162  ILE B CA    1 
ATOM   6140  C C     . ILE B 1 162 ? -29.033 66.644  6.569   1.00 23.95 ? 162  ILE B C     1 
ATOM   6141  O O     . ILE B 1 162 ? -27.932 66.723  6.003   1.00 24.15 ? 162  ILE B O     1 
ATOM   6142  C CB    . ILE B 1 162 ? -30.483 66.417  4.532   1.00 23.56 ? 162  ILE B CB    1 
ATOM   6143  C CG1   . ILE B 1 162 ? -31.687 67.019  3.792   1.00 22.96 ? 162  ILE B CG1   1 
ATOM   6144  C CG2   . ILE B 1 162 ? -30.605 64.907  4.755   1.00 22.43 ? 162  ILE B CG2   1 
ATOM   6145  C CD1   . ILE B 1 162 ? -31.659 66.797  2.293   1.00 23.43 ? 162  ILE B CD1   1 
ATOM   6146  N N     . PHE B 1 163 ? -29.195 66.176  7.813   1.00 23.37 ? 163  PHE B N     1 
ATOM   6147  C CA    . PHE B 1 163 ? -28.144 65.496  8.593   1.00 22.28 ? 163  PHE B CA    1 
ATOM   6148  C C     . PHE B 1 163 ? -27.287 64.573  7.717   1.00 21.88 ? 163  PHE B C     1 
ATOM   6149  O O     . PHE B 1 163 ? -27.819 63.705  7.019   1.00 21.66 ? 163  PHE B O     1 
ATOM   6150  C CB    . PHE B 1 163 ? -28.801 64.689  9.733   1.00 21.79 ? 163  PHE B CB    1 
ATOM   6151  C CG    . PHE B 1 163 ? -27.825 63.917  10.614  1.00 22.12 ? 163  PHE B CG    1 
ATOM   6152  C CD1   . PHE B 1 163 ? -26.876 64.587  11.397  1.00 21.01 ? 163  PHE B CD1   1 
ATOM   6153  C CD2   . PHE B 1 163 ? -27.892 62.524  10.692  1.00 21.28 ? 163  PHE B CD2   1 
ATOM   6154  C CE1   . PHE B 1 163 ? -25.994 63.877  12.230  1.00 23.07 ? 163  PHE B CE1   1 
ATOM   6155  C CE2   . PHE B 1 163 ? -27.004 61.784  11.536  1.00 21.91 ? 163  PHE B CE2   1 
ATOM   6156  C CZ    . PHE B 1 163 ? -26.054 62.464  12.307  1.00 21.02 ? 163  PHE B CZ    1 
ATOM   6157  N N     . GLY B 1 164 ? -25.970 64.759  7.775   1.00 21.37 ? 164  GLY B N     1 
ATOM   6158  C CA    . GLY B 1 164 ? -25.022 63.939  7.028   1.00 21.45 ? 164  GLY B CA    1 
ATOM   6159  C C     . GLY B 1 164 ? -24.971 62.433  7.309   1.00 21.57 ? 164  GLY B C     1 
ATOM   6160  O O     . GLY B 1 164 ? -24.412 61.684  6.517   1.00 22.43 ? 164  GLY B O     1 
ATOM   6161  N N     . GLY B 1 165 ? -25.519 61.967  8.425   1.00 21.41 ? 165  GLY B N     1 
ATOM   6162  C CA    . GLY B 1 165 ? -25.635 60.534  8.637   1.00 21.48 ? 165  GLY B CA    1 
ATOM   6163  C C     . GLY B 1 165 ? -26.887 59.893  8.021   1.00 22.10 ? 165  GLY B C     1 
ATOM   6164  O O     . GLY B 1 165 ? -27.175 58.713  8.280   1.00 22.94 ? 165  GLY B O     1 
ATOM   6165  N N     . PHE B 1 166 ? -27.655 60.638  7.232   1.00 21.54 ? 166  PHE B N     1 
ATOM   6166  C CA    . PHE B 1 166 ? -28.806 60.031  6.556   1.00 22.15 ? 166  PHE B CA    1 
ATOM   6167  C C     . PHE B 1 166 ? -28.376 59.289  5.312   1.00 22.50 ? 166  PHE B C     1 
ATOM   6168  O O     . PHE B 1 166 ? -27.359 59.621  4.692   1.00 22.28 ? 166  PHE B O     1 
ATOM   6169  C CB    . PHE B 1 166 ? -29.881 61.065  6.204   1.00 21.75 ? 166  PHE B CB    1 
ATOM   6170  C CG    . PHE B 1 166 ? -30.867 61.314  7.315   1.00 22.97 ? 166  PHE B CG    1 
ATOM   6171  C CD1   . PHE B 1 166 ? -31.600 60.261  7.864   1.00 21.80 ? 166  PHE B CD1   1 
ATOM   6172  C CD2   . PHE B 1 166 ? -31.055 62.599  7.820   1.00 23.07 ? 166  PHE B CD2   1 
ATOM   6173  C CE1   . PHE B 1 166 ? -32.510 60.477  8.892   1.00 23.66 ? 166  PHE B CE1   1 
ATOM   6174  C CE2   . PHE B 1 166 ? -31.970 62.837  8.831   1.00 23.95 ? 166  PHE B CE2   1 
ATOM   6175  C CZ    . PHE B 1 166 ? -32.711 61.768  9.375   1.00 23.19 ? 166  PHE B CZ    1 
ATOM   6176  N N     . SER B 1 167 ? -29.166 58.300  4.933   1.00 22.69 ? 167  SER B N     1 
ATOM   6177  C CA    . SER B 1 167 ? -28.833 57.485  3.795   1.00 23.45 ? 167  SER B CA    1 
ATOM   6178  C C     . SER B 1 167 ? -29.283 58.160  2.467   1.00 23.16 ? 167  SER B C     1 
ATOM   6179  O O     . SER B 1 167 ? -30.116 59.064  2.486   1.00 23.95 ? 167  SER B O     1 
ATOM   6180  C CB    . SER B 1 167 ? -29.506 56.132  3.964   1.00 23.59 ? 167  SER B CB    1 
ATOM   6181  O OG    . SER B 1 167 ? -30.894 56.264  3.678   1.00 25.32 ? 167  SER B OG    1 
ATOM   6182  N N     . PRO B 1 168 ? -28.750 57.705  1.318   1.00 22.43 ? 168  PRO B N     1 
ATOM   6183  C CA    . PRO B 1 168 ? -29.265 58.208  0.033   1.00 22.31 ? 168  PRO B CA    1 
ATOM   6184  C C     . PRO B 1 168 ? -30.796 58.127  -0.082  1.00 22.72 ? 168  PRO B C     1 
ATOM   6185  O O     . PRO B 1 168 ? -31.451 59.071  -0.569  1.00 22.87 ? 168  PRO B O     1 
ATOM   6186  C CB    . PRO B 1 168 ? -28.593 57.296  -1.004  1.00 22.03 ? 168  PRO B CB    1 
ATOM   6187  C CG    . PRO B 1 168 ? -27.329 56.788  -0.300  1.00 21.58 ? 168  PRO B CG    1 
ATOM   6188  C CD    . PRO B 1 168 ? -27.644 56.734  1.153   1.00 21.92 ? 168  PRO B CD    1 
ATOM   6189  N N     . GLU B 1 169 ? -31.366 57.007  0.351   1.00 22.60 ? 169  GLU B N     1 
ATOM   6190  C CA    . GLU B 1 169 ? -32.810 56.860  0.351   1.00 22.62 ? 169  GLU B CA    1 
ATOM   6191  C C     . GLU B 1 169 ? -33.506 57.968  1.178   1.00 22.53 ? 169  GLU B C     1 
ATOM   6192  O O     . GLU B 1 169 ? -34.561 58.473  0.775   1.00 22.19 ? 169  GLU B O     1 
ATOM   6193  C CB    . GLU B 1 169 ? -33.189 55.470  0.850   1.00 22.82 ? 169  GLU B CB    1 
ATOM   6194  C CG    . GLU B 1 169 ? -34.668 55.207  0.841   1.00 25.23 ? 169  GLU B CG    1 
ATOM   6195  C CD    . GLU B 1 169 ? -35.237 55.152  -0.571  1.00 30.35 ? 169  GLU B CD    1 
ATOM   6196  O OE1   . GLU B 1 169 ? -34.482 54.753  -1.516  1.00 30.30 ? 169  GLU B OE1   1 
ATOM   6197  O OE2   . GLU B 1 169 ? -36.435 55.517  -0.721  1.00 30.97 ? 169  GLU B OE2   1 
ATOM   6198  N N     . ALA B 1 170 ? -32.903 58.337  2.316   1.00 22.02 ? 170  ALA B N     1 
ATOM   6199  C CA    . ALA B 1 170 ? -33.476 59.327  3.220   1.00 22.14 ? 170  ALA B CA    1 
ATOM   6200  C C     . ALA B 1 170 ? -33.358 60.743  2.649   1.00 22.34 ? 170  ALA B C     1 
ATOM   6201  O O     . ALA B 1 170 ? -34.291 61.569  2.776   1.00 21.51 ? 170  ALA B O     1 
ATOM   6202  C CB    . ALA B 1 170 ? -32.824 59.250  4.592   1.00 21.99 ? 170  ALA B CB    1 
ATOM   6203  N N     . VAL B 1 171 ? -32.196 60.994  2.046   1.00 22.32 ? 171  VAL B N     1 
ATOM   6204  C CA    . VAL B 1 171 ? -31.883 62.231  1.326   1.00 22.71 ? 171  VAL B CA    1 
ATOM   6205  C C     . VAL B 1 171 ? -32.876 62.466  0.187   1.00 22.63 ? 171  VAL B C     1 
ATOM   6206  O O     . VAL B 1 171 ? -33.462 63.552  0.079   1.00 22.14 ? 171  VAL B O     1 
ATOM   6207  C CB    . VAL B 1 171 ? -30.397 62.200  0.811   1.00 22.91 ? 171  VAL B CB    1 
ATOM   6208  C CG1   . VAL B 1 171 ? -30.093 63.347  -0.141  1.00 23.61 ? 171  VAL B CG1   1 
ATOM   6209  C CG2   . VAL B 1 171 ? -29.442 62.253  1.973   1.00 21.65 ? 171  VAL B CG2   1 
ATOM   6210  N N     . ALA B 1 172 ? -33.069 61.426  -0.632  1.00 23.17 ? 172  ALA B N     1 
ATOM   6211  C CA    . ALA B 1 172 ? -34.054 61.402  -1.732  1.00 23.48 ? 172  ALA B CA    1 
ATOM   6212  C C     . ALA B 1 172 ? -35.455 61.853  -1.313  1.00 23.93 ? 172  ALA B C     1 
ATOM   6213  O O     . ALA B 1 172 ? -36.035 62.736  -1.954  1.00 24.44 ? 172  ALA B O     1 
ATOM   6214  C CB    . ALA B 1 172 ? -34.128 60.011  -2.358  1.00 23.12 ? 172  ALA B CB    1 
ATOM   6215  N N     . GLY B 1 173 ? -35.986 61.256  -0.242  1.00 23.75 ? 173  GLY B N     1 
ATOM   6216  C CA    . GLY B 1 173 ? -37.354 61.510  0.197   1.00 23.66 ? 173  GLY B CA    1 
ATOM   6217  C C     . GLY B 1 173 ? -37.550 62.951  0.616   1.00 24.20 ? 173  GLY B C     1 
ATOM   6218  O O     . GLY B 1 173 ? -38.605 63.545  0.377   1.00 24.17 ? 173  GLY B O     1 
ATOM   6219  N N     . ARG B 1 174 ? -36.511 63.512  1.230   1.00 24.40 ? 174  ARG B N     1 
ATOM   6220  C CA    . ARG B 1 174 ? -36.512 64.888  1.698   1.00 24.05 ? 174  ARG B CA    1 
ATOM   6221  C C     . ARG B 1 174 ? -36.464 65.867  0.535   1.00 24.50 ? 174  ARG B C     1 
ATOM   6222  O O     . ARG B 1 174 ? -37.284 66.781  0.473   1.00 25.67 ? 174  ARG B O     1 
ATOM   6223  C CB    . ARG B 1 174 ? -35.366 65.104  2.672   1.00 23.61 ? 174  ARG B CB    1 
ATOM   6224  C CG    . ARG B 1 174 ? -35.693 64.598  4.056   1.00 22.55 ? 174  ARG B CG    1 
ATOM   6225  C CD    . ARG B 1 174 ? -34.455 64.478  4.938   1.00 24.25 ? 174  ARG B CD    1 
ATOM   6226  N NE    . ARG B 1 174 ? -34.846 63.916  6.225   1.00 25.42 ? 174  ARG B NE    1 
ATOM   6227  C CZ    . ARG B 1 174 ? -35.152 62.636  6.425   1.00 28.02 ? 174  ARG B CZ    1 
ATOM   6228  N NH1   . ARG B 1 174 ? -35.077 61.743  5.432   1.00 26.67 ? 174  ARG B NH1   1 
ATOM   6229  N NH2   . ARG B 1 174 ? -35.519 62.242  7.638   1.00 30.39 ? 174  ARG B NH2   1 
ATOM   6230  N N     . ILE B 1 175 ? -35.532 65.666  -0.390  1.00 24.28 ? 175  ILE B N     1 
ATOM   6231  C CA    . ILE B 1 175 ? -35.511 66.412  -1.655  1.00 24.29 ? 175  ILE B CA    1 
ATOM   6232  C C     . ILE B 1 175 ? -36.824 66.320  -2.459  1.00 25.15 ? 175  ILE B C     1 
ATOM   6233  O O     . ILE B 1 175 ? -37.322 67.336  -2.967  1.00 25.00 ? 175  ILE B O     1 
ATOM   6234  C CB    . ILE B 1 175 ? -34.335 65.950  -2.543  1.00 25.07 ? 175  ILE B CB    1 
ATOM   6235  C CG1   . ILE B 1 175 ? -32.988 66.412  -1.915  1.00 23.72 ? 175  ILE B CG1   1 
ATOM   6236  C CG2   . ILE B 1 175 ? -34.556 66.342  -4.038  1.00 22.24 ? 175  ILE B CG2   1 
ATOM   6237  C CD1   . ILE B 1 175 ? -31.752 65.669  -2.466  1.00 22.91 ? 175  ILE B CD1   1 
ATOM   6238  N N     . ILE B 1 176 ? -37.386 65.117  -2.564  1.00 25.64 ? 176  ILE B N     1 
ATOM   6239  C CA    . ILE B 1 176 ? -38.678 64.959  -3.234  1.00 26.25 ? 176  ILE B CA    1 
ATOM   6240  C C     . ILE B 1 176 ? -39.790 65.740  -2.497  1.00 26.72 ? 176  ILE B C     1 
ATOM   6241  O O     . ILE B 1 176 ? -40.610 66.412  -3.132  1.00 26.84 ? 176  ILE B O     1 
ATOM   6242  C CB    . ILE B 1 176 ? -39.068 63.471  -3.447  1.00 26.41 ? 176  ILE B CB    1 
ATOM   6243  C CG1   . ILE B 1 176 ? -38.062 62.783  -4.376  1.00 25.51 ? 176  ILE B CG1   1 
ATOM   6244  C CG2   . ILE B 1 176 ? -40.511 63.346  -4.033  1.00 25.50 ? 176  ILE B CG2   1 
ATOM   6245  C CD1   . ILE B 1 176 ? -38.102 61.273  -4.303  1.00 25.77 ? 176  ILE B CD1   1 
ATOM   6246  N N     . ASP B 1 177 ? -39.796 65.673  -1.173  1.00 26.84 ? 177  ASP B N     1 
ATOM   6247  C CA    . ASP B 1 177 ? -40.856 66.306  -0.405  1.00 27.21 ? 177  ASP B CA    1 
ATOM   6248  C C     . ASP B 1 177 ? -40.815 67.832  -0.472  1.00 26.84 ? 177  ASP B C     1 
ATOM   6249  O O     . ASP B 1 177 ? -41.854 68.488  -0.553  1.00 25.49 ? 177  ASP B O     1 
ATOM   6250  C CB    . ASP B 1 177 ? -40.837 65.860  1.059   1.00 26.83 ? 177  ASP B CB    1 
ATOM   6251  C CG    . ASP B 1 177 ? -42.054 66.356  1.812   1.00 29.49 ? 177  ASP B CG    1 
ATOM   6252  O OD1   . ASP B 1 177 ? -41.962 67.354  2.578   1.00 30.91 ? 177  ASP B OD1   1 
ATOM   6253  O OD2   . ASP B 1 177 ? -43.137 65.784  1.580   1.00 31.47 ? 177  ASP B OD2   1 
ATOM   6254  N N     . SER B 1 178 ? -39.604 68.382  -0.424  1.00 27.20 ? 178  SER B N     1 
ATOM   6255  C CA    . SER B 1 178 ? -39.404 69.831  -0.394  1.00 27.45 ? 178  SER B CA    1 
ATOM   6256  C C     . SER B 1 178 ? -39.249 70.449  -1.801  1.00 27.68 ? 178  SER B C     1 
ATOM   6257  O O     . SER B 1 178 ? -39.209 71.679  -1.938  1.00 28.14 ? 178  SER B O     1 
ATOM   6258  C CB    . SER B 1 178 ? -38.156 70.113  0.387   1.00 26.92 ? 178  SER B CB    1 
ATOM   6259  O OG    . SER B 1 178 ? -37.071 69.528  -0.310  1.00 29.03 ? 178  SER B OG    1 
ATOM   6260  N N     . SER B 1 179 ? -39.158 69.601  -2.831  1.00 27.48 ? 179  SER B N     1 
ATOM   6261  C CA    . SER B 1 179 ? -38.885 70.035  -4.202  1.00 27.42 ? 179  SER B CA    1 
ATOM   6262  C C     . SER B 1 179 ? -37.622 70.902  -4.265  1.00 27.36 ? 179  SER B C     1 
ATOM   6263  O O     . SER B 1 179 ? -37.586 71.882  -4.986  1.00 27.60 ? 179  SER B O     1 
ATOM   6264  C CB    . SER B 1 179 ? -40.091 70.785  -4.816  1.00 27.60 ? 179  SER B CB    1 
ATOM   6265  O OG    . SER B 1 179 ? -41.173 69.917  -5.109  1.00 27.18 ? 179  SER B OG    1 
ATOM   6266  N N     . SER B 1 180 ? -36.598 70.533  -3.495  1.00 27.45 ? 180  SER B N     1 
ATOM   6267  C CA    . SER B 1 180 ? -35.313 71.235  -3.462  1.00 27.01 ? 180  SER B CA    1 
ATOM   6268  C C     . SER B 1 180 ? -34.785 71.480  -4.861  1.00 27.23 ? 180  SER B C     1 
ATOM   6269  O O     . SER B 1 180 ? -34.655 70.543  -5.650  1.00 26.85 ? 180  SER B O     1 
ATOM   6270  C CB    . SER B 1 180 ? -34.271 70.416  -2.682  1.00 26.91 ? 180  SER B CB    1 
ATOM   6271  O OG    . SER B 1 180 ? -34.577 70.345  -1.305  1.00 27.02 ? 180  SER B OG    1 
ATOM   6272  N N     . ARG B 1 181 ? -34.470 72.737  -5.165  1.00 27.65 ? 181  ARG B N     1 
ATOM   6273  C CA    . ARG B 1 181 ? -33.930 73.082  -6.480  1.00 28.53 ? 181  ARG B CA    1 
ATOM   6274  C C     . ARG B 1 181 ? -32.430 72.822  -6.556  1.00 28.17 ? 181  ARG B C     1 
ATOM   6275  O O     . ARG B 1 181 ? -31.860 72.697  -7.646  1.00 28.40 ? 181  ARG B O     1 
ATOM   6276  C CB    . ARG B 1 181 ? -34.235 74.533  -6.826  1.00 28.79 ? 181  ARG B CB    1 
ATOM   6277  C CG    . ARG B 1 181 ? -35.689 74.768  -7.214  1.00 33.12 ? 181  ARG B CG    1 
ATOM   6278  C CD    . ARG B 1 181 ? -35.856 76.104  -7.933  1.00 40.39 ? 181  ARG B CD    1 
ATOM   6279  N NE    . ARG B 1 181 ? -34.704 76.452  -8.778  1.00 43.33 ? 181  ARG B NE    1 
ATOM   6280  C CZ    . ARG B 1 181 ? -34.553 77.603  -9.441  1.00 45.53 ? 181  ARG B CZ    1 
ATOM   6281  N NH1   . ARG B 1 181 ? -35.484 78.556  -9.390  1.00 44.25 ? 181  ARG B NH1   1 
ATOM   6282  N NH2   . ARG B 1 181 ? -33.450 77.803  -10.159 1.00 47.08 ? 181  ARG B NH2   1 
ATOM   6283  N N     . LEU B 1 182 ? -31.807 72.722  -5.383  1.00 27.63 ? 182  LEU B N     1 
ATOM   6284  C CA    . LEU B 1 182 ? -30.361 72.691  -5.268  1.00 26.73 ? 182  LEU B CA    1 
ATOM   6285  C C     . LEU B 1 182 ? -29.924 71.797  -4.125  1.00 26.15 ? 182  LEU B C     1 
ATOM   6286  O O     . LEU B 1 182 ? -30.538 71.807  -3.067  1.00 25.59 ? 182  LEU B O     1 
ATOM   6287  C CB    . LEU B 1 182 ? -29.813 74.112  -5.048  1.00 26.44 ? 182  LEU B CB    1 
ATOM   6288  C CG    . LEU B 1 182 ? -28.295 74.287  -4.850  1.00 27.09 ? 182  LEU B CG    1 
ATOM   6289  C CD1   . LEU B 1 182 ? -27.484 73.864  -6.109  1.00 26.61 ? 182  LEU B CD1   1 
ATOM   6290  C CD2   . LEU B 1 182 ? -27.973 75.713  -4.465  1.00 26.41 ? 182  LEU B CD2   1 
ATOM   6291  N N     . VAL B 1 183 ? -28.857 71.029  -4.359  1.00 25.90 ? 183  VAL B N     1 
ATOM   6292  C CA    . VAL B 1 183 ? -28.158 70.338  -3.274  1.00 25.49 ? 183  VAL B CA    1 
ATOM   6293  C C     . VAL B 1 183 ? -26.734 70.854  -3.083  1.00 25.13 ? 183  VAL B C     1 
ATOM   6294  O O     . VAL B 1 183 ? -25.980 71.038  -4.049  1.00 24.72 ? 183  VAL B O     1 
ATOM   6295  C CB    . VAL B 1 183 ? -28.157 68.798  -3.434  1.00 25.77 ? 183  VAL B CB    1 
ATOM   6296  C CG1   . VAL B 1 183 ? -27.393 68.174  -2.288  1.00 25.45 ? 183  VAL B CG1   1 
ATOM   6297  C CG2   . VAL B 1 183 ? -29.591 68.244  -3.466  1.00 23.66 ? 183  VAL B CG2   1 
ATOM   6298  N N     . ILE B 1 184 ? -26.396 71.108  -1.821  1.00 24.76 ? 184  ILE B N     1 
ATOM   6299  C CA    . ILE B 1 184 ? -25.051 71.554  -1.428  1.00 23.82 ? 184  ILE B CA    1 
ATOM   6300  C C     . ILE B 1 184 ? -24.431 70.502  -0.523  1.00 23.74 ? 184  ILE B C     1 
ATOM   6301  O O     . ILE B 1 184 ? -25.015 70.133  0.502   1.00 23.05 ? 184  ILE B O     1 
ATOM   6302  C CB    . ILE B 1 184 ? -25.070 72.906  -0.697  1.00 23.83 ? 184  ILE B CB    1 
ATOM   6303  C CG1   . ILE B 1 184 ? -25.731 73.983  -1.581  1.00 22.87 ? 184  ILE B CG1   1 
ATOM   6304  C CG2   . ILE B 1 184 ? -23.638 73.279  -0.219  1.00 22.39 ? 184  ILE B CG2   1 
ATOM   6305  C CD1   . ILE B 1 184 ? -26.322 75.174  -0.805  1.00 20.35 ? 184  ILE B CD1   1 
ATOM   6306  N N     . THR B 1 185 ? -23.254 70.022  -0.920  1.00 23.52 ? 185  THR B N     1 
ATOM   6307  C CA    . THR B 1 185 ? -22.584 68.965  -0.196  1.00 23.73 ? 185  THR B CA    1 
ATOM   6308  C C     . THR B 1 185 ? -21.050 69.072  -0.217  1.00 23.33 ? 185  THR B C     1 
ATOM   6309  O O     . THR B 1 185 ? -20.489 70.082  -0.644  1.00 22.29 ? 185  THR B O     1 
ATOM   6310  C CB    . THR B 1 185 ? -23.123 67.553  -0.630  1.00 24.52 ? 185  THR B CB    1 
ATOM   6311  O OG1   . THR B 1 185 ? -22.739 66.566  0.347   1.00 26.09 ? 185  THR B OG1   1 
ATOM   6312  C CG2   . THR B 1 185 ? -22.666 67.152  -2.058  1.00 24.33 ? 185  THR B CG2   1 
ATOM   6313  N N     . ALA B 1 186 ? -20.386 68.050  0.316   1.00 23.46 ? 186  ALA B N     1 
ATOM   6314  C CA    . ALA B 1 186 ? -18.925 67.937  0.253   1.00 23.88 ? 186  ALA B CA    1 
ATOM   6315  C C     . ALA B 1 186 ? -18.597 66.616  -0.429  1.00 24.22 ? 186  ALA B C     1 
ATOM   6316  O O     . ALA B 1 186 ? -19.416 65.687  -0.416  1.00 23.98 ? 186  ALA B O     1 
ATOM   6317  C CB    . ALA B 1 186 ? -18.302 67.986  1.672   1.00 23.71 ? 186  ALA B CB    1 
ATOM   6318  N N     . ASP B 1 187 ? -17.415 66.518  -1.033  1.00 25.04 ? 187  ASP B N     1 
ATOM   6319  C CA    . ASP B 1 187 ? -16.965 65.210  -1.522  1.00 25.52 ? 187  ASP B CA    1 
ATOM   6320  C C     . ASP B 1 187 ? -17.137 64.137  -0.416  1.00 26.34 ? 187  ASP B C     1 
ATOM   6321  O O     . ASP B 1 187 ? -17.843 63.139  -0.636  1.00 27.17 ? 187  ASP B O     1 
ATOM   6322  C CB    . ASP B 1 187 ? -15.545 65.245  -2.127  1.00 24.48 ? 187  ASP B CB    1 
ATOM   6323  C CG    . ASP B 1 187 ? -14.495 65.857  -1.200  1.00 24.51 ? 187  ASP B CG    1 
ATOM   6324  O OD1   . ASP B 1 187 ? -14.763 66.220  -0.022  1.00 22.24 ? 187  ASP B OD1   1 
ATOM   6325  O OD2   . ASP B 1 187 ? -13.354 65.956  -1.677  1.00 23.25 ? 187  ASP B OD2   1 
ATOM   6326  N N     . GLU B 1 188 ? -16.539 64.378  0.755   1.00 26.55 ? 188  GLU B N     1 
ATOM   6327  C CA    . GLU B 1 188 ? -16.646 63.502  1.942   1.00 27.62 ? 188  GLU B CA    1 
ATOM   6328  C C     . GLU B 1 188 ? -16.650 64.321  3.225   1.00 28.29 ? 188  GLU B C     1 
ATOM   6329  O O     . GLU B 1 188 ? -16.061 65.412  3.275   1.00 28.11 ? 188  GLU B O     1 
ATOM   6330  C CB    . GLU B 1 188 ? -15.442 62.572  2.054   1.00 27.29 ? 188  GLU B CB    1 
ATOM   6331  C CG    . GLU B 1 188 ? -15.435 61.408  1.138   1.00 27.72 ? 188  GLU B CG    1 
ATOM   6332  C CD    . GLU B 1 188 ? -14.106 60.687  1.137   1.00 28.70 ? 188  GLU B CD    1 
ATOM   6333  O OE1   . GLU B 1 188 ? -13.123 61.161  1.762   1.00 27.56 ? 188  GLU B OE1   1 
ATOM   6334  O OE2   . GLU B 1 188 ? -14.033 59.638  0.472   1.00 32.02 ? 188  GLU B OE2   1 
ATOM   6335  N N     . GLY B 1 189 ? -17.284 63.774  4.261   1.00 29.23 ? 189  GLY B N     1 
ATOM   6336  C CA    . GLY B 1 189 ? -17.155 64.288  5.626   1.00 30.75 ? 189  GLY B CA    1 
ATOM   6337  C C     . GLY B 1 189 ? -16.055 63.524  6.350   1.00 32.34 ? 189  GLY B C     1 
ATOM   6338  O O     . GLY B 1 189 ? -15.717 62.405  5.960   1.00 32.28 ? 189  GLY B O     1 
ATOM   6339  N N     . VAL B 1 190 ? -15.482 64.140  7.387   1.00 34.01 ? 190  VAL B N     1 
ATOM   6340  C CA    . VAL B 1 190 ? -14.449 63.523  8.243   1.00 35.35 ? 190  VAL B CA    1 
ATOM   6341  C C     . VAL B 1 190 ? -14.896 63.513  9.725   1.00 36.58 ? 190  VAL B C     1 
ATOM   6342  O O     . VAL B 1 190 ? -15.232 64.567  10.290  1.00 36.99 ? 190  VAL B O     1 
ATOM   6343  C CB    . VAL B 1 190 ? -13.114 64.271  8.132   1.00 35.02 ? 190  VAL B CB    1 
ATOM   6344  C CG1   . VAL B 1 190 ? -12.068 63.578  8.960   1.00 34.44 ? 190  VAL B CG1   1 
ATOM   6345  C CG2   . VAL B 1 190 ? -12.672 64.379  6.667   1.00 35.78 ? 190  VAL B CG2   1 
ATOM   6346  N N     . ARG B 1 191 ? -14.924 62.325  10.330  1.00 37.49 ? 191  ARG B N     1 
ATOM   6347  C CA    . ARG B 1 191 ? -15.394 62.141  11.701  1.00 39.27 ? 191  ARG B CA    1 
ATOM   6348  C C     . ARG B 1 191 ? -14.706 60.915  12.307  1.00 39.32 ? 191  ARG B C     1 
ATOM   6349  O O     . ARG B 1 191 ? -14.573 59.875  11.652  1.00 38.73 ? 191  ARG B O     1 
ATOM   6350  C CB    . ARG B 1 191 ? -16.914 61.964  11.727  1.00 39.37 ? 191  ARG B CB    1 
ATOM   6351  C CG    . ARG B 1 191 ? -17.618 62.320  13.050  1.00 41.50 ? 191  ARG B CG    1 
ATOM   6352  C CD    . ARG B 1 191 ? -19.178 62.282  12.895  1.00 41.88 ? 191  ARG B CD    1 
ATOM   6353  N NE    . ARG B 1 191 ? -19.894 62.555  14.158  1.00 48.12 ? 191  ARG B NE    1 
ATOM   6354  C CZ    . ARG B 1 191 ? -20.414 61.621  14.975  1.00 49.09 ? 191  ARG B CZ    1 
ATOM   6355  N NH1   . ARG B 1 191 ? -20.324 60.325  14.678  1.00 49.26 ? 191  ARG B NH1   1 
ATOM   6356  N NH2   . ARG B 1 191 ? -21.028 61.982  16.105  1.00 47.35 ? 191  ARG B NH2   1 
ATOM   6357  N N     . ALA B 1 192 ? -14.238 61.066  13.549  1.00 39.78 ? 192  ALA B N     1 
ATOM   6358  C CA    . ALA B 1 192 ? -13.572 59.992  14.295  1.00 39.99 ? 192  ALA B CA    1 
ATOM   6359  C C     . ALA B 1 192 ? -12.539 59.209  13.466  1.00 40.16 ? 192  ALA B C     1 
ATOM   6360  O O     . ALA B 1 192 ? -12.442 57.992  13.582  1.00 40.10 ? 192  ALA B O     1 
ATOM   6361  C CB    . ALA B 1 192 ? -14.617 59.047  14.910  1.00 40.00 ? 192  ALA B CB    1 
ATOM   6362  N N     . GLY B 1 193 ? -11.790 59.924  12.626  1.00 40.82 ? 193  GLY B N     1 
ATOM   6363  C CA    . GLY B 1 193 ? -10.725 59.344  11.797  1.00 41.82 ? 193  GLY B CA    1 
ATOM   6364  C C     . GLY B 1 193 ? -11.201 58.591  10.560  1.00 42.79 ? 193  GLY B C     1 
ATOM   6365  O O     . GLY B 1 193 ? -10.417 57.896  9.907   1.00 42.87 ? 193  GLY B O     1 
ATOM   6366  N N     . ARG B 1 194 ? -12.480 58.755  10.226  1.00 43.30 ? 194  ARG B N     1 
ATOM   6367  C CA    . ARG B 1 194 ? -13.119 58.016  9.145   1.00 43.79 ? 194  ARG B CA    1 
ATOM   6368  C C     . ARG B 1 194 ? -13.907 58.928  8.195   1.00 43.32 ? 194  ARG B C     1 
ATOM   6369  O O     . ARG B 1 194 ? -14.438 59.979  8.602   1.00 43.61 ? 194  ARG B O     1 
ATOM   6370  C CB    . ARG B 1 194 ? -14.067 56.955  9.733   1.00 44.36 ? 194  ARG B CB    1 
ATOM   6371  C CG    . ARG B 1 194 ? -13.376 55.732  10.313  1.00 46.19 ? 194  ARG B CG    1 
ATOM   6372  C CD    . ARG B 1 194 ? -14.249 55.127  11.389  1.00 51.14 ? 194  ARG B CD    1 
ATOM   6373  N NE    . ARG B 1 194 ? -14.462 53.692  11.196  1.00 54.51 ? 194  ARG B NE    1 
ATOM   6374  C CZ    . ARG B 1 194 ? -14.882 52.861  12.154  1.00 57.09 ? 194  ARG B CZ    1 
ATOM   6375  N NH1   . ARG B 1 194 ? -15.112 53.317  13.386  1.00 56.23 ? 194  ARG B NH1   1 
ATOM   6376  N NH2   . ARG B 1 194 ? -15.052 51.564  11.890  1.00 57.42 ? 194  ARG B NH2   1 
ATOM   6377  N N     . SER B 1 195 ? -14.001 58.498  6.936   1.00 42.24 ? 195  SER B N     1 
ATOM   6378  C CA    . SER B 1 195 ? -14.709 59.239  5.897   1.00 40.89 ? 195  SER B CA    1 
ATOM   6379  C C     . SER B 1 195 ? -16.174 58.883  5.856   1.00 39.54 ? 195  SER B C     1 
ATOM   6380  O O     . SER B 1 195 ? -16.543 57.746  6.109   1.00 39.22 ? 195  SER B O     1 
ATOM   6381  C CB    . SER B 1 195 ? -14.078 58.963  4.529   1.00 41.11 ? 195  SER B CB    1 
ATOM   6382  O OG    . SER B 1 195 ? -13.066 59.920  4.267   1.00 42.54 ? 195  SER B OG    1 
ATOM   6383  N N     . ILE B 1 196 ? -17.007 59.867  5.544   1.00 38.32 ? 196  ILE B N     1 
ATOM   6384  C CA    . ILE B 1 196 ? -18.419 59.627  5.237   1.00 37.33 ? 196  ILE B CA    1 
ATOM   6385  C C     . ILE B 1 196 ? -18.615 60.081  3.801   1.00 35.44 ? 196  ILE B C     1 
ATOM   6386  O O     . ILE B 1 196 ? -18.256 61.197  3.473   1.00 35.18 ? 196  ILE B O     1 
ATOM   6387  C CB    . ILE B 1 196 ? -19.393 60.413  6.175   1.00 37.29 ? 196  ILE B CB    1 
ATOM   6388  C CG1   . ILE B 1 196 ? -19.019 60.208  7.646   1.00 38.49 ? 196  ILE B CG1   1 
ATOM   6389  C CG2   . ILE B 1 196 ? -20.844 59.989  5.923   1.00 36.93 ? 196  ILE B CG2   1 
ATOM   6390  C CD1   . ILE B 1 196 ? -19.814 61.099  8.652   1.00 38.90 ? 196  ILE B CD1   1 
ATOM   6391  N N     . PRO B 1 197 ? -19.208 59.225  2.945   1.00 34.38 ? 197  PRO B N     1 
ATOM   6392  C CA    . PRO B 1 197 ? -19.211 59.532  1.520   1.00 33.19 ? 197  PRO B CA    1 
ATOM   6393  C C     . PRO B 1 197 ? -20.437 60.362  1.100   1.00 31.98 ? 197  PRO B C     1 
ATOM   6394  O O     . PRO B 1 197 ? -21.253 59.927  0.275   1.00 31.99 ? 197  PRO B O     1 
ATOM   6395  C CB    . PRO B 1 197 ? -19.216 58.146  0.881   1.00 33.09 ? 197  PRO B CB    1 
ATOM   6396  C CG    . PRO B 1 197 ? -20.037 57.289  1.883   1.00 33.41 ? 197  PRO B CG    1 
ATOM   6397  C CD    . PRO B 1 197 ? -19.913 57.958  3.234   1.00 33.97 ? 197  PRO B CD    1 
ATOM   6398  N N     . LEU B 1 198 ? -20.531 61.563  1.652   1.00 30.36 ? 198  LEU B N     1 
ATOM   6399  C CA    . LEU B 1 198 ? -21.593 62.520  1.319   1.00 29.13 ? 198  LEU B CA    1 
ATOM   6400  C C     . LEU B 1 198 ? -21.950 62.619  -0.177  1.00 28.64 ? 198  LEU B C     1 
ATOM   6401  O O     . LEU B 1 198 ? -23.099 62.412  -0.547  1.00 28.50 ? 198  LEU B O     1 
ATOM   6402  C CB    . LEU B 1 198 ? -21.262 63.893  1.909   1.00 28.16 ? 198  LEU B CB    1 
ATOM   6403  C CG    . LEU B 1 198 ? -21.070 63.879  3.443   1.00 28.62 ? 198  LEU B CG    1 
ATOM   6404  C CD1   . LEU B 1 198 ? -20.675 65.261  3.993   1.00 26.05 ? 198  LEU B CD1   1 
ATOM   6405  C CD2   . LEU B 1 198 ? -22.316 63.319  4.183   1.00 25.90 ? 198  LEU B CD2   1 
ATOM   6406  N N     . LYS B 1 199 ? -20.966 62.920  -1.024  1.00 28.38 ? 199  LYS B N     1 
ATOM   6407  C CA    . LYS B 1 199 ? -21.220 63.214  -2.439  1.00 27.68 ? 199  LYS B CA    1 
ATOM   6408  C C     . LYS B 1 199 ? -21.726 62.002  -3.239  1.00 27.16 ? 199  LYS B C     1 
ATOM   6409  O O     . LYS B 1 199 ? -22.664 62.136  -4.044  1.00 27.24 ? 199  LYS B O     1 
ATOM   6410  C CB    . LYS B 1 199 ? -19.991 63.874  -3.095  1.00 27.63 ? 199  LYS B CB    1 
ATOM   6411  C CG    . LYS B 1 199 ? -19.855 63.656  -4.595  1.00 27.11 ? 199  LYS B CG    1 
ATOM   6412  C CD    . LYS B 1 199 ? -20.731 64.560  -5.406  1.00 25.76 ? 199  LYS B CD    1 
ATOM   6413  C CE    . LYS B 1 199 ? -20.292 64.556  -6.846  1.00 24.64 ? 199  LYS B CE    1 
ATOM   6414  N NZ    . LYS B 1 199 ? -21.291 64.052  -7.807  1.00 23.24 ? 199  LYS B NZ    1 
ATOM   6415  N N     . LYS B 1 200 ? -21.107 60.840  -3.029  1.00 26.36 ? 200  LYS B N     1 
ATOM   6416  C CA    . LYS B 1 200 ? -21.654 59.575  -3.545  1.00 26.58 ? 200  LYS B CA    1 
ATOM   6417  C C     . LYS B 1 200 ? -23.104 59.302  -3.076  1.00 25.60 ? 200  LYS B C     1 
ATOM   6418  O O     . LYS B 1 200 ? -23.910 58.800  -3.847  1.00 26.29 ? 200  LYS B O     1 
ATOM   6419  C CB    . LYS B 1 200 ? -20.741 58.397  -3.188  1.00 26.30 ? 200  LYS B CB    1 
ATOM   6420  C CG    . LYS B 1 200 ? -20.939 57.160  -4.079  1.00 28.44 ? 200  LYS B CG    1 
ATOM   6421  C CD    . LYS B 1 200 ? -20.337 55.892  -3.446  1.00 28.36 ? 200  LYS B CD    1 
ATOM   6422  C CE    . LYS B 1 200 ? -20.804 54.625  -4.147  1.00 29.66 ? 200  LYS B CE    1 
ATOM   6423  N NZ    . LYS B 1 200 ? -20.132 54.415  -5.453  1.00 31.44 ? 200  LYS B NZ    1 
ATOM   6424  N N     . ASN B 1 201 ? -23.438 59.634  -1.828  1.00 24.85 ? 201  ASN B N     1 
ATOM   6425  C CA    . ASN B 1 201 ? -24.797 59.462  -1.325  1.00 24.04 ? 201  ASN B CA    1 
ATOM   6426  C C     . ASN B 1 201 ? -25.758 60.298  -2.140  1.00 23.75 ? 201  ASN B C     1 
ATOM   6427  O O     . ASN B 1 201 ? -26.812 59.797  -2.563  1.00 23.70 ? 201  ASN B O     1 
ATOM   6428  C CB    . ASN B 1 201 ? -24.918 59.795  0.179   1.00 23.95 ? 201  ASN B CB    1 
ATOM   6429  C CG    . ASN B 1 201 ? -24.290 58.724  1.081   1.00 23.51 ? 201  ASN B CG    1 
ATOM   6430  O OD1   . ASN B 1 201 ? -23.865 57.670  0.598   1.00 24.39 ? 201  ASN B OD1   1 
ATOM   6431  N ND2   . ASN B 1 201 ? -24.219 58.997  2.392   1.00 19.42 ? 201  ASN B ND2   1 
ATOM   6432  N N     . VAL B 1 202 ? -25.384 61.555  -2.379  1.00 23.32 ? 202  VAL B N     1 
ATOM   6433  C CA    . VAL B 1 202 ? -26.158 62.449  -3.255  1.00 23.70 ? 202  VAL B CA    1 
ATOM   6434  C C     . VAL B 1 202 ? -26.331 61.884  -4.681  1.00 23.75 ? 202  VAL B C     1 
ATOM   6435  O O     . VAL B 1 202 ? -27.458 61.850  -5.212  1.00 23.64 ? 202  VAL B O     1 
ATOM   6436  C CB    . VAL B 1 202 ? -25.560 63.873  -3.310  1.00 23.78 ? 202  VAL B CB    1 
ATOM   6437  C CG1   . VAL B 1 202 ? -26.308 64.746  -4.350  1.00 24.69 ? 202  VAL B CG1   1 
ATOM   6438  C CG2   . VAL B 1 202 ? -25.634 64.533  -1.950  1.00 23.31 ? 202  VAL B CG2   1 
ATOM   6439  N N     . ASP B 1 203 ? -25.224 61.434  -5.282  1.00 23.69 ? 203  ASP B N     1 
ATOM   6440  C CA    . ASP B 1 203 ? -25.264 60.734  -6.572  1.00 24.35 ? 203  ASP B CA    1 
ATOM   6441  C C     . ASP B 1 203 ? -26.334 59.641  -6.605  1.00 24.06 ? 203  ASP B C     1 
ATOM   6442  O O     . ASP B 1 203 ? -27.132 59.576  -7.522  1.00 23.84 ? 203  ASP B O     1 
ATOM   6443  C CB    . ASP B 1 203 ? -23.908 60.101  -6.879  1.00 24.57 ? 203  ASP B CB    1 
ATOM   6444  C CG    . ASP B 1 203 ? -22.871 61.108  -7.305  1.00 25.96 ? 203  ASP B CG    1 
ATOM   6445  O OD1   . ASP B 1 203 ? -23.241 62.262  -7.618  1.00 27.57 ? 203  ASP B OD1   1 
ATOM   6446  O OD2   . ASP B 1 203 ? -21.679 60.731  -7.354  1.00 27.25 ? 203  ASP B OD2   1 
ATOM   6447  N N     . ASP B 1 204 ? -26.323 58.791  -5.586  1.00 24.45 ? 204  ASP B N     1 
ATOM   6448  C CA    . ASP B 1 204 ? -27.292 57.722  -5.417  1.00 25.16 ? 204  ASP B CA    1 
ATOM   6449  C C     . ASP B 1 204 ? -28.719 58.198  -5.113  1.00 25.23 ? 204  ASP B C     1 
ATOM   6450  O O     . ASP B 1 204 ? -29.680 57.649  -5.642  1.00 25.50 ? 204  ASP B O     1 
ATOM   6451  C CB    . ASP B 1 204 ? -26.801 56.779  -4.328  1.00 25.59 ? 204  ASP B CB    1 
ATOM   6452  C CG    . ASP B 1 204 ? -25.522 56.052  -4.723  1.00 27.43 ? 204  ASP B CG    1 
ATOM   6453  O OD1   . ASP B 1 204 ? -24.909 55.430  -3.835  1.00 28.39 ? 204  ASP B OD1   1 
ATOM   6454  O OD2   . ASP B 1 204 ? -25.133 56.090  -5.921  1.00 29.06 ? 204  ASP B OD2   1 
ATOM   6455  N N     . ALA B 1 205 ? -28.865 59.200  -4.254  1.00 25.56 ? 205  ALA B N     1 
ATOM   6456  C CA    . ALA B 1 205 ? -30.174 59.820  -4.043  1.00 25.90 ? 205  ALA B CA    1 
ATOM   6457  C C     . ALA B 1 205 ? -30.801 60.276  -5.377  1.00 26.78 ? 205  ALA B C     1 
ATOM   6458  O O     . ALA B 1 205 ? -31.974 60.005  -5.639  1.00 26.67 ? 205  ALA B O     1 
ATOM   6459  C CB    . ALA B 1 205 ? -30.067 60.975  -3.065  1.00 24.80 ? 205  ALA B CB    1 
ATOM   6460  N N     . LEU B 1 206 ? -30.002 60.946  -6.218  1.00 27.69 ? 206  LEU B N     1 
ATOM   6461  C CA    . LEU B 1 206 ? -30.494 61.538  -7.463  1.00 28.38 ? 206  LEU B CA    1 
ATOM   6462  C C     . LEU B 1 206 ? -30.760 60.518  -8.592  1.00 28.70 ? 206  LEU B C     1 
ATOM   6463  O O     . LEU B 1 206 ? -31.278 60.879  -9.647  1.00 29.03 ? 206  LEU B O     1 
ATOM   6464  C CB    . LEU B 1 206 ? -29.561 62.671  -7.938  1.00 28.26 ? 206  LEU B CB    1 
ATOM   6465  C CG    . LEU B 1 206 ? -29.389 63.930  -7.058  1.00 29.33 ? 206  LEU B CG    1 
ATOM   6466  C CD1   . LEU B 1 206 ? -28.289 64.868  -7.585  1.00 29.72 ? 206  LEU B CD1   1 
ATOM   6467  C CD2   . LEU B 1 206 ? -30.673 64.721  -6.839  1.00 28.70 ? 206  LEU B CD2   1 
ATOM   6468  N N     . LYS B 1 207 ? -30.420 59.252  -8.372  1.00 29.13 ? 207  LYS B N     1 
ATOM   6469  C CA    . LYS B 1 207 ? -30.760 58.186  -9.325  1.00 29.59 ? 207  LYS B CA    1 
ATOM   6470  C C     . LYS B 1 207 ? -32.227 57.759  -9.205  1.00 29.71 ? 207  LYS B C     1 
ATOM   6471  O O     . LYS B 1 207 ? -32.810 57.200  -10.144 1.00 29.32 ? 207  LYS B O     1 
ATOM   6472  C CB    . LYS B 1 207 ? -29.807 57.007  -9.164  1.00 29.32 ? 207  LYS B CB    1 
ATOM   6473  C CG    . LYS B 1 207 ? -28.505 57.200  -9.924  1.00 30.88 ? 207  LYS B CG    1 
ATOM   6474  C CD    . LYS B 1 207 ? -27.388 56.336  -9.355  1.00 33.84 ? 207  LYS B CD    1 
ATOM   6475  C CE    . LYS B 1 207 ? -26.134 56.402  -10.230 1.00 35.01 ? 207  LYS B CE    1 
ATOM   6476  N NZ    . LYS B 1 207 ? -25.008 55.653  -9.590  1.00 36.86 ? 207  LYS B NZ    1 
ATOM   6477  N N     . ASN B 1 208 ? -32.809 58.049  -8.043  1.00 30.04 ? 208  ASN B N     1 
ATOM   6478  C CA    . ASN B 1 208 ? -34.219 57.854  -7.775  1.00 30.95 ? 208  ASN B CA    1 
ATOM   6479  C C     . ASN B 1 208 ? -35.039 58.673  -8.792  1.00 31.33 ? 208  ASN B C     1 
ATOM   6480  O O     . ASN B 1 208 ? -34.894 59.897  -8.860  1.00 31.35 ? 208  ASN B O     1 
ATOM   6481  C CB    . ASN B 1 208 ? -34.502 58.297  -6.337  1.00 31.10 ? 208  ASN B CB    1 
ATOM   6482  C CG    . ASN B 1 208 ? -35.931 58.029  -5.886  1.00 31.77 ? 208  ASN B CG    1 
ATOM   6483  O OD1   . ASN B 1 208 ? -36.886 58.187  -6.648  1.00 34.94 ? 208  ASN B OD1   1 
ATOM   6484  N ND2   . ASN B 1 208 ? -36.083 57.656  -4.621  1.00 31.11 ? 208  ASN B ND2   1 
ATOM   6485  N N     . PRO B 1 209 ? -35.910 58.002  -9.571  1.00 31.42 ? 209  PRO B N     1 
ATOM   6486  C CA    . PRO B 1 209 ? -36.567 58.673  -10.712 1.00 31.65 ? 209  PRO B CA    1 
ATOM   6487  C C     . PRO B 1 209 ? -37.602 59.702  -10.254 1.00 31.64 ? 209  PRO B C     1 
ATOM   6488  O O     . PRO B 1 209 ? -38.004 60.558  -11.043 1.00 31.58 ? 209  PRO B O     1 
ATOM   6489  C CB    . PRO B 1 209 ? -37.259 57.522  -11.461 1.00 31.42 ? 209  PRO B CB    1 
ATOM   6490  C CG    . PRO B 1 209 ? -37.560 56.505  -10.396 1.00 31.97 ? 209  PRO B CG    1 
ATOM   6491  C CD    . PRO B 1 209 ? -36.382 56.612  -9.395  1.00 31.91 ? 209  PRO B CD    1 
ATOM   6492  N N     . ASN B 1 210 ? -38.001 59.615  -8.981  1.00 31.43 ? 210  ASN B N     1 
ATOM   6493  C CA    . ASN B 1 210 ? -38.929 60.561  -8.361  1.00 31.12 ? 210  ASN B CA    1 
ATOM   6494  C C     . ASN B 1 210 ? -38.327 61.921  -8.004  1.00 30.44 ? 210  ASN B C     1 
ATOM   6495  O O     . ASN B 1 210 ? -39.065 62.890  -7.761  1.00 29.02 ? 210  ASN B O     1 
ATOM   6496  C CB    . ASN B 1 210 ? -39.609 59.920  -7.152  1.00 31.50 ? 210  ASN B CB    1 
ATOM   6497  C CG    . ASN B 1 210 ? -40.729 58.983  -7.562  1.00 34.26 ? 210  ASN B CG    1 
ATOM   6498  O OD1   . ASN B 1 210 ? -41.771 59.430  -8.076  1.00 35.19 ? 210  ASN B OD1   1 
ATOM   6499  N ND2   . ASN B 1 210 ? -40.514 57.674  -7.373  1.00 34.97 ? 210  ASN B ND2   1 
ATOM   6500  N N     . VAL B 1 211 ? -36.991 61.993  -8.001  1.00 30.04 ? 211  VAL B N     1 
ATOM   6501  C CA    . VAL B 1 211 ? -36.290 63.270  -7.842  1.00 30.15 ? 211  VAL B CA    1 
ATOM   6502  C C     . VAL B 1 211 ? -36.251 64.039  -9.192  1.00 30.58 ? 211  VAL B C     1 
ATOM   6503  O O     . VAL B 1 211 ? -35.456 63.707  -10.073 1.00 30.49 ? 211  VAL B O     1 
ATOM   6504  C CB    . VAL B 1 211 ? -34.885 63.042  -7.297  1.00 29.71 ? 211  VAL B CB    1 
ATOM   6505  C CG1   . VAL B 1 211 ? -34.119 64.340  -7.198  1.00 30.11 ? 211  VAL B CG1   1 
ATOM   6506  C CG2   . VAL B 1 211 ? -34.950 62.371  -5.936  1.00 30.35 ? 211  VAL B CG2   1 
ATOM   6507  N N     . THR B 1 212 ? -37.125 65.044  -9.339  1.00 30.63 ? 212  THR B N     1 
ATOM   6508  C CA    . THR B 1 212 ? -37.226 65.855  -10.569 1.00 31.01 ? 212  THR B CA    1 
ATOM   6509  C C     . THR B 1 212 ? -36.882 67.352  -10.397 1.00 30.89 ? 212  THR B C     1 
ATOM   6510  O O     . THR B 1 212 ? -36.890 68.102  -11.377 1.00 30.75 ? 212  THR B O     1 
ATOM   6511  C CB    . THR B 1 212 ? -38.642 65.784  -11.202 1.00 31.24 ? 212  THR B CB    1 
ATOM   6512  O OG1   . THR B 1 212 ? -39.614 66.307  -10.285 1.00 30.99 ? 212  THR B OG1   1 
ATOM   6513  C CG2   . THR B 1 212 ? -39.012 64.356  -11.558 1.00 32.99 ? 212  THR B CG2   1 
ATOM   6514  N N     . SER B 1 213 ? -36.578 67.782  -9.172  1.00 30.54 ? 213  SER B N     1 
ATOM   6515  C CA    . SER B 1 213 ? -36.454 69.210  -8.882  1.00 30.67 ? 213  SER B CA    1 
ATOM   6516  C C     . SER B 1 213 ? -35.009 69.733  -8.847  1.00 30.81 ? 213  SER B C     1 
ATOM   6517  O O     . SER B 1 213 ? -34.775 70.948  -8.939  1.00 30.56 ? 213  SER B O     1 
ATOM   6518  C CB    . SER B 1 213 ? -37.134 69.533  -7.557  1.00 30.61 ? 213  SER B CB    1 
ATOM   6519  O OG    . SER B 1 213 ? -36.474 68.844  -6.514  1.00 30.48 ? 213  SER B OG    1 
ATOM   6520  N N     . VAL B 1 214 ? -34.045 68.824  -8.697  1.00 30.72 ? 214  VAL B N     1 
ATOM   6521  C CA    . VAL B 1 214 ? -32.649 69.232  -8.512  1.00 30.16 ? 214  VAL B CA    1 
ATOM   6522  C C     . VAL B 1 214 ? -31.971 69.566  -9.837  1.00 30.04 ? 214  VAL B C     1 
ATOM   6523  O O     . VAL B 1 214 ? -31.888 68.733  -10.750 1.00 29.77 ? 214  VAL B O     1 
ATOM   6524  C CB    . VAL B 1 214 ? -31.838 68.184  -7.737  1.00 29.94 ? 214  VAL B CB    1 
ATOM   6525  C CG1   . VAL B 1 214 ? -30.388 68.616  -7.641  1.00 29.47 ? 214  VAL B CG1   1 
ATOM   6526  C CG2   . VAL B 1 214 ? -32.420 68.003  -6.336  1.00 30.38 ? 214  VAL B CG2   1 
ATOM   6527  N N     . GLU B 1 215 ? -31.492 70.801  -9.932  1.00 30.06 ? 215  GLU B N     1 
ATOM   6528  C CA    . GLU B 1 215 ? -30.890 71.291  -11.167 1.00 30.48 ? 215  GLU B CA    1 
ATOM   6529  C C     . GLU B 1 215 ? -29.376 71.227  -11.079 1.00 29.51 ? 215  GLU B C     1 
ATOM   6530  O O     . GLU B 1 215 ? -28.701 70.896  -12.052 1.00 29.33 ? 215  GLU B O     1 
ATOM   6531  C CB    . GLU B 1 215 ? -31.385 72.700  -11.488 1.00 30.93 ? 215  GLU B CB    1 
ATOM   6532  C CG    . GLU B 1 215 ? -32.841 72.710  -11.996 1.00 35.13 ? 215  GLU B CG    1 
ATOM   6533  C CD    . GLU B 1 215 ? -33.569 74.015  -11.672 1.00 39.53 ? 215  GLU B CD    1 
ATOM   6534  O OE1   . GLU B 1 215 ? -34.755 73.953  -11.242 1.00 40.69 ? 215  GLU B OE1   1 
ATOM   6535  O OE2   . GLU B 1 215 ? -32.944 75.098  -11.837 1.00 39.61 ? 215  GLU B OE2   1 
ATOM   6536  N N     . HIS B 1 216 ? -28.856 71.526  -9.895  1.00 28.61 ? 216  HIS B N     1 
ATOM   6537  C CA    . HIS B 1 216 ? -27.429 71.488  -9.648  1.00 27.59 ? 216  HIS B CA    1 
ATOM   6538  C C     . HIS B 1 216 ? -27.122 70.916  -8.287  1.00 27.15 ? 216  HIS B C     1 
ATOM   6539  O O     . HIS B 1 216 ? -27.975 70.911  -7.394  1.00 26.91 ? 216  HIS B O     1 
ATOM   6540  C CB    . HIS B 1 216 ? -26.834 72.884  -9.753  1.00 27.39 ? 216  HIS B CB    1 
ATOM   6541  C CG    . HIS B 1 216 ? -27.001 73.500  -11.101 1.00 28.10 ? 216  HIS B CG    1 
ATOM   6542  N ND1   . HIS B 1 216 ? -26.168 73.207  -12.159 1.00 27.84 ? 216  HIS B ND1   1 
ATOM   6543  C CD2   . HIS B 1 216 ? -27.933 74.359  -11.574 1.00 28.02 ? 216  HIS B CD2   1 
ATOM   6544  C CE1   . HIS B 1 216 ? -26.572 73.872  -13.223 1.00 29.10 ? 216  HIS B CE1   1 
ATOM   6545  N NE2   . HIS B 1 216 ? -27.639 74.582  -12.893 1.00 29.03 ? 216  HIS B NE2   1 
ATOM   6546  N N     . VAL B 1 217 ? -25.890 70.427  -8.165  1.00 26.78 ? 217  VAL B N     1 
ATOM   6547  C CA    . VAL B 1 217 ? -25.273 70.048  -6.906  1.00 26.56 ? 217  VAL B CA    1 
ATOM   6548  C C     . VAL B 1 217 ? -23.951 70.811  -6.729  1.00 26.81 ? 217  VAL B C     1 
ATOM   6549  O O     . VAL B 1 217 ? -23.011 70.664  -7.523  1.00 26.91 ? 217  VAL B O     1 
ATOM   6550  C CB    . VAL B 1 217 ? -25.060 68.513  -6.816  1.00 26.61 ? 217  VAL B CB    1 
ATOM   6551  C CG1   . VAL B 1 217 ? -24.426 68.123  -5.480  1.00 25.80 ? 217  VAL B CG1   1 
ATOM   6552  C CG2   . VAL B 1 217 ? -26.379 67.789  -7.007  1.00 26.11 ? 217  VAL B CG2   1 
ATOM   6553  N N     . ILE B 1 218 ? -23.893 71.647  -5.693  1.00 27.03 ? 218  ILE B N     1 
ATOM   6554  C CA    . ILE B 1 218 ? -22.654 72.299  -5.323  1.00 26.56 ? 218  ILE B CA    1 
ATOM   6555  C C     . ILE B 1 218 ? -21.889 71.418  -4.336  1.00 26.86 ? 218  ILE B C     1 
ATOM   6556  O O     . ILE B 1 218 ? -22.455 70.904  -3.355  1.00 26.48 ? 218  ILE B O     1 
ATOM   6557  C CB    . ILE B 1 218 ? -22.896 73.695  -4.751  1.00 27.40 ? 218  ILE B CB    1 
ATOM   6558  C CG1   . ILE B 1 218 ? -23.777 74.512  -5.721  1.00 26.89 ? 218  ILE B CG1   1 
ATOM   6559  C CG2   . ILE B 1 218 ? -21.544 74.387  -4.419  1.00 27.22 ? 218  ILE B CG2   1 
ATOM   6560  C CD1   . ILE B 1 218 ? -24.197 75.888  -5.211  1.00 26.03 ? 218  ILE B CD1   1 
ATOM   6561  N N     . VAL B 1 219 ? -20.603 71.222  -4.625  1.00 26.64 ? 219  VAL B N     1 
ATOM   6562  C CA    . VAL B 1 219 ? -19.770 70.310  -3.855  1.00 26.33 ? 219  VAL B CA    1 
ATOM   6563  C C     . VAL B 1 219 ? -18.579 71.073  -3.288  1.00 26.69 ? 219  VAL B C     1 
ATOM   6564  O O     . VAL B 1 219 ? -17.883 71.773  -4.032  1.00 26.70 ? 219  VAL B O     1 
ATOM   6565  C CB    . VAL B 1 219 ? -19.249 69.119  -4.726  1.00 26.16 ? 219  VAL B CB    1 
ATOM   6566  C CG1   . VAL B 1 219 ? -18.534 68.110  -3.858  1.00 25.33 ? 219  VAL B CG1   1 
ATOM   6567  C CG2   . VAL B 1 219 ? -20.383 68.460  -5.506  1.00 24.80 ? 219  VAL B CG2   1 
ATOM   6568  N N     . LEU B 1 220 ? -18.365 70.945  -1.978  1.00 26.53 ? 220  LEU B N     1 
ATOM   6569  C CA    . LEU B 1 220 ? -17.137 71.410  -1.351  1.00 26.30 ? 220  LEU B CA    1 
ATOM   6570  C C     . LEU B 1 220 ? -16.076 70.321  -1.445  1.00 26.30 ? 220  LEU B C     1 
ATOM   6571  O O     . LEU B 1 220 ? -16.345 69.151  -1.134  1.00 26.39 ? 220  LEU B O     1 
ATOM   6572  C CB    . LEU B 1 220 ? -17.380 71.812  0.117   1.00 26.04 ? 220  LEU B CB    1 
ATOM   6573  C CG    . LEU B 1 220 ? -16.180 72.269  0.976   1.00 26.36 ? 220  LEU B CG    1 
ATOM   6574  C CD1   . LEU B 1 220 ? -15.595 73.655  0.585   1.00 25.45 ? 220  LEU B CD1   1 
ATOM   6575  C CD2   . LEU B 1 220 ? -16.532 72.236  2.448   1.00 25.70 ? 220  LEU B CD2   1 
ATOM   6576  N N     . LYS B 1 221 ? -14.875 70.703  -1.874  1.00 26.40 ? 221  LYS B N     1 
ATOM   6577  C CA    . LYS B 1 221 ? -13.738 69.785  -1.803  1.00 26.45 ? 221  LYS B CA    1 
ATOM   6578  C C     . LYS B 1 221 ? -13.107 69.763  -0.407  1.00 25.84 ? 221  LYS B C     1 
ATOM   6579  O O     . LYS B 1 221 ? -12.168 70.501  -0.109  1.00 25.70 ? 221  LYS B O     1 
ATOM   6580  C CB    . LYS B 1 221 ? -12.685 70.085  -2.875  1.00 26.25 ? 221  LYS B CB    1 
ATOM   6581  C CG    . LYS B 1 221 ? -11.661 68.959  -3.047  1.00 26.17 ? 221  LYS B CG    1 
ATOM   6582  C CD    . LYS B 1 221 ? -10.687 69.208  -4.202  1.00 27.20 ? 221  LYS B CD    1 
ATOM   6583  C CE    . LYS B 1 221 ? -11.326 68.903  -5.610  1.00 28.67 ? 221  LYS B CE    1 
ATOM   6584  N NZ    . LYS B 1 221 ? -11.443 67.433  -5.986  1.00 26.57 ? 221  LYS B NZ    1 
ATOM   6585  N N     . ARG B 1 222 ? -13.619 68.887  0.441   1.00 25.87 ? 222  ARG B N     1 
ATOM   6586  C CA    . ARG B 1 222 ? -13.080 68.745  1.790   1.00 25.34 ? 222  ARG B CA    1 
ATOM   6587  C C     . ARG B 1 222 ? -11.894 67.797  1.822   1.00 25.18 ? 222  ARG B C     1 
ATOM   6588  O O     . ARG B 1 222 ? -10.849 68.144  2.363   1.00 25.40 ? 222  ARG B O     1 
ATOM   6589  C CB    . ARG B 1 222 ? -14.178 68.313  2.756   1.00 25.54 ? 222  ARG B CB    1 
ATOM   6590  C CG    . ARG B 1 222 ? -13.746 67.949  4.152   1.00 25.13 ? 222  ARG B CG    1 
ATOM   6591  C CD    . ARG B 1 222 ? -13.399 69.148  4.987   1.00 27.01 ? 222  ARG B CD    1 
ATOM   6592  N NE    . ARG B 1 222 ? -12.867 68.705  6.274   1.00 28.25 ? 222  ARG B NE    1 
ATOM   6593  C CZ    . ARG B 1 222 ? -11.618 68.304  6.461   1.00 28.08 ? 222  ARG B CZ    1 
ATOM   6594  N NH1   . ARG B 1 222 ? -10.756 68.313  5.448   1.00 27.13 ? 222  ARG B NH1   1 
ATOM   6595  N NH2   . ARG B 1 222 ? -11.241 67.888  7.658   1.00 26.49 ? 222  ARG B NH2   1 
ATOM   6596  N N     . THR B 1 223 ? -12.027 66.619  1.226   1.00 24.97 ? 223  THR B N     1 
ATOM   6597  C CA    . THR B 1 223 ? -10.969 65.607  1.348   1.00 25.10 ? 223  THR B CA    1 
ATOM   6598  C C     . THR B 1 223 ? -10.138 65.478  0.089   1.00 25.11 ? 223  THR B C     1 
ATOM   6599  O O     . THR B 1 223 ? -8.971  65.072  0.147   1.00 25.25 ? 223  THR B O     1 
ATOM   6600  C CB    . THR B 1 223 ? -11.511 64.186  1.722   1.00 25.12 ? 223  THR B CB    1 
ATOM   6601  O OG1   . THR B 1 223 ? -12.228 63.629  0.607   1.00 24.76 ? 223  THR B OG1   1 
ATOM   6602  C CG2   . THR B 1 223 ? -12.418 64.242  2.968   1.00 24.88 ? 223  THR B CG2   1 
ATOM   6603  N N     . GLY B 1 224 ? -10.748 65.795  -1.046  1.00 25.33 ? 224  GLY B N     1 
ATOM   6604  C CA    . GLY B 1 224 ? -10.068 65.721  -2.332  1.00 25.48 ? 224  GLY B CA    1 
ATOM   6605  C C     . GLY B 1 224 ? -10.038 64.303  -2.837  1.00 25.82 ? 224  GLY B C     1 
ATOM   6606  O O     . GLY B 1 224 ? -9.209  63.972  -3.675  1.00 25.49 ? 224  GLY B O     1 
ATOM   6607  N N     . SER B 1 225 ? -10.938 63.479  -2.296  1.00 26.69 ? 225  SER B N     1 
ATOM   6608  C CA    . SER B 1 225 ? -11.169 62.075  -2.707  1.00 27.81 ? 225  SER B CA    1 
ATOM   6609  C C     . SER B 1 225 ? -11.668 61.900  -4.125  1.00 27.50 ? 225  SER B C     1 
ATOM   6610  O O     . SER B 1 225 ? -12.174 62.838  -4.749  1.00 27.25 ? 225  SER B O     1 
ATOM   6611  C CB    . SER B 1 225 ? -12.198 61.416  -1.788  1.00 28.28 ? 225  SER B CB    1 
ATOM   6612  O OG    . SER B 1 225 ? -11.693 61.336  -0.460  1.00 31.82 ? 225  SER B OG    1 
ATOM   6613  N N     . ASP B 1 226 ? -11.534 60.677  -4.623  1.00 27.70 ? 226  ASP B N     1 
ATOM   6614  C CA    . ASP B 1 226 ? -11.999 60.355  -5.963  1.00 27.95 ? 226  ASP B CA    1 
ATOM   6615  C C     . ASP B 1 226 ? -13.517 60.397  -5.986  1.00 27.74 ? 226  ASP B C     1 
ATOM   6616  O O     . ASP B 1 226 ? -14.163 59.742  -5.172  1.00 28.32 ? 226  ASP B O     1 
ATOM   6617  C CB    . ASP B 1 226 ? -11.511 58.971  -6.376  1.00 28.03 ? 226  ASP B CB    1 
ATOM   6618  C CG    . ASP B 1 226 ? -9.995  58.903  -6.539  1.00 29.97 ? 226  ASP B CG    1 
ATOM   6619  O OD1   . ASP B 1 226 ? -9.377  59.957  -6.801  1.00 29.94 ? 226  ASP B OD1   1 
ATOM   6620  O OD2   . ASP B 1 226 ? -9.419  57.787  -6.417  1.00 32.26 ? 226  ASP B OD2   1 
ATOM   6621  N N     . ILE B 1 227 ? -14.096 61.190  -6.883  1.00 27.11 ? 227  ILE B N     1 
ATOM   6622  C CA    . ILE B 1 227 ? -15.536 61.156  -7.035  1.00 26.38 ? 227  ILE B CA    1 
ATOM   6623  C C     . ILE B 1 227 ? -16.001 61.043  -8.472  1.00 26.38 ? 227  ILE B C     1 
ATOM   6624  O O     . ILE B 1 227 ? -15.241 61.284  -9.408  1.00 26.31 ? 227  ILE B O     1 
ATOM   6625  C CB    . ILE B 1 227 ? -16.277 62.326  -6.298  1.00 26.95 ? 227  ILE B CB    1 
ATOM   6626  C CG1   . ILE B 1 227 ? -15.738 63.703  -6.675  1.00 26.39 ? 227  ILE B CG1   1 
ATOM   6627  C CG2   . ILE B 1 227 ? -16.292 62.111  -4.755  1.00 26.82 ? 227  ILE B CG2   1 
ATOM   6628  C CD1   . ILE B 1 227 ? -16.559 64.822  -6.013  1.00 26.13 ? 227  ILE B CD1   1 
ATOM   6629  N N     . ASP B 1 228 ? -17.259 60.640  -8.632  1.00 26.05 ? 228  ASP B N     1 
ATOM   6630  C CA    . ASP B 1 228 ? -17.918 60.675  -9.922  1.00 25.56 ? 228  ASP B CA    1 
ATOM   6631  C C     . ASP B 1 228 ? -18.428 62.097  -10.103 1.00 25.14 ? 228  ASP B C     1 
ATOM   6632  O O     . ASP B 1 228 ? -18.695 62.792  -9.117  1.00 24.62 ? 228  ASP B O     1 
ATOM   6633  C CB    . ASP B 1 228 ? -19.030 59.628  -9.960  1.00 25.43 ? 228  ASP B CB    1 
ATOM   6634  C CG    . ASP B 1 228 ? -18.500 58.231  -9.682  1.00 27.04 ? 228  ASP B CG    1 
ATOM   6635  O OD1   . ASP B 1 228 ? -19.049 57.520  -8.804  1.00 28.64 ? 228  ASP B OD1   1 
ATOM   6636  O OD2   . ASP B 1 228 ? -17.482 57.857  -10.310 1.00 28.07 ? 228  ASP B OD2   1 
ATOM   6637  N N     . TRP B 1 229 ? -18.518 62.545  -11.352 1.00 24.55 ? 229  TRP B N     1 
ATOM   6638  C CA    . TRP B 1 229 ? -18.789 63.947  -11.630 1.00 24.62 ? 229  TRP B CA    1 
ATOM   6639  C C     . TRP B 1 229 ? -19.713 64.080  -12.826 1.00 24.74 ? 229  TRP B C     1 
ATOM   6640  O O     . TRP B 1 229 ? -19.376 63.615  -13.910 1.00 24.34 ? 229  TRP B O     1 
ATOM   6641  C CB    . TRP B 1 229 ? -17.465 64.697  -11.880 1.00 24.19 ? 229  TRP B CB    1 
ATOM   6642  C CG    . TRP B 1 229 ? -17.609 66.205  -11.850 1.00 24.92 ? 229  TRP B CG    1 
ATOM   6643  C CD1   . TRP B 1 229 ? -17.616 67.066  -12.929 1.00 23.44 ? 229  TRP B CD1   1 
ATOM   6644  C CD2   . TRP B 1 229 ? -17.789 67.027  -10.683 1.00 24.55 ? 229  TRP B CD2   1 
ATOM   6645  N NE1   . TRP B 1 229 ? -17.779 68.369  -12.496 1.00 22.84 ? 229  TRP B NE1   1 
ATOM   6646  C CE2   . TRP B 1 229 ? -17.889 68.378  -11.131 1.00 23.18 ? 229  TRP B CE2   1 
ATOM   6647  C CE3   . TRP B 1 229 ? -17.871 66.755  -9.303  1.00 24.82 ? 229  TRP B CE3   1 
ATOM   6648  C CZ2   . TRP B 1 229 ? -18.073 69.451  -10.248 1.00 23.48 ? 229  TRP B CZ2   1 
ATOM   6649  C CZ3   . TRP B 1 229 ? -18.060 67.830  -8.416  1.00 23.67 ? 229  TRP B CZ3   1 
ATOM   6650  C CH2   . TRP B 1 229 ? -18.156 69.162  -8.898  1.00 24.04 ? 229  TRP B CH2   1 
ATOM   6651  N N     . GLN B 1 230 ? -20.873 64.706  -12.634 1.00 25.51 ? 230  GLN B N     1 
ATOM   6652  C CA    . GLN B 1 230 ? -21.788 64.941  -13.750 1.00 26.63 ? 230  GLN B CA    1 
ATOM   6653  C C     . GLN B 1 230 ? -21.648 66.348  -14.293 1.00 26.84 ? 230  GLN B C     1 
ATOM   6654  O O     . GLN B 1 230 ? -22.122 67.289  -13.678 1.00 26.55 ? 230  GLN B O     1 
ATOM   6655  C CB    . GLN B 1 230 ? -23.239 64.676  -13.346 1.00 26.79 ? 230  GLN B CB    1 
ATOM   6656  C CG    . GLN B 1 230 ? -24.180 64.404  -14.537 1.00 27.51 ? 230  GLN B CG    1 
ATOM   6657  C CD    . GLN B 1 230 ? -25.538 63.862  -14.110 1.00 27.86 ? 230  GLN B CD    1 
ATOM   6658  O OE1   . GLN B 1 230 ? -25.629 62.898  -13.336 1.00 27.68 ? 230  GLN B OE1   1 
ATOM   6659  N NE2   . GLN B 1 230 ? -26.601 64.473  -14.620 1.00 29.05 ? 230  GLN B NE2   1 
ATOM   6660  N N     . GLU B 1 231 ? -21.009 66.487  -15.454 1.00 27.96 ? 231  GLU B N     1 
ATOM   6661  C CA    . GLU B 1 231 ? -20.833 67.799  -16.068 1.00 29.15 ? 231  GLU B CA    1 
ATOM   6662  C C     . GLU B 1 231 ? -22.200 68.429  -16.330 1.00 28.91 ? 231  GLU B C     1 
ATOM   6663  O O     . GLU B 1 231 ? -23.123 67.749  -16.788 1.00 28.74 ? 231  GLU B O     1 
ATOM   6664  C CB    . GLU B 1 231 ? -20.039 67.713  -17.377 1.00 30.12 ? 231  GLU B CB    1 
ATOM   6665  C CG    . GLU B 1 231 ? -19.092 68.895  -17.593 1.00 33.34 ? 231  GLU B CG    1 
ATOM   6666  C CD    . GLU B 1 231 ? -17.978 68.878  -16.541 1.00 40.72 ? 231  GLU B CD    1 
ATOM   6667  O OE1   . GLU B 1 231 ? -17.100 67.968  -16.639 1.00 41.54 ? 231  GLU B OE1   1 
ATOM   6668  O OE2   . GLU B 1 231 ? -17.999 69.740  -15.597 1.00 43.78 ? 231  GLU B OE2   1 
ATOM   6669  N N     . GLY B 1 232 ? -22.327 69.720  -16.041 1.00 28.64 ? 232  GLY B N     1 
ATOM   6670  C CA    . GLY B 1 232 ? -23.607 70.403  -16.201 1.00 28.37 ? 232  GLY B CA    1 
ATOM   6671  C C     . GLY B 1 232 ? -24.343 70.534  -14.876 1.00 28.00 ? 232  GLY B C     1 
ATOM   6672  O O     . GLY B 1 232 ? -24.744 71.641  -14.501 1.00 29.31 ? 232  GLY B O     1 
ATOM   6673  N N     . ARG B 1 233 ? -24.508 69.415  -14.163 1.00 26.60 ? 233  ARG B N     1 
ATOM   6674  C CA    . ARG B 1 233 ? -25.235 69.368  -12.882 1.00 24.99 ? 233  ARG B CA    1 
ATOM   6675  C C     . ARG B 1 233 ? -24.335 69.806  -11.722 1.00 24.54 ? 233  ARG B C     1 
ATOM   6676  O O     . ARG B 1 233 ? -24.704 70.658  -10.905 1.00 23.18 ? 233  ARG B O     1 
ATOM   6677  C CB    . ARG B 1 233 ? -25.766 67.950  -12.622 1.00 25.17 ? 233  ARG B CB    1 
ATOM   6678  C CG    . ARG B 1 233 ? -26.703 67.800  -11.401 1.00 24.06 ? 233  ARG B CG    1 
ATOM   6679  C CD    . ARG B 1 233 ? -26.932 66.335  -11.030 1.00 23.71 ? 233  ARG B CD    1 
ATOM   6680  N NE    . ARG B 1 233 ? -25.704 65.750  -10.493 1.00 23.62 ? 233  ARG B NE    1 
ATOM   6681  C CZ    . ARG B 1 233 ? -25.529 64.475  -10.148 1.00 22.48 ? 233  ARG B CZ    1 
ATOM   6682  N NH1   . ARG B 1 233 ? -26.509 63.592  -10.258 1.00 21.35 ? 233  ARG B NH1   1 
ATOM   6683  N NH2   . ARG B 1 233 ? -24.354 64.081  -9.679  1.00 22.00 ? 233  ARG B NH2   1 
ATOM   6684  N N     . ASP B 1 234 ? -23.143 69.220  -11.696 1.00 23.98 ? 234  ASP B N     1 
ATOM   6685  C CA    . ASP B 1 234 ? -22.218 69.333  -10.594 1.00 23.84 ? 234  ASP B CA    1 
ATOM   6686  C C     . ASP B 1 234 ? -21.303 70.549  -10.687 1.00 24.08 ? 234  ASP B C     1 
ATOM   6687  O O     . ASP B 1 234 ? -20.716 70.837  -11.736 1.00 23.88 ? 234  ASP B O     1 
ATOM   6688  C CB    . ASP B 1 234 ? -21.383 68.067  -10.530 1.00 24.05 ? 234  ASP B CB    1 
ATOM   6689  C CG    . ASP B 1 234 ? -22.166 66.870  -10.023 1.00 23.50 ? 234  ASP B CG    1 
ATOM   6690  O OD1   . ASP B 1 234 ? -23.231 67.057  -9.425  1.00 23.79 ? 234  ASP B OD1   1 
ATOM   6691  O OD2   . ASP B 1 234 ? -21.700 65.734  -10.207 1.00 23.98 ? 234  ASP B OD2   1 
ATOM   6692  N N     . LEU B 1 235 ? -21.188 71.262  -9.567  1.00 24.13 ? 235  LEU B N     1 
ATOM   6693  C CA    . LEU B 1 235 ? -20.341 72.455  -9.478  1.00 23.56 ? 235  LEU B CA    1 
ATOM   6694  C C     . LEU B 1 235 ? -19.463 72.404  -8.230  1.00 23.71 ? 235  LEU B C     1 
ATOM   6695  O O     . LEU B 1 235 ? -19.879 71.898  -7.186  1.00 24.26 ? 235  LEU B O     1 
ATOM   6696  C CB    . LEU B 1 235 ? -21.195 73.732  -9.537  1.00 22.93 ? 235  LEU B CB    1 
ATOM   6697  C CG    . LEU B 1 235 ? -22.119 73.909  -10.765 1.00 22.25 ? 235  LEU B CG    1 
ATOM   6698  C CD1   . LEU B 1 235 ? -23.144 75.042  -10.593 1.00 19.01 ? 235  LEU B CD1   1 
ATOM   6699  C CD2   . LEU B 1 235 ? -21.305 74.071  -12.066 1.00 21.92 ? 235  LEU B CD2   1 
ATOM   6700  N N     . TRP B 1 236 ? -18.230 72.880  -8.360  1.00 23.98 ? 236  TRP B N     1 
ATOM   6701  C CA    . TRP B 1 236 ? -17.295 72.941  -7.240  1.00 24.39 ? 236  TRP B CA    1 
ATOM   6702  C C     . TRP B 1 236 ? -17.464 74.227  -6.468  1.00 25.08 ? 236  TRP B C     1 
ATOM   6703  O O     . TRP B 1 236 ? -17.467 75.307  -7.056  1.00 25.06 ? 236  TRP B O     1 
ATOM   6704  C CB    . TRP B 1 236 ? -15.852 72.839  -7.731  1.00 23.85 ? 236  TRP B CB    1 
ATOM   6705  C CG    . TRP B 1 236 ? -15.428 71.450  -8.076  1.00 23.35 ? 236  TRP B CG    1 
ATOM   6706  C CD1   . TRP B 1 236 ? -15.085 70.971  -9.313  1.00 23.37 ? 236  TRP B CD1   1 
ATOM   6707  C CD2   . TRP B 1 236 ? -15.306 70.346  -7.173  1.00 23.97 ? 236  TRP B CD2   1 
ATOM   6708  N NE1   . TRP B 1 236 ? -14.737 69.640  -9.231  1.00 22.93 ? 236  TRP B NE1   1 
ATOM   6709  C CE2   . TRP B 1 236 ? -14.862 69.231  -7.931  1.00 23.44 ? 236  TRP B CE2   1 
ATOM   6710  C CE3   . TRP B 1 236 ? -15.529 70.187  -5.796  1.00 21.53 ? 236  TRP B CE3   1 
ATOM   6711  C CZ2   . TRP B 1 236 ? -14.645 67.973  -7.355  1.00 23.35 ? 236  TRP B CZ2   1 
ATOM   6712  C CZ3   . TRP B 1 236 ? -15.309 68.939  -5.230  1.00 23.62 ? 236  TRP B CZ3   1 
ATOM   6713  C CH2   . TRP B 1 236 ? -14.874 67.845  -6.011  1.00 23.14 ? 236  TRP B CH2   1 
ATOM   6714  N N     . TRP B 1 237 ? -17.583 74.096  -5.146  1.00 26.45 ? 237  TRP B N     1 
ATOM   6715  C CA    . TRP B 1 237 ? -17.706 75.237  -4.227  1.00 27.25 ? 237  TRP B CA    1 
ATOM   6716  C C     . TRP B 1 237 ? -16.660 76.352  -4.523  1.00 28.21 ? 237  TRP B C     1 
ATOM   6717  O O     . TRP B 1 237 ? -17.041 77.491  -4.776  1.00 28.27 ? 237  TRP B O     1 
ATOM   6718  C CB    . TRP B 1 237 ? -17.690 74.764  -2.751  1.00 26.33 ? 237  TRP B CB    1 
ATOM   6719  C CG    . TRP B 1 237 ? -17.797 75.889  -1.701  1.00 25.78 ? 237  TRP B CG    1 
ATOM   6720  C CD1   . TRP B 1 237 ? -16.832 76.795  -1.373  1.00 25.64 ? 237  TRP B CD1   1 
ATOM   6721  C CD2   . TRP B 1 237 ? -18.912 76.180  -0.851  1.00 24.92 ? 237  TRP B CD2   1 
ATOM   6722  N NE1   . TRP B 1 237 ? -17.270 77.630  -0.387  1.00 24.97 ? 237  TRP B NE1   1 
ATOM   6723  C CE2   . TRP B 1 237 ? -18.546 77.282  -0.048  1.00 25.57 ? 237  TRP B CE2   1 
ATOM   6724  C CE3   . TRP B 1 237 ? -20.182 75.612  -0.680  1.00 25.06 ? 237  TRP B CE3   1 
ATOM   6725  C CZ2   . TRP B 1 237 ? -19.411 77.843  0.896   1.00 26.25 ? 237  TRP B CZ2   1 
ATOM   6726  C CZ3   . TRP B 1 237 ? -21.040 76.169  0.249   1.00 25.31 ? 237  TRP B CZ3   1 
ATOM   6727  C CH2   . TRP B 1 237 ? -20.657 77.273  1.022   1.00 26.01 ? 237  TRP B CH2   1 
ATOM   6728  N N     . ARG B 1 238 ? -15.367 76.019  -4.538  1.00 29.68 ? 238  ARG B N     1 
ATOM   6729  C CA    . ARG B 1 238 ? -14.326 77.054  -4.702  1.00 31.32 ? 238  ARG B CA    1 
ATOM   6730  C C     . ARG B 1 238 ? -14.339 77.798  -6.065  1.00 31.78 ? 238  ARG B C     1 
ATOM   6731  O O     . ARG B 1 238 ? -14.083 79.005  -6.102  1.00 32.51 ? 238  ARG B O     1 
ATOM   6732  C CB    . ARG B 1 238 ? -12.916 76.573  -4.223  1.00 31.18 ? 238  ARG B CB    1 
ATOM   6733  C CG    . ARG B 1 238 ? -11.715 76.902  -5.147  1.00 33.21 ? 238  ARG B CG    1 
ATOM   6734  C CD    . ARG B 1 238 ? -10.519 77.574  -4.445  1.00 35.04 ? 238  ARG B CD    1 
ATOM   6735  N NE    . ARG B 1 238 ? -9.527  76.636  -3.935  1.00 36.51 ? 238  ARG B NE    1 
ATOM   6736  C CZ    . ARG B 1 238 ? -8.280  76.487  -4.397  1.00 36.89 ? 238  ARG B CZ    1 
ATOM   6737  N NH1   . ARG B 1 238 ? -7.811  77.221  -5.407  1.00 38.09 ? 238  ARG B NH1   1 
ATOM   6738  N NH2   . ARG B 1 238 ? -7.488  75.582  -3.833  1.00 35.86 ? 238  ARG B NH2   1 
ATOM   6739  N N     . ASP B 1 239 ? -14.669 77.110  -7.161  1.00 32.44 ? 239  ASP B N     1 
ATOM   6740  C CA    . ASP B 1 239 ? -14.846 77.766  -8.474  1.00 33.03 ? 239  ASP B CA    1 
ATOM   6741  C C     . ASP B 1 239 ? -16.019 78.740  -8.562  1.00 32.88 ? 239  ASP B C     1 
ATOM   6742  O O     . ASP B 1 239 ? -15.987 79.686  -9.347  1.00 33.02 ? 239  ASP B O     1 
ATOM   6743  C CB    . ASP B 1 239 ? -15.048 76.734  -9.583  1.00 34.03 ? 239  ASP B CB    1 
ATOM   6744  C CG    . ASP B 1 239 ? -13.755 76.061  -10.002 1.00 36.62 ? 239  ASP B CG    1 
ATOM   6745  O OD1   . ASP B 1 239 ? -12.758 76.791  -10.285 1.00 38.31 ? 239  ASP B OD1   1 
ATOM   6746  O OD2   . ASP B 1 239 ? -13.756 74.798  -10.058 1.00 38.50 ? 239  ASP B OD2   1 
ATOM   6747  N N     . LEU B 1 240 ? -17.077 78.487  -7.800  1.00 32.61 ? 240  LEU B N     1 
ATOM   6748  C CA    . LEU B 1 240 ? -18.249 79.352  -7.848  1.00 32.15 ? 240  LEU B CA    1 
ATOM   6749  C C     . LEU B 1 240 ? -18.051 80.533  -6.949  1.00 32.42 ? 240  LEU B C     1 
ATOM   6750  O O     . LEU B 1 240 ? -18.377 81.650  -7.337  1.00 32.65 ? 240  LEU B O     1 
ATOM   6751  C CB    . LEU B 1 240 ? -19.543 78.618  -7.440  1.00 31.55 ? 240  LEU B CB    1 
ATOM   6752  C CG    . LEU B 1 240 ? -20.051 77.486  -8.330  1.00 29.99 ? 240  LEU B CG    1 
ATOM   6753  C CD1   . LEU B 1 240 ? -21.329 76.936  -7.781  1.00 26.86 ? 240  LEU B CD1   1 
ATOM   6754  C CD2   . LEU B 1 240 ? -20.237 77.997  -9.751  1.00 30.61 ? 240  LEU B CD2   1 
ATOM   6755  N N     . ILE B 1 241 ? -17.543 80.294  -5.741  1.00 32.78 ? 241  ILE B N     1 
ATOM   6756  C CA    . ILE B 1 241 ? -17.469 81.371  -4.759  1.00 33.65 ? 241  ILE B CA    1 
ATOM   6757  C C     . ILE B 1 241 ? -16.470 82.447  -5.190  1.00 34.36 ? 241  ILE B C     1 
ATOM   6758  O O     . ILE B 1 241 ? -16.738 83.651  -5.026  1.00 34.80 ? 241  ILE B O     1 
ATOM   6759  C CB    . ILE B 1 241 ? -17.228 80.875  -3.298  1.00 33.63 ? 241  ILE B CB    1 
ATOM   6760  C CG1   . ILE B 1 241 ? -17.699 81.958  -2.308  1.00 34.22 ? 241  ILE B CG1   1 
ATOM   6761  C CG2   . ILE B 1 241 ? -15.759 80.438  -3.069  1.00 32.36 ? 241  ILE B CG2   1 
ATOM   6762  C CD1   . ILE B 1 241 ? -18.047 81.479  -0.901  1.00 33.80 ? 241  ILE B CD1   1 
ATOM   6763  N N     . GLU B 1 242 ? -15.353 82.005  -5.777  1.00 34.82 ? 242  GLU B N     1 
ATOM   6764  C CA    . GLU B 1 242 ? -14.290 82.899  -6.228  1.00 35.39 ? 242  GLU B CA    1 
ATOM   6765  C C     . GLU B 1 242 ? -14.673 83.698  -7.474  1.00 35.03 ? 242  GLU B C     1 
ATOM   6766  O O     . GLU B 1 242 ? -14.253 84.834  -7.610  1.00 35.52 ? 242  GLU B O     1 
ATOM   6767  C CB    . GLU B 1 242 ? -12.949 82.146  -6.371  1.00 35.43 ? 242  GLU B CB    1 
ATOM   6768  C CG    . GLU B 1 242 ? -12.368 81.721  -4.989  1.00 36.08 ? 242  GLU B CG    1 
ATOM   6769  C CD    . GLU B 1 242 ? -11.054 80.897  -5.037  1.00 36.82 ? 242  GLU B CD    1 
ATOM   6770  O OE1   . GLU B 1 242 ? -10.470 80.694  -6.136  1.00 38.64 ? 242  GLU B OE1   1 
ATOM   6771  O OE2   . GLU B 1 242 ? -10.594 80.460  -3.944  1.00 37.57 ? 242  GLU B OE2   1 
ATOM   6772  N N     . LYS B 1 243 ? -15.488 83.124  -8.356  1.00 34.74 ? 243  LYS B N     1 
ATOM   6773  C CA    . LYS B 1 243 ? -16.029 83.852  -9.518  1.00 34.99 ? 243  LYS B CA    1 
ATOM   6774  C C     . LYS B 1 243 ? -17.060 84.932  -9.144  1.00 35.05 ? 243  LYS B C     1 
ATOM   6775  O O     . LYS B 1 243 ? -17.292 85.856  -9.915  1.00 35.15 ? 243  LYS B O     1 
ATOM   6776  C CB    . LYS B 1 243 ? -16.634 82.885  -10.572 1.00 34.67 ? 243  LYS B CB    1 
ATOM   6777  N N     . ALA B 1 244 ? -17.672 84.823  -7.965  1.00 35.46 ? 244  ALA B N     1 
ATOM   6778  C CA    . ALA B 1 244 ? -18.802 85.704  -7.593  1.00 35.63 ? 244  ALA B CA    1 
ATOM   6779  C C     . ALA B 1 244 ? -18.401 86.960  -6.812  1.00 35.70 ? 244  ALA B C     1 
ATOM   6780  O O     . ALA B 1 244 ? -17.416 86.951  -6.052  1.00 36.03 ? 244  ALA B O     1 
ATOM   6781  C CB    . ALA B 1 244 ? -19.878 84.918  -6.838  1.00 35.04 ? 244  ALA B CB    1 
ATOM   6782  N N     . SER B 1 245 ? -19.187 88.023  -6.996  1.00 35.65 ? 245  SER B N     1 
ATOM   6783  C CA    . SER B 1 245 ? -18.952 89.313  -6.329  1.00 35.75 ? 245  SER B CA    1 
ATOM   6784  C C     . SER B 1 245 ? -19.189 89.241  -4.829  1.00 35.49 ? 245  SER B C     1 
ATOM   6785  O O     . SER B 1 245 ? -20.130 88.586  -4.388  1.00 35.19 ? 245  SER B O     1 
ATOM   6786  C CB    . SER B 1 245 ? -19.822 90.427  -6.938  1.00 36.02 ? 245  SER B CB    1 
ATOM   6787  O OG    . SER B 1 245 ? -19.782 91.602  -6.126  1.00 36.20 ? 245  SER B OG    1 
ATOM   6788  N N     . PRO B 1 246 ? -18.325 89.911  -4.040  1.00 35.64 ? 246  PRO B N     1 
ATOM   6789  C CA    . PRO B 1 246 ? -18.451 89.910  -2.574  1.00 35.94 ? 246  PRO B CA    1 
ATOM   6790  C C     . PRO B 1 246 ? -19.400 90.965  -2.032  1.00 35.97 ? 246  PRO B C     1 
ATOM   6791  O O     . PRO B 1 246 ? -19.604 91.044  -0.816  1.00 36.17 ? 246  PRO B O     1 
ATOM   6792  C CB    . PRO B 1 246 ? -17.027 90.211  -2.111  1.00 36.23 ? 246  PRO B CB    1 
ATOM   6793  C CG    . PRO B 1 246 ? -16.491 91.116  -3.217  1.00 35.93 ? 246  PRO B CG    1 
ATOM   6794  C CD    . PRO B 1 246 ? -17.139 90.663  -4.496  1.00 35.54 ? 246  PRO B CD    1 
ATOM   6795  N N     . GLU B 1 247 ? -19.929 91.799  -2.923  1.00 35.84 ? 247  GLU B N     1 
ATOM   6796  C CA    . GLU B 1 247 ? -20.848 92.856  -2.534  1.00 35.69 ? 247  GLU B CA    1 
ATOM   6797  C C     . GLU B 1 247 ? -22.239 92.316  -2.725  1.00 35.01 ? 247  GLU B C     1 
ATOM   6798  O O     . GLU B 1 247 ? -22.625 91.954  -3.826  1.00 34.58 ? 247  GLU B O     1 
ATOM   6799  C CB    . GLU B 1 247 ? -20.654 94.134  -3.371  1.00 35.90 ? 247  GLU B CB    1 
ATOM   6800  C CG    . GLU B 1 247 ? -19.231 94.715  -3.367  1.00 37.79 ? 247  GLU B CG    1 
ATOM   6801  C CD    . GLU B 1 247 ? -18.777 95.233  -1.999  1.00 41.18 ? 247  GLU B CD    1 
ATOM   6802  O OE1   . GLU B 1 247 ? -19.552 95.178  -1.013  1.00 42.15 ? 247  GLU B OE1   1 
ATOM   6803  O OE2   . GLU B 1 247 ? -17.620 95.710  -1.909  1.00 43.71 ? 247  GLU B OE2   1 
ATOM   6804  N N     . HIS B 1 248 ? -22.977 92.227  -1.631  1.00 34.72 ? 248  HIS B N     1 
ATOM   6805  C CA    . HIS B 1 248 ? -24.366 91.848  -1.702  1.00 34.66 ? 248  HIS B CA    1 
ATOM   6806  C C     . HIS B 1 248 ? -25.185 92.647  -0.704  1.00 35.04 ? 248  HIS B C     1 
ATOM   6807  O O     . HIS B 1 248 ? -24.933 92.623  0.512   1.00 34.38 ? 248  HIS B O     1 
ATOM   6808  C CB    . HIS B 1 248 ? -24.570 90.339  -1.507  1.00 34.10 ? 248  HIS B CB    1 
ATOM   6809  C CG    . HIS B 1 248 ? -25.998 89.928  -1.650  1.00 34.20 ? 248  HIS B CG    1 
ATOM   6810  N ND1   . HIS B 1 248 ? -26.907 90.029  -0.616  1.00 33.79 ? 248  HIS B ND1   1 
ATOM   6811  C CD2   . HIS B 1 248 ? -26.694 89.472  -2.718  1.00 33.88 ? 248  HIS B CD2   1 
ATOM   6812  C CE1   . HIS B 1 248 ? -28.096 89.632  -1.033  1.00 33.30 ? 248  HIS B CE1   1 
ATOM   6813  N NE2   . HIS B 1 248 ? -27.994 89.288  -2.305  1.00 35.11 ? 248  HIS B NE2   1 
ATOM   6814  N N     . GLN B 1 249 ? -26.172 93.352  -1.234  1.00 35.63 ? 249  GLN B N     1 
ATOM   6815  C CA    . GLN B 1 249 ? -27.021 94.190  -0.416  1.00 36.96 ? 249  GLN B CA    1 
ATOM   6816  C C     . GLN B 1 249 ? -28.208 93.359  0.025   1.00 37.20 ? 249  GLN B C     1 
ATOM   6817  O O     . GLN B 1 249 ? -28.922 92.817  -0.818  1.00 37.35 ? 249  GLN B O     1 
ATOM   6818  C CB    . GLN B 1 249 ? -27.456 95.451  -1.189  1.00 37.53 ? 249  GLN B CB    1 
ATOM   6819  C CG    . GLN B 1 249 ? -26.297 96.216  -1.951  1.00 38.94 ? 249  GLN B CG    1 
ATOM   6820  C CD    . GLN B 1 249 ? -25.067 96.584  -1.078  1.00 40.07 ? 249  GLN B CD    1 
ATOM   6821  O OE1   . GLN B 1 249 ? -23.941 96.670  -1.584  1.00 39.31 ? 249  GLN B OE1   1 
ATOM   6822  N NE2   . GLN B 1 249 ? -25.287 96.793  0.227   1.00 40.47 ? 249  GLN B NE2   1 
ATOM   6823  N N     . PRO B 1 250 ? -28.420 93.231  1.351   1.00 37.92 ? 250  PRO B N     1 
ATOM   6824  C CA    . PRO B 1 250 ? -29.500 92.342  1.786   1.00 38.28 ? 250  PRO B CA    1 
ATOM   6825  C C     . PRO B 1 250 ? -30.839 93.069  1.676   1.00 38.89 ? 250  PRO B C     1 
ATOM   6826  O O     . PRO B 1 250 ? -30.960 94.244  2.069   1.00 39.22 ? 250  PRO B O     1 
ATOM   6827  C CB    . PRO B 1 250 ? -29.160 92.038  3.248   1.00 38.20 ? 250  PRO B CB    1 
ATOM   6828  C CG    . PRO B 1 250 ? -28.269 93.152  3.703   1.00 37.60 ? 250  PRO B CG    1 
ATOM   6829  C CD    . PRO B 1 250 ? -27.758 93.904  2.490   1.00 38.07 ? 250  PRO B CD    1 
ATOM   6830  N N     . GLU B 1 251 ? -31.829 92.391  1.117   1.00 38.99 ? 251  GLU B N     1 
ATOM   6831  C CA    . GLU B 1 251 ? -33.149 92.987  1.020   1.00 38.98 ? 251  GLU B CA    1 
ATOM   6832  C C     . GLU B 1 251 ? -34.034 92.578  2.210   1.00 38.04 ? 251  GLU B C     1 
ATOM   6833  O O     . GLU B 1 251 ? -33.688 91.676  2.991   1.00 37.97 ? 251  GLU B O     1 
ATOM   6834  C CB    . GLU B 1 251 ? -33.802 92.629  -0.315  1.00 39.61 ? 251  GLU B CB    1 
ATOM   6835  C CG    . GLU B 1 251 ? -32.972 92.978  -1.559  1.00 41.47 ? 251  GLU B CG    1 
ATOM   6836  C CD    . GLU B 1 251 ? -33.834 92.922  -2.793  1.00 44.67 ? 251  GLU B CD    1 
ATOM   6837  O OE1   . GLU B 1 251 ? -33.721 91.968  -3.593  1.00 44.61 ? 251  GLU B OE1   1 
ATOM   6838  O OE2   . GLU B 1 251 ? -34.686 93.816  -2.928  1.00 48.06 ? 251  GLU B OE2   1 
ATOM   6839  N N     . ALA B 1 252 ? -35.177 93.245  2.336   1.00 36.74 ? 252  ALA B N     1 
ATOM   6840  C CA    . ALA B 1 252 ? -36.064 93.017  3.458   1.00 35.35 ? 252  ALA B CA    1 
ATOM   6841  C C     . ALA B 1 252 ? -36.930 91.781  3.267   1.00 34.24 ? 252  ALA B C     1 
ATOM   6842  O O     . ALA B 1 252 ? -37.470 91.532  2.185   1.00 33.97 ? 252  ALA B O     1 
ATOM   6843  C CB    . ALA B 1 252 ? -36.910 94.258  3.721   1.00 35.53 ? 252  ALA B CB    1 
ATOM   6844  N N     . MET B 1 253 ? -37.022 90.996  4.333   1.00 32.98 ? 253  MET B N     1 
ATOM   6845  C CA    . MET B 1 253 ? -37.879 89.825  4.388   1.00 32.25 ? 253  MET B CA    1 
ATOM   6846  C C     . MET B 1 253 ? -38.980 90.142  5.367   1.00 31.63 ? 253  MET B C     1 
ATOM   6847  O O     . MET B 1 253 ? -38.703 90.714  6.418   1.00 31.65 ? 253  MET B O     1 
ATOM   6848  C CB    . MET B 1 253 ? -37.091 88.598  4.902   1.00 32.35 ? 253  MET B CB    1 
ATOM   6849  C CG    . MET B 1 253 ? -35.948 88.141  3.997   1.00 32.61 ? 253  MET B CG    1 
ATOM   6850  S SD    . MET B 1 253 ? -36.477 87.923  2.275   1.00 34.63 ? 253  MET B SD    1 
ATOM   6851  C CE    . MET B 1 253 ? -35.112 88.636  1.327   1.00 33.73 ? 253  MET B CE    1 
ATOM   6852  N N     . ASN B 1 254 ? -40.219 89.775  5.052   1.00 30.75 ? 254  ASN B N     1 
ATOM   6853  C CA    . ASN B 1 254 ? -41.280 89.870  6.054   1.00 30.05 ? 254  ASN B CA    1 
ATOM   6854  C C     . ASN B 1 254 ? -41.028 88.905  7.216   1.00 29.03 ? 254  ASN B C     1 
ATOM   6855  O O     . ASN B 1 254 ? -40.476 87.812  7.028   1.00 27.98 ? 254  ASN B O     1 
ATOM   6856  C CB    . ASN B 1 254 ? -42.668 89.629  5.454   1.00 30.73 ? 254  ASN B CB    1 
ATOM   6857  C CG    . ASN B 1 254 ? -43.802 89.885  6.475   1.00 33.46 ? 254  ASN B CG    1 
ATOM   6858  O OD1   . ASN B 1 254 ? -44.385 88.932  7.058   1.00 33.24 ? 254  ASN B OD1   1 
ATOM   6859  N ND2   . ASN B 1 254 ? -44.094 91.186  6.724   1.00 34.73 ? 254  ASN B ND2   1 
ATOM   6860  N N     . ALA B 1 255 ? -41.427 89.330  8.412   1.00 28.21 ? 255  ALA B N     1 
ATOM   6861  C CA    . ALA B 1 255 ? -41.339 88.501  9.620   1.00 27.83 ? 255  ALA B CA    1 
ATOM   6862  C C     . ALA B 1 255 ? -41.903 87.082  9.465   1.00 27.56 ? 255  ALA B C     1 
ATOM   6863  O O     . ALA B 1 255 ? -41.359 86.140  10.044  1.00 28.25 ? 255  ALA B O     1 
ATOM   6864  C CB    . ALA B 1 255 ? -41.979 89.217  10.820  1.00 27.31 ? 255  ALA B CB    1 
ATOM   6865  N N     . GLU B 1 256 ? -42.970 86.921  8.685   1.00 26.97 ? 256  GLU B N     1 
ATOM   6866  C CA    . GLU B 1 256 ? -43.568 85.602  8.505   1.00 26.46 ? 256  GLU B CA    1 
ATOM   6867  C C     . GLU B 1 256 ? -43.159 84.888  7.224   1.00 26.32 ? 256  GLU B C     1 
ATOM   6868  O O     . GLU B 1 256 ? -43.773 83.880  6.885   1.00 26.61 ? 256  GLU B O     1 
ATOM   6869  C CB    . GLU B 1 256 ? -45.113 85.646  8.625   1.00 26.61 ? 256  GLU B CB    1 
ATOM   6870  C CG    . GLU B 1 256 ? -45.668 85.865  10.058  1.00 25.58 ? 256  GLU B CG    1 
ATOM   6871  C CD    . GLU B 1 256 ? -45.139 84.859  11.104  1.00 25.81 ? 256  GLU B CD    1 
ATOM   6872  O OE1   . GLU B 1 256 ? -44.774 83.713  10.747  1.00 27.15 ? 256  GLU B OE1   1 
ATOM   6873  O OE2   . GLU B 1 256 ? -45.101 85.211  12.300  1.00 25.52 ? 256  GLU B OE2   1 
ATOM   6874  N N     . ASP B 1 257 ? -42.157 85.411  6.508   1.00 25.78 ? 257  ASP B N     1 
ATOM   6875  C CA    . ASP B 1 257 ? -41.541 84.694  5.380   1.00 25.59 ? 257  ASP B CA    1 
ATOM   6876  C C     . ASP B 1 257 ? -40.775 83.457  5.883   1.00 25.39 ? 257  ASP B C     1 
ATOM   6877  O O     . ASP B 1 257 ? -40.001 83.544  6.850   1.00 25.14 ? 257  ASP B O     1 
ATOM   6878  C CB    . ASP B 1 257 ? -40.574 85.588  4.579   1.00 25.49 ? 257  ASP B CB    1 
ATOM   6879  C CG    . ASP B 1 257 ? -41.289 86.603  3.688   1.00 26.60 ? 257  ASP B CG    1 
ATOM   6880  O OD1   . ASP B 1 257 ? -42.474 86.365  3.347   1.00 24.97 ? 257  ASP B OD1   1 
ATOM   6881  O OD2   . ASP B 1 257 ? -40.641 87.636  3.328   1.00 26.22 ? 257  ASP B OD2   1 
ATOM   6882  N N     . PRO B 1 258 ? -40.989 82.300  5.229   1.00 25.53 ? 258  PRO B N     1 
ATOM   6883  C CA    . PRO B 1 258 ? -40.357 81.045  5.654   1.00 25.43 ? 258  PRO B CA    1 
ATOM   6884  C C     . PRO B 1 258 ? -38.822 81.118  5.687   1.00 25.96 ? 258  PRO B C     1 
ATOM   6885  O O     . PRO B 1 258 ? -38.194 81.613  4.730   1.00 26.09 ? 258  PRO B O     1 
ATOM   6886  C CB    . PRO B 1 258 ? -40.845 80.036  4.621   1.00 25.55 ? 258  PRO B CB    1 
ATOM   6887  C CG    . PRO B 1 258 ? -41.427 80.866  3.487   1.00 25.75 ? 258  PRO B CG    1 
ATOM   6888  C CD    . PRO B 1 258 ? -41.893 82.117  4.077   1.00 25.01 ? 258  PRO B CD    1 
ATOM   6889  N N     . LEU B 1 259 ? -38.235 80.640  6.788   1.00 25.47 ? 259  LEU B N     1 
ATOM   6890  C CA    . LEU B 1 259 ? -36.792 80.624  6.956   1.00 25.07 ? 259  LEU B CA    1 
ATOM   6891  C C     . LEU B 1 259 ? -36.232 79.243  6.622   1.00 25.39 ? 259  LEU B C     1 
ATOM   6892  O O     . LEU B 1 259 ? -35.315 79.119  5.814   1.00 26.23 ? 259  LEU B O     1 
ATOM   6893  C CB    . LEU B 1 259 ? -36.415 81.029  8.382   1.00 25.28 ? 259  LEU B CB    1 
ATOM   6894  C CG    . LEU B 1 259 ? -34.933 81.147  8.784   1.00 25.84 ? 259  LEU B CG    1 
ATOM   6895  C CD1   . LEU B 1 259 ? -34.140 82.172  7.921   1.00 26.26 ? 259  LEU B CD1   1 
ATOM   6896  C CD2   . LEU B 1 259 ? -34.838 81.500  10.248  1.00 24.13 ? 259  LEU B CD2   1 
ATOM   6897  N N     . PHE B 1 260 ? -36.775 78.198  7.234   1.00 25.10 ? 260  PHE B N     1 
ATOM   6898  C CA    . PHE B 1 260 ? -36.279 76.856  6.977   1.00 25.05 ? 260  PHE B CA    1 
ATOM   6899  C C     . PHE B 1 260 ? -37.268 75.731  7.285   1.00 25.31 ? 260  PHE B C     1 
ATOM   6900  O O     . PHE B 1 260 ? -38.178 75.886  8.103   1.00 24.95 ? 260  PHE B O     1 
ATOM   6901  C CB    . PHE B 1 260 ? -34.923 76.608  7.673   1.00 25.39 ? 260  PHE B CB    1 
ATOM   6902  C CG    . PHE B 1 260 ? -34.987 76.571  9.186   1.00 24.29 ? 260  PHE B CG    1 
ATOM   6903  C CD1   . PHE B 1 260 ? -35.468 75.450  9.850   1.00 22.15 ? 260  PHE B CD1   1 
ATOM   6904  C CD2   . PHE B 1 260 ? -34.519 77.650  9.934   1.00 23.96 ? 260  PHE B CD2   1 
ATOM   6905  C CE1   . PHE B 1 260 ? -35.514 75.419  11.241  1.00 25.20 ? 260  PHE B CE1   1 
ATOM   6906  C CE2   . PHE B 1 260 ? -34.565 77.637  11.341  1.00 25.05 ? 260  PHE B CE2   1 
ATOM   6907  C CZ    . PHE B 1 260 ? -35.066 76.517  11.994  1.00 24.66 ? 260  PHE B CZ    1 
ATOM   6908  N N     . ILE B 1 261 ? -37.065 74.616  6.581   1.00 25.45 ? 261  ILE B N     1 
ATOM   6909  C CA    . ILE B 1 261 ? -37.750 73.361  6.824   1.00 25.95 ? 261  ILE B CA    1 
ATOM   6910  C C     . ILE B 1 261 ? -36.781 72.403  7.528   1.00 25.40 ? 261  ILE B C     1 
ATOM   6911  O O     . ILE B 1 261 ? -35.606 72.345  7.160   1.00 25.57 ? 261  ILE B O     1 
ATOM   6912  C CB    . ILE B 1 261 ? -38.159 72.663  5.505   1.00 26.17 ? 261  ILE B CB    1 
ATOM   6913  C CG1   . ILE B 1 261 ? -39.065 73.531  4.641   1.00 26.50 ? 261  ILE B CG1   1 
ATOM   6914  C CG2   . ILE B 1 261 ? -38.819 71.312  5.794   1.00 27.44 ? 261  ILE B CG2   1 
ATOM   6915  C CD1   . ILE B 1 261 ? -40.198 74.103  5.361   1.00 29.07 ? 261  ILE B CD1   1 
ATOM   6916  N N     . LEU B 1 262 ? -37.287 71.657  8.512   1.00 24.35 ? 262  LEU B N     1 
ATOM   6917  C CA    . LEU B 1 262 ? -36.533 70.594  9.171   1.00 24.45 ? 262  LEU B CA    1 
ATOM   6918  C C     . LEU B 1 262 ? -37.358 69.333  9.298   1.00 24.42 ? 262  LEU B C     1 
ATOM   6919  O O     . LEU B 1 262 ? -38.394 69.323  9.975   1.00 25.20 ? 262  LEU B O     1 
ATOM   6920  C CB    . LEU B 1 262 ? -36.053 71.009  10.558  1.00 24.25 ? 262  LEU B CB    1 
ATOM   6921  C CG    . LEU B 1 262 ? -34.566 71.212  10.803  1.00 25.21 ? 262  LEU B CG    1 
ATOM   6922  C CD1   . LEU B 1 262 ? -34.322 71.407  12.294  1.00 21.61 ? 262  LEU B CD1   1 
ATOM   6923  C CD2   . LEU B 1 262 ? -33.718 70.039  10.230  1.00 27.03 ? 262  LEU B CD2   1 
ATOM   6924  N N     . TYR B 1 263 ? -36.905 68.270  8.646   1.00 24.25 ? 263  TYR B N     1 
ATOM   6925  C CA    . TYR B 1 263 ? -37.659 67.026  8.633   1.00 24.20 ? 263  TYR B CA    1 
ATOM   6926  C C     . TYR B 1 263 ? -37.507 66.342  9.956   1.00 24.81 ? 263  TYR B C     1 
ATOM   6927  O O     . TYR B 1 263 ? -36.379 66.097  10.434  1.00 23.84 ? 263  TYR B O     1 
ATOM   6928  C CB    . TYR B 1 263 ? -37.271 66.127  7.445   1.00 24.28 ? 263  TYR B CB    1 
ATOM   6929  C CG    . TYR B 1 263 ? -37.918 66.660  6.198   1.00 23.21 ? 263  TYR B CG    1 
ATOM   6930  C CD1   . TYR B 1 263 ? -37.287 67.639  5.436   1.00 22.75 ? 263  TYR B CD1   1 
ATOM   6931  C CD2   . TYR B 1 263 ? -39.214 66.267  5.840   1.00 23.51 ? 263  TYR B CD2   1 
ATOM   6932  C CE1   . TYR B 1 263 ? -37.899 68.178  4.315   1.00 22.98 ? 263  TYR B CE1   1 
ATOM   6933  C CE2   . TYR B 1 263 ? -39.843 66.801  4.713   1.00 23.53 ? 263  TYR B CE2   1 
ATOM   6934  C CZ    . TYR B 1 263 ? -39.173 67.758  3.964   1.00 24.17 ? 263  TYR B CZ    1 
ATOM   6935  O OH    . TYR B 1 263 ? -39.766 68.310  2.861   1.00 25.33 ? 263  TYR B OH    1 
ATOM   6936  N N     . THR B 1 264 ? -38.668 66.054  10.541  1.00 24.95 ? 264  THR B N     1 
ATOM   6937  C CA    . THR B 1 264 ? -38.760 65.657  11.924  1.00 25.06 ? 264  THR B CA    1 
ATOM   6938  C C     . THR B 1 264 ? -39.686 64.457  12.023  1.00 26.05 ? 264  THR B C     1 
ATOM   6939  O O     . THR B 1 264 ? -40.748 64.412  11.395  1.00 26.03 ? 264  THR B O     1 
ATOM   6940  C CB    . THR B 1 264 ? -39.266 66.838  12.809  1.00 25.08 ? 264  THR B CB    1 
ATOM   6941  O OG1   . THR B 1 264 ? -38.491 68.022  12.540  1.00 22.35 ? 264  THR B OG1   1 
ATOM   6942  C CG2   . THR B 1 264 ? -39.183 66.497  14.292  1.00 23.80 ? 264  THR B CG2   1 
ATOM   6943  N N     . SER B 1 265 ? -39.266 63.478  12.816  1.00 27.25 ? 265  SER B N     1 
ATOM   6944  C CA    . SER B 1 265 ? -40.041 62.263  13.028  1.00 28.42 ? 265  SER B CA    1 
ATOM   6945  C C     . SER B 1 265 ? -41.280 62.513  13.878  1.00 29.22 ? 265  SER B C     1 
ATOM   6946  O O     . SER B 1 265 ? -41.242 63.264  14.846  1.00 29.08 ? 265  SER B O     1 
ATOM   6947  C CB    . SER B 1 265 ? -39.161 61.209  13.685  1.00 28.40 ? 265  SER B CB    1 
ATOM   6948  O OG    . SER B 1 265 ? -38.075 60.869  12.837  1.00 26.52 ? 265  SER B OG    1 
ATOM   6949  N N     . GLY B 1 266 ? -42.376 61.872  13.499  1.00 30.41 ? 266  GLY B N     1 
ATOM   6950  C CA    . GLY B 1 266 ? -43.617 61.927  14.267  1.00 31.29 ? 266  GLY B CA    1 
ATOM   6951  C C     . GLY B 1 266 ? -44.015 60.575  14.843  1.00 32.21 ? 266  GLY B C     1 
ATOM   6952  O O     . GLY B 1 266 ? -43.407 59.537  14.534  1.00 31.76 ? 266  GLY B O     1 
ATOM   6953  N N     . SER B 1 267 ? -45.035 60.613  15.699  1.00 33.27 ? 267  SER B N     1 
ATOM   6954  C CA    . SER B 1 267 ? -45.674 59.436  16.266  1.00 34.38 ? 267  SER B CA    1 
ATOM   6955  C C     . SER B 1 267 ? -46.206 58.527  15.166  1.00 34.75 ? 267  SER B C     1 
ATOM   6956  O O     . SER B 1 267 ? -46.201 57.311  15.313  1.00 35.83 ? 267  SER B O     1 
ATOM   6957  C CB    . SER B 1 267 ? -46.831 59.854  17.197  1.00 34.61 ? 267  SER B CB    1 
ATOM   6958  O OG    . SER B 1 267 ? -46.991 58.934  18.273  1.00 35.82 ? 267  SER B OG    1 
ATOM   6959  N N     . THR B 1 268 ? -46.648 59.118  14.061  1.00 34.94 ? 268  THR B N     1 
ATOM   6960  C CA    . THR B 1 268 ? -47.247 58.370  12.955  1.00 34.76 ? 268  THR B CA    1 
ATOM   6961  C C     . THR B 1 268 ? -46.730 58.929  11.626  1.00 34.84 ? 268  THR B C     1 
ATOM   6962  O O     . THR B 1 268 ? -46.526 60.120  11.488  1.00 34.46 ? 268  THR B O     1 
ATOM   6963  C CB    . THR B 1 268 ? -48.805 58.469  12.972  1.00 35.13 ? 268  THR B CB    1 
ATOM   6964  O OG1   . THR B 1 268 ? -49.219 59.835  12.809  1.00 33.53 ? 268  THR B OG1   1 
ATOM   6965  C CG2   . THR B 1 268 ? -49.399 57.918  14.291  1.00 35.18 ? 268  THR B CG2   1 
ATOM   6966  N N     . GLY B 1 269 ? -46.508 58.053  10.657  1.00 35.06 ? 269  GLY B N     1 
ATOM   6967  C CA    . GLY B 1 269 ? -46.049 58.459  9.337   1.00 35.62 ? 269  GLY B CA    1 
ATOM   6968  C C     . GLY B 1 269 ? -44.582 58.832  9.244   1.00 36.01 ? 269  GLY B C     1 
ATOM   6969  O O     . GLY B 1 269 ? -43.885 58.916  10.264  1.00 36.56 ? 269  GLY B O     1 
ATOM   6970  N N     . LYS B 1 270 ? -44.128 59.041  8.006   1.00 35.90 ? 270  LYS B N     1 
ATOM   6971  C CA    . LYS B 1 270 ? -42.804 59.568  7.690   1.00 36.31 ? 270  LYS B CA    1 
ATOM   6972  C C     . LYS B 1 270 ? -42.497 60.913  8.380   1.00 35.29 ? 270  LYS B C     1 
ATOM   6973  O O     . LYS B 1 270 ? -43.418 61.629  8.780   1.00 35.22 ? 270  LYS B O     1 
ATOM   6974  C CB    . LYS B 1 270 ? -42.674 59.751  6.176   1.00 37.22 ? 270  LYS B CB    1 
ATOM   6975  C CG    . LYS B 1 270 ? -42.538 58.446  5.384   1.00 40.01 ? 270  LYS B CG    1 
ATOM   6976  C CD    . LYS B 1 270 ? -41.178 57.719  5.636   1.00 42.11 ? 270  LYS B CD    1 
ATOM   6977  C CE    . LYS B 1 270 ? -41.228 56.255  5.136   1.00 42.34 ? 270  LYS B CE    1 
ATOM   6978  N NZ    . LYS B 1 270 ? -42.438 55.490  5.664   1.00 41.49 ? 270  LYS B NZ    1 
ATOM   6979  N N     . PRO B 1 271 ? -41.199 61.255  8.534   1.00 34.32 ? 271  PRO B N     1 
ATOM   6980  C CA    . PRO B 1 271 ? -40.871 62.605  9.007   1.00 33.67 ? 271  PRO B CA    1 
ATOM   6981  C C     . PRO B 1 271 ? -41.405 63.728  8.081   1.00 32.95 ? 271  PRO B C     1 
ATOM   6982  O O     . PRO B 1 271 ? -41.335 63.610  6.841   1.00 32.74 ? 271  PRO B O     1 
ATOM   6983  C CB    . PRO B 1 271 ? -39.334 62.592  9.055   1.00 33.56 ? 271  PRO B CB    1 
ATOM   6984  C CG    . PRO B 1 271 ? -38.975 61.158  9.226   1.00 33.64 ? 271  PRO B CG    1 
ATOM   6985  C CD    . PRO B 1 271 ? -39.978 60.450  8.344   1.00 34.33 ? 271  PRO B CD    1 
ATOM   6986  N N     . LYS B 1 272 ? -41.946 64.783  8.697   1.00 31.77 ? 272  LYS B N     1 
ATOM   6987  C CA    . LYS B 1 272 ? -42.530 65.909  7.970   1.00 31.11 ? 272  LYS B CA    1 
ATOM   6988  C C     . LYS B 1 272 ? -41.681 67.137  8.186   1.00 30.24 ? 272  LYS B C     1 
ATOM   6989  O O     . LYS B 1 272 ? -40.939 67.216  9.168   1.00 30.87 ? 272  LYS B O     1 
ATOM   6990  C CB    . LYS B 1 272 ? -43.961 66.208  8.426   1.00 31.68 ? 272  LYS B CB    1 
ATOM   6991  C CG    . LYS B 1 272 ? -44.912 65.011  8.503   1.00 32.08 ? 272  LYS B CG    1 
ATOM   6992  C CD    . LYS B 1 272 ? -45.421 64.526  7.154   1.00 34.73 ? 272  LYS B CD    1 
ATOM   6993  C CE    . LYS B 1 272 ? -46.340 63.286  7.397   1.00 35.95 ? 272  LYS B CE    1 
ATOM   6994  N NZ    . LYS B 1 272 ? -46.823 62.583  6.167   1.00 36.09 ? 272  LYS B NZ    1 
ATOM   6995  N N     . GLY B 1 273 ? -41.794 68.098  7.273   1.00 28.92 ? 273  GLY B N     1 
ATOM   6996  C CA    . GLY B 1 273 ? -40.986 69.306  7.322   1.00 27.47 ? 273  GLY B CA    1 
ATOM   6997  C C     . GLY B 1 273 ? -41.541 70.368  8.249   1.00 26.77 ? 273  GLY B C     1 
ATOM   6998  O O     . GLY B 1 273 ? -42.487 71.065  7.916   1.00 26.24 ? 273  GLY B O     1 
ATOM   6999  N N     . VAL B 1 274 ? -40.943 70.483  9.433   1.00 26.66 ? 274  VAL B N     1 
ATOM   7000  C CA    . VAL B 1 274 ? -41.312 71.521  10.394  1.00 25.29 ? 274  VAL B CA    1 
ATOM   7001  C C     . VAL B 1 274 ? -40.801 72.867  9.892   1.00 24.97 ? 274  VAL B C     1 
ATOM   7002  O O     . VAL B 1 274 ? -39.602 73.030  9.663   1.00 25.01 ? 274  VAL B O     1 
ATOM   7003  C CB    . VAL B 1 274 ? -40.758 71.232  11.822  1.00 25.44 ? 274  VAL B CB    1 
ATOM   7004  C CG1   . VAL B 1 274 ? -41.027 72.431  12.763  1.00 23.48 ? 274  VAL B CG1   1 
ATOM   7005  C CG2   . VAL B 1 274 ? -41.362 69.935  12.379  1.00 23.66 ? 274  VAL B CG2   1 
ATOM   7006  N N     . LEU B 1 275 ? -41.728 73.817  9.739   1.00 24.41 ? 275  LEU B N     1 
ATOM   7007  C CA    . LEU B 1 275 ? -41.442 75.123  9.146   1.00 23.17 ? 275  LEU B CA    1 
ATOM   7008  C C     . LEU B 1 275 ? -41.382 76.260  10.159  1.00 22.49 ? 275  LEU B C     1 
ATOM   7009  O O     . LEU B 1 275 ? -42.319 76.471  10.942  1.00 21.84 ? 275  LEU B O     1 
ATOM   7010  C CB    . LEU B 1 275 ? -42.462 75.464  8.046   1.00 22.98 ? 275  LEU B CB    1 
ATOM   7011  C CG    . LEU B 1 275 ? -42.142 76.714  7.204   1.00 21.45 ? 275  LEU B CG    1 
ATOM   7012  C CD1   . LEU B 1 275 ? -42.689 76.582  5.793   1.00 21.39 ? 275  LEU B CD1   1 
ATOM   7013  C CD2   . LEU B 1 275 ? -42.688 77.984  7.850   1.00 17.54 ? 275  LEU B CD2   1 
ATOM   7014  N N     . HIS B 1 276 ? -40.272 76.989  10.094  1.00 21.48 ? 276  HIS B N     1 
ATOM   7015  C CA    . HIS B 1 276 ? -40.050 78.171  10.894  1.00 21.63 ? 276  HIS B CA    1 
ATOM   7016  C C     . HIS B 1 276 ? -39.932 79.398  9.997   1.00 21.70 ? 276  HIS B C     1 
ATOM   7017  O O     . HIS B 1 276 ? -39.244 79.372  8.973   1.00 21.71 ? 276  HIS B O     1 
ATOM   7018  C CB    . HIS B 1 276 ? -38.779 78.025  11.733  1.00 20.45 ? 276  HIS B CB    1 
ATOM   7019  C CG    . HIS B 1 276 ? -38.962 77.162  12.935  1.00 20.16 ? 276  HIS B CG    1 
ATOM   7020  N ND1   . HIS B 1 276 ? -39.524 77.630  14.102  1.00 18.08 ? 276  HIS B ND1   1 
ATOM   7021  C CD2   . HIS B 1 276 ? -38.665 75.858  13.158  1.00 19.22 ? 276  HIS B CD2   1 
ATOM   7022  C CE1   . HIS B 1 276 ? -39.557 76.660  14.996  1.00 16.54 ? 276  HIS B CE1   1 
ATOM   7023  N NE2   . HIS B 1 276 ? -39.027 75.579  14.456  1.00 19.22 ? 276  HIS B NE2   1 
ATOM   7024  N N     . THR B 1 277 ? -40.623 80.465  10.380  1.00 21.77 ? 277  THR B N     1 
ATOM   7025  C CA    . THR B 1 277 ? -40.448 81.753  9.710   1.00 21.91 ? 277  THR B CA    1 
ATOM   7026  C C     . THR B 1 277 ? -39.253 82.532  10.317  1.00 21.77 ? 277  THR B C     1 
ATOM   7027  O O     . THR B 1 277 ? -38.346 81.939  10.904  1.00 21.41 ? 277  THR B O     1 
ATOM   7028  C CB    . THR B 1 277 ? -41.779 82.554  9.637   1.00 22.45 ? 277  THR B CB    1 
ATOM   7029  O OG1   . THR B 1 277 ? -42.222 82.906  10.955  1.00 21.27 ? 277  THR B OG1   1 
ATOM   7030  C CG2   . THR B 1 277 ? -42.861 81.706  8.938   1.00 21.08 ? 277  THR B CG2   1 
ATOM   7031  N N     . THR B 1 278 ? -39.242 83.845  10.165  1.00 22.02 ? 278  THR B N     1 
ATOM   7032  C CA    . THR B 1 278 ? -38.007 84.607  10.361  1.00 21.69 ? 278  THR B CA    1 
ATOM   7033  C C     . THR B 1 278 ? -37.970 85.434  11.657  1.00 21.59 ? 278  THR B C     1 
ATOM   7034  O O     . THR B 1 278 ? -37.037 85.291  12.463  1.00 21.20 ? 278  THR B O     1 
ATOM   7035  C CB    . THR B 1 278 ? -37.729 85.508  9.123   1.00 21.38 ? 278  THR B CB    1 
ATOM   7036  O OG1   . THR B 1 278 ? -37.739 84.700  7.945   1.00 22.00 ? 278  THR B OG1   1 
ATOM   7037  C CG2   . THR B 1 278 ? -36.393 86.200  9.221   1.00 20.50 ? 278  THR B CG2   1 
ATOM   7038  N N     . GLY B 1 279 ? -38.968 86.305  11.828  1.00 21.25 ? 279  GLY B N     1 
ATOM   7039  C CA    . GLY B 1 279 ? -38.960 87.313  12.897  1.00 21.14 ? 279  GLY B CA    1 
ATOM   7040  C C     . GLY B 1 279 ? -38.953 86.791  14.326  1.00 20.81 ? 279  GLY B C     1 
ATOM   7041  O O     . GLY B 1 279 ? -37.975 86.985  15.075  1.00 20.52 ? 279  GLY B O     1 
ATOM   7042  N N     . GLY B 1 280 ? -40.053 86.132  14.687  1.00 20.78 ? 280  GLY B N     1 
ATOM   7043  C CA    . GLY B 1 280 ? -40.247 85.569  16.012  1.00 21.06 ? 280  GLY B CA    1 
ATOM   7044  C C     . GLY B 1 280 ? -39.251 84.467  16.300  1.00 21.21 ? 280  GLY B C     1 
ATOM   7045  O O     . GLY B 1 280 ? -38.696 84.425  17.394  1.00 21.22 ? 280  GLY B O     1 
ATOM   7046  N N     . TYR B 1 281 ? -39.027 83.595  15.311  1.00 21.60 ? 281  TYR B N     1 
ATOM   7047  C CA    . TYR B 1 281 ? -37.988 82.570  15.386  1.00 21.90 ? 281  TYR B CA    1 
ATOM   7048  C C     . TYR B 1 281 ? -36.682 83.166  15.889  1.00 22.00 ? 281  TYR B C     1 
ATOM   7049  O O     . TYR B 1 281 ? -36.146 82.698  16.903  1.00 22.37 ? 281  TYR B O     1 
ATOM   7050  C CB    . TYR B 1 281 ? -37.738 81.792  14.059  1.00 21.71 ? 281  TYR B CB    1 
ATOM   7051  C CG    . TYR B 1 281 ? -36.480 80.902  14.168  1.00 21.72 ? 281  TYR B CG    1 
ATOM   7052  C CD1   . TYR B 1 281 ? -36.509 79.665  14.853  1.00 23.50 ? 281  TYR B CD1   1 
ATOM   7053  C CD2   . TYR B 1 281 ? -35.252 81.336  13.675  1.00 21.24 ? 281  TYR B CD2   1 
ATOM   7054  C CE1   . TYR B 1 281 ? -35.326 78.855  14.995  1.00 22.63 ? 281  TYR B CE1   1 
ATOM   7055  C CE2   . TYR B 1 281 ? -34.081 80.567  13.812  1.00 23.04 ? 281  TYR B CE2   1 
ATOM   7056  C CZ    . TYR B 1 281 ? -34.119 79.322  14.468  1.00 23.42 ? 281  TYR B CZ    1 
ATOM   7057  O OH    . TYR B 1 281 ? -32.953 78.589  14.591  1.00 21.31 ? 281  TYR B OH    1 
ATOM   7058  N N     . LEU B 1 282 ? -36.184 84.188  15.188  1.00 21.55 ? 282  LEU B N     1 
ATOM   7059  C CA    . LEU B 1 282 ? -34.852 84.752  15.473  1.00 21.22 ? 282  LEU B CA    1 
ATOM   7060  C C     . LEU B 1 282 ? -34.814 85.558  16.781  1.00 21.46 ? 282  LEU B C     1 
ATOM   7061  O O     . LEU B 1 282 ? -33.817 85.534  17.492  1.00 21.32 ? 282  LEU B O     1 
ATOM   7062  C CB    . LEU B 1 282 ? -34.314 85.592  14.287  1.00 21.22 ? 282  LEU B CB    1 
ATOM   7063  C CG    . LEU B 1 282 ? -32.839 86.043  14.449  1.00 21.36 ? 282  LEU B CG    1 
ATOM   7064  C CD1   . LEU B 1 282 ? -31.878 84.847  14.606  1.00 20.05 ? 282  LEU B CD1   1 
ATOM   7065  C CD2   . LEU B 1 282 ? -32.366 86.941  13.348  1.00 19.89 ? 282  LEU B CD2   1 
ATOM   7066  N N     . VAL B 1 283 ? -35.890 86.287  17.072  1.00 21.64 ? 283  VAL B N     1 
ATOM   7067  C CA    . VAL B 1 283 ? -36.020 86.985  18.342  1.00 21.97 ? 283  VAL B CA    1 
ATOM   7068  C C     . VAL B 1 283 ? -35.919 85.903  19.420  1.00 22.16 ? 283  VAL B C     1 
ATOM   7069  O O     . VAL B 1 283 ? -35.156 86.044  20.387  1.00 22.58 ? 283  VAL B O     1 
ATOM   7070  C CB    . VAL B 1 283 ? -37.398 87.765  18.448  1.00 22.37 ? 283  VAL B CB    1 
ATOM   7071  C CG1   . VAL B 1 283 ? -37.709 88.179  19.886  1.00 21.59 ? 283  VAL B CG1   1 
ATOM   7072  C CG2   . VAL B 1 283 ? -37.427 88.978  17.540  1.00 21.58 ? 283  VAL B CG2   1 
ATOM   7073  N N     . TYR B 1 284 ? -36.652 84.806  19.232  1.00 21.82 ? 284  TYR B N     1 
ATOM   7074  C CA    . TYR B 1 284 ? -36.728 83.789  20.276  1.00 21.85 ? 284  TYR B CA    1 
ATOM   7075  C C     . TYR B 1 284 ? -35.364 83.123  20.504  1.00 21.78 ? 284  TYR B C     1 
ATOM   7076  O O     . TYR B 1 284 ? -34.924 82.995  21.643  1.00 21.58 ? 284  TYR B O     1 
ATOM   7077  C CB    . TYR B 1 284 ? -37.867 82.778  20.024  1.00 21.40 ? 284  TYR B CB    1 
ATOM   7078  C CG    . TYR B 1 284 ? -38.299 82.088  21.298  1.00 21.95 ? 284  TYR B CG    1 
ATOM   7079  C CD1   . TYR B 1 284 ? -37.919 80.758  21.563  1.00 19.78 ? 284  TYR B CD1   1 
ATOM   7080  C CD2   . TYR B 1 284 ? -39.036 82.787  22.277  1.00 22.19 ? 284  TYR B CD2   1 
ATOM   7081  C CE1   . TYR B 1 284 ? -38.294 80.126  22.739  1.00 20.19 ? 284  TYR B CE1   1 
ATOM   7082  C CE2   . TYR B 1 284 ? -39.403 82.170  23.482  1.00 21.84 ? 284  TYR B CE2   1 
ATOM   7083  C CZ    . TYR B 1 284 ? -39.021 80.835  23.707  1.00 21.95 ? 284  TYR B CZ    1 
ATOM   7084  O OH    . TYR B 1 284 ? -39.381 80.223  24.883  1.00 19.57 ? 284  TYR B OH    1 
ATOM   7085  N N     . ALA B 1 285 ? -34.686 82.753  19.415  1.00 22.19 ? 285  ALA B N     1 
ATOM   7086  C CA    . ALA B 1 285 ? -33.311 82.222  19.468  1.00 22.59 ? 285  ALA B CA    1 
ATOM   7087  C C     . ALA B 1 285 ? -32.324 83.173  20.185  1.00 23.06 ? 285  ALA B C     1 
ATOM   7088  O O     . ALA B 1 285 ? -31.550 82.758  21.060  1.00 22.63 ? 285  ALA B O     1 
ATOM   7089  C CB    . ALA B 1 285 ? -32.818 81.913  18.060  1.00 22.39 ? 285  ALA B CB    1 
ATOM   7090  N N     . ALA B 1 286 ? -32.360 84.452  19.815  1.00 23.47 ? 286  ALA B N     1 
ATOM   7091  C CA    . ALA B 1 286 ? -31.413 85.418  20.367  1.00 23.90 ? 286  ALA B CA    1 
ATOM   7092  C C     . ALA B 1 286 ? -31.665 85.608  21.870  1.00 24.30 ? 286  ALA B C     1 
ATOM   7093  O O     . ALA B 1 286 ? -30.775 85.391  22.710  1.00 24.78 ? 286  ALA B O     1 
ATOM   7094  C CB    . ALA B 1 286 ? -31.462 86.748  19.594  1.00 23.18 ? 286  ALA B CB    1 
ATOM   7095  N N     . THR B 1 287 ? -32.902 85.940  22.219  1.00 24.52 ? 287  THR B N     1 
ATOM   7096  C CA    . THR B 1 287 ? -33.280 86.094  23.624  1.00 23.72 ? 287  THR B CA    1 
ATOM   7097  C C     . THR B 1 287 ? -32.959 84.885  24.515  1.00 23.69 ? 287  THR B C     1 
ATOM   7098  O O     . THR B 1 287 ? -32.351 85.045  25.580  1.00 23.04 ? 287  THR B O     1 
ATOM   7099  C CB    . THR B 1 287 ? -34.754 86.408  23.727  1.00 23.73 ? 287  THR B CB    1 
ATOM   7100  O OG1   . THR B 1 287 ? -35.085 87.371  22.716  1.00 22.66 ? 287  THR B OG1   1 
ATOM   7101  C CG2   . THR B 1 287 ? -35.089 86.940  25.141  1.00 23.26 ? 287  THR B CG2   1 
ATOM   7102  N N     . THR B 1 288 ? -33.382 83.689  24.090  1.00 23.69 ? 288  THR B N     1 
ATOM   7103  C CA    . THR B 1 288 ? -33.096 82.460  24.844  1.00 24.04 ? 288  THR B CA    1 
ATOM   7104  C C     . THR B 1 288 ? -31.576 82.228  24.984  1.00 24.38 ? 288  THR B C     1 
ATOM   7105  O O     . THR B 1 288 ? -31.070 82.107  26.096  1.00 24.58 ? 288  THR B O     1 
ATOM   7106  C CB    . THR B 1 288 ? -33.786 81.222  24.241  1.00 23.91 ? 288  THR B CB    1 
ATOM   7107  O OG1   . THR B 1 288 ? -33.469 81.146  22.856  1.00 23.27 ? 288  THR B OG1   1 
ATOM   7108  C CG2   . THR B 1 288 ? -35.290 81.304  24.390  1.00 23.23 ? 288  THR B CG2   1 
ATOM   7109  N N     . PHE B 1 289 ? -30.855 82.208  23.865  1.00 24.74 ? 289  PHE B N     1 
ATOM   7110  C CA    . PHE B 1 289 ? -29.384 82.119  23.897  1.00 25.28 ? 289  PHE B CA    1 
ATOM   7111  C C     . PHE B 1 289 ? -28.757 83.029  24.947  1.00 25.48 ? 289  PHE B C     1 
ATOM   7112  O O     . PHE B 1 289 ? -28.024 82.577  25.828  1.00 25.78 ? 289  PHE B O     1 
ATOM   7113  C CB    . PHE B 1 289 ? -28.751 82.464  22.526  1.00 24.57 ? 289  PHE B CB    1 
ATOM   7114  C CG    . PHE B 1 289 ? -27.244 82.485  22.563  1.00 23.95 ? 289  PHE B CG    1 
ATOM   7115  C CD1   . PHE B 1 289 ? -26.512 81.290  22.510  1.00 23.54 ? 289  PHE B CD1   1 
ATOM   7116  C CD2   . PHE B 1 289 ? -26.552 83.687  22.708  1.00 21.62 ? 289  PHE B CD2   1 
ATOM   7117  C CE1   . PHE B 1 289 ? -25.110 81.309  22.568  1.00 22.12 ? 289  PHE B CE1   1 
ATOM   7118  C CE2   . PHE B 1 289 ? -25.162 83.718  22.773  1.00 19.51 ? 289  PHE B CE2   1 
ATOM   7119  C CZ    . PHE B 1 289 ? -24.439 82.534  22.703  1.00 21.56 ? 289  PHE B CZ    1 
ATOM   7120  N N     . LYS B 1 290 ? -29.052 84.320  24.817  1.00 25.98 ? 290  LYS B N     1 
ATOM   7121  C CA    . LYS B 1 290 ? -28.421 85.378  25.610  1.00 26.06 ? 290  LYS B CA    1 
ATOM   7122  C C     . LYS B 1 290 ? -28.638 85.172  27.107  1.00 26.12 ? 290  LYS B C     1 
ATOM   7123  O O     . LYS B 1 290 ? -27.684 85.115  27.876  1.00 26.25 ? 290  LYS B O     1 
ATOM   7124  C CB    . LYS B 1 290 ? -28.961 86.729  25.150  1.00 25.60 ? 290  LYS B CB    1 
ATOM   7125  C CG    . LYS B 1 290 ? -28.472 87.916  25.921  1.00 26.97 ? 290  LYS B CG    1 
ATOM   7126  C CD    . LYS B 1 290 ? -28.987 89.173  25.268  1.00 27.62 ? 290  LYS B CD    1 
ATOM   7127  C CE    . LYS B 1 290 ? -28.524 90.403  25.989  1.00 27.91 ? 290  LYS B CE    1 
ATOM   7128  N NZ    . LYS B 1 290 ? -28.799 91.623  25.159  1.00 29.78 ? 290  LYS B NZ    1 
ATOM   7129  N N     . TYR B 1 291 ? -29.894 85.023  27.503  1.00 26.14 ? 291  TYR B N     1 
ATOM   7130  C CA    . TYR B 1 291 ? -30.253 84.952  28.917  1.00 26.29 ? 291  TYR B CA    1 
ATOM   7131  C C     . TYR B 1 291 ? -29.952 83.623  29.607  1.00 26.30 ? 291  TYR B C     1 
ATOM   7132  O O     . TYR B 1 291 ? -29.525 83.604  30.773  1.00 26.28 ? 291  TYR B O     1 
ATOM   7133  C CB    . TYR B 1 291 ? -31.723 85.310  29.093  1.00 25.64 ? 291  TYR B CB    1 
ATOM   7134  C CG    . TYR B 1 291 ? -31.991 86.757  28.782  1.00 26.06 ? 291  TYR B CG    1 
ATOM   7135  C CD1   . TYR B 1 291 ? -33.146 87.143  28.103  1.00 25.61 ? 291  TYR B CD1   1 
ATOM   7136  C CD2   . TYR B 1 291 ? -31.092 87.751  29.177  1.00 25.57 ? 291  TYR B CD2   1 
ATOM   7137  C CE1   . TYR B 1 291 ? -33.404 88.478  27.823  1.00 25.70 ? 291  TYR B CE1   1 
ATOM   7138  C CE2   . TYR B 1 291 ? -31.342 89.094  28.897  1.00 25.96 ? 291  TYR B CE2   1 
ATOM   7139  C CZ    . TYR B 1 291 ? -32.503 89.448  28.218  1.00 25.83 ? 291  TYR B CZ    1 
ATOM   7140  O OH    . TYR B 1 291 ? -32.763 90.773  27.943  1.00 25.29 ? 291  TYR B OH    1 
ATOM   7141  N N     . VAL B 1 292 ? -30.188 82.519  28.902  1.00 26.12 ? 292  VAL B N     1 
ATOM   7142  C CA    . VAL B 1 292 ? -30.014 81.194  29.505  1.00 26.35 ? 292  VAL B CA    1 
ATOM   7143  C C     . VAL B 1 292 ? -28.534 80.797  29.665  1.00 26.72 ? 292  VAL B C     1 
ATOM   7144  O O     . VAL B 1 292 ? -28.181 80.144  30.636  1.00 26.42 ? 292  VAL B O     1 
ATOM   7145  C CB    . VAL B 1 292 ? -30.838 80.097  28.769  1.00 26.03 ? 292  VAL B CB    1 
ATOM   7146  C CG1   . VAL B 1 292 ? -30.448 78.709  29.243  1.00 24.42 ? 292  VAL B CG1   1 
ATOM   7147  C CG2   . VAL B 1 292 ? -32.328 80.332  28.996  1.00 24.89 ? 292  VAL B CG2   1 
ATOM   7148  N N     . PHE B 1 293 ? -27.691 81.202  28.715  1.00 27.12 ? 293  PHE B N     1 
ATOM   7149  C CA    . PHE B 1 293 ? -26.251 80.989  28.801  1.00 27.37 ? 293  PHE B CA    1 
ATOM   7150  C C     . PHE B 1 293 ? -25.533 82.172  29.419  1.00 27.45 ? 293  PHE B C     1 
ATOM   7151  O O     . PHE B 1 293 ? -24.300 82.178  29.543  1.00 27.02 ? 293  PHE B O     1 
ATOM   7152  C CB    . PHE B 1 293 ? -25.673 80.694  27.414  1.00 27.58 ? 293  PHE B CB    1 
ATOM   7153  C CG    . PHE B 1 293 ? -26.129 79.389  26.854  1.00 28.60 ? 293  PHE B CG    1 
ATOM   7154  C CD1   . PHE B 1 293 ? -26.831 79.338  25.636  1.00 28.76 ? 293  PHE B CD1   1 
ATOM   7155  C CD2   . PHE B 1 293 ? -25.897 78.203  27.558  1.00 26.43 ? 293  PHE B CD2   1 
ATOM   7156  C CE1   . PHE B 1 293 ? -27.274 78.122  25.128  1.00 28.23 ? 293  PHE B CE1   1 
ATOM   7157  C CE2   . PHE B 1 293 ? -26.345 76.988  27.051  1.00 27.30 ? 293  PHE B CE2   1 
ATOM   7158  C CZ    . PHE B 1 293 ? -27.032 76.948  25.840  1.00 27.12 ? 293  PHE B CZ    1 
ATOM   7159  N N     . ASP B 1 294 ? -26.303 83.187  29.785  1.00 27.78 ? 294  ASP B N     1 
ATOM   7160  C CA    . ASP B 1 294 ? -25.740 84.369  30.407  1.00 28.18 ? 294  ASP B CA    1 
ATOM   7161  C C     . ASP B 1 294 ? -24.590 84.918  29.560  1.00 28.46 ? 294  ASP B C     1 
ATOM   7162  O O     . ASP B 1 294 ? -23.562 85.341  30.104  1.00 28.24 ? 294  ASP B O     1 
ATOM   7163  C CB    . ASP B 1 294 ? -25.253 84.021  31.819  1.00 28.38 ? 294  ASP B CB    1 
ATOM   7164  C CG    . ASP B 1 294 ? -25.122 85.230  32.696  1.00 28.97 ? 294  ASP B CG    1 
ATOM   7165  O OD1   . ASP B 1 294 ? -24.026 85.439  33.257  1.00 28.85 ? 294  ASP B OD1   1 
ATOM   7166  O OD2   . ASP B 1 294 ? -26.112 85.980  32.797  1.00 29.41 ? 294  ASP B OD2   1 
ATOM   7167  N N     . TYR B 1 295 ? -24.763 84.913  28.231  1.00 28.75 ? 295  TYR B N     1 
ATOM   7168  C CA    . TYR B 1 295 ? -23.697 85.361  27.331  1.00 28.86 ? 295  TYR B CA    1 
ATOM   7169  C C     . TYR B 1 295 ? -23.326 86.799  27.596  1.00 28.96 ? 295  TYR B C     1 
ATOM   7170  O O     . TYR B 1 295 ? -24.185 87.678  27.662  1.00 29.33 ? 295  TYR B O     1 
ATOM   7171  C CB    . TYR B 1 295 ? -24.006 85.162  25.833  1.00 28.66 ? 295  TYR B CB    1 
ATOM   7172  C CG    . TYR B 1 295 ? -22.747 85.312  24.981  1.00 28.45 ? 295  TYR B CG    1 
ATOM   7173  C CD1   . TYR B 1 295 ? -21.871 84.246  24.832  1.00 28.31 ? 295  TYR B CD1   1 
ATOM   7174  C CD2   . TYR B 1 295 ? -22.417 86.534  24.349  1.00 28.90 ? 295  TYR B CD2   1 
ATOM   7175  C CE1   . TYR B 1 295 ? -20.706 84.360  24.084  1.00 27.57 ? 295  TYR B CE1   1 
ATOM   7176  C CE2   . TYR B 1 295 ? -21.232 86.671  23.593  1.00 26.21 ? 295  TYR B CE2   1 
ATOM   7177  C CZ    . TYR B 1 295 ? -20.383 85.569  23.476  1.00 28.13 ? 295  TYR B CZ    1 
ATOM   7178  O OH    . TYR B 1 295 ? -19.216 85.622  22.726  1.00 28.84 ? 295  TYR B OH    1 
ATOM   7179  N N     . HIS B 1 296 ? -22.029 86.993  27.804  1.00 29.21 ? 296  HIS B N     1 
ATOM   7180  C CA    . HIS B 1 296 ? -21.402 88.300  27.888  1.00 29.02 ? 296  HIS B CA    1 
ATOM   7181  C C     . HIS B 1 296 ? -20.488 88.416  26.674  1.00 28.36 ? 296  HIS B C     1 
ATOM   7182  O O     . HIS B 1 296 ? -19.905 87.417  26.263  1.00 28.33 ? 296  HIS B O     1 
ATOM   7183  C CB    . HIS B 1 296 ? -20.561 88.385  29.155  1.00 29.12 ? 296  HIS B CB    1 
ATOM   7184  C CG    . HIS B 1 296 ? -21.368 88.560  30.399  1.00 30.47 ? 296  HIS B CG    1 
ATOM   7185  N ND1   . HIS B 1 296 ? -22.234 87.592  30.867  1.00 30.85 ? 296  HIS B ND1   1 
ATOM   7186  C CD2   . HIS B 1 296 ? -21.447 89.595  31.272  1.00 29.61 ? 296  HIS B CD2   1 
ATOM   7187  C CE1   . HIS B 1 296 ? -22.813 88.025  31.975  1.00 31.39 ? 296  HIS B CE1   1 
ATOM   7188  N NE2   . HIS B 1 296 ? -22.361 89.239  32.236  1.00 30.84 ? 296  HIS B NE2   1 
ATOM   7189  N N     . PRO B 1 297 ? -20.335 89.632  26.115  1.00 27.77 ? 297  PRO B N     1 
ATOM   7190  C CA    . PRO B 1 297 ? -19.385 89.811  25.013  1.00 27.48 ? 297  PRO B CA    1 
ATOM   7191  C C     . PRO B 1 297 ? -17.998 89.217  25.365  1.00 27.05 ? 297  PRO B C     1 
ATOM   7192  O O     . PRO B 1 297 ? -17.492 89.463  26.464  1.00 26.99 ? 297  PRO B O     1 
ATOM   7193  C CB    . PRO B 1 297 ? -19.293 91.345  24.872  1.00 27.25 ? 297  PRO B CB    1 
ATOM   7194  C CG    . PRO B 1 297 ? -20.585 91.843  25.396  1.00 27.28 ? 297  PRO B CG    1 
ATOM   7195  C CD    . PRO B 1 297 ? -20.984 90.903  26.501  1.00 27.57 ? 297  PRO B CD    1 
ATOM   7196  N N     . GLY B 1 298 ? -17.418 88.425  24.463  1.00 26.41 ? 298  GLY B N     1 
ATOM   7197  C CA    . GLY B 1 298 ? -16.112 87.817  24.720  1.00 26.49 ? 298  GLY B CA    1 
ATOM   7198  C C     . GLY B 1 298 ? -16.117 86.389  25.267  1.00 26.59 ? 298  GLY B C     1 
ATOM   7199  O O     . GLY B 1 298 ? -15.060 85.743  25.338  1.00 26.44 ? 298  GLY B O     1 
ATOM   7200  N N     . ASP B 1 299 ? -17.292 85.895  25.658  1.00 26.16 ? 299  ASP B N     1 
ATOM   7201  C CA    . ASP B 1 299 ? -17.428 84.495  26.054  1.00 26.09 ? 299  ASP B CA    1 
ATOM   7202  C C     . ASP B 1 299 ? -17.219 83.573  24.854  1.00 26.49 ? 299  ASP B C     1 
ATOM   7203  O O     . ASP B 1 299 ? -17.732 83.825  23.731  1.00 26.67 ? 299  ASP B O     1 
ATOM   7204  C CB    . ASP B 1 299 ? -18.790 84.225  26.707  1.00 26.05 ? 299  ASP B CB    1 
ATOM   7205  C CG    . ASP B 1 299 ? -18.936 84.897  28.068  1.00 25.50 ? 299  ASP B CG    1 
ATOM   7206  O OD1   . ASP B 1 299 ? -17.899 85.288  28.635  1.00 26.85 ? 299  ASP B OD1   1 
ATOM   7207  O OD2   . ASP B 1 299 ? -20.073 85.050  28.563  1.00 23.57 ? 299  ASP B OD2   1 
ATOM   7208  N N     . ILE B 1 300 ? -16.430 82.526  25.069  1.00 25.94 ? 300  ILE B N     1 
ATOM   7209  C CA    . ILE B 1 300 ? -16.275 81.523  24.037  1.00 25.68 ? 300  ILE B CA    1 
ATOM   7210  C C     . ILE B 1 300 ? -17.350 80.475  24.254  1.00 25.76 ? 300  ILE B C     1 
ATOM   7211  O O     . ILE B 1 300 ? -17.363 79.775  25.272  1.00 25.66 ? 300  ILE B O     1 
ATOM   7212  C CB    . ILE B 1 300 ? -14.889 80.868  24.045  1.00 25.67 ? 300  ILE B CB    1 
ATOM   7213  C CG1   . ILE B 1 300 ? -13.767 81.925  23.917  1.00 24.95 ? 300  ILE B CG1   1 
ATOM   7214  C CG2   . ILE B 1 300 ? -14.819 79.785  22.947  1.00 26.12 ? 300  ILE B CG2   1 
ATOM   7215  C CD1   . ILE B 1 300 ? -13.853 82.824  22.693  1.00 22.23 ? 300  ILE B CD1   1 
ATOM   7216  N N     . TYR B 1 301 ? -18.256 80.382  23.285  1.00 25.71 ? 301  TYR B N     1 
ATOM   7217  C CA    . TYR B 1 301 ? -19.414 79.493  23.381  1.00 25.29 ? 301  TYR B CA    1 
ATOM   7218  C C     . TYR B 1 301 ? -19.312 78.220  22.511  1.00 25.00 ? 301  TYR B C     1 
ATOM   7219  O O     . TYR B 1 301 ? -19.152 78.287  21.287  1.00 24.76 ? 301  TYR B O     1 
ATOM   7220  C CB    . TYR B 1 301 ? -20.681 80.281  23.055  1.00 24.76 ? 301  TYR B CB    1 
ATOM   7221  C CG    . TYR B 1 301 ? -21.909 79.422  22.904  1.00 25.04 ? 301  TYR B CG    1 
ATOM   7222  C CD1   . TYR B 1 301 ? -22.345 79.034  21.637  1.00 24.55 ? 301  TYR B CD1   1 
ATOM   7223  C CD2   . TYR B 1 301 ? -22.645 78.996  24.032  1.00 23.51 ? 301  TYR B CD2   1 
ATOM   7224  C CE1   . TYR B 1 301 ? -23.491 78.242  21.486  1.00 26.14 ? 301  TYR B CE1   1 
ATOM   7225  C CE2   . TYR B 1 301 ? -23.794 78.202  23.895  1.00 24.20 ? 301  TYR B CE2   1 
ATOM   7226  C CZ    . TYR B 1 301 ? -24.210 77.824  22.615  1.00 25.12 ? 301  TYR B CZ    1 
ATOM   7227  O OH    . TYR B 1 301 ? -25.342 77.063  22.426  1.00 24.30 ? 301  TYR B OH    1 
ATOM   7228  N N     . TRP B 1 302 ? -19.438 77.064  23.159  1.00 24.95 ? 302  TRP B N     1 
ATOM   7229  C CA    . TRP B 1 302 ? -19.459 75.782  22.451  1.00 24.98 ? 302  TRP B CA    1 
ATOM   7230  C C     . TRP B 1 302 ? -20.768 74.973  22.622  1.00 25.31 ? 302  TRP B C     1 
ATOM   7231  O O     . TRP B 1 302 ? -21.052 74.436  23.703  1.00 25.15 ? 302  TRP B O     1 
ATOM   7232  C CB    . TRP B 1 302 ? -18.227 74.954  22.801  1.00 24.02 ? 302  TRP B CB    1 
ATOM   7233  C CG    . TRP B 1 302 ? -18.076 73.725  21.942  1.00 24.92 ? 302  TRP B CG    1 
ATOM   7234  C CD1   . TRP B 1 302 ? -18.679 73.468  20.726  1.00 23.45 ? 302  TRP B CD1   1 
ATOM   7235  C CD2   . TRP B 1 302 ? -17.263 72.579  22.230  1.00 23.68 ? 302  TRP B CD2   1 
ATOM   7236  N NE1   . TRP B 1 302 ? -18.291 72.237  20.258  1.00 22.83 ? 302  TRP B NE1   1 
ATOM   7237  C CE2   . TRP B 1 302 ? -17.433 71.665  21.162  1.00 22.64 ? 302  TRP B CE2   1 
ATOM   7238  C CE3   . TRP B 1 302 ? -16.431 72.227  23.302  1.00 23.12 ? 302  TRP B CE3   1 
ATOM   7239  C CZ2   . TRP B 1 302 ? -16.780 70.427  21.124  1.00 22.80 ? 302  TRP B CZ2   1 
ATOM   7240  C CZ3   . TRP B 1 302 ? -15.786 70.998  23.263  1.00 23.10 ? 302  TRP B CZ3   1 
ATOM   7241  C CH2   . TRP B 1 302 ? -15.969 70.112  22.176  1.00 23.01 ? 302  TRP B CH2   1 
ATOM   7242  N N     . CYS B 1 303 ? -21.559 74.927  21.544  1.00 25.73 ? 303  CYS B N     1 
ATOM   7243  C CA    . CYS B 1 303 ? -22.661 73.972  21.396  1.00 25.97 ? 303  CYS B CA    1 
ATOM   7244  C C     . CYS B 1 303 ? -22.185 72.796  20.569  1.00 25.74 ? 303  CYS B C     1 
ATOM   7245  O O     . CYS B 1 303 ? -21.639 72.989  19.495  1.00 27.10 ? 303  CYS B O     1 
ATOM   7246  C CB    . CYS B 1 303 ? -23.873 74.602  20.695  1.00 26.08 ? 303  CYS B CB    1 
ATOM   7247  S SG    . CYS B 1 303 ? -25.134 73.342  20.249  1.00 26.99 ? 303  CYS B SG    1 
ATOM   7248  N N     . THR B 1 304 ? -22.405 71.582  21.041  1.00 25.50 ? 304  THR B N     1 
ATOM   7249  C CA    . THR B 1 304 ? -21.858 70.390  20.368  1.00 25.79 ? 304  THR B CA    1 
ATOM   7250  C C     . THR B 1 304 ? -22.791 69.755  19.317  1.00 26.15 ? 304  THR B C     1 
ATOM   7251  O O     . THR B 1 304 ? -22.448 68.748  18.694  1.00 25.57 ? 304  THR B O     1 
ATOM   7252  C CB    . THR B 1 304 ? -21.531 69.276  21.379  1.00 25.61 ? 304  THR B CB    1 
ATOM   7253  O OG1   . THR B 1 304 ? -22.735 68.925  22.086  1.00 24.14 ? 304  THR B OG1   1 
ATOM   7254  C CG2   . THR B 1 304 ? -20.435 69.720  22.347  1.00 24.91 ? 304  THR B CG2   1 
ATOM   7255  N N     . ALA B 1 305 ? -23.978 70.326  19.162  1.00 26.71 ? 305  ALA B N     1 
ATOM   7256  C CA    . ALA B 1 305 ? -24.998 69.752  18.291  1.00 26.83 ? 305  ALA B CA    1 
ATOM   7257  C C     . ALA B 1 305 ? -24.640 69.899  16.813  1.00 26.72 ? 305  ALA B C     1 
ATOM   7258  O O     . ALA B 1 305 ? -24.084 70.918  16.389  1.00 25.86 ? 305  ALA B O     1 
ATOM   7259  C CB    . ALA B 1 305 ? -26.374 70.368  18.578  1.00 26.47 ? 305  ALA B CB    1 
ATOM   7260  N N     . ASP B 1 306 ? -24.969 68.854  16.049  1.00 26.89 ? 306  ASP B N     1 
ATOM   7261  C CA    . ASP B 1 306 ? -24.783 68.861  14.623  1.00 26.67 ? 306  ASP B CA    1 
ATOM   7262  C C     . ASP B 1 306 ? -25.675 69.923  14.001  1.00 26.43 ? 306  ASP B C     1 
ATOM   7263  O O     . ASP B 1 306 ? -26.824 70.159  14.407  1.00 25.46 ? 306  ASP B O     1 
ATOM   7264  C CB    . ASP B 1 306 ? -25.093 67.498  14.024  1.00 27.03 ? 306  ASP B CB    1 
ATOM   7265  C CG    . ASP B 1 306 ? -24.566 67.354  12.586  1.00 30.92 ? 306  ASP B CG    1 
ATOM   7266  O OD1   . ASP B 1 306 ? -25.271 67.737  11.609  1.00 32.08 ? 306  ASP B OD1   1 
ATOM   7267  O OD2   . ASP B 1 306 ? -23.431 66.840  12.432  1.00 34.54 ? 306  ASP B OD2   1 
ATOM   7268  N N     . VAL B 1 307 ? -25.114 70.547  12.978  1.00 26.04 ? 307  VAL B N     1 
ATOM   7269  C CA    . VAL B 1 307 ? -25.787 71.561  12.205  1.00 25.03 ? 307  VAL B CA    1 
ATOM   7270  C C     . VAL B 1 307 ? -27.066 70.994  11.569  1.00 24.95 ? 307  VAL B C     1 
ATOM   7271  O O     . VAL B 1 307 ? -28.008 71.738  11.294  1.00 25.28 ? 307  VAL B O     1 
ATOM   7272  C CB    . VAL B 1 307 ? -24.771 72.217  11.212  1.00 24.79 ? 307  VAL B CB    1 
ATOM   7273  C CG1   . VAL B 1 307 ? -24.306 71.232  10.077  1.00 23.94 ? 307  VAL B CG1   1 
ATOM   7274  C CG2   . VAL B 1 307 ? -25.319 73.501  10.672  1.00 25.36 ? 307  VAL B CG2   1 
ATOM   7275  N N     . GLY B 1 308 ? -27.114 69.668  11.398  1.00 24.56 ? 308  GLY B N     1 
ATOM   7276  C CA    . GLY B 1 308 ? -28.283 68.969  10.831  1.00 24.20 ? 308  GLY B CA    1 
ATOM   7277  C C     . GLY B 1 308 ? -29.513 68.816  11.734  1.00 24.46 ? 308  GLY B C     1 
ATOM   7278  O O     . GLY B 1 308 ? -30.551 68.273  11.302  1.00 24.12 ? 308  GLY B O     1 
ATOM   7279  N N     . TRP B 1 309 ? -29.403 69.278  12.987  1.00 24.01 ? 309  TRP B N     1 
ATOM   7280  C CA    . TRP B 1 309 ? -30.546 69.289  13.888  1.00 23.86 ? 309  TRP B CA    1 
ATOM   7281  C C     . TRP B 1 309 ? -30.887 70.687  14.386  1.00 23.40 ? 309  TRP B C     1 
ATOM   7282  O O     . TRP B 1 309 ? -30.095 71.626  14.288  1.00 22.69 ? 309  TRP B O     1 
ATOM   7283  C CB    . TRP B 1 309 ? -30.357 68.328  15.066  1.00 24.10 ? 309  TRP B CB    1 
ATOM   7284  C CG    . TRP B 1 309 ? -29.919 66.956  14.680  1.00 23.57 ? 309  TRP B CG    1 
ATOM   7285  C CD1   . TRP B 1 309 ? -28.754 66.332  15.054  1.00 24.00 ? 309  TRP B CD1   1 
ATOM   7286  C CD2   . TRP B 1 309 ? -30.622 66.033  13.844  1.00 23.52 ? 309  TRP B CD2   1 
ATOM   7287  N NE1   . TRP B 1 309 ? -28.694 65.078  14.493  1.00 25.33 ? 309  TRP B NE1   1 
ATOM   7288  C CE2   . TRP B 1 309 ? -29.833 64.866  13.754  1.00 24.44 ? 309  TRP B CE2   1 
ATOM   7289  C CE3   . TRP B 1 309 ? -31.858 66.064  13.184  1.00 25.35 ? 309  TRP B CE3   1 
ATOM   7290  C CZ2   . TRP B 1 309 ? -30.239 63.741  13.023  1.00 24.35 ? 309  TRP B CZ2   1 
ATOM   7291  C CZ3   . TRP B 1 309 ? -32.254 64.946  12.437  1.00 25.03 ? 309  TRP B CZ3   1 
ATOM   7292  C CH2   . TRP B 1 309 ? -31.441 63.802  12.363  1.00 23.48 ? 309  TRP B CH2   1 
ATOM   7293  N N     . VAL B 1 310 ? -32.095 70.801  14.915  1.00 23.16 ? 310  VAL B N     1 
ATOM   7294  C CA    . VAL B 1 310 ? -32.638 72.082  15.380  1.00 22.71 ? 310  VAL B CA    1 
ATOM   7295  C C     . VAL B 1 310 ? -31.692 72.781  16.378  1.00 22.87 ? 310  VAL B C     1 
ATOM   7296  O O     . VAL B 1 310 ? -31.568 74.006  16.355  1.00 21.98 ? 310  VAL B O     1 
ATOM   7297  C CB    . VAL B 1 310 ? -34.088 71.890  15.956  1.00 22.45 ? 310  VAL B CB    1 
ATOM   7298  C CG1   . VAL B 1 310 ? -34.075 71.044  17.224  1.00 21.44 ? 310  VAL B CG1   1 
ATOM   7299  C CG2   . VAL B 1 310 ? -34.796 73.231  16.167  1.00 21.41 ? 310  VAL B CG2   1 
ATOM   7300  N N     . THR B 1 311 ? -31.024 71.993  17.230  1.00 22.40 ? 311  THR B N     1 
ATOM   7301  C CA    . THR B 1 311 ? -30.131 72.559  18.239  1.00 22.65 ? 311  THR B CA    1 
ATOM   7302  C C     . THR B 1 311 ? -28.965 73.262  17.563  1.00 23.15 ? 311  THR B C     1 
ATOM   7303  O O     . THR B 1 311 ? -28.565 74.368  17.991  1.00 22.93 ? 311  THR B O     1 
ATOM   7304  C CB    . THR B 1 311 ? -29.605 71.512  19.228  1.00 22.26 ? 311  THR B CB    1 
ATOM   7305  O OG1   . THR B 1 311 ? -30.709 70.742  19.723  1.00 19.87 ? 311  THR B OG1   1 
ATOM   7306  C CG2   . THR B 1 311 ? -28.868 72.199  20.380  1.00 22.13 ? 311  THR B CG2   1 
ATOM   7307  N N     . GLY B 1 312 ? -28.452 72.631  16.497  1.00 23.11 ? 312  GLY B N     1 
ATOM   7308  C CA    . GLY B 1 312 ? -27.447 73.252  15.620  1.00 23.03 ? 312  GLY B CA    1 
ATOM   7309  C C     . GLY B 1 312 ? -27.928 74.498  14.876  1.00 23.60 ? 312  GLY B C     1 
ATOM   7310  O O     . GLY B 1 312 ? -27.139 75.413  14.649  1.00 24.30 ? 312  GLY B O     1 
ATOM   7311  N N     . HIS B 1 313 ? -29.206 74.544  14.478  1.00 23.43 ? 313  HIS B N     1 
ATOM   7312  C CA    . HIS B 1 313 ? -29.771 75.731  13.785  1.00 23.52 ? 313  HIS B CA    1 
ATOM   7313  C C     . HIS B 1 313 ? -29.847 76.905  14.741  1.00 23.62 ? 313  HIS B C     1 
ATOM   7314  O O     . HIS B 1 313 ? -29.282 77.982  14.478  1.00 23.71 ? 313  HIS B O     1 
ATOM   7315  C CB    . HIS B 1 313 ? -31.183 75.480  13.217  1.00 23.34 ? 313  HIS B CB    1 
ATOM   7316  C CG    . HIS B 1 313 ? -31.224 74.650  11.970  1.00 23.55 ? 313  HIS B CG    1 
ATOM   7317  N ND1   . HIS B 1 313 ? -30.445 73.527  11.787  1.00 25.12 ? 313  HIS B ND1   1 
ATOM   7318  C CD2   . HIS B 1 313 ? -31.999 74.751  10.861  1.00 25.66 ? 313  HIS B CD2   1 
ATOM   7319  C CE1   . HIS B 1 313 ? -30.722 72.983  10.613  1.00 26.00 ? 313  HIS B CE1   1 
ATOM   7320  N NE2   . HIS B 1 313 ? -31.666 73.705  10.031  1.00 26.51 ? 313  HIS B NE2   1 
ATOM   7321  N N     . SER B 1 314 ? -30.525 76.672  15.863  1.00 23.75 ? 314  SER B N     1 
ATOM   7322  C CA    . SER B 1 314 ? -30.794 77.693  16.850  1.00 24.18 ? 314  SER B CA    1 
ATOM   7323  C C     . SER B 1 314 ? -29.608 78.100  17.726  1.00 24.63 ? 314  SER B C     1 
ATOM   7324  O O     . SER B 1 314 ? -29.452 79.291  18.047  1.00 24.37 ? 314  SER B O     1 
ATOM   7325  C CB    . SER B 1 314 ? -31.950 77.252  17.744  1.00 24.04 ? 314  SER B CB    1 
ATOM   7326  O OG    . SER B 1 314 ? -33.111 77.075  16.979  1.00 25.48 ? 314  SER B OG    1 
ATOM   7327  N N     . TYR B 1 315 ? -28.799 77.123  18.146  1.00 25.19 ? 315  TYR B N     1 
ATOM   7328  C CA    . TYR B 1 315 ? -27.854 77.379  19.251  1.00 26.09 ? 315  TYR B CA    1 
ATOM   7329  C C     . TYR B 1 315 ? -26.411 77.072  18.951  1.00 27.09 ? 315  TYR B C     1 
ATOM   7330  O O     . TYR B 1 315 ? -25.534 77.343  19.773  1.00 28.62 ? 315  TYR B O     1 
ATOM   7331  C CB    . TYR B 1 315 ? -28.308 76.735  20.575  1.00 25.37 ? 315  TYR B CB    1 
ATOM   7332  C CG    . TYR B 1 315 ? -29.668 77.218  21.011  1.00 24.50 ? 315  TYR B CG    1 
ATOM   7333  C CD1   . TYR B 1 315 ? -30.793 76.423  20.837  1.00 23.57 ? 315  TYR B CD1   1 
ATOM   7334  C CD2   . TYR B 1 315 ? -29.830 78.493  21.569  1.00 25.24 ? 315  TYR B CD2   1 
ATOM   7335  C CE1   . TYR B 1 315 ? -32.061 76.873  21.220  1.00 24.32 ? 315  TYR B CE1   1 
ATOM   7336  C CE2   . TYR B 1 315 ? -31.084 78.966  21.959  1.00 25.64 ? 315  TYR B CE2   1 
ATOM   7337  C CZ    . TYR B 1 315 ? -32.205 78.148  21.777  1.00 25.97 ? 315  TYR B CZ    1 
ATOM   7338  O OH    . TYR B 1 315 ? -33.453 78.595  22.175  1.00 25.01 ? 315  TYR B OH    1 
ATOM   7339  N N     . LEU B 1 316 ? -26.164 76.522  17.771  1.00 28.05 ? 316  LEU B N     1 
ATOM   7340  C CA    . LEU B 1 316 ? -24.821 76.500  17.208  1.00 27.98 ? 316  LEU B CA    1 
ATOM   7341  C C     . LEU B 1 316 ? -24.644 77.799  16.406  1.00 27.78 ? 316  LEU B C     1 
ATOM   7342  O O     . LEU B 1 316 ? -23.604 78.439  16.496  1.00 27.80 ? 316  LEU B O     1 
ATOM   7343  C CB    . LEU B 1 316 ? -24.648 75.237  16.349  1.00 28.11 ? 316  LEU B CB    1 
ATOM   7344  C CG    . LEU B 1 316 ? -23.389 74.625  15.711  1.00 29.04 ? 316  LEU B CG    1 
ATOM   7345  C CD1   . LEU B 1 316 ? -22.762 75.490  14.624  1.00 31.27 ? 316  LEU B CD1   1 
ATOM   7346  C CD2   . LEU B 1 316 ? -22.340 74.189  16.757  1.00 31.37 ? 316  LEU B CD2   1 
ATOM   7347  N N     . LEU B 1 317 ? -25.692 78.218  15.688  1.00 27.57 ? 317  LEU B N     1 
ATOM   7348  C CA    . LEU B 1 317 ? -25.586 79.311  14.693  1.00 27.50 ? 317  LEU B CA    1 
ATOM   7349  C C     . LEU B 1 317 ? -26.407 80.578  14.926  1.00 26.71 ? 317  LEU B C     1 
ATOM   7350  O O     . LEU B 1 317 ? -25.879 81.619  15.281  1.00 26.67 ? 317  LEU B O     1 
ATOM   7351  C CB    . LEU B 1 317 ? -25.931 78.788  13.291  1.00 27.92 ? 317  LEU B CB    1 
ATOM   7352  C CG    . LEU B 1 317 ? -24.852 78.330  12.306  1.00 29.26 ? 317  LEU B CG    1 
ATOM   7353  C CD1   . LEU B 1 317 ? -25.181 79.005  10.985  1.00 30.64 ? 317  LEU B CD1   1 
ATOM   7354  C CD2   . LEU B 1 317 ? -23.423 78.688  12.725  1.00 29.88 ? 317  LEU B CD2   1 
ATOM   7355  N N     . TYR B 1 318 ? -27.702 80.492  14.685  1.00 26.17 ? 318  TYR B N     1 
ATOM   7356  C CA    . TYR B 1 318 ? -28.555 81.683  14.627  1.00 25.73 ? 318  TYR B CA    1 
ATOM   7357  C C     . TYR B 1 318 ? -28.648 82.547  15.910  1.00 25.29 ? 318  TYR B C     1 
ATOM   7358  O O     . TYR B 1 318 ? -28.437 83.757  15.853  1.00 24.99 ? 318  TYR B O     1 
ATOM   7359  C CB    . TYR B 1 318 ? -29.924 81.300  14.058  1.00 25.66 ? 318  TYR B CB    1 
ATOM   7360  C CG    . TYR B 1 318 ? -29.844 80.848  12.607  1.00 25.09 ? 318  TYR B CG    1 
ATOM   7361  C CD1   . TYR B 1 318 ? -28.957 81.459  11.717  1.00 23.91 ? 318  TYR B CD1   1 
ATOM   7362  C CD2   . TYR B 1 318 ? -30.661 79.824  12.126  1.00 24.55 ? 318  TYR B CD2   1 
ATOM   7363  C CE1   . TYR B 1 318 ? -28.875 81.050  10.381  1.00 24.00 ? 318  TYR B CE1   1 
ATOM   7364  C CE2   . TYR B 1 318 ? -30.602 79.410  10.794  1.00 23.74 ? 318  TYR B CE2   1 
ATOM   7365  C CZ    . TYR B 1 318 ? -29.706 80.037  9.918   1.00 25.46 ? 318  TYR B CZ    1 
ATOM   7366  O OH    . TYR B 1 318 ? -29.637 79.644  8.585   1.00 24.71 ? 318  TYR B OH    1 
ATOM   7367  N N     . GLY B 1 319 ? -28.930 81.932  17.056  1.00 24.96 ? 319  GLY B N     1 
ATOM   7368  C CA    . GLY B 1 319 ? -28.883 82.638  18.347  1.00 24.32 ? 319  GLY B CA    1 
ATOM   7369  C C     . GLY B 1 319 ? -27.574 83.358  18.708  1.00 24.16 ? 319  GLY B C     1 
ATOM   7370  O O     . GLY B 1 319 ? -27.606 84.556  19.004  1.00 24.04 ? 319  GLY B O     1 
ATOM   7371  N N     . PRO B 1 320 ? -26.426 82.623  18.719  1.00 23.78 ? 320  PRO B N     1 
ATOM   7372  C CA    . PRO B 1 320 ? -25.101 83.171  18.947  1.00 23.45 ? 320  PRO B CA    1 
ATOM   7373  C C     . PRO B 1 320 ? -24.638 84.224  17.928  1.00 23.55 ? 320  PRO B C     1 
ATOM   7374  O O     . PRO B 1 320 ? -24.171 85.293  18.340  1.00 23.52 ? 320  PRO B O     1 
ATOM   7375  C CB    . PRO B 1 320 ? -24.188 81.937  18.900  1.00 23.50 ? 320  PRO B CB    1 
ATOM   7376  C CG    . PRO B 1 320 ? -25.068 80.784  19.160  1.00 24.11 ? 320  PRO B CG    1 
ATOM   7377  C CD    . PRO B 1 320 ? -26.370 81.159  18.549  1.00 24.29 ? 320  PRO B CD    1 
ATOM   7378  N N     . LEU B 1 321 ? -24.749 83.943  16.633  1.00 22.97 ? 321  LEU B N     1 
ATOM   7379  C CA    . LEU B 1 321 ? -24.342 84.922  15.637  1.00 23.19 ? 321  LEU B CA    1 
ATOM   7380  C C     . LEU B 1 321 ? -25.213 86.175  15.738  1.00 23.65 ? 321  LEU B C     1 
ATOM   7381  O O     . LEU B 1 321 ? -24.684 87.288  15.688  1.00 24.17 ? 321  LEU B O     1 
ATOM   7382  C CB    . LEU B 1 321 ? -24.309 84.351  14.199  1.00 22.71 ? 321  LEU B CB    1 
ATOM   7383  C CG    . LEU B 1 321 ? -23.345 83.191  13.868  1.00 22.52 ? 321  LEU B CG    1 
ATOM   7384  C CD1   . LEU B 1 321 ? -23.471 82.758  12.418  1.00 19.37 ? 321  LEU B CD1   1 
ATOM   7385  C CD2   . LEU B 1 321 ? -21.860 83.451  14.249  1.00 21.22 ? 321  LEU B CD2   1 
ATOM   7386  N N     . ALA B 1 322 ? -26.526 86.010  15.917  1.00 23.68 ? 322  ALA B N     1 
ATOM   7387  C CA    . ALA B 1 322 ? -27.408 87.165  16.173  1.00 23.96 ? 322  ALA B CA    1 
ATOM   7388  C C     . ALA B 1 322 ? -26.938 88.025  17.354  1.00 24.45 ? 322  ALA B C     1 
ATOM   7389  O O     . ALA B 1 322 ? -27.128 89.246  17.368  1.00 24.73 ? 322  ALA B O     1 
ATOM   7390  C CB    . ALA B 1 322 ? -28.825 86.723  16.413  1.00 23.49 ? 322  ALA B CB    1 
ATOM   7391  N N     . CYS B 1 323 ? -26.355 87.373  18.354  1.00 24.48 ? 323  CYS B N     1 
ATOM   7392  C CA    . CYS B 1 323 ? -25.925 88.051  19.545  1.00 24.64 ? 323  CYS B CA    1 
ATOM   7393  C C     . CYS B 1 323 ? -24.482 88.537  19.394  1.00 24.30 ? 323  CYS B C     1 
ATOM   7394  O O     . CYS B 1 323 ? -23.924 89.105  20.311  1.00 23.46 ? 323  CYS B O     1 
ATOM   7395  C CB    . CYS B 1 323 ? -26.125 87.150  20.772  1.00 24.53 ? 323  CYS B CB    1 
ATOM   7396  S SG    . CYS B 1 323 ? -27.891 87.028  21.304  1.00 27.52 ? 323  CYS B SG    1 
ATOM   7397  N N     . GLY B 1 324 ? -23.897 88.329  18.218  1.00 24.26 ? 324  GLY B N     1 
ATOM   7398  C CA    . GLY B 1 324 ? -22.512 88.697  17.993  1.00 24.73 ? 324  GLY B CA    1 
ATOM   7399  C C     . GLY B 1 324 ? -21.554 87.915  18.881  1.00 25.38 ? 324  GLY B C     1 
ATOM   7400  O O     . GLY B 1 324 ? -20.474 88.398  19.219  1.00 25.94 ? 324  GLY B O     1 
ATOM   7401  N N     . ALA B 1 325 ? -21.956 86.702  19.253  1.00 25.34 ? 325  ALA B N     1 
ATOM   7402  C CA    . ALA B 1 325 ? -21.138 85.797  20.036  1.00 25.34 ? 325  ALA B CA    1 
ATOM   7403  C C     . ALA B 1 325 ? -20.013 85.174  19.215  1.00 25.55 ? 325  ALA B C     1 
ATOM   7404  O O     . ALA B 1 325 ? -19.987 85.270  17.986  1.00 25.23 ? 325  ALA B O     1 
ATOM   7405  C CB    . ALA B 1 325 ? -22.013 84.694  20.643  1.00 24.82 ? 325  ALA B CB    1 
ATOM   7406  N N     . THR B 1 326 ? -19.072 84.552  19.922  1.00 25.79 ? 326  THR B N     1 
ATOM   7407  C CA    . THR B 1 326 ? -18.115 83.632  19.319  1.00 25.36 ? 326  THR B CA    1 
ATOM   7408  C C     . THR B 1 326 ? -18.624 82.234  19.625  1.00 25.31 ? 326  THR B C     1 
ATOM   7409  O O     . THR B 1 326 ? -18.688 81.813  20.796  1.00 24.25 ? 326  THR B O     1 
ATOM   7410  C CB    . THR B 1 326 ? -16.713 83.795  19.893  1.00 25.29 ? 326  THR B CB    1 
ATOM   7411  O OG1   . THR B 1 326 ? -16.275 85.123  19.640  1.00 25.46 ? 326  THR B OG1   1 
ATOM   7412  C CG2   . THR B 1 326 ? -15.745 82.825  19.233  1.00 25.32 ? 326  THR B CG2   1 
ATOM   7413  N N     . THR B 1 327 ? -19.008 81.547  18.552  1.00 25.26 ? 327  THR B N     1 
ATOM   7414  C CA    . THR B 1 327 ? -19.522 80.204  18.626  1.00 25.42 ? 327  THR B CA    1 
ATOM   7415  C C     . THR B 1 327 ? -18.485 79.270  18.003  1.00 25.51 ? 327  THR B C     1 
ATOM   7416  O O     . THR B 1 327 ? -17.803 79.641  17.039  1.00 26.06 ? 327  THR B O     1 
ATOM   7417  C CB    . THR B 1 327 ? -20.900 80.087  17.952  1.00 25.57 ? 327  THR B CB    1 
ATOM   7418  O OG1   . THR B 1 327 ? -21.429 78.768  18.171  1.00 27.06 ? 327  THR B OG1   1 
ATOM   7419  C CG2   . THR B 1 327 ? -20.813 80.357  16.471  1.00 24.25 ? 327  THR B CG2   1 
ATOM   7420  N N     . LEU B 1 328 ? -18.330 78.090  18.597  1.00 24.94 ? 328  LEU B N     1 
ATOM   7421  C CA    . LEU B 1 328 ? -17.350 77.116  18.158  1.00 24.60 ? 328  LEU B CA    1 
ATOM   7422  C C     . LEU B 1 328 ? -18.031 75.994  17.381  1.00 24.65 ? 328  LEU B C     1 
ATOM   7423  O O     . LEU B 1 328 ? -19.032 75.452  17.838  1.00 24.34 ? 328  LEU B O     1 
ATOM   7424  C CB    . LEU B 1 328 ? -16.615 76.546  19.370  1.00 23.63 ? 328  LEU B CB    1 
ATOM   7425  C CG    . LEU B 1 328 ? -15.344 75.688  19.211  1.00 23.82 ? 328  LEU B CG    1 
ATOM   7426  C CD1   . LEU B 1 328 ? -14.594 75.659  20.568  1.00 21.00 ? 328  LEU B CD1   1 
ATOM   7427  C CD2   . LEU B 1 328 ? -15.584 74.244  18.684  1.00 18.94 ? 328  LEU B CD2   1 
ATOM   7428  N N     . MET B 1 329 ? -17.481 75.644  16.219  1.00 25.15 ? 329  MET B N     1 
ATOM   7429  C CA    . MET B 1 329 ? -17.920 74.459  15.477  1.00 26.06 ? 329  MET B CA    1 
ATOM   7430  C C     . MET B 1 329 ? -16.856 73.343  15.429  1.00 25.52 ? 329  MET B C     1 
ATOM   7431  O O     . MET B 1 329 ? -15.757 73.521  14.866  1.00 25.50 ? 329  MET B O     1 
ATOM   7432  C CB    . MET B 1 329 ? -18.341 74.840  14.060  1.00 25.89 ? 329  MET B CB    1 
ATOM   7433  C CG    . MET B 1 329 ? -18.771 73.641  13.224  1.00 26.50 ? 329  MET B CG    1 
ATOM   7434  S SD    . MET B 1 329 ? -18.966 74.077  11.486  1.00 29.84 ? 329  MET B SD    1 
ATOM   7435  C CE    . MET B 1 329 ? -20.643 74.716  11.348  1.00 23.29 ? 329  MET B CE    1 
ATOM   7436  N N     . PHE B 1 330 ? -17.210 72.188  15.990  1.00 25.08 ? 330  PHE B N     1 
ATOM   7437  C CA    . PHE B 1 330 ? -16.317 71.023  16.078  1.00 24.51 ? 330  PHE B CA    1 
ATOM   7438  C C     . PHE B 1 330 ? -16.648 70.010  14.987  1.00 24.81 ? 330  PHE B C     1 
ATOM   7439  O O     . PHE B 1 330 ? -17.800 69.586  14.862  1.00 25.24 ? 330  PHE B O     1 
ATOM   7440  C CB    . PHE B 1 330 ? -16.441 70.380  17.468  1.00 23.43 ? 330  PHE B CB    1 
ATOM   7441  C CG    . PHE B 1 330 ? -15.578 69.167  17.681  1.00 22.01 ? 330  PHE B CG    1 
ATOM   7442  C CD1   . PHE B 1 330 ? -14.249 69.125  17.233  1.00 20.80 ? 330  PHE B CD1   1 
ATOM   7443  C CD2   . PHE B 1 330 ? -16.073 68.076  18.384  1.00 20.62 ? 330  PHE B CD2   1 
ATOM   7444  C CE1   . PHE B 1 330 ? -13.440 68.009  17.458  1.00 18.89 ? 330  PHE B CE1   1 
ATOM   7445  C CE2   . PHE B 1 330 ? -15.259 66.955  18.636  1.00 20.06 ? 330  PHE B CE2   1 
ATOM   7446  C CZ    . PHE B 1 330 ? -13.941 66.920  18.150  1.00 19.50 ? 330  PHE B CZ    1 
ATOM   7447  N N     . GLU B 1 331 ? -15.638 69.624  14.207  1.00 25.25 ? 331  GLU B N     1 
ATOM   7448  C CA    . GLU B 1 331 ? -15.819 68.668  13.112  1.00 25.17 ? 331  GLU B CA    1 
ATOM   7449  C C     . GLU B 1 331 ? -16.022 67.231  13.581  1.00 25.32 ? 331  GLU B C     1 
ATOM   7450  O O     . GLU B 1 331 ? -16.672 66.451  12.896  1.00 24.77 ? 331  GLU B O     1 
ATOM   7451  C CB    . GLU B 1 331 ? -14.626 68.712  12.163  1.00 25.93 ? 331  GLU B CB    1 
ATOM   7452  C CG    . GLU B 1 331 ? -14.841 67.884  10.868  1.00 26.08 ? 331  GLU B CG    1 
ATOM   7453  C CD    . GLU B 1 331 ? -13.652 67.872  9.957   1.00 25.43 ? 331  GLU B CD    1 
ATOM   7454  O OE1   . GLU B 1 331 ? -12.509 67.779  10.447  1.00 26.52 ? 331  GLU B OE1   1 
ATOM   7455  O OE2   . GLU B 1 331 ? -13.857 67.934  8.728   1.00 27.88 ? 331  GLU B OE2   1 
ATOM   7456  N N     . GLY B 1 332 ? -15.498 66.892  14.760  1.00 25.67 ? 332  GLY B N     1 
ATOM   7457  C CA    . GLY B 1 332 ? -15.399 65.498  15.183  1.00 26.29 ? 332  GLY B CA    1 
ATOM   7458  C C     . GLY B 1 332 ? -16.366 64.999  16.235  1.00 26.86 ? 332  GLY B C     1 
ATOM   7459  O O     . GLY B 1 332 ? -17.509 65.460  16.321  1.00 26.67 ? 332  GLY B O     1 
ATOM   7460  N N     . VAL B 1 333 ? -15.900 64.031  17.030  1.00 27.52 ? 333  VAL B N     1 
ATOM   7461  C CA    . VAL B 1 333 ? -16.669 63.487  18.179  1.00 27.83 ? 333  VAL B CA    1 
ATOM   7462  C C     . VAL B 1 333 ? -15.944 63.749  19.513  1.00 28.20 ? 333  VAL B C     1 
ATOM   7463  O O     . VAL B 1 333 ? -14.712 63.844  19.541  1.00 28.26 ? 333  VAL B O     1 
ATOM   7464  C CB    . VAL B 1 333 ? -16.932 61.973  18.039  1.00 27.79 ? 333  VAL B CB    1 
ATOM   7465  C CG1   . VAL B 1 333 ? -17.917 61.684  16.896  1.00 27.85 ? 333  VAL B CG1   1 
ATOM   7466  C CG2   . VAL B 1 333 ? -15.646 61.221  17.840  1.00 27.29 ? 333  VAL B CG2   1 
ATOM   7467  N N     . PRO B 1 334 ? -16.707 63.883  20.622  1.00 28.71 ? 334  PRO B N     1 
ATOM   7468  C CA    . PRO B 1 334 ? -16.161 64.204  21.973  1.00 28.59 ? 334  PRO B CA    1 
ATOM   7469  C C     . PRO B 1 334 ? -15.092 63.250  22.498  1.00 28.45 ? 334  PRO B C     1 
ATOM   7470  O O     . PRO B 1 334 ? -14.429 63.551  23.513  1.00 28.75 ? 334  PRO B O     1 
ATOM   7471  C CB    . PRO B 1 334 ? -17.395 64.114  22.883  1.00 28.57 ? 334  PRO B CB    1 
ATOM   7472  C CG    . PRO B 1 334 ? -18.430 63.342  22.049  1.00 29.07 ? 334  PRO B CG    1 
ATOM   7473  C CD    . PRO B 1 334 ? -18.176 63.759  20.651  1.00 28.18 ? 334  PRO B CD    1 
ATOM   7474  N N     . ASN B 1 335 ? -14.933 62.104  21.838  1.00 27.75 ? 335  ASN B N     1 
ATOM   7475  C CA    . ASN B 1 335 ? -14.113 61.041  22.404  1.00 27.37 ? 335  ASN B CA    1 
ATOM   7476  C C     . ASN B 1 335 ? -13.151 60.395  21.445  1.00 26.48 ? 335  ASN B C     1 
ATOM   7477  O O     . ASN B 1 335 ? -12.742 59.255  21.650  1.00 25.93 ? 335  ASN B O     1 
ATOM   7478  C CB    . ASN B 1 335 ? -14.984 59.971  23.069  1.00 27.67 ? 335  ASN B CB    1 
ATOM   7479  C CG    . ASN B 1 335 ? -15.929 59.291  22.104  1.00 28.95 ? 335  ASN B CG    1 
ATOM   7480  O OD1   . ASN B 1 335 ? -16.774 58.520  22.533  1.00 31.45 ? 335  ASN B OD1   1 
ATOM   7481  N ND2   . ASN B 1 335 ? -15.796 59.559  20.804  1.00 29.49 ? 335  ASN B ND2   1 
ATOM   7482  N N     . TRP B 1 336 ? -12.791 61.139  20.403  1.00 25.87 ? 336  TRP B N     1 
ATOM   7483  C CA    . TRP B 1 336 ? -11.778 60.690  19.454  1.00 24.84 ? 336  TRP B CA    1 
ATOM   7484  C C     . TRP B 1 336 ? -10.711 61.773  19.287  1.00 24.03 ? 336  TRP B C     1 
ATOM   7485  O O     . TRP B 1 336 ? -11.053 62.941  19.123  1.00 23.91 ? 336  TRP B O     1 
ATOM   7486  C CB    . TRP B 1 336 ? -12.411 60.298  18.111  1.00 24.17 ? 336  TRP B CB    1 
ATOM   7487  C CG    . TRP B 1 336 ? -11.522 59.401  17.322  1.00 23.54 ? 336  TRP B CG    1 
ATOM   7488  C CD1   . TRP B 1 336 ? -11.482 58.029  17.368  1.00 24.00 ? 336  TRP B CD1   1 
ATOM   7489  C CD2   . TRP B 1 336 ? -10.534 59.798  16.381  1.00 22.57 ? 336  TRP B CD2   1 
ATOM   7490  N NE1   . TRP B 1 336 ? -10.533 57.550  16.516  1.00 23.59 ? 336  TRP B NE1   1 
ATOM   7491  C CE2   . TRP B 1 336 ? -9.919  58.610  15.897  1.00 24.04 ? 336  TRP B CE2   1 
ATOM   7492  C CE3   . TRP B 1 336 ? -10.102 61.039  15.893  1.00 21.95 ? 336  TRP B CE3   1 
ATOM   7493  C CZ2   . TRP B 1 336 ? -8.879  58.623  14.943  1.00 23.53 ? 336  TRP B CZ2   1 
ATOM   7494  C CZ3   . TRP B 1 336 ? -9.052  61.053  14.948  1.00 25.21 ? 336  TRP B CZ3   1 
ATOM   7495  C CH2   . TRP B 1 336 ? -8.456  59.843  14.482  1.00 23.31 ? 336  TRP B CH2   1 
ATOM   7496  N N     . PRO B 1 337 ? -9.420  61.386  19.291  1.00 23.85 ? 337  PRO B N     1 
ATOM   7497  C CA    . PRO B 1 337 ? -8.873  60.008  19.463  1.00 23.61 ? 337  PRO B CA    1 
ATOM   7498  C C     . PRO B 1 337 ? -9.086  59.343  20.827  1.00 23.45 ? 337  PRO B C     1 
ATOM   7499  O O     . PRO B 1 337 ? -9.012  58.132  20.904  1.00 23.35 ? 337  PRO B O     1 
ATOM   7500  C CB    . PRO B 1 337 ? -7.369  60.180  19.172  1.00 23.13 ? 337  PRO B CB    1 
ATOM   7501  C CG    . PRO B 1 337 ? -7.272  61.436  18.394  1.00 22.95 ? 337  PRO B CG    1 
ATOM   7502  C CD    . PRO B 1 337 ? -8.342  62.341  18.969  1.00 23.79 ? 337  PRO B CD    1 
ATOM   7503  N N     . THR B 1 338 ? -9.367  60.131  21.868  1.00 23.51 ? 338  THR B N     1 
ATOM   7504  C CA    . THR B 1 338 ? -9.428  59.651  23.270  1.00 23.03 ? 338  THR B CA    1 
ATOM   7505  C C     . THR B 1 338 ? -10.601 60.289  24.035  1.00 22.74 ? 338  THR B C     1 
ATOM   7506  O O     . THR B 1 338 ? -11.057 61.369  23.664  1.00 22.81 ? 338  THR B O     1 
ATOM   7507  C CB    . THR B 1 338 ? -8.131  59.987  24.055  1.00 23.11 ? 338  THR B CB    1 
ATOM   7508  O OG1   . THR B 1 338 ? -8.036  61.405  24.239  1.00 22.30 ? 338  THR B OG1   1 
ATOM   7509  C CG2   . THR B 1 338 ? -6.849  59.431  23.355  1.00 23.22 ? 338  THR B CG2   1 
ATOM   7510  N N     . PRO B 1 339 ? -11.090 59.626  25.108  1.00 22.44 ? 339  PRO B N     1 
ATOM   7511  C CA    . PRO B 1 339 ? -12.217 60.177  25.884  1.00 22.55 ? 339  PRO B CA    1 
ATOM   7512  C C     . PRO B 1 339 ? -12.064 61.642  26.324  1.00 22.40 ? 339  PRO B C     1 
ATOM   7513  O O     . PRO B 1 339 ? -13.080 62.339  26.473  1.00 22.26 ? 339  PRO B O     1 
ATOM   7514  C CB    . PRO B 1 339 ? -12.294 59.252  27.112  1.00 22.51 ? 339  PRO B CB    1 
ATOM   7515  C CG    . PRO B 1 339 ? -11.732 57.986  26.654  1.00 22.09 ? 339  PRO B CG    1 
ATOM   7516  C CD    . PRO B 1 339 ? -10.652 58.324  25.654  1.00 22.39 ? 339  PRO B CD    1 
ATOM   7517  N N     . ALA B 1 340 ? -10.822 62.103  26.509  1.00 22.18 ? 340  ALA B N     1 
ATOM   7518  C CA    . ALA B 1 340 ? -10.572 63.487  26.958  1.00 22.17 ? 340  ALA B CA    1 
ATOM   7519  C C     . ALA B 1 340 ? -10.756 64.559  25.865  1.00 21.84 ? 340  ALA B C     1 
ATOM   7520  O O     . ALA B 1 340 ? -10.638 65.742  26.146  1.00 21.73 ? 340  ALA B O     1 
ATOM   7521  C CB    . ALA B 1 340 ? -9.200  63.611  27.600  1.00 21.74 ? 340  ALA B CB    1 
ATOM   7522  N N     . ARG B 1 341 ? -11.054 64.150  24.637  1.00 21.68 ? 341  ARG B N     1 
ATOM   7523  C CA    . ARG B 1 341 ? -11.079 65.089  23.523  1.00 22.15 ? 341  ARG B CA    1 
ATOM   7524  C C     . ARG B 1 341 ? -11.915 66.345  23.751  1.00 22.55 ? 341  ARG B C     1 
ATOM   7525  O O     . ARG B 1 341 ? -11.423 67.451  23.507  1.00 22.68 ? 341  ARG B O     1 
ATOM   7526  C CB    . ARG B 1 341 ? -11.501 64.435  22.213  1.00 22.08 ? 341  ARG B CB    1 
ATOM   7527  C CG    . ARG B 1 341 ? -11.478 65.445  21.042  1.00 22.86 ? 341  ARG B CG    1 
ATOM   7528  C CD    . ARG B 1 341 ? -10.039 65.895  20.727  1.00 23.03 ? 341  ARG B CD    1 
ATOM   7529  N NE    . ARG B 1 341 ? -9.974  66.904  19.663  1.00 23.69 ? 341  ARG B NE    1 
ATOM   7530  C CZ    . ARG B 1 341 ? -10.064 66.637  18.356  1.00 24.69 ? 341  ARG B CZ    1 
ATOM   7531  N NH1   . ARG B 1 341 ? -10.237 65.380  17.927  1.00 23.18 ? 341  ARG B NH1   1 
ATOM   7532  N NH2   . ARG B 1 341 ? -9.978  67.626  17.468  1.00 24.30 ? 341  ARG B NH2   1 
ATOM   7533  N N     . MET B 1 342 ? -13.161 66.176  24.209  1.00 22.58 ? 342  MET B N     1 
ATOM   7534  C CA    . MET B 1 342 ? -14.042 67.303  24.472  1.00 22.82 ? 342  MET B CA    1 
ATOM   7535  C C     . MET B 1 342 ? -13.362 68.317  25.370  1.00 22.90 ? 342  MET B C     1 
ATOM   7536  O O     . MET B 1 342 ? -13.351 69.512  25.073  1.00 23.22 ? 342  MET B O     1 
ATOM   7537  C CB    . MET B 1 342 ? -15.336 66.852  25.134  1.00 22.68 ? 342  MET B CB    1 
ATOM   7538  C CG    . MET B 1 342 ? -16.334 68.001  25.365  1.00 22.71 ? 342  MET B CG    1 
ATOM   7539  S SD    . MET B 1 342 ? -17.960 67.500  26.016  1.00 24.02 ? 342  MET B SD    1 
ATOM   7540  C CE    . MET B 1 342 ? -17.552 67.185  27.742  1.00 22.47 ? 342  MET B CE    1 
ATOM   7541  N N     . CYS B 1 343 ? -12.801 67.845  26.477  1.00 23.06 ? 343  CYS B N     1 
ATOM   7542  C CA    . CYS B 1 343 ? -12.142 68.751  27.403  1.00 23.32 ? 343  CYS B CA    1 
ATOM   7543  C C     . CYS B 1 343 ? -10.864 69.320  26.821  1.00 23.08 ? 343  CYS B C     1 
ATOM   7544  O O     . CYS B 1 343 ? -10.502 70.453  27.125  1.00 23.21 ? 343  CYS B O     1 
ATOM   7545  C CB    . CYS B 1 343 ? -11.922 68.086  28.758  1.00 23.82 ? 343  CYS B CB    1 
ATOM   7546  S SG    . CYS B 1 343 ? -13.496 67.797  29.639  1.00 23.75 ? 343  CYS B SG    1 
ATOM   7547  N N     . GLN B 1 344 ? -10.215 68.561  25.948  1.00 23.14 ? 344  GLN B N     1 
ATOM   7548  C CA    . GLN B 1 344 ? -9.093  69.095  25.179  1.00 23.89 ? 344  GLN B CA    1 
ATOM   7549  C C     . GLN B 1 344 ? -9.494  70.313  24.314  1.00 24.31 ? 344  GLN B C     1 
ATOM   7550  O O     . GLN B 1 344 ? -8.786  71.348  24.333  1.00 25.10 ? 344  GLN B O     1 
ATOM   7551  C CB    . GLN B 1 344 ? -8.392  68.013  24.350  1.00 23.51 ? 344  GLN B CB    1 
ATOM   7552  C CG    . GLN B 1 344 ? -7.415  67.190  25.164  1.00 22.05 ? 344  GLN B CG    1 
ATOM   7553  C CD    . GLN B 1 344 ? -7.020  65.862  24.516  1.00 21.01 ? 344  GLN B CD    1 
ATOM   7554  O OE1   . GLN B 1 344 ? -6.449  65.005  25.174  1.00 20.88 ? 344  GLN B OE1   1 
ATOM   7555  N NE2   . GLN B 1 344 ? -7.334  65.687  23.240  1.00 21.11 ? 344  GLN B NE2   1 
ATOM   7556  N N     . VAL B 1 345 ? -10.628 70.217  23.611  1.00 24.02 ? 345  VAL B N     1 
ATOM   7557  C CA    . VAL B 1 345 ? -11.148 71.368  22.847  1.00 24.08 ? 345  VAL B CA    1 
ATOM   7558  C C     . VAL B 1 345 ? -11.414 72.555  23.792  1.00 23.88 ? 345  VAL B C     1 
ATOM   7559  O O     . VAL B 1 345 ? -11.097 73.716  23.464  1.00 23.09 ? 345  VAL B O     1 
ATOM   7560  C CB    . VAL B 1 345 ? -12.418 71.034  21.994  1.00 24.09 ? 345  VAL B CB    1 
ATOM   7561  C CG1   . VAL B 1 345 ? -12.775 72.193  21.104  1.00 24.41 ? 345  VAL B CG1   1 
ATOM   7562  C CG2   . VAL B 1 345 ? -12.200 69.833  21.121  1.00 23.97 ? 345  VAL B CG2   1 
ATOM   7563  N N     . VAL B 1 346 ? -11.969 72.240  24.969  1.00 23.76 ? 346  VAL B N     1 
ATOM   7564  C CA    . VAL B 1 346 ? -12.291 73.235  26.001  1.00 23.56 ? 346  VAL B CA    1 
ATOM   7565  C C     . VAL B 1 346 ? -11.035 74.019  26.406  1.00 23.66 ? 346  VAL B C     1 
ATOM   7566  O O     . VAL B 1 346 ? -11.048 75.246  26.437  1.00 23.21 ? 346  VAL B O     1 
ATOM   7567  C CB    . VAL B 1 346 ? -13.003 72.580  27.255  1.00 23.62 ? 346  VAL B CB    1 
ATOM   7568  C CG1   . VAL B 1 346 ? -13.082 73.527  28.435  1.00 21.43 ? 346  VAL B CG1   1 
ATOM   7569  C CG2   . VAL B 1 346 ? -14.402 72.053  26.880  1.00 23.89 ? 346  VAL B CG2   1 
ATOM   7570  N N     . ASP B 1 347 ? -9.948  73.309  26.682  1.00 23.82 ? 347  ASP B N     1 
ATOM   7571  C CA    . ASP B 1 347 ? -8.704  73.984  27.052  1.00 24.40 ? 347  ASP B CA    1 
ATOM   7572  C C     . ASP B 1 347 ? -8.089  74.776  25.892  1.00 24.30 ? 347  ASP B C     1 
ATOM   7573  O O     . ASP B 1 347 ? -7.641  75.895  26.079  1.00 24.56 ? 347  ASP B O     1 
ATOM   7574  C CB    . ASP B 1 347 ? -7.701  72.976  27.614  1.00 24.56 ? 347  ASP B CB    1 
ATOM   7575  C CG    . ASP B 1 347 ? -8.068  72.514  29.011  1.00 24.77 ? 347  ASP B CG    1 
ATOM   7576  O OD1   . ASP B 1 347 ? -8.985  73.117  29.608  1.00 24.71 ? 347  ASP B OD1   1 
ATOM   7577  O OD2   . ASP B 1 347 ? -7.431  71.559  29.509  1.00 24.95 ? 347  ASP B OD2   1 
ATOM   7578  N N     . LYS B 1 348 ? -8.092  74.185  24.701  1.00 24.22 ? 348  LYS B N     1 
ATOM   7579  C CA    . LYS B 1 348 ? -7.475  74.776  23.530  1.00 24.35 ? 348  LYS B CA    1 
ATOM   7580  C C     . LYS B 1 348 ? -8.122  76.114  23.150  1.00 24.48 ? 348  LYS B C     1 
ATOM   7581  O O     . LYS B 1 348 ? -7.430  77.104  22.898  1.00 24.92 ? 348  LYS B O     1 
ATOM   7582  C CB    . LYS B 1 348 ? -7.529  73.785  22.363  1.00 24.39 ? 348  LYS B CB    1 
ATOM   7583  C CG    . LYS B 1 348 ? -6.875  74.272  21.085  1.00 24.87 ? 348  LYS B CG    1 
ATOM   7584  C CD    . LYS B 1 348 ? -6.737  73.143  20.067  1.00 26.74 ? 348  LYS B CD    1 
ATOM   7585  C CE    . LYS B 1 348 ? -6.113  73.644  18.754  1.00 27.90 ? 348  LYS B CE    1 
ATOM   7586  N NZ    . LYS B 1 348 ? -6.582  72.840  17.591  1.00 29.87 ? 348  LYS B NZ    1 
ATOM   7587  N N     . HIS B 1 349 ? -9.444  76.142  23.118  1.00 24.08 ? 349  HIS B N     1 
ATOM   7588  C CA    . HIS B 1 349 ? -10.164 77.340  22.721  1.00 23.78 ? 349  HIS B CA    1 
ATOM   7589  C C     . HIS B 1 349 ? -10.713 78.153  23.879  1.00 23.01 ? 349  HIS B C     1 
ATOM   7590  O O     . HIS B 1 349 ? -11.376 79.171  23.679  1.00 22.83 ? 349  HIS B O     1 
ATOM   7591  C CB    . HIS B 1 349 ? -11.232 76.962  21.700  1.00 23.71 ? 349  HIS B CB    1 
ATOM   7592  C CG    . HIS B 1 349 ? -10.644 76.305  20.485  1.00 25.59 ? 349  HIS B CG    1 
ATOM   7593  N ND1   . HIS B 1 349 ? -9.680  76.919  19.706  1.00 24.12 ? 349  HIS B ND1   1 
ATOM   7594  C CD2   . HIS B 1 349 ? -10.838 75.073  19.949  1.00 24.25 ? 349  HIS B CD2   1 
ATOM   7595  C CE1   . HIS B 1 349 ? -9.319  76.097  18.737  1.00 25.64 ? 349  HIS B CE1   1 
ATOM   7596  N NE2   . HIS B 1 349 ? -10.005 74.971  18.865  1.00 26.07 ? 349  HIS B NE2   1 
ATOM   7597  N N     . GLN B 1 350 ? -10.399 77.707  25.090  1.00 22.76 ? 350  GLN B N     1 
ATOM   7598  C CA    . GLN B 1 350 ? -10.756 78.416  26.305  1.00 22.55 ? 350  GLN B CA    1 
ATOM   7599  C C     . GLN B 1 350 ? -12.263 78.644  26.351  1.00 22.41 ? 350  GLN B C     1 
ATOM   7600  O O     . GLN B 1 350 ? -12.734 79.761  26.599  1.00 23.00 ? 350  GLN B O     1 
ATOM   7601  C CB    . GLN B 1 350 ? -9.972  79.729  26.410  1.00 22.44 ? 350  GLN B CB    1 
ATOM   7602  C CG    . GLN B 1 350 ? -8.480  79.537  26.705  1.00 23.60 ? 350  GLN B CG    1 
ATOM   7603  C CD    . GLN B 1 350 ? -8.194  79.160  28.182  1.00 25.21 ? 350  GLN B CD    1 
ATOM   7604  O OE1   . GLN B 1 350 ? -7.748  78.044  28.462  1.00 25.54 ? 350  GLN B OE1   1 
ATOM   7605  N NE2   . GLN B 1 350 ? -8.451  80.093  29.116  1.00 22.41 ? 350  GLN B NE2   1 
ATOM   7606  N N     . VAL B 1 351 ? -13.012 77.567  26.114  1.00 21.77 ? 351  VAL B N     1 
ATOM   7607  C CA    . VAL B 1 351 ? -14.473 77.593  26.173  1.00 21.35 ? 351  VAL B CA    1 
ATOM   7608  C C     . VAL B 1 351 ? -14.992 78.071  27.541  1.00 21.40 ? 351  VAL B C     1 
ATOM   7609  O O     . VAL B 1 351 ? -14.542 77.586  28.585  1.00 21.41 ? 351  VAL B O     1 
ATOM   7610  C CB    . VAL B 1 351 ? -15.061 76.206  25.834  1.00 21.13 ? 351  VAL B CB    1 
ATOM   7611  C CG1   . VAL B 1 351 ? -16.584 76.234  25.932  1.00 20.65 ? 351  VAL B CG1   1 
ATOM   7612  C CG2   . VAL B 1 351 ? -14.624 75.792  24.445  1.00 20.37 ? 351  VAL B CG2   1 
ATOM   7613  N N     . ASN B 1 352 ? -15.919 79.031  27.521  1.00 21.30 ? 352  ASN B N     1 
ATOM   7614  C CA    . ASN B 1 352 ? -16.564 79.538  28.740  1.00 21.25 ? 352  ASN B CA    1 
ATOM   7615  C C     . ASN B 1 352 ? -17.933 78.925  29.003  1.00 21.84 ? 352  ASN B C     1 
ATOM   7616  O O     . ASN B 1 352 ? -18.383 78.867  30.145  1.00 22.39 ? 352  ASN B O     1 
ATOM   7617  C CB    . ASN B 1 352 ? -16.668 81.061  28.700  1.00 20.42 ? 352  ASN B CB    1 
ATOM   7618  C CG    . ASN B 1 352 ? -15.312 81.725  28.522  1.00 20.54 ? 352  ASN B CG    1 
ATOM   7619  O OD1   . ASN B 1 352 ? -15.103 82.517  27.591  1.00 20.35 ? 352  ASN B OD1   1 
ATOM   7620  N ND2   . ASN B 1 352 ? -14.367 81.377  29.394  1.00 16.75 ? 352  ASN B ND2   1 
ATOM   7621  N N     . ILE B 1 353 ? -18.579 78.452  27.943  1.00 22.59 ? 353  ILE B N     1 
ATOM   7622  C CA    . ILE B 1 353 ? -19.945 77.941  28.007  1.00 23.02 ? 353  ILE B CA    1 
ATOM   7623  C C     . ILE B 1 353 ? -20.017 76.651  27.187  1.00 23.51 ? 353  ILE B C     1 
ATOM   7624  O O     . ILE B 1 353 ? -19.739 76.666  25.994  1.00 23.34 ? 353  ILE B O     1 
ATOM   7625  C CB    . ILE B 1 353 ? -20.981 78.957  27.427  1.00 22.80 ? 353  ILE B CB    1 
ATOM   7626  C CG1   . ILE B 1 353 ? -20.863 80.331  28.088  1.00 22.46 ? 353  ILE B CG1   1 
ATOM   7627  C CG2   . ILE B 1 353 ? -22.396 78.401  27.551  1.00 21.94 ? 353  ILE B CG2   1 
ATOM   7628  C CD1   . ILE B 1 353 ? -21.508 81.468  27.277  1.00 23.50 ? 353  ILE B CD1   1 
ATOM   7629  N N     . LEU B 1 354 ? -20.384 75.541  27.831  1.00 23.86 ? 354  LEU B N     1 
ATOM   7630  C CA    . LEU B 1 354 ? -20.436 74.261  27.148  1.00 23.52 ? 354  LEU B CA    1 
ATOM   7631  C C     . LEU B 1 354 ? -21.855 73.714  27.157  1.00 23.68 ? 354  LEU B C     1 
ATOM   7632  O O     . LEU B 1 354 ? -22.508 73.620  28.195  1.00 23.62 ? 354  LEU B O     1 
ATOM   7633  C CB    . LEU B 1 354 ? -19.449 73.262  27.743  1.00 23.50 ? 354  LEU B CB    1 
ATOM   7634  C CG    . LEU B 1 354 ? -19.461 71.831  27.153  1.00 24.37 ? 354  LEU B CG    1 
ATOM   7635  C CD1   . LEU B 1 354 ? -19.225 71.784  25.593  1.00 20.91 ? 354  LEU B CD1   1 
ATOM   7636  C CD2   . LEU B 1 354 ? -18.465 70.919  27.930  1.00 22.69 ? 354  LEU B CD2   1 
ATOM   7637  N N     . TYR B 1 355 ? -22.322 73.360  25.968  1.00 23.27 ? 355  TYR B N     1 
ATOM   7638  C CA    . TYR B 1 355 ? -23.700 72.982  25.791  1.00 22.65 ? 355  TYR B CA    1 
ATOM   7639  C C     . TYR B 1 355 ? -23.720 71.694  24.983  1.00 22.60 ? 355  TYR B C     1 
ATOM   7640  O O     . TYR B 1 355 ? -23.384 71.688  23.791  1.00 22.67 ? 355  TYR B O     1 
ATOM   7641  C CB    . TYR B 1 355 ? -24.431 74.109  25.078  1.00 22.62 ? 355  TYR B CB    1 
ATOM   7642  C CG    . TYR B 1 355 ? -25.895 73.885  24.873  1.00 22.89 ? 355  TYR B CG    1 
ATOM   7643  C CD1   . TYR B 1 355 ? -26.693 73.318  25.877  1.00 23.00 ? 355  TYR B CD1   1 
ATOM   7644  C CD2   . TYR B 1 355 ? -26.509 74.287  23.689  1.00 23.09 ? 355  TYR B CD2   1 
ATOM   7645  C CE1   . TYR B 1 355 ? -28.064 73.140  25.691  1.00 22.85 ? 355  TYR B CE1   1 
ATOM   7646  C CE2   . TYR B 1 355 ? -27.886 74.105  23.496  1.00 23.20 ? 355  TYR B CE2   1 
ATOM   7647  C CZ    . TYR B 1 355 ? -28.640 73.534  24.503  1.00 22.58 ? 355  TYR B CZ    1 
ATOM   7648  O OH    . TYR B 1 355 ? -29.980 73.341  24.306  1.00 24.28 ? 355  TYR B OH    1 
ATOM   7649  N N     . THR B 1 356 ? -24.100 70.602  25.645  1.00 21.67 ? 356  THR B N     1 
ATOM   7650  C CA    . THR B 1 356 ? -24.062 69.301  25.014  1.00 20.60 ? 356  THR B CA    1 
ATOM   7651  C C     . THR B 1 356 ? -25.251 68.379  25.398  1.00 20.87 ? 356  THR B C     1 
ATOM   7652  O O     . THR B 1 356 ? -26.290 68.847  25.862  1.00 20.19 ? 356  THR B O     1 
ATOM   7653  C CB    . THR B 1 356 ? -22.626 68.643  25.176  1.00 20.89 ? 356  THR B CB    1 
ATOM   7654  O OG1   . THR B 1 356 ? -22.471 67.565  24.229  1.00 19.95 ? 356  THR B OG1   1 
ATOM   7655  C CG2   . THR B 1 356 ? -22.330 68.192  26.617  1.00 17.61 ? 356  THR B CG2   1 
ATOM   7656  N N     . ALA B 1 357 ? -25.083 67.071  25.197  1.00 21.25 ? 357  ALA B N     1 
ATOM   7657  C CA    . ALA B 1 357 ? -26.194 66.117  25.266  1.00 21.43 ? 357  ALA B CA    1 
ATOM   7658  C C     . ALA B 1 357 ? -25.905 64.997  26.267  1.00 21.25 ? 357  ALA B C     1 
ATOM   7659  O O     . ALA B 1 357 ? -24.748 64.547  26.380  1.00 21.52 ? 357  ALA B O     1 
ATOM   7660  C CB    . ALA B 1 357 ? -26.477 65.531  23.846  1.00 21.16 ? 357  ALA B CB    1 
ATOM   7661  N N     . PRO B 1 358 ? -26.934 64.559  27.024  1.00 21.17 ? 358  PRO B N     1 
ATOM   7662  C CA    . PRO B 1 358 ? -26.773 63.410  27.947  1.00 21.24 ? 358  PRO B CA    1 
ATOM   7663  C C     . PRO B 1 358 ? -26.115 62.142  27.350  1.00 21.51 ? 358  PRO B C     1 
ATOM   7664  O O     . PRO B 1 358 ? -25.350 61.475  28.042  1.00 22.00 ? 358  PRO B O     1 
ATOM   7665  C CB    . PRO B 1 358 ? -28.200 63.170  28.441  1.00 20.80 ? 358  PRO B CB    1 
ATOM   7666  C CG    . PRO B 1 358 ? -28.804 64.591  28.454  1.00 19.97 ? 358  PRO B CG    1 
ATOM   7667  C CD    . PRO B 1 358 ? -28.275 65.162  27.147  1.00 21.36 ? 358  PRO B CD    1 
ATOM   7668  N N     . THR B 1 359 ? -26.379 61.825  26.088  1.00 21.87 ? 359  THR B N     1 
ATOM   7669  C CA    . THR B 1 359 ? -25.716 60.685  25.441  1.00 22.72 ? 359  THR B CA    1 
ATOM   7670  C C     . THR B 1 359 ? -24.178 60.819  25.445  1.00 23.05 ? 359  THR B C     1 
ATOM   7671  O O     . THR B 1 359 ? -23.462 59.872  25.824  1.00 23.20 ? 359  THR B O     1 
ATOM   7672  C CB    . THR B 1 359 ? -26.288 60.435  24.001  1.00 23.23 ? 359  THR B CB    1 
ATOM   7673  O OG1   . THR B 1 359 ? -27.605 59.899  24.142  1.00 22.99 ? 359  THR B OG1   1 
ATOM   7674  C CG2   . THR B 1 359 ? -25.438 59.423  23.216  1.00 22.25 ? 359  THR B CG2   1 
ATOM   7675  N N     . ALA B 1 360 ? -23.694 61.999  25.039  1.00 22.94 ? 360  ALA B N     1 
ATOM   7676  C CA    . ALA B 1 360 ? -22.275 62.363  25.140  1.00 22.73 ? 360  ALA B CA    1 
ATOM   7677  C C     . ALA B 1 360 ? -21.750 62.293  26.605  1.00 22.94 ? 360  ALA B C     1 
ATOM   7678  O O     . ALA B 1 360 ? -20.700 61.683  26.864  1.00 22.97 ? 360  ALA B O     1 
ATOM   7679  C CB    . ALA B 1 360 ? -22.012 63.752  24.498  1.00 21.31 ? 360  ALA B CB    1 
ATOM   7680  N N     . ILE B 1 361 ? -22.493 62.883  27.548  1.00 22.70 ? 361  ILE B N     1 
ATOM   7681  C CA    . ILE B 1 361 ? -22.125 62.851  28.968  1.00 22.39 ? 361  ILE B CA    1 
ATOM   7682  C C     . ILE B 1 361 ? -22.021 61.416  29.510  1.00 22.68 ? 361  ILE B C     1 
ATOM   7683  O O     . ILE B 1 361 ? -21.030 61.077  30.175  1.00 22.44 ? 361  ILE B O     1 
ATOM   7684  C CB    . ILE B 1 361 ? -23.131 63.644  29.830  1.00 22.90 ? 361  ILE B CB    1 
ATOM   7685  C CG1   . ILE B 1 361 ? -23.067 65.142  29.511  1.00 21.85 ? 361  ILE B CG1   1 
ATOM   7686  C CG2   . ILE B 1 361 ? -22.957 63.337  31.357  1.00 22.54 ? 361  ILE B CG2   1 
ATOM   7687  C CD1   . ILE B 1 361 ? -24.239 65.943  30.124  1.00 22.14 ? 361  ILE B CD1   1 
ATOM   7688  N N     . ARG B 1 362 ? -23.024 60.578  29.227  1.00 22.40 ? 362  ARG B N     1 
ATOM   7689  C CA    . ARG B 1 362 ? -22.977 59.175  29.683  1.00 23.04 ? 362  ARG B CA    1 
ATOM   7690  C C     . ARG B 1 362 ? -21.763 58.439  29.104  1.00 23.18 ? 362  ARG B C     1 
ATOM   7691  O O     . ARG B 1 362 ? -21.189 57.580  29.765  1.00 22.62 ? 362  ARG B O     1 
ATOM   7692  C CB    . ARG B 1 362 ? -24.263 58.410  29.349  1.00 22.62 ? 362  ARG B CB    1 
ATOM   7693  C CG    . ARG B 1 362 ? -25.489 58.859  30.164  1.00 25.41 ? 362  ARG B CG    1 
ATOM   7694  C CD    . ARG B 1 362 ? -26.700 57.969  29.944  1.00 22.89 ? 362  ARG B CD    1 
ATOM   7695  N NE    . ARG B 1 362 ? -27.011 57.846  28.521  1.00 25.45 ? 362  ARG B NE    1 
ATOM   7696  C CZ    . ARG B 1 362 ? -27.929 58.572  27.885  1.00 23.70 ? 362  ARG B CZ    1 
ATOM   7697  N NH1   . ARG B 1 362 ? -28.614 59.502  28.549  1.00 23.04 ? 362  ARG B NH1   1 
ATOM   7698  N NH2   . ARG B 1 362 ? -28.151 58.373  26.590  1.00 21.42 ? 362  ARG B NH2   1 
ATOM   7699  N N     . ALA B 1 363 ? -21.385 58.789  27.873  1.00 23.54 ? 363  ALA B N     1 
ATOM   7700  C CA    . ALA B 1 363 ? -20.320 58.081  27.198  1.00 24.79 ? 363  ALA B CA    1 
ATOM   7701  C C     . ALA B 1 363 ? -18.972 58.451  27.818  1.00 25.63 ? 363  ALA B C     1 
ATOM   7702  O O     . ALA B 1 363 ? -18.104 57.574  27.983  1.00 26.09 ? 363  ALA B O     1 
ATOM   7703  C CB    . ALA B 1 363 ? -20.337 58.350  25.695  1.00 24.20 ? 363  ALA B CB    1 
ATOM   7704  N N     . LEU B 1 364 ? -18.817 59.740  28.161  1.00 26.12 ? 364  LEU B N     1 
ATOM   7705  C CA    . LEU B 1 364 ? -17.658 60.242  28.896  1.00 25.95 ? 364  LEU B CA    1 
ATOM   7706  C C     . LEU B 1 364 ? -17.649 59.617  30.272  1.00 26.06 ? 364  LEU B C     1 
ATOM   7707  O O     . LEU B 1 364 ? -16.647 59.040  30.685  1.00 25.83 ? 364  LEU B O     1 
ATOM   7708  C CB    . LEU B 1 364 ? -17.700 61.770  29.022  1.00 25.91 ? 364  LEU B CB    1 
ATOM   7709  C CG    . LEU B 1 364 ? -17.716 62.549  27.700  1.00 27.78 ? 364  LEU B CG    1 
ATOM   7710  C CD1   . LEU B 1 364 ? -18.025 64.009  27.929  1.00 28.59 ? 364  LEU B CD1   1 
ATOM   7711  C CD2   . LEU B 1 364 ? -16.435 62.348  26.879  1.00 28.27 ? 364  LEU B CD2   1 
ATOM   7712  N N     . MET B 1 365 ? -18.786 59.727  30.960  1.00 26.29 ? 365  MET B N     1 
ATOM   7713  C CA    . MET B 1 365 ? -18.966 59.187  32.295  1.00 27.06 ? 365  MET B CA    1 
ATOM   7714  C C     . MET B 1 365 ? -18.549 57.713  32.392  1.00 26.72 ? 365  MET B C     1 
ATOM   7715  O O     . MET B 1 365 ? -17.883 57.310  33.338  1.00 26.20 ? 365  MET B O     1 
ATOM   7716  C CB    . MET B 1 365 ? -20.421 59.383  32.772  1.00 26.75 ? 365  MET B CB    1 
ATOM   7717  C CG    . MET B 1 365 ? -20.604 58.946  34.204  1.00 28.27 ? 365  MET B CG    1 
ATOM   7718  S SD    . MET B 1 365 ? -22.134 59.425  35.018  1.00 29.24 ? 365  MET B SD    1 
ATOM   7719  C CE    . MET B 1 365 ? -23.336 58.542  34.026  1.00 33.98 ? 365  MET B CE    1 
ATOM   7720  N N     . ALA B 1 366 ? -18.920 56.923  31.387  1.00 27.02 ? 366  ALA B N     1 
ATOM   7721  C CA    . ALA B 1 366 ? -18.563 55.509  31.346  1.00 27.30 ? 366  ALA B CA    1 
ATOM   7722  C C     . ALA B 1 366 ? -17.040 55.282  31.389  1.00 27.59 ? 366  ALA B C     1 
ATOM   7723  O O     . ALA B 1 366 ? -16.576 54.227  31.856  1.00 27.46 ? 366  ALA B O     1 
ATOM   7724  C CB    . ALA B 1 366 ? -19.202 54.823  30.120  1.00 26.39 ? 366  ALA B CB    1 
ATOM   7725  N N     . GLU B 1 367 ? -16.272 56.269  30.913  1.00 27.93 ? 367  GLU B N     1 
ATOM   7726  C CA    . GLU B 1 367 ? -14.801 56.164  30.905  1.00 28.38 ? 367  GLU B CA    1 
ATOM   7727  C C     . GLU B 1 367 ? -14.179 56.672  32.215  1.00 27.78 ? 367  GLU B C     1 
ATOM   7728  O O     . GLU B 1 367 ? -12.994 56.464  32.461  1.00 27.97 ? 367  GLU B O     1 
ATOM   7729  C CB    . GLU B 1 367 ? -14.194 56.900  29.704  1.00 28.29 ? 367  GLU B CB    1 
ATOM   7730  C CG    . GLU B 1 367 ? -14.819 56.559  28.375  1.00 31.23 ? 367  GLU B CG    1 
ATOM   7731  C CD    . GLU B 1 367 ? -14.474 55.151  27.870  1.00 37.10 ? 367  GLU B CD    1 
ATOM   7732  O OE1   . GLU B 1 367 ? -13.272 54.792  27.825  1.00 38.66 ? 367  GLU B OE1   1 
ATOM   7733  O OE2   . GLU B 1 367 ? -15.415 54.404  27.493  1.00 39.71 ? 367  GLU B OE2   1 
ATOM   7734  N N     . GLY B 1 368 ? -14.985 57.333  33.044  1.00 27.21 ? 368  GLY B N     1 
ATOM   7735  C CA    . GLY B 1 368 ? -14.519 57.879  34.310  1.00 26.73 ? 368  GLY B CA    1 
ATOM   7736  C C     . GLY B 1 368 ? -13.534 59.019  34.113  1.00 26.90 ? 368  GLY B C     1 
ATOM   7737  O O     . GLY B 1 368 ? -13.758 59.919  33.296  1.00 26.52 ? 368  GLY B O     1 
ATOM   7738  N N     . ASP B 1 369 ? -12.428 58.976  34.848  1.00 26.89 ? 369  ASP B N     1 
ATOM   7739  C CA    . ASP B 1 369 ? -11.474 60.082  34.823  1.00 27.36 ? 369  ASP B CA    1 
ATOM   7740  C C     . ASP B 1 369 ? -10.658 60.148  33.537  1.00 27.67 ? 369  ASP B C     1 
ATOM   7741  O O     . ASP B 1 369 ? -9.990  61.152  33.302  1.00 28.10 ? 369  ASP B O     1 
ATOM   7742  C CB    . ASP B 1 369 ? -10.592 60.106  36.078  1.00 27.25 ? 369  ASP B CB    1 
ATOM   7743  C CG    . ASP B 1 369 ? -11.399 60.415  37.342  1.00 28.00 ? 369  ASP B CG    1 
ATOM   7744  O OD1   . ASP B 1 369 ? -12.374 61.195  37.264  1.00 26.59 ? 369  ASP B OD1   1 
ATOM   7745  O OD2   . ASP B 1 369 ? -11.072 59.866  38.412  1.00 28.95 ? 369  ASP B OD2   1 
ATOM   7746  N N     . LYS B 1 370 ? -10.746 59.118  32.688  1.00 27.47 ? 370  LYS B N     1 
ATOM   7747  C CA    . LYS B 1 370 ? -10.182 59.203  31.338  1.00 27.50 ? 370  LYS B CA    1 
ATOM   7748  C C     . LYS B 1 370 ? -10.797 60.386  30.567  1.00 27.23 ? 370  LYS B C     1 
ATOM   7749  O O     . LYS B 1 370 ? -10.171 60.978  29.687  1.00 27.20 ? 370  LYS B O     1 
ATOM   7750  C CB    . LYS B 1 370 ? -10.386 57.895  30.575  1.00 27.27 ? 370  LYS B CB    1 
ATOM   7751  C CG    . LYS B 1 370 ? -9.589  56.708  31.135  1.00 28.75 ? 370  LYS B CG    1 
ATOM   7752  C CD    . LYS B 1 370 ? -9.392  55.571  30.092  1.00 28.64 ? 370  LYS B CD    1 
ATOM   7753  C CE    . LYS B 1 370 ? -10.446 54.453  30.216  1.00 32.38 ? 370  LYS B CE    1 
ATOM   7754  N NZ    . LYS B 1 370 ? -10.335 53.382  29.147  1.00 30.90 ? 370  LYS B NZ    1 
ATOM   7755  N N     . ALA B 1 371 ? -12.026 60.746  30.918  1.00 27.27 ? 371  ALA B N     1 
ATOM   7756  C CA    . ALA B 1 371 ? -12.706 61.856  30.247  1.00 26.96 ? 371  ALA B CA    1 
ATOM   7757  C C     . ALA B 1 371 ? -12.042 63.204  30.525  1.00 26.60 ? 371  ALA B C     1 
ATOM   7758  O O     . ALA B 1 371 ? -12.114 64.108  29.678  1.00 26.37 ? 371  ALA B O     1 
ATOM   7759  C CB    . ALA B 1 371 ? -14.198 61.885  30.603  1.00 26.58 ? 371  ALA B CB    1 
ATOM   7760  N N     . ILE B 1 372 ? -11.377 63.322  31.682  1.00 26.17 ? 372  ILE B N     1 
ATOM   7761  C CA    . ILE B 1 372 ? -10.791 64.608  32.122  1.00 26.62 ? 372  ILE B CA    1 
ATOM   7762  C C     . ILE B 1 372 ? -9.265  64.647  32.291  1.00 26.84 ? 372  ILE B C     1 
ATOM   7763  O O     . ILE B 1 372 ? -8.679  65.691  32.607  1.00 26.70 ? 372  ILE B O     1 
ATOM   7764  C CB    . ILE B 1 372 ? -11.445 65.126  33.429  1.00 26.60 ? 372  ILE B CB    1 
ATOM   7765  C CG1   . ILE B 1 372 ? -11.216 64.125  34.576  1.00 26.87 ? 372  ILE B CG1   1 
ATOM   7766  C CG2   . ILE B 1 372 ? -12.917 65.511  33.187  1.00 25.05 ? 372  ILE B CG2   1 
ATOM   7767  C CD1   . ILE B 1 372 ? -11.384 64.705  35.977  1.00 26.90 ? 372  ILE B CD1   1 
ATOM   7768  N N     . GLU B 1 373 ? -8.644  63.499  32.068  1.00 27.23 ? 373  GLU B N     1 
ATOM   7769  C CA    . GLU B 1 373 ? -7.230  63.272  32.303  1.00 27.74 ? 373  GLU B CA    1 
ATOM   7770  C C     . GLU B 1 373 ? -6.303  64.148  31.446  1.00 26.98 ? 373  GLU B C     1 
ATOM   7771  O O     . GLU B 1 373 ? -6.397  64.142  30.208  1.00 27.16 ? 373  GLU B O     1 
ATOM   7772  C CB    . GLU B 1 373 ? -6.956  61.816  31.999  1.00 28.28 ? 373  GLU B CB    1 
ATOM   7773  C CG    . GLU B 1 373 ? -5.733  61.253  32.651  1.00 32.09 ? 373  GLU B CG    1 
ATOM   7774  C CD    . GLU B 1 373 ? -5.673  59.756  32.431  1.00 38.22 ? 373  GLU B CD    1 
ATOM   7775  O OE1   . GLU B 1 373 ? -5.824  59.017  33.440  1.00 39.04 ? 373  GLU B OE1   1 
ATOM   7776  O OE2   . GLU B 1 373 ? -5.530  59.335  31.247  1.00 38.21 ? 373  GLU B OE2   1 
ATOM   7777  N N     . GLY B 1 374 ? -5.409  64.874  32.118  1.00 25.96 ? 374  GLY B N     1 
ATOM   7778  C CA    . GLY B 1 374 ? -4.483  65.800  31.483  1.00 24.79 ? 374  GLY B CA    1 
ATOM   7779  C C     . GLY B 1 374 ? -5.148  67.079  30.988  1.00 24.70 ? 374  GLY B C     1 
ATOM   7780  O O     . GLY B 1 374 ? -4.578  67.811  30.181  1.00 24.07 ? 374  GLY B O     1 
ATOM   7781  N N     . THR B 1 375 ? -6.364  67.351  31.448  1.00 24.20 ? 375  THR B N     1 
ATOM   7782  C CA    . THR B 1 375 ? -7.021  68.599  31.084  1.00 23.90 ? 375  THR B CA    1 
ATOM   7783  C C     . THR B 1 375 ? -7.293  69.445  32.316  1.00 23.89 ? 375  THR B C     1 
ATOM   7784  O O     . THR B 1 375 ? -7.289  68.975  33.459  1.00 23.65 ? 375  THR B O     1 
ATOM   7785  C CB    . THR B 1 375 ? -8.341  68.395  30.325  1.00 23.66 ? 375  THR B CB    1 
ATOM   7786  O OG1   . THR B 1 375 ? -9.340  67.937  31.244  1.00 24.55 ? 375  THR B OG1   1 
ATOM   7787  C CG2   . THR B 1 375 ? -8.181  67.404  29.171  1.00 22.46 ? 375  THR B CG2   1 
ATOM   7788  N N     . ASP B 1 376 ? -7.569  70.706  32.065  1.00 24.18 ? 376  ASP B N     1 
ATOM   7789  C CA    . ASP B 1 376 ? -7.634  71.675  33.128  1.00 24.59 ? 376  ASP B CA    1 
ATOM   7790  C C     . ASP B 1 376 ? -9.073  72.198  33.330  1.00 24.05 ? 376  ASP B C     1 
ATOM   7791  O O     . ASP B 1 376 ? -9.549  72.297  34.488  1.00 23.63 ? 376  ASP B O     1 
ATOM   7792  C CB    . ASP B 1 376 ? -6.605  72.770  32.817  1.00 25.77 ? 376  ASP B CB    1 
ATOM   7793  C CG    . ASP B 1 376 ? -6.570  73.824  33.842  1.00 27.42 ? 376  ASP B CG    1 
ATOM   7794  O OD1   . ASP B 1 376 ? -7.302  74.812  33.630  1.00 30.93 ? 376  ASP B OD1   1 
ATOM   7795  O OD2   . ASP B 1 376 ? -5.860  73.653  34.857  1.00 27.81 ? 376  ASP B OD2   1 
ATOM   7796  N N     . ARG B 1 377 ? -9.762  72.485  32.208  1.00 22.97 ? 377  ARG B N     1 
ATOM   7797  C CA    . ARG B 1 377 ? -11.199 72.876  32.177  1.00 22.30 ? 377  ARG B CA    1 
ATOM   7798  C C     . ARG B 1 377 ? -11.581 74.189  32.862  1.00 22.76 ? 377  ARG B C     1 
ATOM   7799  O O     . ARG B 1 377 ? -12.787 74.487  33.005  1.00 23.49 ? 377  ARG B O     1 
ATOM   7800  C CB    . ARG B 1 377 ? -12.108 71.769  32.753  1.00 22.08 ? 377  ARG B CB    1 
ATOM   7801  C CG    . ARG B 1 377 ? -12.229 70.480  31.928  1.00 20.22 ? 377  ARG B CG    1 
ATOM   7802  C CD    . ARG B 1 377 ? -12.343 69.312  32.865  1.00 18.56 ? 377  ARG B CD    1 
ATOM   7803  N NE    . ARG B 1 377 ? -11.047 68.985  33.449  1.00 18.25 ? 377  ARG B NE    1 
ATOM   7804  C CZ    . ARG B 1 377 ? -10.823 68.635  34.715  1.00 18.32 ? 377  ARG B CZ    1 
ATOM   7805  N NH1   . ARG B 1 377 ? -11.807 68.546  35.598  1.00 18.15 ? 377  ARG B NH1   1 
ATOM   7806  N NH2   . ARG B 1 377 ? -9.585  68.376  35.102  1.00 18.89 ? 377  ARG B NH2   1 
ATOM   7807  N N     . SER B 1 378 ? -10.591 74.969  33.303  1.00 22.56 ? 378  SER B N     1 
ATOM   7808  C CA    . SER B 1 378 ? -10.846 76.093  34.206  1.00 22.27 ? 378  SER B CA    1 
ATOM   7809  C C     . SER B 1 378 ? -11.543 77.269  33.541  1.00 21.97 ? 378  SER B C     1 
ATOM   7810  O O     . SER B 1 378 ? -12.093 78.135  34.221  1.00 20.85 ? 378  SER B O     1 
ATOM   7811  C CB    . SER B 1 378 ? -9.545  76.558  34.862  1.00 22.62 ? 378  SER B CB    1 
ATOM   7812  O OG    . SER B 1 378 ? -9.218  75.693  35.940  1.00 25.18 ? 378  SER B OG    1 
ATOM   7813  N N     . SER B 1 379 ? -11.508 77.299  32.207  1.00 22.06 ? 379  SER B N     1 
ATOM   7814  C CA    . SER B 1 379 ? -12.182 78.355  31.453  1.00 21.98 ? 379  SER B CA    1 
ATOM   7815  C C     . SER B 1 379 ? -13.731 78.332  31.580  1.00 21.91 ? 379  SER B C     1 
ATOM   7816  O O     . SER B 1 379 ? -14.395 79.331  31.307  1.00 21.68 ? 379  SER B O     1 
ATOM   7817  C CB    . SER B 1 379 ? -11.718 78.348  29.984  1.00 22.22 ? 379  SER B CB    1 
ATOM   7818  O OG    . SER B 1 379 ? -12.016 77.137  29.299  1.00 20.84 ? 379  SER B OG    1 
ATOM   7819  N N     . LEU B 1 380 ? -14.290 77.203  32.008  1.00 21.86 ? 380  LEU B N     1 
ATOM   7820  C CA    . LEU B 1 380 ? -15.742 77.006  31.980  1.00 22.07 ? 380  LEU B CA    1 
ATOM   7821  C C     . LEU B 1 380 ? -16.442 77.772  33.102  1.00 22.89 ? 380  LEU B C     1 
ATOM   7822  O O     . LEU B 1 380 ? -16.006 77.736  34.256  1.00 21.60 ? 380  LEU B O     1 
ATOM   7823  C CB    . LEU B 1 380 ? -16.092 75.519  32.061  1.00 21.62 ? 380  LEU B CB    1 
ATOM   7824  C CG    . LEU B 1 380 ? -15.805 74.641  30.826  1.00 21.45 ? 380  LEU B CG    1 
ATOM   7825  C CD1   . LEU B 1 380 ? -16.023 73.181  31.175  1.00 16.86 ? 380  LEU B CD1   1 
ATOM   7826  C CD2   . LEU B 1 380 ? -16.654 75.037  29.599  1.00 18.48 ? 380  LEU B CD2   1 
ATOM   7827  N N     . ARG B 1 381 ? -17.523 78.461  32.732  1.00 23.90 ? 381  ARG B N     1 
ATOM   7828  C CA    . ARG B 1 381 ? -18.378 79.186  33.659  1.00 25.63 ? 381  ARG B CA    1 
ATOM   7829  C C     . ARG B 1 381 ? -19.817 78.622  33.706  1.00 25.05 ? 381  ARG B C     1 
ATOM   7830  O O     . ARG B 1 381 ? -20.479 78.680  34.739  1.00 24.70 ? 381  ARG B O     1 
ATOM   7831  C CB    . ARG B 1 381 ? -18.407 80.663  33.272  1.00 25.85 ? 381  ARG B CB    1 
ATOM   7832  C CG    . ARG B 1 381 ? -17.356 81.544  33.972  1.00 28.66 ? 381  ARG B CG    1 
ATOM   7833  C CD    . ARG B 1 381 ? -17.562 83.073  33.652  1.00 28.89 ? 381  ARG B CD    1 
ATOM   7834  N NE    . ARG B 1 381 ? -17.402 83.403  32.222  1.00 33.48 ? 381  ARG B NE    1 
ATOM   7835  C CZ    . ARG B 1 381 ? -16.242 83.691  31.622  1.00 34.58 ? 381  ARG B CZ    1 
ATOM   7836  N NH1   . ARG B 1 381 ? -15.098 83.709  32.315  1.00 33.94 ? 381  ARG B NH1   1 
ATOM   7837  N NH2   . ARG B 1 381 ? -16.225 83.964  30.313  1.00 33.87 ? 381  ARG B NH2   1 
ATOM   7838  N N     . ILE B 1 382 ? -20.282 78.076  32.581  1.00 25.22 ? 382  ILE B N     1 
ATOM   7839  C CA    . ILE B 1 382 ? -21.671 77.634  32.397  1.00 25.08 ? 382  ILE B CA    1 
ATOM   7840  C C     . ILE B 1 382 ? -21.678 76.316  31.648  1.00 25.56 ? 382  ILE B C     1 
ATOM   7841  O O     . ILE B 1 382 ? -20.941 76.166  30.682  1.00 26.59 ? 382  ILE B O     1 
ATOM   7842  C CB    . ILE B 1 382 ? -22.507 78.658  31.537  1.00 24.81 ? 382  ILE B CB    1 
ATOM   7843  C CG1   . ILE B 1 382 ? -22.519 80.061  32.160  1.00 24.03 ? 382  ILE B CG1   1 
ATOM   7844  C CG2   . ILE B 1 382 ? -23.944 78.149  31.247  1.00 24.15 ? 382  ILE B CG2   1 
ATOM   7845  C CD1   . ILE B 1 382 ? -23.485 80.249  33.329  1.00 22.35 ? 382  ILE B CD1   1 
ATOM   7846  N N     . LEU B 1 383 ? -22.524 75.381  32.078  1.00 25.69 ? 383  LEU B N     1 
ATOM   7847  C CA    . LEU B 1 383 ? -22.754 74.127  31.363  1.00 25.09 ? 383  LEU B CA    1 
ATOM   7848  C C     . LEU B 1 383 ? -24.219 73.985  30.944  1.00 25.24 ? 383  LEU B C     1 
ATOM   7849  O O     . LEU B 1 383 ? -25.122 74.564  31.557  1.00 24.99 ? 383  LEU B O     1 
ATOM   7850  C CB    . LEU B 1 383 ? -22.369 72.929  32.236  1.00 24.95 ? 383  LEU B CB    1 
ATOM   7851  C CG    . LEU B 1 383 ? -20.923 72.757  32.726  1.00 24.46 ? 383  LEU B CG    1 
ATOM   7852  C CD1   . LEU B 1 383 ? -20.844 71.561  33.689  1.00 22.30 ? 383  LEU B CD1   1 
ATOM   7853  C CD2   . LEU B 1 383 ? -19.941 72.607  31.575  1.00 22.85 ? 383  LEU B CD2   1 
ATOM   7854  N N     . GLY B 1 384 ? -24.453 73.198  29.904  1.00 25.16 ? 384  GLY B N     1 
ATOM   7855  C CA    . GLY B 1 384 ? -25.803 72.955  29.451  1.00 25.54 ? 384  GLY B CA    1 
ATOM   7856  C C     . GLY B 1 384 ? -26.022 71.525  29.034  1.00 25.96 ? 384  GLY B C     1 
ATOM   7857  O O     . GLY B 1 384 ? -25.072 70.813  28.680  1.00 26.53 ? 384  GLY B O     1 
ATOM   7858  N N     . SER B 1 385 ? -27.282 71.106  29.077  1.00 25.80 ? 385  SER B N     1 
ATOM   7859  C CA    . SER B 1 385 ? -27.675 69.764  28.669  1.00 25.60 ? 385  SER B CA    1 
ATOM   7860  C C     . SER B 1 385 ? -28.959 69.854  27.823  1.00 26.00 ? 385  SER B C     1 
ATOM   7861  O O     . SER B 1 385 ? -29.876 70.617  28.167  1.00 26.39 ? 385  SER B O     1 
ATOM   7862  C CB    . SER B 1 385 ? -27.885 68.896  29.908  1.00 25.39 ? 385  SER B CB    1 
ATOM   7863  O OG    . SER B 1 385 ? -28.270 67.587  29.569  1.00 25.35 ? 385  SER B OG    1 
ATOM   7864  N N     . VAL B 1 386 ? -29.019 69.106  26.716  1.00 25.59 ? 386  VAL B N     1 
ATOM   7865  C CA    . VAL B 1 386 ? -30.219 69.096  25.866  1.00 25.31 ? 386  VAL B CA    1 
ATOM   7866  C C     . VAL B 1 386 ? -30.517 67.736  25.206  1.00 25.81 ? 386  VAL B C     1 
ATOM   7867  O O     . VAL B 1 386 ? -29.603 66.979  24.897  1.00 25.53 ? 386  VAL B O     1 
ATOM   7868  C CB    . VAL B 1 386 ? -30.185 70.236  24.797  1.00 24.97 ? 386  VAL B CB    1 
ATOM   7869  C CG1   . VAL B 1 386 ? -28.992 70.095  23.840  1.00 24.03 ? 386  VAL B CG1   1 
ATOM   7870  C CG2   . VAL B 1 386 ? -31.508 70.317  24.038  1.00 23.11 ? 386  VAL B CG2   1 
ATOM   7871  N N     . GLY B 1 387 ? -31.803 67.433  25.023  1.00 26.17 ? 387  GLY B N     1 
ATOM   7872  C CA    . GLY B 1 387 ? -32.202 66.430  24.054  1.00 27.17 ? 387  GLY B CA    1 
ATOM   7873  C C     . GLY B 1 387 ? -32.884 65.228  24.637  1.00 28.43 ? 387  GLY B C     1 
ATOM   7874  O O     . GLY B 1 387 ? -33.670 64.540  23.953  1.00 28.48 ? 387  GLY B O     1 
ATOM   7875  N N     . GLU B 1 388 ? -32.569 64.960  25.899  1.00 28.86 ? 388  GLU B N     1 
ATOM   7876  C CA    . GLU B 1 388 ? -33.085 63.800  26.576  1.00 29.96 ? 388  GLU B CA    1 
ATOM   7877  C C     . GLU B 1 388 ? -33.091 64.033  28.074  1.00 30.19 ? 388  GLU B C     1 
ATOM   7878  O O     . GLU B 1 388 ? -32.360 64.904  28.571  1.00 30.30 ? 388  GLU B O     1 
ATOM   7879  C CB    . GLU B 1 388 ? -32.253 62.572  26.225  1.00 30.28 ? 388  GLU B CB    1 
ATOM   7880  C CG    . GLU B 1 388 ? -30.809 62.895  26.139  1.00 33.21 ? 388  GLU B CG    1 
ATOM   7881  C CD    . GLU B 1 388 ? -29.939 61.772  25.584  1.00 35.38 ? 388  GLU B CD    1 
ATOM   7882  O OE1   . GLU B 1 388 ? -30.031 60.613  26.093  1.00 33.59 ? 388  GLU B OE1   1 
ATOM   7883  O OE2   . GLU B 1 388 ? -29.135 62.100  24.668  1.00 33.90 ? 388  GLU B OE2   1 
ATOM   7884  N N     . PRO B 1 389 ? -33.933 63.272  28.803  1.00 30.17 ? 389  PRO B N     1 
ATOM   7885  C CA    . PRO B 1 389 ? -33.863 63.372  30.243  1.00 30.43 ? 389  PRO B CA    1 
ATOM   7886  C C     . PRO B 1 389 ? -32.434 63.090  30.641  1.00 31.36 ? 389  PRO B C     1 
ATOM   7887  O O     . PRO B 1 389 ? -31.731 62.313  29.955  1.00 31.01 ? 389  PRO B O     1 
ATOM   7888  C CB    . PRO B 1 389 ? -34.743 62.226  30.714  1.00 30.83 ? 389  PRO B CB    1 
ATOM   7889  C CG    . PRO B 1 389 ? -35.692 61.993  29.589  1.00 30.45 ? 389  PRO B CG    1 
ATOM   7890  C CD    . PRO B 1 389 ? -34.921 62.277  28.353  1.00 29.51 ? 389  PRO B CD    1 
ATOM   7891  N N     . ILE B 1 390 ? -31.991 63.732  31.721  1.00 31.98 ? 390  ILE B N     1 
ATOM   7892  C CA    . ILE B 1 390 ? -30.669 63.447  32.286  1.00 31.96 ? 390  ILE B CA    1 
ATOM   7893  C C     . ILE B 1 390 ? -30.807 62.892  33.703  1.00 32.10 ? 390  ILE B C     1 
ATOM   7894  O O     . ILE B 1 390 ? -31.313 63.562  34.593  1.00 32.77 ? 390  ILE B O     1 
ATOM   7895  C CB    . ILE B 1 390 ? -29.729 64.694  32.231  1.00 32.22 ? 390  ILE B CB    1 
ATOM   7896  C CG1   . ILE B 1 390 ? -28.363 64.371  32.847  1.00 31.39 ? 390  ILE B CG1   1 
ATOM   7897  C CG2   . ILE B 1 390 ? -30.406 65.956  32.857  1.00 31.44 ? 390  ILE B CG2   1 
ATOM   7898  C CD1   . ILE B 1 390 ? -27.239 65.210  32.306  1.00 29.33 ? 390  ILE B CD1   1 
ATOM   7899  N N     . ASN B 1 391 ? -30.382 61.652  33.890  1.00 32.13 ? 391  ASN B N     1 
ATOM   7900  C CA    . ASN B 1 391 ? -30.222 61.052  35.217  1.00 31.88 ? 391  ASN B CA    1 
ATOM   7901  C C     . ASN B 1 391 ? -29.459 61.984  36.183  1.00 31.22 ? 391  ASN B C     1 
ATOM   7902  O O     . ASN B 1 391 ? -28.434 62.559  35.809  1.00 31.17 ? 391  ASN B O     1 
ATOM   7903  C CB    . ASN B 1 391 ? -29.447 59.755  35.018  1.00 32.96 ? 391  ASN B CB    1 
ATOM   7904  C CG    . ASN B 1 391 ? -29.455 58.850  36.231  1.00 34.18 ? 391  ASN B CG    1 
ATOM   7905  O OD1   . ASN B 1 391 ? -29.898 57.706  36.144  1.00 37.30 ? 391  ASN B OD1   1 
ATOM   7906  N ND2   . ASN B 1 391 ? -28.922 59.326  37.344  1.00 36.31 ? 391  ASN B ND2   1 
ATOM   7907  N N     . PRO B 1 392 ? -29.958 62.146  37.428  1.00 30.72 ? 392  PRO B N     1 
ATOM   7908  C CA    . PRO B 1 392 ? -29.233 62.905  38.463  1.00 29.88 ? 392  PRO B CA    1 
ATOM   7909  C C     . PRO B 1 392 ? -27.753 62.579  38.637  1.00 29.23 ? 392  PRO B C     1 
ATOM   7910  O O     . PRO B 1 392 ? -26.944 63.492  38.844  1.00 29.58 ? 392  PRO B O     1 
ATOM   7911  C CB    . PRO B 1 392 ? -30.017 62.580  39.741  1.00 29.80 ? 392  PRO B CB    1 
ATOM   7912  C CG    . PRO B 1 392 ? -31.409 62.435  39.264  1.00 29.57 ? 392  PRO B CG    1 
ATOM   7913  C CD    . PRO B 1 392 ? -31.274 61.699  37.931  1.00 30.69 ? 392  PRO B CD    1 
ATOM   7914  N N     . GLU B 1 393 ? -27.401 61.301  38.562  1.00 28.33 ? 393  GLU B N     1 
ATOM   7915  C CA    . GLU B 1 393 ? -26.017 60.866  38.716  1.00 27.80 ? 393  GLU B CA    1 
ATOM   7916  C C     . GLU B 1 393 ? -25.124 61.273  37.545  1.00 27.00 ? 393  GLU B C     1 
ATOM   7917  O O     . GLU B 1 393 ? -23.944 61.594  37.743  1.00 27.24 ? 393  GLU B O     1 
ATOM   7918  C CB    . GLU B 1 393 ? -25.967 59.374  38.917  1.00 28.31 ? 393  GLU B CB    1 
ATOM   7919  C CG    . GLU B 1 393 ? -26.460 58.939  40.301  1.00 31.30 ? 393  GLU B CG    1 
ATOM   7920  C CD    . GLU B 1 393 ? -26.663 57.442  40.382  1.00 36.00 ? 393  GLU B CD    1 
ATOM   7921  O OE1   . GLU B 1 393 ? -27.027 56.846  39.324  1.00 37.25 ? 393  GLU B OE1   1 
ATOM   7922  O OE2   . GLU B 1 393 ? -26.445 56.865  41.484  1.00 36.67 ? 393  GLU B OE2   1 
ATOM   7923  N N     . ALA B 1 394 ? -25.707 61.279  36.344  1.00 25.47 ? 394  ALA B N     1 
ATOM   7924  C CA    . ALA B 1 394 ? -25.103 61.853  35.154  1.00 24.33 ? 394  ALA B CA    1 
ATOM   7925  C C     . ALA B 1 394 ? -24.947 63.392  35.272  1.00 24.18 ? 394  ALA B C     1 
ATOM   7926  O O     . ALA B 1 394 ? -23.920 63.957  34.914  1.00 23.93 ? 394  ALA B O     1 
ATOM   7927  C CB    . ALA B 1 394 ? -25.930 61.487  33.933  1.00 23.09 ? 394  ALA B CB    1 
ATOM   7928  N N     . TRP B 1 395 ? -25.983 64.058  35.762  1.00 23.94 ? 395  TRP B N     1 
ATOM   7929  C CA    . TRP B 1 395 ? -25.961 65.495  36.018  1.00 23.69 ? 395  TRP B CA    1 
ATOM   7930  C C     . TRP B 1 395 ? -24.885 65.853  37.038  1.00 23.29 ? 395  TRP B C     1 
ATOM   7931  O O     . TRP B 1 395 ? -24.104 66.779  36.815  1.00 23.42 ? 395  TRP B O     1 
ATOM   7932  C CB    . TRP B 1 395 ? -27.358 65.955  36.482  1.00 23.60 ? 395  TRP B CB    1 
ATOM   7933  C CG    . TRP B 1 395 ? -27.595 67.446  36.586  1.00 24.68 ? 395  TRP B CG    1 
ATOM   7934  C CD1   . TRP B 1 395 ? -28.379 68.215  35.754  1.00 25.50 ? 395  TRP B CD1   1 
ATOM   7935  C CD2   . TRP B 1 395 ? -27.114 68.348  37.615  1.00 24.85 ? 395  TRP B CD2   1 
ATOM   7936  N NE1   . TRP B 1 395 ? -28.417 69.517  36.206  1.00 24.59 ? 395  TRP B NE1   1 
ATOM   7937  C CE2   . TRP B 1 395 ? -27.642 69.628  37.332  1.00 24.05 ? 395  TRP B CE2   1 
ATOM   7938  C CE3   . TRP B 1 395 ? -26.278 68.196  38.732  1.00 24.52 ? 395  TRP B CE3   1 
ATOM   7939  C CZ2   . TRP B 1 395 ? -27.351 70.752  38.116  1.00 25.08 ? 395  TRP B CZ2   1 
ATOM   7940  C CZ3   . TRP B 1 395 ? -25.998 69.323  39.525  1.00 25.45 ? 395  TRP B CZ3   1 
ATOM   7941  C CH2   . TRP B 1 395 ? -26.539 70.579  39.208  1.00 24.75 ? 395  TRP B CH2   1 
ATOM   7942  N N     . GLU B 1 396 ? -24.845 65.132  38.153  1.00 23.20 ? 396  GLU B N     1 
ATOM   7943  C CA    . GLU B 1 396 ? -23.842 65.386  39.188  1.00 23.30 ? 396  GLU B CA    1 
ATOM   7944  C C     . GLU B 1 396 ? -22.431 65.152  38.668  1.00 22.82 ? 396  GLU B C     1 
ATOM   7945  O O     . GLU B 1 396 ? -21.520 65.895  39.034  1.00 23.17 ? 396  GLU B O     1 
ATOM   7946  C CB    . GLU B 1 396 ? -24.077 64.519  40.437  1.00 23.58 ? 396  GLU B CB    1 
ATOM   7947  C CG    . GLU B 1 396 ? -25.340 64.895  41.241  1.00 26.73 ? 396  GLU B CG    1 
ATOM   7948  C CD    . GLU B 1 396 ? -25.248 66.287  41.853  1.00 30.15 ? 396  GLU B CD    1 
ATOM   7949  O OE1   . GLU B 1 396 ? -24.106 66.807  41.954  1.00 31.74 ? 396  GLU B OE1   1 
ATOM   7950  O OE2   . GLU B 1 396 ? -26.298 66.861  42.230  1.00 30.33 ? 396  GLU B OE2   1 
ATOM   7951  N N     . TRP B 1 397 ? -22.258 64.125  37.823  1.00 21.91 ? 397  TRP B N     1 
ATOM   7952  C CA    . TRP B 1 397 ? -20.947 63.780  37.276  1.00 21.40 ? 397  TRP B CA    1 
ATOM   7953  C C     . TRP B 1 397 ? -20.500 64.915  36.361  1.00 20.55 ? 397  TRP B C     1 
ATOM   7954  O O     . TRP B 1 397 ? -19.373 65.385  36.426  1.00 20.49 ? 397  TRP B O     1 
ATOM   7955  C CB    . TRP B 1 397 ? -20.976 62.436  36.541  1.00 20.89 ? 397  TRP B CB    1 
ATOM   7956  C CG    . TRP B 1 397 ? -19.599 61.979  36.087  1.00 22.45 ? 397  TRP B CG    1 
ATOM   7957  C CD1   . TRP B 1 397 ? -18.734 61.154  36.772  1.00 22.45 ? 397  TRP B CD1   1 
ATOM   7958  C CD2   . TRP B 1 397 ? -18.919 62.334  34.860  1.00 21.67 ? 397  TRP B CD2   1 
ATOM   7959  N NE1   . TRP B 1 397 ? -17.578 60.963  36.040  1.00 22.14 ? 397  TRP B NE1   1 
ATOM   7960  C CE2   . TRP B 1 397 ? -17.661 61.676  34.873  1.00 20.78 ? 397  TRP B CE2   1 
ATOM   7961  C CE3   . TRP B 1 397 ? -19.256 63.138  33.755  1.00 20.53 ? 397  TRP B CE3   1 
ATOM   7962  C CZ2   . TRP B 1 397 ? -16.741 61.801  33.838  1.00 20.32 ? 397  TRP B CZ2   1 
ATOM   7963  C CZ3   . TRP B 1 397 ? -18.359 63.254  32.731  1.00 21.63 ? 397  TRP B CZ3   1 
ATOM   7964  C CH2   . TRP B 1 397 ? -17.096 62.590  32.776  1.00 21.72 ? 397  TRP B CH2   1 
ATOM   7965  N N     . TYR B 1 398 ? -21.427 65.377  35.545  1.00 20.51 ? 398  TYR B N     1 
ATOM   7966  C CA    . TYR B 1 398 ? -21.225 66.503  34.649  1.00 20.72 ? 398  TYR B CA    1 
ATOM   7967  C C     . TYR B 1 398 ? -20.800 67.780  35.395  1.00 20.58 ? 398  TYR B C     1 
ATOM   7968  O O     . TYR B 1 398 ? -19.768 68.378  35.099  1.00 20.66 ? 398  TYR B O     1 
ATOM   7969  C CB    . TYR B 1 398 ? -22.532 66.722  33.880  1.00 20.49 ? 398  TYR B CB    1 
ATOM   7970  C CG    . TYR B 1 398 ? -22.452 67.700  32.713  1.00 21.33 ? 398  TYR B CG    1 
ATOM   7971  C CD1   . TYR B 1 398 ? -21.333 67.734  31.856  1.00 20.32 ? 398  TYR B CD1   1 
ATOM   7972  C CD2   . TYR B 1 398 ? -23.521 68.558  32.444  1.00 20.67 ? 398  TYR B CD2   1 
ATOM   7973  C CE1   . TYR B 1 398 ? -21.291 68.613  30.790  1.00 19.71 ? 398  TYR B CE1   1 
ATOM   7974  C CE2   . TYR B 1 398 ? -23.496 69.424  31.363  1.00 21.87 ? 398  TYR B CE2   1 
ATOM   7975  C CZ    . TYR B 1 398 ? -22.381 69.457  30.550  1.00 21.17 ? 398  TYR B CZ    1 
ATOM   7976  O OH    . TYR B 1 398 ? -22.393 70.333  29.487  1.00 22.42 ? 398  TYR B OH    1 
ATOM   7977  N N     . TRP B 1 399 ? -21.630 68.173  36.356  1.00 21.07 ? 399  TRP B N     1 
ATOM   7978  C CA    . TRP B 1 399 ? -21.422 69.309  37.231  1.00 21.48 ? 399  TRP B CA    1 
ATOM   7979  C C     . TRP B 1 399 ? -20.098 69.260  37.998  1.00 22.13 ? 399  TRP B C     1 
ATOM   7980  O O     . TRP B 1 399 ? -19.456 70.315  38.205  1.00 22.01 ? 399  TRP B O     1 
ATOM   7981  C CB    . TRP B 1 399 ? -22.596 69.371  38.224  1.00 21.05 ? 399  TRP B CB    1 
ATOM   7982  C CG    . TRP B 1 399 ? -22.617 70.566  39.158  1.00 20.32 ? 399  TRP B CG    1 
ATOM   7983  C CD1   . TRP B 1 399 ? -23.054 71.828  38.870  1.00 18.60 ? 399  TRP B CD1   1 
ATOM   7984  C CD2   . TRP B 1 399 ? -22.224 70.580  40.545  1.00 18.13 ? 399  TRP B CD2   1 
ATOM   7985  N NE1   . TRP B 1 399 ? -22.955 72.625  39.991  1.00 19.28 ? 399  TRP B NE1   1 
ATOM   7986  C CE2   . TRP B 1 399 ? -22.437 71.884  41.025  1.00 18.46 ? 399  TRP B CE2   1 
ATOM   7987  C CE3   . TRP B 1 399 ? -21.683 69.620  41.412  1.00 17.13 ? 399  TRP B CE3   1 
ATOM   7988  C CZ2   . TRP B 1 399 ? -22.126 72.257  42.352  1.00 21.14 ? 399  TRP B CZ2   1 
ATOM   7989  C CZ3   . TRP B 1 399 ? -21.396 69.979  42.725  1.00 18.63 ? 399  TRP B CZ3   1 
ATOM   7990  C CH2   . TRP B 1 399 ? -21.614 71.278  43.185  1.00 19.28 ? 399  TRP B CH2   1 
ATOM   7991  N N     . LYS B 1 400 ? -19.717 68.053  38.444  1.00 22.67 ? 400  LYS B N     1 
ATOM   7992  C CA    . LYS B 1 400 ? -18.455 67.839  39.181  1.00 23.22 ? 400  LYS B CA    1 
ATOM   7993  C C     . LYS B 1 400 ? -17.222 67.754  38.272  1.00 23.13 ? 400  LYS B C     1 
ATOM   7994  O O     . LYS B 1 400 ? -16.294 68.581  38.356  1.00 23.44 ? 400  LYS B O     1 
ATOM   7995  C CB    . LYS B 1 400 ? -18.542 66.578  40.023  1.00 23.46 ? 400  LYS B CB    1 
ATOM   7996  C CG    . LYS B 1 400 ? -17.282 66.290  40.865  1.00 25.62 ? 400  LYS B CG    1 
ATOM   7997  C CD    . LYS B 1 400 ? -17.444 65.017  41.740  1.00 24.44 ? 400  LYS B CD    1 
ATOM   7998  C CE    . LYS B 1 400 ? -16.361 64.947  42.827  1.00 27.07 ? 400  LYS B CE    1 
ATOM   7999  N NZ    . LYS B 1 400 ? -16.230 63.559  43.370  1.00 28.19 ? 400  LYS B NZ    1 
ATOM   8000  N N     . LYS B 1 401 ? -17.219 66.756  37.395  1.00 22.88 ? 401  LYS B N     1 
ATOM   8001  C CA    . LYS B 1 401 ? -16.039 66.430  36.610  1.00 22.58 ? 401  LYS B CA    1 
ATOM   8002  C C     . LYS B 1 401 ? -15.769 67.480  35.531  1.00 22.67 ? 401  LYS B C     1 
ATOM   8003  O O     . LYS B 1 401 ? -14.631 67.896  35.338  1.00 22.65 ? 401  LYS B O     1 
ATOM   8004  C CB    . LYS B 1 401 ? -16.173 65.029  35.989  1.00 22.35 ? 401  LYS B CB    1 
ATOM   8005  C CG    . LYS B 1 401 ? -16.283 63.898  37.001  1.00 22.03 ? 401  LYS B CG    1 
ATOM   8006  C CD    . LYS B 1 401 ? -14.939 63.607  37.591  1.00 21.64 ? 401  LYS B CD    1 
ATOM   8007  C CE    . LYS B 1 401 ? -15.041 62.810  38.869  1.00 23.68 ? 401  LYS B CE    1 
ATOM   8008  N NZ    . LYS B 1 401 ? -13.673 62.578  39.472  1.00 22.87 ? 401  LYS B NZ    1 
ATOM   8009  N N     . ILE B 1 402 ? -16.807 67.916  34.828  1.00 22.39 ? 402  ILE B N     1 
ATOM   8010  C CA    . ILE B 1 402 ? -16.582 68.880  33.740  1.00 22.38 ? 402  ILE B CA    1 
ATOM   8011  C C     . ILE B 1 402 ? -16.670 70.339  34.246  1.00 22.31 ? 402  ILE B C     1 
ATOM   8012  O O     . ILE B 1 402 ? -15.905 71.211  33.818  1.00 20.92 ? 402  ILE B O     1 
ATOM   8013  C CB    . ILE B 1 402 ? -17.557 68.651  32.553  1.00 21.91 ? 402  ILE B CB    1 
ATOM   8014  C CG1   . ILE B 1 402 ? -17.590 67.165  32.127  1.00 22.76 ? 402  ILE B CG1   1 
ATOM   8015  C CG2   . ILE B 1 402 ? -17.216 69.567  31.412  1.00 20.39 ? 402  ILE B CG2   1 
ATOM   8016  C CD1   . ILE B 1 402 ? -16.218 66.467  31.892  1.00 21.83 ? 402  ILE B CD1   1 
ATOM   8017  N N     . GLY B 1 403 ? -17.605 70.577  35.166  1.00 22.23 ? 403  GLY B N     1 
ATOM   8018  C CA    . GLY B 1 403 ? -17.846 71.921  35.675  1.00 22.85 ? 403  GLY B CA    1 
ATOM   8019  C C     . GLY B 1 403 ? -17.055 72.278  36.907  1.00 23.35 ? 403  GLY B C     1 
ATOM   8020  O O     . GLY B 1 403 ? -17.037 73.452  37.299  1.00 23.08 ? 403  GLY B O     1 
ATOM   8021  N N     . LYS B 1 404 ? -16.401 71.272  37.508  1.00 23.92 ? 404  LYS B N     1 
ATOM   8022  C CA    . LYS B 1 404 ? -15.542 71.452  38.700  1.00 24.41 ? 404  LYS B CA    1 
ATOM   8023  C C     . LYS B 1 404 ? -16.315 72.019  39.896  1.00 25.42 ? 404  LYS B C     1 
ATOM   8024  O O     . LYS B 1 404 ? -15.734 72.682  40.774  1.00 26.08 ? 404  LYS B O     1 
ATOM   8025  C CB    . LYS B 1 404 ? -14.314 72.311  38.380  1.00 23.99 ? 404  LYS B CB    1 
ATOM   8026  C CG    . LYS B 1 404 ? -13.354 71.657  37.384  1.00 24.43 ? 404  LYS B CG    1 
ATOM   8027  C CD    . LYS B 1 404 ? -12.235 72.609  36.918  1.00 23.17 ? 404  LYS B CD    1 
ATOM   8028  C CE    . LYS B 1 404 ? -10.998 72.498  37.808  1.00 20.37 ? 404  LYS B CE    1 
ATOM   8029  N NZ    . LYS B 1 404 ? -9.877  73.328  37.285  1.00 20.48 ? 404  LYS B NZ    1 
ATOM   8030  N N     . GLU B 1 405 ? -17.620 71.738  39.922  1.00 25.98 ? 405  GLU B N     1 
ATOM   8031  C CA    . GLU B 1 405 ? -18.538 72.239  40.945  1.00 27.01 ? 405  GLU B CA    1 
ATOM   8032  C C     . GLU B 1 405 ? -18.735 73.759  40.909  1.00 27.11 ? 405  GLU B C     1 
ATOM   8033  O O     . GLU B 1 405 ? -19.313 74.336  41.825  1.00 28.08 ? 405  GLU B O     1 
ATOM   8034  C CB    . GLU B 1 405 ? -18.121 71.768  42.358  1.00 26.79 ? 405  GLU B CB    1 
ATOM   8035  C CG    . GLU B 1 405 ? -17.844 70.254  42.503  1.00 27.70 ? 405  GLU B CG    1 
ATOM   8036  C CD    . GLU B 1 405 ? -17.501 69.806  43.937  1.00 28.42 ? 405  GLU B CD    1 
ATOM   8037  O OE1   . GLU B 1 405 ? -17.047 68.656  44.092  1.00 29.97 ? 405  GLU B OE1   1 
ATOM   8038  O OE2   . GLU B 1 405 ? -17.689 70.578  44.918  1.00 31.55 ? 405  GLU B OE2   1 
ATOM   8039  N N     . LYS B 1 406 ? -18.275 74.417  39.855  1.00 27.37 ? 406  LYS B N     1 
ATOM   8040  C CA    . LYS B 1 406 ? -18.363 75.877  39.776  1.00 27.30 ? 406  LYS B CA    1 
ATOM   8041  C C     . LYS B 1 406 ? -19.437 76.382  38.804  1.00 27.02 ? 406  LYS B C     1 
ATOM   8042  O O     . LYS B 1 406 ? -19.780 77.566  38.816  1.00 27.73 ? 406  LYS B O     1 
ATOM   8043  C CB    . LYS B 1 406 ? -17.006 76.459  39.393  1.00 26.89 ? 406  LYS B CB    1 
ATOM   8044  C CG    . LYS B 1 406 ? -15.909 76.184  40.416  1.00 27.91 ? 406  LYS B CG    1 
ATOM   8045  C CD    . LYS B 1 406 ? -14.506 76.490  39.856  1.00 28.74 ? 406  LYS B CD    1 
ATOM   8046  C CE    . LYS B 1 406 ? -14.110 77.937  40.105  1.00 33.73 ? 406  LYS B CE    1 
ATOM   8047  N NZ    . LYS B 1 406 ? -13.367 78.544  38.954  1.00 35.48 ? 406  LYS B NZ    1 
ATOM   8048  N N     . CYS B 1 407 ? -19.984 75.495  37.979  1.00 26.41 ? 407  CYS B N     1 
ATOM   8049  C CA    . CYS B 1 407 ? -20.742 75.931  36.824  1.00 25.95 ? 407  CYS B CA    1 
ATOM   8050  C C     . CYS B 1 407 ? -22.185 75.514  36.918  1.00 26.46 ? 407  CYS B C     1 
ATOM   8051  O O     . CYS B 1 407 ? -22.460 74.319  37.048  1.00 27.45 ? 407  CYS B O     1 
ATOM   8052  C CB    . CYS B 1 407 ? -20.161 75.327  35.545  1.00 26.00 ? 407  CYS B CB    1 
ATOM   8053  S SG    . CYS B 1 407 ? -18.525 75.895  35.096  1.00 22.82 ? 407  CYS B SG    1 
ATOM   8054  N N     . PRO B 1 408 ? -23.123 76.482  36.846  1.00 26.16 ? 408  PRO B N     1 
ATOM   8055  C CA    . PRO B 1 408 ? -24.526 76.078  36.710  1.00 25.56 ? 408  PRO B CA    1 
ATOM   8056  C C     . PRO B 1 408 ? -24.746 75.215  35.466  1.00 25.55 ? 408  PRO B C     1 
ATOM   8057  O O     . PRO B 1 408 ? -24.083 75.410  34.429  1.00 25.21 ? 408  PRO B O     1 
ATOM   8058  C CB    . PRO B 1 408 ? -25.271 77.416  36.620  1.00 25.11 ? 408  PRO B CB    1 
ATOM   8059  C CG    . PRO B 1 408 ? -24.326 78.398  37.376  1.00 25.94 ? 408  PRO B CG    1 
ATOM   8060  C CD    . PRO B 1 408 ? -22.970 77.952  36.950  1.00 26.11 ? 408  PRO B CD    1 
ATOM   8061  N N     . VAL B 1 409 ? -25.652 74.242  35.593  1.00 25.18 ? 409  VAL B N     1 
ATOM   8062  C CA    . VAL B 1 409 ? -26.025 73.371  34.486  1.00 24.55 ? 409  VAL B CA    1 
ATOM   8063  C C     . VAL B 1 409 ? -27.410 73.780  34.029  1.00 24.51 ? 409  VAL B C     1 
ATOM   8064  O O     . VAL B 1 409 ? -28.382 73.664  34.793  1.00 24.88 ? 409  VAL B O     1 
ATOM   8065  C CB    . VAL B 1 409 ? -26.009 71.853  34.883  1.00 24.70 ? 409  VAL B CB    1 
ATOM   8066  C CG1   . VAL B 1 409 ? -26.505 70.992  33.718  1.00 23.57 ? 409  VAL B CG1   1 
ATOM   8067  C CG2   . VAL B 1 409 ? -24.619 71.397  35.327  1.00 23.49 ? 409  VAL B CG2   1 
ATOM   8068  N N     . VAL B 1 410 ? -27.503 74.292  32.801  1.00 24.37 ? 410  VAL B N     1 
ATOM   8069  C CA    . VAL B 1 410 ? -28.816 74.618  32.226  1.00 23.82 ? 410  VAL B CA    1 
ATOM   8070  C C     . VAL B 1 410 ? -29.350 73.456  31.399  1.00 23.75 ? 410  VAL B C     1 
ATOM   8071  O O     . VAL B 1 410 ? -28.871 73.180  30.277  1.00 23.53 ? 410  VAL B O     1 
ATOM   8072  C CB    . VAL B 1 410 ? -28.862 75.971  31.455  1.00 24.03 ? 410  VAL B CB    1 
ATOM   8073  C CG1   . VAL B 1 410 ? -28.747 77.145  32.448  1.00 23.92 ? 410  VAL B CG1   1 
ATOM   8074  C CG2   . VAL B 1 410 ? -27.796 76.036  30.317  1.00 23.40 ? 410  VAL B CG2   1 
ATOM   8075  N N     . ASP B 1 411 ? -30.323 72.762  31.988  1.00 23.20 ? 411  ASP B N     1 
ATOM   8076  C CA    . ASP B 1 411 ? -30.942 71.612  31.366  1.00 23.03 ? 411  ASP B CA    1 
ATOM   8077  C C     . ASP B 1 411 ? -32.156 72.166  30.658  1.00 23.22 ? 411  ASP B C     1 
ATOM   8078  O O     . ASP B 1 411 ? -33.123 72.575  31.292  1.00 23.04 ? 411  ASP B O     1 
ATOM   8079  C CB    . ASP B 1 411 ? -31.318 70.604  32.433  1.00 22.81 ? 411  ASP B CB    1 
ATOM   8080  C CG    . ASP B 1 411 ? -32.182 69.489  31.917  1.00 23.54 ? 411  ASP B CG    1 
ATOM   8081  O OD1   . ASP B 1 411 ? -32.446 69.436  30.680  1.00 23.05 ? 411  ASP B OD1   1 
ATOM   8082  O OD2   . ASP B 1 411 ? -32.608 68.668  32.777  1.00 23.44 ? 411  ASP B OD2   1 
ATOM   8083  N N     . THR B 1 412 ? -32.074 72.217  29.332  1.00 23.41 ? 412  THR B N     1 
ATOM   8084  C CA    . THR B 1 412 ? -33.076 72.895  28.532  1.00 23.44 ? 412  THR B CA    1 
ATOM   8085  C C     . THR B 1 412 ? -33.978 71.884  27.856  1.00 23.77 ? 412  THR B C     1 
ATOM   8086  O O     . THR B 1 412 ? -33.540 71.090  26.997  1.00 22.85 ? 412  THR B O     1 
ATOM   8087  C CB    . THR B 1 412 ? -32.442 73.824  27.431  1.00 23.88 ? 412  THR B CB    1 
ATOM   8088  O OG1   . THR B 1 412 ? -31.615 73.050  26.544  1.00 22.84 ? 412  THR B OG1   1 
ATOM   8089  C CG2   . THR B 1 412 ? -31.622 74.959  28.060  1.00 23.95 ? 412  THR B CG2   1 
ATOM   8090  N N     . TRP B 1 413 ? -35.239 71.912  28.275  1.00 24.05 ? 413  TRP B N     1 
ATOM   8091  C CA    . TRP B 1 413 ? -36.301 71.212  27.577  1.00 23.75 ? 413  TRP B CA    1 
ATOM   8092  C C     . TRP B 1 413 ? -36.882 72.105  26.474  1.00 23.51 ? 413  TRP B C     1 
ATOM   8093  O O     . TRP B 1 413 ? -37.322 73.243  26.723  1.00 23.63 ? 413  TRP B O     1 
ATOM   8094  C CB    . TRP B 1 413 ? -37.413 70.725  28.545  1.00 24.47 ? 413  TRP B CB    1 
ATOM   8095  C CG    . TRP B 1 413 ? -38.458 70.029  27.748  1.00 24.44 ? 413  TRP B CG    1 
ATOM   8096  C CD1   . TRP B 1 413 ? -38.403 68.762  27.277  1.00 24.47 ? 413  TRP B CD1   1 
ATOM   8097  C CD2   . TRP B 1 413 ? -39.640 70.615  27.205  1.00 24.55 ? 413  TRP B CD2   1 
ATOM   8098  N NE1   . TRP B 1 413 ? -39.494 68.499  26.498  1.00 25.18 ? 413  TRP B NE1   1 
ATOM   8099  C CE2   . TRP B 1 413 ? -40.272 69.624  26.430  1.00 24.71 ? 413  TRP B CE2   1 
ATOM   8100  C CE3   . TRP B 1 413 ? -40.234 71.882  27.312  1.00 24.33 ? 413  TRP B CE3   1 
ATOM   8101  C CZ2   . TRP B 1 413 ? -41.495 69.847  25.754  1.00 26.04 ? 413  TRP B CZ2   1 
ATOM   8102  C CZ3   . TRP B 1 413 ? -41.443 72.115  26.639  1.00 25.66 ? 413  TRP B CZ3   1 
ATOM   8103  C CH2   . TRP B 1 413 ? -42.060 71.095  25.861  1.00 25.53 ? 413  TRP B CH2   1 
ATOM   8104  N N     . TRP B 1 414 ? -36.861 71.581  25.255  1.00 23.45 ? 414  TRP B N     1 
ATOM   8105  C CA    . TRP B 1 414 ? -37.555 72.166  24.115  1.00 23.58 ? 414  TRP B CA    1 
ATOM   8106  C C     . TRP B 1 414 ? -37.574 71.124  23.022  1.00 24.18 ? 414  TRP B C     1 
ATOM   8107  O O     . TRP B 1 414 ? -37.283 69.957  23.285  1.00 25.21 ? 414  TRP B O     1 
ATOM   8108  C CB    . TRP B 1 414 ? -36.920 73.475  23.638  1.00 23.34 ? 414  TRP B CB    1 
ATOM   8109  C CG    . TRP B 1 414 ? -35.527 73.340  23.129  1.00 23.41 ? 414  TRP B CG    1 
ATOM   8110  C CD1   . TRP B 1 414 ? -34.439 72.938  23.838  1.00 23.01 ? 414  TRP B CD1   1 
ATOM   8111  C CD2   . TRP B 1 414 ? -35.058 73.631  21.803  1.00 23.62 ? 414  TRP B CD2   1 
ATOM   8112  N NE1   . TRP B 1 414 ? -33.330 72.947  23.042  1.00 24.74 ? 414  TRP B NE1   1 
ATOM   8113  C CE2   . TRP B 1 414 ? -33.677 73.367  21.785  1.00 24.21 ? 414  TRP B CE2   1 
ATOM   8114  C CE3   . TRP B 1 414 ? -35.672 74.087  20.632  1.00 23.72 ? 414  TRP B CE3   1 
ATOM   8115  C CZ2   . TRP B 1 414 ? -32.889 73.528  20.630  1.00 23.96 ? 414  TRP B CZ2   1 
ATOM   8116  C CZ3   . TRP B 1 414 ? -34.888 74.249  19.477  1.00 23.37 ? 414  TRP B CZ3   1 
ATOM   8117  C CH2   . TRP B 1 414 ? -33.515 73.964  19.489  1.00 23.05 ? 414  TRP B CH2   1 
ATOM   8118  N N     . GLN B 1 415 ? -37.914 71.532  21.802  1.00 24.33 ? 415  GLN B N     1 
ATOM   8119  C CA    . GLN B 1 415 ? -38.104 70.608  20.688  1.00 25.00 ? 415  GLN B CA    1 
ATOM   8120  C C     . GLN B 1 415 ? -38.097 71.350  19.372  1.00 24.89 ? 415  GLN B C     1 
ATOM   8121  O O     . GLN B 1 415 ? -38.123 72.575  19.344  1.00 25.07 ? 415  GLN B O     1 
ATOM   8122  C CB    . GLN B 1 415 ? -39.414 69.773  20.825  1.00 25.08 ? 415  GLN B CB    1 
ATOM   8123  C CG    . GLN B 1 415 ? -40.523 70.351  21.718  1.00 24.76 ? 415  GLN B CG    1 
ATOM   8124  C CD    . GLN B 1 415 ? -41.782 69.480  21.758  1.00 26.03 ? 415  GLN B CD    1 
ATOM   8125  O OE1   . GLN B 1 415 ? -42.872 69.949  21.416  1.00 26.35 ? 415  GLN B OE1   1 
ATOM   8126  N NE2   . GLN B 1 415 ? -41.639 68.207  22.178  1.00 25.66 ? 415  GLN B NE2   1 
ATOM   8127  N N     . THR B 1 416 ? -38.094 70.607  18.273  1.00 25.23 ? 416  THR B N     1 
ATOM   8128  C CA    . THR B 1 416 ? -37.980 71.235  16.946  1.00 25.10 ? 416  THR B CA    1 
ATOM   8129  C C     . THR B 1 416 ? -39.083 72.258  16.728  1.00 25.30 ? 416  THR B C     1 
ATOM   8130  O O     . THR B 1 416 ? -38.838 73.373  16.251  1.00 25.31 ? 416  THR B O     1 
ATOM   8131  C CB    . THR B 1 416 ? -38.051 70.198  15.838  1.00 24.50 ? 416  THR B CB    1 
ATOM   8132  O OG1   . THR B 1 416 ? -37.066 69.200  16.094  1.00 23.41 ? 416  THR B OG1   1 
ATOM   8133  C CG2   . THR B 1 416 ? -37.812 70.848  14.467  1.00 24.41 ? 416  THR B CG2   1 
ATOM   8134  N N     . GLU B 1 417 ? -40.294 71.863  17.121  1.00 25.30 ? 417  GLU B N     1 
ATOM   8135  C CA    . GLU B 1 417 ? -41.505 72.615  16.848  1.00 24.02 ? 417  GLU B CA    1 
ATOM   8136  C C     . GLU B 1 417 ? -41.598 73.861  17.693  1.00 23.39 ? 417  GLU B C     1 
ATOM   8137  O O     . GLU B 1 417 ? -42.418 74.731  17.405  1.00 23.32 ? 417  GLU B O     1 
ATOM   8138  C CB    . GLU B 1 417 ? -42.732 71.715  17.035  1.00 24.76 ? 417  GLU B CB    1 
ATOM   8139  C CG    . GLU B 1 417 ? -42.826 70.537  16.021  1.00 24.55 ? 417  GLU B CG    1 
ATOM   8140  C CD    . GLU B 1 417 ? -42.244 69.210  16.547  1.00 24.50 ? 417  GLU B CD    1 
ATOM   8141  O OE1   . GLU B 1 417 ? -41.500 69.193  17.547  1.00 23.62 ? 417  GLU B OE1   1 
ATOM   8142  O OE2   . GLU B 1 417 ? -42.554 68.156  15.955  1.00 24.93 ? 417  GLU B OE2   1 
ATOM   8143  N N     . THR B 1 418 ? -40.734 73.978  18.704  1.00 23.09 ? 418  THR B N     1 
ATOM   8144  C CA    . THR B 1 418 ? -40.755 75.160  19.604  1.00 23.11 ? 418  THR B CA    1 
ATOM   8145  C C     . THR B 1 418 ? -39.718 76.249  19.283  1.00 23.82 ? 418  THR B C     1 
ATOM   8146  O O     . THR B 1 418 ? -39.773 77.346  19.853  1.00 24.49 ? 418  THR B O     1 
ATOM   8147  C CB    . THR B 1 418 ? -40.625 74.809  21.120  1.00 22.77 ? 418  THR B CB    1 
ATOM   8148  O OG1   . THR B 1 418 ? -39.283 74.422  21.431  1.00 22.43 ? 418  THR B OG1   1 
ATOM   8149  C CG2   . THR B 1 418 ? -41.612 73.744  21.560  1.00 20.78 ? 418  THR B CG2   1 
ATOM   8150  N N     . GLY B 1 419 ? -38.767 75.945  18.408  1.00 23.70 ? 419  GLY B N     1 
ATOM   8151  C CA    . GLY B 1 419 ? -37.817 76.952  17.926  1.00 24.14 ? 419  GLY B CA    1 
ATOM   8152  C C     . GLY B 1 419 ? -36.648 77.286  18.831  1.00 24.04 ? 419  GLY B C     1 
ATOM   8153  O O     . GLY B 1 419 ? -35.539 77.509  18.354  1.00 24.09 ? 419  GLY B O     1 
ATOM   8154  N N     . GLY B 1 420 ? -36.906 77.327  20.136  1.00 23.99 ? 420  GLY B N     1 
ATOM   8155  C CA    . GLY B 1 420 ? -35.879 77.596  21.151  1.00 23.54 ? 420  GLY B CA    1 
ATOM   8156  C C     . GLY B 1 420 ? -36.347 77.097  22.513  1.00 23.37 ? 420  GLY B C     1 
ATOM   8157  O O     . GLY B 1 420 ? -37.419 76.459  22.613  1.00 23.36 ? 420  GLY B O     1 
ATOM   8158  N N     . PHE B 1 421 ? -35.558 77.398  23.552  1.00 22.98 ? 421  PHE B N     1 
ATOM   8159  C CA    . PHE B 1 421 ? -35.782 76.908  24.935  1.00 22.79 ? 421  PHE B CA    1 
ATOM   8160  C C     . PHE B 1 421 ? -37.182 77.185  25.466  1.00 22.76 ? 421  PHE B C     1 
ATOM   8161  O O     . PHE B 1 421 ? -37.711 78.259  25.236  1.00 23.16 ? 421  PHE B O     1 
ATOM   8162  C CB    . PHE B 1 421 ? -34.744 77.499  25.906  1.00 22.61 ? 421  PHE B CB    1 
ATOM   8163  C CG    . PHE B 1 421 ? -33.284 77.301  25.467  1.00 23.49 ? 421  PHE B CG    1 
ATOM   8164  C CD1   . PHE B 1 421 ? -32.287 78.210  25.877  1.00 22.08 ? 421  PHE B CD1   1 
ATOM   8165  C CD2   . PHE B 1 421 ? -32.909 76.213  24.653  1.00 22.96 ? 421  PHE B CD2   1 
ATOM   8166  C CE1   . PHE B 1 421 ? -30.935 78.047  25.476  1.00 22.71 ? 421  PHE B CE1   1 
ATOM   8167  C CE2   . PHE B 1 421 ? -31.560 76.031  24.247  1.00 24.15 ? 421  PHE B CE2   1 
ATOM   8168  C CZ    . PHE B 1 421 ? -30.565 76.961  24.658  1.00 23.27 ? 421  PHE B CZ    1 
ATOM   8169  N N     . MET B 1 422 ? -37.779 76.224  26.177  1.00 23.05 ? 422  MET B N     1 
ATOM   8170  C CA    . MET B 1 422 ? -39.130 76.393  26.735  1.00 22.91 ? 422  MET B CA    1 
ATOM   8171  C C     . MET B 1 422 ? -39.163 76.268  28.269  1.00 23.75 ? 422  MET B C     1 
ATOM   8172  O O     . MET B 1 422 ? -39.854 77.032  28.989  1.00 23.51 ? 422  MET B O     1 
ATOM   8173  C CB    . MET B 1 422 ? -40.103 75.382  26.124  1.00 22.64 ? 422  MET B CB    1 
ATOM   8174  C CG    . MET B 1 422 ? -40.233 75.453  24.628  1.00 21.97 ? 422  MET B CG    1 
ATOM   8175  S SD    . MET B 1 422 ? -41.115 76.930  24.069  1.00 21.83 ? 422  MET B SD    1 
ATOM   8176  C CE    . MET B 1 422 ? -42.823 76.457  24.323  1.00 19.88 ? 422  MET B CE    1 
ATOM   8177  N N     . ILE B 1 423 ? -38.443 75.278  28.773  1.00 23.87 ? 423  ILE B N     1 
ATOM   8178  C CA    . ILE B 1 423 ? -38.339 75.110  30.212  1.00 23.92 ? 423  ILE B CA    1 
ATOM   8179  C C     . ILE B 1 423 ? -36.858 74.863  30.465  1.00 24.75 ? 423  ILE B C     1 
ATOM   8180  O O     . ILE B 1 423 ? -36.241 73.971  29.849  1.00 24.13 ? 423  ILE B O     1 
ATOM   8181  C CB    . ILE B 1 423 ? -39.213 73.959  30.734  1.00 23.64 ? 423  ILE B CB    1 
ATOM   8182  C CG1   . ILE B 1 423 ? -40.679 74.188  30.366  1.00 22.36 ? 423  ILE B CG1   1 
ATOM   8183  C CG2   . ILE B 1 423 ? -39.022 73.800  32.227  1.00 22.99 ? 423  ILE B CG2   1 
ATOM   8184  C CD1   . ILE B 1 423 ? -41.610 72.986  30.670  1.00 23.85 ? 423  ILE B CD1   1 
ATOM   8185  N N     . THR B 1 424 ? -36.299 75.686  31.347  1.00 25.20 ? 424  THR B N     1 
ATOM   8186  C CA    . THR B 1 424 ? -34.867 75.846  31.445  1.00 26.45 ? 424  THR B CA    1 
ATOM   8187  C C     . THR B 1 424 ? -34.520 76.677  32.667  1.00 27.10 ? 424  THR B C     1 
ATOM   8188  O O     . THR B 1 424 ? -35.264 77.593  33.020  1.00 27.57 ? 424  THR B O     1 
ATOM   8189  C CB    . THR B 1 424 ? -34.304 76.551  30.175  1.00 26.46 ? 424  THR B CB    1 
ATOM   8190  O OG1   . THR B 1 424 ? -32.892 76.704  30.300  1.00 26.27 ? 424  THR B OG1   1 
ATOM   8191  C CG2   . THR B 1 424 ? -34.938 77.931  29.949  1.00 26.83 ? 424  THR B CG2   1 
ATOM   8192  N N     . PRO B 1 425 ? -33.394 76.370  33.325  1.00 27.20 ? 425  PRO B N     1 
ATOM   8193  C CA    . PRO B 1 425 ? -32.910 77.356  34.297  1.00 27.41 ? 425  PRO B CA    1 
ATOM   8194  C C     . PRO B 1 425 ? -32.326 78.608  33.606  1.00 27.58 ? 425  PRO B C     1 
ATOM   8195  O O     . PRO B 1 425 ? -32.041 78.601  32.410  1.00 27.41 ? 425  PRO B O     1 
ATOM   8196  C CB    . PRO B 1 425 ? -31.806 76.596  35.069  1.00 27.24 ? 425  PRO B CB    1 
ATOM   8197  C CG    . PRO B 1 425 ? -31.993 75.126  34.707  1.00 27.31 ? 425  PRO B CG    1 
ATOM   8198  C CD    . PRO B 1 425 ? -32.554 75.166  33.294  1.00 27.47 ? 425  PRO B CD    1 
ATOM   8199  N N     . LEU B 1 426 ? -32.193 79.682  34.366  1.00 27.72 ? 426  LEU B N     1 
ATOM   8200  C CA    . LEU B 1 426 ? -31.353 80.798  33.978  1.00 27.99 ? 426  LEU B CA    1 
ATOM   8201  C C     . LEU B 1 426 ? -30.296 80.816  35.075  1.00 27.92 ? 426  LEU B C     1 
ATOM   8202  O O     . LEU B 1 426 ? -30.648 80.758  36.248  1.00 28.22 ? 426  LEU B O     1 
ATOM   8203  C CB    . LEU B 1 426 ? -32.160 82.111  33.916  1.00 27.74 ? 426  LEU B CB    1 
ATOM   8204  C CG    . LEU B 1 426 ? -32.886 82.398  32.586  1.00 28.13 ? 426  LEU B CG    1 
ATOM   8205  C CD1   . LEU B 1 426 ? -34.160 81.560  32.424  1.00 29.52 ? 426  LEU B CD1   1 
ATOM   8206  C CD2   . LEU B 1 426 ? -33.237 83.861  32.464  1.00 28.10 ? 426  LEU B CD2   1 
ATOM   8207  N N     . PRO B 1 427 ? -29.006 80.901  34.707  1.00 27.96 ? 427  PRO B N     1 
ATOM   8208  C CA    . PRO B 1 427 ? -27.903 80.511  35.622  1.00 27.94 ? 427  PRO B CA    1 
ATOM   8209  C C     . PRO B 1 427 ? -27.821 81.354  36.903  1.00 27.74 ? 427  PRO B C     1 
ATOM   8210  O O     . PRO B 1 427 ? -27.386 80.853  37.931  1.00 27.24 ? 427  PRO B O     1 
ATOM   8211  C CB    . PRO B 1 427 ? -26.645 80.764  34.786  1.00 28.26 ? 427  PRO B CB    1 
ATOM   8212  C CG    . PRO B 1 427 ? -27.126 80.892  33.356  1.00 27.49 ? 427  PRO B CG    1 
ATOM   8213  C CD    . PRO B 1 427 ? -28.503 81.444  33.433  1.00 27.81 ? 427  PRO B CD    1 
ATOM   8214  N N     . GLY B 1 428 ? -28.240 82.623  36.824  1.00 27.41 ? 428  GLY B N     1 
ATOM   8215  C CA    . GLY B 1 428 ? -28.266 83.512  37.982  1.00 26.10 ? 428  GLY B CA    1 
ATOM   8216  C C     . GLY B 1 428 ? -29.641 83.742  38.580  1.00 25.84 ? 428  GLY B C     1 
ATOM   8217  O O     . GLY B 1 428 ? -29.785 84.548  39.503  1.00 25.90 ? 428  GLY B O     1 
ATOM   8218  N N     . ALA B 1 429 ? -30.653 83.033  38.080  1.00 25.38 ? 429  ALA B N     1 
ATOM   8219  C CA    . ALA B 1 429 ? -32.041 83.287  38.489  1.00 24.88 ? 429  ALA B CA    1 
ATOM   8220  C C     . ALA B 1 429 ? -32.683 82.136  39.252  1.00 24.60 ? 429  ALA B C     1 
ATOM   8221  O O     . ALA B 1 429 ? -33.406 82.355  40.196  1.00 24.62 ? 429  ALA B O     1 
ATOM   8222  C CB    . ALA B 1 429 ? -32.897 83.674  37.277  1.00 24.23 ? 429  ALA B CB    1 
ATOM   8223  N N     . ILE B 1 430 ? -32.404 80.911  38.833  1.00 25.06 ? 430  ILE B N     1 
ATOM   8224  C CA    . ILE B 1 430 ? -33.124 79.730  39.295  1.00 24.69 ? 430  ILE B CA    1 
ATOM   8225  C C     . ILE B 1 430 ? -32.120 78.740  39.910  1.00 25.02 ? 430  ILE B C     1 
ATOM   8226  O O     . ILE B 1 430 ? -31.169 78.306  39.241  1.00 25.09 ? 430  ILE B O     1 
ATOM   8227  C CB    . ILE B 1 430 ? -33.902 79.054  38.088  1.00 24.89 ? 430  ILE B CB    1 
ATOM   8228  C CG1   . ILE B 1 430 ? -34.981 79.999  37.533  1.00 25.27 ? 430  ILE B CG1   1 
ATOM   8229  C CG2   . ILE B 1 430 ? -34.549 77.742  38.488  1.00 22.75 ? 430  ILE B CG2   1 
ATOM   8230  C CD1   . ILE B 1 430 ? -35.281 79.871  36.048  1.00 24.15 ? 430  ILE B CD1   1 
ATOM   8231  N N     . GLU B 1 431 ? -32.348 78.373  41.171  1.00 24.71 ? 431  GLU B N     1 
ATOM   8232  C CA    . GLU B 1 431 ? -31.586 77.305  41.837  1.00 24.84 ? 431  GLU B CA    1 
ATOM   8233  C C     . GLU B 1 431 ? -31.853 75.938  41.223  1.00 25.02 ? 431  GLU B C     1 
ATOM   8234  O O     . GLU B 1 431 ? -32.991 75.626  40.846  1.00 25.39 ? 431  GLU B O     1 
ATOM   8235  C CB    . GLU B 1 431 ? -31.897 77.256  43.330  1.00 24.80 ? 431  GLU B CB    1 
ATOM   8236  C CG    . GLU B 1 431 ? -31.363 78.418  44.123  1.00 25.30 ? 431  GLU B CG    1 
ATOM   8237  C CD    . GLU B 1 431 ? -31.904 78.428  45.536  1.00 28.50 ? 431  GLU B CD    1 
ATOM   8238  O OE1   . GLU B 1 431 ? -33.110 78.130  45.706  1.00 31.01 ? 431  GLU B OE1   1 
ATOM   8239  O OE2   . GLU B 1 431 ? -31.135 78.738  46.475  1.00 27.43 ? 431  GLU B OE2   1 
ATOM   8240  N N     . LEU B 1 432 ? -30.810 75.116  41.157  1.00 24.93 ? 432  LEU B N     1 
ATOM   8241  C CA    . LEU B 1 432 ? -30.857 73.885  40.374  1.00 25.02 ? 432  LEU B CA    1 
ATOM   8242  C C     . LEU B 1 432 ? -31.175 72.658  41.184  1.00 25.38 ? 432  LEU B C     1 
ATOM   8243  O O     . LEU B 1 432 ? -30.682 72.494  42.304  1.00 25.78 ? 432  LEU B O     1 
ATOM   8244  C CB    . LEU B 1 432 ? -29.517 73.652  39.674  1.00 24.87 ? 432  LEU B CB    1 
ATOM   8245  C CG    . LEU B 1 432 ? -28.936 74.827  38.895  1.00 24.64 ? 432  LEU B CG    1 
ATOM   8246  C CD1   . LEU B 1 432 ? -27.555 74.467  38.380  1.00 26.15 ? 432  LEU B CD1   1 
ATOM   8247  C CD2   . LEU B 1 432 ? -29.857 75.244  37.756  1.00 23.96 ? 432  LEU B CD2   1 
ATOM   8248  N N     . LYS B 1 433 ? -32.000 71.792  40.604  1.00 25.69 ? 433  LYS B N     1 
ATOM   8249  C CA    . LYS B 1 433 ? -32.147 70.411  41.083  1.00 25.97 ? 433  LYS B CA    1 
ATOM   8250  C C     . LYS B 1 433 ? -31.732 69.492  39.938  1.00 25.77 ? 433  LYS B C     1 
ATOM   8251  O O     . LYS B 1 433 ? -32.224 69.650  38.796  1.00 25.97 ? 433  LYS B O     1 
ATOM   8252  C CB    . LYS B 1 433 ? -33.589 70.077  41.508  1.00 26.19 ? 433  LYS B CB    1 
ATOM   8253  C CG    . LYS B 1 433 ? -34.347 71.145  42.319  1.00 26.05 ? 433  LYS B CG    1 
ATOM   8254  C CD    . LYS B 1 433 ? -35.785 70.688  42.601  1.00 26.39 ? 433  LYS B CD    1 
ATOM   8255  C CE    . LYS B 1 433 ? -36.475 71.550  43.671  1.00 27.63 ? 433  LYS B CE    1 
ATOM   8256  N NZ    . LYS B 1 433 ? -37.778 70.983  44.152  1.00 25.50 ? 433  LYS B NZ    1 
ATOM   8257  N N     . ALA B 1 434 ? -30.848 68.542  40.256  1.00 25.14 ? 434  ALA B N     1 
ATOM   8258  C CA    . ALA B 1 434 ? -30.240 67.620  39.292  1.00 24.89 ? 434  ALA B CA    1 
ATOM   8259  C C     . ALA B 1 434 ? -31.302 66.837  38.529  1.00 24.67 ? 434  ALA B C     1 
ATOM   8260  O O     . ALA B 1 434 ? -32.126 66.150  39.130  1.00 24.76 ? 434  ALA B O     1 
ATOM   8261  C CB    . ALA B 1 434 ? -29.248 66.663  40.009  1.00 24.15 ? 434  ALA B CB    1 
ATOM   8262  N N     . GLY B 1 435 ? -31.316 66.975  37.209  1.00 24.47 ? 435  GLY B N     1 
ATOM   8263  C CA    . GLY B 1 435 ? -32.306 66.247  36.395  1.00 25.01 ? 435  GLY B CA    1 
ATOM   8264  C C     . GLY B 1 435 ? -33.639 66.957  36.153  1.00 24.66 ? 435  GLY B C     1 
ATOM   8265  O O     . GLY B 1 435 ? -34.544 66.396  35.523  1.00 24.65 ? 435  GLY B O     1 
ATOM   8266  N N     . SER B 1 436 ? -33.775 68.185  36.656  1.00 24.21 ? 436  SER B N     1 
ATOM   8267  C CA    . SER B 1 436 ? -35.005 68.974  36.431  1.00 23.66 ? 436  SER B CA    1 
ATOM   8268  C C     . SER B 1 436 ? -34.765 70.113  35.421  1.00 22.97 ? 436  SER B C     1 
ATOM   8269  O O     . SER B 1 436 ? -33.729 70.776  35.436  1.00 22.20 ? 436  SER B O     1 
ATOM   8270  C CB    . SER B 1 436 ? -35.566 69.496  37.772  1.00 23.51 ? 436  SER B CB    1 
ATOM   8271  O OG    . SER B 1 436 ? -36.531 70.518  37.580  1.00 23.27 ? 436  SER B OG    1 
ATOM   8272  N N     . ALA B 1 437 ? -35.718 70.335  34.530  1.00 23.13 ? 437  ALA B N     1 
ATOM   8273  C CA    . ALA B 1 437 ? -35.573 71.423  33.562  1.00 23.31 ? 437  ALA B CA    1 
ATOM   8274  C C     . ALA B 1 437 ? -35.937 72.744  34.196  1.00 23.24 ? 437  ALA B C     1 
ATOM   8275  O O     . ALA B 1 437 ? -35.576 73.792  33.685  1.00 23.93 ? 437  ALA B O     1 
ATOM   8276  C CB    . ALA B 1 437 ? -36.383 71.159  32.307  1.00 23.33 ? 437  ALA B CB    1 
ATOM   8277  N N     . THR B 1 438 ? -36.615 72.667  35.338  1.00 23.42 ? 438  THR B N     1 
ATOM   8278  C CA    . THR B 1 438 ? -37.022 73.809  36.188  1.00 23.62 ? 438  THR B CA    1 
ATOM   8279  C C     . THR B 1 438 ? -38.245 74.601  35.670  1.00 24.15 ? 438  THR B C     1 
ATOM   8280  O O     . THR B 1 438 ? -39.336 74.050  35.575  1.00 24.79 ? 438  THR B O     1 
ATOM   8281  C CB    . THR B 1 438 ? -35.839 74.733  36.663  1.00 23.45 ? 438  THR B CB    1 
ATOM   8282  O OG1   . THR B 1 438 ? -35.493 75.678  35.639  1.00 24.90 ? 438  THR B OG1   1 
ATOM   8283  C CG2   . THR B 1 438 ? -34.591 73.918  37.097  1.00 21.86 ? 438  THR B CG2   1 
ATOM   8284  N N     . ARG B 1 439 ? -38.080 75.878  35.343  1.00 24.65 ? 439  ARG B N     1 
ATOM   8285  C CA    . ARG B 1 439 ? -39.226 76.782  35.169  1.00 24.72 ? 439  ARG B CA    1 
ATOM   8286  C C     . ARG B 1 439 ? -39.440 77.171  33.698  1.00 25.09 ? 439  ARG B C     1 
ATOM   8287  O O     . ARG B 1 439 ? -38.490 77.149  32.916  1.00 25.22 ? 439  ARG B O     1 
ATOM   8288  C CB    . ARG B 1 439 ? -39.028 78.039  36.032  1.00 24.60 ? 439  ARG B CB    1 
ATOM   8289  C CG    . ARG B 1 439 ? -38.888 77.777  37.553  1.00 24.08 ? 439  ARG B CG    1 
ATOM   8290  C CD    . ARG B 1 439 ? -39.064 79.081  38.332  1.00 25.12 ? 439  ARG B CD    1 
ATOM   8291  N NE    . ARG B 1 439 ? -38.980 78.905  39.781  1.00 28.03 ? 439  ARG B NE    1 
ATOM   8292  C CZ    . ARG B 1 439 ? -39.994 78.508  40.556  1.00 29.28 ? 439  ARG B CZ    1 
ATOM   8293  N NH1   . ARG B 1 439 ? -41.184 78.230  40.019  1.00 27.27 ? 439  ARG B NH1   1 
ATOM   8294  N NH2   . ARG B 1 439 ? -39.814 78.368  41.870  1.00 28.66 ? 439  ARG B NH2   1 
ATOM   8295  N N     . PRO B 1 440 ? -40.686 77.539  33.309  1.00 24.99 ? 440  PRO B N     1 
ATOM   8296  C CA    . PRO B 1 440 ? -40.888 77.956  31.919  1.00 24.61 ? 440  PRO B CA    1 
ATOM   8297  C C     . PRO B 1 440 ? -40.094 79.211  31.580  1.00 24.51 ? 440  PRO B C     1 
ATOM   8298  O O     . PRO B 1 440 ? -39.958 80.096  32.426  1.00 25.62 ? 440  PRO B O     1 
ATOM   8299  C CB    . PRO B 1 440 ? -42.378 78.251  31.857  1.00 24.69 ? 440  PRO B CB    1 
ATOM   8300  C CG    . PRO B 1 440 ? -42.774 78.520  33.308  1.00 25.14 ? 440  PRO B CG    1 
ATOM   8301  C CD    . PRO B 1 440 ? -41.942 77.587  34.085  1.00 25.10 ? 440  PRO B CD    1 
ATOM   8302  N N     . PHE B 1 441 ? -39.569 79.292  30.361  1.00 23.41 ? 441  PHE B N     1 
ATOM   8303  C CA    . PHE B 1 441 ? -38.958 80.517  29.903  1.00 22.66 ? 441  PHE B CA    1 
ATOM   8304  C C     . PHE B 1 441 ? -40.018 81.610  29.715  1.00 23.25 ? 441  PHE B C     1 
ATOM   8305  O O     . PHE B 1 441 ? -41.224 81.343  29.753  1.00 23.29 ? 441  PHE B O     1 
ATOM   8306  C CB    . PHE B 1 441 ? -38.177 80.265  28.604  1.00 22.59 ? 441  PHE B CB    1 
ATOM   8307  C CG    . PHE B 1 441 ? -37.253 81.392  28.229  1.00 20.88 ? 441  PHE B CG    1 
ATOM   8308  C CD1   . PHE B 1 441 ? -36.058 81.591  28.936  1.00 17.20 ? 441  PHE B CD1   1 
ATOM   8309  C CD2   . PHE B 1 441 ? -37.600 82.283  27.197  1.00 18.47 ? 441  PHE B CD2   1 
ATOM   8310  C CE1   . PHE B 1 441 ? -35.210 82.639  28.621  1.00 15.47 ? 441  PHE B CE1   1 
ATOM   8311  C CE2   . PHE B 1 441 ? -36.756 83.359  26.873  1.00 18.29 ? 441  PHE B CE2   1 
ATOM   8312  C CZ    . PHE B 1 441 ? -35.557 83.540  27.594  1.00 18.34 ? 441  PHE B CZ    1 
ATOM   8313  N N     . PHE B 1 442 ? -39.572 82.848  29.535  1.00 23.59 ? 442  PHE B N     1 
ATOM   8314  C CA    . PHE B 1 442 ? -40.469 83.963  29.228  1.00 23.84 ? 442  PHE B CA    1 
ATOM   8315  C C     . PHE B 1 442 ? -41.421 83.656  28.058  1.00 24.24 ? 442  PHE B C     1 
ATOM   8316  O O     . PHE B 1 442 ? -41.012 83.128  27.034  1.00 23.69 ? 442  PHE B O     1 
ATOM   8317  C CB    . PHE B 1 442 ? -39.657 85.209  28.884  1.00 23.94 ? 442  PHE B CB    1 
ATOM   8318  C CG    . PHE B 1 442 ? -38.578 85.553  29.888  1.00 23.29 ? 442  PHE B CG    1 
ATOM   8319  C CD1   . PHE B 1 442 ? -37.345 86.001  29.446  1.00 22.42 ? 442  PHE B CD1   1 
ATOM   8320  C CD2   . PHE B 1 442 ? -38.801 85.446  31.259  1.00 22.92 ? 442  PHE B CD2   1 
ATOM   8321  C CE1   . PHE B 1 442 ? -36.338 86.339  30.359  1.00 24.23 ? 442  PHE B CE1   1 
ATOM   8322  C CE2   . PHE B 1 442 ? -37.797 85.767  32.186  1.00 22.74 ? 442  PHE B CE2   1 
ATOM   8323  C CZ    . PHE B 1 442 ? -36.568 86.222  31.737  1.00 23.64 ? 442  PHE B CZ    1 
ATOM   8324  N N     . GLY B 1 443 ? -42.700 83.976  28.219  1.00 24.49 ? 443  GLY B N     1 
ATOM   8325  C CA    . GLY B 1 443 ? -43.649 83.798  27.131  1.00 24.69 ? 443  GLY B CA    1 
ATOM   8326  C C     . GLY B 1 443 ? -44.179 82.385  26.991  1.00 25.24 ? 443  GLY B C     1 
ATOM   8327  O O     . GLY B 1 443 ? -45.082 82.134  26.172  1.00 24.92 ? 443  GLY B O     1 
ATOM   8328  N N     . VAL B 1 444 ? -43.626 81.474  27.803  1.00 25.75 ? 444  VAL B N     1 
ATOM   8329  C CA    . VAL B 1 444 ? -44.010 80.057  27.834  1.00 25.35 ? 444  VAL B CA    1 
ATOM   8330  C C     . VAL B 1 444 ? -44.966 79.733  28.995  1.00 26.25 ? 444  VAL B C     1 
ATOM   8331  O O     . VAL B 1 444 ? -44.637 79.944  30.175  1.00 25.93 ? 444  VAL B O     1 
ATOM   8332  C CB    . VAL B 1 444 ? -42.782 79.106  27.904  1.00 24.59 ? 444  VAL B CB    1 
ATOM   8333  C CG1   . VAL B 1 444 ? -43.221 77.654  27.820  1.00 23.72 ? 444  VAL B CG1   1 
ATOM   8334  C CG2   . VAL B 1 444 ? -41.804 79.399  26.798  1.00 23.54 ? 444  VAL B CG2   1 
ATOM   8335  N N     . GLN B 1 445 ? -46.136 79.190  28.634  1.00 26.93 ? 445  GLN B N     1 
ATOM   8336  C CA    . GLN B 1 445 ? -47.137 78.750  29.607  1.00 27.99 ? 445  GLN B CA    1 
ATOM   8337  C C     . GLN B 1 445 ? -47.403 77.242  29.518  1.00 27.27 ? 445  GLN B C     1 
ATOM   8338  O O     . GLN B 1 445 ? -48.232 76.798  28.709  1.00 27.38 ? 445  GLN B O     1 
ATOM   8339  C CB    . GLN B 1 445 ? -48.441 79.548  29.442  1.00 28.07 ? 445  GLN B CB    1 
ATOM   8340  C CG    . GLN B 1 445 ? -48.216 81.052  29.481  1.00 29.49 ? 445  GLN B CG    1 
ATOM   8341  C CD    . GLN B 1 445 ? -49.429 81.867  29.060  1.00 30.14 ? 445  GLN B CD    1 
ATOM   8342  O OE1   . GLN B 1 445 ? -50.495 81.824  29.701  1.00 30.60 ? 445  GLN B OE1   1 
ATOM   8343  N NE2   . GLN B 1 445 ? -49.263 82.642  27.985  1.00 32.59 ? 445  GLN B NE2   1 
ATOM   8344  N N     . PRO B 1 446 ? -46.701 76.452  30.350  1.00 26.98 ? 446  PRO B N     1 
ATOM   8345  C CA    . PRO B 1 446 ? -46.928 75.017  30.390  1.00 26.57 ? 446  PRO B CA    1 
ATOM   8346  C C     . PRO B 1 446 ? -48.083 74.644  31.311  1.00 26.34 ? 446  PRO B C     1 
ATOM   8347  O O     . PRO B 1 446 ? -48.410 75.390  32.225  1.00 26.10 ? 446  PRO B O     1 
ATOM   8348  C CB    . PRO B 1 446 ? -45.618 74.473  30.979  1.00 26.66 ? 446  PRO B CB    1 
ATOM   8349  C CG    . PRO B 1 446 ? -45.092 75.586  31.832  1.00 26.74 ? 446  PRO B CG    1 
ATOM   8350  C CD    . PRO B 1 446 ? -45.647 76.877  31.299  1.00 26.97 ? 446  PRO B CD    1 
ATOM   8351  N N     . ALA B 1 447 ? -48.684 73.487  31.040  1.00 26.27 ? 447  ALA B N     1 
ATOM   8352  C CA    . ALA B 1 447 ? -49.627 72.834  31.940  1.00 25.80 ? 447  ALA B CA    1 
ATOM   8353  C C     . ALA B 1 447 ? -49.513 71.318  31.763  1.00 25.70 ? 447  ALA B C     1 
ATOM   8354  O O     . ALA B 1 447 ? -48.984 70.839  30.756  1.00 25.76 ? 447  ALA B O     1 
ATOM   8355  C CB    . ALA B 1 447 ? -51.040 73.304  31.648  1.00 25.94 ? 447  ALA B CB    1 
ATOM   8356  N N     . LEU B 1 448 ? -50.003 70.566  32.744  1.00 25.82 ? 448  LEU B N     1 
ATOM   8357  C CA    . LEU B 1 448 ? -50.045 69.107  32.639  1.00 25.83 ? 448  LEU B CA    1 
ATOM   8358  C C     . LEU B 1 448 ? -51.491 68.660  32.646  1.00 25.81 ? 448  LEU B C     1 
ATOM   8359  O O     . LEU B 1 448 ? -52.292 69.133  33.452  1.00 26.10 ? 448  LEU B O     1 
ATOM   8360  C CB    . LEU B 1 448 ? -49.274 68.440  33.788  1.00 26.07 ? 448  LEU B CB    1 
ATOM   8361  C CG    . LEU B 1 448 ? -47.804 68.812  33.969  1.00 26.12 ? 448  LEU B CG    1 
ATOM   8362  C CD1   . LEU B 1 448 ? -47.268 68.177  35.237  1.00 26.38 ? 448  LEU B CD1   1 
ATOM   8363  C CD2   . LEU B 1 448 ? -47.001 68.386  32.756  1.00 24.30 ? 448  LEU B CD2   1 
ATOM   8364  N N     . VAL B 1 449 ? -51.837 67.761  31.739  1.00 25.56 ? 449  VAL B N     1 
ATOM   8365  C CA    . VAL B 1 449 ? -53.229 67.324  31.616  1.00 25.57 ? 449  VAL B CA    1 
ATOM   8366  C C     . VAL B 1 449 ? -53.283 65.817  31.735  1.00 26.00 ? 449  VAL B C     1 
ATOM   8367  O O     . VAL B 1 449 ? -52.304 65.129  31.402  1.00 26.77 ? 449  VAL B O     1 
ATOM   8368  C CB    . VAL B 1 449 ? -53.906 67.806  30.272  1.00 25.74 ? 449  VAL B CB    1 
ATOM   8369  C CG1   . VAL B 1 449 ? -53.984 69.345  30.207  1.00 24.73 ? 449  VAL B CG1   1 
ATOM   8370  C CG2   . VAL B 1 449 ? -53.218 67.209  29.007  1.00 24.09 ? 449  VAL B CG2   1 
ATOM   8371  N N     . ASP B 1 450 ? -54.397 65.284  32.210  1.00 25.83 ? 450  ASP B N     1 
ATOM   8372  C CA    . ASP B 1 450 ? -54.542 63.829  32.174  1.00 26.32 ? 450  ASP B CA    1 
ATOM   8373  C C     . ASP B 1 450 ? -54.956 63.396  30.768  1.00 26.32 ? 450  ASP B C     1 
ATOM   8374  O O     . ASP B 1 450 ? -55.103 64.238  29.888  1.00 26.17 ? 450  ASP B O     1 
ATOM   8375  C CB    . ASP B 1 450 ? -55.464 63.304  33.285  1.00 26.22 ? 450  ASP B CB    1 
ATOM   8376  C CG    . ASP B 1 450 ? -56.915 63.674  33.090  1.00 25.88 ? 450  ASP B CG    1 
ATOM   8377  O OD1   . ASP B 1 450 ? -57.300 64.243  32.047  1.00 26.47 ? 450  ASP B OD1   1 
ATOM   8378  O OD2   . ASP B 1 450 ? -57.687 63.368  34.005  1.00 26.19 ? 450  ASP B OD2   1 
ATOM   8379  N N     . ASN B 1 451 ? -55.120 62.099  30.539  1.00 27.09 ? 451  ASN B N     1 
ATOM   8380  C CA    . ASN B 1 451 ? -55.368 61.626  29.166  1.00 27.99 ? 451  ASN B CA    1 
ATOM   8381  C C     . ASN B 1 451 ? -56.714 62.079  28.578  1.00 28.51 ? 451  ASN B C     1 
ATOM   8382  O O     . ASN B 1 451 ? -56.900 62.010  27.365  1.00 28.77 ? 451  ASN B O     1 
ATOM   8383  C CB    . ASN B 1 451 ? -55.179 60.110  29.036  1.00 27.98 ? 451  ASN B CB    1 
ATOM   8384  C CG    . ASN B 1 451 ? -53.744 59.674  29.293  1.00 28.91 ? 451  ASN B CG    1 
ATOM   8385  O OD1   . ASN B 1 451 ? -52.784 60.433  29.071  1.00 29.68 ? 451  ASN B OD1   1 
ATOM   8386  N ND2   . ASN B 1 451 ? -53.587 58.441  29.765  1.00 27.20 ? 451  ASN B ND2   1 
ATOM   8387  N N     . GLU B 1 452 ? -57.625 62.550  29.436  1.00 28.80 ? 452  GLU B N     1 
ATOM   8388  C CA    . GLU B 1 452 ? -58.899 63.117  29.004  1.00 29.67 ? 452  GLU B CA    1 
ATOM   8389  C C     . GLU B 1 452 ? -58.823 64.666  28.968  1.00 29.86 ? 452  GLU B C     1 
ATOM   8390  O O     . GLU B 1 452 ? -59.855 65.353  28.872  1.00 29.51 ? 452  GLU B O     1 
ATOM   8391  C CB    . GLU B 1 452 ? -60.053 62.624  29.908  1.00 30.42 ? 452  GLU B CB    1 
ATOM   8392  C CG    . GLU B 1 452 ? -60.285 61.085  29.967  1.00 32.11 ? 452  GLU B CG    1 
ATOM   8393  C CD    . GLU B 1 452 ? -59.147 60.291  30.671  1.00 35.92 ? 452  GLU B CD    1 
ATOM   8394  O OE1   . GLU B 1 452 ? -58.784 60.586  31.839  1.00 36.61 ? 452  GLU B OE1   1 
ATOM   8395  O OE2   . GLU B 1 452 ? -58.609 59.351  30.046  1.00 37.43 ? 452  GLU B OE2   1 
ATOM   8396  N N     . GLY B 1 453 ? -57.595 65.199  29.047  1.00 29.92 ? 453  GLY B N     1 
ATOM   8397  C CA    . GLY B 1 453 ? -57.322 66.643  28.945  1.00 30.07 ? 453  GLY B CA    1 
ATOM   8398  C C     . GLY B 1 453 ? -57.702 67.556  30.112  1.00 30.37 ? 453  GLY B C     1 
ATOM   8399  O O     . GLY B 1 453 ? -57.738 68.779  29.955  1.00 30.11 ? 453  GLY B O     1 
ATOM   8400  N N     . HIS B 1 454 ? -58.004 66.965  31.272  1.00 30.62 ? 454  HIS B N     1 
ATOM   8401  C CA    . HIS B 1 454 ? -58.234 67.706  32.512  1.00 30.34 ? 454  HIS B CA    1 
ATOM   8402  C C     . HIS B 1 454 ? -56.907 68.278  33.048  1.00 30.17 ? 454  HIS B C     1 
ATOM   8403  O O     . HIS B 1 454 ? -56.016 67.521  33.391  1.00 30.10 ? 454  HIS B O     1 
ATOM   8404  C CB    . HIS B 1 454 ? -58.881 66.802  33.571  1.00 30.24 ? 454  HIS B CB    1 
ATOM   8405  C CG    . HIS B 1 454 ? -60.212 66.227  33.174  1.00 31.42 ? 454  HIS B CG    1 
ATOM   8406  N ND1   . HIS B 1 454 ? -60.494 64.877  33.256  1.00 33.35 ? 454  HIS B ND1   1 
ATOM   8407  C CD2   . HIS B 1 454 ? -61.348 66.816  32.721  1.00 32.12 ? 454  HIS B CD2   1 
ATOM   8408  C CE1   . HIS B 1 454 ? -61.736 64.657  32.850  1.00 32.51 ? 454  HIS B CE1   1 
ATOM   8409  N NE2   . HIS B 1 454 ? -62.277 65.818  32.524  1.00 32.08 ? 454  HIS B NE2   1 
ATOM   8410  N N     . PRO B 1 455 ? -56.764 69.622  33.107  1.00 30.31 ? 455  PRO B N     1 
ATOM   8411  C CA    . PRO B 1 455 ? -55.570 70.199  33.739  1.00 30.13 ? 455  PRO B CA    1 
ATOM   8412  C C     . PRO B 1 455 ? -55.333 69.587  35.109  1.00 30.41 ? 455  PRO B C     1 
ATOM   8413  O O     . PRO B 1 455 ? -56.286 69.253  35.814  1.00 30.76 ? 455  PRO B O     1 
ATOM   8414  C CB    . PRO B 1 455 ? -55.945 71.671  33.914  1.00 30.08 ? 455  PRO B CB    1 
ATOM   8415  C CG    . PRO B 1 455 ? -56.918 71.946  32.813  1.00 30.12 ? 455  PRO B CG    1 
ATOM   8416  C CD    . PRO B 1 455 ? -57.682 70.668  32.598  1.00 30.31 ? 455  PRO B CD    1 
ATOM   8417  N N     . GLN B 1 456 ? -54.072 69.432  35.481  1.00 30.09 ? 456  GLN B N     1 
ATOM   8418  C CA    . GLN B 1 456 ? -53.714 68.808  36.740  1.00 29.62 ? 456  GLN B CA    1 
ATOM   8419  C C     . GLN B 1 456 ? -53.023 69.864  37.577  1.00 29.20 ? 456  GLN B C     1 
ATOM   8420  O O     . GLN B 1 456 ? -52.040 70.459  37.151  1.00 28.45 ? 456  GLN B O     1 
ATOM   8421  C CB    . GLN B 1 456 ? -52.793 67.609  36.485  1.00 30.31 ? 456  GLN B CB    1 
ATOM   8422  C CG    . GLN B 1 456 ? -53.449 66.463  35.733  1.00 30.81 ? 456  GLN B CG    1 
ATOM   8423  C CD    . GLN B 1 456 ? -54.709 65.956  36.436  1.00 31.87 ? 456  GLN B CD    1 
ATOM   8424  O OE1   . GLN B 1 456 ? -55.827 66.135  35.940  1.00 33.08 ? 456  GLN B OE1   1 
ATOM   8425  N NE2   . GLN B 1 456 ? -54.534 65.344  37.599  1.00 30.68 ? 456  GLN B NE2   1 
ATOM   8426  N N     . GLU B 1 457 ? -53.560 70.099  38.763  1.00 29.40 ? 457  GLU B N     1 
ATOM   8427  C CA    . GLU B 1 457 ? -53.101 71.181  39.631  1.00 30.03 ? 457  GLU B CA    1 
ATOM   8428  C C     . GLU B 1 457 ? -52.128 70.717  40.721  1.00 29.35 ? 457  GLU B C     1 
ATOM   8429  O O     . GLU B 1 457 ? -52.104 69.538  41.091  1.00 28.19 ? 457  GLU B O     1 
ATOM   8430  C CB    . GLU B 1 457 ? -54.305 71.888  40.263  1.00 30.75 ? 457  GLU B CB    1 
ATOM   8431  C CG    . GLU B 1 457 ? -55.141 72.684  39.263  1.00 33.30 ? 457  GLU B CG    1 
ATOM   8432  C CD    . GLU B 1 457 ? -56.600 72.815  39.677  1.00 37.06 ? 457  GLU B CD    1 
ATOM   8433  O OE1   . GLU B 1 457 ? -57.467 72.843  38.775  1.00 37.71 ? 457  GLU B OE1   1 
ATOM   8434  O OE2   . GLU B 1 457 ? -56.887 72.875  40.895  1.00 39.54 ? 457  GLU B OE2   1 
ATOM   8435  N N     . GLY B 1 458 ? -51.321 71.659  41.211  1.00 29.40 ? 458  GLY B N     1 
ATOM   8436  C CA    . GLY B 1 458 ? -50.348 71.379  42.267  1.00 29.62 ? 458  GLY B CA    1 
ATOM   8437  C C     . GLY B 1 458 ? -49.202 70.488  41.811  1.00 29.71 ? 458  GLY B C     1 
ATOM   8438  O O     . GLY B 1 458 ? -48.863 70.431  40.608  1.00 29.68 ? 458  GLY B O     1 
ATOM   8439  N N     . ALA B 1 459 ? -48.590 69.821  42.788  1.00 29.36 ? 459  ALA B N     1 
ATOM   8440  C CA    . ALA B 1 459 ? -47.616 68.776  42.551  1.00 28.87 ? 459  ALA B CA    1 
ATOM   8441  C C     . ALA B 1 459 ? -48.343 67.607  41.925  1.00 28.89 ? 459  ALA B C     1 
ATOM   8442  O O     . ALA B 1 459 ? -49.228 67.006  42.530  1.00 28.55 ? 459  ALA B O     1 
ATOM   8443  C CB    . ALA B 1 459 ? -46.949 68.347  43.868  1.00 28.93 ? 459  ALA B CB    1 
ATOM   8444  N N     . THR B 1 460 ? -47.956 67.282  40.701  1.00 29.39 ? 460  THR B N     1 
ATOM   8445  C CA    . THR B 1 460 ? -48.704 66.331  39.899  1.00 29.44 ? 460  THR B CA    1 
ATOM   8446  C C     . THR B 1 460 ? -47.863 65.897  38.710  1.00 29.39 ? 460  THR B C     1 
ATOM   8447  O O     . THR B 1 460 ? -46.749 66.385  38.518  1.00 29.34 ? 460  THR B O     1 
ATOM   8448  C CB    . THR B 1 460 ? -50.016 66.996  39.392  1.00 29.22 ? 460  THR B CB    1 
ATOM   8449  O OG1   . THR B 1 460 ? -50.884 66.007  38.834  1.00 30.22 ? 460  THR B OG1   1 
ATOM   8450  C CG2   . THR B 1 460 ? -49.724 68.058  38.364  1.00 28.64 ? 460  THR B CG2   1 
ATOM   8451  N N     . GLU B 1 461 ? -48.412 64.990  37.907  1.00 29.41 ? 461  GLU B N     1 
ATOM   8452  C CA    . GLU B 1 461 ? -47.825 64.636  36.622  1.00 29.52 ? 461  GLU B CA    1 
ATOM   8453  C C     . GLU B 1 461 ? -48.923 64.512  35.557  1.00 28.63 ? 461  GLU B C     1 
ATOM   8454  O O     . GLU B 1 461 ? -50.107 64.377  35.871  1.00 29.22 ? 461  GLU B O     1 
ATOM   8455  C CB    . GLU B 1 461 ? -47.049 63.334  36.747  1.00 29.89 ? 461  GLU B CB    1 
ATOM   8456  C CG    . GLU B 1 461 ? -47.925 62.173  37.139  1.00 34.75 ? 461  GLU B CG    1 
ATOM   8457  C CD    . GLU B 1 461 ? -47.178 60.859  37.183  1.00 41.78 ? 461  GLU B CD    1 
ATOM   8458  O OE1   . GLU B 1 461 ? -47.839 59.811  36.938  1.00 43.17 ? 461  GLU B OE1   1 
ATOM   8459  O OE2   . GLU B 1 461 ? -45.940 60.876  37.455  1.00 43.17 ? 461  GLU B OE2   1 
ATOM   8460  N N     . GLY B 1 462 ? -48.534 64.562  34.295  1.00 27.21 ? 462  GLY B N     1 
ATOM   8461  C CA    . GLY B 1 462 ? -49.485 64.425  33.216  1.00 25.61 ? 462  GLY B CA    1 
ATOM   8462  C C     . GLY B 1 462 ? -48.783 64.657  31.903  1.00 24.51 ? 462  GLY B C     1 
ATOM   8463  O O     . GLY B 1 462 ? -47.560 64.769  31.872  1.00 23.78 ? 462  GLY B O     1 
ATOM   8464  N N     . ASN B 1 463 ? -49.578 64.704  30.833  1.00 24.07 ? 463  ASN B N     1 
ATOM   8465  C CA    . ASN B 1 463 ? -49.141 65.062  29.487  1.00 23.57 ? 463  ASN B CA    1 
ATOM   8466  C C     . ASN B 1 463 ? -48.840 66.552  29.408  1.00 23.16 ? 463  ASN B C     1 
ATOM   8467  O O     . ASN B 1 463 ? -49.651 67.386  29.813  1.00 22.86 ? 463  ASN B O     1 
ATOM   8468  C CB    . ASN B 1 463 ? -50.237 64.737  28.474  1.00 23.50 ? 463  ASN B CB    1 
ATOM   8469  C CG    . ASN B 1 463 ? -50.696 63.283  28.546  1.00 25.65 ? 463  ASN B CG    1 
ATOM   8470  O OD1   . ASN B 1 463 ? -49.926 62.345  28.218  1.00 28.00 ? 463  ASN B OD1   1 
ATOM   8471  N ND2   . ASN B 1 463 ? -51.957 63.076  28.969  1.00 22.56 ? 463  ASN B ND2   1 
ATOM   8472  N N     . LEU B 1 464 ? -47.671 66.881  28.865  1.00 23.46 ? 464  LEU B N     1 
ATOM   8473  C CA    . LEU B 1 464 ? -47.187 68.265  28.803  1.00 22.95 ? 464  LEU B CA    1 
ATOM   8474  C C     . LEU B 1 464 ? -47.757 69.083  27.621  1.00 22.93 ? 464  LEU B C     1 
ATOM   8475  O O     . LEU B 1 464 ? -47.493 68.789  26.440  1.00 22.68 ? 464  LEU B O     1 
ATOM   8476  C CB    . LEU B 1 464 ? -45.657 68.277  28.804  1.00 22.50 ? 464  LEU B CB    1 
ATOM   8477  C CG    . LEU B 1 464 ? -44.914 69.603  28.685  1.00 22.95 ? 464  LEU B CG    1 
ATOM   8478  C CD1   . LEU B 1 464 ? -45.260 70.618  29.812  1.00 20.79 ? 464  LEU B CD1   1 
ATOM   8479  C CD2   . LEU B 1 464 ? -43.444 69.281  28.663  1.00 22.24 ? 464  LEU B CD2   1 
ATOM   8480  N N     . VAL B 1 465 ? -48.533 70.111  27.954  1.00 22.16 ? 465  VAL B N     1 
ATOM   8481  C CA    . VAL B 1 465 ? -49.046 71.013  26.931  1.00 22.02 ? 465  VAL B CA    1 
ATOM   8482  C C     . VAL B 1 465 ? -48.495 72.402  27.156  1.00 22.63 ? 465  VAL B C     1 
ATOM   8483  O O     . VAL B 1 465 ? -48.103 72.738  28.284  1.00 21.60 ? 465  VAL B O     1 
ATOM   8484  C CB    . VAL B 1 465 ? -50.628 71.087  26.895  1.00 21.83 ? 465  VAL B CB    1 
ATOM   8485  C CG1   . VAL B 1 465 ? -51.241 69.785  26.401  1.00 20.21 ? 465  VAL B CG1   1 
ATOM   8486  C CG2   . VAL B 1 465 ? -51.216 71.506  28.241  1.00 20.28 ? 465  VAL B CG2   1 
ATOM   8487  N N     . ILE B 1 466 ? -48.468 73.192  26.072  1.00 23.65 ? 466  ILE B N     1 
ATOM   8488  C CA    . ILE B 1 466 ? -48.255 74.650  26.131  1.00 24.47 ? 466  ILE B CA    1 
ATOM   8489  C C     . ILE B 1 466 ? -49.586 75.316  25.747  1.00 25.43 ? 466  ILE B C     1 
ATOM   8490  O O     . ILE B 1 466 ? -50.135 75.035  24.665  1.00 26.28 ? 466  ILE B O     1 
ATOM   8491  C CB    . ILE B 1 466 ? -47.082 75.130  25.204  1.00 24.71 ? 466  ILE B CB    1 
ATOM   8492  C CG1   . ILE B 1 466 ? -45.888 74.168  25.265  1.00 24.27 ? 466  ILE B CG1   1 
ATOM   8493  C CG2   . ILE B 1 466 ? -46.603 76.547  25.586  1.00 24.56 ? 466  ILE B CG2   1 
ATOM   8494  C CD1   . ILE B 1 466 ? -45.126 74.137  26.629  1.00 22.56 ? 466  ILE B CD1   1 
ATOM   8495  N N     . THR B 1 467 ? -50.113 76.178  26.624  1.00 25.43 ? 467  THR B N     1 
ATOM   8496  C CA    . THR B 1 467 ? -51.495 76.685  26.493  1.00 25.16 ? 467  THR B CA    1 
ATOM   8497  C C     . THR B 1 467 ? -51.673 77.974  25.663  1.00 25.19 ? 467  THR B C     1 
ATOM   8498  O O     . THR B 1 467 ? -52.816 78.457  25.490  1.00 24.44 ? 467  THR B O     1 
ATOM   8499  C CB    . THR B 1 467 ? -52.134 76.933  27.876  1.00 25.46 ? 467  THR B CB    1 
ATOM   8500  O OG1   . THR B 1 467 ? -51.447 78.007  28.521  1.00 26.49 ? 467  THR B OG1   1 
ATOM   8501  C CG2   . THR B 1 467 ? -52.079 75.691  28.766  1.00 25.66 ? 467  THR B CG2   1 
ATOM   8502  N N     . ASP B 1 468 ? -50.561 78.526  25.156  1.00 24.93 ? 468  ASP B N     1 
ATOM   8503  C CA    . ASP B 1 468 ? -50.569 79.753  24.340  1.00 24.29 ? 468  ASP B CA    1 
ATOM   8504  C C     . ASP B 1 468 ? -49.280 79.813  23.524  1.00 24.10 ? 468  ASP B C     1 
ATOM   8505  O O     . ASP B 1 468 ? -48.301 79.152  23.881  1.00 24.73 ? 468  ASP B O     1 
ATOM   8506  C CB    . ASP B 1 468 ? -50.655 80.993  25.244  1.00 24.36 ? 468  ASP B CB    1 
ATOM   8507  C CG    . ASP B 1 468 ? -51.248 82.242  24.528  1.00 25.07 ? 468  ASP B CG    1 
ATOM   8508  O OD1   . ASP B 1 468 ? -51.467 82.251  23.295  1.00 25.15 ? 468  ASP B OD1   1 
ATOM   8509  O OD2   . ASP B 1 468 ? -51.511 83.235  25.227  1.00 26.39 ? 468  ASP B OD2   1 
ATOM   8510  N N     . SER B 1 469 ? -49.262 80.606  22.455  1.00 23.07 ? 469  SER B N     1 
ATOM   8511  C CA    . SER B 1 469 ? -48.072 80.746  21.611  1.00 22.38 ? 469  SER B CA    1 
ATOM   8512  C C     . SER B 1 469 ? -46.896 81.483  22.266  1.00 22.48 ? 469  SER B C     1 
ATOM   8513  O O     . SER B 1 469 ? -47.006 82.038  23.362  1.00 21.62 ? 469  SER B O     1 
ATOM   8514  C CB    . SER B 1 469 ? -48.429 81.450  20.300  1.00 22.58 ? 469  SER B CB    1 
ATOM   8515  O OG    . SER B 1 469 ? -47.382 81.358  19.342  1.00 21.16 ? 469  SER B OG    1 
ATOM   8516  N N     . TRP B 1 470 ? -45.763 81.457  21.558  1.00 22.47 ? 470  TRP B N     1 
ATOM   8517  C CA    . TRP B 1 470 ? -44.542 82.162  21.927  1.00 22.15 ? 470  TRP B CA    1 
ATOM   8518  C C     . TRP B 1 470 ? -43.856 82.465  20.572  1.00 22.13 ? 470  TRP B C     1 
ATOM   8519  O O     . TRP B 1 470 ? -44.129 81.786  19.588  1.00 22.08 ? 470  TRP B O     1 
ATOM   8520  C CB    . TRP B 1 470 ? -43.681 81.303  22.872  1.00 21.49 ? 470  TRP B CB    1 
ATOM   8521  C CG    . TRP B 1 470 ? -43.256 80.042  22.215  1.00 21.27 ? 470  TRP B CG    1 
ATOM   8522  C CD1   . TRP B 1 470 ? -42.051 79.799  21.621  1.00 20.45 ? 470  TRP B CD1   1 
ATOM   8523  C CD2   . TRP B 1 470 ? -44.058 78.869  22.000  1.00 22.71 ? 470  TRP B CD2   1 
ATOM   8524  N NE1   . TRP B 1 470 ? -42.043 78.535  21.072  1.00 22.90 ? 470  TRP B NE1   1 
ATOM   8525  C CE2   . TRP B 1 470 ? -43.267 77.946  21.284  1.00 23.21 ? 470  TRP B CE2   1 
ATOM   8526  C CE3   . TRP B 1 470 ? -45.368 78.492  22.367  1.00 23.00 ? 470  TRP B CE3   1 
ATOM   8527  C CZ2   . TRP B 1 470 ? -43.742 76.660  20.937  1.00 21.65 ? 470  TRP B CZ2   1 
ATOM   8528  C CZ3   . TRP B 1 470 ? -45.836 77.202  22.009  1.00 21.06 ? 470  TRP B CZ3   1 
ATOM   8529  C CH2   . TRP B 1 470 ? -45.024 76.316  21.313  1.00 19.77 ? 470  TRP B CH2   1 
ATOM   8530  N N     . PRO B 1 471 ? -42.986 83.498  20.511  1.00 22.32 ? 471  PRO B N     1 
ATOM   8531  C CA    . PRO B 1 471 ? -42.409 83.951  19.234  1.00 22.02 ? 471  PRO B CA    1 
ATOM   8532  C C     . PRO B 1 471 ? -41.667 82.910  18.367  1.00 22.45 ? 471  PRO B C     1 
ATOM   8533  O O     . PRO B 1 471 ? -41.654 83.038  17.131  1.00 21.98 ? 471  PRO B O     1 
ATOM   8534  C CB    . PRO B 1 471 ? -41.462 85.084  19.662  1.00 22.04 ? 471  PRO B CB    1 
ATOM   8535  C CG    . PRO B 1 471 ? -42.013 85.563  20.982  1.00 22.18 ? 471  PRO B CG    1 
ATOM   8536  C CD    . PRO B 1 471 ? -42.525 84.325  21.649  1.00 21.94 ? 471  PRO B CD    1 
ATOM   8537  N N     . GLY B 1 472 ? -41.053 81.909  18.988  1.00 22.72 ? 472  GLY B N     1 
ATOM   8538  C CA    . GLY B 1 472 ? -40.279 80.910  18.252  1.00 23.68 ? 472  GLY B CA    1 
ATOM   8539  C C     . GLY B 1 472 ? -40.995 79.694  17.684  1.00 24.73 ? 472  GLY B C     1 
ATOM   8540  O O     . GLY B 1 472 ? -40.355 78.831  17.059  1.00 25.62 ? 472  GLY B O     1 
ATOM   8541  N N     . GLN B 1 473 ? -42.311 79.619  17.889  1.00 24.82 ? 473  GLN B N     1 
ATOM   8542  C CA    . GLN B 1 473 ? -43.116 78.463  17.497  1.00 24.68 ? 473  GLN B CA    1 
ATOM   8543  C C     . GLN B 1 473 ? -43.116 78.131  15.990  1.00 25.25 ? 473  GLN B C     1 
ATOM   8544  O O     . GLN B 1 473 ? -43.300 79.019  15.137  1.00 25.35 ? 473  GLN B O     1 
ATOM   8545  C CB    . GLN B 1 473 ? -44.554 78.650  17.994  1.00 24.73 ? 473  GLN B CB    1 
ATOM   8546  C CG    . GLN B 1 473 ? -45.399 77.361  18.005  1.00 23.33 ? 473  GLN B CG    1 
ATOM   8547  C CD    . GLN B 1 473 ? -46.774 77.558  18.635  1.00 24.24 ? 473  GLN B CD    1 
ATOM   8548  O OE1   . GLN B 1 473 ? -47.190 78.686  18.951  1.00 24.86 ? 473  GLN B OE1   1 
ATOM   8549  N NE2   . GLN B 1 473 ? -47.500 76.459  18.803  1.00 24.00 ? 473  GLN B NE2   1 
ATOM   8550  N N     . ALA B 1 474 ? -42.919 76.852  15.664  1.00 25.06 ? 474  ALA B N     1 
ATOM   8551  C CA    . ALA B 1 474 ? -43.059 76.405  14.284  1.00 24.62 ? 474  ALA B CA    1 
ATOM   8552  C C     . ALA B 1 474 ? -44.434 76.846  13.816  1.00 24.41 ? 474  ALA B C     1 
ATOM   8553  O O     . ALA B 1 474 ? -45.402 76.767  14.569  1.00 24.49 ? 474  ALA B O     1 
ATOM   8554  C CB    . ALA B 1 474 ? -42.919 74.907  14.187  1.00 24.15 ? 474  ALA B CB    1 
ATOM   8555  N N     . ARG B 1 475 ? -44.508 77.328  12.582  1.00 24.09 ? 475  ARG B N     1 
ATOM   8556  C CA    . ARG B 1 475 ? -45.734 77.955  12.058  1.00 24.00 ? 475  ARG B CA    1 
ATOM   8557  C C     . ARG B 1 475 ? -46.634 76.944  11.345  1.00 23.60 ? 475  ARG B C     1 
ATOM   8558  O O     . ARG B 1 475 ? -47.845 77.131  11.281  1.00 23.19 ? 475  ARG B O     1 
ATOM   8559  C CB    . ARG B 1 475 ? -45.409 79.134  11.110  1.00 23.49 ? 475  ARG B CB    1 
ATOM   8560  C CG    . ARG B 1 475 ? -44.576 80.249  11.738  1.00 23.61 ? 475  ARG B CG    1 
ATOM   8561  C CD    . ARG B 1 475 ? -45.186 80.790  13.028  1.00 21.56 ? 475  ARG B CD    1 
ATOM   8562  N NE    . ARG B 1 475 ? -44.767 82.165  13.300  1.00 23.89 ? 475  ARG B NE    1 
ATOM   8563  C CZ    . ARG B 1 475 ? -43.983 82.561  14.306  1.00 23.10 ? 475  ARG B CZ    1 
ATOM   8564  N NH1   . ARG B 1 475 ? -43.526 81.694  15.196  1.00 26.03 ? 475  ARG B NH1   1 
ATOM   8565  N NH2   . ARG B 1 475 ? -43.673 83.837  14.438  1.00 20.49 ? 475  ARG B NH2   1 
ATOM   8566  N N     . THR B 1 476 ? -46.026 75.886  10.814  1.00 22.94 ? 476  THR B N     1 
ATOM   8567  C CA    . THR B 1 476 ? -46.753 74.890  10.074  1.00 22.85 ? 476  THR B CA    1 
ATOM   8568  C C     . THR B 1 476 ? -45.917 73.665  9.829   1.00 23.23 ? 476  THR B C     1 
ATOM   8569  O O     . THR B 1 476 ? -44.789 73.547  10.335  1.00 22.65 ? 476  THR B O     1 
ATOM   8570  C CB    . THR B 1 476 ? -47.345 75.434  8.718   1.00 23.28 ? 476  THR B CB    1 
ATOM   8571  O OG1   . THR B 1 476 ? -48.296 74.490  8.191   1.00 22.60 ? 476  THR B OG1   1 
ATOM   8572  C CG2   . THR B 1 476 ? -46.259 75.692  7.695   1.00 21.78 ? 476  THR B CG2   1 
ATOM   8573  N N     . LEU B 1 477 ? -46.519 72.735  9.091   1.00 23.83 ? 477  LEU B N     1 
ATOM   8574  C CA    . LEU B 1 477 ? -45.821 71.602  8.511   1.00 24.47 ? 477  LEU B CA    1 
ATOM   8575  C C     . LEU B 1 477 ? -45.814 71.894  7.029   1.00 25.25 ? 477  LEU B C     1 
ATOM   8576  O O     . LEU B 1 477 ? -46.877 72.221  6.448   1.00 25.31 ? 477  LEU B O     1 
ATOM   8577  C CB    . LEU B 1 477 ? -46.563 70.294  8.790   1.00 24.07 ? 477  LEU B CB    1 
ATOM   8578  C CG    . LEU B 1 477 ? -46.361 69.697  10.178  1.00 23.90 ? 477  LEU B CG    1 
ATOM   8579  C CD1   . LEU B 1 477 ? -46.958 68.287  10.178  1.00 21.66 ? 477  LEU B CD1   1 
ATOM   8580  C CD2   . LEU B 1 477 ? -44.867 69.682  10.630  1.00 21.43 ? 477  LEU B CD2   1 
ATOM   8581  N N     . PHE B 1 478 ? -44.636 71.776  6.413   1.00 25.63 ? 478  PHE B N     1 
ATOM   8582  C CA    . PHE B 1 478 ? -44.468 72.197  5.031   1.00 26.05 ? 478  PHE B CA    1 
ATOM   8583  C C     . PHE B 1 478 ? -45.418 71.466  4.079   1.00 25.98 ? 478  PHE B C     1 
ATOM   8584  O O     . PHE B 1 478 ? -45.372 70.243  3.976   1.00 25.17 ? 478  PHE B O     1 
ATOM   8585  C CB    . PHE B 1 478 ? -43.020 72.082  4.556   1.00 26.31 ? 478  PHE B CB    1 
ATOM   8586  C CG    . PHE B 1 478 ? -42.848 72.429  3.097   1.00 28.50 ? 478  PHE B CG    1 
ATOM   8587  C CD1   . PHE B 1 478 ? -43.071 73.734  2.652   1.00 29.50 ? 478  PHE B CD1   1 
ATOM   8588  C CD2   . PHE B 1 478 ? -42.518 71.443  2.160   1.00 28.50 ? 478  PHE B CD2   1 
ATOM   8589  C CE1   . PHE B 1 478 ? -42.938 74.061  1.289   1.00 30.81 ? 478  PHE B CE1   1 
ATOM   8590  C CE2   . PHE B 1 478 ? -42.388 71.753  0.813   1.00 28.73 ? 478  PHE B CE2   1 
ATOM   8591  C CZ    . PHE B 1 478 ? -42.591 73.062  0.371   1.00 29.28 ? 478  PHE B CZ    1 
ATOM   8592  N N     . GLY B 1 479 ? -46.288 72.246  3.427   1.00 26.28 ? 479  GLY B N     1 
ATOM   8593  C CA    . GLY B 1 479 ? -47.239 71.766  2.422   1.00 26.33 ? 479  GLY B CA    1 
ATOM   8594  C C     . GLY B 1 479 ? -48.414 70.975  2.977   1.00 27.00 ? 479  GLY B C     1 
ATOM   8595  O O     . GLY B 1 479 ? -49.082 70.233  2.230   1.00 26.27 ? 479  GLY B O     1 
ATOM   8596  N N     . ASP B 1 480 ? -48.663 71.122  4.284   1.00 27.46 ? 480  ASP B N     1 
ATOM   8597  C CA    . ASP B 1 480 ? -49.647 70.292  4.989   1.00 27.83 ? 480  ASP B CA    1 
ATOM   8598  C C     . ASP B 1 480 ? -50.073 70.911  6.328   1.00 27.61 ? 480  ASP B C     1 
ATOM   8599  O O     . ASP B 1 480 ? -49.786 70.348  7.387   1.00 27.26 ? 480  ASP B O     1 
ATOM   8600  C CB    . ASP B 1 480 ? -49.065 68.878  5.201   1.00 28.40 ? 480  ASP B CB    1 
ATOM   8601  C CG    . ASP B 1 480 ? -50.153 67.778  5.320   1.00 30.31 ? 480  ASP B CG    1 
ATOM   8602  O OD1   . ASP B 1 480 ? -51.360 68.118  5.381   1.00 29.09 ? 480  ASP B OD1   1 
ATOM   8603  O OD2   . ASP B 1 480 ? -49.769 66.568  5.363   1.00 31.09 ? 480  ASP B OD2   1 
ATOM   8604  N N     . HIS B 1 481 ? -50.756 72.060  6.277   1.00 27.57 ? 481  HIS B N     1 
ATOM   8605  C CA    . HIS B 1 481 ? -51.248 72.730  7.498   1.00 28.24 ? 481  HIS B CA    1 
ATOM   8606  C C     . HIS B 1 481 ? -52.311 71.945  8.279   1.00 29.20 ? 481  HIS B C     1 
ATOM   8607  O O     . HIS B 1 481 ? -52.388 72.065  9.504   1.00 29.28 ? 481  HIS B O     1 
ATOM   8608  C CB    . HIS B 1 481 ? -51.778 74.139  7.212   1.00 27.88 ? 481  HIS B CB    1 
ATOM   8609  C CG    . HIS B 1 481 ? -51.910 74.983  8.441   1.00 28.61 ? 481  HIS B CG    1 
ATOM   8610  N ND1   . HIS B 1 481 ? -50.819 75.531  9.088   1.00 28.31 ? 481  HIS B ND1   1 
ATOM   8611  C CD2   . HIS B 1 481 ? -52.999 75.335  9.171   1.00 29.77 ? 481  HIS B CD2   1 
ATOM   8612  C CE1   . HIS B 1 481 ? -51.236 76.200  10.151  1.00 30.04 ? 481  HIS B CE1   1 
ATOM   8613  N NE2   . HIS B 1 481 ? -52.553 76.096  10.226  1.00 29.09 ? 481  HIS B NE2   1 
ATOM   8614  N N     . GLU B 1 482 ? -53.113 71.150  7.561   1.00 29.99 ? 482  GLU B N     1 
ATOM   8615  C CA    . GLU B 1 482 ? -54.169 70.311  8.136   1.00 31.09 ? 482  GLU B CA    1 
ATOM   8616  C C     . GLU B 1 482 ? -53.556 69.200  8.998   1.00 30.42 ? 482  GLU B C     1 
ATOM   8617  O O     . GLU B 1 482 ? -54.101 68.863  10.057  1.00 31.16 ? 482  GLU B O     1 
ATOM   8618  C CB    . GLU B 1 482 ? -55.120 69.798  7.013   1.00 30.77 ? 482  GLU B CB    1 
ATOM   8619  C CG    . GLU B 1 482 ? -56.409 69.069  7.462   1.00 32.87 ? 482  GLU B CG    1 
ATOM   8620  C CD    . GLU B 1 482 ? -57.757 69.451  6.692   1.00 34.39 ? 482  GLU B CD    1 
ATOM   8621  O OE1   . GLU B 1 482 ? -57.793 70.100  5.580   1.00 35.65 ? 482  GLU B OE1   1 
ATOM   8622  O OE2   . GLU B 1 482 ? -58.821 69.056  7.247   1.00 36.26 ? 482  GLU B OE2   1 
ATOM   8623  N N     . ARG B 1 483 ? -52.400 68.676  8.581   1.00 29.84 ? 483  ARG B N     1 
ATOM   8624  C CA    . ARG B 1 483 ? -51.638 67.704  9.384   1.00 29.15 ? 483  ARG B CA    1 
ATOM   8625  C C     . ARG B 1 483 ? -50.982 68.340  10.630  1.00 28.77 ? 483  ARG B C     1 
ATOM   8626  O O     . ARG B 1 483 ? -50.849 67.703  11.686  1.00 28.22 ? 483  ARG B O     1 
ATOM   8627  C CB    . ARG B 1 483 ? -50.569 67.016  8.522   1.00 29.14 ? 483  ARG B CB    1 
ATOM   8628  C CG    . ARG B 1 483 ? -49.734 65.931  9.225   1.00 30.01 ? 483  ARG B CG    1 
ATOM   8629  C CD    . ARG B 1 483 ? -50.554 64.640  9.460   1.00 33.68 ? 483  ARG B CD    1 
ATOM   8630  N N     . PHE B 1 484 ? -50.568 69.594  10.478  1.00 27.94 ? 484  PHE B N     1 
ATOM   8631  C CA    . PHE B 1 484 ? -49.967 70.354  11.538  1.00 27.61 ? 484  PHE B CA    1 
ATOM   8632  C C     . PHE B 1 484 ? -50.958 70.483  12.681  1.00 28.31 ? 484  PHE B C     1 
ATOM   8633  O O     . PHE B 1 484 ? -50.597 70.298  13.846  1.00 28.36 ? 484  PHE B O     1 
ATOM   8634  C CB    . PHE B 1 484 ? -49.568 71.722  10.982  1.00 27.28 ? 484  PHE B CB    1 
ATOM   8635  C CG    . PHE B 1 484 ? -49.047 72.690  12.008  1.00 25.70 ? 484  PHE B CG    1 
ATOM   8636  C CD1   . PHE B 1 484 ? -47.782 72.550  12.532  1.00 25.90 ? 484  PHE B CD1   1 
ATOM   8637  C CD2   . PHE B 1 484 ? -49.811 73.771  12.404  1.00 26.61 ? 484  PHE B CD2   1 
ATOM   8638  C CE1   . PHE B 1 484 ? -47.282 73.460  13.446  1.00 25.62 ? 484  PHE B CE1   1 
ATOM   8639  C CE2   . PHE B 1 484 ? -49.331 74.693  13.329  1.00 26.46 ? 484  PHE B CE2   1 
ATOM   8640  C CZ    . PHE B 1 484 ? -48.062 74.539  13.842  1.00 26.96 ? 484  PHE B CZ    1 
ATOM   8641  N N     . GLU B 1 485 ? -52.205 70.797  12.333  1.00 28.39 ? 485  GLU B N     1 
ATOM   8642  C CA    . GLU B 1 485 ? -53.248 71.001  13.304  1.00 29.50 ? 485  GLU B CA    1 
ATOM   8643  C C     . GLU B 1 485 ? -53.571 69.694  14.031  1.00 29.67 ? 485  GLU B C     1 
ATOM   8644  O O     . GLU B 1 485 ? -53.673 69.674  15.274  1.00 29.78 ? 485  GLU B O     1 
ATOM   8645  C CB    . GLU B 1 485 ? -54.494 71.626  12.640  1.00 29.44 ? 485  GLU B CB    1 
ATOM   8646  C CG    . GLU B 1 485 ? -54.257 73.065  12.130  1.00 30.70 ? 485  GLU B CG    1 
ATOM   8647  C CD    . GLU B 1 485 ? -55.362 73.627  11.189  1.00 31.07 ? 485  GLU B CD    1 
ATOM   8648  O OE1   . GLU B 1 485 ? -55.768 72.964  10.198  1.00 31.91 ? 485  GLU B OE1   1 
ATOM   8649  O OE2   . GLU B 1 485 ? -55.804 74.773  11.434  1.00 32.70 ? 485  GLU B OE2   1 
ATOM   8650  N N     . GLN B 1 486 ? -53.720 68.616  13.256  1.00 29.64 ? 486  GLN B N     1 
ATOM   8651  C CA    . GLN B 1 486 ? -54.036 67.281  13.778  1.00 30.18 ? 486  GLN B CA    1 
ATOM   8652  C C     . GLN B 1 486 ? -52.994 66.808  14.807  1.00 29.46 ? 486  GLN B C     1 
ATOM   8653  O O     . GLN B 1 486 ? -53.343 66.311  15.892  1.00 28.90 ? 486  GLN B O     1 
ATOM   8654  C CB    . GLN B 1 486 ? -54.119 66.271  12.622  1.00 30.75 ? 486  GLN B CB    1 
ATOM   8655  C CG    . GLN B 1 486 ? -55.460 65.555  12.500  1.00 34.69 ? 486  GLN B CG    1 
ATOM   8656  C CD    . GLN B 1 486 ? -55.424 64.050  12.881  1.00 38.95 ? 486  GLN B CD    1 
ATOM   8657  O OE1   . GLN B 1 486 ? -55.223 63.175  12.020  1.00 37.57 ? 486  GLN B OE1   1 
ATOM   8658  N NE2   . GLN B 1 486 ? -55.678 63.754  14.161  1.00 39.61 ? 486  GLN B NE2   1 
ATOM   8659  N N     . THR B 1 487 ? -51.721 67.000  14.462  1.00 28.67 ? 487  THR B N     1 
ATOM   8660  C CA    . THR B 1 487 ? -50.602 66.466  15.226  1.00 27.83 ? 487  THR B CA    1 
ATOM   8661  C C     . THR B 1 487 ? -50.411 67.148  16.566  1.00 27.89 ? 487  THR B C     1 
ATOM   8662  O O     . THR B 1 487 ? -50.136 66.490  17.556  1.00 27.74 ? 487  THR B O     1 
ATOM   8663  C CB    . THR B 1 487 ? -49.303 66.574  14.429  1.00 27.47 ? 487  THR B CB    1 
ATOM   8664  O OG1   . THR B 1 487 ? -49.464 65.891  13.186  1.00 26.12 ? 487  THR B OG1   1 
ATOM   8665  C CG2   . THR B 1 487 ? -48.128 65.963  15.198  1.00 27.07 ? 487  THR B CG2   1 
ATOM   8666  N N     . TYR B 1 488 ? -50.570 68.465  16.591  1.00 27.84 ? 488  TYR B N     1 
ATOM   8667  C CA    . TYR B 1 488 ? -50.175 69.247  17.753  1.00 27.65 ? 488  TYR B CA    1 
ATOM   8668  C C     . TYR B 1 488 ? -51.347 69.865  18.502  1.00 27.49 ? 488  TYR B C     1 
ATOM   8669  O O     . TYR B 1 488 ? -51.200 70.257  19.655  1.00 27.66 ? 488  TYR B O     1 
ATOM   8670  C CB    . TYR B 1 488 ? -49.168 70.332  17.330  1.00 28.03 ? 488  TYR B CB    1 
ATOM   8671  C CG    . TYR B 1 488 ? -47.962 69.781  16.577  1.00 27.56 ? 488  TYR B CG    1 
ATOM   8672  C CD1   . TYR B 1 488 ? -47.871 69.911  15.194  1.00 26.28 ? 488  TYR B CD1   1 
ATOM   8673  C CD2   . TYR B 1 488 ? -46.937 69.104  17.254  1.00 27.28 ? 488  TYR B CD2   1 
ATOM   8674  C CE1   . TYR B 1 488 ? -46.795 69.402  14.495  1.00 26.74 ? 488  TYR B CE1   1 
ATOM   8675  C CE2   . TYR B 1 488 ? -45.849 68.568  16.565  1.00 27.05 ? 488  TYR B CE2   1 
ATOM   8676  C CZ    . TYR B 1 488 ? -45.790 68.728  15.184  1.00 28.09 ? 488  TYR B CZ    1 
ATOM   8677  O OH    . TYR B 1 488 ? -44.740 68.221  14.483  1.00 28.28 ? 488  TYR B OH    1 
ATOM   8678  N N     . PHE B 1 489 ? -52.507 69.946  17.851  1.00 27.52 ? 489  PHE B N     1 
ATOM   8679  C CA    . PHE B 1 489 ? -53.637 70.711  18.398  1.00 27.24 ? 489  PHE B CA    1 
ATOM   8680  C C     . PHE B 1 489 ? -54.988 69.984  18.406  1.00 27.34 ? 489  PHE B C     1 
ATOM   8681  O O     . PHE B 1 489 ? -56.034 70.621  18.575  1.00 27.46 ? 489  PHE B O     1 
ATOM   8682  C CB    . PHE B 1 489 ? -53.782 72.040  17.647  1.00 26.27 ? 489  PHE B CB    1 
ATOM   8683  C CG    . PHE B 1 489 ? -52.539 72.852  17.620  1.00 25.61 ? 489  PHE B CG    1 
ATOM   8684  C CD1   . PHE B 1 489 ? -51.672 72.784  16.528  1.00 24.75 ? 489  PHE B CD1   1 
ATOM   8685  C CD2   . PHE B 1 489 ? -52.223 73.696  18.679  1.00 23.89 ? 489  PHE B CD2   1 
ATOM   8686  C CE1   . PHE B 1 489 ? -50.511 73.561  16.499  1.00 25.53 ? 489  PHE B CE1   1 
ATOM   8687  C CE2   . PHE B 1 489 ? -51.062 74.475  18.656  1.00 23.10 ? 489  PHE B CE2   1 
ATOM   8688  C CZ    . PHE B 1 489 ? -50.208 74.411  17.569  1.00 24.97 ? 489  PHE B CZ    1 
ATOM   8689  N N     . SER B 1 490 ? -54.982 68.671  18.213  1.00 27.64 ? 490  SER B N     1 
ATOM   8690  C CA    . SER B 1 490 ? -56.257 67.933  18.175  1.00 27.78 ? 490  SER B CA    1 
ATOM   8691  C C     . SER B 1 490 ? -56.485 67.087  19.415  1.00 27.34 ? 490  SER B C     1 
ATOM   8692  O O     . SER B 1 490 ? -57.628 66.902  19.812  1.00 27.75 ? 490  SER B O     1 
ATOM   8693  C CB    . SER B 1 490 ? -56.402 67.083  16.902  1.00 27.69 ? 490  SER B CB    1 
ATOM   8694  O OG    . SER B 1 490 ? -55.593 65.910  16.962  1.00 27.69 ? 490  SER B OG    1 
ATOM   8695  N N     . THR B 1 491 ? -55.413 66.577  20.022  1.00 27.07 ? 491  THR B N     1 
ATOM   8696  C CA    . THR B 1 491 ? -55.532 65.743  21.240  1.00 26.75 ? 491  THR B CA    1 
ATOM   8697  C C     . THR B 1 491 ? -56.131 66.567  22.377  1.00 26.38 ? 491  THR B C     1 
ATOM   8698  O O     . THR B 1 491 ? -57.077 66.144  23.026  1.00 26.22 ? 491  THR B O     1 
ATOM   8699  C CB    . THR B 1 491 ? -54.168 65.143  21.689  1.00 27.07 ? 491  THR B CB    1 
ATOM   8700  O OG1   . THR B 1 491 ? -53.558 64.445  20.592  1.00 27.58 ? 491  THR B OG1   1 
ATOM   8701  C CG2   . THR B 1 491 ? -54.346 64.171  22.843  1.00 26.13 ? 491  THR B CG2   1 
ATOM   8702  N N     . PHE B 1 492 ? -55.580 67.753  22.603  1.00 26.02 ? 492  PHE B N     1 
ATOM   8703  C CA    . PHE B 1 492 ? -56.080 68.637  23.651  1.00 25.42 ? 492  PHE B CA    1 
ATOM   8704  C C     . PHE B 1 492 ? -56.413 70.008  23.032  1.00 25.37 ? 492  PHE B C     1 
ATOM   8705  O O     . PHE B 1 492 ? -55.532 70.812  22.739  1.00 24.16 ? 492  PHE B O     1 
ATOM   8706  C CB    . PHE B 1 492 ? -55.060 68.728  24.803  1.00 25.30 ? 492  PHE B CB    1 
ATOM   8707  C CG    . PHE B 1 492 ? -54.571 67.382  25.308  1.00 25.34 ? 492  PHE B CG    1 
ATOM   8708  C CD1   . PHE B 1 492 ? -53.240 67.010  25.161  1.00 25.27 ? 492  PHE B CD1   1 
ATOM   8709  C CD2   . PHE B 1 492 ? -55.454 66.471  25.909  1.00 24.85 ? 492  PHE B CD2   1 
ATOM   8710  C CE1   . PHE B 1 492 ? -52.787 65.746  25.636  1.00 26.55 ? 492  PHE B CE1   1 
ATOM   8711  C CE2   . PHE B 1 492 ? -55.018 65.220  26.374  1.00 23.50 ? 492  PHE B CE2   1 
ATOM   8712  C CZ    . PHE B 1 492 ? -53.694 64.852  26.241  1.00 24.09 ? 492  PHE B CZ    1 
ATOM   8713  N N     . LYS B 1 493 ? -57.708 70.225  22.799  1.00 26.11 ? 493  LYS B N     1 
ATOM   8714  C CA    . LYS B 1 493 ? -58.225 71.399  22.100  1.00 26.53 ? 493  LYS B CA    1 
ATOM   8715  C C     . LYS B 1 493 ? -57.712 72.687  22.711  1.00 26.60 ? 493  LYS B C     1 
ATOM   8716  O O     . LYS B 1 493 ? -57.761 72.870  23.930  1.00 26.18 ? 493  LYS B O     1 
ATOM   8717  C CB    . LYS B 1 493 ? -59.763 71.412  22.123  1.00 27.07 ? 493  LYS B CB    1 
ATOM   8718  C CG    . LYS B 1 493 ? -60.433 70.302  21.283  1.00 28.84 ? 493  LYS B CG    1 
ATOM   8719  N N     . ASN B 1 494 ? -57.215 73.574  21.849  1.00 26.97 ? 494  ASN B N     1 
ATOM   8720  C CA    . ASN B 1 494 ? -56.791 74.921  22.242  1.00 27.13 ? 494  ASN B CA    1 
ATOM   8721  C C     . ASN B 1 494 ? -55.446 74.904  22.909  1.00 27.09 ? 494  ASN B C     1 
ATOM   8722  O O     . ASN B 1 494 ? -55.036 75.865  23.571  1.00 26.35 ? 494  ASN B O     1 
ATOM   8723  C CB    . ASN B 1 494 ? -57.827 75.573  23.153  1.00 27.41 ? 494  ASN B CB    1 
ATOM   8724  C CG    . ASN B 1 494 ? -59.077 75.963  22.411  1.00 27.75 ? 494  ASN B CG    1 
ATOM   8725  O OD1   . ASN B 1 494 ? -59.054 76.888  21.590  1.00 30.09 ? 494  ASN B OD1   1 
ATOM   8726  N ND2   . ASN B 1 494 ? -60.179 75.262  22.685  1.00 26.34 ? 494  ASN B ND2   1 
ATOM   8727  N N     . MET B 1 495 ? -54.761 73.786  22.720  1.00 27.67 ? 495  MET B N     1 
ATOM   8728  C CA    . MET B 1 495 ? -53.456 73.591  23.303  1.00 29.26 ? 495  MET B CA    1 
ATOM   8729  C C     . MET B 1 495 ? -52.465 72.920  22.387  1.00 27.84 ? 495  MET B C     1 
ATOM   8730  O O     . MET B 1 495 ? -52.789 71.931  21.701  1.00 27.72 ? 495  MET B O     1 
ATOM   8731  C CB    . MET B 1 495 ? -53.592 72.864  24.633  1.00 28.58 ? 495  MET B CB    1 
ATOM   8732  C CG    . MET B 1 495 ? -54.332 73.752  25.591  1.00 30.77 ? 495  MET B CG    1 
ATOM   8733  S SD    . MET B 1 495 ? -54.639 73.043  27.162  1.00 35.08 ? 495  MET B SD    1 
ATOM   8734  C CE    . MET B 1 495 ? -55.591 71.583  26.709  1.00 38.44 ? 495  MET B CE    1 
ATOM   8735  N N     . TYR B 1 496 ? -51.258 73.488  22.371  1.00 26.97 ? 496  TYR B N     1 
ATOM   8736  C CA    . TYR B 1 496 ? -50.113 72.799  21.796  1.00 26.17 ? 496  TYR B CA    1 
ATOM   8737  C C     . TYR B 1 496 ? -49.687 71.581  22.646  1.00 25.81 ? 496  TYR B C     1 
ATOM   8738  O O     . TYR B 1 496 ? -49.144 71.732  23.746  1.00 25.06 ? 496  TYR B O     1 
ATOM   8739  C CB    . TYR B 1 496 ? -48.927 73.748  21.566  1.00 25.55 ? 496  TYR B CB    1 
ATOM   8740  C CG    . TYR B 1 496 ? -47.700 72.995  21.107  1.00 24.82 ? 496  TYR B CG    1 
ATOM   8741  C CD1   . TYR B 1 496 ? -47.498 72.702  19.751  1.00 23.51 ? 496  TYR B CD1   1 
ATOM   8742  C CD2   . TYR B 1 496 ? -46.766 72.534  22.026  1.00 23.53 ? 496  TYR B CD2   1 
ATOM   8743  C CE1   . TYR B 1 496 ? -46.377 71.987  19.331  1.00 23.80 ? 496  TYR B CE1   1 
ATOM   8744  C CE2   . TYR B 1 496 ? -45.635 71.836  21.622  1.00 24.36 ? 496  TYR B CE2   1 
ATOM   8745  C CZ    . TYR B 1 496 ? -45.450 71.552  20.273  1.00 25.45 ? 496  TYR B CZ    1 
ATOM   8746  O OH    . TYR B 1 496 ? -44.338 70.836  19.876  1.00 24.82 ? 496  TYR B OH    1 
ATOM   8747  N N     . PHE B 1 497 ? -49.940 70.379  22.113  1.00 25.65 ? 497  PHE B N     1 
ATOM   8748  C CA    . PHE B 1 497 ? -49.448 69.131  22.715  1.00 25.62 ? 497  PHE B CA    1 
ATOM   8749  C C     . PHE B 1 497 ? -48.012 68.740  22.255  1.00 25.37 ? 497  PHE B C     1 
ATOM   8750  O O     . PHE B 1 497 ? -47.759 68.532  21.059  1.00 25.59 ? 497  PHE B O     1 
ATOM   8751  C CB    . PHE B 1 497 ? -50.444 67.968  22.511  1.00 25.58 ? 497  PHE B CB    1 
ATOM   8752  C CG    . PHE B 1 497 ? -50.012 66.662  23.173  1.00 26.95 ? 497  PHE B CG    1 
ATOM   8753  C CD1   . PHE B 1 497 ? -49.452 66.654  24.471  1.00 26.19 ? 497  PHE B CD1   1 
ATOM   8754  C CD2   . PHE B 1 497 ? -50.171 65.443  22.511  1.00 27.20 ? 497  PHE B CD2   1 
ATOM   8755  C CE1   . PHE B 1 497 ? -49.047 65.466  25.095  1.00 25.50 ? 497  PHE B CE1   1 
ATOM   8756  C CE2   . PHE B 1 497 ? -49.782 64.242  23.137  1.00 28.21 ? 497  PHE B CE2   1 
ATOM   8757  C CZ    . PHE B 1 497 ? -49.224 64.262  24.445  1.00 26.97 ? 497  PHE B CZ    1 
ATOM   8758  N N     . SER B 1 498 ? -47.097 68.620  23.220  1.00 24.87 ? 498  SER B N     1 
ATOM   8759  C CA    . SER B 1 498 ? -45.697 68.310  22.942  1.00 24.88 ? 498  SER B CA    1 
ATOM   8760  C C     . SER B 1 498 ? -45.408 66.822  22.681  1.00 24.87 ? 498  SER B C     1 
ATOM   8761  O O     . SER B 1 498 ? -44.482 66.505  21.955  1.00 24.93 ? 498  SER B O     1 
ATOM   8762  C CB    . SER B 1 498 ? -44.817 68.799  24.074  1.00 24.52 ? 498  SER B CB    1 
ATOM   8763  O OG    . SER B 1 498 ? -44.961 67.935  25.174  1.00 25.07 ? 498  SER B OG    1 
ATOM   8764  N N     . GLY B 1 499 ? -46.205 65.915  23.248  1.00 25.05 ? 499  GLY B N     1 
ATOM   8765  C CA    . GLY B 1 499 ? -45.916 64.476  23.145  1.00 25.05 ? 499  GLY B CA    1 
ATOM   8766  C C     . GLY B 1 499 ? -45.010 63.970  24.269  1.00 25.38 ? 499  GLY B C     1 
ATOM   8767  O O     . GLY B 1 499 ? -44.657 62.790  24.334  1.00 25.98 ? 499  GLY B O     1 
ATOM   8768  N N     . ASP B 1 500 ? -44.618 64.869  25.160  1.00 24.97 ? 500  ASP B N     1 
ATOM   8769  C CA    . ASP B 1 500 ? -43.887 64.485  26.343  1.00 24.29 ? 500  ASP B CA    1 
ATOM   8770  C C     . ASP B 1 500 ? -44.827 64.399  27.541  1.00 24.19 ? 500  ASP B C     1 
ATOM   8771  O O     . ASP B 1 500 ? -45.885 65.040  27.569  1.00 23.99 ? 500  ASP B O     1 
ATOM   8772  C CB    . ASP B 1 500 ? -42.808 65.526  26.634  1.00 24.33 ? 500  ASP B CB    1 
ATOM   8773  C CG    . ASP B 1 500 ? -41.637 65.432  25.695  1.00 23.15 ? 500  ASP B CG    1 
ATOM   8774  O OD1   . ASP B 1 500 ? -41.165 64.300  25.435  1.00 24.97 ? 500  ASP B OD1   1 
ATOM   8775  O OD2   . ASP B 1 500 ? -41.166 66.497  25.235  1.00 22.19 ? 500  ASP B OD2   1 
ATOM   8776  N N     . GLY B 1 501 ? -44.422 63.598  28.520  1.00 24.04 ? 501  GLY B N     1 
ATOM   8777  C CA    . GLY B 1 501 ? -45.002 63.592  29.849  1.00 23.78 ? 501  GLY B CA    1 
ATOM   8778  C C     . GLY B 1 501 ? -44.039 64.297  30.781  1.00 23.96 ? 501  GLY B C     1 
ATOM   8779  O O     . GLY B 1 501 ? -42.829 64.416  30.485  1.00 24.18 ? 501  GLY B O     1 
ATOM   8780  N N     . ALA B 1 502 ? -44.569 64.816  31.887  1.00 24.14 ? 502  ALA B N     1 
ATOM   8781  C CA    . ALA B 1 502 ? -43.743 65.507  32.896  1.00 24.49 ? 502  ALA B CA    1 
ATOM   8782  C C     . ALA B 1 502 ? -44.347 65.378  34.271  1.00 25.30 ? 502  ALA B C     1 
ATOM   8783  O O     . ALA B 1 502 ? -45.503 64.994  34.427  1.00 25.93 ? 502  ALA B O     1 
ATOM   8784  C CB    . ALA B 1 502 ? -43.532 66.982  32.542  1.00 23.64 ? 502  ALA B CB    1 
ATOM   8785  N N     . ARG B 1 503 ? -43.560 65.699  35.276  1.00 26.22 ? 503  ARG B N     1 
ATOM   8786  C CA    . ARG B 1 503 ? -44.087 65.820  36.601  1.00 27.75 ? 503  ARG B CA    1 
ATOM   8787  C C     . ARG B 1 503 ? -43.708 67.219  37.079  1.00 27.44 ? 503  ARG B C     1 
ATOM   8788  O O     . ARG B 1 503 ? -42.657 67.753  36.702  1.00 27.57 ? 503  ARG B O     1 
ATOM   8789  C CB    . ARG B 1 503 ? -43.587 64.665  37.510  1.00 28.06 ? 503  ARG B CB    1 
ATOM   8790  C CG    . ARG B 1 503 ? -42.621 65.045  38.630  1.00 30.71 ? 503  ARG B CG    1 
ATOM   8791  C CD    . ARG B 1 503 ? -42.257 63.872  39.562  1.00 30.22 ? 503  ARG B CD    1 
ATOM   8792  N NE    . ARG B 1 503 ? -40.795 63.795  39.750  1.00 37.30 ? 503  ARG B NE    1 
ATOM   8793  C CZ    . ARG B 1 503 ? -39.949 63.155  38.918  1.00 39.69 ? 503  ARG B CZ    1 
ATOM   8794  N NH1   . ARG B 1 503 ? -40.400 62.519  37.833  1.00 38.81 ? 503  ARG B NH1   1 
ATOM   8795  N NH2   . ARG B 1 503 ? -38.637 63.136  39.170  1.00 39.96 ? 503  ARG B NH2   1 
ATOM   8796  N N     . ARG B 1 504 ? -44.594 67.836  37.854  1.00 27.15 ? 504  ARG B N     1 
ATOM   8797  C CA    . ARG B 1 504 ? -44.295 69.131  38.455  1.00 27.00 ? 504  ARG B CA    1 
ATOM   8798  C C     . ARG B 1 504 ? -44.222 68.940  39.966  1.00 26.93 ? 504  ARG B C     1 
ATOM   8799  O O     . ARG B 1 504 ? -45.140 68.377  40.558  1.00 27.18 ? 504  ARG B O     1 
ATOM   8800  C CB    . ARG B 1 504 ? -45.345 70.184  38.063  1.00 26.60 ? 504  ARG B CB    1 
ATOM   8801  C CG    . ARG B 1 504 ? -45.013 71.586  38.525  1.00 26.23 ? 504  ARG B CG    1 
ATOM   8802  C CD    . ARG B 1 504 ? -46.084 72.619  38.172  1.00 26.92 ? 504  ARG B CD    1 
ATOM   8803  N NE    . ARG B 1 504 ? -47.438 72.182  38.519  1.00 28.09 ? 504  ARG B NE    1 
ATOM   8804  C CZ    . ARG B 1 504 ? -48.444 72.032  37.648  1.00 27.12 ? 504  ARG B CZ    1 
ATOM   8805  N NH1   . ARG B 1 504 ? -48.280 72.293  36.353  1.00 26.03 ? 504  ARG B NH1   1 
ATOM   8806  N NH2   . ARG B 1 504 ? -49.625 71.617  38.080  1.00 24.83 ? 504  ARG B NH2   1 
ATOM   8807  N N     . ASP B 1 505 ? -43.127 69.369  40.583  1.00 26.83 ? 505  ASP B N     1 
ATOM   8808  C CA    . ASP B 1 505 ? -42.991 69.212  42.026  1.00 27.53 ? 505  ASP B CA    1 
ATOM   8809  C C     . ASP B 1 505 ? -43.611 70.389  42.782  1.00 27.23 ? 505  ASP B C     1 
ATOM   8810  O O     . ASP B 1 505 ? -44.233 71.273  42.174  1.00 27.10 ? 505  ASP B O     1 
ATOM   8811  C CB    . ASP B 1 505 ? -41.533 68.945  42.466  1.00 27.29 ? 505  ASP B CB    1 
ATOM   8812  C CG    . ASP B 1 505 ? -40.588 70.125  42.193  1.00 29.38 ? 505  ASP B CG    1 
ATOM   8813  O OD1   . ASP B 1 505 ? -41.060 71.284  41.992  1.00 29.69 ? 505  ASP B OD1   1 
ATOM   8814  O OD2   . ASP B 1 505 ? -39.353 69.874  42.184  1.00 29.73 ? 505  ASP B OD2   1 
ATOM   8815  N N     . GLU B 1 506 ? -43.409 70.382  44.099  1.00 26.94 ? 506  GLU B N     1 
ATOM   8816  C CA    . GLU B 1 506 ? -43.980 71.348  45.024  1.00 26.94 ? 506  GLU B CA    1 
ATOM   8817  C C     . GLU B 1 506 ? -43.499 72.776  44.777  1.00 26.79 ? 506  GLU B C     1 
ATOM   8818  O O     . GLU B 1 506 ? -44.210 73.733  45.084  1.00 26.79 ? 506  GLU B O     1 
ATOM   8819  C CB    . GLU B 1 506 ? -43.697 70.917  46.479  1.00 27.52 ? 506  GLU B CB    1 
ATOM   8820  N N     . ASP B 1 507 ? -42.298 72.918  44.224  1.00 26.65 ? 507  ASP B N     1 
ATOM   8821  C CA    . ASP B 1 507 ? -41.751 74.239  43.883  1.00 26.56 ? 507  ASP B CA    1 
ATOM   8822  C C     . ASP B 1 507 ? -42.145 74.754  42.488  1.00 26.34 ? 507  ASP B C     1 
ATOM   8823  O O     . ASP B 1 507 ? -41.721 75.851  42.091  1.00 26.16 ? 507  ASP B O     1 
ATOM   8824  C CB    . ASP B 1 507 ? -40.217 74.237  44.008  1.00 27.01 ? 507  ASP B CB    1 
ATOM   8825  C CG    . ASP B 1 507 ? -39.731 73.960  45.430  1.00 27.70 ? 507  ASP B CG    1 
ATOM   8826  O OD1   . ASP B 1 507 ? -40.307 74.467  46.433  1.00 25.72 ? 507  ASP B OD1   1 
ATOM   8827  O OD2   . ASP B 1 507 ? -38.736 73.224  45.532  1.00 28.84 ? 507  ASP B OD2   1 
ATOM   8828  N N     . GLY B 1 508 ? -42.936 73.972  41.742  1.00 26.33 ? 508  GLY B N     1 
ATOM   8829  C CA    . GLY B 1 508 ? -43.322 74.334  40.373  1.00 26.24 ? 508  GLY B CA    1 
ATOM   8830  C C     . GLY B 1 508 ? -42.293 73.919  39.314  1.00 26.77 ? 508  GLY B C     1 
ATOM   8831  O O     . GLY B 1 508 ? -42.390 74.326  38.128  1.00 26.51 ? 508  GLY B O     1 
ATOM   8832  N N     . TYR B 1 509 ? -41.317 73.103  39.732  1.00 26.53 ? 509  TYR B N     1 
ATOM   8833  C CA    . TYR B 1 509 ? -40.219 72.658  38.859  1.00 26.54 ? 509  TYR B CA    1 
ATOM   8834  C C     . TYR B 1 509 ? -40.691 71.487  37.994  1.00 26.17 ? 509  TYR B C     1 
ATOM   8835  O O     . TYR B 1 509 ? -41.356 70.576  38.493  1.00 26.03 ? 509  TYR B O     1 
ATOM   8836  C CB    . TYR B 1 509 ? -38.992 72.221  39.700  1.00 26.53 ? 509  TYR B CB    1 
ATOM   8837  C CG    . TYR B 1 509 ? -38.042 73.338  40.148  1.00 26.94 ? 509  TYR B CG    1 
ATOM   8838  C CD1   . TYR B 1 509 ? -38.524 74.573  40.615  1.00 26.41 ? 509  TYR B CD1   1 
ATOM   8839  C CD2   . TYR B 1 509 ? -36.659 73.134  40.155  1.00 26.60 ? 509  TYR B CD2   1 
ATOM   8840  C CE1   . TYR B 1 509 ? -37.636 75.585  41.043  1.00 26.51 ? 509  TYR B CE1   1 
ATOM   8841  C CE2   . TYR B 1 509 ? -35.769 74.136  40.567  1.00 25.67 ? 509  TYR B CE2   1 
ATOM   8842  C CZ    . TYR B 1 509 ? -36.261 75.357  41.010  1.00 27.15 ? 509  TYR B CZ    1 
ATOM   8843  O OH    . TYR B 1 509 ? -35.377 76.340  41.438  1.00 26.91 ? 509  TYR B OH    1 
ATOM   8844  N N     . TYR B 1 510 ? -40.330 71.495  36.713  1.00 25.52 ? 510  TYR B N     1 
ATOM   8845  C CA    . TYR B 1 510 ? -40.784 70.451  35.816  1.00 25.14 ? 510  TYR B CA    1 
ATOM   8846  C C     . TYR B 1 510 ? -39.721 69.403  35.616  1.00 25.51 ? 510  TYR B C     1 
ATOM   8847  O O     . TYR B 1 510 ? -38.541 69.729  35.435  1.00 26.00 ? 510  TYR B O     1 
ATOM   8848  C CB    . TYR B 1 510 ? -41.173 71.039  34.475  1.00 25.22 ? 510  TYR B CB    1 
ATOM   8849  C CG    . TYR B 1 510 ? -42.481 71.768  34.518  1.00 25.87 ? 510  TYR B CG    1 
ATOM   8850  C CD1   . TYR B 1 510 ? -42.538 73.129  34.861  1.00 26.25 ? 510  TYR B CD1   1 
ATOM   8851  C CD2   . TYR B 1 510 ? -43.679 71.102  34.231  1.00 24.27 ? 510  TYR B CD2   1 
ATOM   8852  C CE1   . TYR B 1 510 ? -43.766 73.810  34.907  1.00 25.73 ? 510  TYR B CE1   1 
ATOM   8853  C CE2   . TYR B 1 510 ? -44.893 71.767  34.273  1.00 25.10 ? 510  TYR B CE2   1 
ATOM   8854  C CZ    . TYR B 1 510 ? -44.937 73.120  34.616  1.00 25.61 ? 510  TYR B CZ    1 
ATOM   8855  O OH    . TYR B 1 510 ? -46.155 73.773  34.666  1.00 25.41 ? 510  TYR B OH    1 
ATOM   8856  N N     . TRP B 1 511 ? -40.138 68.138  35.646  1.00 25.09 ? 511  TRP B N     1 
ATOM   8857  C CA    . TRP B 1 511 ? -39.230 67.017  35.372  1.00 24.48 ? 511  TRP B CA    1 
ATOM   8858  C C     . TRP B 1 511 ? -39.776 66.339  34.141  1.00 24.48 ? 511  TRP B C     1 
ATOM   8859  O O     . TRP B 1 511 ? -40.854 65.741  34.194  1.00 24.19 ? 511  TRP B O     1 
ATOM   8860  C CB    . TRP B 1 511 ? -39.153 66.043  36.562  1.00 23.23 ? 511  TRP B CB    1 
ATOM   8861  C CG    . TRP B 1 511 ? -38.787 66.733  37.856  1.00 22.86 ? 511  TRP B CG    1 
ATOM   8862  C CD1   . TRP B 1 511 ? -39.559 67.626  38.572  1.00 22.51 ? 511  TRP B CD1   1 
ATOM   8863  C CD2   . TRP B 1 511 ? -37.561 66.601  38.584  1.00 22.55 ? 511  TRP B CD2   1 
ATOM   8864  N NE1   . TRP B 1 511 ? -38.891 68.040  39.695  1.00 20.66 ? 511  TRP B NE1   1 
ATOM   8865  C CE2   . TRP B 1 511 ? -37.660 67.434  39.726  1.00 23.44 ? 511  TRP B CE2   1 
ATOM   8866  C CE3   . TRP B 1 511 ? -36.386 65.854  38.388  1.00 21.85 ? 511  TRP B CE3   1 
ATOM   8867  C CZ2   . TRP B 1 511 ? -36.614 67.541  40.676  1.00 24.16 ? 511  TRP B CZ2   1 
ATOM   8868  C CZ3   . TRP B 1 511 ? -35.355 65.969  39.320  1.00 22.40 ? 511  TRP B CZ3   1 
ATOM   8869  C CH2   . TRP B 1 511 ? -35.476 66.806  40.448  1.00 22.62 ? 511  TRP B CH2   1 
ATOM   8870  N N     . ILE B 1 512 ? -39.055 66.458  33.030  1.00 24.78 ? 512  ILE B N     1 
ATOM   8871  C CA    . ILE B 1 512 ? -39.503 65.850  31.784  1.00 25.63 ? 512  ILE B CA    1 
ATOM   8872  C C     . ILE B 1 512 ? -39.077 64.403  31.731  1.00 26.45 ? 512  ILE B C     1 
ATOM   8873  O O     . ILE B 1 512 ? -37.882 64.077  31.738  1.00 27.09 ? 512  ILE B O     1 
ATOM   8874  C CB    . ILE B 1 512 ? -39.085 66.646  30.513  1.00 26.04 ? 512  ILE B CB    1 
ATOM   8875  C CG1   . ILE B 1 512 ? -40.068 67.803  30.280  1.00 25.25 ? 512  ILE B CG1   1 
ATOM   8876  C CG2   . ILE B 1 512 ? -39.081 65.727  29.249  1.00 25.65 ? 512  ILE B CG2   1 
ATOM   8877  C CD1   . ILE B 1 512 ? -39.745 69.050  31.051  1.00 25.28 ? 512  ILE B CD1   1 
ATOM   8878  N N     . THR B 1 513 ? -40.090 63.542  31.711  1.00 27.29 ? 513  THR B N     1 
ATOM   8879  C CA    . THR B 1 513 ? -39.915 62.100  31.746  1.00 27.50 ? 513  THR B CA    1 
ATOM   8880  C C     . THR B 1 513 ? -39.766 61.540  30.327  1.00 27.52 ? 513  THR B C     1 
ATOM   8881  O O     . THR B 1 513 ? -39.228 60.456  30.127  1.00 27.55 ? 513  THR B O     1 
ATOM   8882  C CB    . THR B 1 513 ? -41.079 61.439  32.518  1.00 27.50 ? 513  THR B CB    1 
ATOM   8883  O OG1   . THR B 1 513 ? -42.324 61.882  31.975  1.00 26.81 ? 513  THR B OG1   1 
ATOM   8884  C CG2   . THR B 1 513 ? -41.032 61.868  33.995  1.00 28.64 ? 513  THR B CG2   1 
ATOM   8885  N N     . GLY B 1 514 ? -40.220 62.300  29.339  1.00 27.75 ? 514  GLY B N     1 
ATOM   8886  C CA    . GLY B 1 514 ? -40.033 61.912  27.929  1.00 28.01 ? 514  GLY B CA    1 
ATOM   8887  C C     . GLY B 1 514 ? -41.319 61.567  27.199  1.00 27.51 ? 514  GLY B C     1 
ATOM   8888  O O     . GLY B 1 514 ? -42.419 61.751  27.732  1.00 27.32 ? 514  GLY B O     1 
ATOM   8889  N N     . ARG B 1 515 ? -41.166 61.058  25.980  1.00 27.39 ? 515  ARG B N     1 
ATOM   8890  C CA    . ARG B 1 515 ? -42.286 60.852  25.047  1.00 27.21 ? 515  ARG B CA    1 
ATOM   8891  C C     . ARG B 1 515 ? -43.346 59.935  25.625  1.00 27.62 ? 515  ARG B C     1 
ATOM   8892  O O     . ARG B 1 515 ? -43.020 58.860  26.157  1.00 27.58 ? 515  ARG B O     1 
ATOM   8893  C CB    . ARG B 1 515 ? -41.812 60.312  23.698  1.00 26.33 ? 515  ARG B CB    1 
ATOM   8894  C CG    . ARG B 1 515 ? -40.771 61.199  22.983  1.00 26.31 ? 515  ARG B CG    1 
ATOM   8895  C CD    . ARG B 1 515 ? -41.304 62.620  22.665  1.00 28.05 ? 515  ARG B CD    1 
ATOM   8896  N NE    . ARG B 1 515 ? -42.304 62.633  21.587  1.00 27.86 ? 515  ARG B NE    1 
ATOM   8897  C CZ    . ARG B 1 515 ? -42.554 63.672  20.776  1.00 27.06 ? 515  ARG B CZ    1 
ATOM   8898  N NH1   . ARG B 1 515 ? -41.881 64.810  20.895  1.00 23.88 ? 515  ARG B NH1   1 
ATOM   8899  N NH2   . ARG B 1 515 ? -43.480 63.564  19.820  1.00 24.49 ? 515  ARG B NH2   1 
ATOM   8900  N N     . VAL B 1 516 ? -44.602 60.379  25.528  1.00 27.24 ? 516  VAL B N     1 
ATOM   8901  C CA    . VAL B 1 516 ? -45.770 59.558  25.894  1.00 27.28 ? 516  VAL B CA    1 
ATOM   8902  C C     . VAL B 1 516 ? -46.472 59.012  24.650  1.00 27.61 ? 516  VAL B C     1 
ATOM   8903  O O     . VAL B 1 516 ? -47.370 58.201  24.764  1.00 27.36 ? 516  VAL B O     1 
ATOM   8904  C CB    . VAL B 1 516 ? -46.787 60.340  26.753  1.00 27.00 ? 516  VAL B CB    1 
ATOM   8905  C CG1   . VAL B 1 516 ? -46.166 60.708  28.099  1.00 25.71 ? 516  VAL B CG1   1 
ATOM   8906  C CG2   . VAL B 1 516 ? -47.299 61.583  25.990  1.00 25.30 ? 516  VAL B CG2   1 
ATOM   8907  N N     . ASP B 1 517 ? -46.052 59.478  23.473  1.00 28.40 ? 517  ASP B N     1 
ATOM   8908  C CA    . ASP B 1 517 ? -46.544 58.956  22.201  1.00 29.42 ? 517  ASP B CA    1 
ATOM   8909  C C     . ASP B 1 517 ? -45.572 57.878  21.685  1.00 30.04 ? 517  ASP B C     1 
ATOM   8910  O O     . ASP B 1 517 ? -44.894 57.223  22.491  1.00 30.25 ? 517  ASP B O     1 
ATOM   8911  C CB    . ASP B 1 517 ? -46.789 60.087  21.190  1.00 29.61 ? 517  ASP B CB    1 
ATOM   8912  C CG    . ASP B 1 517 ? -45.555 60.985  20.960  1.00 30.30 ? 517  ASP B CG    1 
ATOM   8913  O OD1   . ASP B 1 517 ? -45.671 61.952  20.173  1.00 28.14 ? 517  ASP B OD1   1 
ATOM   8914  O OD2   . ASP B 1 517 ? -44.473 60.733  21.544  1.00 32.64 ? 517  ASP B OD2   1 
ATOM   8915  N N     . ASP B 1 518 ? -45.499 57.670  20.372  1.00 30.43 ? 518  ASP B N     1 
ATOM   8916  C CA    . ASP B 1 518 ? -44.665 56.572  19.854  1.00 30.84 ? 518  ASP B CA    1 
ATOM   8917  C C     . ASP B 1 518 ? -43.331 57.023  19.290  1.00 29.90 ? 518  ASP B C     1 
ATOM   8918  O O     . ASP B 1 518 ? -42.786 56.390  18.388  1.00 29.67 ? 518  ASP B O     1 
ATOM   8919  C CB    . ASP B 1 518 ? -45.443 55.726  18.833  1.00 31.52 ? 518  ASP B CB    1 
ATOM   8920  C CG    . ASP B 1 518 ? -46.616 55.002  19.466  1.00 35.26 ? 518  ASP B CG    1 
ATOM   8921  O OD1   . ASP B 1 518 ? -46.450 54.478  20.606  1.00 37.02 ? 518  ASP B OD1   1 
ATOM   8922  O OD2   . ASP B 1 518 ? -47.709 54.982  18.836  1.00 38.86 ? 518  ASP B OD2   1 
ATOM   8923  N N     . VAL B 1 519 ? -42.819 58.133  19.815  1.00 29.62 ? 519  VAL B N     1 
ATOM   8924  C CA    . VAL B 1 519 ? -41.553 58.683  19.334  1.00 29.07 ? 519  VAL B CA    1 
ATOM   8925  C C     . VAL B 1 519 ? -40.436 58.142  20.210  1.00 29.22 ? 519  VAL B C     1 
ATOM   8926  O O     . VAL B 1 519 ? -40.567 58.085  21.445  1.00 29.38 ? 519  VAL B O     1 
ATOM   8927  C CB    . VAL B 1 519 ? -41.564 60.227  19.245  1.00 29.12 ? 519  VAL B CB    1 
ATOM   8928  C CG1   . VAL B 1 519 ? -40.228 60.751  18.766  1.00 27.82 ? 519  VAL B CG1   1 
ATOM   8929  C CG2   . VAL B 1 519 ? -42.645 60.702  18.260  1.00 29.27 ? 519  VAL B CG2   1 
ATOM   8930  N N     . LEU B 1 520 ? -39.363 57.699  19.550  1.00 28.93 ? 520  LEU B N     1 
ATOM   8931  C CA    . LEU B 1 520 ? -38.212 57.125  20.208  1.00 28.64 ? 520  LEU B CA    1 
ATOM   8932  C C     . LEU B 1 520 ? -37.127 58.176  20.335  1.00 28.35 ? 520  LEU B C     1 
ATOM   8933  O O     . LEU B 1 520 ? -37.039 59.078  19.512  1.00 27.86 ? 520  LEU B O     1 
ATOM   8934  C CB    . LEU B 1 520 ? -37.681 55.922  19.410  1.00 29.17 ? 520  LEU B CB    1 
ATOM   8935  C CG    . LEU B 1 520 ? -38.595 54.701  19.188  1.00 30.66 ? 520  LEU B CG    1 
ATOM   8936  C CD1   . LEU B 1 520 ? -37.809 53.511  18.622  1.00 32.04 ? 520  LEU B CD1   1 
ATOM   8937  C CD2   . LEU B 1 520 ? -39.331 54.281  20.459  1.00 31.63 ? 520  LEU B CD2   1 
ATOM   8938  N N     . ASN B 1 521 ? -36.312 58.038  21.376  1.00 28.13 ? 521  ASN B N     1 
ATOM   8939  C CA    . ASN B 1 521 ? -35.087 58.797  21.542  1.00 28.04 ? 521  ASN B CA    1 
ATOM   8940  C C     . ASN B 1 521 ? -33.885 57.851  21.627  1.00 26.88 ? 521  ASN B C     1 
ATOM   8941  O O     . ASN B 1 521 ? -33.662 57.216  22.632  1.00 26.89 ? 521  ASN B O     1 
ATOM   8942  C CB    . ASN B 1 521 ? -35.187 59.658  22.800  1.00 28.72 ? 521  ASN B CB    1 
ATOM   8943  C CG    . ASN B 1 521 ? -34.066 60.712  22.906  1.00 31.58 ? 521  ASN B CG    1 
ATOM   8944  O OD1   . ASN B 1 521 ? -34.360 61.887  23.152  1.00 37.47 ? 521  ASN B OD1   1 
ATOM   8945  N ND2   . ASN B 1 521 ? -32.795 60.297  22.766  1.00 30.05 ? 521  ASN B ND2   1 
ATOM   8946  N N     . VAL B 1 522 ? -33.105 57.770  20.566  1.00 26.43 ? 522  VAL B N     1 
ATOM   8947  C CA    . VAL B 1 522 ? -32.010 56.825  20.501  1.00 25.65 ? 522  VAL B CA    1 
ATOM   8948  C C     . VAL B 1 522 ? -30.729 57.601  20.220  1.00 26.27 ? 522  VAL B C     1 
ATOM   8949  O O     . VAL B 1 522 ? -30.613 58.291  19.192  1.00 26.59 ? 522  VAL B O     1 
ATOM   8950  C CB    . VAL B 1 522 ? -32.274 55.773  19.405  1.00 26.15 ? 522  VAL B CB    1 
ATOM   8951  C CG1   . VAL B 1 522 ? -31.049 54.822  19.221  1.00 24.33 ? 522  VAL B CG1   1 
ATOM   8952  C CG2   . VAL B 1 522 ? -33.626 54.981  19.684  1.00 24.57 ? 522  VAL B CG2   1 
ATOM   8953  N N     . SER B 1 523 ? -29.776 57.512  21.149  1.00 26.42 ? 523  SER B N     1 
ATOM   8954  C CA    . SER B 1 523 ? -28.558 58.322  21.104  1.00 26.55 ? 523  SER B CA    1 
ATOM   8955  C C     . SER B 1 523 ? -28.881 59.790  20.794  1.00 26.96 ? 523  SER B C     1 
ATOM   8956  O O     . SER B 1 523 ? -28.281 60.388  19.896  1.00 27.25 ? 523  SER B O     1 
ATOM   8957  C CB    . SER B 1 523 ? -27.568 57.775  20.070  1.00 26.23 ? 523  SER B CB    1 
ATOM   8958  O OG    . SER B 1 523 ? -26.929 56.613  20.541  1.00 25.48 ? 523  SER B OG    1 
ATOM   8959  N N     . GLY B 1 524 ? -29.828 60.360  21.540  1.00 26.82 ? 524  GLY B N     1 
ATOM   8960  C CA    . GLY B 1 524 ? -30.266 61.729  21.296  1.00 26.67 ? 524  GLY B CA    1 
ATOM   8961  C C     . GLY B 1 524 ? -30.788 61.976  19.880  1.00 26.49 ? 524  GLY B C     1 
ATOM   8962  O O     . GLY B 1 524 ? -30.669 63.085  19.366  1.00 26.71 ? 524  GLY B O     1 
ATOM   8963  N N     . HIS B 1 525 ? -31.331 60.951  19.235  1.00 25.64 ? 525  HIS B N     1 
ATOM   8964  C CA    . HIS B 1 525 ? -32.008 61.155  17.965  1.00 25.66 ? 525  HIS B CA    1 
ATOM   8965  C C     . HIS B 1 525 ? -33.481 60.857  18.141  1.00 25.19 ? 525  HIS B C     1 
ATOM   8966  O O     . HIS B 1 525 ? -33.849 59.847  18.742  1.00 25.43 ? 525  HIS B O     1 
ATOM   8967  C CB    . HIS B 1 525 ? -31.394 60.321  16.831  1.00 25.61 ? 525  HIS B CB    1 
ATOM   8968  C CG    . HIS B 1 525 ? -29.995 60.723  16.492  1.00 27.88 ? 525  HIS B CG    1 
ATOM   8969  N ND1   . HIS B 1 525 ? -28.911 59.892  16.681  1.00 29.31 ? 525  HIS B ND1   1 
ATOM   8970  C CD2   . HIS B 1 525 ? -29.491 61.892  16.023  1.00 30.38 ? 525  HIS B CD2   1 
ATOM   8971  C CE1   . HIS B 1 525 ? -27.804 60.521  16.323  1.00 28.40 ? 525  HIS B CE1   1 
ATOM   8972  N NE2   . HIS B 1 525 ? -28.128 61.736  15.919  1.00 29.12 ? 525  HIS B NE2   1 
ATOM   8973  N N     . ARG B 1 526 ? -34.314 61.760  17.634  1.00 24.24 ? 526  ARG B N     1 
ATOM   8974  C CA    . ARG B 1 526 ? -35.752 61.574  17.640  1.00 23.43 ? 526  ARG B CA    1 
ATOM   8975  C C     . ARG B 1 526 ? -36.162 60.829  16.372  1.00 23.86 ? 526  ARG B C     1 
ATOM   8976  O O     . ARG B 1 526 ? -36.081 61.355  15.269  1.00 23.15 ? 526  ARG B O     1 
ATOM   8977  C CB    . ARG B 1 526 ? -36.439 62.928  17.758  1.00 22.59 ? 526  ARG B CB    1 
ATOM   8978  C CG    . ARG B 1 526 ? -37.865 62.950  17.388  1.00 20.52 ? 526  ARG B CG    1 
ATOM   8979  C CD    . ARG B 1 526 ? -38.376 64.362  17.555  1.00 19.96 ? 526  ARG B CD    1 
ATOM   8980  N NE    . ARG B 1 526 ? -39.746 64.516  17.103  1.00 17.06 ? 526  ARG B NE    1 
ATOM   8981  C CZ    . ARG B 1 526 ? -40.448 65.635  17.224  1.00 17.78 ? 526  ARG B CZ    1 
ATOM   8982  N NH1   . ARG B 1 526 ? -39.888 66.708  17.780  1.00 15.54 ? 526  ARG B NH1   1 
ATOM   8983  N NH2   . ARG B 1 526 ? -41.705 65.689  16.766  1.00 15.18 ? 526  ARG B NH2   1 
ATOM   8984  N N     . LEU B 1 527 ? -36.576 59.582  16.559  1.00 24.63 ? 527  LEU B N     1 
ATOM   8985  C CA    . LEU B 1 527 ? -36.954 58.704  15.479  1.00 24.99 ? 527  LEU B CA    1 
ATOM   8986  C C     . LEU B 1 527 ? -38.398 58.285  15.689  1.00 25.39 ? 527  LEU B C     1 
ATOM   8987  O O     . LEU B 1 527 ? -38.861 58.188  16.819  1.00 25.29 ? 527  LEU B O     1 
ATOM   8988  C CB    . LEU B 1 527 ? -36.066 57.448  15.475  1.00 25.11 ? 527  LEU B CB    1 
ATOM   8989  C CG    . LEU B 1 527 ? -34.556 57.554  15.195  1.00 25.82 ? 527  LEU B CG    1 
ATOM   8990  C CD1   . LEU B 1 527 ? -33.867 56.235  15.520  1.00 23.64 ? 527  LEU B CD1   1 
ATOM   8991  C CD2   . LEU B 1 527 ? -34.261 57.968  13.743  1.00 25.81 ? 527  LEU B CD2   1 
ATOM   8992  N N     . GLY B 1 528 ? -39.089 58.021  14.588  1.00 26.20 ? 528  GLY B N     1 
ATOM   8993  C CA    . GLY B 1 528 ? -40.444 57.500  14.615  1.00 27.66 ? 528  GLY B CA    1 
ATOM   8994  C C     . GLY B 1 528 ? -40.441 55.997  14.388  1.00 28.48 ? 528  GLY B C     1 
ATOM   8995  O O     . GLY B 1 528 ? -39.583 55.468  13.708  1.00 27.80 ? 528  GLY B O     1 
ATOM   8996  N N     . THR B 1 529 ? -41.415 55.306  14.972  1.00 29.72 ? 529  THR B N     1 
ATOM   8997  C CA    . THR B 1 529 ? -41.494 53.854  14.826  1.00 29.92 ? 529  THR B CA    1 
ATOM   8998  C C     . THR B 1 529 ? -42.097 53.496  13.484  1.00 30.15 ? 529  THR B C     1 
ATOM   8999  O O     . THR B 1 529 ? -41.695 52.511  12.889  1.00 30.35 ? 529  THR B O     1 
ATOM   9000  C CB    . THR B 1 529 ? -42.279 53.152  15.982  1.00 29.87 ? 529  THR B CB    1 
ATOM   9001  O OG1   . THR B 1 529 ? -43.674 53.401  15.836  1.00 28.84 ? 529  THR B OG1   1 
ATOM   9002  C CG2   . THR B 1 529 ? -41.788 53.599  17.362  1.00 28.43 ? 529  THR B CG2   1 
ATOM   9003  N N     . ALA B 1 530 ? -43.041 54.298  12.997  1.00 30.73 ? 530  ALA B N     1 
ATOM   9004  C CA    . ALA B 1 530 ? -43.609 54.056  11.654  1.00 31.13 ? 530  ALA B CA    1 
ATOM   9005  C C     . ALA B 1 530 ? -42.573 54.052  10.527  1.00 30.77 ? 530  ALA B C     1 
ATOM   9006  O O     . ALA B 1 530 ? -42.676 53.247  9.595   1.00 31.55 ? 530  ALA B O     1 
ATOM   9007  C CB    . ALA B 1 530 ? -44.748 55.037  11.325  1.00 31.37 ? 530  ALA B CB    1 
ATOM   9008  N N     . GLU B 1 531 ? -41.590 54.942  10.587  1.00 29.64 ? 531  GLU B N     1 
ATOM   9009  C CA    . GLU B 1 531 ? -40.607 54.978  9.518   1.00 29.15 ? 531  GLU B CA    1 
ATOM   9010  C C     . GLU B 1 531 ? -39.674 53.778  9.565   1.00 27.93 ? 531  GLU B C     1 
ATOM   9011  O O     . GLU B 1 531 ? -39.176 53.353  8.516   1.00 27.97 ? 531  GLU B O     1 
ATOM   9012  C CB    . GLU B 1 531 ? -39.813 56.294  9.472   1.00 30.36 ? 531  GLU B CB    1 
ATOM   9013  C CG    . GLU B 1 531 ? -40.114 57.313  10.605  1.00 32.42 ? 531  GLU B CG    1 
ATOM   9014  C CD    . GLU B 1 531 ? -38.852 57.800  11.253  1.00 34.86 ? 531  GLU B CD    1 
ATOM   9015  O OE1   . GLU B 1 531 ? -37.853 57.066  11.167  1.00 38.27 ? 531  GLU B OE1   1 
ATOM   9016  O OE2   . GLU B 1 531 ? -38.838 58.894  11.842  1.00 34.87 ? 531  GLU B OE2   1 
ATOM   9017  N N     . ILE B 1 532 ? -39.453 53.216  10.759  1.00 26.30 ? 532  ILE B N     1 
ATOM   9018  C CA    . ILE B 1 532 ? -38.576 52.047  10.877  1.00 24.97 ? 532  ILE B CA    1 
ATOM   9019  C C     . ILE B 1 532 ? -39.296 50.804  10.397  1.00 24.65 ? 532  ILE B C     1 
ATOM   9020  O O     . ILE B 1 532 ? -38.731 49.993  9.647   1.00 24.48 ? 532  ILE B O     1 
ATOM   9021  C CB    . ILE B 1 532 ? -38.020 51.834  12.288  1.00 25.07 ? 532  ILE B CB    1 
ATOM   9022  C CG1   . ILE B 1 532 ? -37.349 53.124  12.788  1.00 24.93 ? 532  ILE B CG1   1 
ATOM   9023  C CG2   . ILE B 1 532 ? -37.006 50.690  12.271  1.00 23.52 ? 532  ILE B CG2   1 
ATOM   9024  C CD1   . ILE B 1 532 ? -36.876 53.091  14.240  1.00 24.40 ? 532  ILE B CD1   1 
ATOM   9025  N N     . GLU B 1 533 ? -40.553 50.688  10.811  1.00 23.94 ? 533  GLU B N     1 
ATOM   9026  C CA    . GLU B 1 533 ? -41.456 49.656  10.362  1.00 23.44 ? 533  GLU B CA    1 
ATOM   9027  C C     . GLU B 1 533 ? -41.552 49.595  8.839   1.00 23.50 ? 533  GLU B C     1 
ATOM   9028  O O     . GLU B 1 533 ? -41.435 48.496  8.261   1.00 23.21 ? 533  GLU B O     1 
ATOM   9029  C CB    . GLU B 1 533 ? -42.827 49.836  11.025  1.00 23.39 ? 533  GLU B CB    1 
ATOM   9030  C CG    . GLU B 1 533 ? -42.806 49.428  12.486  1.00 23.46 ? 533  GLU B CG    1 
ATOM   9031  C CD    . GLU B 1 533 ? -44.088 49.728  13.244  1.00 24.25 ? 533  GLU B CD    1 
ATOM   9032  O OE1   . GLU B 1 533 ? -45.132 50.053  12.626  1.00 25.81 ? 533  GLU B OE1   1 
ATOM   9033  O OE2   . GLU B 1 533 ? -44.055 49.623  14.489  1.00 26.18 ? 533  GLU B OE2   1 
ATOM   9034  N N     . SER B 1 534 ? -41.738 50.765  8.206   1.00 23.47 ? 534  SER B N     1 
ATOM   9035  C CA    . SER B 1 534 ? -41.744 50.917  6.721   1.00 23.53 ? 534  SER B CA    1 
ATOM   9036  C C     . SER B 1 534 ? -40.491 50.406  6.079   1.00 23.26 ? 534  SER B C     1 
ATOM   9037  O O     . SER B 1 534 ? -40.550 49.609  5.145   1.00 23.45 ? 534  SER B O     1 
ATOM   9038  C CB    . SER B 1 534 ? -41.845 52.375  6.306   1.00 22.95 ? 534  SER B CB    1 
ATOM   9039  O OG    . SER B 1 534 ? -43.124 52.872  6.571   1.00 25.49 ? 534  SER B OG    1 
ATOM   9040  N N     . ALA B 1 535 ? -39.353 50.922  6.548   1.00 23.26 ? 535  ALA B N     1 
ATOM   9041  C CA    . ALA B 1 535 ? -38.058 50.423  6.114   1.00 23.36 ? 535  ALA B CA    1 
ATOM   9042  C C     . ALA B 1 535 ? -38.037 48.890  6.190   1.00 23.28 ? 535  ALA B C     1 
ATOM   9043  O O     . ALA B 1 535 ? -37.715 48.238  5.184   1.00 23.18 ? 535  ALA B O     1 
ATOM   9044  C CB    . ALA B 1 535 ? -36.898 51.048  6.946   1.00 22.99 ? 535  ALA B CB    1 
ATOM   9045  N N     . LEU B 1 536 ? -38.407 48.324  7.352   1.00 22.80 ? 536  LEU B N     1 
ATOM   9046  C CA    . LEU B 1 536 ? -38.335 46.869  7.548   1.00 22.75 ? 536  LEU B CA    1 
ATOM   9047  C C     . LEU B 1 536 ? -39.216 46.122  6.572   1.00 23.03 ? 536  LEU B C     1 
ATOM   9048  O O     . LEU B 1 536 ? -38.764 45.158  5.926   1.00 23.37 ? 536  LEU B O     1 
ATOM   9049  C CB    . LEU B 1 536 ? -38.709 46.473  8.965   1.00 22.91 ? 536  LEU B CB    1 
ATOM   9050  C CG    . LEU B 1 536 ? -37.643 46.806  10.011  1.00 22.92 ? 536  LEU B CG    1 
ATOM   9051  C CD1   . LEU B 1 536 ? -38.269 46.804  11.394  1.00 19.88 ? 536  LEU B CD1   1 
ATOM   9052  C CD2   . LEU B 1 536 ? -36.460 45.839  9.899   1.00 19.03 ? 536  LEU B CD2   1 
ATOM   9053  N N     . VAL B 1 537 ? -40.459 46.592  6.432   1.00 22.62 ? 537  VAL B N     1 
ATOM   9054  C CA    . VAL B 1 537 ? -41.442 45.945  5.559   1.00 22.06 ? 537  VAL B CA    1 
ATOM   9055  C C     . VAL B 1 537 ? -41.069 46.012  4.068   1.00 22.41 ? 537  VAL B C     1 
ATOM   9056  O O     . VAL B 1 537 ? -41.512 45.171  3.275   1.00 21.91 ? 537  VAL B O     1 
ATOM   9057  C CB    . VAL B 1 537 ? -42.876 46.452  5.833   1.00 22.44 ? 537  VAL B CB    1 
ATOM   9058  C CG1   . VAL B 1 537 ? -43.848 46.009  4.726   1.00 21.69 ? 537  VAL B CG1   1 
ATOM   9059  C CG2   . VAL B 1 537 ? -43.353 45.950  7.231   1.00 21.44 ? 537  VAL B CG2   1 
ATOM   9060  N N     . ALA B 1 538 ? -40.220 46.981  3.708   1.00 22.19 ? 538  ALA B N     1 
ATOM   9061  C CA    . ALA B 1 538 ? -39.753 47.126  2.330   1.00 22.30 ? 538  ALA B CA    1 
ATOM   9062  C C     . ALA B 1 538 ? -38.756 46.028  1.945   1.00 22.42 ? 538  ALA B C     1 
ATOM   9063  O O     . ALA B 1 538 ? -38.517 45.787  0.765   1.00 22.33 ? 538  ALA B O     1 
ATOM   9064  C CB    . ALA B 1 538 ? -39.162 48.532  2.087   1.00 21.65 ? 538  ALA B CB    1 
ATOM   9065  N N     . HIS B 1 539 ? -38.189 45.354  2.940   1.00 22.84 ? 539  HIS B N     1 
ATOM   9066  C CA    . HIS B 1 539 ? -37.260 44.271  2.664   1.00 23.15 ? 539  HIS B CA    1 
ATOM   9067  C C     . HIS B 1 539 ? -38.033 43.152  1.993   1.00 22.95 ? 539  HIS B C     1 
ATOM   9068  O O     . HIS B 1 539 ? -39.076 42.733  2.502   1.00 23.63 ? 539  HIS B O     1 
ATOM   9069  C CB    . HIS B 1 539 ? -36.571 43.765  3.952   1.00 23.07 ? 539  HIS B CB    1 
ATOM   9070  C CG    . HIS B 1 539 ? -35.500 42.746  3.696   1.00 23.91 ? 539  HIS B CG    1 
ATOM   9071  N ND1   . HIS B 1 539 ? -35.776 41.412  3.468   1.00 25.18 ? 539  HIS B ND1   1 
ATOM   9072  C CD2   . HIS B 1 539 ? -34.158 42.874  3.580   1.00 24.96 ? 539  HIS B CD2   1 
ATOM   9073  C CE1   . HIS B 1 539 ? -34.650 40.761  3.245   1.00 23.26 ? 539  HIS B CE1   1 
ATOM   9074  N NE2   . HIS B 1 539 ? -33.653 41.625  3.306   1.00 25.45 ? 539  HIS B NE2   1 
ATOM   9075  N N     . PRO B 1 540 ? -37.512 42.632  0.870   1.00 23.20 ? 540  PRO B N     1 
ATOM   9076  C CA    . PRO B 1 540 ? -38.282 41.653  0.067   1.00 22.79 ? 540  PRO B CA    1 
ATOM   9077  C C     . PRO B 1 540 ? -38.730 40.413  0.852   1.00 22.97 ? 540  PRO B C     1 
ATOM   9078  O O     . PRO B 1 540 ? -39.613 39.711  0.389   1.00 23.29 ? 540  PRO B O     1 
ATOM   9079  C CB    . PRO B 1 540 ? -37.295 41.235  -1.031  1.00 22.62 ? 540  PRO B CB    1 
ATOM   9080  C CG    . PRO B 1 540 ? -36.265 42.354  -1.107  1.00 22.35 ? 540  PRO B CG    1 
ATOM   9081  C CD    . PRO B 1 540 ? -36.166 42.894  0.302   1.00 23.14 ? 540  PRO B CD    1 
ATOM   9082  N N     . LYS B 1 541 ? -38.135 40.137  2.014   1.00 22.81 ? 541  LYS B N     1 
ATOM   9083  C CA    . LYS B 1 541 ? -38.470 38.912  2.765   1.00 22.77 ? 541  LYS B CA    1 
ATOM   9084  C C     . LYS B 1 541 ? -39.286 39.150  4.024   1.00 22.78 ? 541  LYS B C     1 
ATOM   9085  O O     . LYS B 1 541 ? -39.594 38.191  4.751   1.00 22.83 ? 541  LYS B O     1 
ATOM   9086  C CB    . LYS B 1 541 ? -37.217 38.142  3.172   1.00 23.00 ? 541  LYS B CB    1 
ATOM   9087  C CG    . LYS B 1 541 ? -36.437 37.511  2.031   1.00 23.48 ? 541  LYS B CG    1 
ATOM   9088  C CD    . LYS B 1 541 ? -35.277 36.733  2.616   1.00 25.07 ? 541  LYS B CD    1 
ATOM   9089  C CE    . LYS B 1 541 ? -34.303 36.313  1.538   1.00 28.28 ? 541  LYS B CE    1 
ATOM   9090  N NZ    . LYS B 1 541 ? -33.741 34.994  1.914   1.00 29.67 ? 541  LYS B NZ    1 
ATOM   9091  N N     . ILE B 1 542 ? -39.610 40.420  4.293   1.00 22.28 ? 542  ILE B N     1 
ATOM   9092  C CA    . ILE B 1 542 ? -40.367 40.789  5.474   1.00 21.42 ? 542  ILE B CA    1 
ATOM   9093  C C     . ILE B 1 542 ? -41.847 41.025  5.156   1.00 21.72 ? 542  ILE B C     1 
ATOM   9094  O O     . ILE B 1 542 ? -42.201 41.761  4.224   1.00 21.35 ? 542  ILE B O     1 
ATOM   9095  C CB    . ILE B 1 542 ? -39.697 41.974  6.234   1.00 22.06 ? 542  ILE B CB    1 
ATOM   9096  C CG1   . ILE B 1 542 ? -38.418 41.478  6.944   1.00 21.55 ? 542  ILE B CG1   1 
ATOM   9097  C CG2   . ILE B 1 542 ? -40.647 42.584  7.266   1.00 20.74 ? 542  ILE B CG2   1 
ATOM   9098  C CD1   . ILE B 1 542 ? -37.512 42.563  7.460   1.00 20.15 ? 542  ILE B CD1   1 
ATOM   9099  N N     . ALA B 1 543 ? -42.709 40.371  5.925   1.00 22.02 ? 543  ALA B N     1 
ATOM   9100  C CA    . ALA B 1 543 ? -44.150 40.535  5.746   1.00 22.77 ? 543  ALA B CA    1 
ATOM   9101  C C     . ALA B 1 543 ? -44.646 41.672  6.609   1.00 23.42 ? 543  ALA B C     1 
ATOM   9102  O O     . ALA B 1 543 ? -45.437 42.516  6.140   1.00 23.99 ? 543  ALA B O     1 
ATOM   9103  C CB    . ALA B 1 543 ? -44.911 39.243  6.067   1.00 21.85 ? 543  ALA B CB    1 
ATOM   9104  N N     . GLU B 1 544 ? -44.169 41.684  7.862   1.00 23.88 ? 544  GLU B N     1 
ATOM   9105  C CA    . GLU B 1 544 ? -44.692 42.545  8.918   1.00 24.30 ? 544  GLU B CA    1 
ATOM   9106  C C     . GLU B 1 544 ? -43.625 42.843  9.962   1.00 23.75 ? 544  GLU B C     1 
ATOM   9107  O O     . GLU B 1 544 ? -42.778 42.011  10.222  1.00 24.01 ? 544  GLU B O     1 
ATOM   9108  C CB    . GLU B 1 544 ? -45.875 41.871  9.620   1.00 23.91 ? 544  GLU B CB    1 
ATOM   9109  C CG    . GLU B 1 544 ? -47.079 41.577  8.736   1.00 25.85 ? 544  GLU B CG    1 
ATOM   9110  C CD    . GLU B 1 544 ? -48.164 40.807  9.472   1.00 26.43 ? 544  GLU B CD    1 
ATOM   9111  O OE1   . GLU B 1 544 ? -48.294 39.563  9.270   1.00 31.39 ? 544  GLU B OE1   1 
ATOM   9112  O OE2   . GLU B 1 544 ? -48.872 41.436  10.272  1.00 27.78 ? 544  GLU B OE2   1 
ATOM   9113  N N     . ALA B 1 545 ? -43.704 44.025  10.578  1.00 23.39 ? 545  ALA B N     1 
ATOM   9114  C CA    . ALA B 1 545 ? -42.790 44.453  11.636  1.00 22.66 ? 545  ALA B CA    1 
ATOM   9115  C C     . ALA B 1 545 ? -43.459 45.431  12.575  1.00 22.42 ? 545  ALA B C     1 
ATOM   9116  O O     . ALA B 1 545 ? -44.234 46.280  12.161  1.00 22.70 ? 545  ALA B O     1 
ATOM   9117  C CB    . ALA B 1 545 ? -41.531 45.087  11.059  1.00 22.14 ? 545  ALA B CB    1 
ATOM   9118  N N     . ALA B 1 546 ? -43.154 45.295  13.851  1.00 22.13 ? 546  ALA B N     1 
ATOM   9119  C CA    . ALA B 1 546 ? -43.548 46.264  14.838  1.00 22.23 ? 546  ALA B CA    1 
ATOM   9120  C C     . ALA B 1 546 ? -42.307 46.633  15.629  1.00 22.62 ? 546  ALA B C     1 
ATOM   9121  O O     . ALA B 1 546 ? -41.494 45.746  16.008  1.00 22.70 ? 546  ALA B O     1 
ATOM   9122  C CB    . ALA B 1 546 ? -44.624 45.692  15.742  1.00 22.15 ? 546  ALA B CB    1 
ATOM   9123  N N     . VAL B 1 547 ? -42.161 47.938  15.863  1.00 22.60 ? 547  VAL B N     1 
ATOM   9124  C CA    . VAL B 1 547 ? -40.959 48.510  16.482  1.00 22.44 ? 547  VAL B CA    1 
ATOM   9125  C C     . VAL B 1 547 ? -41.307 49.218  17.790  1.00 23.03 ? 547  VAL B C     1 
ATOM   9126  O O     . VAL B 1 547 ? -42.278 49.984  17.852  1.00 23.61 ? 547  VAL B O     1 
ATOM   9127  C CB    . VAL B 1 547 ? -40.238 49.434  15.483  1.00 22.34 ? 547  VAL B CB    1 
ATOM   9128  C CG1   . VAL B 1 547 ? -39.224 50.359  16.173  1.00 22.15 ? 547  VAL B CG1   1 
ATOM   9129  C CG2   . VAL B 1 547 ? -39.582 48.584  14.341  1.00 21.95 ? 547  VAL B CG2   1 
ATOM   9130  N N     . VAL B 1 548 ? -40.559 48.907  18.854  1.00 23.59 ? 548  VAL B N     1 
ATOM   9131  C CA    . VAL B 1 548 ? -40.682 49.629  20.143  1.00 23.74 ? 548  VAL B CA    1 
ATOM   9132  C C     . VAL B 1 548 ? -39.308 50.031  20.659  1.00 23.74 ? 548  VAL B C     1 
ATOM   9133  O O     . VAL B 1 548 ? -38.288 49.522  20.176  1.00 24.57 ? 548  VAL B O     1 
ATOM   9134  C CB    . VAL B 1 548 ? -41.414 48.796  21.248  1.00 24.26 ? 548  VAL B CB    1 
ATOM   9135  C CG1   . VAL B 1 548 ? -42.825 48.312  20.765  1.00 21.93 ? 548  VAL B CG1   1 
ATOM   9136  C CG2   . VAL B 1 548 ? -40.526 47.647  21.735  1.00 24.13 ? 548  VAL B CG2   1 
ATOM   9137  N N     . GLY B 1 549 ? -39.282 50.941  21.627  1.00 23.59 ? 549  GLY B N     1 
ATOM   9138  C CA    . GLY B 1 549 ? -38.046 51.324  22.300  1.00 23.71 ? 549  GLY B CA    1 
ATOM   9139  C C     . GLY B 1 549 ? -37.898 50.575  23.613  1.00 24.46 ? 549  GLY B C     1 
ATOM   9140  O O     . GLY B 1 549 ? -38.906 50.348  24.324  1.00 24.43 ? 549  GLY B O     1 
ATOM   9141  N N     . ILE B 1 550 ? -36.671 50.149  23.934  1.00 24.16 ? 550  ILE B N     1 
ATOM   9142  C CA    . ILE B 1 550 ? -36.392 49.636  25.289  1.00 24.58 ? 550  ILE B CA    1 
ATOM   9143  C C     . ILE B 1 550 ? -35.344 50.502  25.983  1.00 25.26 ? 550  ILE B C     1 
ATOM   9144  O O     . ILE B 1 550 ? -34.548 51.157  25.304  1.00 25.87 ? 550  ILE B O     1 
ATOM   9145  C CB    . ILE B 1 550 ? -35.964 48.140  25.316  1.00 24.27 ? 550  ILE B CB    1 
ATOM   9146  C CG1   . ILE B 1 550 ? -34.742 47.902  24.412  1.00 24.80 ? 550  ILE B CG1   1 
ATOM   9147  C CG2   . ILE B 1 550 ? -37.150 47.245  24.970  1.00 22.70 ? 550  ILE B CG2   1 
ATOM   9148  C CD1   . ILE B 1 550 ? -34.096 46.501  24.535  1.00 24.29 ? 550  ILE B CD1   1 
ATOM   9149  N N     . PRO B 1 551 ? -35.346 50.529  27.331  1.00 25.44 ? 551  PRO B N     1 
ATOM   9150  C CA    . PRO B 1 551 ? -34.274 51.259  28.019  1.00 25.38 ? 551  PRO B CA    1 
ATOM   9151  C C     . PRO B 1 551 ? -32.909 50.708  27.636  1.00 25.60 ? 551  PRO B C     1 
ATOM   9152  O O     . PRO B 1 551 ? -32.766 49.508  27.405  1.00 25.85 ? 551  PRO B O     1 
ATOM   9153  C CB    . PRO B 1 551 ? -34.566 51.009  29.506  1.00 25.19 ? 551  PRO B CB    1 
ATOM   9154  C CG    . PRO B 1 551 ? -36.059 50.682  29.554  1.00 25.05 ? 551  PRO B CG    1 
ATOM   9155  C CD    . PRO B 1 551 ? -36.297 49.912  28.284  1.00 25.55 ? 551  PRO B CD    1 
ATOM   9156  N N     . HIS B 1 552 ? -31.935 51.604  27.522  1.00 25.79 ? 552  HIS B N     1 
ATOM   9157  C CA    . HIS B 1 552 ? -30.568 51.263  27.159  1.00 26.26 ? 552  HIS B CA    1 
ATOM   9158  C C     . HIS B 1 552 ? -29.731 52.298  27.864  1.00 26.57 ? 552  HIS B C     1 
ATOM   9159  O O     . HIS B 1 552 ? -30.014 53.479  27.759  1.00 26.89 ? 552  HIS B O     1 
ATOM   9160  C CB    . HIS B 1 552 ? -30.349 51.359  25.641  1.00 25.98 ? 552  HIS B CB    1 
ATOM   9161  C CG    . HIS B 1 552 ? -29.032 50.812  25.185  1.00 26.06 ? 552  HIS B CG    1 
ATOM   9162  N ND1   . HIS B 1 552 ? -28.878 49.516  24.729  1.00 25.20 ? 552  HIS B ND1   1 
ATOM   9163  C CD2   . HIS B 1 552 ? -27.798 51.375  25.136  1.00 26.10 ? 552  HIS B CD2   1 
ATOM   9164  C CE1   . HIS B 1 552 ? -27.610 49.308  24.412  1.00 24.51 ? 552  HIS B CE1   1 
ATOM   9165  N NE2   . HIS B 1 552 ? -26.936 50.425  24.642  1.00 25.86 ? 552  HIS B NE2   1 
ATOM   9166  N N     . ALA B 1 553 ? -28.713 51.856  28.587  1.00 26.83 ? 553  ALA B N     1 
ATOM   9167  C CA    . ALA B 1 553 ? -27.890 52.753  29.392  1.00 27.36 ? 553  ALA B CA    1 
ATOM   9168  C C     . ALA B 1 553 ? -26.973 53.659  28.543  1.00 27.65 ? 553  ALA B C     1 
ATOM   9169  O O     . ALA B 1 553 ? -26.798 54.843  28.853  1.00 27.59 ? 553  ALA B O     1 
ATOM   9170  C CB    . ALA B 1 553 ? -27.083 51.947  30.407  1.00 27.11 ? 553  ALA B CB    1 
ATOM   9171  N N     . ILE B 1 554 ? -26.388 53.109  27.478  1.00 27.59 ? 554  ILE B N     1 
ATOM   9172  C CA    . ILE B 1 554 ? -25.551 53.911  26.588  1.00 27.74 ? 554  ILE B CA    1 
ATOM   9173  C C     . ILE B 1 554 ? -26.415 54.885  25.766  1.00 27.70 ? 554  ILE B C     1 
ATOM   9174  O O     . ILE B 1 554 ? -26.226 56.101  25.835  1.00 27.40 ? 554  ILE B O     1 
ATOM   9175  C CB    . ILE B 1 554 ? -24.630 53.013  25.690  1.00 27.96 ? 554  ILE B CB    1 
ATOM   9176  C CG1   . ILE B 1 554 ? -23.523 52.362  26.534  1.00 27.89 ? 554  ILE B CG1   1 
ATOM   9177  C CG2   . ILE B 1 554 ? -24.022 53.806  24.521  1.00 27.09 ? 554  ILE B CG2   1 
ATOM   9178  C CD1   . ILE B 1 554 ? -22.797 51.173  25.843  1.00 28.77 ? 554  ILE B CD1   1 
ATOM   9179  N N     . LYS B 1 555 ? -27.390 54.333  25.044  1.00 27.41 ? 555  LYS B N     1 
ATOM   9180  C CA    . LYS B 1 555 ? -28.175 55.071  24.062  1.00 27.88 ? 555  LYS B CA    1 
ATOM   9181  C C     . LYS B 1 555 ? -29.441 55.736  24.608  1.00 26.95 ? 555  LYS B C     1 
ATOM   9182  O O     . LYS B 1 555 ? -30.142 56.430  23.851  1.00 26.96 ? 555  LYS B O     1 
ATOM   9183  C CB    . LYS B 1 555 ? -28.568 54.145  22.909  1.00 27.87 ? 555  LYS B CB    1 
ATOM   9184  C CG    . LYS B 1 555 ? -27.381 53.427  22.273  1.00 30.45 ? 555  LYS B CG    1 
ATOM   9185  C CD    . LYS B 1 555 ? -27.771 52.471  21.145  1.00 30.09 ? 555  LYS B CD    1 
ATOM   9186  C CE    . LYS B 1 555 ? -26.539 51.611  20.786  1.00 34.85 ? 555  LYS B CE    1 
ATOM   9187  N NZ    . LYS B 1 555 ? -26.495 51.143  19.356  1.00 34.13 ? 555  LYS B NZ    1 
ATOM   9188  N N     . GLY B 1 556 ? -29.750 55.512  25.888  1.00 25.25 ? 556  GLY B N     1 
ATOM   9189  C CA    . GLY B 1 556 ? -31.004 55.993  26.450  1.00 24.12 ? 556  GLY B CA    1 
ATOM   9190  C C     . GLY B 1 556 ? -32.166 55.054  26.165  1.00 23.62 ? 556  GLY B C     1 
ATOM   9191  O O     . GLY B 1 556 ? -32.822 54.575  27.083  1.00 23.41 ? 556  GLY B O     1 
ATOM   9192  N N     . GLN B 1 557 ? -32.427 54.817  24.881  1.00 23.27 ? 557  GLN B N     1 
ATOM   9193  C CA    . GLN B 1 557 ? -33.389 53.834  24.414  1.00 22.94 ? 557  GLN B CA    1 
ATOM   9194  C C     . GLN B 1 557 ? -32.742 53.077  23.276  1.00 22.91 ? 557  GLN B C     1 
ATOM   9195  O O     . GLN B 1 557 ? -32.010 53.645  22.482  1.00 22.43 ? 557  GLN B O     1 
ATOM   9196  C CB    . GLN B 1 557 ? -34.635 54.513  23.840  1.00 23.22 ? 557  GLN B CB    1 
ATOM   9197  C CG    . GLN B 1 557 ? -35.792 54.651  24.756  1.00 24.38 ? 557  GLN B CG    1 
ATOM   9198  C CD    . GLN B 1 557 ? -37.022 55.091  24.021  1.00 25.31 ? 557  GLN B CD    1 
ATOM   9199  O OE1   . GLN B 1 557 ? -36.935 55.810  23.035  1.00 25.45 ? 557  GLN B OE1   1 
ATOM   9200  N NE2   . GLN B 1 557 ? -38.193 54.669  24.508  1.00 26.63 ? 557  GLN B NE2   1 
ATOM   9201  N N     . ALA B 1 558 ? -33.054 51.796  23.170  1.00 23.09 ? 558  ALA B N     1 
ATOM   9202  C CA    . ALA B 1 558 ? -32.592 50.998  22.053  1.00 23.46 ? 558  ALA B CA    1 
ATOM   9203  C C     . ALA B 1 558 ? -33.799 50.672  21.153  1.00 23.25 ? 558  ALA B C     1 
ATOM   9204  O O     . ALA B 1 558 ? -34.936 50.756  21.605  1.00 22.84 ? 558  ALA B O     1 
ATOM   9205  C CB    . ALA B 1 558 ? -31.888 49.716  22.551  1.00 22.88 ? 558  ALA B CB    1 
ATOM   9206  N N     . ILE B 1 559 ? -33.528 50.334  19.888  1.00 23.22 ? 559  ILE B N     1 
ATOM   9207  C CA    . ILE B 1 559 ? -34.561 50.004  18.917  1.00 23.46 ? 559  ILE B CA    1 
ATOM   9208  C C     . ILE B 1 559 ? -34.744 48.490  18.928  1.00 23.79 ? 559  ILE B C     1 
ATOM   9209  O O     . ILE B 1 559 ? -33.801 47.735  18.636  1.00 23.57 ? 559  ILE B O     1 
ATOM   9210  C CB    . ILE B 1 559 ? -34.196 50.528  17.471  1.00 23.64 ? 559  ILE B CB    1 
ATOM   9211  C CG1   . ILE B 1 559 ? -34.073 52.050  17.460  1.00 24.08 ? 559  ILE B CG1   1 
ATOM   9212  C CG2   . ILE B 1 559 ? -35.217 50.080  16.428  1.00 23.08 ? 559  ILE B CG2   1 
ATOM   9213  C CD1   . ILE B 1 559 ? -33.443 52.630  16.192  1.00 23.03 ? 559  ILE B CD1   1 
ATOM   9214  N N     . TYR B 1 560 ? -35.955 48.054  19.279  1.00 24.10 ? 560  TYR B N     1 
ATOM   9215  C CA    . TYR B 1 560 ? -36.291 46.623  19.367  1.00 23.88 ? 560  TYR B CA    1 
ATOM   9216  C C     . TYR B 1 560 ? -37.410 46.307  18.364  1.00 24.37 ? 560  TYR B C     1 
ATOM   9217  O O     . TYR B 1 560 ? -38.547 46.755  18.522  1.00 24.61 ? 560  TYR B O     1 
ATOM   9218  C CB    . TYR B 1 560 ? -36.696 46.294  20.809  1.00 23.60 ? 560  TYR B CB    1 
ATOM   9219  C CG    . TYR B 1 560 ? -36.980 44.839  21.140  1.00 22.43 ? 560  TYR B CG    1 
ATOM   9220  C CD1   . TYR B 1 560 ? -38.066 44.168  20.567  1.00 22.00 ? 560  TYR B CD1   1 
ATOM   9221  C CD2   . TYR B 1 560 ? -36.200 44.154  22.083  1.00 22.68 ? 560  TYR B CD2   1 
ATOM   9222  C CE1   . TYR B 1 560 ? -38.357 42.843  20.898  1.00 23.50 ? 560  TYR B CE1   1 
ATOM   9223  C CE2   . TYR B 1 560 ? -36.476 42.817  22.428  1.00 22.60 ? 560  TYR B CE2   1 
ATOM   9224  C CZ    . TYR B 1 560 ? -37.560 42.167  21.828  1.00 23.38 ? 560  TYR B CZ    1 
ATOM   9225  O OH    . TYR B 1 560 ? -37.846 40.853  22.132  1.00 22.06 ? 560  TYR B OH    1 
ATOM   9226  N N     . ALA B 1 561 ? -37.068 45.552  17.323  1.00 24.58 ? 561  ALA B N     1 
ATOM   9227  C CA    . ALA B 1 561 ? -37.981 45.254  16.207  1.00 24.74 ? 561  ALA B CA    1 
ATOM   9228  C C     . ALA B 1 561 ? -38.523 43.812  16.237  1.00 25.06 ? 561  ALA B C     1 
ATOM   9229  O O     . ALA B 1 561 ? -37.754 42.846  16.259  1.00 25.47 ? 561  ALA B O     1 
ATOM   9230  C CB    . ALA B 1 561 ? -37.264 45.511  14.865  1.00 24.11 ? 561  ALA B CB    1 
ATOM   9231  N N     . TYR B 1 562 ? -39.842 43.668  16.252  1.00 25.40 ? 562  TYR B N     1 
ATOM   9232  C CA    . TYR B 1 562 ? -40.471 42.368  15.993  1.00 25.38 ? 562  TYR B CA    1 
ATOM   9233  C C     . TYR B 1 562 ? -40.671 42.258  14.478  1.00 25.35 ? 562  TYR B C     1 
ATOM   9234  O O     . TYR B 1 562 ? -41.287 43.142  13.877  1.00 25.13 ? 562  TYR B O     1 
ATOM   9235  C CB    . TYR B 1 562 ? -41.829 42.252  16.685  1.00 25.83 ? 562  TYR B CB    1 
ATOM   9236  C CG    . TYR B 1 562 ? -41.822 42.361  18.203  1.00 24.86 ? 562  TYR B CG    1 
ATOM   9237  C CD1   . TYR B 1 562 ? -41.802 43.606  18.828  1.00 25.32 ? 562  TYR B CD1   1 
ATOM   9238  C CD2   . TYR B 1 562 ? -41.851 41.222  19.005  1.00 24.63 ? 562  TYR B CD2   1 
ATOM   9239  C CE1   . TYR B 1 562 ? -41.816 43.718  20.225  1.00 25.57 ? 562  TYR B CE1   1 
ATOM   9240  C CE2   . TYR B 1 562 ? -41.862 41.321  20.416  1.00 24.30 ? 562  TYR B CE2   1 
ATOM   9241  C CZ    . TYR B 1 562 ? -41.846 42.575  21.004  1.00 24.55 ? 562  TYR B CZ    1 
ATOM   9242  O OH    . TYR B 1 562 ? -41.864 42.708  22.368  1.00 25.61 ? 562  TYR B OH    1 
ATOM   9243  N N     . VAL B 1 563 ? -40.138 41.190  13.876  1.00 24.44 ? 563  VAL B N     1 
ATOM   9244  C CA    . VAL B 1 563 ? -40.160 41.010  12.433  1.00 24.13 ? 563  VAL B CA    1 
ATOM   9245  C C     . VAL B 1 563 ? -40.884 39.716  12.097  1.00 24.22 ? 563  VAL B C     1 
ATOM   9246  O O     . VAL B 1 563 ? -40.632 38.684  12.719  1.00 24.29 ? 563  VAL B O     1 
ATOM   9247  C CB    . VAL B 1 563 ? -38.715 40.944  11.828  1.00 24.62 ? 563  VAL B CB    1 
ATOM   9248  C CG1   . VAL B 1 563 ? -38.769 40.747  10.327  1.00 23.16 ? 563  VAL B CG1   1 
ATOM   9249  C CG2   . VAL B 1 563 ? -37.863 42.190  12.206  1.00 23.79 ? 563  VAL B CG2   1 
ATOM   9250  N N     . THR B 1 564 ? -41.794 39.789  11.121  1.00 24.43 ? 564  THR B N     1 
ATOM   9251  C CA    . THR B 1 564 ? -42.536 38.633  10.603  1.00 24.01 ? 564  THR B CA    1 
ATOM   9252  C C     . THR B 1 564 ? -42.181 38.496  9.118   1.00 24.06 ? 564  THR B C     1 
ATOM   9253  O O     . THR B 1 564 ? -42.439 39.397  8.315   1.00 23.93 ? 564  THR B O     1 
ATOM   9254  C CB    . THR B 1 564 ? -44.090 38.752  10.841  1.00 23.93 ? 564  THR B CB    1 
ATOM   9255  O OG1   . THR B 1 564 ? -44.353 38.765  12.241  1.00 24.25 ? 564  THR B OG1   1 
ATOM   9256  C CG2   . THR B 1 564 ? -44.872 37.581  10.233  1.00 22.62 ? 564  THR B CG2   1 
ATOM   9257  N N     . LEU B 1 565 ? -41.569 37.355  8.788   1.00 24.22 ? 565  LEU B N     1 
ATOM   9258  C CA    . LEU B 1 565 ? -41.068 37.036  7.444   1.00 23.29 ? 565  LEU B CA    1 
ATOM   9259  C C     . LEU B 1 565 ? -42.173 36.474  6.606   1.00 23.13 ? 565  LEU B C     1 
ATOM   9260  O O     . LEU B 1 565 ? -43.104 35.856  7.132   1.00 22.72 ? 565  LEU B O     1 
ATOM   9261  C CB    . LEU B 1 565 ? -39.962 35.987  7.536   1.00 23.03 ? 565  LEU B CB    1 
ATOM   9262  C CG    . LEU B 1 565 ? -38.714 36.337  8.346   1.00 22.62 ? 565  LEU B CG    1 
ATOM   9263  C CD1   . LEU B 1 565 ? -37.769 35.151  8.374   1.00 21.29 ? 565  LEU B CD1   1 
ATOM   9264  C CD2   . LEU B 1 565 ? -38.025 37.601  7.786   1.00 22.21 ? 565  LEU B CD2   1 
ATOM   9265  N N     . ASN B 1 566 ? -42.071 36.688  5.301   1.00 23.13 ? 566  ASN B N     1 
ATOM   9266  C CA    . ASN B 1 566 ? -42.986 36.050  4.352   1.00 23.54 ? 566  ASN B CA    1 
ATOM   9267  C C     . ASN B 1 566 ? -43.010 34.530  4.499   1.00 23.54 ? 566  ASN B C     1 
ATOM   9268  O O     . ASN B 1 566 ? -42.001 33.899  4.816   1.00 23.45 ? 566  ASN B O     1 
ATOM   9269  C CB    . ASN B 1 566 ? -42.637 36.437  2.913   1.00 23.28 ? 566  ASN B CB    1 
ATOM   9270  C CG    . ASN B 1 566 ? -42.896 37.918  2.623   1.00 22.97 ? 566  ASN B CG    1 
ATOM   9271  O OD1   . ASN B 1 566 ? -43.911 38.479  3.043   1.00 23.43 ? 566  ASN B OD1   1 
ATOM   9272  N ND2   . ASN B 1 566 ? -41.975 38.553  1.903   1.00 19.77 ? 566  ASN B ND2   1 
ATOM   9273  N N     . HIS B 1 567 ? -44.182 33.950  4.299   1.00 23.96 ? 567  HIS B N     1 
ATOM   9274  C CA    . HIS B 1 567 ? -44.324 32.502  4.287   1.00 24.13 ? 567  HIS B CA    1 
ATOM   9275  C C     . HIS B 1 567 ? -43.246 31.900  3.375   1.00 24.66 ? 567  HIS B C     1 
ATOM   9276  O O     . HIS B 1 567 ? -43.099 32.313  2.225   1.00 24.21 ? 567  HIS B O     1 
ATOM   9277  C CB    . HIS B 1 567 ? -45.713 32.108  3.782   1.00 23.63 ? 567  HIS B CB    1 
ATOM   9278  C CG    . HIS B 1 567 ? -46.838 32.680  4.585   1.00 23.16 ? 567  HIS B CG    1 
ATOM   9279  N ND1   . HIS B 1 567 ? -48.122 32.749  4.106   1.00 23.14 ? 567  HIS B ND1   1 
ATOM   9280  C CD2   . HIS B 1 567 ? -46.875 33.208  5.834   1.00 22.78 ? 567  HIS B CD2   1 
ATOM   9281  C CE1   . HIS B 1 567 ? -48.909 33.275  5.029   1.00 23.21 ? 567  HIS B CE1   1 
ATOM   9282  N NE2   . HIS B 1 567 ? -48.174 33.570  6.084   1.00 22.20 ? 567  HIS B NE2   1 
ATOM   9283  N N     . GLY B 1 568 ? -42.492 30.942  3.915   1.00 25.26 ? 568  GLY B N     1 
ATOM   9284  C CA    . GLY B 1 568 ? -41.410 30.280  3.191   1.00 25.44 ? 568  GLY B CA    1 
ATOM   9285  C C     . GLY B 1 568 ? -40.024 30.774  3.540   1.00 25.79 ? 568  GLY B C     1 
ATOM   9286  O O     . GLY B 1 568 ? -39.033 30.176  3.117   1.00 25.67 ? 568  GLY B O     1 
ATOM   9287  N N     . GLU B 1 569 ? -39.947 31.871  4.296   1.00 26.15 ? 569  GLU B N     1 
ATOM   9288  C CA    . GLU B 1 569 ? -38.659 32.393  4.741   1.00 26.81 ? 569  GLU B CA    1 
ATOM   9289  C C     . GLU B 1 569 ? -38.352 31.938  6.163   1.00 27.73 ? 569  GLU B C     1 
ATOM   9290  O O     . GLU B 1 569 ? -39.246 31.789  7.012   1.00 28.19 ? 569  GLU B O     1 
ATOM   9291  C CB    . GLU B 1 569 ? -38.582 33.923  4.652   1.00 26.49 ? 569  GLU B CB    1 
ATOM   9292  C CG    . GLU B 1 569 ? -39.031 34.550  3.322   1.00 25.87 ? 569  GLU B CG    1 
ATOM   9293  C CD    . GLU B 1 569 ? -38.227 34.110  2.099   1.00 25.55 ? 569  GLU B CD    1 
ATOM   9294  O OE1   . GLU B 1 569 ? -37.093 33.601  2.237   1.00 26.16 ? 569  GLU B OE1   1 
ATOM   9295  O OE2   . GLU B 1 569 ? -38.744 34.281  0.977   1.00 25.90 ? 569  GLU B OE2   1 
ATOM   9296  N N     . GLU B 1 570 ? -37.072 31.727  6.408   1.00 28.34 ? 570  GLU B N     1 
ATOM   9297  C CA    . GLU B 1 570 ? -36.600 31.172  7.644   1.00 29.05 ? 570  GLU B CA    1 
ATOM   9298  C C     . GLU B 1 570 ? -35.529 32.136  8.190   1.00 28.24 ? 570  GLU B C     1 
ATOM   9299  O O     . GLU B 1 570 ? -34.728 32.675  7.416   1.00 28.53 ? 570  GLU B O     1 
ATOM   9300  C CB    . GLU B 1 570 ? -36.044 29.774  7.345   1.00 30.02 ? 570  GLU B CB    1 
ATOM   9301  C CG    . GLU B 1 570 ? -36.579 28.602  8.245   1.00 33.97 ? 570  GLU B CG    1 
ATOM   9302  C CD    . GLU B 1 570 ? -38.087 28.661  8.570   1.00 38.47 ? 570  GLU B CD    1 
ATOM   9303  O OE1   . GLU B 1 570 ? -38.938 28.247  7.735   1.00 39.82 ? 570  GLU B OE1   1 
ATOM   9304  O OE2   . GLU B 1 570 ? -38.417 29.097  9.696   1.00 40.27 ? 570  GLU B OE2   1 
ATOM   9305  N N     . PRO B 1 571 ? -35.518 32.381  9.518   1.00 27.06 ? 571  PRO B N     1 
ATOM   9306  C CA    . PRO B 1 571 ? -34.481 33.255  10.074  1.00 25.98 ? 571  PRO B CA    1 
ATOM   9307  C C     . PRO B 1 571 ? -33.083 32.642  9.928   1.00 25.58 ? 571  PRO B C     1 
ATOM   9308  O O     . PRO B 1 571 ? -32.947 31.431  9.700   1.00 25.51 ? 571  PRO B O     1 
ATOM   9309  C CB    . PRO B 1 571 ? -34.837 33.332  11.565  1.00 26.51 ? 571  PRO B CB    1 
ATOM   9310  C CG    . PRO B 1 571 ? -36.233 32.804  11.704  1.00 26.08 ? 571  PRO B CG    1 
ATOM   9311  C CD    . PRO B 1 571 ? -36.415 31.842  10.559  1.00 27.02 ? 571  PRO B CD    1 
ATOM   9312  N N     . SER B 1 572 ? -32.052 33.474  10.059  1.00 24.55 ? 572  SER B N     1 
ATOM   9313  C CA    . SER B 1 572 ? -30.674 33.024  10.028  1.00 23.31 ? 572  SER B CA    1 
ATOM   9314  C C     . SER B 1 572 ? -29.809 34.199  10.457  1.00 23.49 ? 572  SER B C     1 
ATOM   9315  O O     . SER B 1 572 ? -30.238 35.357  10.330  1.00 23.50 ? 572  SER B O     1 
ATOM   9316  C CB    . SER B 1 572 ? -30.281 32.540  8.619   1.00 23.44 ? 572  SER B CB    1 
ATOM   9317  O OG    . SER B 1 572 ? -30.012 33.601  7.714   1.00 22.40 ? 572  SER B OG    1 
ATOM   9318  N N     . PRO B 1 573 ? -28.593 33.927  10.965  1.00 22.86 ? 573  PRO B N     1 
ATOM   9319  C CA    . PRO B 1 573 ? -27.679 35.007  11.298  1.00 22.87 ? 573  PRO B CA    1 
ATOM   9320  C C     . PRO B 1 573 ? -27.378 35.941  10.125  1.00 23.08 ? 573  PRO B C     1 
ATOM   9321  O O     . PRO B 1 573 ? -27.236 37.149  10.316  1.00 23.85 ? 573  PRO B O     1 
ATOM   9322  C CB    . PRO B 1 573 ? -26.405 34.265  11.726  1.00 22.93 ? 573  PRO B CB    1 
ATOM   9323  C CG    . PRO B 1 573 ? -26.875 32.960  12.221  1.00 22.94 ? 573  PRO B CG    1 
ATOM   9324  C CD    . PRO B 1 573 ? -28.026 32.612  11.306  1.00 23.04 ? 573  PRO B CD    1 
ATOM   9325  N N     . GLU B 1 574 ? -27.261 35.376  8.932   1.00 22.93 ? 574  GLU B N     1 
ATOM   9326  C CA    . GLU B 1 574 ? -27.030 36.121  7.711   1.00 23.19 ? 574  GLU B CA    1 
ATOM   9327  C C     . GLU B 1 574 ? -28.194 37.101  7.478   1.00 22.54 ? 574  GLU B C     1 
ATOM   9328  O O     . GLU B 1 574 ? -27.978 38.273  7.202   1.00 22.46 ? 574  GLU B O     1 
ATOM   9329  C CB    . GLU B 1 574 ? -26.891 35.129  6.543   1.00 22.80 ? 574  GLU B CB    1 
ATOM   9330  C CG    . GLU B 1 574 ? -26.344 35.693  5.267   1.00 24.06 ? 574  GLU B CG    1 
ATOM   9331  C CD    . GLU B 1 574 ? -26.379 34.705  4.066   1.00 25.60 ? 574  GLU B CD    1 
ATOM   9332  O OE1   . GLU B 1 574 ? -26.252 33.459  4.282   1.00 25.12 ? 574  GLU B OE1   1 
ATOM   9333  O OE2   . GLU B 1 574 ? -26.498 35.206  2.894   1.00 27.07 ? 574  GLU B OE2   1 
ATOM   9334  N N     . LEU B 1 575 ? -29.425 36.616  7.621   1.00 22.34 ? 575  LEU B N     1 
ATOM   9335  C CA    . LEU B 1 575 ? -30.610 37.448  7.430   1.00 22.05 ? 575  LEU B CA    1 
ATOM   9336  C C     . LEU B 1 575 ? -30.733 38.521  8.504   1.00 21.91 ? 575  LEU B C     1 
ATOM   9337  O O     . LEU B 1 575 ? -31.104 39.656  8.219   1.00 22.41 ? 575  LEU B O     1 
ATOM   9338  C CB    . LEU B 1 575 ? -31.880 36.589  7.356   1.00 21.62 ? 575  LEU B CB    1 
ATOM   9339  C CG    . LEU B 1 575 ? -33.145 37.301  6.875   1.00 22.15 ? 575  LEU B CG    1 
ATOM   9340  C CD1   . LEU B 1 575 ? -32.994 37.890  5.455   1.00 18.48 ? 575  LEU B CD1   1 
ATOM   9341  C CD2   . LEU B 1 575 ? -34.340 36.348  6.967   1.00 22.16 ? 575  LEU B CD2   1 
ATOM   9342  N N     . TYR B 1 576 ? -30.416 38.148  9.736   1.00 21.75 ? 576  TYR B N     1 
ATOM   9343  C CA    . TYR B 1 576 ? -30.325 39.068  10.847  1.00 21.44 ? 576  TYR B CA    1 
ATOM   9344  C C     . TYR B 1 576 ? -29.482 40.321  10.517  1.00 21.59 ? 576  TYR B C     1 
ATOM   9345  O O     . TYR B 1 576 ? -29.977 41.452  10.570  1.00 21.57 ? 576  TYR B O     1 
ATOM   9346  C CB    . TYR B 1 576 ? -29.738 38.323  12.046  1.00 21.59 ? 576  TYR B CB    1 
ATOM   9347  C CG    . TYR B 1 576 ? -30.009 39.008  13.356  1.00 22.56 ? 576  TYR B CG    1 
ATOM   9348  C CD1   . TYR B 1 576 ? -31.068 38.591  14.157  1.00 21.81 ? 576  TYR B CD1   1 
ATOM   9349  C CD2   . TYR B 1 576 ? -29.226 40.095  13.789  1.00 21.34 ? 576  TYR B CD2   1 
ATOM   9350  C CE1   . TYR B 1 576 ? -31.338 39.215  15.353  1.00 21.93 ? 576  TYR B CE1   1 
ATOM   9351  C CE2   . TYR B 1 576 ? -29.497 40.727  14.987  1.00 21.95 ? 576  TYR B CE2   1 
ATOM   9352  C CZ    . TYR B 1 576 ? -30.557 40.274  15.766  1.00 21.89 ? 576  TYR B CZ    1 
ATOM   9353  O OH    . TYR B 1 576 ? -30.866 40.861  16.969  1.00 23.11 ? 576  TYR B OH    1 
ATOM   9354  N N     . ALA B 1 577 ? -28.214 40.109  10.170  1.00 21.65 ? 577  ALA B N     1 
ATOM   9355  C CA    . ALA B 1 577 ? -27.321 41.191  9.779   1.00 21.46 ? 577  ALA B CA    1 
ATOM   9356  C C     . ALA B 1 577 ? -27.836 41.887  8.524   1.00 21.42 ? 577  ALA B C     1 
ATOM   9357  O O     . ALA B 1 577 ? -27.699 43.113  8.378   1.00 20.62 ? 577  ALA B O     1 
ATOM   9358  C CB    . ALA B 1 577 ? -25.913 40.655  9.554   1.00 21.07 ? 577  ALA B CB    1 
ATOM   9359  N N     . GLU B 1 578 ? -28.431 41.099  7.621   1.00 21.73 ? 578  GLU B N     1 
ATOM   9360  C CA    . GLU B 1 578 ? -28.969 41.632  6.354   1.00 22.62 ? 578  GLU B CA    1 
ATOM   9361  C C     . GLU B 1 578 ? -30.097 42.631  6.571   1.00 22.70 ? 578  GLU B C     1 
ATOM   9362  O O     . GLU B 1 578 ? -30.125 43.693  5.956   1.00 24.00 ? 578  GLU B O     1 
ATOM   9363  C CB    . GLU B 1 578 ? -29.447 40.521  5.414   1.00 22.53 ? 578  GLU B CB    1 
ATOM   9364  C CG    . GLU B 1 578 ? -29.566 40.971  3.956   1.00 22.82 ? 578  GLU B CG    1 
ATOM   9365  C CD    . GLU B 1 578 ? -30.255 39.942  3.092   1.00 25.77 ? 578  GLU B CD    1 
ATOM   9366  O OE1   . GLU B 1 578 ? -29.686 38.834  2.889   1.00 27.23 ? 578  GLU B OE1   1 
ATOM   9367  O OE2   . GLU B 1 578 ? -31.378 40.234  2.626   1.00 23.52 ? 578  GLU B OE2   1 
ATOM   9368  N N     . VAL B 1 579 ? -31.021 42.281  7.454   1.00 22.52 ? 579  VAL B N     1 
ATOM   9369  C CA    . VAL B 1 579 ? -32.134 43.150  7.788   1.00 22.07 ? 579  VAL B CA    1 
ATOM   9370  C C     . VAL B 1 579 ? -31.669 44.432  8.505   1.00 22.67 ? 579  VAL B C     1 
ATOM   9371  O O     . VAL B 1 579 ? -32.152 45.523  8.197   1.00 23.29 ? 579  VAL B O     1 
ATOM   9372  C CB    . VAL B 1 579 ? -33.196 42.385  8.618   1.00 21.66 ? 579  VAL B CB    1 
ATOM   9373  C CG1   . VAL B 1 579 ? -34.227 43.352  9.203   1.00 20.14 ? 579  VAL B CG1   1 
ATOM   9374  C CG2   . VAL B 1 579 ? -33.856 41.303  7.766   1.00 18.61 ? 579  VAL B CG2   1 
ATOM   9375  N N     . ARG B 1 580 ? -30.754 44.295  9.459   1.00 22.40 ? 580  ARG B N     1 
ATOM   9376  C CA    . ARG B 1 580 ? -30.152 45.457  10.125  1.00 22.78 ? 580  ARG B CA    1 
ATOM   9377  C C     . ARG B 1 580 ? -29.487 46.421  9.130   1.00 23.16 ? 580  ARG B C     1 
ATOM   9378  O O     . ARG B 1 580 ? -29.734 47.630  9.190   1.00 23.37 ? 580  ARG B O     1 
ATOM   9379  C CB    . ARG B 1 580 ? -29.132 45.017  11.168  1.00 22.40 ? 580  ARG B CB    1 
ATOM   9380  C CG    . ARG B 1 580 ? -29.762 44.307  12.349  1.00 24.38 ? 580  ARG B CG    1 
ATOM   9381  C CD    . ARG B 1 580 ? -29.305 45.005  13.619  1.00 28.27 ? 580  ARG B CD    1 
ATOM   9382  N NE    . ARG B 1 580 ? -27.942 44.630  13.887  1.00 29.70 ? 580  ARG B NE    1 
ATOM   9383  C CZ    . ARG B 1 580 ? -27.000 45.387  14.426  1.00 30.10 ? 580  ARG B CZ    1 
ATOM   9384  N NH1   . ARG B 1 580 ? -27.244 46.640  14.814  1.00 27.50 ? 580  ARG B NH1   1 
ATOM   9385  N NH2   . ARG B 1 580 ? -25.790 44.837  14.581  1.00 30.72 ? 580  ARG B NH2   1 
ATOM   9386  N N     . ASN B 1 581 ? -28.653 45.881  8.224   1.00 22.79 ? 581  ASN B N     1 
ATOM   9387  C CA    . ASN B 1 581 ? -27.993 46.663  7.173   1.00 21.85 ? 581  ASN B CA    1 
ATOM   9388  C C     . ASN B 1 581 ? -29.023 47.294  6.250   1.00 21.35 ? 581  ASN B C     1 
ATOM   9389  O O     . ASN B 1 581 ? -28.779 48.342  5.655   1.00 20.56 ? 581  ASN B O     1 
ATOM   9390  C CB    . ASN B 1 581 ? -27.030 45.778  6.362   1.00 21.86 ? 581  ASN B CB    1 
ATOM   9391  C CG    . ASN B 1 581 ? -25.697 45.511  7.096   1.00 23.40 ? 581  ASN B CG    1 
ATOM   9392  O OD1   . ASN B 1 581 ? -25.276 46.302  7.953   1.00 25.76 ? 581  ASN B OD1   1 
ATOM   9393  N ND2   . ASN B 1 581 ? -25.018 44.407  6.737   1.00 21.09 ? 581  ASN B ND2   1 
ATOM   9394  N N     . TRP B 1 582 ? -30.179 46.639  6.135   1.00 21.43 ? 582  TRP B N     1 
ATOM   9395  C CA    . TRP B 1 582 ? -31.245 47.089  5.239   1.00 21.54 ? 582  TRP B CA    1 
ATOM   9396  C C     . TRP B 1 582 ? -31.850 48.412  5.747   1.00 20.91 ? 582  TRP B C     1 
ATOM   9397  O O     . TRP B 1 582 ? -31.996 49.371  4.983   1.00 20.91 ? 582  TRP B O     1 
ATOM   9398  C CB    . TRP B 1 582 ? -32.320 45.996  5.050   1.00 22.12 ? 582  TRP B CB    1 
ATOM   9399  C CG    . TRP B 1 582 ? -33.515 46.504  4.282   1.00 22.92 ? 582  TRP B CG    1 
ATOM   9400  C CD1   . TRP B 1 582 ? -34.645 47.110  4.795   1.00 23.52 ? 582  TRP B CD1   1 
ATOM   9401  C CD2   . TRP B 1 582 ? -33.678 46.497  2.857   1.00 22.43 ? 582  TRP B CD2   1 
ATOM   9402  N NE1   . TRP B 1 582 ? -35.500 47.468  3.766   1.00 22.97 ? 582  TRP B NE1   1 
ATOM   9403  C CE2   . TRP B 1 582 ? -34.932 47.099  2.570   1.00 23.08 ? 582  TRP B CE2   1 
ATOM   9404  C CE3   . TRP B 1 582 ? -32.895 46.031  1.798   1.00 22.71 ? 582  TRP B CE3   1 
ATOM   9405  C CZ2   . TRP B 1 582 ? -35.415 47.249  1.258   1.00 23.41 ? 582  TRP B CZ2   1 
ATOM   9406  C CZ3   . TRP B 1 582 ? -33.388 46.176  0.480   1.00 24.38 ? 582  TRP B CZ3   1 
ATOM   9407  C CH2   . TRP B 1 582 ? -34.634 46.798  0.233   1.00 23.25 ? 582  TRP B CH2   1 
ATOM   9408  N N     . VAL B 1 583 ? -32.173 48.457  7.034   1.00 20.09 ? 583  VAL B N     1 
ATOM   9409  C CA    . VAL B 1 583 ? -32.614 49.692  7.688   1.00 19.96 ? 583  VAL B CA    1 
ATOM   9410  C C     . VAL B 1 583 ? -31.513 50.777  7.647   1.00 21.06 ? 583  VAL B C     1 
ATOM   9411  O O     . VAL B 1 583 ? -31.798 51.972  7.418   1.00 20.25 ? 583  VAL B O     1 
ATOM   9412  C CB    . VAL B 1 583 ? -33.033 49.414  9.133   1.00 19.63 ? 583  VAL B CB    1 
ATOM   9413  C CG1   . VAL B 1 583 ? -33.569 50.685  9.824   1.00 18.13 ? 583  VAL B CG1   1 
ATOM   9414  C CG2   . VAL B 1 583 ? -34.068 48.271  9.161   1.00 17.24 ? 583  VAL B CG2   1 
ATOM   9415  N N     . GLU B 1 584 ? -30.258 50.359  7.828   1.00 21.31 ? 584  GLU B N     1 
ATOM   9416  C CA    . GLU B 1 584 ? -29.164 51.300  7.719   1.00 22.86 ? 584  GLU B CA    1 
ATOM   9417  C C     . GLU B 1 584 ? -29.174 51.998  6.357   1.00 22.96 ? 584  GLU B C     1 
ATOM   9418  O O     . GLU B 1 584 ? -29.002 53.207  6.259   1.00 24.06 ? 584  GLU B O     1 
ATOM   9419  C CB    . GLU B 1 584 ? -27.825 50.622  7.989   1.00 22.93 ? 584  GLU B CB    1 
ATOM   9420  C CG    . GLU B 1 584 ? -26.647 51.523  7.768   1.00 25.78 ? 584  GLU B CG    1 
ATOM   9421  C CD    . GLU B 1 584 ? -25.343 50.933  8.265   1.00 30.27 ? 584  GLU B CD    1 
ATOM   9422  O OE1   . GLU B 1 584 ? -24.694 51.596  9.090   1.00 33.34 ? 584  GLU B OE1   1 
ATOM   9423  O OE2   . GLU B 1 584 ? -24.963 49.813  7.861   1.00 32.48 ? 584  GLU B OE2   1 
ATOM   9424  N N     . LYS B 1 585 ? -29.396 51.232  5.310   1.00 23.11 ? 585  LYS B N     1 
ATOM   9425  C CA    . LYS B 1 585 ? -29.384 51.758  3.963   1.00 23.68 ? 585  LYS B CA    1 
ATOM   9426  C C     . LYS B 1 585 ? -30.675 52.548  3.639   1.00 23.15 ? 585  LYS B C     1 
ATOM   9427  O O     . LYS B 1 585 ? -30.651 53.487  2.838   1.00 22.96 ? 585  LYS B O     1 
ATOM   9428  C CB    . LYS B 1 585 ? -29.132 50.589  2.991   1.00 23.73 ? 585  LYS B CB    1 
ATOM   9429  C CG    . LYS B 1 585 ? -29.256 50.906  1.505   1.00 27.68 ? 585  LYS B CG    1 
ATOM   9430  C CD    . LYS B 1 585 ? -30.706 50.804  0.986   1.00 31.63 ? 585  LYS B CD    1 
ATOM   9431  C CE    . LYS B 1 585 ? -31.327 49.411  1.189   1.00 33.42 ? 585  LYS B CE    1 
ATOM   9432  N NZ    . LYS B 1 585 ? -32.626 49.281  0.481   1.00 32.90 ? 585  LYS B NZ    1 
ATOM   9433  N N     . GLU B 1 586 ? -31.789 52.158  4.261   1.00 22.72 ? 586  GLU B N     1 
ATOM   9434  C CA    . GLU B 1 586 ? -33.083 52.796  4.022   1.00 22.49 ? 586  GLU B CA    1 
ATOM   9435  C C     . GLU B 1 586 ? -33.246 54.152  4.699   1.00 22.12 ? 586  GLU B C     1 
ATOM   9436  O O     . GLU B 1 586 ? -33.937 55.024  4.155   1.00 22.69 ? 586  GLU B O     1 
ATOM   9437  C CB    . GLU B 1 586 ? -34.230 51.870  4.418   1.00 22.67 ? 586  GLU B CB    1 
ATOM   9438  C CG    . GLU B 1 586 ? -34.431 50.709  3.465   1.00 24.97 ? 586  GLU B CG    1 
ATOM   9439  C CD    . GLU B 1 586 ? -34.840 51.182  2.079   1.00 28.42 ? 586  GLU B CD    1 
ATOM   9440  O OE1   . GLU B 1 586 ? -36.039 51.491  1.899   1.00 29.95 ? 586  GLU B OE1   1 
ATOM   9441  O OE2   . GLU B 1 586 ? -33.962 51.275  1.189   1.00 29.01 ? 586  GLU B OE2   1 
ATOM   9442  N N     . ILE B 1 587 ? -32.613 54.329  5.862   1.00 21.27 ? 587  ILE B N     1 
ATOM   9443  C CA    . ILE B 1 587 ? -32.723 55.556  6.674   1.00 20.31 ? 587  ILE B CA    1 
ATOM   9444  C C     . ILE B 1 587 ? -31.341 56.097  7.059   1.00 20.06 ? 587  ILE B C     1 
ATOM   9445  O O     . ILE B 1 587 ? -30.974 57.205  6.709   1.00 20.87 ? 587  ILE B O     1 
ATOM   9446  C CB    . ILE B 1 587 ? -33.561 55.305  7.965   1.00 20.56 ? 587  ILE B CB    1 
ATOM   9447  C CG1   . ILE B 1 587 ? -35.015 54.875  7.619   1.00 20.36 ? 587  ILE B CG1   1 
ATOM   9448  C CG2   . ILE B 1 587 ? -33.540 56.537  8.891   1.00 19.96 ? 587  ILE B CG2   1 
ATOM   9449  C CD1   . ILE B 1 587 ? -35.779 54.250  8.778   1.00 19.64 ? 587  ILE B CD1   1 
ATOM   9450  N N     . GLY B 1 588 ? -30.575 55.302  7.784   1.00 20.25 ? 588  GLY B N     1 
ATOM   9451  C CA    . GLY B 1 588 ? -29.211 55.622  8.172   1.00 19.30 ? 588  GLY B CA    1 
ATOM   9452  C C     . GLY B 1 588 ? -28.832 54.766  9.374   1.00 19.58 ? 588  GLY B C     1 
ATOM   9453  O O     . GLY B 1 588 ? -29.716 54.124  9.967   1.00 18.23 ? 588  GLY B O     1 
ATOM   9454  N N     . PRO B 1 589 ? -27.512 54.729  9.725   1.00 19.97 ? 589  PRO B N     1 
ATOM   9455  C CA    . PRO B 1 589 ? -27.014 54.083  10.960  1.00 20.44 ? 589  PRO B CA    1 
ATOM   9456  C C     . PRO B 1 589 ? -27.809 54.452  12.223  1.00 21.23 ? 589  PRO B C     1 
ATOM   9457  O O     . PRO B 1 589 ? -27.978 53.590  13.098  1.00 21.96 ? 589  PRO B O     1 
ATOM   9458  C CB    . PRO B 1 589 ? -25.558 54.589  11.087  1.00 19.88 ? 589  PRO B CB    1 
ATOM   9459  C CG    . PRO B 1 589 ? -25.134 54.906  9.729   1.00 19.99 ? 589  PRO B CG    1 
ATOM   9460  C CD    . PRO B 1 589 ? -26.404 55.286  8.924   1.00 19.81 ? 589  PRO B CD    1 
ATOM   9461  N N     . LEU B 1 590 ? -28.299 55.699  12.308  1.00 21.44 ? 590  LEU B N     1 
ATOM   9462  C CA    . LEU B 1 590 ? -29.007 56.183  13.500  1.00 21.68 ? 590  LEU B CA    1 
ATOM   9463  C C     . LEU B 1 590 ? -30.230 55.343  13.816  1.00 22.01 ? 590  LEU B C     1 
ATOM   9464  O O     . LEU B 1 590 ? -30.638 55.267  14.973  1.00 23.14 ? 590  LEU B O     1 
ATOM   9465  C CB    . LEU B 1 590 ? -29.406 57.673  13.392  1.00 21.69 ? 590  LEU B CB    1 
ATOM   9466  C CG    . LEU B 1 590 ? -30.558 58.210  12.490  1.00 22.48 ? 590  LEU B CG    1 
ATOM   9467  C CD1   . LEU B 1 590 ? -30.738 59.732  12.625  1.00 21.79 ? 590  LEU B CD1   1 
ATOM   9468  C CD2   . LEU B 1 590 ? -30.371 57.850  10.995  1.00 20.06 ? 590  LEU B CD2   1 
ATOM   9469  N N     . ALA B 1 591 ? -30.793 54.692  12.803  1.00 21.68 ? 591  ALA B N     1 
ATOM   9470  C CA    . ALA B 1 591 ? -32.061 54.005  12.956  1.00 22.06 ? 591  ALA B CA    1 
ATOM   9471  C C     . ALA B 1 591 ? -31.926 52.491  12.917  1.00 22.27 ? 591  ALA B C     1 
ATOM   9472  O O     . ALA B 1 591 ? -32.914 51.782  12.972  1.00 22.06 ? 591  ALA B O     1 
ATOM   9473  C CB    . ALA B 1 591 ? -33.051 54.483  11.896  1.00 21.93 ? 591  ALA B CB    1 
ATOM   9474  N N     . THR B 1 592 ? -30.705 51.989  12.824  1.00 23.19 ? 592  THR B N     1 
ATOM   9475  C CA    . THR B 1 592 ? -30.490 50.540  12.801  1.00 24.49 ? 592  THR B CA    1 
ATOM   9476  C C     . THR B 1 592 ? -31.033 49.899  14.083  1.00 24.86 ? 592  THR B C     1 
ATOM   9477  O O     . THR B 1 592 ? -30.716 50.340  15.185  1.00 25.08 ? 592  THR B O     1 
ATOM   9478  C CB    . THR B 1 592 ? -29.005 50.210  12.618  1.00 24.57 ? 592  THR B CB    1 
ATOM   9479  O OG1   . THR B 1 592 ? -28.537 50.882  11.443  1.00 26.78 ? 592  THR B OG1   1 
ATOM   9480  C CG2   . THR B 1 592 ? -28.794 48.714  12.477  1.00 24.47 ? 592  THR B CG2   1 
ATOM   9481  N N     . PRO B 1 593 ? -31.890 48.883  13.936  1.00 25.45 ? 593  PRO B N     1 
ATOM   9482  C CA    . PRO B 1 593 ? -32.422 48.239  15.148  1.00 25.72 ? 593  PRO B CA    1 
ATOM   9483  C C     . PRO B 1 593 ? -31.329 47.562  15.926  1.00 25.91 ? 593  PRO B C     1 
ATOM   9484  O O     . PRO B 1 593 ? -30.400 47.067  15.331  1.00 26.54 ? 593  PRO B O     1 
ATOM   9485  C CB    . PRO B 1 593 ? -33.426 47.213  14.604  1.00 25.48 ? 593  PRO B CB    1 
ATOM   9486  C CG    . PRO B 1 593 ? -33.779 47.722  13.196  1.00 24.86 ? 593  PRO B CG    1 
ATOM   9487  C CD    . PRO B 1 593 ? -32.473 48.323  12.699  1.00 25.14 ? 593  PRO B CD    1 
ATOM   9488  N N     . ASP B 1 594 ? -31.435 47.564  17.248  1.00 26.13 ? 594  ASP B N     1 
ATOM   9489  C CA    . ASP B 1 594 ? -30.447 46.942  18.107  1.00 26.17 ? 594  ASP B CA    1 
ATOM   9490  C C     . ASP B 1 594 ? -30.817 45.480  18.358  1.00 25.95 ? 594  ASP B C     1 
ATOM   9491  O O     . ASP B 1 594 ? -29.939 44.658  18.635  1.00 26.14 ? 594  ASP B O     1 
ATOM   9492  C CB    . ASP B 1 594 ? -30.377 47.695  19.434  1.00 26.97 ? 594  ASP B CB    1 
ATOM   9493  C CG    . ASP B 1 594 ? -29.888 49.149  19.279  1.00 29.98 ? 594  ASP B CG    1 
ATOM   9494  O OD1   . ASP B 1 594 ? -28.705 49.379  19.612  1.00 32.66 ? 594  ASP B OD1   1 
ATOM   9495  O OD2   . ASP B 1 594 ? -30.668 50.061  18.850  1.00 32.03 ? 594  ASP B OD2   1 
ATOM   9496  N N     . VAL B 1 595 ? -32.120 45.168  18.277  1.00 25.49 ? 595  VAL B N     1 
ATOM   9497  C CA    . VAL B 1 595 ? -32.653 43.799  18.433  1.00 24.48 ? 595  VAL B CA    1 
ATOM   9498  C C     . VAL B 1 595 ? -33.641 43.458  17.317  1.00 24.52 ? 595  VAL B C     1 
ATOM   9499  O O     . VAL B 1 595 ? -34.465 44.289  16.940  1.00 24.28 ? 595  VAL B O     1 
ATOM   9500  C CB    . VAL B 1 595 ? -33.357 43.611  19.797  1.00 24.57 ? 595  VAL B CB    1 
ATOM   9501  C CG1   . VAL B 1 595 ? -33.988 42.223  19.921  1.00 23.15 ? 595  VAL B CG1   1 
ATOM   9502  C CG2   . VAL B 1 595 ? -32.366 43.845  20.958  1.00 24.75 ? 595  VAL B CG2   1 
ATOM   9503  N N     . LEU B 1 596 ? -33.540 42.246  16.769  1.00 24.03 ? 596  LEU B N     1 
ATOM   9504  C CA    . LEU B 1 596 ? -34.591 41.738  15.895  1.00 23.95 ? 596  LEU B CA    1 
ATOM   9505  C C     . LEU B 1 596 ? -35.194 40.510  16.562  1.00 24.06 ? 596  LEU B C     1 
ATOM   9506  O O     . LEU B 1 596 ? -34.489 39.535  16.885  1.00 24.13 ? 596  LEU B O     1 
ATOM   9507  C CB    . LEU B 1 596 ? -34.077 41.384  14.491  1.00 23.50 ? 596  LEU B CB    1 
ATOM   9508  C CG    . LEU B 1 596 ? -33.296 42.376  13.608  1.00 23.46 ? 596  LEU B CG    1 
ATOM   9509  C CD1   . LEU B 1 596 ? -32.936 41.680  12.283  1.00 22.15 ? 596  LEU B CD1   1 
ATOM   9510  C CD2   . LEU B 1 596 ? -34.027 43.690  13.327  1.00 22.74 ? 596  LEU B CD2   1 
ATOM   9511  N N     . HIS B 1 597 ? -36.499 40.562  16.770  1.00 23.51 ? 597  HIS B N     1 
ATOM   9512  C CA    . HIS B 1 597 ? -37.214 39.498  17.448  1.00 23.63 ? 597  HIS B CA    1 
ATOM   9513  C C     . HIS B 1 597 ? -38.088 38.901  16.368  1.00 23.27 ? 597  HIS B C     1 
ATOM   9514  O O     . HIS B 1 597 ? -39.110 39.513  16.010  1.00 23.96 ? 597  HIS B O     1 
ATOM   9515  C CB    . HIS B 1 597 ? -38.045 40.100  18.589  1.00 23.89 ? 597  HIS B CB    1 
ATOM   9516  C CG    . HIS B 1 597 ? -39.013 39.157  19.231  1.00 25.67 ? 597  HIS B CG    1 
ATOM   9517  N ND1   . HIS B 1 597 ? -39.175 39.085  20.599  1.00 27.25 ? 597  HIS B ND1   1 
ATOM   9518  C CD2   . HIS B 1 597 ? -39.883 38.265  18.704  1.00 27.39 ? 597  HIS B CD2   1 
ATOM   9519  C CE1   . HIS B 1 597 ? -40.106 38.196  20.887  1.00 27.12 ? 597  HIS B CE1   1 
ATOM   9520  N NE2   . HIS B 1 597 ? -40.546 37.677  19.756  1.00 28.75 ? 597  HIS B NE2   1 
ATOM   9521  N N     . TRP B 1 598 ? -37.655 37.762  15.807  1.00 22.26 ? 598  TRP B N     1 
ATOM   9522  C CA    . TRP B 1 598 ? -38.399 37.048  14.781  1.00 22.06 ? 598  TRP B CA    1 
ATOM   9523  C C     . TRP B 1 598 ? -39.610 36.427  15.443  1.00 22.83 ? 598  TRP B C     1 
ATOM   9524  O O     . TRP B 1 598 ? -39.493 35.792  16.494  1.00 22.66 ? 598  TRP B O     1 
ATOM   9525  C CB    . TRP B 1 598 ? -37.598 35.900  14.178  1.00 21.56 ? 598  TRP B CB    1 
ATOM   9526  C CG    . TRP B 1 598 ? -36.203 36.177  13.770  1.00 21.07 ? 598  TRP B CG    1 
ATOM   9527  C CD1   . TRP B 1 598 ? -35.079 35.633  14.307  1.00 20.43 ? 598  TRP B CD1   1 
ATOM   9528  C CD2   . TRP B 1 598 ? -35.768 37.013  12.684  1.00 22.40 ? 598  TRP B CD2   1 
ATOM   9529  N NE1   . TRP B 1 598 ? -33.971 36.093  13.644  1.00 20.80 ? 598  TRP B NE1   1 
ATOM   9530  C CE2   . TRP B 1 598 ? -34.362 36.944  12.644  1.00 21.85 ? 598  TRP B CE2   1 
ATOM   9531  C CE3   . TRP B 1 598 ? -36.428 37.833  11.760  1.00 22.45 ? 598  TRP B CE3   1 
ATOM   9532  C CZ2   . TRP B 1 598 ? -33.592 37.671  11.712  1.00 21.61 ? 598  TRP B CZ2   1 
ATOM   9533  C CZ3   . TRP B 1 598 ? -35.652 38.556  10.827  1.00 21.74 ? 598  TRP B CZ3   1 
ATOM   9534  C CH2   . TRP B 1 598 ? -34.255 38.468  10.824  1.00 20.03 ? 598  TRP B CH2   1 
ATOM   9535  N N     . THR B 1 599 ? -40.776 36.608  14.828  1.00 23.55 ? 599  THR B N     1 
ATOM   9536  C CA    . THR B 1 599 ? -42.020 36.093  15.394  1.00 24.23 ? 599  THR B CA    1 
ATOM   9537  C C     . THR B 1 599 ? -43.024 35.820  14.272  1.00 25.35 ? 599  THR B C     1 
ATOM   9538  O O     . THR B 1 599 ? -42.928 36.411  13.191  1.00 25.36 ? 599  THR B O     1 
ATOM   9539  C CB    . THR B 1 599 ? -42.618 37.101  16.464  1.00 23.92 ? 599  THR B CB    1 
ATOM   9540  O OG1   . THR B 1 599 ? -43.433 36.398  17.412  1.00 21.54 ? 599  THR B OG1   1 
ATOM   9541  C CG2   . THR B 1 599 ? -43.430 38.224  15.799  1.00 22.92 ? 599  THR B CG2   1 
ATOM   9542  N N     . ASP B 1 600 ? -43.970 34.922  14.532  1.00 26.27 ? 600  ASP B N     1 
ATOM   9543  C CA    . ASP B 1 600 ? -45.145 34.788  13.683  1.00 27.11 ? 600  ASP B CA    1 
ATOM   9544  C C     . ASP B 1 600 ? -46.362 35.118  14.517  1.00 27.12 ? 600  ASP B C     1 
ATOM   9545  O O     . ASP B 1 600 ? -47.474 34.688  14.222  1.00 27.76 ? 600  ASP B O     1 
ATOM   9546  C CB    . ASP B 1 600 ? -45.216 33.381  13.083  1.00 27.35 ? 600  ASP B CB    1 
ATOM   9547  C CG    . ASP B 1 600 ? -44.120 33.146  12.045  1.00 29.38 ? 600  ASP B CG    1 
ATOM   9548  O OD1   . ASP B 1 600 ? -43.946 34.050  11.178  1.00 29.78 ? 600  ASP B OD1   1 
ATOM   9549  O OD2   . ASP B 1 600 ? -43.427 32.087  12.109  1.00 29.33 ? 600  ASP B OD2   1 
ATOM   9550  N N     . SER B 1 601 ? -46.140 35.925  15.551  1.00 27.00 ? 601  SER B N     1 
ATOM   9551  C CA    . SER B 1 601 ? -47.118 36.092  16.613  1.00 26.45 ? 601  SER B CA    1 
ATOM   9552  C C     . SER B 1 601 ? -47.414 37.536  17.029  1.00 26.22 ? 601  SER B C     1 
ATOM   9553  O O     . SER B 1 601 ? -47.674 37.809  18.215  1.00 25.71 ? 601  SER B O     1 
ATOM   9554  C CB    . SER B 1 601 ? -46.677 35.269  17.825  1.00 26.28 ? 601  SER B CB    1 
ATOM   9555  O OG    . SER B 1 601 ? -47.062 33.932  17.652  1.00 25.74 ? 601  SER B OG    1 
ATOM   9556  N N     . LEU B 1 602 ? -47.396 38.453  16.061  1.00 25.97 ? 602  LEU B N     1 
ATOM   9557  C CA    . LEU B 1 602 ? -47.774 39.848  16.347  1.00 25.85 ? 602  LEU B CA    1 
ATOM   9558  C C     . LEU B 1 602 ? -49.181 39.921  16.917  1.00 25.73 ? 602  LEU B C     1 
ATOM   9559  O O     . LEU B 1 602 ? -50.106 39.338  16.336  1.00 26.17 ? 602  LEU B O     1 
ATOM   9560  C CB    . LEU B 1 602 ? -47.685 40.724  15.099  1.00 25.30 ? 602  LEU B CB    1 
ATOM   9561  C CG    . LEU B 1 602 ? -46.300 41.181  14.649  1.00 25.49 ? 602  LEU B CG    1 
ATOM   9562  C CD1   . LEU B 1 602 ? -46.425 42.030  13.376  1.00 23.88 ? 602  LEU B CD1   1 
ATOM   9563  C CD2   . LEU B 1 602 ? -45.585 41.953  15.767  1.00 23.58 ? 602  LEU B CD2   1 
ATOM   9564  N N     . PRO B 1 603 ? -49.349 40.627  18.059  1.00 25.75 ? 603  PRO B N     1 
ATOM   9565  C CA    . PRO B 1 603 ? -50.674 40.816  18.677  1.00 25.41 ? 603  PRO B CA    1 
ATOM   9566  C C     . PRO B 1 603 ? -51.524 41.833  17.895  1.00 25.39 ? 603  PRO B C     1 
ATOM   9567  O O     . PRO B 1 603 ? -51.094 42.962  17.650  1.00 26.09 ? 603  PRO B O     1 
ATOM   9568  C CB    . PRO B 1 603 ? -50.330 41.346  20.069  1.00 24.81 ? 603  PRO B CB    1 
ATOM   9569  C CG    . PRO B 1 603 ? -49.096 42.104  19.864  1.00 25.30 ? 603  PRO B CG    1 
ATOM   9570  C CD    . PRO B 1 603 ? -48.300 41.320  18.826  1.00 25.22 ? 603  PRO B CD    1 
ATOM   9571  N N     . LYS B 1 604 ? -52.710 41.431  17.483  1.00 25.32 ? 604  LYS B N     1 
ATOM   9572  C CA    . LYS B 1 604 ? -53.548 42.318  16.691  1.00 25.98 ? 604  LYS B CA    1 
ATOM   9573  C C     . LYS B 1 604 ? -54.979 42.398  17.212  1.00 25.49 ? 604  LYS B C     1 
ATOM   9574  O O     . LYS B 1 604 ? -55.474 41.488  17.893  1.00 25.50 ? 604  LYS B O     1 
ATOM   9575  C CB    . LYS B 1 604 ? -53.539 41.923  15.199  1.00 26.19 ? 604  LYS B CB    1 
ATOM   9576  C CG    . LYS B 1 604 ? -52.141 41.642  14.655  1.00 28.68 ? 604  LYS B CG    1 
ATOM   9577  C CD    . LYS B 1 604 ? -51.987 42.157  13.240  1.00 31.36 ? 604  LYS B CD    1 
ATOM   9578  C CE    . LYS B 1 604 ? -51.079 41.267  12.431  1.00 30.63 ? 604  LYS B CE    1 
ATOM   9579  N NZ    . LYS B 1 604 ? -51.321 41.567  11.000  1.00 32.79 ? 604  LYS B NZ    1 
ATOM   9580  N N     . THR B 1 605 ? -55.632 43.506  16.892  1.00 25.00 ? 605  THR B N     1 
ATOM   9581  C CA    . THR B 1 605 ? -57.042 43.651  17.171  1.00 25.23 ? 605  THR B CA    1 
ATOM   9582  C C     . THR B 1 605 ? -57.774 42.846  16.110  1.00 25.49 ? 605  THR B C     1 
ATOM   9583  O O     . THR B 1 605 ? -57.146 42.296  15.185  1.00 25.14 ? 605  THR B O     1 
ATOM   9584  C CB    . THR B 1 605 ? -57.501 45.111  17.137  1.00 24.85 ? 605  THR B CB    1 
ATOM   9585  O OG1   . THR B 1 605 ? -57.475 45.582  15.782  1.00 26.49 ? 605  THR B OG1   1 
ATOM   9586  C CG2   . THR B 1 605 ? -56.616 45.998  18.053  1.00 23.59 ? 605  THR B CG2   1 
ATOM   9587  N N     . ARG B 1 606 ? -59.094 42.763  16.253  1.00 25.48 ? 606  ARG B N     1 
ATOM   9588  C CA    . ARG B 1 606 ? -59.910 42.009  15.309  1.00 25.88 ? 606  ARG B CA    1 
ATOM   9589  C C     . ARG B 1 606 ? -59.992 42.652  13.916  1.00 26.62 ? 606  ARG B C     1 
ATOM   9590  O O     . ARG B 1 606 ? -60.346 41.987  12.933  1.00 26.82 ? 606  ARG B O     1 
ATOM   9591  C CB    . ARG B 1 606 ? -61.282 41.717  15.907  1.00 25.20 ? 606  ARG B CB    1 
ATOM   9592  C CG    . ARG B 1 606 ? -61.161 40.759  17.068  1.00 23.89 ? 606  ARG B CG    1 
ATOM   9593  C CD    . ARG B 1 606 ? -62.480 40.432  17.744  1.00 22.76 ? 606  ARG B CD    1 
ATOM   9594  N NE    . ARG B 1 606 ? -62.266 39.297  18.633  1.00 21.03 ? 606  ARG B NE    1 
ATOM   9595  C CZ    . ARG B 1 606 ? -61.926 39.399  19.913  1.00 18.96 ? 606  ARG B CZ    1 
ATOM   9596  N NH1   . ARG B 1 606 ? -61.810 40.600  20.502  1.00 15.94 ? 606  ARG B NH1   1 
ATOM   9597  N NH2   . ARG B 1 606 ? -61.726 38.289  20.607  1.00 16.47 ? 606  ARG B NH2   1 
ATOM   9598  N N     . SER B 1 607 ? -59.630 43.928  13.823  1.00 27.41 ? 607  SER B N     1 
ATOM   9599  C CA    . SER B 1 607 ? -59.549 44.571  12.520  1.00 28.69 ? 607  SER B CA    1 
ATOM   9600  C C     . SER B 1 607 ? -58.109 44.759  12.048  1.00 29.11 ? 607  SER B C     1 
ATOM   9601  O O     . SER B 1 607 ? -57.860 45.537  11.141  1.00 29.55 ? 607  SER B O     1 
ATOM   9602  C CB    . SER B 1 607 ? -60.344 45.881  12.477  1.00 29.01 ? 607  SER B CB    1 
ATOM   9603  O OG    . SER B 1 607 ? -59.819 46.807  13.392  1.00 29.60 ? 607  SER B OG    1 
ATOM   9604  N N     . GLY B 1 608 ? -57.170 44.046  12.667  1.00 29.51 ? 608  GLY B N     1 
ATOM   9605  C CA    . GLY B 1 608 ? -55.823 43.911  12.127  1.00 29.63 ? 608  GLY B CA    1 
ATOM   9606  C C     . GLY B 1 608 ? -54.799 44.953  12.547  1.00 30.23 ? 608  GLY B C     1 
ATOM   9607  O O     . GLY B 1 608 ? -53.712 45.006  11.970  1.00 29.83 ? 608  GLY B O     1 
ATOM   9608  N N     . LYS B 1 609 ? -55.139 45.775  13.545  1.00 30.73 ? 609  LYS B N     1 
ATOM   9609  C CA    . LYS B 1 609 ? -54.205 46.749  14.114  1.00 30.89 ? 609  LYS B CA    1 
ATOM   9610  C C     . LYS B 1 609 ? -53.255 46.065  15.106  1.00 31.30 ? 609  LYS B C     1 
ATOM   9611  O O     . LYS B 1 609 ? -53.683 45.231  15.912  1.00 30.88 ? 609  LYS B O     1 
ATOM   9612  C CB    . LYS B 1 609 ? -54.972 47.881  14.818  1.00 30.97 ? 609  LYS B CB    1 
ATOM   9613  N N     . ILE B 1 610 ? -51.970 46.428  15.037  1.00 31.59 ? 610  ILE B N     1 
ATOM   9614  C CA    . ILE B 1 610 ? -50.938 45.912  15.930  1.00 31.88 ? 610  ILE B CA    1 
ATOM   9615  C C     . ILE B 1 610 ? -51.061 46.588  17.284  1.00 32.48 ? 610  ILE B C     1 
ATOM   9616  O O     . ILE B 1 610 ? -51.138 47.815  17.363  1.00 32.29 ? 610  ILE B O     1 
ATOM   9617  C CB    . ILE B 1 610 ? -49.499 46.113  15.329  1.00 32.12 ? 610  ILE B CB    1 
ATOM   9618  C CG1   . ILE B 1 610 ? -49.312 45.244  14.075  1.00 32.07 ? 610  ILE B CG1   1 
ATOM   9619  C CG2   . ILE B 1 610 ? -48.407 45.776  16.358  1.00 30.98 ? 610  ILE B CG2   1 
ATOM   9620  C CD1   . ILE B 1 610 ? -48.240 45.744  13.062  1.00 32.35 ? 610  ILE B CD1   1 
ATOM   9621  N N     . MET B 1 611 ? -51.088 45.781  18.345  1.00 33.12 ? 611  MET B N     1 
ATOM   9622  C CA    . MET B 1 611 ? -51.248 46.286  19.713  1.00 33.96 ? 611  MET B CA    1 
ATOM   9623  C C     . MET B 1 611 ? -49.883 46.510  20.356  1.00 33.71 ? 611  MET B C     1 
ATOM   9624  O O     . MET B 1 611 ? -49.247 45.588  20.857  1.00 33.65 ? 611  MET B O     1 
ATOM   9625  C CB    . MET B 1 611 ? -52.089 45.316  20.545  1.00 33.72 ? 611  MET B CB    1 
ATOM   9626  C CG    . MET B 1 611 ? -53.456 44.972  19.940  1.00 34.91 ? 611  MET B CG    1 
ATOM   9627  S SD    . MET B 1 611 ? -54.471 43.892  21.012  1.00 37.45 ? 611  MET B SD    1 
ATOM   9628  C CE    . MET B 1 611 ? -54.824 44.969  22.412  1.00 37.57 ? 611  MET B CE    1 
ATOM   9629  N N     . ARG B 1 612 ? -49.432 47.753  20.350  1.00 34.10 ? 612  ARG B N     1 
ATOM   9630  C CA    . ARG B 1 612 ? -48.054 48.048  20.688  1.00 34.76 ? 612  ARG B CA    1 
ATOM   9631  C C     . ARG B 1 612 ? -47.749 48.166  22.182  1.00 34.45 ? 612  ARG B C     1 
ATOM   9632  O O     . ARG B 1 612 ? -46.589 48.076  22.576  1.00 34.55 ? 612  ARG B O     1 
ATOM   9633  C CB    . ARG B 1 612 ? -47.569 49.282  19.910  1.00 34.85 ? 612  ARG B CB    1 
ATOM   9634  C CG    . ARG B 1 612 ? -47.055 48.987  18.496  1.00 35.32 ? 612  ARG B CG    1 
ATOM   9635  C CD    . ARG B 1 612 ? -46.190 50.157  17.930  1.00 37.06 ? 612  ARG B CD    1 
ATOM   9636  N NE    . ARG B 1 612 ? -46.342 50.340  16.477  1.00 38.55 ? 612  ARG B NE    1 
ATOM   9637  C CZ    . ARG B 1 612 ? -47.443 50.829  15.910  1.00 40.65 ? 612  ARG B CZ    1 
ATOM   9638  N NH1   . ARG B 1 612 ? -48.477 51.180  16.671  1.00 40.02 ? 612  ARG B NH1   1 
ATOM   9639  N NH2   . ARG B 1 612 ? -47.521 50.964  14.590  1.00 40.97 ? 612  ARG B NH2   1 
ATOM   9640  N N     . ARG B 1 613 ? -48.779 48.351  23.010  1.00 34.59 ? 613  ARG B N     1 
ATOM   9641  C CA    . ARG B 1 613 ? -48.596 48.469  24.466  1.00 34.28 ? 613  ARG B CA    1 
ATOM   9642  C C     . ARG B 1 613 ? -47.994 47.191  25.036  1.00 33.90 ? 613  ARG B C     1 
ATOM   9643  O O     . ARG B 1 613 ? -47.030 47.233  25.809  1.00 33.37 ? 613  ARG B O     1 
ATOM   9644  C CB    . ARG B 1 613 ? -49.922 48.787  25.181  1.00 34.71 ? 613  ARG B CB    1 
ATOM   9645  N N     . ILE B 1 614 ? -48.581 46.063  24.651  1.00 33.45 ? 614  ILE B N     1 
ATOM   9646  C CA    . ILE B 1 614 ? -48.101 44.753  25.082  1.00 33.76 ? 614  ILE B CA    1 
ATOM   9647  C C     . ILE B 1 614 ? -46.683 44.464  24.566  1.00 33.16 ? 614  ILE B C     1 
ATOM   9648  O O     . ILE B 1 614 ? -45.824 44.027  25.337  1.00 33.42 ? 614  ILE B O     1 
ATOM   9649  C CB    . ILE B 1 614 ? -49.118 43.609  24.733  1.00 34.04 ? 614  ILE B CB    1 
ATOM   9650  C CG1   . ILE B 1 614 ? -48.554 42.235  25.078  1.00 35.31 ? 614  ILE B CG1   1 
ATOM   9651  C CG2   . ILE B 1 614 ? -49.505 43.631  23.273  1.00 34.95 ? 614  ILE B CG2   1 
ATOM   9652  C CD1   . ILE B 1 614 ? -48.508 41.954  26.587  1.00 39.07 ? 614  ILE B CD1   1 
ATOM   9653  N N     . LEU B 1 615 ? -46.441 44.740  23.283  1.00 32.60 ? 615  LEU B N     1 
ATOM   9654  C CA    . LEU B 1 615 ? -45.117 44.590  22.668  1.00 32.47 ? 615  LEU B CA    1 
ATOM   9655  C C     . LEU B 1 615 ? -44.053 45.425  23.385  1.00 32.35 ? 615  LEU B C     1 
ATOM   9656  O O     . LEU B 1 615 ? -42.928 44.970  23.589  1.00 31.42 ? 615  LEU B O     1 
ATOM   9657  C CB    . LEU B 1 615 ? -45.156 44.971  21.188  1.00 32.14 ? 615  LEU B CB    1 
ATOM   9658  C CG    . LEU B 1 615 ? -45.938 44.072  20.232  1.00 31.43 ? 615  LEU B CG    1 
ATOM   9659  C CD1   . LEU B 1 615 ? -45.836 44.623  18.838  1.00 29.35 ? 615  LEU B CD1   1 
ATOM   9660  C CD2   . LEU B 1 615 ? -45.441 42.645  20.263  1.00 29.98 ? 615  LEU B CD2   1 
ATOM   9661  N N     . ARG B 1 616 ? -44.448 46.637  23.774  1.00 32.72 ? 616  ARG B N     1 
ATOM   9662  C CA    . ARG B 1 616 ? -43.632 47.536  24.586  1.00 33.34 ? 616  ARG B CA    1 
ATOM   9663  C C     . ARG B 1 616 ? -43.234 46.889  25.908  1.00 32.69 ? 616  ARG B C     1 
ATOM   9664  O O     . ARG B 1 616 ? -42.067 46.929  26.288  1.00 32.92 ? 616  ARG B O     1 
ATOM   9665  C CB    . ARG B 1 616 ? -44.394 48.840  24.827  1.00 33.91 ? 616  ARG B CB    1 
ATOM   9666  C CG    . ARG B 1 616 ? -43.541 50.044  25.200  1.00 37.15 ? 616  ARG B CG    1 
ATOM   9667  C CD    . ARG B 1 616 ? -44.329 51.340  24.982  1.00 43.23 ? 616  ARG B CD    1 
ATOM   9668  N NE    . ARG B 1 616 ? -44.712 51.528  23.575  1.00 47.10 ? 616  ARG B NE    1 
ATOM   9669  C CZ    . ARG B 1 616 ? -45.954 51.751  23.124  1.00 49.59 ? 616  ARG B CZ    1 
ATOM   9670  N NH1   . ARG B 1 616 ? -46.995 51.843  23.956  1.00 49.38 ? 616  ARG B NH1   1 
ATOM   9671  N NH2   . ARG B 1 616 ? -46.156 51.903  21.817  1.00 50.49 ? 616  ARG B NH2   1 
ATOM   9672  N N     . LYS B 1 617 ? -44.200 46.255  26.569  1.00 32.23 ? 617  LYS B N     1 
ATOM   9673  C CA    . LYS B 1 617 ? -44.003 45.635  27.879  1.00 31.85 ? 617  LYS B CA    1 
ATOM   9674  C C     . LYS B 1 617 ? -43.198 44.343  27.811  1.00 31.38 ? 617  LYS B C     1 
ATOM   9675  O O     . LYS B 1 617 ? -42.296 44.123  28.617  1.00 30.92 ? 617  LYS B O     1 
ATOM   9676  C CB    . LYS B 1 617 ? -45.354 45.373  28.547  1.00 31.78 ? 617  LYS B CB    1 
ATOM   9677  C CG    . LYS B 1 617 ? -46.068 46.628  29.026  1.00 33.26 ? 617  LYS B CG    1 
ATOM   9678  C CD    . LYS B 1 617 ? -47.596 46.420  29.169  1.00 33.85 ? 617  LYS B CD    1 
ATOM   9679  C CE    . LYS B 1 617 ? -48.112 47.290  30.305  1.00 35.85 ? 617  LYS B CE    1 
ATOM   9680  N NZ    . LYS B 1 617 ? -49.434 47.919  30.030  1.00 37.48 ? 617  LYS B NZ    1 
ATOM   9681  N N     . ILE B 1 618 ? -43.535 43.482  26.856  1.00 31.33 ? 618  ILE B N     1 
ATOM   9682  C CA    . ILE B 1 618 ? -42.786 42.232  26.664  1.00 31.46 ? 618  ILE B CA    1 
ATOM   9683  C C     . ILE B 1 618 ? -41.299 42.537  26.415  1.00 32.05 ? 618  ILE B C     1 
ATOM   9684  O O     . ILE B 1 618 ? -40.437 42.002  27.110  1.00 31.98 ? 618  ILE B O     1 
ATOM   9685  C CB    . ILE B 1 618 ? -43.410 41.321  25.563  1.00 30.94 ? 618  ILE B CB    1 
ATOM   9686  C CG1   . ILE B 1 618 ? -44.755 40.749  26.046  1.00 30.83 ? 618  ILE B CG1   1 
ATOM   9687  C CG2   . ILE B 1 618 ? -42.454 40.199  25.195  1.00 31.37 ? 618  ILE B CG2   1 
ATOM   9688  C CD1   . ILE B 1 618 ? -45.585 40.044  24.988  1.00 30.63 ? 618  ILE B CD1   1 
ATOM   9689  N N     . ALA B 1 619 ? -41.029 43.436  25.465  1.00 32.75 ? 619  ALA B N     1 
ATOM   9690  C CA    . ALA B 1 619 ? -39.669 43.861  25.139  1.00 33.73 ? 619  ALA B CA    1 
ATOM   9691  C C     . ALA B 1 619 ? -38.903 44.464  26.324  1.00 34.34 ? 619  ALA B C     1 
ATOM   9692  O O     . ALA B 1 619 ? -37.714 44.226  26.461  1.00 34.32 ? 619  ALA B O     1 
ATOM   9693  C CB    . ALA B 1 619 ? -39.671 44.831  23.937  1.00 33.44 ? 619  ALA B CB    1 
ATOM   9694  N N     . ALA B 1 620 ? -39.577 45.247  27.167  1.00 35.54 ? 620  ALA B N     1 
ATOM   9695  C CA    . ALA B 1 620 ? -38.954 45.779  28.395  1.00 36.65 ? 620  ALA B CA    1 
ATOM   9696  C C     . ALA B 1 620 ? -38.654 44.684  29.450  1.00 37.67 ? 620  ALA B C     1 
ATOM   9697  O O     . ALA B 1 620 ? -37.888 44.910  30.387  1.00 37.84 ? 620  ALA B O     1 
ATOM   9698  C CB    . ALA B 1 620 ? -39.803 46.912  29.002  1.00 36.18 ? 620  ALA B CB    1 
ATOM   9699  N N     . GLY B 1 621 ? -39.233 43.495  29.287  1.00 38.58 ? 621  GLY B N     1 
ATOM   9700  C CA    . GLY B 1 621 ? -39.018 42.414  30.249  1.00 39.96 ? 621  GLY B CA    1 
ATOM   9701  C C     . GLY B 1 621 ? -40.154 42.196  31.245  1.00 40.71 ? 621  GLY B C     1 
ATOM   9702  O O     . GLY B 1 621 ? -39.917 42.151  32.454  1.00 40.81 ? 621  GLY B O     1 
ATOM   9703  N N     . ASP B 1 622 ? -41.385 42.074  30.732  1.00 41.48 ? 622  ASP B N     1 
ATOM   9704  C CA    . ASP B 1 622 ? -42.574 41.654  31.525  1.00 42.14 ? 622  ASP B CA    1 
ATOM   9705  C C     . ASP B 1 622 ? -43.783 41.317  30.643  1.00 42.23 ? 622  ASP B C     1 
ATOM   9706  O O     . ASP B 1 622 ? -43.687 40.542  29.690  1.00 42.26 ? 622  ASP B O     1 
ATOM   9707  C CB    . ASP B 1 622 ? -42.989 42.724  32.546  1.00 42.40 ? 622  ASP B CB    1 
ATOM   9708  C CG    . ASP B 1 622 ? -43.067 44.105  31.936  1.00 42.32 ? 622  ASP B CG    1 
ATOM   9709  O OD1   . ASP B 1 622 ? -42.002 44.732  31.747  1.00 41.82 ? 622  ASP B OD1   1 
ATOM   9710  O OD2   . ASP B 1 622 ? -44.193 44.555  31.646  1.00 42.97 ? 622  ASP B OD2   1 
ATOM   9711  N N     . THR B 1 631 ? -60.385 41.573  23.292  1.00 34.18 ? 631  THR B N     1 
ATOM   9712  C CA    . THR B 1 631 ? -59.870 42.692  22.455  1.00 35.18 ? 631  THR B CA    1 
ATOM   9713  C C     . THR B 1 631 ? -58.785 42.314  21.424  1.00 34.88 ? 631  THR B C     1 
ATOM   9714  O O     . THR B 1 631 ? -58.795 42.798  20.288  1.00 33.98 ? 631  THR B O     1 
ATOM   9715  C CB    . THR B 1 631 ? -59.378 43.914  23.288  1.00 35.41 ? 631  THR B CB    1 
ATOM   9716  O OG1   . THR B 1 631 ? -58.404 44.646  22.527  1.00 35.67 ? 631  THR B OG1   1 
ATOM   9717  C CG2   . THR B 1 631 ? -58.753 43.468  24.636  1.00 36.67 ? 631  THR B CG2   1 
ATOM   9718  N N     . LEU B 1 632 ? -57.853 41.460  21.839  1.00 35.17 ? 632  LEU B N     1 
ATOM   9719  C CA    . LEU B 1 632 ? -56.842 40.960  20.935  1.00 35.69 ? 632  LEU B CA    1 
ATOM   9720  C C     . LEU B 1 632 ? -57.317 39.659  20.297  1.00 35.45 ? 632  LEU B C     1 
ATOM   9721  O O     . LEU B 1 632 ? -57.839 38.778  20.967  1.00 35.40 ? 632  LEU B O     1 
ATOM   9722  C CB    . LEU B 1 632 ? -55.469 40.871  21.638  1.00 36.27 ? 632  LEU B CB    1 
ATOM   9723  C CG    . LEU B 1 632 ? -54.779 39.662  22.266  1.00 36.92 ? 632  LEU B CG    1 
ATOM   9724  C CD1   . LEU B 1 632 ? -53.849 39.107  21.239  1.00 39.15 ? 632  LEU B CD1   1 
ATOM   9725  C CD2   . LEU B 1 632 ? -53.956 40.085  23.467  1.00 35.94 ? 632  LEU B CD2   1 
ATOM   9726  N N     . ALA B 1 633 ? -57.151 39.579  18.981  1.00 35.36 ? 633  ALA B N     1 
ATOM   9727  C CA    . ALA B 1 633 ? -57.717 38.521  18.147  1.00 35.13 ? 633  ALA B CA    1 
ATOM   9728  C C     . ALA B 1 633 ? -57.320 37.080  18.534  1.00 35.08 ? 633  ALA B C     1 
ATOM   9729  O O     . ALA B 1 633 ? -58.163 36.174  18.530  1.00 35.08 ? 633  ALA B O     1 
ATOM   9730  C CB    . ALA B 1 633 ? -57.393 38.806  16.670  1.00 34.93 ? 633  ALA B CB    1 
ATOM   9731  N N     . ASP B 1 634 ? -56.041 36.873  18.841  1.00 35.01 ? 634  ASP B N     1 
ATOM   9732  C CA    . ASP B 1 634 ? -55.547 35.580  19.318  1.00 34.77 ? 634  ASP B CA    1 
ATOM   9733  C C     . ASP B 1 634 ? -54.711 35.750  20.593  1.00 34.16 ? 634  ASP B C     1 
ATOM   9734  O O     . ASP B 1 634 ? -53.527 36.067  20.524  1.00 33.72 ? 634  ASP B O     1 
ATOM   9735  C CB    . ASP B 1 634 ? -54.745 34.863  18.216  1.00 35.23 ? 634  ASP B CB    1 
ATOM   9736  C CG    . ASP B 1 634 ? -54.057 33.594  18.719  1.00 36.83 ? 634  ASP B CG    1 
ATOM   9737  O OD1   . ASP B 1 634 ? -54.434 33.089  19.817  1.00 37.78 ? 634  ASP B OD1   1 
ATOM   9738  O OD2   . ASP B 1 634 ? -53.131 33.113  18.021  1.00 37.13 ? 634  ASP B OD2   1 
ATOM   9739  N N     . PRO B 1 635 ? -55.332 35.526  21.769  1.00 34.12 ? 635  PRO B N     1 
ATOM   9740  C CA    . PRO B 1 635 ? -54.668 35.688  23.087  1.00 33.64 ? 635  PRO B CA    1 
ATOM   9741  C C     . PRO B 1 635 ? -53.506 34.687  23.330  1.00 33.05 ? 635  PRO B C     1 
ATOM   9742  O O     . PRO B 1 635 ? -52.655 34.887  24.225  1.00 32.37 ? 635  PRO B O     1 
ATOM   9743  C CB    . PRO B 1 635 ? -55.818 35.453  24.076  1.00 33.86 ? 635  PRO B CB    1 
ATOM   9744  C CG    . PRO B 1 635 ? -56.801 34.576  23.302  1.00 33.92 ? 635  PRO B CG    1 
ATOM   9745  C CD    . PRO B 1 635 ? -56.740 35.089  21.907  1.00 33.98 ? 635  PRO B CD    1 
ATOM   9746  N N     . GLY B 1 636 ? -53.488 33.625  22.522  1.00 32.36 ? 636  GLY B N     1 
ATOM   9747  C CA    . GLY B 1 636 ? -52.394 32.665  22.505  1.00 31.41 ? 636  GLY B CA    1 
ATOM   9748  C C     . GLY B 1 636 ? -51.030 33.236  22.127  1.00 30.79 ? 636  GLY B C     1 
ATOM   9749  O O     . GLY B 1 636 ? -50.016 32.625  22.457  1.00 30.86 ? 636  GLY B O     1 
ATOM   9750  N N     . VAL B 1 637 ? -50.992 34.393  21.450  1.00 29.96 ? 637  VAL B N     1 
ATOM   9751  C CA    . VAL B 1 637 ? -49.709 35.026  21.044  1.00 29.04 ? 637  VAL B CA    1 
ATOM   9752  C C     . VAL B 1 637 ? -48.847 35.480  22.215  1.00 28.65 ? 637  VAL B C     1 
ATOM   9753  O O     . VAL B 1 637 ? -47.634 35.369  22.170  1.00 28.36 ? 637  VAL B O     1 
ATOM   9754  C CB    . VAL B 1 637 ? -49.868 36.201  20.015  1.00 28.88 ? 637  VAL B CB    1 
ATOM   9755  C CG1   . VAL B 1 637 ? -50.651 35.751  18.783  1.00 28.94 ? 637  VAL B CG1   1 
ATOM   9756  C CG2   . VAL B 1 637 ? -50.502 37.459  20.638  1.00 28.42 ? 637  VAL B CG2   1 
ATOM   9757  N N     . VAL B 1 638 ? -49.486 35.975  23.264  1.00 28.89 ? 638  VAL B N     1 
ATOM   9758  C CA    . VAL B 1 638 ? -48.789 36.532  24.419  1.00 29.42 ? 638  VAL B CA    1 
ATOM   9759  C C     . VAL B 1 638 ? -47.729 35.555  24.980  1.00 30.32 ? 638  VAL B C     1 
ATOM   9760  O O     . VAL B 1 638 ? -46.548 35.929  25.143  1.00 31.15 ? 638  VAL B O     1 
ATOM   9761  C CB    . VAL B 1 638 ? -49.804 36.976  25.506  1.00 29.53 ? 638  VAL B CB    1 
ATOM   9762  C CG1   . VAL B 1 638 ? -49.094 37.505  26.775  1.00 29.85 ? 638  VAL B CG1   1 
ATOM   9763  C CG2   . VAL B 1 638 ? -50.760 38.023  24.941  1.00 27.78 ? 638  VAL B CG2   1 
ATOM   9764  N N     . GLU B 1 639 ? -48.145 34.311  25.228  1.00 30.25 ? 639  GLU B N     1 
ATOM   9765  C CA    . GLU B 1 639 ? -47.266 33.263  25.722  1.00 30.52 ? 639  GLU B CA    1 
ATOM   9766  C C     . GLU B 1 639 ? -46.146 32.967  24.743  1.00 30.54 ? 639  GLU B C     1 
ATOM   9767  O O     . GLU B 1 639 ? -45.002 32.810  25.154  1.00 30.48 ? 639  GLU B O     1 
ATOM   9768  C CB    . GLU B 1 639 ? -48.056 31.974  26.033  1.00 30.80 ? 639  GLU B CB    1 
ATOM   9769  N N     . LYS B 1 640 ? -46.477 32.892  23.454  1.00 31.04 ? 640  LYS B N     1 
ATOM   9770  C CA    . LYS B 1 640 ? -45.470 32.623  22.423  1.00 31.63 ? 640  LYS B CA    1 
ATOM   9771  C C     . LYS B 1 640 ? -44.420 33.740  22.376  1.00 31.93 ? 640  LYS B C     1 
ATOM   9772  O O     . LYS B 1 640 ? -43.220 33.469  22.343  1.00 32.12 ? 640  LYS B O     1 
ATOM   9773  C CB    . LYS B 1 640 ? -46.108 32.367  21.044  1.00 31.44 ? 640  LYS B CB    1 
ATOM   9774  N N     . LEU B 1 641 ? -44.873 34.989  22.418  1.00 32.40 ? 641  LEU B N     1 
ATOM   9775  C CA    . LEU B 1 641 ? -43.962 36.142  22.455  1.00 32.60 ? 641  LEU B CA    1 
ATOM   9776  C C     . LEU B 1 641 ? -43.067 36.150  23.693  1.00 33.37 ? 641  LEU B C     1 
ATOM   9777  O O     . LEU B 1 641 ? -41.899 36.515  23.609  1.00 33.55 ? 641  LEU B O     1 
ATOM   9778  C CB    . LEU B 1 641 ? -44.736 37.460  22.367  1.00 31.93 ? 641  LEU B CB    1 
ATOM   9779  C CG    . LEU B 1 641 ? -45.387 37.792  21.028  1.00 30.08 ? 641  LEU B CG    1 
ATOM   9780  C CD1   . LEU B 1 641 ? -46.386 38.941  21.196  1.00 28.45 ? 641  LEU B CD1   1 
ATOM   9781  C CD2   . LEU B 1 641 ? -44.343 38.087  19.963  1.00 27.29 ? 641  LEU B CD2   1 
ATOM   9782  N N     . LEU B 1 642 ? -43.619 35.743  24.830  1.00 34.34 ? 642  LEU B N     1 
ATOM   9783  C CA    . LEU B 1 642 ? -42.868 35.690  26.087  1.00 35.34 ? 642  LEU B CA    1 
ATOM   9784  C C     . LEU B 1 642 ? -41.700 34.721  26.063  1.00 36.29 ? 642  LEU B C     1 
ATOM   9785  O O     . LEU B 1 642 ? -40.617 35.031  26.574  1.00 36.34 ? 642  LEU B O     1 
ATOM   9786  C CB    . LEU B 1 642 ? -43.784 35.298  27.232  1.00 34.80 ? 642  LEU B CB    1 
ATOM   9787  C CG    . LEU B 1 642 ? -44.654 36.392  27.802  1.00 34.84 ? 642  LEU B CG    1 
ATOM   9788  C CD1   . LEU B 1 642 ? -45.572 35.763  28.858  1.00 34.90 ? 642  LEU B CD1   1 
ATOM   9789  C CD2   . LEU B 1 642 ? -43.791 37.508  28.372  1.00 32.74 ? 642  LEU B CD2   1 
ATOM   9790  N N     . GLU B 1 643 ? -41.940 33.538  25.502  1.00 37.54 ? 643  GLU B N     1 
ATOM   9791  C CA    . GLU B 1 643 ? -40.902 32.532  25.340  1.00 38.94 ? 643  GLU B CA    1 
ATOM   9792  C C     . GLU B 1 643 ? -39.798 33.022  24.411  1.00 39.29 ? 643  GLU B C     1 
ATOM   9793  O O     . GLU B 1 643 ? -38.622 32.971  24.764  1.00 39.47 ? 643  GLU B O     1 
ATOM   9794  C CB    . GLU B 1 643 ? -41.498 31.249  24.790  1.00 39.39 ? 643  GLU B CB    1 
ATOM   9795  C CG    . GLU B 1 643 ? -42.019 30.320  25.866  1.00 42.49 ? 643  GLU B CG    1 
ATOM   9796  C CD    . GLU B 1 643 ? -42.611 29.060  25.275  1.00 46.76 ? 643  GLU B CD    1 
ATOM   9797  O OE1   . GLU B 1 643 ? -42.518 28.003  25.942  1.00 48.23 ? 643  GLU B OE1   1 
ATOM   9798  O OE2   . GLU B 1 643 ? -43.154 29.130  24.137  1.00 48.44 ? 643  GLU B OE2   1 
ATOM   9799  N N     . GLU B 1 644 ? -40.197 33.503  23.231  1.00 39.51 ? 644  GLU B N     1 
ATOM   9800  C CA    . GLU B 1 644 ? -39.274 34.025  22.232  1.00 39.40 ? 644  GLU B CA    1 
ATOM   9801  C C     . GLU B 1 644 ? -38.340 35.084  22.828  1.00 40.60 ? 644  GLU B C     1 
ATOM   9802  O O     . GLU B 1 644 ? -37.128 34.971  22.693  1.00 40.57 ? 644  GLU B O     1 
ATOM   9803  C CB    . GLU B 1 644 ? -40.043 34.571  21.032  1.00 38.90 ? 644  GLU B CB    1 
ATOM   9804  C CG    . GLU B 1 644 ? -40.783 33.520  20.230  1.00 37.00 ? 644  GLU B CG    1 
ATOM   9805  C CD    . GLU B 1 644 ? -41.793 34.123  19.253  1.00 37.50 ? 644  GLU B CD    1 
ATOM   9806  O OE1   . GLU B 1 644 ? -42.076 35.331  19.350  1.00 34.69 ? 644  GLU B OE1   1 
ATOM   9807  O OE2   . GLU B 1 644 ? -42.315 33.391  18.385  1.00 34.91 ? 644  GLU B OE2   1 
ATOM   9808  N N     . LYS B 1 645 ? -38.921 36.077  23.508  1.00 41.81 ? 645  LYS B N     1 
ATOM   9809  C CA    . LYS B 1 645 ? -38.192 37.132  24.209  1.00 43.09 ? 645  LYS B CA    1 
ATOM   9810  C C     . LYS B 1 645 ? -37.209 36.582  25.241  1.00 44.30 ? 645  LYS B C     1 
ATOM   9811  O O     . LYS B 1 645 ? -36.078 37.073  25.350  1.00 44.59 ? 645  LYS B O     1 
ATOM   9812  C CB    . LYS B 1 645 ? -39.174 38.058  24.928  1.00 42.84 ? 645  LYS B CB    1 
ATOM   9813  C CG    . LYS B 1 645 ? -38.730 39.525  25.046  1.00 44.24 ? 645  LYS B CG    1 
ATOM   9814  C CD    . LYS B 1 645 ? -37.351 39.709  25.684  1.00 44.71 ? 645  LYS B CD    1 
ATOM   9815  C CE    . LYS B 1 645 ? -37.097 41.136  26.099  1.00 43.94 ? 645  LYS B CE    1 
ATOM   9816  N NZ    . LYS B 1 645 ? -36.056 41.174  27.172  1.00 43.27 ? 645  LYS B NZ    1 
ATOM   9817  N N     . GLN B 1 646 ? -37.645 35.586  26.013  1.00 45.39 ? 646  GLN B N     1 
ATOM   9818  C CA    . GLN B 1 646 ? -36.810 35.009  27.070  1.00 46.38 ? 646  GLN B CA    1 
ATOM   9819  C C     . GLN B 1 646 ? -35.572 34.311  26.486  1.00 46.34 ? 646  GLN B C     1 
ATOM   9820  O O     . GLN B 1 646 ? -34.484 34.381  27.076  1.00 46.46 ? 646  GLN B O     1 
ATOM   9821  C CB    . GLN B 1 646 ? -37.630 34.082  27.985  1.00 47.00 ? 646  GLN B CB    1 
ATOM   9822  C CG    . GLN B 1 646 ? -38.238 34.803  29.213  1.00 49.70 ? 646  GLN B CG    1 
ATOM   9823  C CD    . GLN B 1 646 ? -39.701 34.404  29.541  1.00 53.26 ? 646  GLN B CD    1 
ATOM   9824  O OE1   . GLN B 1 646 ? -40.317 34.959  30.465  1.00 53.33 ? 646  GLN B OE1   1 
ATOM   9825  N NE2   . GLN B 1 646 ? -40.253 33.450  28.786  1.00 54.44 ? 646  GLN B NE2   1 
ATOM   9826  N N     . ALA B 1 647 ? -35.741 33.674  25.321  1.00 45.96 ? 647  ALA B N     1 
ATOM   9827  C CA    . ALA B 1 647 ? -34.622 33.149  24.529  1.00 45.62 ? 647  ALA B CA    1 
ATOM   9828  C C     . ALA B 1 647 ? -33.798 34.290  23.921  1.00 45.66 ? 647  ALA B C     1 
ATOM   9829  O O     . ALA B 1 647 ? -32.642 34.097  23.548  1.00 45.64 ? 647  ALA B O     1 
ATOM   9830  C CB    . ALA B 1 647 ? -35.119 32.198  23.443  1.00 45.43 ? 647  ALA B CB    1 
ATOM   9831  N N     . ILE B 1 648 ? -34.415 35.471  23.824  1.00 45.52 ? 648  ILE B N     1 
ATOM   9832  C CA    . ILE B 1 648 ? -33.726 36.753  23.568  1.00 45.56 ? 648  ILE B CA    1 
ATOM   9833  C C     . ILE B 1 648 ? -33.664 37.137  22.076  1.00 45.36 ? 648  ILE B C     1 
ATOM   9834  O O     . ILE B 1 648 ? -34.688 37.522  21.484  1.00 44.47 ? 648  ILE B O     1 
ATOM   9835  C CB    . ILE B 1 648 ? -32.355 36.878  24.370  1.00 45.39 ? 648  ILE B CB    1 
ATOM   9836  C CG1   . ILE B 1 648 ? -32.616 37.418  25.800  1.00 45.70 ? 648  ILE B CG1   1 
ATOM   9837  C CG2   . ILE B 1 648 ? -31.338 37.745  23.631  1.00 46.17 ? 648  ILE B CG2   1 
ATOM   9838  C CD1   . ILE B 1 648 ? -31.796 36.729  26.949  1.00 43.98 ? 648  ILE B CD1   1 
HETATM 9839  O "O2'" . PRX C 2 .   ? -9.698  26.394  25.839  1.00 15.62 ? 999  PRX A "O2'" 1 
HETATM 9840  C "C2'" . PRX C 2 .   ? -8.869  26.084  24.716  1.00 16.22 ? 999  PRX A "C2'" 1 
HETATM 9841  C "C1'" . PRX C 2 .   ? -8.862  27.323  23.817  1.00 16.37 ? 999  PRX A "C1'" 1 
HETATM 9842  O "O4'" . PRX C 2 .   ? -7.696  28.079  24.141  1.00 12.88 ? 999  PRX A "O4'" 1 
HETATM 9843  C "C4'" . PRX C 2 .   ? -6.916  27.370  25.114  1.00 16.80 ? 999  PRX A "C4'" 1 
HETATM 9844  C "C5'" . PRX C 2 .   ? -5.444  27.518  24.777  1.00 17.57 ? 999  PRX A "C5'" 1 
HETATM 9845  O "O5'" . PRX C 2 .   ? -5.224  28.921  24.824  1.00 19.85 ? 999  PRX A "O5'" 1 
HETATM 9846  P P     . PRX C 2 .   ? -3.771  29.587  24.630  1.00 19.41 ? 999  PRX A P     1 
HETATM 9847  O O1P   . PRX C 2 .   ? -2.750  28.807  25.407  1.00 20.01 ? 999  PRX A O1P   1 
HETATM 9848  O O2P   . PRX C 2 .   ? -3.887  31.073  24.817  1.00 17.85 ? 999  PRX A O2P   1 
HETATM 9849  O O3P   . PRX C 2 .   ? -3.473  29.310  23.065  1.00 22.63 ? 999  PRX A O3P   1 
HETATM 9850  C C1P   . PRX C 2 .   ? -4.333  29.769  22.018  1.00 19.64 ? 999  PRX A C1P   1 
HETATM 9851  C C2P   . PRX C 2 .   ? -3.758  29.192  20.739  1.00 19.06 ? 999  PRX A C2P   1 
HETATM 9852  C C3P   . PRX C 2 .   ? -4.196  27.775  20.528  1.00 16.36 ? 999  PRX A C3P   1 
HETATM 9853  C "C3'" . PRX C 2 .   ? -7.409  25.923  25.095  1.00 16.52 ? 999  PRX A "C3'" 1 
HETATM 9854  O "O3'" . PRX C 2 .   ? -7.203  25.197  26.316  1.00 14.93 ? 999  PRX A "O3'" 1 
HETATM 9855  N N9    . PRX C 2 .   ? -8.850  26.918  22.382  1.00 16.42 ? 999  PRX A N9    1 
HETATM 9856  C C8    . PRX C 2 .   ? -7.838  27.102  21.533  1.00 16.12 ? 999  PRX A C8    1 
HETATM 9857  N N7    . PRX C 2 .   ? -8.185  26.605  20.327  1.00 17.48 ? 999  PRX A N7    1 
HETATM 9858  C C5    . PRX C 2 .   ? -9.434  26.100  20.426  1.00 17.04 ? 999  PRX A C5    1 
HETATM 9859  C C4    . PRX C 2 .   ? -9.856  26.302  21.733  1.00 17.60 ? 999  PRX A C4    1 
HETATM 9860  N N3    . PRX C 2 .   ? -11.103 25.869  22.117  1.00 16.99 ? 999  PRX A N3    1 
HETATM 9861  C C2    . PRX C 2 .   ? -11.898 25.277  21.221  1.00 16.37 ? 999  PRX A C2    1 
HETATM 9862  N N1    . PRX C 2 .   ? -11.519 25.092  19.943  1.00 15.83 ? 999  PRX A N1    1 
HETATM 9863  C C6    . PRX C 2 .   ? -10.300 25.485  19.512  1.00 16.55 ? 999  PRX A C6    1 
HETATM 9864  N N6    . PRX C 2 .   ? -9.926  25.283  18.212  1.00 16.19 ? 999  PRX A N6    1 
HETATM 9865  O "O2'" . PRX D 2 .   ? -38.766 64.302  24.441  1.00 21.82 ? 998  PRX B "O2'" 1 
HETATM 9866  C "C2'" . PRX D 2 .   ? -38.186 65.615  24.442  1.00 20.77 ? 998  PRX B "C2'" 1 
HETATM 9867  C "C1'" . PRX D 2 .   ? -36.704 65.447  24.220  1.00 20.37 ? 998  PRX B "C1'" 1 
HETATM 9868  O "O4'" . PRX D 2 .   ? -36.498 65.603  22.815  1.00 17.30 ? 998  PRX B "O4'" 1 
HETATM 9869  C "C4'" . PRX D 2 .   ? -37.709 65.938  22.161  1.00 18.33 ? 998  PRX B "C4'" 1 
HETATM 9870  C "C5'" . PRX D 2 .   ? -37.436 66.997  21.117  1.00 17.69 ? 998  PRX B "C5'" 1 
HETATM 9871  O "O5'" . PRX D 2 .   ? -36.720 66.372  20.062  1.00 16.46 ? 998  PRX B "O5'" 1 
HETATM 9872  P P     . PRX D 2 .   ? -36.210 67.237  18.801  1.00 18.93 ? 998  PRX B P     1 
HETATM 9873  O O1P   . PRX D 2 .   ? -37.391 67.877  18.101  1.00 18.99 ? 998  PRX B O1P   1 
HETATM 9874  O O2P   . PRX D 2 .   ? -35.229 66.375  18.027  1.00 15.45 ? 998  PRX B O2P   1 
HETATM 9875  O O3P   . PRX D 2 .   ? -35.393 68.452  19.513  1.00 19.63 ? 998  PRX B O3P   1 
HETATM 9876  C C1P   . PRX D 2 .   ? -34.186 68.186  20.213  1.00 20.25 ? 998  PRX B C1P   1 
HETATM 9877  C C2P   . PRX D 2 .   ? -33.604 69.508  20.658  1.00 20.98 ? 998  PRX B C2P   1 
HETATM 9878  C C3P   . PRX D 2 .   ? -34.374 69.952  21.868  1.00 21.34 ? 998  PRX B C3P   1 
HETATM 9879  C "C3'" . PRX D 2 .   ? -38.629 66.432  23.249  1.00 18.86 ? 998  PRX B "C3'" 1 
HETATM 9880  O "O3'" . PRX D 2 .   ? -39.993 66.169  22.919  1.00 19.43 ? 998  PRX B "O3'" 1 
HETATM 9881  N N9    . PRX D 2 .   ? -35.941 66.469  24.986  1.00 20.82 ? 998  PRX B N9    1 
HETATM 9882  C C8    . PRX D 2 .   ? -35.321 67.557  24.490  1.00 21.00 ? 998  PRX B C8    1 
HETATM 9883  N N7    . PRX D 2 .   ? -34.737 68.234  25.497  1.00 20.76 ? 998  PRX B N7    1 
HETATM 9884  C C5    . PRX D 2 .   ? -35.005 67.554  26.641  1.00 20.03 ? 998  PRX B C5    1 
HETATM 9885  C C4    . PRX D 2 .   ? -35.755 66.445  26.303  1.00 19.85 ? 998  PRX B C4    1 
HETATM 9886  N N3    . PRX D 2 .   ? -36.168 65.578  27.254  1.00 20.88 ? 998  PRX B N3    1 
HETATM 9887  C C2    . PRX D 2 .   ? -35.850 65.798  28.530  1.00 20.68 ? 998  PRX B C2    1 
HETATM 9888  N N1    . PRX D 2 .   ? -35.097 66.854  28.887  1.00 20.62 ? 998  PRX B N1    1 
HETATM 9889  C C6    . PRX D 2 .   ? -34.663 67.746  27.976  1.00 20.52 ? 998  PRX B C6    1 
HETATM 9890  N N6    . PRX D 2 .   ? -33.900 68.808  28.381  1.00 21.13 ? 998  PRX B N6    1 
HETATM 9891  O O     . HOH E 3 .   ? -7.178  25.158  -6.444  1.00 17.55 ? 1000 HOH A O     1 
HETATM 9892  O O     . HOH E 3 .   ? -3.764  12.169  -2.994  1.00 18.39 ? 1001 HOH A O     1 
HETATM 9893  O O     . HOH E 3 .   ? -1.816  13.186  -1.430  1.00 18.46 ? 1002 HOH A O     1 
HETATM 9894  O O     . HOH E 3 .   ? -4.211  17.277  3.560   1.00 22.04 ? 1003 HOH A O     1 
HETATM 9895  O O     . HOH E 3 .   ? 3.493   11.856  0.974   1.00 20.72 ? 1004 HOH A O     1 
HETATM 9896  O O     . HOH E 3 .   ? 7.590   1.998   11.655  1.00 15.97 ? 1005 HOH A O     1 
HETATM 9897  O O     . HOH E 3 .   ? 9.401   3.798   18.737  1.00 27.35 ? 1006 HOH A O     1 
HETATM 9898  O O     . HOH E 3 .   ? 18.032  17.080  7.901   1.00 27.85 ? 1007 HOH A O     1 
HETATM 9899  O O     . HOH E 3 .   ? 14.987  7.602   20.332  1.00 22.87 ? 1008 HOH A O     1 
HETATM 9900  O O     . HOH E 3 .   ? 9.928   7.701   25.703  1.00 18.71 ? 1009 HOH A O     1 
HETATM 9901  O O     . HOH E 3 .   ? 8.589   16.054  37.868  1.00 20.03 ? 1010 HOH A O     1 
HETATM 9902  O O     . HOH E 3 .   ? 15.558  12.656  22.689  1.00 19.86 ? 1011 HOH A O     1 
HETATM 9903  O O     . HOH E 3 .   ? 27.247  20.906  17.341  1.00 26.69 ? 1012 HOH A O     1 
HETATM 9904  O O     . HOH E 3 .   ? 20.636  23.871  11.853  1.00 24.00 ? 1013 HOH A O     1 
HETATM 9905  O O     . HOH E 3 .   ? 21.069  28.655  1.583   1.00 24.86 ? 1014 HOH A O     1 
HETATM 9906  O O     . HOH E 3 .   ? 18.067  27.750  -0.930  1.00 28.45 ? 1015 HOH A O     1 
HETATM 9907  O O     . HOH E 3 .   ? -5.719  46.346  2.854   1.00 13.84 ? 1016 HOH A O     1 
HETATM 9908  O O     . HOH E 3 .   ? -6.541  48.420  10.764  1.00 16.23 ? 1017 HOH A O     1 
HETATM 9909  O O     . HOH E 3 .   ? 27.775  39.219  24.409  1.00 16.54 ? 1018 HOH A O     1 
HETATM 9910  O O     . HOH E 3 .   ? 5.114   42.259  21.639  1.00 22.35 ? 1019 HOH A O     1 
HETATM 9911  O O     . HOH E 3 .   ? 0.357   46.867  15.722  1.00 23.05 ? 1020 HOH A O     1 
HETATM 9912  O O     . HOH E 3 .   ? 7.702   49.455  10.626  1.00 28.80 ? 1021 HOH A O     1 
HETATM 9913  O O     . HOH E 3 .   ? 17.395  29.989  21.826  1.00 16.62 ? 1022 HOH A O     1 
HETATM 9914  O O     . HOH E 3 .   ? 18.416  28.752  17.370  1.00 21.79 ? 1023 HOH A O     1 
HETATM 9915  O O     . HOH E 3 .   ? 19.271  29.005  24.966  1.00 17.09 ? 1024 HOH A O     1 
HETATM 9916  O O     . HOH E 3 .   ? 8.246   34.460  23.519  1.00 15.51 ? 1025 HOH A O     1 
HETATM 9917  O O     . HOH E 3 .   ? 6.022   36.259  27.579  1.00 18.52 ? 1026 HOH A O     1 
HETATM 9918  O O     . HOH E 3 .   ? -5.158  44.684  26.165  1.00 29.81 ? 1027 HOH A O     1 
HETATM 9919  O O     . HOH E 3 .   ? -0.186  49.774  34.840  1.00 23.21 ? 1028 HOH A O     1 
HETATM 9920  O O     . HOH E 3 .   ? 4.657   49.299  37.835  1.00 34.76 ? 1029 HOH A O     1 
HETATM 9921  O O     . HOH E 3 .   ? -0.374  40.009  33.801  1.00 22.81 ? 1030 HOH A O     1 
HETATM 9922  O O     . HOH E 3 .   ? 7.083   32.062  35.425  1.00 22.45 ? 1031 HOH A O     1 
HETATM 9923  O O     . HOH E 3 .   ? 5.038   55.612  24.326  1.00 30.39 ? 1032 HOH A O     1 
HETATM 9924  O O     . HOH E 3 .   ? 13.898  42.321  37.351  1.00 26.13 ? 1033 HOH A O     1 
HETATM 9925  O O     . HOH E 3 .   ? 20.449  55.646  20.548  1.00 25.91 ? 1034 HOH A O     1 
HETATM 9926  O O     . HOH E 3 .   ? -3.123  33.196  35.514  1.00 13.62 ? 1035 HOH A O     1 
HETATM 9927  O O     . HOH E 3 .   ? 9.048   22.849  23.458  1.00 15.80 ? 1036 HOH A O     1 
HETATM 9928  O O     . HOH E 3 .   ? 11.088  21.532  21.748  1.00 17.94 ? 1037 HOH A O     1 
HETATM 9929  O O     . HOH E 3 .   ? 13.852  19.188  20.952  1.00 12.07 ? 1038 HOH A O     1 
HETATM 9930  O O     . HOH E 3 .   ? 5.503   23.185  17.897  1.00 20.56 ? 1039 HOH A O     1 
HETATM 9931  O O     . HOH E 3 .   ? 0.876   35.222  8.604   1.00 14.14 ? 1040 HOH A O     1 
HETATM 9932  O O     . HOH E 3 .   ? 5.741   35.385  -2.440  1.00 17.76 ? 1041 HOH A O     1 
HETATM 9933  O O     . HOH E 3 .   ? -11.307 49.363  4.670   1.00 24.11 ? 1042 HOH A O     1 
HETATM 9934  O O     . HOH E 3 .   ? -13.422 41.422  5.679   1.00 9.55  ? 1043 HOH A O     1 
HETATM 9935  O O     . HOH E 3 .   ? -8.452  37.173  -3.546  1.00 16.92 ? 1044 HOH A O     1 
HETATM 9936  O O     . HOH E 3 .   ? -25.953 42.198  13.082  1.00 17.18 ? 1045 HOH A O     1 
HETATM 9937  O O     . HOH E 3 .   ? -24.640 37.761  13.400  1.00 18.81 ? 1046 HOH A O     1 
HETATM 9938  O O     . HOH E 3 .   ? -23.477 38.139  5.365   1.00 16.67 ? 1047 HOH A O     1 
HETATM 9939  O O     . HOH E 3 .   ? -25.542 41.760  5.026   1.00 16.94 ? 1048 HOH A O     1 
HETATM 9940  O O     . HOH E 3 .   ? -12.728 32.754  -1.348  1.00 25.29 ? 1049 HOH A O     1 
HETATM 9941  O O     . HOH E 3 .   ? -10.338 25.307  -2.005  1.00 9.40  ? 1050 HOH A O     1 
HETATM 9942  O O     . HOH E 3 .   ? -9.756  33.364  19.342  1.00 27.30 ? 1051 HOH A O     1 
HETATM 9943  O O     . HOH E 3 .   ? -18.704 31.351  17.285  1.00 27.48 ? 1052 HOH A O     1 
HETATM 9944  O O     . HOH E 3 .   ? -5.097  15.649  12.568  1.00 19.53 ? 1053 HOH A O     1 
HETATM 9945  O O     . HOH E 3 .   ? -8.022  13.973  -0.813  1.00 18.68 ? 1054 HOH A O     1 
HETATM 9946  O O     . HOH E 3 .   ? -11.843 11.341  4.624   1.00 16.47 ? 1055 HOH A O     1 
HETATM 9947  O O     . HOH E 3 .   ? -14.333 20.276  11.195  1.00 16.80 ? 1056 HOH A O     1 
HETATM 9948  O O     . HOH E 3 .   ? -20.937 20.705  9.138   1.00 29.65 ? 1057 HOH A O     1 
HETATM 9949  O O     . HOH E 3 .   ? 0.311   12.132  22.296  1.00 27.39 ? 1058 HOH A O     1 
HETATM 9950  O O     . HOH E 3 .   ? -17.240 12.719  36.378  1.00 29.58 ? 1059 HOH A O     1 
HETATM 9951  O O     . HOH E 3 .   ? 0.016   6.090   25.672  1.00 30.64 ? 1060 HOH A O     1 
HETATM 9952  O O     . HOH E 3 .   ? 13.615  26.713  33.827  1.00 13.03 ? 1061 HOH A O     1 
HETATM 9953  O O     . HOH E 3 .   ? 11.216  23.600  40.655  1.00 25.42 ? 1062 HOH A O     1 
HETATM 9954  O O     . HOH E 3 .   ? 7.569   24.874  43.456  1.00 30.07 ? 1063 HOH A O     1 
HETATM 9955  O O     . HOH E 3 .   ? -2.756  15.280  34.929  1.00 14.71 ? 1064 HOH A O     1 
HETATM 9956  O O     . HOH E 3 .   ? -9.720  40.095  25.943  1.00 30.55 ? 1065 HOH A O     1 
HETATM 9957  O O     . HOH E 3 .   ? -11.071 31.898  40.592  1.00 29.71 ? 1066 HOH A O     1 
HETATM 9958  O O     . HOH E 3 .   ? -4.901  41.702  45.924  1.00 27.08 ? 1067 HOH A O     1 
HETATM 9959  O O     . HOH E 3 .   ? -8.433  46.028  48.668  1.00 13.22 ? 1068 HOH A O     1 
HETATM 9960  O O     . HOH E 3 .   ? -22.204 32.007  33.563  1.00 33.18 ? 1069 HOH A O     1 
HETATM 9961  O O     . HOH E 3 .   ? 5.215   12.148  3.184   1.00 24.71 ? 1070 HOH A O     1 
HETATM 9962  O O     . HOH E 3 .   ? -12.993 12.118  6.948   1.00 15.92 ? 1071 HOH A O     1 
HETATM 9963  O O     . HOH E 3 .   ? 2.109   13.385  -0.562  1.00 10.38 ? 1072 HOH A O     1 
HETATM 9964  O O     . HOH E 3 .   ? -7.126  9.098   14.572  1.00 30.03 ? 1073 HOH A O     1 
HETATM 9965  O O     . HOH E 3 .   ? 10.563  39.974  -1.971  1.00 22.05 ? 1074 HOH A O     1 
HETATM 9966  O O     . HOH E 3 .   ? 15.075  33.061  21.351  1.00 30.07 ? 1075 HOH A O     1 
HETATM 9967  O O     . HOH E 3 .   ? 14.663  53.553  15.381  1.00 10.46 ? 1076 HOH A O     1 
HETATM 9968  O O     . HOH E 3 .   ? -1.924  55.362  15.073  1.00 96.43 ? 1077 HOH A O     1 
HETATM 9969  O O     . HOH E 3 .   ? 3.219   55.981  10.687  1.00 28.26 ? 1078 HOH A O     1 
HETATM 9970  O O     . HOH E 3 .   ? 13.186  62.765  28.804  1.00 24.69 ? 1079 HOH A O     1 
HETATM 9971  O O     . HOH E 3 .   ? 28.631  44.201  14.483  1.00 36.46 ? 1080 HOH A O     1 
HETATM 9972  O O     . HOH E 3 .   ? -2.627  33.504  28.755  1.00 14.67 ? 1081 HOH A O     1 
HETATM 9973  O O     . HOH E 3 .   ? -1.063  39.361  10.993  1.00 22.47 ? 1082 HOH A O     1 
HETATM 9974  O O     . HOH E 3 .   ? -0.150  32.616  23.821  1.00 22.64 ? 1083 HOH A O     1 
HETATM 9975  O O     . HOH E 3 .   ? -18.982 44.008  14.717  1.00 18.73 ? 1084 HOH A O     1 
HETATM 9976  O O     . HOH E 3 .   ? -11.658 27.746  16.182  1.00 14.46 ? 1085 HOH A O     1 
HETATM 9977  O O     . HOH E 3 .   ? -11.243 8.423   25.739  1.00 20.93 ? 1086 HOH A O     1 
HETATM 9978  O O     . HOH E 3 .   ? -17.398 17.838  28.951  1.00 34.83 ? 1087 HOH A O     1 
HETATM 9979  O O     . HOH E 3 .   ? -3.422  24.094  -1.078  1.00 29.42 ? 1088 HOH A O     1 
HETATM 9980  O O     . HOH E 3 .   ? 22.047  24.630  9.812   1.00 19.06 ? 1089 HOH A O     1 
HETATM 9981  O O     . HOH E 3 .   ? 1.869   12.431  36.753  1.00 22.52 ? 1090 HOH A O     1 
HETATM 9982  O O     . HOH E 3 .   ? 22.268  32.765  -4.381  1.00 29.39 ? 1091 HOH A O     1 
HETATM 9983  O O     . HOH E 3 .   ? -3.269  54.191  10.422  1.00 32.94 ? 1092 HOH A O     1 
HETATM 9984  O O     . HOH E 3 .   ? -6.218  52.119  5.879   1.00 33.36 ? 1093 HOH A O     1 
HETATM 9985  O O     . HOH E 3 .   ? 2.285   42.626  20.629  1.00 20.21 ? 1094 HOH A O     1 
HETATM 9986  O O     . HOH E 3 .   ? 2.647   38.045  25.433  1.00 22.82 ? 1095 HOH A O     1 
HETATM 9987  O O     . HOH E 3 .   ? 11.671  54.439  33.455  1.00 23.79 ? 1096 HOH A O     1 
HETATM 9988  O O     . HOH E 3 .   ? 10.049  58.810  18.810  1.00 28.61 ? 1097 HOH A O     1 
HETATM 9989  O O     . HOH E 3 .   ? 11.898  56.978  32.518  1.00 25.01 ? 1098 HOH A O     1 
HETATM 9990  O O     . HOH E 3 .   ? 20.744  57.660  22.247  1.00 31.23 ? 1099 HOH A O     1 
HETATM 9991  O O     . HOH E 3 .   ? 25.556  23.074  21.442  1.00 42.79 ? 1100 HOH A O     1 
HETATM 9992  O O     . HOH E 3 .   ? 4.165   25.204  -6.047  1.00 19.16 ? 1101 HOH A O     1 
HETATM 9993  O O     . HOH E 3 .   ? -4.037  37.726  18.371  1.00 20.94 ? 1102 HOH A O     1 
HETATM 9994  O O     . HOH E 3 .   ? -17.312 47.286  4.175   1.00 27.44 ? 1103 HOH A O     1 
HETATM 9995  O O     . HOH E 3 .   ? -24.444 30.937  9.083   1.00 25.32 ? 1104 HOH A O     1 
HETATM 9996  O O     . HOH E 3 .   ? -13.067 22.656  10.762  1.00 16.78 ? 1105 HOH A O     1 
HETATM 9997  O O     . HOH E 3 .   ? -14.361 21.408  18.438  1.00 17.95 ? 1106 HOH A O     1 
HETATM 9998  O O     . HOH E 3 .   ? -16.797 15.534  33.142  1.00 24.24 ? 1107 HOH A O     1 
HETATM 9999  O O     . HOH E 3 .   ? -3.802  24.578  30.167  1.00 23.63 ? 1108 HOH A O     1 
HETATM 10000 O O     . HOH E 3 .   ? -13.687 29.234  30.123  1.00 22.45 ? 1109 HOH A O     1 
HETATM 10001 O O     . HOH E 3 .   ? -10.581 29.005  26.546  1.00 34.12 ? 1110 HOH A O     1 
HETATM 10002 O O     . HOH E 3 .   ? -3.563  40.176  38.731  1.00 18.23 ? 1111 HOH A O     1 
HETATM 10003 O O     . HOH E 3 .   ? -2.440  38.595  32.589  1.00 19.85 ? 1112 HOH A O     1 
HETATM 10004 O O     . HOH E 3 .   ? -16.404 30.831  34.881  1.00 28.01 ? 1113 HOH A O     1 
HETATM 10005 O O     . HOH E 3 .   ? -19.456 31.530  30.070  1.00 24.51 ? 1114 HOH A O     1 
HETATM 10006 O O     . HOH E 3 .   ? -12.608 42.273  28.888  1.00 24.95 ? 1115 HOH A O     1 
HETATM 10007 O O     . HOH E 3 .   ? -21.662 36.796  52.526  1.00 23.45 ? 1116 HOH A O     1 
HETATM 10008 O O     . HOH E 3 .   ? -29.144 36.924  53.497  1.00 24.01 ? 1117 HOH A O     1 
HETATM 10009 O O     . HOH F 3 .   ? -60.078 43.979  18.410  1.00 32.97 ? 999  HOH B O     1 
HETATM 10010 O O     . HOH F 3 .   ? -37.240 81.440  40.735  1.00 32.39 ? 1000 HOH B O     1 
HETATM 10011 O O     . HOH F 3 .   ? -50.921 91.516  25.308  1.00 31.02 ? 1001 HOH B O     1 
HETATM 10012 O O     . HOH F 3 .   ? -39.640 97.147  15.433  1.00 29.54 ? 1002 HOH B O     1 
HETATM 10013 O O     . HOH F 3 .   ? -55.576 84.531  14.687  1.00 18.03 ? 1003 HOH B O     1 
HETATM 10014 O O     . HOH F 3 .   ? -52.962 81.443  21.003  1.00 24.89 ? 1004 HOH B O     1 
HETATM 10015 O O     . HOH F 3 .   ? -57.146 73.146  19.212  1.00 19.41 ? 1005 HOH B O     1 
HETATM 10016 O O     . HOH F 3 .   ? -57.335 71.622  14.613  1.00 24.28 ? 1006 HOH B O     1 
HETATM 10017 O O     . HOH F 3 .   ? -61.266 80.590  15.012  1.00 24.35 ? 1007 HOH B O     1 
HETATM 10018 O O     . HOH F 3 .   ? -52.796 88.154  9.908   1.00 24.40 ? 1008 HOH B O     1 
HETATM 10019 O O     . HOH F 3 .   ? -48.001 89.528  14.344  1.00 22.34 ? 1009 HOH B O     1 
HETATM 10020 O O     . HOH F 3 .   ? -25.308 95.138  17.288  1.00 24.91 ? 1010 HOH B O     1 
HETATM 10021 O O     . HOH F 3 .   ? -21.335 96.577  15.061  1.00 27.90 ? 1011 HOH B O     1 
HETATM 10022 O O     . HOH F 3 .   ? -12.061 87.331  18.690  1.00 19.72 ? 1012 HOH B O     1 
HETATM 10023 O O     . HOH F 3 .   ? -8.582  69.541  20.663  1.00 19.67 ? 1013 HOH B O     1 
HETATM 10024 O O     . HOH F 3 .   ? -13.414 63.659  16.796  1.00 19.46 ? 1014 HOH B O     1 
HETATM 10025 O O     . HOH F 3 .   ? -4.704  74.058  15.337  1.00 18.52 ? 1015 HOH B O     1 
HETATM 10026 O O     . HOH F 3 .   ? -8.769  79.371  20.183  1.00 25.03 ? 1016 HOH B O     1 
HETATM 10027 O O     . HOH F 3 .   ? -17.072 91.667  4.530   1.00 34.67 ? 1017 HOH B O     1 
HETATM 10028 O O     . HOH F 3 .   ? -32.051 84.291  -9.177  1.00 33.49 ? 1018 HOH B O     1 
HETATM 10029 O O     . HOH F 3 .   ? -17.982 66.494  10.261  1.00 17.67 ? 1019 HOH B O     1 
HETATM 10030 O O     . HOH F 3 .   ? -16.206 66.934  8.012   1.00 18.64 ? 1020 HOH B O     1 
HETATM 10031 O O     . HOH F 3 .   ? -33.136 73.355  7.552   1.00 17.83 ? 1021 HOH B O     1 
HETATM 10032 O O     . HOH F 3 .   ? -34.627 68.975  6.569   1.00 20.90 ? 1022 HOH B O     1 
HETATM 10033 O O     . HOH F 3 .   ? -24.263 58.777  5.320   1.00 32.97 ? 1023 HOH B O     1 
HETATM 10034 O O     . HOH F 3 .   ? -27.065 58.003  10.879  1.00 28.31 ? 1024 HOH B O     1 
HETATM 10035 O O     . HOH F 3 .   ? -30.090 54.440  0.570   1.00 26.75 ? 1025 HOH B O     1 
HETATM 10036 O O     . HOH F 3 .   ? -33.078 56.353  -3.400  1.00 32.27 ? 1026 HOH B O     1 
HETATM 10037 O O     . HOH F 3 .   ? -39.454 61.692  2.870   1.00 29.83 ? 1027 HOH B O     1 
HETATM 10038 O O     . HOH F 3 .   ? -39.565 62.575  4.582   1.00 26.50 ? 1028 HOH B O     1 
HETATM 10039 O O     . HOH F 3 .   ? -40.354 66.845  -6.118  1.00 20.52 ? 1029 HOH B O     1 
HETATM 10040 O O     . HOH F 3 .   ? -18.474 60.767  -1.492  1.00 23.18 ? 1030 HOH B O     1 
HETATM 10041 O O     . HOH F 3 .   ? -14.432 73.146  -3.360  1.00 15.52 ? 1031 HOH B O     1 
HETATM 10042 O O     . HOH F 3 .   ? -12.779 65.315  -4.271  1.00 14.15 ? 1032 HOH B O     1 
HETATM 10043 O O     . HOH F 3 .   ? -21.668 58.170  -8.044  1.00 23.57 ? 1033 HOH B O     1 
HETATM 10044 O O     . HOH F 3 .   ? -14.832 86.682  -5.308  1.00 27.07 ? 1034 HOH B O     1 
HETATM 10045 O O     . HOH F 3 .   ? -38.582 82.993  2.464   1.00 23.51 ? 1035 HOH B O     1 
HETATM 10046 O O     . HOH F 3 .   ? -35.663 82.760  4.174   1.00 13.33 ? 1036 HOH B O     1 
HETATM 10047 O O     . HOH F 3 .   ? -36.128 63.422  9.759   1.00 21.47 ? 1037 HOH B O     1 
HETATM 10048 O O     . HOH F 3 .   ? -41.864 60.120  11.341  1.00 27.14 ? 1038 HOH B O     1 
HETATM 10049 O O     . HOH F 3 .   ? -40.875 82.887  13.425  1.00 14.55 ? 1039 HOH B O     1 
HETATM 10050 O O     . HOH F 3 .   ? -41.218 80.076  13.511  1.00 12.99 ? 1040 HOH B O     1 
HETATM 10051 O O     . HOH F 3 .   ? -36.396 80.262  18.256  1.00 20.33 ? 1041 HOH B O     1 
HETATM 10052 O O     . HOH F 3 .   ? -17.227 86.985  21.844  1.00 28.15 ? 1042 HOH B O     1 
HETATM 10053 O O     . HOH F 3 .   ? -21.106 76.274  19.198  1.00 16.00 ? 1043 HOH B O     1 
HETATM 10054 O O     . HOH F 3 .   ? -19.526 71.583  17.529  1.00 10.42 ? 1044 HOH B O     1 
HETATM 10055 O O     . HOH F 3 .   ? -23.960 66.546  20.881  1.00 26.20 ? 1045 HOH B O     1 
HETATM 10056 O O     . HOH F 3 .   ? -22.088 66.361  15.089  1.00 24.81 ? 1046 HOH B O     1 
HETATM 10057 O O     . HOH F 3 .   ? -31.572 67.095  9.095   1.00 20.53 ? 1047 HOH B O     1 
HETATM 10058 O O     . HOH F 3 .   ? -10.337 75.320  30.235  1.00 24.40 ? 1048 HOH B O     1 
HETATM 10059 O O     . HOH F 3 .   ? -29.567 64.185  23.178  1.00 26.36 ? 1049 HOH B O     1 
HETATM 10060 O O     . HOH F 3 .   ? -28.401 60.515  31.500  1.00 16.60 ? 1050 HOH B O     1 
HETATM 10061 O O     . HOH F 3 .   ? -13.501 64.834  27.318  1.00 18.55 ? 1051 HOH B O     1 
HETATM 10062 O O     . HOH F 3 .   ? -14.573 73.452  34.879  1.00 23.51 ? 1052 HOH B O     1 
HETATM 10063 O O     . HOH F 3 .   ? -14.938 76.196  36.121  1.00 17.94 ? 1053 HOH B O     1 
HETATM 10064 O O     . HOH F 3 .   ? -19.523 79.557  37.115  1.00 25.27 ? 1054 HOH B O     1 
HETATM 10065 O O     . HOH F 3 .   ? -34.848 62.684  37.231  1.00 32.36 ? 1055 HOH B O     1 
HETATM 10066 O O     . HOH F 3 .   ? -20.233 72.690  37.471  1.00 17.78 ? 1056 HOH B O     1 
HETATM 10067 O O     . HOH F 3 .   ? -24.004 75.243  40.169  1.00 20.60 ? 1057 HOH B O     1 
HETATM 10068 O O     . HOH F 3 .   ? -29.995 71.718  35.461  1.00 22.50 ? 1058 HOH B O     1 
HETATM 10069 O O     . HOH F 3 .   ? -31.377 69.018  35.108  1.00 21.65 ? 1059 HOH B O     1 
HETATM 10070 O O     . HOH F 3 .   ? -36.867 79.813  32.285  1.00 40.40 ? 1060 HOH B O     1 
HETATM 10071 O O     . HOH F 3 .   ? -29.863 68.748  42.956  1.00 23.05 ? 1061 HOH B O     1 
HETATM 10072 O O     . HOH F 3 .   ? -36.559 67.545  33.596  1.00 13.14 ? 1062 HOH B O     1 
HETATM 10073 O O     . HOH F 3 .   ? -46.850 79.996  25.792  1.00 21.78 ? 1063 HOH B O     1 
HETATM 10074 O O     . HOH F 3 .   ? -55.186 60.118  32.414  1.00 33.51 ? 1064 HOH B O     1 
HETATM 10075 O O     . HOH F 3 .   ? -53.307 69.223  21.635  1.00 22.26 ? 1065 HOH B O     1 
HETATM 10076 O O     . HOH F 3 .   ? -29.467 56.971  16.640  1.00 19.23 ? 1066 HOH B O     1 
HETATM 10077 O O     . HOH F 3 .   ? -41.794 42.940  2.171   1.00 11.59 ? 1067 HOH B O     1 
HETATM 10078 O O     . HOH F 3 .   ? -37.741 52.683  26.978  1.00 21.00 ? 1068 HOH B O     1 
HETATM 10079 O O     . HOH F 3 .   ? -41.074 35.024  10.892  1.00 20.74 ? 1069 HOH B O     1 
HETATM 10080 O O     . HOH F 3 .   ? -47.003 37.652  13.185  1.00 19.83 ? 1070 HOH B O     1 
HETATM 10081 O O     . HOH F 3 .   ? -24.746 46.901  11.105  1.00 37.73 ? 1071 HOH B O     1 
HETATM 10082 O O     . HOH F 3 .   ? -25.679 50.173  11.048  1.00 30.17 ? 1072 HOH B O     1 
HETATM 10083 O O     . HOH F 3 .   ? -51.788 46.164  23.748  1.00 36.47 ? 1073 HOH B O     1 
HETATM 10084 O O     . HOH F 3 .   ? -16.769 83.696  36.636  1.00 25.03 ? 1074 HOH B O     1 
HETATM 10085 O O     . HOH F 3 .   ? -23.785 67.555  44.974  1.00 30.04 ? 1075 HOH B O     1 
HETATM 10086 O O     . HOH F 3 .   ? -29.574 84.291  34.841  1.00 25.13 ? 1076 HOH B O     1 
HETATM 10087 O O     . HOH F 3 .   ? -53.170 86.459  19.811  1.00 20.22 ? 1077 HOH B O     1 
HETATM 10088 O O     . HOH F 3 .   ? -22.071 97.290  10.894  1.00 29.49 ? 1078 HOH B O     1 
HETATM 10089 O O     . HOH F 3 .   ? -23.184 80.578  -9.602  1.00 26.69 ? 1079 HOH B O     1 
HETATM 10090 O O     . HOH F 3 .   ? -26.001 68.795  6.830   1.00 25.42 ? 1080 HOH B O     1 
HETATM 10091 O O     . HOH F 3 .   ? -24.938 67.148  8.958   1.00 12.28 ? 1081 HOH B O     1 
HETATM 10092 O O     . HOH F 3 .   ? -22.509 55.970  -6.725  1.00 24.34 ? 1082 HOH B O     1 
HETATM 10093 O O     . HOH F 3 .   ? -26.493 60.888  -9.870  1.00 17.95 ? 1083 HOH B O     1 
HETATM 10094 O O     . HOH F 3 .   ? -26.748 91.052  22.507  1.00 19.39 ? 1084 HOH B O     1 
HETATM 10095 O O     . HOH F 3 .   ? -7.750  63.100  22.449  1.00 13.95 ? 1085 HOH B O     1 
HETATM 10096 O O     . HOH F 3 .   ? -6.253  61.647  26.306  1.00 18.27 ? 1086 HOH B O     1 
HETATM 10097 O O     . HOH F 3 .   ? -32.534 65.536  41.856  1.00 28.61 ? 1087 HOH B O     1 
HETATM 10098 O O     . HOH F 3 .   ? -52.470 62.875  34.756  1.00 27.38 ? 1088 HOH B O     1 
HETATM 10099 O O     . HOH F 3 .   ? -50.260 59.363  28.252  1.00 24.33 ? 1089 HOH B O     1 
HETATM 10100 O O     . HOH F 3 .   ? -43.274 57.231  12.952  1.00 25.64 ? 1090 HOH B O     1 
HETATM 10101 O O     . HOH F 3 .   ? -40.153 48.837  26.105  1.00 24.37 ? 1091 HOH B O     1 
HETATM 10102 O O     . HOH F 3 .   ? -23.743 57.228  25.295  1.00 25.73 ? 1092 HOH B O     1 
HETATM 10103 O O     . HOH F 3 .   ? -30.200 35.527  3.335   1.00 29.34 ? 1093 HOH B O     1 
HETATM 10104 O O     . HOH F 3 .   ? -36.908 50.918  -0.890  1.00 26.04 ? 1094 HOH B O     1 
HETATM 10105 O O     . HOH F 3 .   ? -29.630 52.946  16.614  1.00 16.48 ? 1095 HOH B O     1 
HETATM 10106 O O     . HOH F 3 .   ? -51.789 48.768  22.330  1.00 29.08 ? 1096 HOH B O     1 
HETATM 10107 O O     . HOH F 3 .   ? -40.612 39.517  28.769  1.00 29.94 ? 1097 HOH B O     1 
HETATM 10108 O O     . HOH F 3 .   ? -24.022 73.351  45.020  1.00 28.76 ? 1098 HOH B O     1 
HETATM 10109 O O     . HOH F 3 .   ? -33.298 93.614  40.523  1.00 20.86 ? 1099 HOH B O     1 
HETATM 10110 O O     . HOH F 3 .   ? -47.087 95.235  30.837  1.00 31.66 ? 1100 HOH B O     1 
HETATM 10111 O O     . HOH F 3 .   ? -33.276 94.514  23.979  1.00 22.47 ? 1101 HOH B O     1 
HETATM 10112 O O     . HOH F 3 .   ? -41.703 98.606  16.534  1.00 33.32 ? 1102 HOH B O     1 
HETATM 10113 O O     . HOH F 3 .   ? -21.712 92.754  17.907  1.00 26.33 ? 1103 HOH B O     1 
HETATM 10114 O O     . HOH F 3 .   ? -6.793  77.676  16.836  1.00 37.28 ? 1104 HOH B O     1 
HETATM 10115 O O     . HOH F 3 .   ? -17.970 92.286  1.027   1.00 34.63 ? 1105 HOH B O     1 
HETATM 10116 O O     . HOH F 3 .   ? -36.309 58.807  7.073   1.00 28.10 ? 1106 HOH B O     1 
HETATM 10117 O O     . HOH F 3 .   ? -38.821 73.326  -7.347  1.00 32.61 ? 1107 HOH B O     1 
HETATM 10118 O O     . HOH F 3 .   ? -33.841 66.570  -10.451 1.00 25.52 ? 1108 HOH B O     1 
HETATM 10119 O O     . HOH F 3 .   ? -45.891 86.435  4.588   1.00 31.21 ? 1109 HOH B O     1 
HETATM 10120 O O     . HOH F 3 .   ? -33.995 66.042  8.552   1.00 19.54 ? 1110 HOH B O     1 
HETATM 10121 O O     . HOH F 3 .   ? -36.581 63.770  14.173  1.00 10.22 ? 1111 HOH B O     1 
HETATM 10122 O O     . HOH F 3 .   ? -35.412 65.643  15.305  1.00 12.01 ? 1112 HOH B O     1 
HETATM 10123 O O     . HOH F 3 .   ? -34.153 68.560  14.677  1.00 15.46 ? 1113 HOH B O     1 
HETATM 10124 O O     . HOH F 3 .   ? -48.163 55.558  10.172  1.00 24.14 ? 1114 HOH B O     1 
HETATM 10125 O O     . HOH F 3 .   ? -28.859 85.449  32.437  1.00 27.34 ? 1115 HOH B O     1 
HETATM 10126 O O     . HOH F 3 .   ? -31.182 68.817  17.981  1.00 31.94 ? 1116 HOH B O     1 
HETATM 10127 O O     . HOH F 3 .   ? -32.805 63.844  16.067  1.00 23.90 ? 1117 HOH B O     1 
HETATM 10128 O O     . HOH F 3 .   ? -30.926 67.265  28.831  1.00 17.64 ? 1118 HOH B O     1 
HETATM 10129 O O     . HOH F 3 .   ? -15.198 59.882  36.968  1.00 16.27 ? 1119 HOH B O     1 
HETATM 10130 O O     . HOH F 3 .   ? -36.890 61.807  21.021  1.00 33.70 ? 1120 HOH B O     1 
HETATM 10131 O O     . HOH F 3 .   ? -53.832 39.015  18.340  1.00 34.96 ? 1121 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   GLN 3   3   ?   ?   ?   A . n 
A 1 4   THR 4   4   ?   ?   ?   A . n 
A 1 5   HIS 5   5   ?   ?   ?   A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   HIS 7   7   7   HIS HIS A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  PRO 10  10  10  PRO PRO A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  ASP 15  15  15  ASP ASP A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  CYS 17  17  17  CYS CYS A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  ASN 20  20  20  ASN ASN A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  SER 31  31  31  SER SER A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  TRP 39  39  39  TRP TRP A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  TRP 48  48  48  TRP TRP A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  GLN 53  53  53  GLN GLN A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  TRP 69  69  69  TRP TRP A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  ARG 84  84  84  ARG ARG A . n 
A 1 85  HIS 85  85  85  HIS HIS A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  TRP 97  97  97  TRP TRP A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 HIS 107 107 107 HIS HIS A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 HIS 114 114 114 HIS HIS A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 CYS 118 118 118 CYS CYS A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ILE 137 137 137 ILE ILE A . n 
A 1 138 TYR 138 138 138 TYR TYR A . n 
A 1 139 MET 139 139 139 MET MET A . n 
A 1 140 PRO 140 140 140 PRO PRO A . n 
A 1 141 MET 141 141 141 MET MET A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 PRO 143 143 143 PRO PRO A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ALA 146 146 146 ALA ALA A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 CYS 152 152 152 CYS CYS A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 VAL 158 158 158 VAL VAL A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 SER 160 160 160 SER SER A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 PHE 163 163 163 PHE PHE A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 PHE 166 166 166 PHE PHE A . n 
A 1 167 SER 167 167 167 SER SER A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 ALA 170 170 170 ALA ALA A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 ILE 176 176 176 ILE ILE A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 THR 185 185 185 THR THR A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PRO 197 197 197 PRO PRO A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 LYS 199 199 199 LYS LYS A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 ASN 201 201 201 ASN ASN A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 ASP 203 203 203 ASP ASP A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 LYS 207 207 207 LYS LYS A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 ASN 210 210 210 ASN ASN A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 THR 212 212 212 THR THR A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 HIS 216 216 216 HIS HIS A . n 
A 1 217 VAL 217 217 217 VAL VAL A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 LYS 221 221 221 LYS LYS A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 GLY 224 224 224 GLY GLY A . n 
A 1 225 SER 225 225 225 SER SER A . n 
A 1 226 ASP 226 226 226 ASP ASP A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 ASP 228 228 228 ASP ASP A . n 
A 1 229 TRP 229 229 229 TRP TRP A . n 
A 1 230 GLN 230 230 230 GLN GLN A . n 
A 1 231 GLU 231 231 231 GLU GLU A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 TRP 237 237 237 TRP TRP A . n 
A 1 238 ARG 238 238 238 ARG ARG A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 GLU 242 242 242 GLU GLU A . n 
A 1 243 LYS 243 243 243 LYS LYS A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 SER 245 245 245 SER SER A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 HIS 248 248 248 HIS HIS A . n 
A 1 249 GLN 249 249 249 GLN GLN A . n 
A 1 250 PRO 250 250 250 PRO PRO A . n 
A 1 251 GLU 251 251 251 GLU GLU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 MET 253 253 253 MET MET A . n 
A 1 254 ASN 254 254 254 ASN ASN A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 ASP 257 257 257 ASP ASP A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 PHE 260 260 260 PHE PHE A . n 
A 1 261 ILE 261 261 261 ILE ILE A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 TYR 263 263 263 TYR TYR A . n 
A 1 264 THR 264 264 264 THR THR A . n 
A 1 265 SER 265 265 265 SER SER A . n 
A 1 266 GLY 266 266 266 GLY GLY A . n 
A 1 267 SER 267 267 267 SER SER A . n 
A 1 268 THR 268 268 268 THR THR A . n 
A 1 269 GLY 269 269 269 GLY GLY A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 LYS 272 272 272 LYS LYS A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 VAL 274 274 274 VAL VAL A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 HIS 276 276 276 HIS HIS A . n 
A 1 277 THR 277 277 277 THR THR A . n 
A 1 278 THR 278 278 278 THR THR A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 TYR 281 281 281 TYR TYR A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 VAL 283 283 283 VAL VAL A . n 
A 1 284 TYR 284 284 284 TYR TYR A . n 
A 1 285 ALA 285 285 285 ALA ALA A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 THR 287 287 287 THR THR A . n 
A 1 288 THR 288 288 288 THR THR A . n 
A 1 289 PHE 289 289 289 PHE PHE A . n 
A 1 290 LYS 290 290 290 LYS LYS A . n 
A 1 291 TYR 291 291 291 TYR TYR A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 PHE 293 293 293 PHE PHE A . n 
A 1 294 ASP 294 294 294 ASP ASP A . n 
A 1 295 TYR 295 295 295 TYR TYR A . n 
A 1 296 HIS 296 296 296 HIS HIS A . n 
A 1 297 PRO 297 297 297 PRO PRO A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 ASP 299 299 299 ASP ASP A . n 
A 1 300 ILE 300 300 300 ILE ILE A . n 
A 1 301 TYR 301 301 301 TYR TYR A . n 
A 1 302 TRP 302 302 302 TRP TRP A . n 
A 1 303 CYS 303 303 303 CYS CYS A . n 
A 1 304 THR 304 304 304 THR THR A . n 
A 1 305 ALA 305 305 305 ALA ALA A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 VAL 307 307 307 VAL VAL A . n 
A 1 308 GLY 308 308 308 GLY GLY A . n 
A 1 309 TRP 309 309 309 TRP TRP A . n 
A 1 310 VAL 310 310 310 VAL VAL A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 HIS 313 313 313 HIS HIS A . n 
A 1 314 SER 314 314 314 SER SER A . n 
A 1 315 TYR 315 315 315 TYR TYR A . n 
A 1 316 LEU 316 316 316 LEU LEU A . n 
A 1 317 LEU 317 317 317 LEU LEU A . n 
A 1 318 TYR 318 318 318 TYR TYR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 PRO 320 320 320 PRO PRO A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 ALA 322 322 322 ALA ALA A . n 
A 1 323 CYS 323 323 323 CYS CYS A . n 
A 1 324 GLY 324 324 324 GLY GLY A . n 
A 1 325 ALA 325 325 325 ALA ALA A . n 
A 1 326 THR 326 326 326 THR THR A . n 
A 1 327 THR 327 327 327 THR THR A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 MET 329 329 329 MET MET A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 GLU 331 331 331 GLU GLU A . n 
A 1 332 GLY 332 332 332 GLY GLY A . n 
A 1 333 VAL 333 333 333 VAL VAL A . n 
A 1 334 PRO 334 334 334 PRO PRO A . n 
A 1 335 ASN 335 335 335 ASN ASN A . n 
A 1 336 TRP 336 336 336 TRP TRP A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 THR 338 338 338 THR THR A . n 
A 1 339 PRO 339 339 339 PRO PRO A . n 
A 1 340 ALA 340 340 340 ALA ALA A . n 
A 1 341 ARG 341 341 341 ARG ARG A . n 
A 1 342 MET 342 342 342 MET MET A . n 
A 1 343 CYS 343 343 343 CYS CYS A . n 
A 1 344 GLN 344 344 344 GLN GLN A . n 
A 1 345 VAL 345 345 345 VAL VAL A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 ASP 347 347 347 ASP ASP A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 HIS 349 349 349 HIS HIS A . n 
A 1 350 GLN 350 350 350 GLN GLN A . n 
A 1 351 VAL 351 351 351 VAL VAL A . n 
A 1 352 ASN 352 352 352 ASN ASN A . n 
A 1 353 ILE 353 353 353 ILE ILE A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 TYR 355 355 355 TYR TYR A . n 
A 1 356 THR 356 356 356 THR THR A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 PRO 358 358 358 PRO PRO A . n 
A 1 359 THR 359 359 359 THR THR A . n 
A 1 360 ALA 360 360 360 ALA ALA A . n 
A 1 361 ILE 361 361 361 ILE ILE A . n 
A 1 362 ARG 362 362 362 ARG ARG A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 LEU 364 364 364 LEU LEU A . n 
A 1 365 MET 365 365 365 MET MET A . n 
A 1 366 ALA 366 366 366 ALA ALA A . n 
A 1 367 GLU 367 367 367 GLU GLU A . n 
A 1 368 GLY 368 368 368 GLY GLY A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 LYS 370 370 370 LYS LYS A . n 
A 1 371 ALA 371 371 371 ALA ALA A . n 
A 1 372 ILE 372 372 372 ILE ILE A . n 
A 1 373 GLU 373 373 373 GLU GLU A . n 
A 1 374 GLY 374 374 374 GLY GLY A . n 
A 1 375 THR 375 375 375 THR THR A . n 
A 1 376 ASP 376 376 376 ASP ASP A . n 
A 1 377 ARG 377 377 377 ARG ARG A . n 
A 1 378 SER 378 378 378 SER SER A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 ARG 381 381 381 ARG ARG A . n 
A 1 382 ILE 382 382 382 ILE ILE A . n 
A 1 383 LEU 383 383 383 LEU LEU A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 SER 385 385 385 SER SER A . n 
A 1 386 VAL 386 386 386 VAL VAL A . n 
A 1 387 GLY 387 387 387 GLY GLY A . n 
A 1 388 GLU 388 388 388 GLU GLU A . n 
A 1 389 PRO 389 389 389 PRO PRO A . n 
A 1 390 ILE 390 390 390 ILE ILE A . n 
A 1 391 ASN 391 391 391 ASN ASN A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 GLU 393 393 393 GLU GLU A . n 
A 1 394 ALA 394 394 394 ALA ALA A . n 
A 1 395 TRP 395 395 395 TRP TRP A . n 
A 1 396 GLU 396 396 396 GLU GLU A . n 
A 1 397 TRP 397 397 397 TRP TRP A . n 
A 1 398 TYR 398 398 398 TYR TYR A . n 
A 1 399 TRP 399 399 399 TRP TRP A . n 
A 1 400 LYS 400 400 400 LYS LYS A . n 
A 1 401 LYS 401 401 401 LYS LYS A . n 
A 1 402 ILE 402 402 402 ILE ILE A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 LYS 404 404 404 LYS LYS A . n 
A 1 405 GLU 405 405 405 GLU GLU A . n 
A 1 406 LYS 406 406 406 LYS LYS A . n 
A 1 407 CYS 407 407 407 CYS CYS A . n 
A 1 408 PRO 408 408 408 PRO PRO A . n 
A 1 409 VAL 409 409 409 VAL VAL A . n 
A 1 410 VAL 410 410 410 VAL VAL A . n 
A 1 411 ASP 411 411 411 ASP ASP A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 TRP 413 413 413 TRP TRP A . n 
A 1 414 TRP 414 414 414 TRP TRP A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 THR 416 416 416 THR THR A . n 
A 1 417 GLU 417 417 417 GLU GLU A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 GLY 419 419 419 GLY GLY A . n 
A 1 420 GLY 420 420 420 GLY GLY A . n 
A 1 421 PHE 421 421 421 PHE PHE A . n 
A 1 422 MET 422 422 422 MET MET A . n 
A 1 423 ILE 423 423 423 ILE ILE A . n 
A 1 424 THR 424 424 424 THR THR A . n 
A 1 425 PRO 425 425 425 PRO PRO A . n 
A 1 426 LEU 426 426 426 LEU LEU A . n 
A 1 427 PRO 427 427 427 PRO PRO A . n 
A 1 428 GLY 428 428 428 GLY GLY A . n 
A 1 429 ALA 429 429 429 ALA ALA A . n 
A 1 430 ILE 430 430 430 ILE ILE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 LEU 432 432 432 LEU LEU A . n 
A 1 433 LYS 433 433 433 LYS LYS A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 GLY 435 435 435 GLY GLY A . n 
A 1 436 SER 436 436 436 SER SER A . n 
A 1 437 ALA 437 437 437 ALA ALA A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 ARG 439 439 439 ARG ARG A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 PHE 441 441 441 PHE PHE A . n 
A 1 442 PHE 442 442 442 PHE PHE A . n 
A 1 443 GLY 443 443 443 GLY GLY A . n 
A 1 444 VAL 444 444 444 VAL VAL A . n 
A 1 445 GLN 445 445 445 GLN GLN A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 ALA 447 447 447 ALA ALA A . n 
A 1 448 LEU 448 448 448 LEU LEU A . n 
A 1 449 VAL 449 449 449 VAL VAL A . n 
A 1 450 ASP 450 450 450 ASP ASP A . n 
A 1 451 ASN 451 451 451 ASN ASN A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 GLY 453 453 453 GLY GLY A . n 
A 1 454 HIS 454 454 454 HIS HIS A . n 
A 1 455 PRO 455 455 455 PRO PRO A . n 
A 1 456 GLN 456 456 456 GLN GLN A . n 
A 1 457 GLU 457 457 457 GLU GLU A . n 
A 1 458 GLY 458 458 458 GLY GLY A . n 
A 1 459 ALA 459 459 459 ALA ALA A . n 
A 1 460 THR 460 460 460 THR THR A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLY 462 462 462 GLY GLY A . n 
A 1 463 ASN 463 463 463 ASN ASN A . n 
A 1 464 LEU 464 464 464 LEU LEU A . n 
A 1 465 VAL 465 465 465 VAL VAL A . n 
A 1 466 ILE 466 466 466 ILE ILE A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 ASP 468 468 468 ASP ASP A . n 
A 1 469 SER 469 469 469 SER SER A . n 
A 1 470 TRP 470 470 470 TRP TRP A . n 
A 1 471 PRO 471 471 471 PRO PRO A . n 
A 1 472 GLY 472 472 472 GLY GLY A . n 
A 1 473 GLN 473 473 473 GLN GLN A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 THR 476 476 476 THR THR A . n 
A 1 477 LEU 477 477 477 LEU LEU A . n 
A 1 478 PHE 478 478 478 PHE PHE A . n 
A 1 479 GLY 479 479 479 GLY GLY A . n 
A 1 480 ASP 480 480 480 ASP ASP A . n 
A 1 481 HIS 481 481 481 HIS HIS A . n 
A 1 482 GLU 482 482 482 GLU GLU A . n 
A 1 483 ARG 483 483 483 ARG ARG A . n 
A 1 484 PHE 484 484 484 PHE PHE A . n 
A 1 485 GLU 485 485 485 GLU GLU A . n 
A 1 486 GLN 486 486 486 GLN GLN A . n 
A 1 487 THR 487 487 487 THR THR A . n 
A 1 488 TYR 488 488 488 TYR TYR A . n 
A 1 489 PHE 489 489 489 PHE PHE A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 THR 491 491 491 THR THR A . n 
A 1 492 PHE 492 492 492 PHE PHE A . n 
A 1 493 LYS 493 493 493 LYS LYS A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 MET 495 495 495 MET MET A . n 
A 1 496 TYR 496 496 496 TYR TYR A . n 
A 1 497 PHE 497 497 497 PHE PHE A . n 
A 1 498 SER 498 498 498 SER SER A . n 
A 1 499 GLY 499 499 499 GLY GLY A . n 
A 1 500 ASP 500 500 500 ASP ASP A . n 
A 1 501 GLY 501 501 501 GLY GLY A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 ARG 503 503 503 ARG ARG A . n 
A 1 504 ARG 504 504 504 ARG ARG A . n 
A 1 505 ASP 505 505 505 ASP ASP A . n 
A 1 506 GLU 506 506 506 GLU GLU A . n 
A 1 507 ASP 507 507 507 ASP ASP A . n 
A 1 508 GLY 508 508 508 GLY GLY A . n 
A 1 509 TYR 509 509 509 TYR TYR A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 TRP 511 511 511 TRP TRP A . n 
A 1 512 ILE 512 512 512 ILE ILE A . n 
A 1 513 THR 513 513 513 THR THR A . n 
A 1 514 GLY 514 514 514 GLY GLY A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 ASP 517 517 517 ASP ASP A . n 
A 1 518 ASP 518 518 518 ASP ASP A . n 
A 1 519 VAL 519 519 519 VAL VAL A . n 
A 1 520 LEU 520 520 520 LEU LEU A . n 
A 1 521 ASN 521 521 521 ASN ASN A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 SER 523 523 523 SER SER A . n 
A 1 524 GLY 524 524 524 GLY GLY A . n 
A 1 525 HIS 525 525 525 HIS HIS A . n 
A 1 526 ARG 526 526 526 ARG ARG A . n 
A 1 527 LEU 527 527 527 LEU LEU A . n 
A 1 528 GLY 528 528 528 GLY GLY A . n 
A 1 529 THR 529 529 529 THR THR A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 GLU 531 531 531 GLU GLU A . n 
A 1 532 ILE 532 532 532 ILE ILE A . n 
A 1 533 GLU 533 533 533 GLU GLU A . n 
A 1 534 SER 534 534 534 SER SER A . n 
A 1 535 ALA 535 535 535 ALA ALA A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 VAL 537 537 537 VAL VAL A . n 
A 1 538 ALA 538 538 538 ALA ALA A . n 
A 1 539 HIS 539 539 539 HIS HIS A . n 
A 1 540 PRO 540 540 540 PRO PRO A . n 
A 1 541 LYS 541 541 541 LYS LYS A . n 
A 1 542 ILE 542 542 542 ILE ILE A . n 
A 1 543 ALA 543 543 543 ALA ALA A . n 
A 1 544 GLU 544 544 544 GLU GLU A . n 
A 1 545 ALA 545 545 545 ALA ALA A . n 
A 1 546 ALA 546 546 546 ALA ALA A . n 
A 1 547 VAL 547 547 547 VAL VAL A . n 
A 1 548 VAL 548 548 548 VAL VAL A . n 
A 1 549 GLY 549 549 549 GLY GLY A . n 
A 1 550 ILE 550 550 550 ILE ILE A . n 
A 1 551 PRO 551 551 551 PRO PRO A . n 
A 1 552 HIS 552 552 552 HIS HIS A . n 
A 1 553 ALA 553 553 553 ALA ALA A . n 
A 1 554 ILE 554 554 554 ILE ILE A . n 
A 1 555 LYS 555 555 555 LYS LYS A . n 
A 1 556 GLY 556 556 556 GLY GLY A . n 
A 1 557 GLN 557 557 557 GLN GLN A . n 
A 1 558 ALA 558 558 558 ALA ALA A . n 
A 1 559 ILE 559 559 559 ILE ILE A . n 
A 1 560 TYR 560 560 560 TYR TYR A . n 
A 1 561 ALA 561 561 561 ALA ALA A . n 
A 1 562 TYR 562 562 562 TYR TYR A . n 
A 1 563 VAL 563 563 563 VAL VAL A . n 
A 1 564 THR 564 564 564 THR THR A . n 
A 1 565 LEU 565 565 565 LEU LEU A . n 
A 1 566 ASN 566 566 566 ASN ASN A . n 
A 1 567 HIS 567 567 567 HIS HIS A . n 
A 1 568 GLY 568 568 568 GLY GLY A . n 
A 1 569 GLU 569 569 569 GLU GLU A . n 
A 1 570 GLU 570 570 570 GLU GLU A . n 
A 1 571 PRO 571 571 571 PRO PRO A . n 
A 1 572 SER 572 572 572 SER SER A . n 
A 1 573 PRO 573 573 573 PRO PRO A . n 
A 1 574 GLU 574 574 574 GLU GLU A . n 
A 1 575 LEU 575 575 575 LEU LEU A . n 
A 1 576 TYR 576 576 576 TYR TYR A . n 
A 1 577 ALA 577 577 577 ALA ALA A . n 
A 1 578 GLU 578 578 578 GLU GLU A . n 
A 1 579 VAL 579 579 579 VAL VAL A . n 
A 1 580 ARG 580 580 580 ARG ARG A . n 
A 1 581 ASN 581 581 581 ASN ASN A . n 
A 1 582 TRP 582 582 582 TRP TRP A . n 
A 1 583 VAL 583 583 583 VAL VAL A . n 
A 1 584 GLU 584 584 584 GLU GLU A . n 
A 1 585 LYS 585 585 585 LYS LYS A . n 
A 1 586 GLU 586 586 586 GLU GLU A . n 
A 1 587 ILE 587 587 587 ILE ILE A . n 
A 1 588 GLY 588 588 588 GLY GLY A . n 
A 1 589 PRO 589 589 589 PRO PRO A . n 
A 1 590 LEU 590 590 590 LEU LEU A . n 
A 1 591 ALA 591 591 591 ALA ALA A . n 
A 1 592 THR 592 592 592 THR THR A . n 
A 1 593 PRO 593 593 593 PRO PRO A . n 
A 1 594 ASP 594 594 594 ASP ASP A . n 
A 1 595 VAL 595 595 595 VAL VAL A . n 
A 1 596 LEU 596 596 596 LEU LEU A . n 
A 1 597 HIS 597 597 597 HIS HIS A . n 
A 1 598 TRP 598 598 598 TRP TRP A . n 
A 1 599 THR 599 599 599 THR THR A . n 
A 1 600 ASP 600 600 600 ASP ASP A . n 
A 1 601 SER 601 601 601 SER SER A . n 
A 1 602 LEU 602 602 602 LEU LEU A . n 
A 1 603 PRO 603 603 603 PRO PRO A . n 
A 1 604 LYS 604 604 604 LYS LYS A . n 
A 1 605 THR 605 605 605 THR THR A . n 
A 1 606 ARG 606 606 606 ARG ARG A . n 
A 1 607 SER 607 607 607 SER SER A . n 
A 1 608 GLY 608 608 608 GLY GLY A . n 
A 1 609 LYS 609 609 609 LYS LYS A . n 
A 1 610 ILE 610 610 610 ILE ILE A . n 
A 1 611 MET 611 611 611 MET MET A . n 
A 1 612 ARG 612 612 612 ARG ARG A . n 
A 1 613 ARG 613 613 613 ARG ARG A . n 
A 1 614 ILE 614 614 614 ILE ILE A . n 
A 1 615 LEU 615 615 615 LEU LEU A . n 
A 1 616 ARG 616 616 616 ARG ARG A . n 
A 1 617 LYS 617 617 617 LYS LYS A . n 
A 1 618 ILE 618 618 618 ILE ILE A . n 
A 1 619 ALA 619 619 619 ALA ALA A . n 
A 1 620 ALA 620 620 620 ALA ALA A . n 
A 1 621 GLY 621 621 621 GLY GLY A . n 
A 1 622 ASP 622 622 622 ASP ASP A . n 
A 1 623 THR 623 623 623 THR THR A . n 
A 1 624 SER 624 624 624 SER SER A . n 
A 1 625 ASN 625 625 ?   ?   ?   A . n 
A 1 626 LEU 626 626 ?   ?   ?   A . n 
A 1 627 GLY 627 627 ?   ?   ?   A . n 
A 1 628 ASP 628 628 ?   ?   ?   A . n 
A 1 629 THR 629 629 ?   ?   ?   A . n 
A 1 630 SER 630 630 ?   ?   ?   A . n 
A 1 631 THR 631 631 ?   ?   ?   A . n 
A 1 632 LEU 632 632 ?   ?   ?   A . n 
A 1 633 ALA 633 633 633 ALA ALA A . n 
A 1 634 ASP 634 634 634 ASP ASP A . n 
A 1 635 PRO 635 635 635 PRO PRO A . n 
A 1 636 GLY 636 636 636 GLY GLY A . n 
A 1 637 VAL 637 637 637 VAL VAL A . n 
A 1 638 VAL 638 638 638 VAL VAL A . n 
A 1 639 GLU 639 639 639 GLU GLU A . n 
A 1 640 LYS 640 640 640 LYS LYS A . n 
A 1 641 LEU 641 641 641 LEU LEU A . n 
A 1 642 LEU 642 642 642 LEU LEU A . n 
A 1 643 GLU 643 643 643 GLU GLU A . n 
A 1 644 GLU 644 644 644 GLU GLU A . n 
A 1 645 LYS 645 645 645 LYS LYS A . n 
A 1 646 GLN 646 646 646 GLN GLN A . n 
A 1 647 ALA 647 647 647 ALA ALA A . n 
A 1 648 ILE 648 648 ?   ?   ?   A . n 
A 1 649 ALA 649 649 ?   ?   ?   A . n 
A 1 650 MET 650 650 ?   ?   ?   A . n 
A 1 651 PRO 651 651 ?   ?   ?   A . n 
A 1 652 SER 652 652 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   GLN 3   3   ?   ?   ?   B . n 
B 1 4   THR 4   4   ?   ?   ?   B . n 
B 1 5   HIS 5   5   5   HIS HIS B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   HIS 7   7   7   HIS HIS B . n 
B 1 8   ALA 8   8   8   ALA ALA B . n 
B 1 9   ILE 9   9   9   ILE ILE B . n 
B 1 10  PRO 10  10  10  PRO PRO B . n 
B 1 11  ALA 11  11  11  ALA ALA B . n 
B 1 12  ASN 12  12  12  ASN ASN B . n 
B 1 13  ILE 13  13  13  ILE ILE B . n 
B 1 14  ALA 14  14  14  ALA ALA B . n 
B 1 15  ASP 15  15  15  ASP ASP B . n 
B 1 16  ARG 16  16  16  ARG ARG B . n 
B 1 17  CYS 17  17  17  CYS CYS B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  ILE 19  19  19  ILE ILE B . n 
B 1 20  ASN 20  20  20  ASN ASN B . n 
B 1 21  PRO 21  21  21  PRO PRO B . n 
B 1 22  GLU 22  22  22  GLU GLU B . n 
B 1 23  GLN 23  23  23  GLN GLN B . n 
B 1 24  TYR 24  24  24  TYR TYR B . n 
B 1 25  GLU 25  25  25  GLU GLU B . n 
B 1 26  THR 26  26  26  THR THR B . n 
B 1 27  LYS 27  27  27  LYS LYS B . n 
B 1 28  TYR 28  28  28  TYR TYR B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  GLN 30  30  30  GLN GLN B . n 
B 1 31  SER 31  31  31  SER SER B . n 
B 1 32  ILE 32  32  32  ILE ILE B . n 
B 1 33  ASN 33  33  33  ASN ASN B . n 
B 1 34  ASP 34  34  34  ASP ASP B . n 
B 1 35  PRO 35  35  35  PRO PRO B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  THR 37  37  37  THR THR B . n 
B 1 38  PHE 38  38  38  PHE PHE B . n 
B 1 39  TRP 39  39  39  TRP TRP B . n 
B 1 40  GLY 40  40  40  GLY GLY B . n 
B 1 41  GLU 41  41  41  GLU GLU B . n 
B 1 42  GLN 42  42  42  GLN GLN B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  LYS 44  44  44  LYS LYS B . n 
B 1 45  ILE 45  45  45  ILE ILE B . n 
B 1 46  LEU 46  46  46  LEU LEU B . n 
B 1 47  ASP 47  47  47  ASP ASP B . n 
B 1 48  TRP 48  48  48  TRP TRP B . n 
B 1 49  ILE 49  49  49  ILE ILE B . n 
B 1 50  THR 50  50  50  THR THR B . n 
B 1 51  PRO 51  51  51  PRO PRO B . n 
B 1 52  TYR 52  52  52  TYR TYR B . n 
B 1 53  GLN 53  53  53  GLN GLN B . n 
B 1 54  LYS 54  54  54  LYS LYS B . n 
B 1 55  VAL 55  55  55  VAL VAL B . n 
B 1 56  LYS 56  56  56  LYS LYS B . n 
B 1 57  ASN 57  57  57  ASN ASN B . n 
B 1 58  THR 58  58  58  THR THR B . n 
B 1 59  SER 59  59  59  SER SER B . n 
B 1 60  PHE 60  60  60  PHE PHE B . n 
B 1 61  ALA 61  61  61  ALA ALA B . n 
B 1 62  PRO 62  62  62  PRO PRO B . n 
B 1 63  GLY 63  63  63  GLY GLY B . n 
B 1 64  ASN 64  64  64  ASN ASN B . n 
B 1 65  VAL 65  65  65  VAL VAL B . n 
B 1 66  SER 66  66  66  SER SER B . n 
B 1 67  ILE 67  67  67  ILE ILE B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  TRP 69  69  69  TRP TRP B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLU 71  71  71  GLU GLU B . n 
B 1 72  ASP 72  72  72  ASP ASP B . n 
B 1 73  GLY 73  73  73  GLY GLY B . n 
B 1 74  THR 74  74  74  THR THR B . n 
B 1 75  LEU 75  75  75  LEU LEU B . n 
B 1 76  ASN 76  76  76  ASN ASN B . n 
B 1 77  LEU 77  77  77  LEU LEU B . n 
B 1 78  ALA 78  78  78  ALA ALA B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  ASN 80  80  80  ASN ASN B . n 
B 1 81  CYS 81  81  81  CYS CYS B . n 
B 1 82  LEU 82  82  82  LEU LEU B . n 
B 1 83  ASP 83  83  83  ASP ASP B . n 
B 1 84  ARG 84  84  84  ARG ARG B . n 
B 1 85  HIS 85  85  85  HIS HIS B . n 
B 1 86  LEU 86  86  86  LEU LEU B . n 
B 1 87  GLN 87  87  87  GLN GLN B . n 
B 1 88  GLU 88  88  88  GLU GLU B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  GLY 90  90  90  GLY GLY B . n 
B 1 91  ASP 91  91  91  ASP ASP B . n 
B 1 92  ARG 92  92  92  ARG ARG B . n 
B 1 93  THR 93  93  93  THR THR B . n 
B 1 94  ALA 94  94  94  ALA ALA B . n 
B 1 95  ILE 95  95  95  ILE ILE B . n 
B 1 96  ILE 96  96  96  ILE ILE B . n 
B 1 97  TRP 97  97  97  TRP TRP B . n 
B 1 98  GLU 98  98  98  GLU GLU B . n 
B 1 99  GLY 99  99  99  GLY GLY B . n 
B 1 100 ASP 100 100 100 ASP ASP B . n 
B 1 101 ASP 101 101 101 ASP ASP B . n 
B 1 102 THR 102 102 102 THR THR B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 GLN 104 104 104 GLN GLN B . n 
B 1 105 SER 105 105 105 SER SER B . n 
B 1 106 LYS 106 106 106 LYS LYS B . n 
B 1 107 HIS 107 107 107 HIS HIS B . n 
B 1 108 ILE 108 108 108 ILE ILE B . n 
B 1 109 SER 109 109 109 SER SER B . n 
B 1 110 TYR 110 110 110 TYR TYR B . n 
B 1 111 ARG 111 111 111 ARG ARG B . n 
B 1 112 GLU 112 112 112 GLU GLU B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 HIS 114 114 114 HIS HIS B . n 
B 1 115 ARG 115 115 115 ARG ARG B . n 
B 1 116 ASP 116 116 116 ASP ASP B . n 
B 1 117 VAL 117 117 117 VAL VAL B . n 
B 1 118 CYS 118 118 118 CYS CYS B . n 
B 1 119 ARG 119 119 119 ARG ARG B . n 
B 1 120 PHE 120 120 120 PHE PHE B . n 
B 1 121 ALA 121 121 121 ALA ALA B . n 
B 1 122 ASN 122 122 122 ASN ASN B . n 
B 1 123 THR 123 123 123 THR THR B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 ASP 126 126 126 ASP ASP B . n 
B 1 127 LEU 127 127 127 LEU LEU B . n 
B 1 128 GLY 128 128 128 GLY GLY B . n 
B 1 129 ILE 129 129 129 ILE ILE B . n 
B 1 130 LYS 130 130 130 LYS LYS B . n 
B 1 131 LYS 131 131 131 LYS LYS B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 VAL 134 134 134 VAL VAL B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 ILE 137 137 137 ILE ILE B . n 
B 1 138 TYR 138 138 138 TYR TYR B . n 
B 1 139 MET 139 139 139 MET MET B . n 
B 1 140 PRO 140 140 140 PRO PRO B . n 
B 1 141 MET 141 141 141 MET MET B . n 
B 1 142 VAL 142 142 142 VAL VAL B . n 
B 1 143 PRO 143 143 143 PRO PRO B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 ALA 145 145 145 ALA ALA B . n 
B 1 146 ALA 146 146 146 ALA ALA B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 ALA 148 148 148 ALA ALA B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 LEU 150 150 150 LEU LEU B . n 
B 1 151 ALA 151 151 151 ALA ALA B . n 
B 1 152 CYS 152 152 152 CYS CYS B . n 
B 1 153 ALA 153 153 153 ALA ALA B . n 
B 1 154 ARG 154 154 154 ARG ARG B . n 
B 1 155 ILE 155 155 155 ILE ILE B . n 
B 1 156 GLY 156 156 156 GLY GLY B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 VAL 158 158 158 VAL VAL B . n 
B 1 159 HIS 159 159 159 HIS HIS B . n 
B 1 160 SER 160 160 160 SER SER B . n 
B 1 161 VAL 161 161 161 VAL VAL B . n 
B 1 162 ILE 162 162 162 ILE ILE B . n 
B 1 163 PHE 163 163 163 PHE PHE B . n 
B 1 164 GLY 164 164 164 GLY GLY B . n 
B 1 165 GLY 165 165 165 GLY GLY B . n 
B 1 166 PHE 166 166 166 PHE PHE B . n 
B 1 167 SER 167 167 167 SER SER B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLU 169 169 169 GLU GLU B . n 
B 1 170 ALA 170 170 170 ALA ALA B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 GLY 173 173 173 GLY GLY B . n 
B 1 174 ARG 174 174 174 ARG ARG B . n 
B 1 175 ILE 175 175 175 ILE ILE B . n 
B 1 176 ILE 176 176 176 ILE ILE B . n 
B 1 177 ASP 177 177 177 ASP ASP B . n 
B 1 178 SER 178 178 178 SER SER B . n 
B 1 179 SER 179 179 179 SER SER B . n 
B 1 180 SER 180 180 180 SER SER B . n 
B 1 181 ARG 181 181 181 ARG ARG B . n 
B 1 182 LEU 182 182 182 LEU LEU B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 ILE 184 184 184 ILE ILE B . n 
B 1 185 THR 185 185 185 THR THR B . n 
B 1 186 ALA 186 186 186 ALA ALA B . n 
B 1 187 ASP 187 187 187 ASP ASP B . n 
B 1 188 GLU 188 188 188 GLU GLU B . n 
B 1 189 GLY 189 189 189 GLY GLY B . n 
B 1 190 VAL 190 190 190 VAL VAL B . n 
B 1 191 ARG 191 191 191 ARG ARG B . n 
B 1 192 ALA 192 192 192 ALA ALA B . n 
B 1 193 GLY 193 193 193 GLY GLY B . n 
B 1 194 ARG 194 194 194 ARG ARG B . n 
B 1 195 SER 195 195 195 SER SER B . n 
B 1 196 ILE 196 196 196 ILE ILE B . n 
B 1 197 PRO 197 197 197 PRO PRO B . n 
B 1 198 LEU 198 198 198 LEU LEU B . n 
B 1 199 LYS 199 199 199 LYS LYS B . n 
B 1 200 LYS 200 200 200 LYS LYS B . n 
B 1 201 ASN 201 201 201 ASN ASN B . n 
B 1 202 VAL 202 202 202 VAL VAL B . n 
B 1 203 ASP 203 203 203 ASP ASP B . n 
B 1 204 ASP 204 204 204 ASP ASP B . n 
B 1 205 ALA 205 205 205 ALA ALA B . n 
B 1 206 LEU 206 206 206 LEU LEU B . n 
B 1 207 LYS 207 207 207 LYS LYS B . n 
B 1 208 ASN 208 208 208 ASN ASN B . n 
B 1 209 PRO 209 209 209 PRO PRO B . n 
B 1 210 ASN 210 210 210 ASN ASN B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 THR 212 212 212 THR THR B . n 
B 1 213 SER 213 213 213 SER SER B . n 
B 1 214 VAL 214 214 214 VAL VAL B . n 
B 1 215 GLU 215 215 215 GLU GLU B . n 
B 1 216 HIS 216 216 216 HIS HIS B . n 
B 1 217 VAL 217 217 217 VAL VAL B . n 
B 1 218 ILE 218 218 218 ILE ILE B . n 
B 1 219 VAL 219 219 219 VAL VAL B . n 
B 1 220 LEU 220 220 220 LEU LEU B . n 
B 1 221 LYS 221 221 221 LYS LYS B . n 
B 1 222 ARG 222 222 222 ARG ARG B . n 
B 1 223 THR 223 223 223 THR THR B . n 
B 1 224 GLY 224 224 224 GLY GLY B . n 
B 1 225 SER 225 225 225 SER SER B . n 
B 1 226 ASP 226 226 226 ASP ASP B . n 
B 1 227 ILE 227 227 227 ILE ILE B . n 
B 1 228 ASP 228 228 228 ASP ASP B . n 
B 1 229 TRP 229 229 229 TRP TRP B . n 
B 1 230 GLN 230 230 230 GLN GLN B . n 
B 1 231 GLU 231 231 231 GLU GLU B . n 
B 1 232 GLY 232 232 232 GLY GLY B . n 
B 1 233 ARG 233 233 233 ARG ARG B . n 
B 1 234 ASP 234 234 234 ASP ASP B . n 
B 1 235 LEU 235 235 235 LEU LEU B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 TRP 237 237 237 TRP TRP B . n 
B 1 238 ARG 238 238 238 ARG ARG B . n 
B 1 239 ASP 239 239 239 ASP ASP B . n 
B 1 240 LEU 240 240 240 LEU LEU B . n 
B 1 241 ILE 241 241 241 ILE ILE B . n 
B 1 242 GLU 242 242 242 GLU GLU B . n 
B 1 243 LYS 243 243 243 LYS LYS B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 SER 245 245 245 SER SER B . n 
B 1 246 PRO 246 246 246 PRO PRO B . n 
B 1 247 GLU 247 247 247 GLU GLU B . n 
B 1 248 HIS 248 248 248 HIS HIS B . n 
B 1 249 GLN 249 249 249 GLN GLN B . n 
B 1 250 PRO 250 250 250 PRO PRO B . n 
B 1 251 GLU 251 251 251 GLU GLU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 MET 253 253 253 MET MET B . n 
B 1 254 ASN 254 254 254 ASN ASN B . n 
B 1 255 ALA 255 255 255 ALA ALA B . n 
B 1 256 GLU 256 256 256 GLU GLU B . n 
B 1 257 ASP 257 257 257 ASP ASP B . n 
B 1 258 PRO 258 258 258 PRO PRO B . n 
B 1 259 LEU 259 259 259 LEU LEU B . n 
B 1 260 PHE 260 260 260 PHE PHE B . n 
B 1 261 ILE 261 261 261 ILE ILE B . n 
B 1 262 LEU 262 262 262 LEU LEU B . n 
B 1 263 TYR 263 263 263 TYR TYR B . n 
B 1 264 THR 264 264 264 THR THR B . n 
B 1 265 SER 265 265 265 SER SER B . n 
B 1 266 GLY 266 266 266 GLY GLY B . n 
B 1 267 SER 267 267 267 SER SER B . n 
B 1 268 THR 268 268 268 THR THR B . n 
B 1 269 GLY 269 269 269 GLY GLY B . n 
B 1 270 LYS 270 270 270 LYS LYS B . n 
B 1 271 PRO 271 271 271 PRO PRO B . n 
B 1 272 LYS 272 272 272 LYS LYS B . n 
B 1 273 GLY 273 273 273 GLY GLY B . n 
B 1 274 VAL 274 274 274 VAL VAL B . n 
B 1 275 LEU 275 275 275 LEU LEU B . n 
B 1 276 HIS 276 276 276 HIS HIS B . n 
B 1 277 THR 277 277 277 THR THR B . n 
B 1 278 THR 278 278 278 THR THR B . n 
B 1 279 GLY 279 279 279 GLY GLY B . n 
B 1 280 GLY 280 280 280 GLY GLY B . n 
B 1 281 TYR 281 281 281 TYR TYR B . n 
B 1 282 LEU 282 282 282 LEU LEU B . n 
B 1 283 VAL 283 283 283 VAL VAL B . n 
B 1 284 TYR 284 284 284 TYR TYR B . n 
B 1 285 ALA 285 285 285 ALA ALA B . n 
B 1 286 ALA 286 286 286 ALA ALA B . n 
B 1 287 THR 287 287 287 THR THR B . n 
B 1 288 THR 288 288 288 THR THR B . n 
B 1 289 PHE 289 289 289 PHE PHE B . n 
B 1 290 LYS 290 290 290 LYS LYS B . n 
B 1 291 TYR 291 291 291 TYR TYR B . n 
B 1 292 VAL 292 292 292 VAL VAL B . n 
B 1 293 PHE 293 293 293 PHE PHE B . n 
B 1 294 ASP 294 294 294 ASP ASP B . n 
B 1 295 TYR 295 295 295 TYR TYR B . n 
B 1 296 HIS 296 296 296 HIS HIS B . n 
B 1 297 PRO 297 297 297 PRO PRO B . n 
B 1 298 GLY 298 298 298 GLY GLY B . n 
B 1 299 ASP 299 299 299 ASP ASP B . n 
B 1 300 ILE 300 300 300 ILE ILE B . n 
B 1 301 TYR 301 301 301 TYR TYR B . n 
B 1 302 TRP 302 302 302 TRP TRP B . n 
B 1 303 CYS 303 303 303 CYS CYS B . n 
B 1 304 THR 304 304 304 THR THR B . n 
B 1 305 ALA 305 305 305 ALA ALA B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 VAL 307 307 307 VAL VAL B . n 
B 1 308 GLY 308 308 308 GLY GLY B . n 
B 1 309 TRP 309 309 309 TRP TRP B . n 
B 1 310 VAL 310 310 310 VAL VAL B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 GLY 312 312 312 GLY GLY B . n 
B 1 313 HIS 313 313 313 HIS HIS B . n 
B 1 314 SER 314 314 314 SER SER B . n 
B 1 315 TYR 315 315 315 TYR TYR B . n 
B 1 316 LEU 316 316 316 LEU LEU B . n 
B 1 317 LEU 317 317 317 LEU LEU B . n 
B 1 318 TYR 318 318 318 TYR TYR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 PRO 320 320 320 PRO PRO B . n 
B 1 321 LEU 321 321 321 LEU LEU B . n 
B 1 322 ALA 322 322 322 ALA ALA B . n 
B 1 323 CYS 323 323 323 CYS CYS B . n 
B 1 324 GLY 324 324 324 GLY GLY B . n 
B 1 325 ALA 325 325 325 ALA ALA B . n 
B 1 326 THR 326 326 326 THR THR B . n 
B 1 327 THR 327 327 327 THR THR B . n 
B 1 328 LEU 328 328 328 LEU LEU B . n 
B 1 329 MET 329 329 329 MET MET B . n 
B 1 330 PHE 330 330 330 PHE PHE B . n 
B 1 331 GLU 331 331 331 GLU GLU B . n 
B 1 332 GLY 332 332 332 GLY GLY B . n 
B 1 333 VAL 333 333 333 VAL VAL B . n 
B 1 334 PRO 334 334 334 PRO PRO B . n 
B 1 335 ASN 335 335 335 ASN ASN B . n 
B 1 336 TRP 336 336 336 TRP TRP B . n 
B 1 337 PRO 337 337 337 PRO PRO B . n 
B 1 338 THR 338 338 338 THR THR B . n 
B 1 339 PRO 339 339 339 PRO PRO B . n 
B 1 340 ALA 340 340 340 ALA ALA B . n 
B 1 341 ARG 341 341 341 ARG ARG B . n 
B 1 342 MET 342 342 342 MET MET B . n 
B 1 343 CYS 343 343 343 CYS CYS B . n 
B 1 344 GLN 344 344 344 GLN GLN B . n 
B 1 345 VAL 345 345 345 VAL VAL B . n 
B 1 346 VAL 346 346 346 VAL VAL B . n 
B 1 347 ASP 347 347 347 ASP ASP B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 HIS 349 349 349 HIS HIS B . n 
B 1 350 GLN 350 350 350 GLN GLN B . n 
B 1 351 VAL 351 351 351 VAL VAL B . n 
B 1 352 ASN 352 352 352 ASN ASN B . n 
B 1 353 ILE 353 353 353 ILE ILE B . n 
B 1 354 LEU 354 354 354 LEU LEU B . n 
B 1 355 TYR 355 355 355 TYR TYR B . n 
B 1 356 THR 356 356 356 THR THR B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 PRO 358 358 358 PRO PRO B . n 
B 1 359 THR 359 359 359 THR THR B . n 
B 1 360 ALA 360 360 360 ALA ALA B . n 
B 1 361 ILE 361 361 361 ILE ILE B . n 
B 1 362 ARG 362 362 362 ARG ARG B . n 
B 1 363 ALA 363 363 363 ALA ALA B . n 
B 1 364 LEU 364 364 364 LEU LEU B . n 
B 1 365 MET 365 365 365 MET MET B . n 
B 1 366 ALA 366 366 366 ALA ALA B . n 
B 1 367 GLU 367 367 367 GLU GLU B . n 
B 1 368 GLY 368 368 368 GLY GLY B . n 
B 1 369 ASP 369 369 369 ASP ASP B . n 
B 1 370 LYS 370 370 370 LYS LYS B . n 
B 1 371 ALA 371 371 371 ALA ALA B . n 
B 1 372 ILE 372 372 372 ILE ILE B . n 
B 1 373 GLU 373 373 373 GLU GLU B . n 
B 1 374 GLY 374 374 374 GLY GLY B . n 
B 1 375 THR 375 375 375 THR THR B . n 
B 1 376 ASP 376 376 376 ASP ASP B . n 
B 1 377 ARG 377 377 377 ARG ARG B . n 
B 1 378 SER 378 378 378 SER SER B . n 
B 1 379 SER 379 379 379 SER SER B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 ARG 381 381 381 ARG ARG B . n 
B 1 382 ILE 382 382 382 ILE ILE B . n 
B 1 383 LEU 383 383 383 LEU LEU B . n 
B 1 384 GLY 384 384 384 GLY GLY B . n 
B 1 385 SER 385 385 385 SER SER B . n 
B 1 386 VAL 386 386 386 VAL VAL B . n 
B 1 387 GLY 387 387 387 GLY GLY B . n 
B 1 388 GLU 388 388 388 GLU GLU B . n 
B 1 389 PRO 389 389 389 PRO PRO B . n 
B 1 390 ILE 390 390 390 ILE ILE B . n 
B 1 391 ASN 391 391 391 ASN ASN B . n 
B 1 392 PRO 392 392 392 PRO PRO B . n 
B 1 393 GLU 393 393 393 GLU GLU B . n 
B 1 394 ALA 394 394 394 ALA ALA B . n 
B 1 395 TRP 395 395 395 TRP TRP B . n 
B 1 396 GLU 396 396 396 GLU GLU B . n 
B 1 397 TRP 397 397 397 TRP TRP B . n 
B 1 398 TYR 398 398 398 TYR TYR B . n 
B 1 399 TRP 399 399 399 TRP TRP B . n 
B 1 400 LYS 400 400 400 LYS LYS B . n 
B 1 401 LYS 401 401 401 LYS LYS B . n 
B 1 402 ILE 402 402 402 ILE ILE B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 LYS 404 404 404 LYS LYS B . n 
B 1 405 GLU 405 405 405 GLU GLU B . n 
B 1 406 LYS 406 406 406 LYS LYS B . n 
B 1 407 CYS 407 407 407 CYS CYS B . n 
B 1 408 PRO 408 408 408 PRO PRO B . n 
B 1 409 VAL 409 409 409 VAL VAL B . n 
B 1 410 VAL 410 410 410 VAL VAL B . n 
B 1 411 ASP 411 411 411 ASP ASP B . n 
B 1 412 THR 412 412 412 THR THR B . n 
B 1 413 TRP 413 413 413 TRP TRP B . n 
B 1 414 TRP 414 414 414 TRP TRP B . n 
B 1 415 GLN 415 415 415 GLN GLN B . n 
B 1 416 THR 416 416 416 THR THR B . n 
B 1 417 GLU 417 417 417 GLU GLU B . n 
B 1 418 THR 418 418 418 THR THR B . n 
B 1 419 GLY 419 419 419 GLY GLY B . n 
B 1 420 GLY 420 420 420 GLY GLY B . n 
B 1 421 PHE 421 421 421 PHE PHE B . n 
B 1 422 MET 422 422 422 MET MET B . n 
B 1 423 ILE 423 423 423 ILE ILE B . n 
B 1 424 THR 424 424 424 THR THR B . n 
B 1 425 PRO 425 425 425 PRO PRO B . n 
B 1 426 LEU 426 426 426 LEU LEU B . n 
B 1 427 PRO 427 427 427 PRO PRO B . n 
B 1 428 GLY 428 428 428 GLY GLY B . n 
B 1 429 ALA 429 429 429 ALA ALA B . n 
B 1 430 ILE 430 430 430 ILE ILE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 LEU 432 432 432 LEU LEU B . n 
B 1 433 LYS 433 433 433 LYS LYS B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 GLY 435 435 435 GLY GLY B . n 
B 1 436 SER 436 436 436 SER SER B . n 
B 1 437 ALA 437 437 437 ALA ALA B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 ARG 439 439 439 ARG ARG B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 PHE 441 441 441 PHE PHE B . n 
B 1 442 PHE 442 442 442 PHE PHE B . n 
B 1 443 GLY 443 443 443 GLY GLY B . n 
B 1 444 VAL 444 444 444 VAL VAL B . n 
B 1 445 GLN 445 445 445 GLN GLN B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 ALA 447 447 447 ALA ALA B . n 
B 1 448 LEU 448 448 448 LEU LEU B . n 
B 1 449 VAL 449 449 449 VAL VAL B . n 
B 1 450 ASP 450 450 450 ASP ASP B . n 
B 1 451 ASN 451 451 451 ASN ASN B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 GLY 453 453 453 GLY GLY B . n 
B 1 454 HIS 454 454 454 HIS HIS B . n 
B 1 455 PRO 455 455 455 PRO PRO B . n 
B 1 456 GLN 456 456 456 GLN GLN B . n 
B 1 457 GLU 457 457 457 GLU GLU B . n 
B 1 458 GLY 458 458 458 GLY GLY B . n 
B 1 459 ALA 459 459 459 ALA ALA B . n 
B 1 460 THR 460 460 460 THR THR B . n 
B 1 461 GLU 461 461 461 GLU GLU B . n 
B 1 462 GLY 462 462 462 GLY GLY B . n 
B 1 463 ASN 463 463 463 ASN ASN B . n 
B 1 464 LEU 464 464 464 LEU LEU B . n 
B 1 465 VAL 465 465 465 VAL VAL B . n 
B 1 466 ILE 466 466 466 ILE ILE B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 ASP 468 468 468 ASP ASP B . n 
B 1 469 SER 469 469 469 SER SER B . n 
B 1 470 TRP 470 470 470 TRP TRP B . n 
B 1 471 PRO 471 471 471 PRO PRO B . n 
B 1 472 GLY 472 472 472 GLY GLY B . n 
B 1 473 GLN 473 473 473 GLN GLN B . n 
B 1 474 ALA 474 474 474 ALA ALA B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 THR 476 476 476 THR THR B . n 
B 1 477 LEU 477 477 477 LEU LEU B . n 
B 1 478 PHE 478 478 478 PHE PHE B . n 
B 1 479 GLY 479 479 479 GLY GLY B . n 
B 1 480 ASP 480 480 480 ASP ASP B . n 
B 1 481 HIS 481 481 481 HIS HIS B . n 
B 1 482 GLU 482 482 482 GLU GLU B . n 
B 1 483 ARG 483 483 483 ARG ARG B . n 
B 1 484 PHE 484 484 484 PHE PHE B . n 
B 1 485 GLU 485 485 485 GLU GLU B . n 
B 1 486 GLN 486 486 486 GLN GLN B . n 
B 1 487 THR 487 487 487 THR THR B . n 
B 1 488 TYR 488 488 488 TYR TYR B . n 
B 1 489 PHE 489 489 489 PHE PHE B . n 
B 1 490 SER 490 490 490 SER SER B . n 
B 1 491 THR 491 491 491 THR THR B . n 
B 1 492 PHE 492 492 492 PHE PHE B . n 
B 1 493 LYS 493 493 493 LYS LYS B . n 
B 1 494 ASN 494 494 494 ASN ASN B . n 
B 1 495 MET 495 495 495 MET MET B . n 
B 1 496 TYR 496 496 496 TYR TYR B . n 
B 1 497 PHE 497 497 497 PHE PHE B . n 
B 1 498 SER 498 498 498 SER SER B . n 
B 1 499 GLY 499 499 499 GLY GLY B . n 
B 1 500 ASP 500 500 500 ASP ASP B . n 
B 1 501 GLY 501 501 501 GLY GLY B . n 
B 1 502 ALA 502 502 502 ALA ALA B . n 
B 1 503 ARG 503 503 503 ARG ARG B . n 
B 1 504 ARG 504 504 504 ARG ARG B . n 
B 1 505 ASP 505 505 505 ASP ASP B . n 
B 1 506 GLU 506 506 506 GLU GLU B . n 
B 1 507 ASP