data_2P4E
# 
_entry.id   2P4E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2P4E         
RCSB  RCSB041951   
WWPDB D_1000041951 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2P4E 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cunningham, D.'  1 
'Danley, D.E.'    2 
'Geoghegan, F.K.' 3 
'Griffor, M.C.'   4 
'Hawkins, J.L.'   5 
'Qiu, X.'         6 
# 
_citation.id                        primary 
_citation.title                     
'Structural and biophysical studies of PCSK9 and its mutants linked to familial hypercholesterolemia.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            14 
_citation.page_first                413 
_citation.page_last                 419 
_citation.year                      2007 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17435765 
_citation.pdbx_database_id_DOI      10.1038/nsmb1235 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cunningham, D.'         1  
primary 'Danley, D.E.'           2  
primary 'Geoghegan, K.F.'        3  
primary 'Griffor, M.C.'          4  
primary 'Hawkins, J.L.'          5  
primary 'Subashi, T.A.'          6  
primary 'Varghese, A.H.'         7  
primary 'Ammirati, M.J.'         8  
primary 'Culp, J.S.'             9  
primary 'Hoth, L.R.'             10 
primary 'Mansour, M.N.'          11 
primary 'McGrath, K.M.'          12 
primary 'Seddon, A.P.'           13 
primary 'Shenolikar, S.'         14 
primary 'Stutzman-Engwall, K.J.' 15 
primary 'Warren, L.C.'           16 
primary 'Xia, D.'                17 
primary 'Qiu, X.'                18 
# 
_cell.entry_id           2P4E 
_cell.length_a           62.810 
_cell.length_b           70.670 
_cell.length_c           150.020 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2P4E 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Proprotein convertase subtilisin/kexin type 9' 74461.289 2   3.4.21.- ? ? ? 
2 non-polymer syn 'MERCURY (II) ION'                              200.590   2   ?        ? ? ? 
3 water       nat water                                           18.015    371 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Proprotein convertase PC9, Subtilisin/kexin-like protease PC9, Neural apoptosis-regulated convertase 1, NARC-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVV
VLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLER
ITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAG
VAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRD
DACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMML
SAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAIARCAPD
EELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLT
GCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPG
TSHVLGAYAVDNTCVVRSRDVSTTGSTSEEAVTAVAICCRSRHLAQASQELQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVV
VLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLER
ITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAG
VAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRD
DACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMML
SAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAIARCAPD
EELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLT
GCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPG
TSHVLGAYAVDNTCVVRSRDVSTTGSTSEEAVTAVAICCRSRHLAQASQELQ
;
_entity_poly.pdbx_strand_id                 P,A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   THR n 
1 4   VAL n 
1 5   SER n 
1 6   SER n 
1 7   ARG n 
1 8   ARG n 
1 9   SER n 
1 10  TRP n 
1 11  TRP n 
1 12  PRO n 
1 13  LEU n 
1 14  PRO n 
1 15  LEU n 
1 16  LEU n 
1 17  LEU n 
1 18  LEU n 
1 19  LEU n 
1 20  LEU n 
1 21  LEU n 
1 22  LEU n 
1 23  LEU n 
1 24  GLY n 
1 25  PRO n 
1 26  ALA n 
1 27  GLY n 
1 28  ALA n 
1 29  ARG n 
1 30  ALA n 
1 31  GLN n 
1 32  GLU n 
1 33  ASP n 
1 34  GLU n 
1 35  ASP n 
1 36  GLY n 
1 37  ASP n 
1 38  TYR n 
1 39  GLU n 
1 40  GLU n 
1 41  LEU n 
1 42  VAL n 
1 43  LEU n 
1 44  ALA n 
1 45  LEU n 
1 46  ARG n 
1 47  SER n 
1 48  GLU n 
1 49  GLU n 
1 50  ASP n 
1 51  GLY n 
1 52  LEU n 
1 53  ALA n 
1 54  GLU n 
1 55  ALA n 
1 56  PRO n 
1 57  GLU n 
1 58  HIS n 
1 59  GLY n 
1 60  THR n 
1 61  THR n 
1 62  ALA n 
1 63  THR n 
1 64  PHE n 
1 65  HIS n 
1 66  ARG n 
1 67  CYS n 
1 68  ALA n 
1 69  LYS n 
1 70  ASP n 
1 71  PRO n 
1 72  TRP n 
1 73  ARG n 
1 74  LEU n 
1 75  PRO n 
1 76  GLY n 
1 77  THR n 
1 78  TYR n 
1 79  VAL n 
1 80  VAL n 
1 81  VAL n 
1 82  LEU n 
1 83  LYS n 
1 84  GLU n 
1 85  GLU n 
1 86  THR n 
1 87  HIS n 
1 88  LEU n 
1 89  SER n 
1 90  GLN n 
1 91  SER n 
1 92  GLU n 
1 93  ARG n 
1 94  THR n 
1 95  ALA n 
1 96  ARG n 
1 97  ARG n 
1 98  LEU n 
1 99  GLN n 
1 100 ALA n 
1 101 GLN n 
1 102 ALA n 
1 103 ALA n 
1 104 ARG n 
1 105 ARG n 
1 106 GLY n 
1 107 TYR n 
1 108 LEU n 
1 109 THR n 
1 110 LYS n 
1 111 ILE n 
1 112 LEU n 
1 113 HIS n 
1 114 VAL n 
1 115 PHE n 
1 116 HIS n 
1 117 GLY n 
1 118 LEU n 
1 119 LEU n 
1 120 PRO n 
1 121 GLY n 
1 122 PHE n 
1 123 LEU n 
1 124 VAL n 
1 125 LYS n 
1 126 MET n 
1 127 SER n 
1 128 GLY n 
1 129 ASP n 
1 130 LEU n 
1 131 LEU n 
1 132 GLU n 
1 133 LEU n 
1 134 ALA n 
1 135 LEU n 
1 136 LYS n 
1 137 LEU n 
1 138 PRO n 
1 139 HIS n 
1 140 VAL n 
1 141 ASP n 
1 142 TYR n 
1 143 ILE n 
1 144 GLU n 
1 145 GLU n 
1 146 ASP n 
1 147 SER n 
1 148 SER n 
1 149 VAL n 
1 150 PHE n 
1 151 ALA n 
1 152 GLN n 
1 153 SER n 
1 154 ILE n 
1 155 PRO n 
1 156 TRP n 
1 157 ASN n 
1 158 LEU n 
1 159 GLU n 
1 160 ARG n 
1 161 ILE n 
1 162 THR n 
1 163 PRO n 
1 164 PRO n 
1 165 ARG n 
1 166 TYR n 
1 167 ARG n 
1 168 ALA n 
1 169 ASP n 
1 170 GLU n 
1 171 TYR n 
1 172 GLN n 
1 173 PRO n 
1 174 PRO n 
1 175 ASP n 
1 176 GLY n 
1 177 GLY n 
1 178 SER n 
1 179 LEU n 
1 180 VAL n 
1 181 GLU n 
1 182 VAL n 
1 183 TYR n 
1 184 LEU n 
1 185 LEU n 
1 186 ASP n 
1 187 THR n 
1 188 SER n 
1 189 ILE n 
1 190 GLN n 
1 191 SER n 
1 192 ASP n 
1 193 HIS n 
1 194 ARG n 
1 195 GLU n 
1 196 ILE n 
1 197 GLU n 
1 198 GLY n 
1 199 ARG n 
1 200 VAL n 
1 201 MET n 
1 202 VAL n 
1 203 THR n 
1 204 ASP n 
1 205 PHE n 
1 206 GLU n 
1 207 ASN n 
1 208 VAL n 
1 209 PRO n 
1 210 GLU n 
1 211 GLU n 
1 212 ASP n 
1 213 GLY n 
1 214 THR n 
1 215 ARG n 
1 216 PHE n 
1 217 HIS n 
1 218 ARG n 
1 219 GLN n 
1 220 ALA n 
1 221 SER n 
1 222 LYS n 
1 223 CYS n 
1 224 ASP n 
1 225 SER n 
1 226 HIS n 
1 227 GLY n 
1 228 THR n 
1 229 HIS n 
1 230 LEU n 
1 231 ALA n 
1 232 GLY n 
1 233 VAL n 
1 234 VAL n 
1 235 SER n 
1 236 GLY n 
1 237 ARG n 
1 238 ASP n 
1 239 ALA n 
1 240 GLY n 
1 241 VAL n 
1 242 ALA n 
1 243 LYS n 
1 244 GLY n 
1 245 ALA n 
1 246 SER n 
1 247 MET n 
1 248 ARG n 
1 249 SER n 
1 250 LEU n 
1 251 ARG n 
1 252 VAL n 
1 253 LEU n 
1 254 ASN n 
1 255 CYS n 
1 256 GLN n 
1 257 GLY n 
1 258 LYS n 
1 259 GLY n 
1 260 THR n 
1 261 VAL n 
1 262 SER n 
1 263 GLY n 
1 264 THR n 
1 265 LEU n 
1 266 ILE n 
1 267 GLY n 
1 268 LEU n 
1 269 GLU n 
1 270 PHE n 
1 271 ILE n 
1 272 ARG n 
1 273 LYS n 
1 274 SER n 
1 275 GLN n 
1 276 LEU n 
1 277 VAL n 
1 278 GLN n 
1 279 PRO n 
1 280 VAL n 
1 281 GLY n 
1 282 PRO n 
1 283 LEU n 
1 284 VAL n 
1 285 VAL n 
1 286 LEU n 
1 287 LEU n 
1 288 PRO n 
1 289 LEU n 
1 290 ALA n 
1 291 GLY n 
1 292 GLY n 
1 293 TYR n 
1 294 SER n 
1 295 ARG n 
1 296 VAL n 
1 297 LEU n 
1 298 ASN n 
1 299 ALA n 
1 300 ALA n 
1 301 CYS n 
1 302 GLN n 
1 303 ARG n 
1 304 LEU n 
1 305 ALA n 
1 306 ARG n 
1 307 ALA n 
1 308 GLY n 
1 309 VAL n 
1 310 VAL n 
1 311 LEU n 
1 312 VAL n 
1 313 THR n 
1 314 ALA n 
1 315 ALA n 
1 316 GLY n 
1 317 ASN n 
1 318 PHE n 
1 319 ARG n 
1 320 ASP n 
1 321 ASP n 
1 322 ALA n 
1 323 CYS n 
1 324 LEU n 
1 325 TYR n 
1 326 SER n 
1 327 PRO n 
1 328 ALA n 
1 329 SER n 
1 330 ALA n 
1 331 PRO n 
1 332 GLU n 
1 333 VAL n 
1 334 ILE n 
1 335 THR n 
1 336 VAL n 
1 337 GLY n 
1 338 ALA n 
1 339 THR n 
1 340 ASN n 
1 341 ALA n 
1 342 GLN n 
1 343 ASP n 
1 344 GLN n 
1 345 PRO n 
1 346 VAL n 
1 347 THR n 
1 348 LEU n 
1 349 GLY n 
1 350 THR n 
1 351 LEU n 
1 352 GLY n 
1 353 THR n 
1 354 ASN n 
1 355 PHE n 
1 356 GLY n 
1 357 ARG n 
1 358 CYS n 
1 359 VAL n 
1 360 ASP n 
1 361 LEU n 
1 362 PHE n 
1 363 ALA n 
1 364 PRO n 
1 365 GLY n 
1 366 GLU n 
1 367 ASP n 
1 368 ILE n 
1 369 ILE n 
1 370 GLY n 
1 371 ALA n 
1 372 SER n 
1 373 SER n 
1 374 ASP n 
1 375 CYS n 
1 376 SER n 
1 377 THR n 
1 378 CYS n 
1 379 PHE n 
1 380 VAL n 
1 381 SER n 
1 382 GLN n 
1 383 SER n 
1 384 GLY n 
1 385 THR n 
1 386 SER n 
1 387 GLN n 
1 388 ALA n 
1 389 ALA n 
1 390 ALA n 
1 391 HIS n 
1 392 VAL n 
1 393 ALA n 
1 394 GLY n 
1 395 ILE n 
1 396 ALA n 
1 397 ALA n 
1 398 MET n 
1 399 MET n 
1 400 LEU n 
1 401 SER n 
1 402 ALA n 
1 403 GLU n 
1 404 PRO n 
1 405 GLU n 
1 406 LEU n 
1 407 THR n 
1 408 LEU n 
1 409 ALA n 
1 410 GLU n 
1 411 LEU n 
1 412 ARG n 
1 413 GLN n 
1 414 ARG n 
1 415 LEU n 
1 416 ILE n 
1 417 HIS n 
1 418 PHE n 
1 419 SER n 
1 420 ALA n 
1 421 LYS n 
1 422 ASP n 
1 423 VAL n 
1 424 ILE n 
1 425 ASN n 
1 426 GLU n 
1 427 ALA n 
1 428 TRP n 
1 429 PHE n 
1 430 PRO n 
1 431 GLU n 
1 432 ASP n 
1 433 GLN n 
1 434 ARG n 
1 435 VAL n 
1 436 LEU n 
1 437 THR n 
1 438 PRO n 
1 439 ASN n 
1 440 LEU n 
1 441 VAL n 
1 442 ALA n 
1 443 ALA n 
1 444 LEU n 
1 445 PRO n 
1 446 PRO n 
1 447 SER n 
1 448 THR n 
1 449 HIS n 
1 450 GLY n 
1 451 ALA n 
1 452 GLY n 
1 453 TRP n 
1 454 GLN n 
1 455 LEU n 
1 456 PHE n 
1 457 CYS n 
1 458 ARG n 
1 459 THR n 
1 460 VAL n 
1 461 TRP n 
1 462 SER n 
1 463 ALA n 
1 464 HIS n 
1 465 SER n 
1 466 GLY n 
1 467 PRO n 
1 468 THR n 
1 469 ARG n 
1 470 MET n 
1 471 ALA n 
1 472 THR n 
1 473 ALA n 
1 474 ILE n 
1 475 ALA n 
1 476 ARG n 
1 477 CYS n 
1 478 ALA n 
1 479 PRO n 
1 480 ASP n 
1 481 GLU n 
1 482 GLU n 
1 483 LEU n 
1 484 LEU n 
1 485 SER n 
1 486 CYS n 
1 487 SER n 
1 488 SER n 
1 489 PHE n 
1 490 SER n 
1 491 ARG n 
1 492 SER n 
1 493 GLY n 
1 494 LYS n 
1 495 ARG n 
1 496 ARG n 
1 497 GLY n 
1 498 GLU n 
1 499 ARG n 
1 500 MET n 
1 501 GLU n 
1 502 ALA n 
1 503 GLN n 
1 504 GLY n 
1 505 GLY n 
1 506 LYS n 
1 507 LEU n 
1 508 VAL n 
1 509 CYS n 
1 510 ARG n 
1 511 ALA n 
1 512 HIS n 
1 513 ASN n 
1 514 ALA n 
1 515 PHE n 
1 516 GLY n 
1 517 GLY n 
1 518 GLU n 
1 519 GLY n 
1 520 VAL n 
1 521 TYR n 
1 522 ALA n 
1 523 ILE n 
1 524 ALA n 
1 525 ARG n 
1 526 CYS n 
1 527 CYS n 
1 528 LEU n 
1 529 LEU n 
1 530 PRO n 
1 531 GLN n 
1 532 ALA n 
1 533 ASN n 
1 534 CYS n 
1 535 SER n 
1 536 VAL n 
1 537 HIS n 
1 538 THR n 
1 539 ALA n 
1 540 PRO n 
1 541 PRO n 
1 542 ALA n 
1 543 GLU n 
1 544 ALA n 
1 545 SER n 
1 546 MET n 
1 547 GLY n 
1 548 THR n 
1 549 ARG n 
1 550 VAL n 
1 551 HIS n 
1 552 CYS n 
1 553 HIS n 
1 554 GLN n 
1 555 GLN n 
1 556 GLY n 
1 557 HIS n 
1 558 VAL n 
1 559 LEU n 
1 560 THR n 
1 561 GLY n 
1 562 CYS n 
1 563 SER n 
1 564 SER n 
1 565 HIS n 
1 566 TRP n 
1 567 GLU n 
1 568 VAL n 
1 569 GLU n 
1 570 ASP n 
1 571 LEU n 
1 572 GLY n 
1 573 THR n 
1 574 HIS n 
1 575 LYS n 
1 576 PRO n 
1 577 PRO n 
1 578 VAL n 
1 579 LEU n 
1 580 ARG n 
1 581 PRO n 
1 582 ARG n 
1 583 GLY n 
1 584 GLN n 
1 585 PRO n 
1 586 ASN n 
1 587 GLN n 
1 588 CYS n 
1 589 VAL n 
1 590 GLY n 
1 591 HIS n 
1 592 ARG n 
1 593 GLU n 
1 594 ALA n 
1 595 SER n 
1 596 ILE n 
1 597 HIS n 
1 598 ALA n 
1 599 SER n 
1 600 CYS n 
1 601 CYS n 
1 602 HIS n 
1 603 ALA n 
1 604 PRO n 
1 605 GLY n 
1 606 LEU n 
1 607 GLU n 
1 608 CYS n 
1 609 LYS n 
1 610 VAL n 
1 611 LYS n 
1 612 GLU n 
1 613 HIS n 
1 614 GLY n 
1 615 ILE n 
1 616 PRO n 
1 617 ALA n 
1 618 PRO n 
1 619 GLN n 
1 620 GLU n 
1 621 GLN n 
1 622 VAL n 
1 623 THR n 
1 624 VAL n 
1 625 ALA n 
1 626 CYS n 
1 627 GLU n 
1 628 GLU n 
1 629 GLY n 
1 630 TRP n 
1 631 THR n 
1 632 LEU n 
1 633 THR n 
1 634 GLY n 
1 635 CYS n 
1 636 SER n 
1 637 ALA n 
1 638 LEU n 
1 639 PRO n 
1 640 GLY n 
1 641 THR n 
1 642 SER n 
1 643 HIS n 
1 644 VAL n 
1 645 LEU n 
1 646 GLY n 
1 647 ALA n 
1 648 TYR n 
1 649 ALA n 
1 650 VAL n 
1 651 ASP n 
1 652 ASN n 
1 653 THR n 
1 654 CYS n 
1 655 VAL n 
1 656 VAL n 
1 657 ARG n 
1 658 SER n 
1 659 ARG n 
1 660 ASP n 
1 661 VAL n 
1 662 SER n 
1 663 THR n 
1 664 THR n 
1 665 GLY n 
1 666 SER n 
1 667 THR n 
1 668 SER n 
1 669 GLU n 
1 670 GLU n 
1 671 ALA n 
1 672 VAL n 
1 673 THR n 
1 674 ALA n 
1 675 VAL n 
1 676 ALA n 
1 677 ILE n 
1 678 CYS n 
1 679 CYS n 
1 680 ARG n 
1 681 SER n 
1 682 ARG n 
1 683 HIS n 
1 684 LEU n 
1 685 ALA n 
1 686 GLN n 
1 687 ALA n 
1 688 SER n 
1 689 GLN n 
1 690 GLU n 
1 691 LEU n 
1 692 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'PCSK9, NARC1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'Chinese hamster' 
_entity_src_gen.pdbx_host_org_scientific_name      'Cricetulus griseus' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     Cricetulus 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PCSK9 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PCSK9_HUMAN 
_struct_ref.pdbx_db_accession          Q8NBP7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVV
VLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLER
ITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAG
VAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRD
DACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMML
SAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAIARCAPD
EELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLT
GCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPG
TSHVLGAYAVDNTCVVRSRDVSTTGSTSEEAVTAVAICCRSRHLAQASQELQ
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2P4E P 1 ? 692 ? Q8NBP7 1 ? 692 ? 1 692 
2 1 2P4E A 1 ? 692 ? Q8NBP7 1 ? 692 ? 1 692 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'    ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE           ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE            ? 'C2 H5 N O2'     75.067  
HG  non-polymer         . 'MERCURY (II) ION' ? 'Hg 2'           200.590 
HIS 'L-peptide linking' y HISTIDINE          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER              ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE         ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE             ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2P4E 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    '25% PEG 1500, 50 mM Tris-HCl buffer, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 300K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2006-04-01 
_diffrn_detector.details                mirros 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    mirror 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     2P4E 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   2 
_reflns.d_resolution_high            1.98 
_reflns.d_resolution_low             75 
_reflns.number_all                   48000 
_reflns.number_obs                   46285 
_reflns.percent_possible_obs         97.9 
_reflns.pdbx_Rmerge_I_obs            0.115 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.98 
_reflns_shell.d_res_low              2.05 
_reflns_shell.percent_possible_all   84.4 
_reflns_shell.Rmerge_I_obs           0.57 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2 
_reflns_shell.pdbx_redundancy        4.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2P4E 
_refine.ls_d_res_high                            1.98 
_refine.ls_d_res_low                             75 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     43933 
_refine.ls_number_reflns_obs                     43933 
_refine.ls_number_reflns_R_free                  2339 
_refine.ls_percent_reflns_obs                    97.9 
_refine.ls_R_factor_all                          0.202 
_refine.ls_R_factor_obs                          0.202 
_refine.ls_R_factor_R_work                       0.200 
_refine.ls_R_factor_R_free                       0.250 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1IC6 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             'individual isotropic' 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2P4E 
_refine_analyze.Luzzati_coordinate_error_obs    0.18 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4398 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             371 
_refine_hist.number_atoms_total               4771 
_refine_hist.d_res_high                       1.98 
_refine_hist.d_res_low                        75 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_d   0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2P4E 
_struct.title                     'Crystal Structure of PCSK9' 
_struct.pdbx_descriptor           'Proprotein convertase subtilisin/kexin type 9 (E.C.3.4.21.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2P4E 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'protease, subtilisin, LDL receptor, LDL, endocytosis, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 69  ? PRO A 71  ? LYS P 69  PRO P 71  5 ? 3  
HELX_P HELX_P2  2  HIS A 87  ? ARG A 105 ? HIS P 87  ARG P 105 1 ? 19 
HELX_P HELX_P3  3  SER A 127 ? ASP A 129 ? SER P 127 ASP P 129 5 ? 3  
HELX_P HELX_P4  4  LEU A 130 ? LYS A 136 ? LEU P 130 LYS P 136 1 ? 7  
HELX_P HELX_P5  5  PRO B 155 ? ILE B 161 ? PRO A 155 ILE A 161 1 ? 7  
HELX_P HELX_P6  6  GLN B 219 ? ASP B 224 ? GLN A 219 ASP A 224 1 ? 6  
HELX_P HELX_P7  7  ASP B 224 ? GLY B 236 ? ASP A 224 GLY A 236 1 ? 13 
HELX_P HELX_P8  8  VAL B 261 ? GLN B 278 ? VAL A 261 GLN A 278 1 ? 18 
HELX_P HELX_P9  9  SER B 294 ? ALA B 307 ? SER A 294 ALA A 307 1 ? 14 
HELX_P HELX_P10 10 ASP B 321 ? CYS B 323 ? ASP A 321 CYS A 323 5 ? 3  
HELX_P HELX_P11 11 GLY B 384 ? GLU B 403 ? GLY A 384 GLU A 403 1 ? 20 
HELX_P HELX_P12 12 THR B 407 ? SER B 419 ? THR A 407 SER A 419 1 ? 13 
HELX_P HELX_P13 13 ASN B 425 ? PHE B 429 ? ASN A 425 PHE A 429 5 ? 5  
HELX_P HELX_P14 14 PRO B 430 ? ARG B 434 ? PRO A 430 ARG A 434 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? B CYS 223 SG ? ? ? 1_555 B CYS 255 SG ? ? A CYS 223 A CYS 255 1_555 ? ? ? ? ? ? ? 2.076 ? 
disulf2  disulf ? ? B CYS 323 SG ? ? ? 1_555 B CYS 358 SG ? ? A CYS 323 A CYS 358 1_555 ? ? ? ? ? ? ? 2.107 ? 
disulf3  disulf ? ? B CYS 375 SG ? ? ? 1_555 B CYS 378 SG ? ? A CYS 375 A CYS 378 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf4  disulf ? ? B CYS 457 SG ? ? ? 1_555 B CYS 527 SG ? ? A CYS 457 A CYS 527 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf5  disulf ? ? B CYS 477 SG ? ? ? 1_555 B CYS 526 SG ? ? A CYS 477 A CYS 526 1_555 ? ? ? ? ? ? ? 2.052 ? 
disulf6  disulf ? ? B CYS 486 SG ? ? ? 1_555 B CYS 509 SG ? ? A CYS 486 A CYS 509 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf7  disulf ? ? B CYS 534 SG ? ? ? 1_555 B CYS 601 SG ? ? A CYS 534 A CYS 601 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf8  disulf ? ? B CYS 552 SG ? ? ? 1_555 B CYS 600 SG ? ? A CYS 552 A CYS 600 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf9  disulf ? ? B CYS 562 SG ? ? ? 1_555 B CYS 588 SG ? ? A CYS 562 A CYS 588 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf10 disulf ? ? B CYS 608 SG ? ? ? 1_555 B CYS 679 SG ? ? A CYS 608 A CYS 679 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf11 disulf ? ? B CYS 626 SG ? ? ? 1_555 B CYS 678 SG ? ? A CYS 626 A CYS 678 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf12 disulf ? ? B CYS 635 SG ? ? ? 1_555 B CYS 654 SG ? ? A CYS 635 A CYS 654 1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc1  metalc ? ? C HG  .   HG ? ? ? 1_555 F HOH .   O  ? ? P HG  693 A HOH 876 1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc2  metalc ? ? C HG  .   HG ? ? ? 1_555 F HOH .   O  ? ? P HG  693 A HOH 768 1_555 ? ? ? ? ? ? ? 2.120 ? 
metalc3  metalc ? ? D HG  .   HG ? ? ? 1_555 F HOH .   O  ? ? P HG  694 A HOH 876 1_555 ? ? ? ? ? ? ? 1.751 ? 
metalc4  metalc ? ? C HG  .   HG ? ? ? 1_555 A SER 147 OG ? ? P HG  693 P SER 147 1_555 ? ? ? ? ? ? ? 3.204 ? 
metalc5  metalc ? ? C HG  .   HG ? ? ? 1_555 D HG  .   HG ? ? P HG  693 P HG  694 1_555 ? ? ? ? ? ? ? 1.870 ? 
metalc6  metalc ? ? C HG  .   HG ? ? ? 1_555 A CYS 67  N  ? ? P HG  693 P CYS 67  1_555 ? ? ? ? ? ? ? 3.346 ? 
metalc7  metalc ? ? C HG  .   HG ? ? ? 1_555 A CYS 67  SG ? ? P HG  693 P CYS 67  1_555 ? ? ? ? ? ? ? 3.305 ? 
metalc8  metalc ? ? C HG  .   HG ? ? ? 1_555 B TYR 293 O  ? ? P HG  693 A TYR 293 1_555 ? ? ? ? ? ? ? 3.326 ? 
metalc9  metalc ? ? D HG  .   HG ? ? ? 1_555 E HOH .   O  ? ? P HG  694 P HOH 723 1_555 ? ? ? ? ? ? ? 2.956 ? 
metalc10 metalc ? ? D HG  .   HG ? ? ? 1_555 A CYS 67  SG ? ? P HG  694 P CYS 67  1_555 ? ? ? ? ? ? ? 2.219 ? 
metalc11 metalc ? ? D HG  .   HG ? ? ? 1_555 A SER 147 OG ? ? P HG  694 P SER 147 1_555 ? ? ? ? ? ? ? 2.920 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           326 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            326 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    327 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     327 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.14 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 6 ? 
C ? 7 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 3 ? 
H ? 3 ? 
I ? 3 ? 
J ? 2 ? 
K ? 3 ? 
L ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 63  ? HIS A 65  ? THR P 63  HIS P 65  
A 2 VAL A 140 ? ALA A 151 ? VAL P 140 ALA P 151 
A 3 LYS B 258 ? THR B 260 ? LYS A 258 THR A 260 
B 1 LYS A 110 ? PHE A 115 ? LYS P 110 PHE P 115 
B 2 GLY A 121 ? LYS A 125 ? GLY P 121 LYS P 125 
B 3 ARG A 73  ? LEU A 82  ? ARG P 73  LEU P 82  
B 4 VAL A 140 ? ALA A 151 ? VAL P 140 ALA P 151 
B 5 LEU B 289 ? GLY B 292 ? LEU A 289 GLY A 292 
B 6 TYR B 325 ? SER B 326 ? TYR A 325 SER A 326 
C 1 VAL B 200 ? GLU B 206 ? VAL A 200 GLU A 206 
C 2 SER B 246 ? ARG B 251 ? SER A 246 ARG A 251 
C 3 GLU B 181 ? ASP B 186 ? GLU A 181 ASP A 186 
C 4 LEU B 283 ? LEU B 287 ? LEU A 283 LEU A 287 
C 5 VAL B 310 ? ALA B 314 ? VAL A 310 ALA A 314 
C 6 ILE B 334 ? THR B 339 ? ILE A 334 THR A 339 
C 7 LEU B 361 ? PRO B 364 ? LEU A 361 PRO A 364 
D 1 THR B 347 ? LEU B 348 ? THR A 347 LEU A 348 
D 2 LEU B 351 ? GLY B 352 ? LEU A 351 GLY A 352 
E 1 ILE B 368 ? ALA B 371 ? ILE A 368 ALA A 371 
E 2 PHE B 379 ? GLN B 382 ? PHE A 379 GLN A 382 
F 1 ALA B 420 ? LYS B 421 ? ALA A 420 LYS A 421 
F 2 LEU B 440 ? VAL B 441 ? LEU A 440 VAL A 441 
G 1 PHE B 456 ? TRP B 461 ? PHE A 456 TRP A 461 
G 2 TYR B 521 ? LEU B 528 ? TYR A 521 LEU A 528 
G 3 GLU B 482 ? PHE B 489 ? GLU A 482 PHE A 489 
H 1 THR B 472 ? ALA B 475 ? THR A 472 ALA A 475 
H 2 LEU B 507 ? ASN B 513 ? LEU A 507 ASN A 513 
H 3 ARG B 495 ? ALA B 502 ? ARG A 495 ALA A 502 
I 1 ASN B 533 ? ALA B 539 ? ASN A 533 ALA A 539 
I 2 SER B 595 ? HIS B 602 ? SER A 595 HIS A 602 
I 3 HIS B 557 ? HIS B 565 ? HIS A 557 HIS A 565 
J 1 THR B 548 ? HIS B 551 ? THR A 548 HIS A 551 
J 2 GLN B 587 ? GLY B 590 ? GLN A 587 GLY A 590 
K 1 LEU B 606 ? PRO B 616 ? LEU A 606 PRO A 616 
K 2 ALA B 671 ? SER B 681 ? ALA A 671 SER A 681 
K 3 THR B 631 ? ALA B 637 ? THR A 631 ALA A 637 
L 1 GLN B 621 ? ALA B 625 ? GLN A 621 ALA A 625 
L 2 THR B 653 ? SER B 658 ? THR A 653 SER A 658 
L 3 VAL B 644 ? VAL B 650 ? VAL A 644 VAL A 650 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS A 65  ? N HIS P 65  O GLU A 145 ? O GLU P 145 
A 2 3 N VAL A 149 ? N VAL P 149 O GLY B 259 ? O GLY A 259 
B 1 2 N LYS A 110 ? N LYS P 110 O LYS A 125 ? O LYS P 125 
B 2 3 O PHE A 122 ? O PHE P 122 N VAL A 80  ? N VAL P 80  
B 3 4 N VAL A 81  ? N VAL P 81  O ASP A 141 ? O ASP P 141 
B 4 5 N PHE A 150 ? N PHE P 150 O ALA B 290 ? O ALA A 290 
B 5 6 N GLY B 291 ? N GLY A 291 O SER B 326 ? O SER A 326 
C 1 2 N PHE B 205 ? N PHE A 205 O ARG B 251 ? O ARG A 251 
C 2 3 O LEU B 250 ? O LEU A 250 N LEU B 184 ? N LEU A 184 
C 3 4 N TYR B 183 ? N TYR A 183 O VAL B 284 ? O VAL A 284 
C 4 5 N VAL B 285 ? N VAL A 285 O VAL B 310 ? O VAL A 310 
C 5 6 N THR B 313 ? N THR A 313 O ILE B 334 ? O ILE A 334 
C 6 7 N GLY B 337 ? N GLY A 337 O LEU B 361 ? O LEU A 361 
D 1 2 N LEU B 348 ? N LEU A 348 O LEU B 351 ? O LEU A 351 
E 1 2 N ILE B 368 ? N ILE A 368 O GLN B 382 ? O GLN A 382 
F 1 2 N ALA B 420 ? N ALA A 420 O VAL B 441 ? O VAL A 441 
G 1 2 N VAL B 460 ? N VAL A 460 O ALA B 524 ? O ALA A 524 
G 2 3 O CYS B 527 ? O CYS A 527 N GLU B 482 ? N GLU A 482 
H 1 2 N ALA B 473 ? N ALA A 473 O ALA B 511 ? O ALA A 511 
H 2 3 O VAL B 508 ? O VAL A 508 N GLU B 501 ? N GLU A 501 
I 1 2 N ASN B 533 ? N ASN A 533 O HIS B 602 ? O HIS A 602 
I 2 3 O SER B 595 ? O SER A 595 N HIS B 565 ? N HIS A 565 
J 1 2 N VAL B 550 ? N VAL A 550 O CYS B 588 ? O CYS A 588 
K 1 2 N HIS B 613 ? N HIS A 613 O ALA B 674 ? O ALA A 674 
K 2 3 O ILE B 677 ? O ILE A 677 N THR B 633 ? N THR A 633 
L 1 2 N VAL B 622 ? N VAL A 622 O VAL B 656 ? O VAL A 656 
L 2 3 O ARG B 657 ? O ARG A 657 N LEU B 645 ? N LEU A 645 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE HG P 693' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE HG P 694' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 TYR B 293 ? TYR A 293 . ? 1_555 ? 
2  AC1 6 HOH F .   ? HOH A 768 . ? 1_555 ? 
3  AC1 6 HOH F .   ? HOH A 876 . ? 1_555 ? 
4  AC1 6 CYS A 67  ? CYS P 67  . ? 1_555 ? 
5  AC1 6 SER A 147 ? SER P 147 . ? 1_555 ? 
6  AC1 6 HG  D .   ? HG  P 694 . ? 1_555 ? 
7  AC2 6 GLY B 292 ? GLY A 292 . ? 1_555 ? 
8  AC2 6 HOH F .   ? HOH A 876 . ? 1_555 ? 
9  AC2 6 CYS A 67  ? CYS P 67  . ? 1_555 ? 
10 AC2 6 SER A 147 ? SER P 147 . ? 1_555 ? 
11 AC2 6 HG  C .   ? HG  P 693 . ? 1_555 ? 
12 AC2 6 HOH E .   ? HOH P 723 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2P4E 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2P4E 
_atom_sites.fract_transf_matrix[1][1]   0.015921 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014150 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006666 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
HG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . THR A 1 61  ? 46.612 26.973 50.793 1.00 39.45 ? 61  THR P N   1 
ATOM   2    C  CA  . THR A 1 61  ? 45.757 28.057 51.379 1.00 38.66 ? 61  THR P CA  1 
ATOM   3    C  C   . THR A 1 61  ? 44.445 28.329 50.585 1.00 36.57 ? 61  THR P C   1 
ATOM   4    O  O   . THR A 1 61  ? 44.446 28.700 49.412 1.00 36.14 ? 61  THR P O   1 
ATOM   5    C  CB  . THR A 1 61  ? 46.580 29.340 51.672 1.00 39.99 ? 61  THR P CB  1 
ATOM   6    O  OG1 . THR A 1 61  ? 45.840 30.199 52.556 1.00 41.98 ? 61  THR P OG1 1 
ATOM   7    C  CG2 . THR A 1 61  ? 46.957 30.082 50.380 1.00 41.03 ? 61  THR P CG2 1 
ATOM   8    N  N   . ALA A 1 62  ? 43.334 28.107 51.270 1.00 34.08 ? 62  ALA P N   1 
ATOM   9    C  CA  . ALA A 1 62  ? 42.021 28.002 50.663 1.00 31.77 ? 62  ALA P CA  1 
ATOM   10   C  C   . ALA A 1 62  ? 41.440 29.362 50.276 1.00 30.32 ? 62  ALA P C   1 
ATOM   11   O  O   . ALA A 1 62  ? 41.657 30.359 50.961 1.00 29.62 ? 62  ALA P O   1 
ATOM   12   C  CB  . ALA A 1 62  ? 41.101 27.304 51.623 1.00 31.37 ? 62  ALA P CB  1 
ATOM   13   N  N   . THR A 1 63  ? 40.674 29.379 49.190 1.00 28.83 ? 63  THR P N   1 
ATOM   14   C  CA  . THR A 1 63  ? 40.080 30.618 48.661 1.00 26.97 ? 63  THR P CA  1 
ATOM   15   C  C   . THR A 1 63  ? 38.546 30.556 48.662 1.00 26.02 ? 63  THR P C   1 
ATOM   16   O  O   . THR A 1 63  ? 37.973 29.460 48.701 1.00 25.48 ? 63  THR P O   1 
ATOM   17   C  CB  . THR A 1 63  ? 40.616 30.893 47.238 1.00 26.74 ? 63  THR P CB  1 
ATOM   18   O  OG1 . THR A 1 63  ? 40.448 29.717 46.436 1.00 26.50 ? 63  THR P OG1 1 
ATOM   19   C  CG2 . THR A 1 63  ? 42.118 31.234 47.300 1.00 27.34 ? 63  THR P CG2 1 
ATOM   20   N  N   . PHE A 1 64  ? 37.906 31.732 48.613 1.00 24.29 ? 64  PHE P N   1 
ATOM   21   C  CA  . PHE A 1 64  ? 36.465 31.888 48.584 1.00 23.56 ? 64  PHE P CA  1 
ATOM   22   C  C   . PHE A 1 64  ? 35.981 32.506 47.264 1.00 23.42 ? 64  PHE P C   1 
ATOM   23   O  O   . PHE A 1 64  ? 36.643 33.379 46.691 1.00 23.28 ? 64  PHE P O   1 
ATOM   24   C  CB  . PHE A 1 64  ? 35.992 32.761 49.765 1.00 23.22 ? 64  PHE P CB  1 
ATOM   25   C  CG  . PHE A 1 64  ? 34.514 33.015 49.778 1.00 23.82 ? 64  PHE P CG  1 
ATOM   26   C  CD1 . PHE A 1 64  ? 33.602 31.947 49.823 1.00 22.50 ? 64  PHE P CD1 1 
ATOM   27   C  CD2 . PHE A 1 64  ? 34.007 34.329 49.750 1.00 24.85 ? 64  PHE P CD2 1 
ATOM   28   C  CE1 . PHE A 1 64  ? 32.218 32.169 49.836 1.00 22.42 ? 64  PHE P CE1 1 
ATOM   29   C  CE2 . PHE A 1 64  ? 32.603 34.566 49.758 1.00 23.10 ? 64  PHE P CE2 1 
ATOM   30   C  CZ  . PHE A 1 64  ? 31.711 33.494 49.813 1.00 22.65 ? 64  PHE P CZ  1 
ATOM   31   N  N   . HIS A 1 65  ? 34.832 32.046 46.774 1.00 22.42 ? 65  HIS P N   1 
ATOM   32   C  CA  . HIS A 1 65  ? 34.330 32.479 45.483 1.00 22.58 ? 65  HIS P CA  1 
ATOM   33   C  C   . HIS A 1 65  ? 32.825 32.610 45.557 1.00 22.48 ? 65  HIS P C   1 
ATOM   34   O  O   . HIS A 1 65  ? 32.154 31.752 46.134 1.00 23.14 ? 65  HIS P O   1 
ATOM   35   C  CB  . HIS A 1 65  ? 34.690 31.466 44.375 1.00 22.22 ? 65  HIS P CB  1 
ATOM   36   C  CG  . HIS A 1 65  ? 36.146 31.110 44.333 1.00 24.20 ? 65  HIS P CG  1 
ATOM   37   N  ND1 . HIS A 1 65  ? 36.674 30.053 45.048 1.00 24.49 ? 65  HIS P ND1 1 
ATOM   38   C  CD2 . HIS A 1 65  ? 37.188 31.681 43.682 1.00 22.43 ? 65  HIS P CD2 1 
ATOM   39   C  CE1 . HIS A 1 65  ? 37.975 29.977 44.822 1.00 23.73 ? 65  HIS P CE1 1 
ATOM   40   N  NE2 . HIS A 1 65  ? 38.316 30.958 44.008 1.00 25.79 ? 65  HIS P NE2 1 
ATOM   41   N  N   . ARG A 1 66  ? 32.292 33.692 44.998 1.00 22.38 ? 66  ARG P N   1 
ATOM   42   C  CA  . ARG A 1 66  ? 30.844 33.825 44.837 1.00 22.93 ? 66  ARG P CA  1 
ATOM   43   C  C   . ARG A 1 66  ? 30.517 34.436 43.489 1.00 24.02 ? 66  ARG P C   1 
ATOM   44   O  O   . ARG A 1 66  ? 31.382 35.013 42.826 1.00 23.24 ? 66  ARG P O   1 
ATOM   45   C  CB  . ARG A 1 66  ? 30.205 34.610 45.980 1.00 23.78 ? 66  ARG P CB  1 
ATOM   46   C  CG  . ARG A 1 66  ? 30.558 36.069 46.010 1.00 23.11 ? 66  ARG P CG  1 
ATOM   47   C  CD  . ARG A 1 66  ? 30.128 36.620 47.335 1.00 26.61 ? 66  ARG P CD  1 
ATOM   48   N  NE  . ARG A 1 66  ? 30.197 38.062 47.336 1.00 29.31 ? 66  ARG P NE  1 
ATOM   49   C  CZ  . ARG A 1 66  ? 30.092 38.805 48.427 1.00 30.69 ? 66  ARG P CZ  1 
ATOM   50   N  NH1 . ARG A 1 66  ? 29.956 38.232 49.618 1.00 31.84 ? 66  ARG P NH1 1 
ATOM   51   N  NH2 . ARG A 1 66  ? 30.161 40.108 48.317 1.00 32.65 ? 66  ARG P NH2 1 
ATOM   52   N  N   . CYS A 1 67  ? 29.267 34.268 43.078 1.00 25.53 ? 67  CYS P N   1 
ATOM   53   C  CA  . CYS A 1 67  ? 28.818 34.704 41.767 1.00 26.41 ? 67  CYS P CA  1 
ATOM   54   C  C   . CYS A 1 67  ? 29.039 36.191 41.613 1.00 26.26 ? 67  CYS P C   1 
ATOM   55   O  O   . CYS A 1 67  ? 28.710 36.961 42.511 1.00 25.83 ? 67  CYS P O   1 
ATOM   56   C  CB  . CYS A 1 67  ? 27.329 34.386 41.596 1.00 26.86 ? 67  CYS P CB  1 
ATOM   57   S  SG  . CYS A 1 67  ? 26.883 34.221 39.885 1.00 29.13 ? 67  CYS P SG  1 
ATOM   58   N  N   . ALA A 1 68  ? 29.621 36.583 40.489 1.00 27.55 ? 68  ALA P N   1 
ATOM   59   C  CA  . ALA A 1 68  ? 29.797 37.998 40.184 1.00 29.36 ? 68  ALA P CA  1 
ATOM   60   C  C   . ALA A 1 68  ? 28.485 38.657 39.785 1.00 30.07 ? 68  ALA P C   1 
ATOM   61   O  O   . ALA A 1 68  ? 28.353 39.881 39.875 1.00 31.27 ? 68  ALA P O   1 
ATOM   62   C  CB  . ALA A 1 68  ? 30.839 38.185 39.090 1.00 28.76 ? 68  ALA P CB  1 
ATOM   63   N  N   . LYS A 1 69  ? 27.535 37.850 39.311 1.00 30.40 ? 69  LYS P N   1 
ATOM   64   C  CA  . LYS A 1 69  ? 26.199 38.329 38.975 1.00 30.65 ? 69  LYS P CA  1 
ATOM   65   C  C   . LYS A 1 69  ? 25.370 38.302 40.261 1.00 30.76 ? 69  LYS P C   1 
ATOM   66   O  O   . LYS A 1 69  ? 24.818 37.262 40.671 1.00 29.94 ? 69  LYS P O   1 
ATOM   67   C  CB  . LYS A 1 69  ? 25.606 37.532 37.788 1.00 30.96 ? 69  LYS P CB  1 
ATOM   68   C  CG  . LYS A 1 69  ? 26.396 37.816 36.488 1.00 31.85 ? 69  LYS P CG  1 
ATOM   69   C  CD  . LYS A 1 69  ? 25.980 37.001 35.254 1.00 31.42 ? 69  LYS P CD  1 
ATOM   70   C  CE  A LYS A 1 69  ? 26.826 37.369 34.023 0.50 32.07 ? 69  LYS P CE  1 
ATOM   71   C  CE  B LYS A 1 69  ? 27.002 37.141 34.108 0.50 31.84 ? 69  LYS P CE  1 
ATOM   72   N  NZ  A LYS A 1 69  ? 26.598 38.758 33.528 0.50 31.44 ? 69  LYS P NZ  1 
ATOM   73   N  NZ  B LYS A 1 69  ? 28.151 36.175 34.185 0.50 29.99 ? 69  LYS P NZ  1 
ATOM   74   N  N   . ASP A 1 70  ? 25.342 39.454 40.931 1.00 30.84 ? 70  ASP P N   1 
ATOM   75   C  CA  . ASP A 1 70  ? 24.778 39.554 42.291 1.00 31.79 ? 70  ASP P CA  1 
ATOM   76   C  C   . ASP A 1 70  ? 23.335 39.055 42.443 1.00 30.81 ? 70  ASP P C   1 
ATOM   77   O  O   . ASP A 1 70  ? 23.016 38.425 43.442 1.00 30.47 ? 70  ASP P O   1 
ATOM   78   C  CB  . ASP A 1 70  ? 24.924 40.977 42.847 1.00 32.65 ? 70  ASP P CB  1 
ATOM   79   C  CG  . ASP A 1 70  ? 25.034 41.009 44.371 1.00 35.66 ? 70  ASP P CG  1 
ATOM   80   O  OD1 . ASP A 1 70  ? 26.080 40.584 44.928 1.00 39.16 ? 70  ASP P OD1 1 
ATOM   81   O  OD2 . ASP A 1 70  ? 24.084 41.487 45.014 1.00 38.20 ? 70  ASP P OD2 1 
ATOM   82   N  N   . PRO A 1 71  ? 22.445 39.339 41.470 1.00 30.34 ? 71  PRO P N   1 
ATOM   83   C  CA  . PRO A 1 71  ? 21.097 38.738 41.585 1.00 29.50 ? 71  PRO P CA  1 
ATOM   84   C  C   . PRO A 1 71  ? 21.063 37.203 41.495 1.00 29.04 ? 71  PRO P C   1 
ATOM   85   O  O   . PRO A 1 71  ? 20.023 36.603 41.766 1.00 29.06 ? 71  PRO P O   1 
ATOM   86   C  CB  . PRO A 1 71  ? 20.351 39.305 40.370 1.00 29.65 ? 71  PRO P CB  1 
ATOM   87   C  CG  . PRO A 1 71  ? 21.139 40.520 39.959 1.00 30.69 ? 71  PRO P CG  1 
ATOM   88   C  CD  . PRO A 1 71  ? 22.561 40.210 40.288 1.00 30.33 ? 71  PRO P CD  1 
ATOM   89   N  N   . TRP A 1 72  ? 22.161 36.569 41.077 1.00 27.62 ? 72  TRP P N   1 
ATOM   90   C  CA  . TRP A 1 72  ? 22.164 35.097 40.946 1.00 26.97 ? 72  TRP P CA  1 
ATOM   91   C  C   . TRP A 1 72  ? 22.758 34.371 42.148 1.00 26.88 ? 72  TRP P C   1 
ATOM   92   O  O   . TRP A 1 72  ? 22.748 33.133 42.210 1.00 25.83 ? 72  TRP P O   1 
ATOM   93   C  CB  . TRP A 1 72  ? 22.869 34.659 39.668 1.00 27.31 ? 72  TRP P CB  1 
ATOM   94   C  CG  . TRP A 1 72  ? 22.165 35.070 38.418 1.00 26.65 ? 72  TRP P CG  1 
ATOM   95   C  CD1 . TRP A 1 72  ? 20.943 35.668 38.319 1.00 28.88 ? 72  TRP P CD1 1 
ATOM   96   C  CD2 . TRP A 1 72  ? 22.613 34.848 37.076 1.00 27.47 ? 72  TRP P CD2 1 
ATOM   97   N  NE1 . TRP A 1 72  ? 20.613 35.860 36.995 1.00 29.88 ? 72  TRP P NE1 1 
ATOM   98   C  CE2 . TRP A 1 72  ? 21.620 35.364 36.211 1.00 28.93 ? 72  TRP P CE2 1 
ATOM   99   C  CE3 . TRP A 1 72  ? 23.764 34.280 36.522 1.00 26.61 ? 72  TRP P CE3 1 
ATOM   100  C  CZ2 . TRP A 1 72  ? 21.740 35.324 34.816 1.00 28.90 ? 72  TRP P CZ2 1 
ATOM   101  C  CZ3 . TRP A 1 72  ? 23.882 34.234 35.131 1.00 30.43 ? 72  TRP P CZ3 1 
ATOM   102  C  CH2 . TRP A 1 72  ? 22.876 34.761 34.297 1.00 28.55 ? 72  TRP P CH2 1 
ATOM   103  N  N   . ARG A 1 73  ? 23.293 35.138 43.096 1.00 25.85 ? 73  ARG P N   1 
ATOM   104  C  CA  . ARG A 1 73  ? 23.847 34.549 44.303 1.00 25.66 ? 73  ARG P CA  1 
ATOM   105  C  C   . ARG A 1 73  ? 22.752 33.996 45.184 1.00 26.38 ? 73  ARG P C   1 
ATOM   106  O  O   . ARG A 1 73  ? 21.627 34.517 45.175 1.00 25.76 ? 73  ARG P O   1 
ATOM   107  C  CB  . ARG A 1 73  ? 24.620 35.582 45.100 1.00 25.58 ? 73  ARG P CB  1 
ATOM   108  C  CG  . ARG A 1 73  ? 25.855 36.125 44.409 1.00 23.26 ? 73  ARG P CG  1 
ATOM   109  C  CD  . ARG A 1 73  ? 26.475 37.260 45.256 1.00 27.35 ? 73  ARG P CD  1 
ATOM   110  N  NE  . ARG A 1 73  ? 26.554 36.860 46.663 1.00 27.08 ? 73  ARG P NE  1 
ATOM   111  C  CZ  . ARG A 1 73  ? 26.518 37.706 47.697 1.00 30.26 ? 73  ARG P CZ  1 
ATOM   112  N  NH1 . ARG A 1 73  ? 26.389 39.016 47.492 1.00 27.51 ? 73  ARG P NH1 1 
ATOM   113  N  NH2 . ARG A 1 73  ? 26.598 37.240 48.944 1.00 26.59 ? 73  ARG P NH2 1 
ATOM   114  N  N   . LEU A 1 74  ? 23.109 32.968 45.962 1.00 25.99 ? 74  LEU P N   1 
ATOM   115  C  CA  . LEU A 1 74  ? 22.246 32.364 46.969 1.00 26.67 ? 74  LEU P CA  1 
ATOM   116  C  C   . LEU A 1 74  ? 22.998 32.268 48.304 1.00 27.74 ? 74  LEU P C   1 
ATOM   117  O  O   . LEU A 1 74  ? 23.407 31.181 48.727 1.00 27.75 ? 74  LEU P O   1 
ATOM   118  C  CB  . LEU A 1 74  ? 21.767 30.970 46.523 1.00 26.60 ? 74  LEU P CB  1 
ATOM   119  C  CG  . LEU A 1 74  ? 20.883 30.878 45.273 1.00 27.24 ? 74  LEU P CG  1 
ATOM   120  C  CD1 . LEU A 1 74  ? 20.710 29.424 44.880 1.00 27.73 ? 74  LEU P CD1 1 
ATOM   121  C  CD2 . LEU A 1 74  ? 19.485 31.580 45.445 1.00 28.85 ? 74  LEU P CD2 1 
ATOM   122  N  N   . PRO A 1 75  ? 23.179 33.412 48.988 1.00 28.37 ? 75  PRO P N   1 
ATOM   123  C  CA  . PRO A 1 75  ? 23.966 33.358 50.221 1.00 28.86 ? 75  PRO P CA  1 
ATOM   124  C  C   . PRO A 1 75  ? 23.307 32.485 51.306 1.00 28.97 ? 75  PRO P C   1 
ATOM   125  O  O   . PRO A 1 75  ? 22.101 32.247 51.277 1.00 28.69 ? 75  PRO P O   1 
ATOM   126  C  CB  . PRO A 1 75  ? 24.046 34.820 50.663 1.00 28.89 ? 75  PRO P CB  1 
ATOM   127  C  CG  . PRO A 1 75  ? 22.952 35.536 49.935 1.00 29.55 ? 75  PRO P CG  1 
ATOM   128  C  CD  . PRO A 1 75  ? 22.678 34.768 48.685 1.00 28.99 ? 75  PRO P CD  1 
ATOM   129  N  N   . GLY A 1 76  ? 24.114 31.987 52.230 1.00 28.40 ? 76  GLY P N   1 
ATOM   130  C  CA  . GLY A 1 76  ? 23.593 31.164 53.307 1.00 28.29 ? 76  GLY P CA  1 
ATOM   131  C  C   . GLY A 1 76  ? 23.803 29.676 53.085 1.00 27.14 ? 76  GLY P C   1 
ATOM   132  O  O   . GLY A 1 76  ? 23.647 28.901 54.011 1.00 26.82 ? 76  GLY P O   1 
ATOM   133  N  N   . THR A 1 77  ? 24.148 29.283 51.858 1.00 26.83 ? 77  THR P N   1 
ATOM   134  C  CA  . THR A 1 77  ? 24.537 27.901 51.569 1.00 25.57 ? 77  THR P CA  1 
ATOM   135  C  C   . THR A 1 77  ? 25.870 27.875 50.822 1.00 25.14 ? 77  THR P C   1 
ATOM   136  O  O   . THR A 1 77  ? 26.037 28.575 49.816 1.00 24.90 ? 77  THR P O   1 
ATOM   137  C  CB  . THR A 1 77  ? 23.447 27.175 50.743 1.00 25.86 ? 77  THR P CB  1 
ATOM   138  O  OG1 . THR A 1 77  ? 22.214 27.206 51.460 1.00 27.83 ? 77  THR P OG1 1 
ATOM   139  C  CG2 . THR A 1 77  ? 23.799 25.698 50.547 1.00 26.90 ? 77  THR P CG2 1 
ATOM   140  N  N   . TYR A 1 78  ? 26.806 27.046 51.285 1.00 23.81 ? 78  TYR P N   1 
ATOM   141  C  CA  . TYR A 1 78  ? 28.154 26.991 50.714 1.00 23.77 ? 78  TYR P CA  1 
ATOM   142  C  C   . TYR A 1 78  ? 28.629 25.595 50.347 1.00 23.11 ? 78  TYR P C   1 
ATOM   143  O  O   . TYR A 1 78  ? 28.426 24.646 51.109 1.00 23.09 ? 78  TYR P O   1 
ATOM   144  C  CB  . TYR A 1 78  ? 29.145 27.601 51.706 1.00 24.61 ? 78  TYR P CB  1 
ATOM   145  C  CG  . TYR A 1 78  ? 28.810 29.015 52.035 1.00 26.48 ? 78  TYR P CG  1 
ATOM   146  C  CD1 . TYR A 1 78  ? 29.305 30.054 51.250 1.00 26.76 ? 78  TYR P CD1 1 
ATOM   147  C  CD2 . TYR A 1 78  ? 27.965 29.328 53.100 1.00 27.67 ? 78  TYR P CD2 1 
ATOM   148  C  CE1 . TYR A 1 78  ? 29.000 31.367 51.527 1.00 28.97 ? 78  TYR P CE1 1 
ATOM   149  C  CE2 . TYR A 1 78  ? 27.641 30.671 53.382 1.00 29.30 ? 78  TYR P CE2 1 
ATOM   150  C  CZ  . TYR A 1 78  ? 28.180 31.677 52.581 1.00 28.48 ? 78  TYR P CZ  1 
ATOM   151  O  OH  . TYR A 1 78  ? 27.905 33.013 52.807 1.00 31.28 ? 78  TYR P OH  1 
ATOM   152  N  N   . VAL A 1 79  ? 29.256 25.470 49.184 1.00 22.43 ? 79  VAL P N   1 
ATOM   153  C  CA  . VAL A 1 79  ? 29.940 24.232 48.815 1.00 22.55 ? 79  VAL P CA  1 
ATOM   154  C  C   . VAL A 1 79  ? 31.406 24.271 49.281 1.00 22.94 ? 79  VAL P C   1 
ATOM   155  O  O   . VAL A 1 79  ? 32.207 25.080 48.791 1.00 23.12 ? 79  VAL P O   1 
ATOM   156  C  CB  . VAL A 1 79  ? 29.826 23.921 47.279 1.00 22.91 ? 79  VAL P CB  1 
ATOM   157  C  CG1 . VAL A 1 79  ? 30.640 22.697 46.927 1.00 22.06 ? 79  VAL P CG1 1 
ATOM   158  C  CG2 . VAL A 1 79  ? 28.393 23.655 46.893 1.00 21.52 ? 79  VAL P CG2 1 
ATOM   159  N  N   . VAL A 1 80  ? 31.756 23.414 50.238 1.00 22.39 ? 80  VAL P N   1 
ATOM   160  C  CA  . VAL A 1 80  ? 33.144 23.309 50.685 1.00 22.17 ? 80  VAL P CA  1 
ATOM   161  C  C   . VAL A 1 80  ? 33.817 22.214 49.880 1.00 22.87 ? 80  VAL P C   1 
ATOM   162  O  O   . VAL A 1 80  ? 33.409 21.037 49.966 1.00 23.55 ? 80  VAL P O   1 
ATOM   163  C  CB  . VAL A 1 80  ? 33.232 22.995 52.177 1.00 22.53 ? 80  VAL P CB  1 
ATOM   164  C  CG1 . VAL A 1 80  ? 34.699 22.992 52.656 1.00 21.73 ? 80  VAL P CG1 1 
ATOM   165  C  CG2 . VAL A 1 80  ? 32.383 24.003 52.973 1.00 22.58 ? 80  VAL P CG2 1 
ATOM   166  N  N   . VAL A 1 81  ? 34.824 22.597 49.094 1.00 22.74 ? 81  VAL P N   1 
ATOM   167  C  CA  . VAL A 1 81  ? 35.568 21.664 48.247 1.00 23.37 ? 81  VAL P CA  1 
ATOM   168  C  C   . VAL A 1 81  ? 36.909 21.340 48.876 1.00 24.47 ? 81  VAL P C   1 
ATOM   169  O  O   . VAL A 1 81  ? 37.704 22.236 49.180 1.00 23.93 ? 81  VAL P O   1 
ATOM   170  C  CB  . VAL A 1 81  ? 35.737 22.166 46.792 1.00 23.65 ? 81  VAL P CB  1 
ATOM   171  C  CG1 . VAL A 1 81  ? 36.440 21.113 45.925 1.00 23.59 ? 81  VAL P CG1 1 
ATOM   172  C  CG2 . VAL A 1 81  ? 34.363 22.520 46.186 1.00 22.54 ? 81  VAL P CG2 1 
ATOM   173  N  N   . LEU A 1 82  ? 37.131 20.043 49.104 1.00 23.95 ? 82  LEU P N   1 
ATOM   174  C  CA  . LEU A 1 82  ? 38.326 19.565 49.747 1.00 24.56 ? 82  LEU P CA  1 
ATOM   175  C  C   . LEU A 1 82  ? 39.327 19.158 48.683 1.00 25.67 ? 82  LEU P C   1 
ATOM   176  O  O   . LEU A 1 82  ? 38.969 19.009 47.511 1.00 24.65 ? 82  LEU P O   1 
ATOM   177  C  CB  . LEU A 1 82  ? 37.981 18.401 50.703 1.00 25.06 ? 82  LEU P CB  1 
ATOM   178  C  CG  . LEU A 1 82  ? 36.939 18.722 51.795 1.00 24.23 ? 82  LEU P CG  1 
ATOM   179  C  CD1 . LEU A 1 82  ? 36.764 17.575 52.794 1.00 24.61 ? 82  LEU P CD1 1 
ATOM   180  C  CD2 . LEU A 1 82  ? 37.305 19.997 52.555 1.00 25.33 ? 82  LEU P CD2 1 
ATOM   181  N  N   . LYS A 1 83  ? 40.588 18.997 49.076 1.00 27.53 ? 83  LYS P N   1 
ATOM   182  C  CA  . LYS A 1 83  ? 41.648 18.658 48.129 1.00 29.89 ? 83  LYS P CA  1 
ATOM   183  C  C   . LYS A 1 83  ? 41.415 17.302 47.464 1.00 31.37 ? 83  LYS P C   1 
ATOM   184  O  O   . LYS A 1 83  ? 40.868 16.396 48.076 1.00 30.90 ? 83  LYS P O   1 
ATOM   185  C  CB  . LYS A 1 83  ? 43.011 18.697 48.808 1.00 30.16 ? 83  LYS P CB  1 
ATOM   186  C  CG  . LYS A 1 83  ? 43.503 20.116 49.083 1.00 32.51 ? 83  LYS P CG  1 
ATOM   187  C  CD  . LYS A 1 83  ? 44.624 20.085 50.117 1.00 36.03 ? 83  LYS P CD  1 
ATOM   188  C  CE  . LYS A 1 83  ? 45.151 21.468 50.403 1.00 39.73 ? 83  LYS P CE  1 
ATOM   189  N  NZ  . LYS A 1 83  ? 44.206 22.178 51.306 1.00 42.22 ? 83  LYS P NZ  1 
ATOM   190  N  N   . GLU A 1 84  ? 41.850 17.197 46.215 1.00 33.56 ? 84  GLU P N   1 
ATOM   191  C  CA  . GLU A 1 84  ? 41.532 16.098 45.293 1.00 36.27 ? 84  GLU P CA  1 
ATOM   192  C  C   . GLU A 1 84  ? 41.514 14.684 45.913 1.00 35.92 ? 84  GLU P C   1 
ATOM   193  O  O   . GLU A 1 84  ? 40.598 13.897 45.669 1.00 37.10 ? 84  GLU P O   1 
ATOM   194  C  CB  . GLU A 1 84  ? 42.535 16.155 44.138 1.00 36.27 ? 84  GLU P CB  1 
ATOM   195  C  CG  . GLU A 1 84  ? 42.157 15.384 42.881 1.00 39.10 ? 84  GLU P CG  1 
ATOM   196  C  CD  . GLU A 1 84  ? 43.381 14.971 42.042 1.00 40.72 ? 84  GLU P CD  1 
ATOM   197  O  OE1 . GLU A 1 84  ? 44.523 15.386 42.381 1.00 46.19 ? 84  GLU P OE1 1 
ATOM   198  O  OE2 . GLU A 1 84  ? 43.195 14.233 41.031 1.00 46.18 ? 84  GLU P OE2 1 
ATOM   199  N  N   . GLU A 1 85  ? 42.513 14.365 46.715 1.00 35.94 ? 85  GLU P N   1 
ATOM   200  C  CA  . GLU A 1 85  ? 42.632 12.997 47.240 1.00 35.80 ? 85  GLU P CA  1 
ATOM   201  C  C   . GLU A 1 85  ? 41.949 12.748 48.601 1.00 33.86 ? 85  GLU P C   1 
ATOM   202  O  O   . GLU A 1 85  ? 42.063 11.658 49.174 1.00 33.89 ? 85  GLU P O   1 
ATOM   203  C  CB  . GLU A 1 85  ? 44.108 12.576 47.245 1.00 36.61 ? 85  GLU P CB  1 
ATOM   204  C  CG  . GLU A 1 85  ? 44.673 12.418 45.808 1.00 40.76 ? 85  GLU P CG  1 
ATOM   205  C  CD  . GLU A 1 85  ? 46.153 12.781 45.675 1.00 45.68 ? 85  GLU P CD  1 
ATOM   206  O  OE1 . GLU A 1 85  ? 46.573 13.867 46.158 1.00 47.61 ? 85  GLU P OE1 1 
ATOM   207  O  OE2 . GLU A 1 85  ? 46.897 11.975 45.062 1.00 47.92 ? 85  GLU P OE2 1 
ATOM   208  N  N   . THR A 1 86  ? 41.205 13.736 49.097 1.00 31.03 ? 86  THR P N   1 
ATOM   209  C  CA  . THR A 1 86  ? 40.532 13.591 50.385 1.00 28.47 ? 86  THR P CA  1 
ATOM   210  C  C   . THR A 1 86  ? 39.512 12.435 50.334 1.00 28.07 ? 86  THR P C   1 
ATOM   211  O  O   . THR A 1 86  ? 38.719 12.313 49.382 1.00 27.61 ? 86  THR P O   1 
ATOM   212  C  CB  . THR A 1 86  ? 39.883 14.932 50.828 1.00 28.51 ? 86  THR P CB  1 
ATOM   213  O  OG1 . THR A 1 86  ? 40.831 15.992 50.640 1.00 24.62 ? 86  THR P OG1 1 
ATOM   214  C  CG2 . THR A 1 86  ? 39.462 14.897 52.271 1.00 27.55 ? 86  THR P CG2 1 
ATOM   215  N  N   . HIS A 1 87  ? 39.542 11.593 51.368 1.00 26.85 ? 87  HIS P N   1 
ATOM   216  C  CA  . HIS A 1 87  ? 38.683 10.420 51.442 1.00 26.03 ? 87  HIS P CA  1 
ATOM   217  C  C   . HIS A 1 87  ? 37.339 10.832 52.027 1.00 25.29 ? 87  HIS P C   1 
ATOM   218  O  O   . HIS A 1 87  ? 37.274 11.741 52.849 1.00 25.22 ? 87  HIS P O   1 
ATOM   219  C  CB  . HIS A 1 87  ? 39.324 9.311  52.323 1.00 26.08 ? 87  HIS P CB  1 
ATOM   220  C  CG  . HIS A 1 87  ? 38.575 8.011  52.286 1.00 27.78 ? 87  HIS P CG  1 
ATOM   221  N  ND1 . HIS A 1 87  ? 37.591 7.689  53.201 1.00 29.38 ? 87  HIS P ND1 1 
ATOM   222  C  CD2 . HIS A 1 87  ? 38.640 6.966  51.422 1.00 29.10 ? 87  HIS P CD2 1 
ATOM   223  C  CE1 . HIS A 1 87  ? 37.088 6.502  52.913 1.00 29.08 ? 87  HIS P CE1 1 
ATOM   224  N  NE2 . HIS A 1 87  ? 37.707 6.040  51.836 1.00 29.98 ? 87  HIS P NE2 1 
ATOM   225  N  N   . LEU A 1 88  ? 36.273 10.136 51.641 1.00 24.26 ? 88  LEU P N   1 
ATOM   226  C  CA  . LEU A 1 88  ? 34.947 10.344 52.243 1.00 23.11 ? 88  LEU P CA  1 
ATOM   227  C  C   . LEU A 1 88  ? 34.903 10.473 53.771 1.00 23.81 ? 88  LEU P C   1 
ATOM   228  O  O   . LEU A 1 88  ? 34.144 11.315 54.307 1.00 22.58 ? 88  LEU P O   1 
ATOM   229  C  CB  . LEU A 1 88  ? 33.976 9.249  51.800 1.00 22.92 ? 88  LEU P CB  1 
ATOM   230  C  CG  . LEU A 1 88  ? 32.576 9.323  52.430 1.00 21.62 ? 88  LEU P CG  1 
ATOM   231  C  CD1 . LEU A 1 88  ? 31.834 10.668 52.120 1.00 21.82 ? 88  LEU P CD1 1 
ATOM   232  C  CD2 . LEU A 1 88  ? 31.752 8.153  51.938 1.00 20.66 ? 88  LEU P CD2 1 
ATOM   233  N  N   . SER A 1 89  ? 35.655 9.611  54.469 1.00 23.04 ? 89  SER P N   1 
ATOM   234  C  CA  . SER A 1 89  ? 35.716 9.638  55.921 1.00 24.03 ? 89  SER P CA  1 
ATOM   235  C  C   . SER A 1 89  ? 36.312 10.966 56.405 1.00 24.43 ? 89  SER P C   1 
ATOM   236  O  O   . SER A 1 89  ? 35.893 11.505 57.424 1.00 24.80 ? 89  SER P O   1 
ATOM   237  C  CB  . SER A 1 89  ? 36.573 8.471  56.465 1.00 23.81 ? 89  SER P CB  1 
ATOM   238  O  OG  . SER A 1 89  ? 35.813 7.289  56.472 1.00 23.63 ? 89  SER P OG  1 
ATOM   239  N  N   . GLN A 1 90  ? 37.295 11.473 55.671 1.00 25.08 ? 90  GLN P N   1 
ATOM   240  C  CA  . GLN A 1 90  ? 37.908 12.765 56.003 1.00 25.22 ? 90  GLN P CA  1 
ATOM   241  C  C   . GLN A 1 90  ? 36.930 13.920 55.727 1.00 24.70 ? 90  GLN P C   1 
ATOM   242  O  O   . GLN A 1 90  ? 36.854 14.862 56.514 1.00 25.29 ? 90  GLN P O   1 
ATOM   243  C  CB  . GLN A 1 90  ? 39.222 12.960 55.251 1.00 25.24 ? 90  GLN P CB  1 
ATOM   244  C  CG  . GLN A 1 90  ? 40.271 11.887 55.558 1.00 27.85 ? 90  GLN P CG  1 
ATOM   245  C  CD  . GLN A 1 90  ? 41.503 11.990 54.705 1.00 29.36 ? 90  GLN P CD  1 
ATOM   246  O  OE1 . GLN A 1 90  ? 41.440 11.915 53.478 1.00 29.59 ? 90  GLN P OE1 1 
ATOM   247  N  NE2 . GLN A 1 90  ? 42.652 12.133 55.356 1.00 31.94 ? 90  GLN P NE2 1 
ATOM   248  N  N   . SER A 1 91  ? 36.177 13.846 54.629 1.00 24.92 ? 91  SER P N   1 
ATOM   249  C  CA  . SER A 1 91  ? 35.122 14.839 54.341 1.00 24.13 ? 91  SER P CA  1 
ATOM   250  C  C   . SER A 1 91  ? 34.061 14.921 55.437 1.00 24.63 ? 91  SER P C   1 
ATOM   251  O  O   . SER A 1 91  ? 33.643 16.023 55.838 1.00 23.41 ? 91  SER P O   1 
ATOM   252  C  CB  . SER A 1 91  ? 34.447 14.560 52.994 1.00 24.09 ? 91  SER P CB  1 
ATOM   253  O  OG  . SER A 1 91  ? 35.405 14.556 51.963 1.00 24.35 ? 91  SER P OG  1 
ATOM   254  N  N   . GLU A 1 92  ? 33.619 13.762 55.932 1.00 24.48 ? 92  GLU P N   1 
ATOM   255  C  CA  . GLU A 1 92  ? 32.575 13.760 56.945 1.00 25.74 ? 92  GLU P CA  1 
ATOM   256  C  C   . GLU A 1 92  ? 33.100 14.339 58.257 1.00 25.81 ? 92  GLU P C   1 
ATOM   257  O  O   . GLU A 1 92  ? 32.421 15.132 58.905 1.00 26.20 ? 92  GLU P O   1 
ATOM   258  C  CB  . GLU A 1 92  ? 32.005 12.355 57.147 1.00 25.46 ? 92  GLU P CB  1 
ATOM   259  C  CG  . GLU A 1 92  ? 31.264 11.808 55.913 1.00 27.39 ? 92  GLU P CG  1 
ATOM   260  C  CD  . GLU A 1 92  ? 30.919 10.314 56.026 1.00 28.81 ? 92  GLU P CD  1 
ATOM   261  O  OE1 . GLU A 1 92  ? 31.459 9.631  56.918 1.00 31.03 ? 92  GLU P OE1 1 
ATOM   262  O  OE2 . GLU A 1 92  ? 30.110 9.824  55.196 1.00 32.92 ? 92  GLU P OE2 1 
ATOM   263  N  N   . ARG A 1 93  ? 34.311 13.942 58.641 1.00 25.36 ? 93  ARG P N   1 
ATOM   264  C  CA  . ARG A 1 93  ? 34.922 14.441 59.865 1.00 26.75 ? 93  ARG P CA  1 
ATOM   265  C  C   . ARG A 1 93  ? 35.186 15.963 59.806 1.00 26.15 ? 93  ARG P C   1 
ATOM   266  O  O   . ARG A 1 93  ? 35.017 16.666 60.794 1.00 25.50 ? 93  ARG P O   1 
ATOM   267  C  CB  . ARG A 1 93  ? 36.224 13.706 60.137 1.00 26.92 ? 93  ARG P CB  1 
ATOM   268  C  CG  . ARG A 1 93  ? 36.026 12.283 60.664 1.00 30.28 ? 93  ARG P CG  1 
ATOM   269  C  CD  . ARG A 1 93  ? 37.353 11.524 60.627 1.00 35.24 ? 93  ARG P CD  1 
ATOM   270  N  NE  . ARG A 1 93  ? 37.136 10.081 60.614 1.00 39.59 ? 93  ARG P NE  1 
ATOM   271  C  CZ  . ARG A 1 93  ? 37.943 9.202  60.030 1.00 42.37 ? 93  ARG P CZ  1 
ATOM   272  N  NH1 . ARG A 1 93  ? 39.039 9.617  59.387 1.00 43.61 ? 93  ARG P NH1 1 
ATOM   273  N  NH2 . ARG A 1 93  ? 37.643 7.903  60.080 1.00 43.47 ? 93  ARG P NH2 1 
ATOM   274  N  N   . THR A 1 94  ? 35.605 16.451 58.648 1.00 26.42 ? 94  THR P N   1 
ATOM   275  C  CA  . THR A 1 94  ? 35.764 17.907 58.449 1.00 26.50 ? 94  THR P CA  1 
ATOM   276  C  C   . THR A 1 94  ? 34.437 18.636 58.605 1.00 25.99 ? 94  THR P C   1 
ATOM   277  O  O   . THR A 1 94  ? 34.377 19.694 59.260 1.00 26.50 ? 94  THR P O   1 
ATOM   278  C  CB  . THR A 1 94  ? 36.403 18.220 57.094 1.00 26.52 ? 94  THR P CB  1 
ATOM   279  O  OG1 . THR A 1 94  ? 37.663 17.552 57.037 1.00 27.57 ? 94  THR P OG1 1 
ATOM   280  C  CG2 . THR A 1 94  ? 36.642 19.756 56.937 1.00 27.93 ? 94  THR P CG2 1 
ATOM   281  N  N   . ALA A 1 95  ? 33.370 18.068 58.044 1.00 24.88 ? 95  ALA P N   1 
ATOM   282  C  CA  . ALA A 1 95  ? 32.045 18.658 58.175 1.00 25.63 ? 95  ALA P CA  1 
ATOM   283  C  C   . ALA A 1 95  ? 31.589 18.742 59.614 1.00 26.31 ? 95  ALA P C   1 
ATOM   284  O  O   . ALA A 1 95  ? 31.050 19.771 60.034 1.00 25.71 ? 95  ALA P O   1 
ATOM   285  C  CB  . ALA A 1 95  ? 31.025 17.906 57.354 1.00 25.23 ? 95  ALA P CB  1 
ATOM   286  N  N   . ARG A 1 96  ? 31.778 17.652 60.368 1.00 26.34 ? 96  ARG P N   1 
ATOM   287  C  CA  . ARG A 1 96  ? 31.381 17.637 61.779 1.00 27.63 ? 96  ARG P CA  1 
ATOM   288  C  C   . ARG A 1 96  ? 32.248 18.577 62.598 1.00 26.46 ? 96  ARG P C   1 
ATOM   289  O  O   . ARG A 1 96  ? 31.775 19.169 63.548 1.00 28.00 ? 96  ARG P O   1 
ATOM   290  C  CB  . ARG A 1 96  ? 31.436 16.213 62.380 1.00 27.67 ? 96  ARG P CB  1 
ATOM   291  C  CG  . ARG A 1 96  ? 30.615 15.151 61.611 1.00 31.71 ? 96  ARG P CG  1 
ATOM   292  C  CD  . ARG A 1 96  ? 29.155 15.562 61.409 1.00 35.67 ? 96  ARG P CD  1 
ATOM   293  N  NE  . ARG A 1 96  ? 28.583 15.039 60.166 1.00 39.50 ? 96  ARG P NE  1 
ATOM   294  C  CZ  . ARG A 1 96  ? 27.359 15.333 59.716 1.00 41.01 ? 96  ARG P CZ  1 
ATOM   295  N  NH1 . ARG A 1 96  ? 26.560 16.152 60.395 1.00 40.91 ? 96  ARG P NH1 1 
ATOM   296  N  NH2 . ARG A 1 96  ? 26.935 14.816 58.576 1.00 40.98 ? 96  ARG P NH2 1 
ATOM   297  N  N   . ARG A 1 97  ? 33.518 18.688 62.242 1.00 27.10 ? 97  ARG P N   1 
ATOM   298  C  CA  . ARG A 1 97  ? 34.424 19.652 62.888 1.00 28.04 ? 97  ARG P CA  1 
ATOM   299  C  C   . ARG A 1 97  ? 33.934 21.104 62.700 1.00 27.50 ? 97  ARG P C   1 
ATOM   300  O  O   . ARG A 1 97  ? 33.851 21.866 63.677 1.00 27.40 ? 97  ARG P O   1 
ATOM   301  C  CB  . ARG A 1 97  ? 35.857 19.482 62.394 1.00 28.46 ? 97  ARG P CB  1 
ATOM   302  C  CG  . ARG A 1 97  ? 36.863 20.243 63.232 1.00 32.36 ? 97  ARG P CG  1 
ATOM   303  C  CD  . ARG A 1 97  ? 38.181 20.388 62.531 1.00 37.57 ? 97  ARG P CD  1 
ATOM   304  N  NE  . ARG A 1 97  ? 39.068 21.317 63.235 1.00 44.05 ? 97  ARG P NE  1 
ATOM   305  C  CZ  . ARG A 1 97  ? 39.929 20.958 64.185 1.00 46.70 ? 97  ARG P CZ  1 
ATOM   306  N  NH1 . ARG A 1 97  ? 40.033 19.683 64.553 1.00 48.95 ? 97  ARG P NH1 1 
ATOM   307  N  NH2 . ARG A 1 97  ? 40.688 21.873 64.773 1.00 48.76 ? 97  ARG P NH2 1 
ATOM   308  N  N   . LEU A 1 98  ? 33.582 21.466 61.468 1.00 27.30 ? 98  LEU P N   1 
ATOM   309  C  CA  . LEU A 1 98  ? 32.941 22.750 61.198 1.00 27.87 ? 98  LEU P CA  1 
ATOM   310  C  C   . LEU A 1 98  ? 31.751 22.989 62.126 1.00 29.09 ? 98  LEU P C   1 
ATOM   311  O  O   . LEU A 1 98  ? 31.690 24.023 62.811 1.00 29.47 ? 98  LEU P O   1 
ATOM   312  C  CB  . LEU A 1 98  ? 32.501 22.868 59.729 1.00 28.22 ? 98  LEU P CB  1 
ATOM   313  C  CG  . LEU A 1 98  ? 31.768 24.160 59.300 1.00 27.61 ? 98  LEU P CG  1 
ATOM   314  C  CD1 . LEU A 1 98  ? 32.566 25.408 59.690 1.00 28.63 ? 98  LEU P CD1 1 
ATOM   315  C  CD2 . LEU A 1 98  ? 31.485 24.145 57.803 1.00 27.38 ? 98  LEU P CD2 1 
ATOM   316  N  N   . GLN A 1 99  ? 30.834 22.029 62.185 1.00 29.82 ? 99  GLN P N   1 
ATOM   317  C  CA  . GLN A 1 99  ? 29.609 22.176 62.982 1.00 30.92 ? 99  GLN P CA  1 
ATOM   318  C  C   . GLN A 1 99  ? 29.884 22.386 64.454 1.00 31.43 ? 99  GLN P C   1 
ATOM   319  O  O   . GLN A 1 99  ? 29.183 23.161 65.097 1.00 31.96 ? 99  GLN P O   1 
ATOM   320  C  CB  . GLN A 1 99  ? 28.735 20.944 62.872 1.00 31.10 ? 99  GLN P CB  1 
ATOM   321  C  CG  . GLN A 1 99  ? 28.157 20.700 61.512 1.00 32.38 ? 99  GLN P CG  1 
ATOM   322  C  CD  . GLN A 1 99  ? 26.985 19.769 61.600 1.00 32.87 ? 99  GLN P CD  1 
ATOM   323  O  OE1 . GLN A 1 99  ? 27.157 18.559 61.693 1.00 33.08 ? 99  GLN P OE1 1 
ATOM   324  N  NE2 . GLN A 1 99  ? 25.782 20.326 61.591 1.00 33.31 ? 99  GLN P NE2 1 
ATOM   325  N  N   . ALA A 1 100 ? 30.881 21.671 64.980 1.00 31.73 ? 100 ALA P N   1 
ATOM   326  C  CA  . ALA A 1 100 ? 31.232 21.747 66.392 1.00 32.23 ? 100 ALA P CA  1 
ATOM   327  C  C   . ALA A 1 100 ? 31.890 23.095 66.694 1.00 32.37 ? 100 ALA P C   1 
ATOM   328  O  O   . ALA A 1 100 ? 31.539 23.745 67.677 1.00 32.02 ? 100 ALA P O   1 
ATOM   329  C  CB  . ALA A 1 100 ? 32.134 20.578 66.810 1.00 31.96 ? 100 ALA P CB  1 
ATOM   330  N  N   . GLN A 1 101 ? 32.813 23.515 65.830 1.00 32.53 ? 101 GLN P N   1 
ATOM   331  C  CA  . GLN A 1 101 ? 33.479 24.810 65.966 1.00 33.37 ? 101 GLN P CA  1 
ATOM   332  C  C   . GLN A 1 101 ? 32.492 25.965 65.843 1.00 33.79 ? 101 GLN P C   1 
ATOM   333  O  O   . GLN A 1 101 ? 32.609 26.976 66.549 1.00 34.11 ? 101 GLN P O   1 
ATOM   334  C  CB  . GLN A 1 101 ? 34.587 24.952 64.936 1.00 33.69 ? 101 GLN P CB  1 
ATOM   335  C  CG  . GLN A 1 101 ? 35.776 24.045 65.191 1.00 35.29 ? 101 GLN P CG  1 
ATOM   336  C  CD  . GLN A 1 101 ? 36.839 24.164 64.130 1.00 37.67 ? 101 GLN P CD  1 
ATOM   337  O  OE1 . GLN A 1 101 ? 37.984 23.771 64.349 1.00 41.38 ? 101 GLN P OE1 1 
ATOM   338  N  NE2 . GLN A 1 101 ? 36.474 24.698 62.965 1.00 38.23 ? 101 GLN P NE2 1 
ATOM   339  N  N   . ALA A 1 102 ? 31.516 25.804 64.951 1.00 33.18 ? 102 ALA P N   1 
ATOM   340  C  CA  . ALA A 1 102 ? 30.445 26.764 64.810 1.00 33.43 ? 102 ALA P CA  1 
ATOM   341  C  C   . ALA A 1 102 ? 29.588 26.842 66.073 1.00 34.38 ? 102 ALA P C   1 
ATOM   342  O  O   . ALA A 1 102 ? 29.297 27.947 66.552 1.00 33.96 ? 102 ALA P O   1 
ATOM   343  C  CB  . ALA A 1 102 ? 29.585 26.448 63.582 1.00 32.76 ? 102 ALA P CB  1 
ATOM   344  N  N   . ALA A 1 103 ? 29.188 25.678 66.598 1.00 34.61 ? 103 ALA P N   1 
ATOM   345  C  CA  . ALA A 1 103 ? 28.302 25.587 67.759 1.00 35.56 ? 103 ALA P CA  1 
ATOM   346  C  C   . ALA A 1 103 ? 28.910 26.238 68.977 1.00 36.30 ? 103 ALA P C   1 
ATOM   347  O  O   . ALA A 1 103 ? 28.209 26.907 69.724 1.00 36.73 ? 103 ALA P O   1 
ATOM   348  C  CB  . ALA A 1 103 ? 27.944 24.137 68.070 1.00 35.09 ? 103 ALA P CB  1 
ATOM   349  N  N   . ARG A 1 104 ? 30.206 26.016 69.166 1.00 37.55 ? 104 ARG P N   1 
ATOM   350  C  CA  . ARG A 1 104 ? 31.001 26.673 70.200 1.00 39.61 ? 104 ARG P CA  1 
ATOM   351  C  C   . ARG A 1 104 ? 30.883 28.204 70.114 1.00 39.97 ? 104 ARG P C   1 
ATOM   352  O  O   . ARG A 1 104 ? 30.909 28.887 71.135 1.00 40.48 ? 104 ARG P O   1 
ATOM   353  C  CB  . ARG A 1 104 ? 32.470 26.229 70.083 1.00 39.77 ? 104 ARG P CB  1 
ATOM   354  C  CG  . ARG A 1 104 ? 33.443 26.850 71.083 1.00 43.87 ? 104 ARG P CG  1 
ATOM   355  C  CD  . ARG A 1 104 ? 33.602 26.012 72.357 1.00 49.73 ? 104 ARG P CD  1 
ATOM   356  N  NE  . ARG A 1 104 ? 34.272 26.767 73.423 1.00 53.59 ? 104 ARG P NE  1 
ATOM   357  C  CZ  . ARG A 1 104 ? 33.643 27.464 74.372 1.00 55.22 ? 104 ARG P CZ  1 
ATOM   358  N  NH1 . ARG A 1 104 ? 32.314 27.512 74.416 1.00 56.06 ? 104 ARG P NH1 1 
ATOM   359  N  NH2 . ARG A 1 104 ? 34.347 28.114 75.290 1.00 56.05 ? 104 ARG P NH2 1 
ATOM   360  N  N   . ARG A 1 105 ? 30.727 28.732 68.901 1.00 40.00 ? 105 ARG P N   1 
ATOM   361  C  CA  . ARG A 1 105 ? 30.617 30.177 68.697 1.00 39.65 ? 105 ARG P CA  1 
ATOM   362  C  C   . ARG A 1 105 ? 29.181 30.703 68.689 1.00 39.29 ? 105 ARG P C   1 
ATOM   363  O  O   . ARG A 1 105 ? 28.941 31.904 68.513 1.00 39.32 ? 105 ARG P O   1 
ATOM   364  C  CB  . ARG A 1 105 ? 31.362 30.580 67.425 1.00 39.92 ? 105 ARG P CB  1 
ATOM   365  C  CG  . ARG A 1 105 ? 32.856 30.484 67.566 1.00 41.15 ? 105 ARG P CG  1 
ATOM   366  C  CD  . ARG A 1 105 ? 33.537 30.796 66.275 1.00 45.11 ? 105 ARG P CD  1 
ATOM   367  N  NE  . ARG A 1 105 ? 34.972 30.568 66.377 1.00 49.83 ? 105 ARG P NE  1 
ATOM   368  C  CZ  . ARG A 1 105 ? 35.891 31.174 65.620 1.00 51.89 ? 105 ARG P CZ  1 
ATOM   369  N  NH1 . ARG A 1 105 ? 35.536 32.059 64.697 1.00 51.77 ? 105 ARG P NH1 1 
ATOM   370  N  NH2 . ARG A 1 105 ? 37.179 30.898 65.793 1.00 52.61 ? 105 ARG P NH2 1 
ATOM   371  N  N   . GLY A 1 106 ? 28.224 29.808 68.897 1.00 38.65 ? 106 GLY P N   1 
ATOM   372  C  CA  . GLY A 1 106 ? 26.818 30.200 68.984 1.00 37.87 ? 106 GLY P CA  1 
ATOM   373  C  C   . GLY A 1 106 ? 26.044 30.133 67.682 1.00 37.58 ? 106 GLY P C   1 
ATOM   374  O  O   . GLY A 1 106 ? 24.955 30.698 67.581 1.00 37.69 ? 106 GLY P O   1 
ATOM   375  N  N   . TYR A 1 107 ? 26.591 29.430 66.688 1.00 36.78 ? 107 TYR P N   1 
ATOM   376  C  CA  . TYR A 1 107 ? 25.998 29.368 65.355 1.00 35.86 ? 107 TYR P CA  1 
ATOM   377  C  C   . TYR A 1 107 ? 25.427 27.999 65.043 1.00 35.91 ? 107 TYR P C   1 
ATOM   378  O  O   . TYR A 1 107 ? 26.102 26.997 65.204 1.00 35.54 ? 107 TYR P O   1 
ATOM   379  C  CB  . TYR A 1 107 ? 27.058 29.659 64.283 1.00 36.11 ? 107 TYR P CB  1 
ATOM   380  C  CG  . TYR A 1 107 ? 27.500 31.097 64.178 1.00 34.98 ? 107 TYR P CG  1 
ATOM   381  C  CD1 . TYR A 1 107 ? 26.926 31.959 63.235 1.00 35.80 ? 107 TYR P CD1 1 
ATOM   382  C  CD2 . TYR A 1 107 ? 28.511 31.590 64.998 1.00 35.07 ? 107 TYR P CD2 1 
ATOM   383  C  CE1 . TYR A 1 107 ? 27.351 33.283 63.125 1.00 35.27 ? 107 TYR P CE1 1 
ATOM   384  C  CE2 . TYR A 1 107 ? 28.934 32.911 64.911 1.00 35.25 ? 107 TYR P CE2 1 
ATOM   385  C  CZ  . TYR A 1 107 ? 28.350 33.750 63.975 1.00 35.99 ? 107 TYR P CZ  1 
ATOM   386  O  OH  . TYR A 1 107 ? 28.782 35.058 63.889 1.00 35.47 ? 107 TYR P OH  1 
ATOM   387  N  N   . LEU A 1 108 ? 24.199 27.997 64.541 1.00 35.97 ? 108 LEU P N   1 
ATOM   388  C  CA  . LEU A 1 108 ? 23.513 26.832 64.016 1.00 36.01 ? 108 LEU P CA  1 
ATOM   389  C  C   . LEU A 1 108 ? 24.068 26.533 62.618 1.00 35.16 ? 108 LEU P C   1 
ATOM   390  O  O   . LEU A 1 108 ? 24.347 27.463 61.852 1.00 34.62 ? 108 LEU P O   1 
ATOM   391  C  CB  . LEU A 1 108 ? 22.033 27.204 63.892 1.00 36.69 ? 108 LEU P CB  1 
ATOM   392  C  CG  . LEU A 1 108 ? 20.850 26.384 64.396 1.00 39.63 ? 108 LEU P CG  1 
ATOM   393  C  CD1 . LEU A 1 108 ? 20.737 25.065 63.639 1.00 41.21 ? 108 LEU P CD1 1 
ATOM   394  C  CD2 . LEU A 1 108 ? 20.949 26.171 65.916 1.00 41.84 ? 108 LEU P CD2 1 
ATOM   395  N  N   . THR A 1 109 ? 24.248 25.251 62.288 1.00 33.95 ? 109 THR P N   1 
ATOM   396  C  CA  . THR A 1 109 ? 24.624 24.838 60.918 1.00 32.49 ? 109 THR P CA  1 
ATOM   397  C  C   . THR A 1 109 ? 23.899 23.562 60.510 1.00 32.09 ? 109 THR P C   1 
ATOM   398  O  O   . THR A 1 109 ? 23.503 22.780 61.362 1.00 32.20 ? 109 THR P O   1 
ATOM   399  C  CB  . THR A 1 109 ? 26.129 24.564 60.772 1.00 32.58 ? 109 THR P CB  1 
ATOM   400  O  OG1 . THR A 1 109 ? 26.523 23.566 61.718 1.00 32.77 ? 109 THR P OG1 1 
ATOM   401  C  CG2 . THR A 1 109 ? 26.951 25.816 61.002 1.00 32.36 ? 109 THR P CG2 1 
ATOM   402  N  N   . LYS A 1 110 ? 23.751 23.336 59.210 1.00 30.90 ? 110 LYS P N   1 
ATOM   403  C  CA  . LYS A 1 110 ? 23.204 22.086 58.722 1.00 30.62 ? 110 LYS P CA  1 
ATOM   404  C  C   . LYS A 1 110 ? 24.072 21.583 57.564 1.00 30.32 ? 110 LYS P C   1 
ATOM   405  O  O   . LYS A 1 110 ? 24.379 22.340 56.617 1.00 29.27 ? 110 LYS P O   1 
ATOM   406  C  CB  . LYS A 1 110 ? 21.746 22.308 58.291 1.00 31.04 ? 110 LYS P CB  1 
ATOM   407  C  CG  . LYS A 1 110 ? 20.874 21.073 58.143 1.00 33.55 ? 110 LYS P CG  1 
ATOM   408  C  CD  . LYS A 1 110 ? 19.391 21.457 58.364 1.00 36.71 ? 110 LYS P CD  1 
ATOM   409  C  CE  . LYS A 1 110 ? 18.409 20.364 57.950 1.00 40.28 ? 110 LYS P CE  1 
ATOM   410  N  NZ  . LYS A 1 110 ? 17.731 20.645 56.644 1.00 42.40 ? 110 LYS P NZ  1 
ATOM   411  N  N   . ILE A 1 111 ? 24.493 20.322 57.661 1.00 29.62 ? 111 ILE P N   1 
ATOM   412  C  CA  . ILE A 1 111 ? 25.189 19.658 56.575 1.00 28.97 ? 111 ILE P CA  1 
ATOM   413  C  C   . ILE A 1 111 ? 24.130 19.061 55.680 1.00 29.32 ? 111 ILE P C   1 
ATOM   414  O  O   . ILE A 1 111 ? 23.432 18.107 56.061 1.00 29.73 ? 111 ILE P O   1 
ATOM   415  C  CB  . ILE A 1 111 ? 26.189 18.585 57.065 1.00 28.98 ? 111 ILE P CB  1 
ATOM   416  C  CG1 . ILE A 1 111 ? 27.196 19.182 58.074 1.00 28.78 ? 111 ILE P CG1 1 
ATOM   417  C  CG2 . ILE A 1 111 ? 26.916 17.913 55.882 1.00 28.89 ? 111 ILE P CG2 1 
ATOM   418  C  CD1 . ILE A 1 111 ? 28.020 20.404 57.548 1.00 27.62 ? 111 ILE P CD1 1 
ATOM   419  N  N   . LEU A 1 112 ? 24.000 19.628 54.490 1.00 28.09 ? 112 LEU P N   1 
ATOM   420  C  CA  . LEU A 1 112 ? 22.948 19.214 53.568 1.00 27.59 ? 112 LEU P CA  1 
ATOM   421  C  C   . LEU A 1 112 ? 23.303 17.980 52.743 1.00 27.09 ? 112 LEU P C   1 
ATOM   422  O  O   . LEU A 1 112 ? 22.414 17.248 52.296 1.00 27.37 ? 112 LEU P O   1 
ATOM   423  C  CB  . LEU A 1 112 ? 22.562 20.388 52.641 1.00 27.57 ? 112 LEU P CB  1 
ATOM   424  C  CG  . LEU A 1 112 ? 22.029 21.678 53.291 1.00 27.73 ? 112 LEU P CG  1 
ATOM   425  C  CD1 . LEU A 1 112 ? 21.723 22.688 52.218 1.00 24.17 ? 112 LEU P CD1 1 
ATOM   426  C  CD2 . LEU A 1 112 ? 20.780 21.440 54.094 1.00 29.20 ? 112 LEU P CD2 1 
ATOM   427  N  N   . HIS A 1 113 ? 24.593 17.753 52.531 1.00 26.50 ? 113 HIS P N   1 
ATOM   428  C  CA  . HIS A 1 113 ? 25.082 16.696 51.631 1.00 25.87 ? 113 HIS P CA  1 
ATOM   429  C  C   . HIS A 1 113 ? 26.584 16.598 51.828 1.00 26.01 ? 113 HIS P C   1 
ATOM   430  O  O   . HIS A 1 113 ? 27.237 17.611 52.087 1.00 25.47 ? 113 HIS P O   1 
ATOM   431  C  CB  . HIS A 1 113 ? 24.780 17.064 50.164 1.00 25.58 ? 113 HIS P CB  1 
ATOM   432  C  CG  . HIS A 1 113 ? 25.127 15.996 49.170 1.00 25.43 ? 113 HIS P CG  1 
ATOM   433  N  ND1 . HIS A 1 113 ? 24.276 14.956 48.865 1.00 24.46 ? 113 HIS P ND1 1 
ATOM   434  C  CD2 . HIS A 1 113 ? 26.220 15.826 48.389 1.00 23.50 ? 113 HIS P CD2 1 
ATOM   435  C  CE1 . HIS A 1 113 ? 24.835 14.180 47.951 1.00 24.03 ? 113 HIS P CE1 1 
ATOM   436  N  NE2 . HIS A 1 113 ? 26.018 14.686 47.646 1.00 24.54 ? 113 HIS P NE2 1 
ATOM   437  N  N   . VAL A 1 114 ? 27.118 15.381 51.725 1.00 25.41 ? 114 VAL P N   1 
ATOM   438  C  CA  . VAL A 1 114 ? 28.557 15.127 51.653 1.00 25.29 ? 114 VAL P CA  1 
ATOM   439  C  C   . VAL A 1 114 ? 28.822 14.551 50.264 1.00 25.65 ? 114 VAL P C   1 
ATOM   440  O  O   . VAL A 1 114 ? 28.177 13.572 49.858 1.00 24.85 ? 114 VAL P O   1 
ATOM   441  C  CB  . VAL A 1 114 ? 29.012 14.118 52.743 1.00 25.93 ? 114 VAL P CB  1 
ATOM   442  C  CG1 . VAL A 1 114 ? 30.519 14.010 52.797 1.00 24.89 ? 114 VAL P CG1 1 
ATOM   443  C  CG2 . VAL A 1 114 ? 28.471 14.546 54.121 1.00 25.47 ? 114 VAL P CG2 1 
ATOM   444  N  N   . PHE A 1 115 ? 29.756 15.166 49.541 1.00 25.39 ? 115 PHE P N   1 
ATOM   445  C  CA  . PHE A 1 115 ? 30.103 14.761 48.187 1.00 26.16 ? 115 PHE P CA  1 
ATOM   446  C  C   . PHE A 1 115 ? 31.238 13.759 48.209 1.00 27.60 ? 115 PHE P C   1 
ATOM   447  O  O   . PHE A 1 115 ? 32.202 13.909 48.951 1.00 27.15 ? 115 PHE P O   1 
ATOM   448  C  CB  . PHE A 1 115 ? 30.583 15.966 47.343 1.00 25.83 ? 115 PHE P CB  1 
ATOM   449  C  CG  . PHE A 1 115 ? 29.531 17.015 47.108 1.00 25.53 ? 115 PHE P CG  1 
ATOM   450  C  CD1 . PHE A 1 115 ? 29.450 18.126 47.927 1.00 24.68 ? 115 PHE P CD1 1 
ATOM   451  C  CD2 . PHE A 1 115 ? 28.617 16.879 46.056 1.00 24.52 ? 115 PHE P CD2 1 
ATOM   452  C  CE1 . PHE A 1 115 ? 28.472 19.107 47.723 1.00 26.26 ? 115 PHE P CE1 1 
ATOM   453  C  CE2 . PHE A 1 115 ? 27.630 17.852 45.827 1.00 25.38 ? 115 PHE P CE2 1 
ATOM   454  C  CZ  . PHE A 1 115 ? 27.554 18.970 46.666 1.00 25.93 ? 115 PHE P CZ  1 
ATOM   455  N  N   . HIS A 1 116 ? 31.143 12.753 47.352 1.00 29.63 ? 116 HIS P N   1 
ATOM   456  C  CA  . HIS A 1 116 ? 32.322 11.966 47.007 1.00 32.00 ? 116 HIS P CA  1 
ATOM   457  C  C   . HIS A 1 116 ? 32.002 11.280 45.704 1.00 32.38 ? 116 HIS P C   1 
ATOM   458  O  O   . HIS A 1 116 ? 30.845 10.989 45.440 1.00 33.28 ? 116 HIS P O   1 
ATOM   459  C  CB  . HIS A 1 116 ? 32.621 10.927 48.093 1.00 32.52 ? 116 HIS P CB  1 
ATOM   460  C  CG  . HIS A 1 116 ? 31.573 9.867  48.205 1.00 34.06 ? 116 HIS P CG  1 
ATOM   461  N  ND1 . HIS A 1 116 ? 31.786 8.566  47.796 1.00 35.75 ? 116 HIS P ND1 1 
ATOM   462  C  CD2 . HIS A 1 116 ? 30.296 9.921  48.652 1.00 35.78 ? 116 HIS P CD2 1 
ATOM   463  C  CE1 . HIS A 1 116 ? 30.689 7.862  48.008 1.00 36.87 ? 116 HIS P CE1 1 
ATOM   464  N  NE2 . HIS A 1 116 ? 29.770 8.659  48.527 1.00 36.01 ? 116 HIS P NE2 1 
ATOM   465  N  N   . GLY A 1 117 ? 33.011 11.055 44.873 1.00 33.41 ? 117 GLY P N   1 
ATOM   466  C  CA  . GLY A 1 117 ? 32.782 10.378 43.596 1.00 33.97 ? 117 GLY P CA  1 
ATOM   467  C  C   . GLY A 1 117 ? 33.210 11.197 42.403 1.00 33.89 ? 117 GLY P C   1 
ATOM   468  O  O   . GLY A 1 117 ? 33.688 10.645 41.410 1.00 35.42 ? 117 GLY P O   1 
ATOM   469  N  N   . LEU A 1 118 ? 32.987 12.506 42.473 1.00 33.35 ? 118 LEU P N   1 
ATOM   470  C  CA  . LEU A 1 118 ? 33.574 13.443 41.514 1.00 32.93 ? 118 LEU P CA  1 
ATOM   471  C  C   . LEU A 1 118 ? 34.506 14.390 42.252 1.00 32.56 ? 118 LEU P C   1 
ATOM   472  O  O   . LEU A 1 118 ? 35.704 14.440 41.971 1.00 33.68 ? 118 LEU P O   1 
ATOM   473  C  CB  . LEU A 1 118 ? 32.496 14.218 40.743 1.00 33.04 ? 118 LEU P CB  1 
ATOM   474  C  CG  . LEU A 1 118 ? 31.582 13.420 39.801 1.00 31.80 ? 118 LEU P CG  1 
ATOM   475  C  CD1 . LEU A 1 118 ? 30.511 14.313 39.156 1.00 29.74 ? 118 LEU P CD1 1 
ATOM   476  C  CD2 . LEU A 1 118 ? 32.403 12.676 38.751 1.00 32.31 ? 118 LEU P CD2 1 
ATOM   477  N  N   . LEU A 1 119 ? 33.948 15.131 43.201 1.00 31.60 ? 119 LEU P N   1 
ATOM   478  C  CA  . LEU A 1 119 ? 34.710 16.063 44.039 1.00 30.10 ? 119 LEU P CA  1 
ATOM   479  C  C   . LEU A 1 119 ? 34.429 15.682 45.484 1.00 28.53 ? 119 LEU P C   1 
ATOM   480  O  O   . LEU A 1 119 ? 33.300 15.374 45.818 1.00 28.96 ? 119 LEU P O   1 
ATOM   481  C  CB  . LEU A 1 119 ? 34.269 17.524 43.819 1.00 30.20 ? 119 LEU P CB  1 
ATOM   482  C  CG  . LEU A 1 119 ? 34.423 18.219 42.459 1.00 30.82 ? 119 LEU P CG  1 
ATOM   483  C  CD1 . LEU A 1 119 ? 33.732 19.576 42.491 1.00 31.83 ? 119 LEU P CD1 1 
ATOM   484  C  CD2 . LEU A 1 119 ? 35.878 18.375 42.025 1.00 33.09 ? 119 LEU P CD2 1 
ATOM   485  N  N   . PRO A 1 120 ? 35.462 15.678 46.335 1.00 26.98 ? 120 PRO P N   1 
ATOM   486  C  CA  . PRO A 1 120 ? 35.228 15.535 47.766 1.00 25.93 ? 120 PRO P CA  1 
ATOM   487  C  C   . PRO A 1 120 ? 34.811 16.851 48.432 1.00 24.86 ? 120 PRO P C   1 
ATOM   488  O  O   . PRO A 1 120 ? 35.292 17.910 48.065 1.00 23.67 ? 120 PRO P O   1 
ATOM   489  C  CB  . PRO A 1 120 ? 36.581 15.056 48.295 1.00 25.32 ? 120 PRO P CB  1 
ATOM   490  C  CG  . PRO A 1 120 ? 37.572 15.614 47.344 1.00 26.73 ? 120 PRO P CG  1 
ATOM   491  C  CD  . PRO A 1 120 ? 36.895 15.728 45.999 1.00 26.60 ? 120 PRO P CD  1 
ATOM   492  N  N   . GLY A 1 121 ? 33.940 16.770 49.426 1.00 24.66 ? 121 GLY P N   1 
ATOM   493  C  CA  . GLY A 1 121 ? 33.582 17.950 50.192 1.00 23.75 ? 121 GLY P CA  1 
ATOM   494  C  C   . GLY A 1 121 ? 32.187 17.846 50.738 1.00 23.62 ? 121 GLY P C   1 
ATOM   495  O  O   . GLY A 1 121 ? 31.674 16.743 50.931 1.00 23.63 ? 121 GLY P O   1 
ATOM   496  N  N   . PHE A 1 122 ? 31.568 18.998 50.993 1.00 22.77 ? 122 PHE P N   1 
ATOM   497  C  CA  . PHE A 1 122 ? 30.218 19.023 51.519 1.00 22.82 ? 122 PHE P CA  1 
ATOM   498  C  C   . PHE A 1 122 ? 29.455 20.306 51.244 1.00 22.55 ? 122 PHE P C   1 
ATOM   499  O  O   . PHE A 1 122 ? 30.047 21.334 50.894 1.00 22.03 ? 122 PHE P O   1 
ATOM   500  C  CB  . PHE A 1 122 ? 30.206 18.693 53.016 1.00 23.03 ? 122 PHE P CB  1 
ATOM   501  C  CG  . PHE A 1 122 ? 31.082 19.580 53.862 1.00 23.05 ? 122 PHE P CG  1 
ATOM   502  C  CD1 . PHE A 1 122 ? 32.424 19.277 54.061 1.00 24.70 ? 122 PHE P CD1 1 
ATOM   503  C  CD2 . PHE A 1 122 ? 30.541 20.667 54.518 1.00 24.34 ? 122 PHE P CD2 1 
ATOM   504  C  CE1 . PHE A 1 122 ? 33.226 20.086 54.876 1.00 25.16 ? 122 PHE P CE1 1 
ATOM   505  C  CE2 . PHE A 1 122 ? 31.323 21.472 55.338 1.00 21.47 ? 122 PHE P CE2 1 
ATOM   506  C  CZ  . PHE A 1 122 ? 32.663 21.181 55.517 1.00 22.60 ? 122 PHE P CZ  1 
ATOM   507  N  N   . LEU A 1 123 ? 28.144 20.221 51.390 1.00 22.15 ? 123 LEU P N   1 
ATOM   508  C  CA  . LEU A 1 123 ? 27.246 21.371 51.283 1.00 22.96 ? 123 LEU P CA  1 
ATOM   509  C  C   . LEU A 1 123 ? 26.718 21.708 52.658 1.00 23.38 ? 123 LEU P C   1 
ATOM   510  O  O   . LEU A 1 123 ? 26.176 20.845 53.348 1.00 24.84 ? 123 LEU P O   1 
ATOM   511  C  CB  . LEU A 1 123 ? 26.069 21.040 50.363 1.00 23.39 ? 123 LEU P CB  1 
ATOM   512  C  CG  . LEU A 1 123 ? 25.022 22.109 50.039 1.00 23.94 ? 123 LEU P CG  1 
ATOM   513  C  CD1 . LEU A 1 123 ? 25.642 23.191 49.149 1.00 22.43 ? 123 LEU P CD1 1 
ATOM   514  C  CD2 . LEU A 1 123 ? 23.827 21.428 49.347 1.00 21.42 ? 123 LEU P CD2 1 
ATOM   515  N  N   . VAL A 1 124 ? 26.856 22.973 53.038 1.00 23.56 ? 124 VAL P N   1 
ATOM   516  C  CA  . VAL A 1 124 ? 26.533 23.446 54.382 1.00 22.58 ? 124 VAL P CA  1 
ATOM   517  C  C   . VAL A 1 124 ? 25.672 24.705 54.343 1.00 23.37 ? 124 VAL P C   1 
ATOM   518  O  O   . VAL A 1 124 ? 25.914 25.623 53.531 1.00 22.27 ? 124 VAL P O   1 
ATOM   519  C  CB  . VAL A 1 124 ? 27.814 23.644 55.247 1.00 23.25 ? 124 VAL P CB  1 
ATOM   520  C  CG1 . VAL A 1 124 ? 28.797 24.643 54.596 1.00 23.00 ? 124 VAL P CG1 1 
ATOM   521  C  CG2 . VAL A 1 124 ? 27.461 24.038 56.702 1.00 23.04 ? 124 VAL P CG2 1 
ATOM   522  N  N   . LYS A 1 125 ? 24.646 24.703 55.192 1.00 22.52 ? 125 LYS P N   1 
ATOM   523  C  CA  . LYS A 1 125 ? 23.765 25.833 55.424 1.00 24.56 ? 125 LYS P CA  1 
ATOM   524  C  C   . LYS A 1 125 ? 24.270 26.456 56.702 1.00 24.61 ? 125 LYS P C   1 
ATOM   525  O  O   . LYS A 1 125 ? 24.246 25.830 57.765 1.00 23.27 ? 125 LYS P O   1 
ATOM   526  C  CB  . LYS A 1 125 ? 22.329 25.344 55.616 1.00 24.14 ? 125 LYS P CB  1 
ATOM   527  C  CG  . LYS A 1 125 ? 21.247 26.428 55.613 1.00 25.62 ? 125 LYS P CG  1 
ATOM   528  C  CD  . LYS A 1 125 ? 19.880 25.777 55.906 1.00 27.33 ? 125 LYS P CD  1 
ATOM   529  C  CE  . LYS A 1 125 ? 18.740 26.790 55.966 1.00 33.39 ? 125 LYS P CE  1 
ATOM   530  N  NZ  . LYS A 1 125 ? 18.761 27.541 57.267 1.00 36.40 ? 125 LYS P NZ  1 
ATOM   531  N  N   . MET A 1 126 ? 24.775 27.675 56.566 1.00 25.15 ? 126 MET P N   1 
ATOM   532  C  CA  . MET A 1 126 ? 25.417 28.390 57.649 1.00 26.64 ? 126 MET P CA  1 
ATOM   533  C  C   . MET A 1 126 ? 25.525 29.865 57.296 1.00 26.85 ? 126 MET P C   1 
ATOM   534  O  O   . MET A 1 126 ? 25.435 30.256 56.128 1.00 26.00 ? 126 MET P O   1 
ATOM   535  C  CB  . MET A 1 126 ? 26.813 27.836 57.944 1.00 26.14 ? 126 MET P CB  1 
ATOM   536  C  CG  . MET A 1 126 ? 27.834 28.038 56.818 1.00 26.66 ? 126 MET P CG  1 
ATOM   537  S  SD  . MET A 1 126 ? 29.465 27.538 57.336 1.00 29.14 ? 126 MET P SD  1 
ATOM   538  C  CE  . MET A 1 126 ? 30.484 28.367 56.108 1.00 27.09 ? 126 MET P CE  1 
ATOM   539  N  N   . SER A 1 127 ? 25.732 30.666 58.329 1.00 27.62 ? 127 SER P N   1 
ATOM   540  C  CA  . SER A 1 127 ? 26.002 32.093 58.172 1.00 28.38 ? 127 SER P CA  1 
ATOM   541  C  C   . SER A 1 127 ? 27.390 32.296 57.555 1.00 27.76 ? 127 SER P C   1 
ATOM   542  O  O   . SER A 1 127 ? 28.337 31.585 57.890 1.00 27.62 ? 127 SER P O   1 
ATOM   543  C  CB  . SER A 1 127 ? 25.920 32.766 59.550 1.00 28.54 ? 127 SER P CB  1 
ATOM   544  O  OG  . SER A 1 127 ? 26.693 33.957 59.581 1.00 31.21 ? 127 SER P OG  1 
ATOM   545  N  N   . GLY A 1 128 ? 27.503 33.278 56.658 1.00 27.53 ? 128 GLY P N   1 
ATOM   546  C  CA  . GLY A 1 128 ? 28.770 33.658 56.044 1.00 26.75 ? 128 GLY P CA  1 
ATOM   547  C  C   . GLY A 1 128 ? 29.839 34.083 57.029 1.00 26.65 ? 128 GLY P C   1 
ATOM   548  O  O   . GLY A 1 128 ? 31.018 34.015 56.721 1.00 25.87 ? 128 GLY P O   1 
ATOM   549  N  N   . ASP A 1 129 ? 29.436 34.504 58.226 1.00 26.83 ? 129 ASP P N   1 
ATOM   550  C  CA  . ASP A 1 129 ? 30.377 34.844 59.287 1.00 26.95 ? 129 ASP P CA  1 
ATOM   551  C  C   . ASP A 1 129 ? 31.388 33.721 59.561 1.00 27.46 ? 129 ASP P C   1 
ATOM   552  O  O   . ASP A 1 129 ? 32.493 33.967 60.060 1.00 27.40 ? 129 ASP P O   1 
ATOM   553  C  CB  . ASP A 1 129 ? 29.625 35.114 60.592 1.00 27.28 ? 129 ASP P CB  1 
ATOM   554  C  CG  . ASP A 1 129 ? 28.673 36.300 60.515 1.00 29.77 ? 129 ASP P CG  1 
ATOM   555  O  OD1 . ASP A 1 129 ? 28.451 36.905 59.427 1.00 28.28 ? 129 ASP P OD1 1 
ATOM   556  O  OD2 . ASP A 1 129 ? 28.125 36.616 61.586 1.00 30.96 ? 129 ASP P OD2 1 
ATOM   557  N  N   . LEU A 1 130 ? 31.009 32.481 59.251 1.00 27.10 ? 130 LEU P N   1 
ATOM   558  C  CA  . LEU A 1 130 ? 31.866 31.333 59.574 1.00 27.12 ? 130 LEU P CA  1 
ATOM   559  C  C   . LEU A 1 130 ? 32.851 31.015 58.468 1.00 26.83 ? 130 LEU P C   1 
ATOM   560  O  O   . LEU A 1 130 ? 33.582 30.021 58.547 1.00 26.80 ? 130 LEU P O   1 
ATOM   561  C  CB  . LEU A 1 130 ? 31.013 30.091 59.894 1.00 27.26 ? 130 LEU P CB  1 
ATOM   562  C  CG  . LEU A 1 130 ? 30.065 30.199 61.097 1.00 28.02 ? 130 LEU P CG  1 
ATOM   563  C  CD1 . LEU A 1 130 ? 28.992 29.139 60.985 1.00 27.52 ? 130 LEU P CD1 1 
ATOM   564  C  CD2 . LEU A 1 130 ? 30.846 30.055 62.398 1.00 27.51 ? 130 LEU P CD2 1 
ATOM   565  N  N   . LEU A 1 131 ? 32.897 31.865 57.442 1.00 27.32 ? 131 LEU P N   1 
ATOM   566  C  CA  . LEU A 1 131 ? 33.726 31.567 56.278 1.00 26.76 ? 131 LEU P CA  1 
ATOM   567  C  C   . LEU A 1 131 ? 35.208 31.562 56.592 1.00 27.05 ? 131 LEU P C   1 
ATOM   568  O  O   . LEU A 1 131 ? 35.909 30.655 56.190 1.00 26.58 ? 131 LEU P O   1 
ATOM   569  C  CB  . LEU A 1 131 ? 33.391 32.469 55.087 1.00 27.09 ? 131 LEU P CB  1 
ATOM   570  C  CG  . LEU A 1 131 ? 32.161 32.056 54.269 1.00 26.73 ? 131 LEU P CG  1 
ATOM   571  C  CD1 . LEU A 1 131 ? 31.854 33.135 53.245 1.00 28.25 ? 131 LEU P CD1 1 
ATOM   572  C  CD2 . LEU A 1 131 ? 32.337 30.665 53.580 1.00 26.55 ? 131 LEU P CD2 1 
ATOM   573  N  N   . GLU A 1 132 ? 35.715 32.539 57.341 1.00 27.72 ? 132 GLU P N   1 
ATOM   574  C  CA  . GLU A 1 132 ? 37.146 32.483 57.655 1.00 28.82 ? 132 GLU P CA  1 
ATOM   575  C  C   . GLU A 1 132 ? 37.500 31.267 58.520 1.00 28.75 ? 132 GLU P C   1 
ATOM   576  O  O   . GLU A 1 132 ? 38.553 30.661 58.331 1.00 28.73 ? 132 GLU P O   1 
ATOM   577  C  CB  . GLU A 1 132 ? 37.676 33.774 58.276 1.00 29.60 ? 132 GLU P CB  1 
ATOM   578  C  CG  . GLU A 1 132 ? 37.659 34.980 57.333 1.00 33.48 ? 132 GLU P CG  1 
ATOM   579  C  CD  . GLU A 1 132 ? 38.842 35.061 56.349 1.00 38.86 ? 132 GLU P CD  1 
ATOM   580  O  OE1 . GLU A 1 132 ? 39.085 36.180 55.837 1.00 42.62 ? 132 GLU P OE1 1 
ATOM   581  O  OE2 . GLU A 1 132 ? 39.521 34.045 56.070 1.00 41.73 ? 132 GLU P OE2 1 
ATOM   582  N  N   . LEU A 1 133 ? 36.619 30.904 59.447 1.00 28.39 ? 133 LEU P N   1 
ATOM   583  C  CA  . LEU A 1 133 ? 36.792 29.655 60.212 1.00 29.76 ? 133 LEU P CA  1 
ATOM   584  C  C   . LEU A 1 133 ? 36.846 28.416 59.285 1.00 28.78 ? 133 LEU P C   1 
ATOM   585  O  O   . LEU A 1 133 ? 37.779 27.609 59.363 1.00 30.11 ? 133 LEU P O   1 
ATOM   586  C  CB  . LEU A 1 133 ? 35.671 29.522 61.240 1.00 29.35 ? 133 LEU P CB  1 
ATOM   587  C  CG  . LEU A 1 133 ? 35.595 28.308 62.164 1.00 32.06 ? 133 LEU P CG  1 
ATOM   588  C  CD1 . LEU A 1 133 ? 36.737 28.333 63.165 1.00 33.44 ? 133 LEU P CD1 1 
ATOM   589  C  CD2 . LEU A 1 133 ? 34.267 28.372 62.898 1.00 30.29 ? 133 LEU P CD2 1 
ATOM   590  N  N   . ALA A 1 134 ? 35.866 28.300 58.394 1.00 28.37 ? 134 ALA P N   1 
ATOM   591  C  CA  . ALA A 1 134 ? 35.777 27.172 57.465 1.00 27.47 ? 134 ALA P CA  1 
ATOM   592  C  C   . ALA A 1 134 ? 36.977 27.065 56.518 1.00 27.54 ? 134 ALA P C   1 
ATOM   593  O  O   . ALA A 1 134 ? 37.464 25.947 56.236 1.00 26.30 ? 134 ALA P O   1 
ATOM   594  C  CB  . ALA A 1 134 ? 34.470 27.209 56.701 1.00 27.64 ? 134 ALA P CB  1 
ATOM   595  N  N   . LEU A 1 135 ? 37.505 28.214 56.077 1.00 26.59 ? 135 LEU P N   1 
ATOM   596  C  CA  . LEU A 1 135 ? 38.672 28.194 55.197 1.00 26.95 ? 135 LEU P CA  1 
ATOM   597  C  C   . LEU A 1 135 ? 39.941 27.678 55.873 1.00 27.16 ? 135 LEU P C   1 
ATOM   598  O  O   . LEU A 1 135 ? 40.916 27.357 55.201 1.00 27.15 ? 135 LEU P O   1 
ATOM   599  C  CB  . LEU A 1 135 ? 38.949 29.573 54.578 1.00 26.65 ? 135 LEU P CB  1 
ATOM   600  C  CG  . LEU A 1 135 ? 37.962 30.121 53.531 1.00 26.65 ? 135 LEU P CG  1 
ATOM   601  C  CD1 . LEU A 1 135 ? 38.243 31.583 53.321 1.00 24.38 ? 135 LEU P CD1 1 
ATOM   602  C  CD2 . LEU A 1 135 ? 37.998 29.379 52.203 1.00 23.19 ? 135 LEU P CD2 1 
ATOM   603  N  N   . LYS A 1 136 ? 39.934 27.649 57.199 1.00 28.35 ? 136 LYS P N   1 
ATOM   604  C  CA  . LYS A 1 136 ? 41.075 27.176 57.981 1.00 29.57 ? 136 LYS P CA  1 
ATOM   605  C  C   . LYS A 1 136 ? 40.998 25.686 58.342 1.00 29.97 ? 136 LYS P C   1 
ATOM   606  O  O   . LYS A 1 136 ? 41.948 25.142 58.899 1.00 29.75 ? 136 LYS P O   1 
ATOM   607  C  CB  . LYS A 1 136 ? 41.210 28.016 59.261 1.00 30.25 ? 136 LYS P CB  1 
ATOM   608  C  CG  . LYS A 1 136 ? 41.901 29.358 59.064 1.00 31.87 ? 136 LYS P CG  1 
ATOM   609  C  CD  . LYS A 1 136 ? 41.443 30.374 60.116 1.00 37.25 ? 136 LYS P CD  1 
ATOM   610  C  CE  . LYS A 1 136 ? 41.446 29.801 61.528 1.00 39.29 ? 136 LYS P CE  1 
ATOM   611  N  NZ  . LYS A 1 136 ? 40.475 30.492 62.449 1.00 41.99 ? 136 LYS P NZ  1 
ATOM   612  N  N   . LEU A 1 137 ? 39.879 25.034 58.022 1.00 30.26 ? 137 LEU P N   1 
ATOM   613  C  CA  . LEU A 1 137 ? 39.714 23.595 58.258 1.00 30.65 ? 137 LEU P CA  1 
ATOM   614  C  C   . LEU A 1 137 ? 40.696 22.755 57.436 1.00 30.84 ? 137 LEU P C   1 
ATOM   615  O  O   . LEU A 1 137 ? 41.061 23.138 56.322 1.00 29.60 ? 137 LEU P O   1 
ATOM   616  C  CB  . LEU A 1 137 ? 38.295 23.148 57.895 1.00 30.66 ? 137 LEU P CB  1 
ATOM   617  C  CG  . LEU A 1 137 ? 37.097 23.678 58.681 1.00 30.61 ? 137 LEU P CG  1 
ATOM   618  C  CD1 . LEU A 1 137 ? 35.853 23.395 57.877 1.00 31.32 ? 137 LEU P CD1 1 
ATOM   619  C  CD2 . LEU A 1 137 ? 37.014 23.057 60.051 1.00 30.83 ? 137 LEU P CD2 1 
ATOM   620  N  N   . PRO A 1 138 ? 41.098 21.581 57.976 1.00 31.21 ? 138 PRO P N   1 
ATOM   621  C  CA  . PRO A 1 138 ? 41.990 20.678 57.261 1.00 30.93 ? 138 PRO P CA  1 
ATOM   622  C  C   . PRO A 1 138 ? 41.353 20.248 55.940 1.00 29.84 ? 138 PRO P C   1 
ATOM   623  O  O   . PRO A 1 138 ? 40.130 20.135 55.857 1.00 30.14 ? 138 PRO P O   1 
ATOM   624  C  CB  . PRO A 1 138 ? 42.123 19.467 58.221 1.00 31.40 ? 138 PRO P CB  1 
ATOM   625  C  CG  . PRO A 1 138 ? 40.945 19.566 59.144 1.00 33.15 ? 138 PRO P CG  1 
ATOM   626  C  CD  . PRO A 1 138 ? 40.726 21.054 59.305 1.00 31.76 ? 138 PRO P CD  1 
ATOM   627  N  N   . HIS A 1 139 ? 42.178 20.044 54.925 1.00 28.93 ? 139 HIS P N   1 
ATOM   628  C  CA  . HIS A 1 139 ? 41.754 19.499 53.630 1.00 29.11 ? 139 HIS P CA  1 
ATOM   629  C  C   . HIS A 1 139 ? 41.049 20.489 52.693 1.00 27.60 ? 139 HIS P C   1 
ATOM   630  O  O   . HIS A 1 139 ? 40.884 20.186 51.514 1.00 27.32 ? 139 HIS P O   1 
ATOM   631  C  CB  . HIS A 1 139 ? 40.920 18.217 53.793 1.00 29.28 ? 139 HIS P CB  1 
ATOM   632  C  CG  . HIS A 1 139 ? 41.549 17.211 54.713 1.00 32.83 ? 139 HIS P CG  1 
ATOM   633  N  ND1 . HIS A 1 139 ? 41.041 16.923 55.963 1.00 36.27 ? 139 HIS P ND1 1 
ATOM   634  C  CD2 . HIS A 1 139 ? 42.671 16.467 54.582 1.00 32.60 ? 139 HIS P CD2 1 
ATOM   635  C  CE1 . HIS A 1 139 ? 41.812 16.028 56.554 1.00 35.53 ? 139 HIS P CE1 1 
ATOM   636  N  NE2 . HIS A 1 139 ? 42.812 15.741 55.740 1.00 36.56 ? 139 HIS P NE2 1 
ATOM   637  N  N   . VAL A 1 140 ? 40.642 21.654 53.198 1.00 26.60 ? 140 VAL P N   1 
ATOM   638  C  CA  . VAL A 1 140 ? 39.879 22.607 52.363 1.00 25.34 ? 140 VAL P CA  1 
ATOM   639  C  C   . VAL A 1 140 ? 40.711 23.131 51.200 1.00 25.01 ? 140 VAL P C   1 
ATOM   640  O  O   . VAL A 1 140 ? 41.863 23.544 51.372 1.00 25.23 ? 140 VAL P O   1 
ATOM   641  C  CB  . VAL A 1 140 ? 39.256 23.782 53.186 1.00 25.93 ? 140 VAL P CB  1 
ATOM   642  C  CG1 . VAL A 1 140 ? 38.575 24.789 52.270 1.00 24.08 ? 140 VAL P CG1 1 
ATOM   643  C  CG2 . VAL A 1 140 ? 38.255 23.253 54.201 1.00 24.36 ? 140 VAL P CG2 1 
ATOM   644  N  N   . ASP A 1 141 ? 40.115 23.105 50.014 1.00 24.34 ? 141 ASP P N   1 
ATOM   645  C  CA  . ASP A 1 141 ? 40.758 23.582 48.798 1.00 24.12 ? 141 ASP P CA  1 
ATOM   646  C  C   . ASP A 1 141 ? 40.153 24.955 48.491 1.00 23.53 ? 141 ASP P C   1 
ATOM   647  O  O   . ASP A 1 141 ? 40.870 25.972 48.400 1.00 22.77 ? 141 ASP P O   1 
ATOM   648  C  CB  . ASP A 1 141 ? 40.514 22.568 47.665 1.00 23.40 ? 141 ASP P CB  1 
ATOM   649  C  CG  . ASP A 1 141 ? 41.289 22.872 46.397 1.00 26.89 ? 141 ASP P CG  1 
ATOM   650  O  OD1 . ASP A 1 141 ? 42.150 23.773 46.385 1.00 28.69 ? 141 ASP P OD1 1 
ATOM   651  O  OD2 . ASP A 1 141 ? 41.040 22.170 45.379 1.00 30.12 ? 141 ASP P OD2 1 
ATOM   652  N  N   . TYR A 1 142 ? 38.830 25.000 48.357 1.00 22.77 ? 142 TYR P N   1 
ATOM   653  C  CA  . TYR A 1 142 ? 38.143 26.279 48.255 1.00 21.98 ? 142 TYR P CA  1 
ATOM   654  C  C   . TYR A 1 142 ? 36.708 26.139 48.714 1.00 22.18 ? 142 TYR P C   1 
ATOM   655  O  O   . TYR A 1 142 ? 36.237 25.014 48.953 1.00 21.44 ? 142 TYR P O   1 
ATOM   656  C  CB  . TYR A 1 142 ? 38.219 26.824 46.817 1.00 21.63 ? 142 TYR P CB  1 
ATOM   657  C  CG  . TYR A 1 142 ? 37.685 25.886 45.755 1.00 21.65 ? 142 TYR P CG  1 
ATOM   658  C  CD1 . TYR A 1 142 ? 36.369 25.994 45.303 1.00 23.06 ? 142 TYR P CD1 1 
ATOM   659  C  CD2 . TYR A 1 142 ? 38.487 24.893 45.208 1.00 20.65 ? 142 TYR P CD2 1 
ATOM   660  C  CE1 . TYR A 1 142 ? 35.860 25.120 44.325 1.00 19.71 ? 142 TYR P CE1 1 
ATOM   661  C  CE2 . TYR A 1 142 ? 37.998 24.035 44.209 1.00 21.31 ? 142 TYR P CE2 1 
ATOM   662  C  CZ  . TYR A 1 142 ? 36.673 24.159 43.790 1.00 21.82 ? 142 TYR P CZ  1 
ATOM   663  O  OH  . TYR A 1 142 ? 36.184 23.299 42.822 1.00 23.82 ? 142 TYR P OH  1 
ATOM   664  N  N   . ILE A 1 143 ? 36.021 27.281 48.829 1.00 20.60 ? 143 ILE P N   1 
ATOM   665  C  CA  . ILE A 1 143 ? 34.624 27.340 49.191 1.00 20.69 ? 143 ILE P CA  1 
ATOM   666  C  C   . ILE A 1 143 ? 33.883 28.219 48.196 1.00 21.91 ? 143 ILE P C   1 
ATOM   667  O  O   . ILE A 1 143 ? 34.348 29.312 47.863 1.00 21.85 ? 143 ILE P O   1 
ATOM   668  C  CB  . ILE A 1 143 ? 34.436 27.870 50.648 1.00 19.82 ? 143 ILE P CB  1 
ATOM   669  C  CG1 . ILE A 1 143 ? 35.220 26.966 51.616 1.00 20.35 ? 143 ILE P CG1 1 
ATOM   670  C  CG2 . ILE A 1 143 ? 32.945 27.964 51.007 1.00 20.11 ? 143 ILE P CG2 1 
ATOM   671  C  CD1 . ILE A 1 143 ? 35.168 27.350 53.105 1.00 18.75 ? 143 ILE P CD1 1 
ATOM   672  N  N   . GLU A 1 144 ? 32.750 27.721 47.702 1.00 22.96 ? 144 GLU P N   1 
ATOM   673  C  CA  . GLU A 1 144 ? 31.921 28.485 46.772 1.00 23.28 ? 144 GLU P CA  1 
ATOM   674  C  C   . GLU A 1 144 ? 30.522 28.705 47.327 1.00 22.53 ? 144 GLU P C   1 
ATOM   675  O  O   . GLU A 1 144 ? 29.822 27.747 47.736 1.00 22.59 ? 144 GLU P O   1 
ATOM   676  C  CB  . GLU A 1 144 ? 31.907 27.794 45.390 1.00 23.66 ? 144 GLU P CB  1 
ATOM   677  C  CG  . GLU A 1 144 ? 31.125 28.559 44.328 1.00 26.02 ? 144 GLU P CG  1 
ATOM   678  C  CD  . GLU A 1 144 ? 31.303 27.980 42.932 1.00 26.46 ? 144 GLU P CD  1 
ATOM   679  O  OE1 . GLU A 1 144 ? 30.318 28.011 42.166 1.00 29.36 ? 144 GLU P OE1 1 
ATOM   680  O  OE2 . GLU A 1 144 ? 32.430 27.509 42.600 1.00 28.07 ? 144 GLU P OE2 1 
ATOM   681  N  N   . GLU A 1 145 ? 30.090 29.966 47.354 1.00 21.11 ? 145 GLU P N   1 
ATOM   682  C  CA  . GLU A 1 145 ? 28.724 30.270 47.716 1.00 20.81 ? 145 GLU P CA  1 
ATOM   683  C  C   . GLU A 1 145 ? 27.792 29.693 46.637 1.00 21.52 ? 145 GLU P C   1 
ATOM   684  O  O   . GLU A 1 145 ? 28.098 29.777 45.439 1.00 20.26 ? 145 GLU P O   1 
ATOM   685  C  CB  . GLU A 1 145 ? 28.544 31.785 47.851 1.00 21.35 ? 145 GLU P CB  1 
ATOM   686  C  CG  . GLU A 1 145 ? 27.170 32.194 48.312 1.00 23.10 ? 145 GLU P CG  1 
ATOM   687  C  CD  . GLU A 1 145 ? 26.899 33.681 48.106 1.00 26.82 ? 145 GLU P CD  1 
ATOM   688  O  OE1 . GLU A 1 145 ? 26.769 34.121 46.937 1.00 27.45 ? 145 GLU P OE1 1 
ATOM   689  O  OE2 . GLU A 1 145 ? 26.795 34.406 49.115 1.00 27.21 ? 145 GLU P OE2 1 
ATOM   690  N  N   . ASP A 1 146 ? 26.669 29.101 47.047 1.00 21.40 ? 146 ASP P N   1 
ATOM   691  C  CA  . ASP A 1 146 ? 25.703 28.557 46.065 1.00 22.14 ? 146 ASP P CA  1 
ATOM   692  C  C   . ASP A 1 146 ? 25.140 29.667 45.144 1.00 22.29 ? 146 ASP P C   1 
ATOM   693  O  O   . ASP A 1 146 ? 25.051 30.826 45.539 1.00 22.99 ? 146 ASP P O   1 
ATOM   694  C  CB  . ASP A 1 146 ? 24.558 27.832 46.786 1.00 21.52 ? 146 ASP P CB  1 
ATOM   695  C  CG  . ASP A 1 146 ? 23.983 26.643 45.983 1.00 23.22 ? 146 ASP P CG  1 
ATOM   696  O  OD1 . ASP A 1 146 ? 24.424 26.391 44.848 1.00 23.21 ? 146 ASP P OD1 1 
ATOM   697  O  OD2 . ASP A 1 146 ? 23.071 25.954 46.497 1.00 22.83 ? 146 ASP P OD2 1 
ATOM   698  N  N   . SER A 1 147 ? 24.753 29.311 43.925 1.00 22.40 ? 147 SER P N   1 
ATOM   699  C  CA  . SER A 1 147 ? 24.154 30.283 43.010 1.00 21.84 ? 147 SER P CA  1 
ATOM   700  C  C   . SER A 1 147 ? 23.158 29.609 42.083 1.00 21.76 ? 147 SER P C   1 
ATOM   701  O  O   . SER A 1 147 ? 23.052 28.367 42.071 1.00 20.79 ? 147 SER P O   1 
ATOM   702  C  CB  . SER A 1 147 ? 25.229 31.068 42.248 1.00 22.40 ? 147 SER P CB  1 
ATOM   703  O  OG  . SER A 1 147 ? 26.046 30.240 41.456 1.00 24.97 ? 147 SER P OG  1 
ATOM   704  N  N   . SER A 1 148 ? 22.394 30.422 41.355 1.00 21.01 ? 148 SER P N   1 
ATOM   705  C  CA  . SER A 1 148 ? 21.299 29.944 40.506 1.00 21.25 ? 148 SER P CA  1 
ATOM   706  C  C   . SER A 1 148 ? 21.787 29.504 39.140 1.00 20.96 ? 148 SER P C   1 
ATOM   707  O  O   . SER A 1 148 ? 22.754 30.068 38.591 1.00 21.06 ? 148 SER P O   1 
ATOM   708  C  CB  . SER A 1 148 ? 20.216 31.032 40.330 1.00 21.14 ? 148 SER P CB  1 
ATOM   709  O  OG  . SER A 1 148 ? 19.724 31.472 41.575 1.00 22.71 ? 148 SER P OG  1 
ATOM   710  N  N   . VAL A 1 149 ? 21.113 28.494 38.592 1.00 19.80 ? 149 VAL P N   1 
ATOM   711  C  CA  . VAL A 1 149 ? 21.256 28.120 37.181 1.00 20.26 ? 149 VAL P CA  1 
ATOM   712  C  C   . VAL A 1 149 ? 19.862 28.166 36.564 1.00 20.36 ? 149 VAL P C   1 
ATOM   713  O  O   . VAL A 1 149 ? 18.862 28.086 37.294 1.00 20.36 ? 149 VAL P O   1 
ATOM   714  C  CB  . VAL A 1 149 ? 21.956 26.722 36.964 1.00 20.17 ? 149 VAL P CB  1 
ATOM   715  C  CG1 . VAL A 1 149 ? 23.380 26.744 37.472 1.00 19.78 ? 149 VAL P CG1 1 
ATOM   716  C  CG2 . VAL A 1 149 ? 21.152 25.553 37.581 1.00 20.79 ? 149 VAL P CG2 1 
ATOM   717  N  N   . PHE A 1 150 ? 19.795 28.322 35.238 1.00 21.41 ? 150 PHE P N   1 
ATOM   718  C  CA  . PHE A 1 150 ? 18.538 28.582 34.530 1.00 21.15 ? 150 PHE P CA  1 
ATOM   719  C  C   . PHE A 1 150 ? 18.427 27.789 33.231 1.00 20.86 ? 150 PHE P C   1 
ATOM   720  O  O   . PHE A 1 150 ? 19.399 27.649 32.500 1.00 21.15 ? 150 PHE P O   1 
ATOM   721  C  CB  . PHE A 1 150 ? 18.425 30.079 34.168 1.00 21.92 ? 150 PHE P CB  1 
ATOM   722  C  CG  . PHE A 1 150 ? 18.516 31.012 35.352 1.00 22.23 ? 150 PHE P CG  1 
ATOM   723  C  CD1 . PHE A 1 150 ? 17.390 31.263 36.143 1.00 25.82 ? 150 PHE P CD1 1 
ATOM   724  C  CD2 . PHE A 1 150 ? 19.709 31.638 35.674 1.00 22.48 ? 150 PHE P CD2 1 
ATOM   725  C  CE1 . PHE A 1 150 ? 17.461 32.130 37.243 1.00 24.77 ? 150 PHE P CE1 1 
ATOM   726  C  CE2 . PHE A 1 150 ? 19.794 32.491 36.780 1.00 23.33 ? 150 PHE P CE2 1 
ATOM   727  C  CZ  . PHE A 1 150 ? 18.662 32.740 37.555 1.00 24.00 ? 150 PHE P CZ  1 
ATOM   728  N  N   . ALA A 1 151 ? 17.225 27.293 32.950 1.00 20.70 ? 151 ALA P N   1 
ATOM   729  C  CA  . ALA A 1 151 ? 16.879 26.641 31.688 1.00 21.39 ? 151 ALA P CA  1 
ATOM   730  C  C   . ALA A 1 151 ? 17.228 27.584 30.552 1.00 22.16 ? 151 ALA P C   1 
ATOM   731  O  O   . ALA A 1 151 ? 16.970 28.789 30.650 1.00 22.82 ? 151 ALA P O   1 
ATOM   732  C  CB  . ALA A 1 151 ? 15.373 26.334 31.663 1.00 21.18 ? 151 ALA P CB  1 
ATOM   733  N  N   . GLN A 1 152 ? 17.844 27.056 29.499 1.00 22.97 ? 152 GLN P N   1 
ATOM   734  C  CA  . GLN A 1 152 ? 18.230 27.856 28.330 1.00 24.24 ? 152 GLN P CA  1 
ATOM   735  C  C   . GLN A 1 152 ? 17.388 27.527 27.081 1.00 25.65 ? 152 GLN P C   1 
ATOM   736  O  O   . GLN A 1 152 ? 16.209 27.204 27.226 1.00 27.52 ? 152 GLN P O   1 
ATOM   737  C  CB  . GLN A 1 152 ? 19.741 27.728 28.069 1.00 23.86 ? 152 GLN P CB  1 
ATOM   738  C  CG  . GLN A 1 152 ? 20.578 28.211 29.275 1.00 21.28 ? 152 GLN P CG  1 
ATOM   739  C  CD  . GLN A 1 152 ? 20.373 29.698 29.553 1.00 25.03 ? 152 GLN P CD  1 
ATOM   740  O  OE1 . GLN A 1 152 ? 20.546 30.539 28.661 1.00 22.78 ? 152 GLN P OE1 1 
ATOM   741  N  NE2 . GLN A 1 152 ? 20.011 30.028 30.785 1.00 22.64 ? 152 GLN P NE2 1 
ATOM   742  N  N   . SER B 1 153 ? 8.175  18.558 4.564  1.00 39.79 ? 153 SER A N   1 
ATOM   743  C  CA  . SER B 1 153 ? 7.502  17.921 5.738  1.00 39.28 ? 153 SER A CA  1 
ATOM   744  C  C   . SER B 1 153 ? 8.452  17.565 6.891  1.00 37.95 ? 153 SER A C   1 
ATOM   745  O  O   . SER B 1 153 ? 8.024  17.569 8.057  1.00 38.79 ? 153 SER A O   1 
ATOM   746  C  CB  . SER B 1 153 ? 6.751  16.668 5.310  1.00 39.61 ? 153 SER A CB  1 
ATOM   747  O  OG  . SER B 1 153 ? 6.125  16.076 6.436  1.00 41.21 ? 153 SER A OG  1 
ATOM   748  N  N   . ILE B 1 154 ? 9.706  17.211 6.577  1.00 35.49 ? 154 ILE A N   1 
ATOM   749  C  CA  . ILE B 1 154 ? 10.737 17.023 7.611  1.00 32.94 ? 154 ILE A CA  1 
ATOM   750  C  C   . ILE B 1 154 ? 10.961 18.392 8.288  1.00 30.71 ? 154 ILE A C   1 
ATOM   751  O  O   . ILE B 1 154 ? 11.100 19.399 7.589  1.00 30.18 ? 154 ILE A O   1 
ATOM   752  C  CB  . ILE B 1 154 ? 12.093 16.504 7.010  1.00 33.16 ? 154 ILE A CB  1 
ATOM   753  C  CG1 . ILE B 1 154 ? 11.950 15.143 6.302  1.00 34.51 ? 154 ILE A CG1 1 
ATOM   754  C  CG2 . ILE B 1 154 ? 13.211 16.447 8.061  1.00 33.58 ? 154 ILE A CG2 1 
ATOM   755  C  CD1 . ILE B 1 154 ? 11.298 14.019 7.088  1.00 34.94 ? 154 ILE A CD1 1 
ATOM   756  N  N   . PRO B 1 155 ? 10.977 18.443 9.640  1.00 29.40 ? 155 PRO A N   1 
ATOM   757  C  CA  . PRO B 1 155 ? 11.316 19.709 10.327 1.00 28.10 ? 155 PRO A CA  1 
ATOM   758  C  C   . PRO B 1 155 ? 12.649 20.272 9.822  1.00 26.77 ? 155 PRO A C   1 
ATOM   759  O  O   . PRO B 1 155 ? 13.584 19.508 9.612  1.00 27.27 ? 155 PRO A O   1 
ATOM   760  C  CB  . PRO B 1 155 ? 11.462 19.278 11.784 1.00 28.41 ? 155 PRO A CB  1 
ATOM   761  C  CG  . PRO B 1 155 ? 10.569 18.089 11.915 1.00 28.60 ? 155 PRO A CG  1 
ATOM   762  C  CD  . PRO B 1 155 ? 10.681 17.364 10.603 1.00 29.16 ? 155 PRO A CD  1 
ATOM   763  N  N   . TRP B 1 156 ? 12.738 21.584 9.625  1.00 25.19 ? 156 TRP A N   1 
ATOM   764  C  CA  . TRP B 1 156 ? 13.919 22.183 8.996  1.00 23.99 ? 156 TRP A CA  1 
ATOM   765  C  C   . TRP B 1 156 ? 15.236 21.741 9.673  1.00 23.23 ? 156 TRP A C   1 
ATOM   766  O  O   . TRP B 1 156 ? 16.237 21.526 8.997  1.00 22.46 ? 156 TRP A O   1 
ATOM   767  C  CB  . TRP B 1 156 ? 13.801 23.711 8.947  1.00 23.51 ? 156 TRP A CB  1 
ATOM   768  C  CG  . TRP B 1 156 ? 14.164 24.395 10.258 1.00 23.35 ? 156 TRP A CG  1 
ATOM   769  C  CD1 . TRP B 1 156 ? 13.305 24.787 11.242 1.00 23.65 ? 156 TRP A CD1 1 
ATOM   770  C  CD2 . TRP B 1 156 ? 15.479 24.762 10.703 1.00 22.69 ? 156 TRP A CD2 1 
ATOM   771  N  NE1 . TRP B 1 156 ? 14.005 25.370 12.282 1.00 25.02 ? 156 TRP A NE1 1 
ATOM   772  C  CE2 . TRP B 1 156 ? 15.339 25.370 11.968 1.00 22.23 ? 156 TRP A CE2 1 
ATOM   773  C  CE3 . TRP B 1 156 ? 16.764 24.633 10.153 1.00 22.64 ? 156 TRP A CE3 1 
ATOM   774  C  CZ2 . TRP B 1 156 ? 16.424 25.839 12.689 1.00 22.94 ? 156 TRP A CZ2 1 
ATOM   775  C  CZ3 . TRP B 1 156 ? 17.833 25.094 10.869 1.00 23.93 ? 156 TRP A CZ3 1 
ATOM   776  C  CH2 . TRP B 1 156 ? 17.658 25.703 12.129 1.00 22.55 ? 156 TRP A CH2 1 
ATOM   777  N  N   . ASN B 1 157 ? 15.197 21.589 11.003 1.00 22.06 ? 157 ASN A N   1 
ATOM   778  C  CA  . ASN B 1 157 ? 16.385 21.330 11.816 1.00 21.41 ? 157 ASN A CA  1 
ATOM   779  C  C   . ASN B 1 157 ? 16.922 19.905 11.649 1.00 21.99 ? 157 ASN A C   1 
ATOM   780  O  O   . ASN B 1 157 ? 18.123 19.665 11.731 1.00 20.87 ? 157 ASN A O   1 
ATOM   781  C  CB  . ASN B 1 157 ? 16.064 21.584 13.289 1.00 20.69 ? 157 ASN A CB  1 
ATOM   782  C  CG  . ASN B 1 157 ? 14.827 20.828 13.763 1.00 20.09 ? 157 ASN A CG  1 
ATOM   783  O  OD1 . ASN B 1 157 ? 13.720 21.099 13.312 1.00 21.43 ? 157 ASN A OD1 1 
ATOM   784  N  ND2 . ASN B 1 157 ? 15.009 19.909 14.712 1.00 21.13 ? 157 ASN A ND2 1 
ATOM   785  N  N   . LEU B 1 158 ? 16.008 18.966 11.428 1.00 22.53 ? 158 LEU A N   1 
ATOM   786  C  CA  . LEU B 1 158 ? 16.372 17.579 11.122 1.00 23.31 ? 158 LEU A CA  1 
ATOM   787  C  C   . LEU B 1 158 ? 16.965 17.450 9.720  1.00 24.30 ? 158 LEU A C   1 
ATOM   788  O  O   . LEU B 1 158 ? 17.928 16.687 9.510  1.00 25.64 ? 158 LEU A O   1 
ATOM   789  C  CB  . LEU B 1 158 ? 15.158 16.653 11.305 1.00 23.49 ? 158 LEU A CB  1 
ATOM   790  C  CG  . LEU B 1 158 ? 14.571 16.633 12.723 1.00 24.28 ? 158 LEU A CG  1 
ATOM   791  C  CD1 . LEU B 1 158 ? 13.464 15.581 12.849 1.00 23.41 ? 158 LEU A CD1 1 
ATOM   792  C  CD2 . LEU B 1 158 ? 15.677 16.405 13.762 1.00 24.15 ? 158 LEU A CD2 1 
ATOM   793  N  N   . GLU B 1 159 ? 16.411 18.188 8.758  1.00 23.72 ? 159 GLU A N   1 
ATOM   794  C  CA  . GLU B 1 159 ? 17.044 18.291 7.446  1.00 23.53 ? 159 GLU A CA  1 
ATOM   795  C  C   . GLU B 1 159 ? 18.437 18.941 7.508  1.00 22.98 ? 159 GLU A C   1 
ATOM   796  O  O   . GLU B 1 159 ? 19.385 18.465 6.879  1.00 21.57 ? 159 GLU A O   1 
ATOM   797  C  CB  . GLU B 1 159 ? 16.174 19.048 6.452  1.00 23.40 ? 159 GLU A CB  1 
ATOM   798  C  CG  . GLU B 1 159 ? 16.656 18.882 5.008  1.00 26.28 ? 159 GLU A CG  1 
ATOM   799  C  CD  . GLU B 1 159 ? 16.691 17.404 4.522  1.00 30.48 ? 159 GLU A CD  1 
ATOM   800  O  OE1 . GLU B 1 159 ? 17.758 16.917 4.048  1.00 30.53 ? 159 GLU A OE1 1 
ATOM   801  O  OE2 . GLU B 1 159 ? 15.651 16.718 4.610  1.00 33.73 ? 159 GLU A OE2 1 
ATOM   802  N  N   . ARG B 1 160 ? 18.551 20.038 8.252  1.00 22.62 ? 160 ARG A N   1 
ATOM   803  C  CA  . ARG B 1 160 ? 19.807 20.774 8.356  1.00 23.18 ? 160 ARG A CA  1 
ATOM   804  C  C   . ARG B 1 160 ? 20.994 19.908 8.848  1.00 22.38 ? 160 ARG A C   1 
ATOM   805  O  O   . ARG B 1 160 ? 22.121 20.057 8.357  1.00 23.21 ? 160 ARG A O   1 
ATOM   806  C  CB  . ARG B 1 160 ? 19.607 22.033 9.238  1.00 22.57 ? 160 ARG A CB  1 
ATOM   807  C  CG  . ARG B 1 160 ? 20.779 22.989 9.251  1.00 25.76 ? 160 ARG A CG  1 
ATOM   808  C  CD  . ARG B 1 160 ? 21.004 23.642 7.869  1.00 26.99 ? 160 ARG A CD  1 
ATOM   809  N  NE  . ARG B 1 160 ? 19.728 24.029 7.250  1.00 32.11 ? 160 ARG A NE  1 
ATOM   810  C  CZ  . ARG B 1 160 ? 19.226 25.264 7.222  1.00 33.15 ? 160 ARG A CZ  1 
ATOM   811  N  NH1 . ARG B 1 160 ? 19.875 26.276 7.783  1.00 32.67 ? 160 ARG A NH1 1 
ATOM   812  N  NH2 . ARG B 1 160 ? 18.057 25.483 6.633  1.00 34.05 ? 160 ARG A NH2 1 
ATOM   813  N  N   . ILE B 1 161 ? 20.746 19.021 9.808  1.00 22.77 ? 161 ILE A N   1 
ATOM   814  C  CA  . ILE B 1 161 ? 21.790 18.114 10.323 1.00 23.92 ? 161 ILE A CA  1 
ATOM   815  C  C   . ILE B 1 161 ? 22.010 16.850 9.456  1.00 25.62 ? 161 ILE A C   1 
ATOM   816  O  O   . ILE B 1 161 ? 22.929 16.060 9.706  1.00 26.23 ? 161 ILE A O   1 
ATOM   817  C  CB  . ILE B 1 161 ? 21.558 17.718 11.803 1.00 22.72 ? 161 ILE A CB  1 
ATOM   818  C  CG1 . ILE B 1 161 ? 20.345 16.795 11.959 1.00 24.00 ? 161 ILE A CG1 1 
ATOM   819  C  CG2 . ILE B 1 161 ? 21.471 18.979 12.718 1.00 22.15 ? 161 ILE A CG2 1 
ATOM   820  C  CD1 . ILE B 1 161 ? 20.283 16.072 13.313 1.00 24.12 ? 161 ILE A CD1 1 
ATOM   821  N  N   . THR B 1 162 ? 21.166 16.656 8.449  1.00 27.30 ? 162 THR A N   1 
ATOM   822  C  CA  . THR B 1 162 ? 21.291 15.517 7.545  1.00 29.28 ? 162 THR A CA  1 
ATOM   823  C  C   . THR B 1 162 ? 22.457 15.768 6.593  1.00 30.48 ? 162 THR A C   1 
ATOM   824  O  O   . THR B 1 162 ? 22.507 16.804 5.936  1.00 30.95 ? 162 THR A O   1 
ATOM   825  C  CB  . THR B 1 162 ? 19.991 15.282 6.747  1.00 28.75 ? 162 THR A CB  1 
ATOM   826  O  OG1 . THR B 1 162 ? 18.952 14.958 7.661  1.00 29.44 ? 162 THR A OG1 1 
ATOM   827  C  CG2 . THR B 1 162 ? 20.137 14.102 5.748  1.00 30.50 ? 162 THR A CG2 1 
ATOM   828  N  N   . PRO B 1 163 ? 23.402 14.821 6.524  1.00 32.02 ? 163 PRO A N   1 
ATOM   829  C  CA  . PRO B 1 163 ? 24.591 14.986 5.691  1.00 32.94 ? 163 PRO A CA  1 
ATOM   830  C  C   . PRO B 1 163 ? 24.283 14.873 4.190  1.00 34.06 ? 163 PRO A C   1 
ATOM   831  O  O   . PRO B 1 163 ? 23.205 14.392 3.815  1.00 33.00 ? 163 PRO A O   1 
ATOM   832  C  CB  . PRO B 1 163 ? 25.469 13.824 6.139  1.00 33.21 ? 163 PRO A CB  1 
ATOM   833  C  CG  . PRO B 1 163 ? 24.512 12.798 6.578  1.00 32.30 ? 163 PRO A CG  1 
ATOM   834  C  CD  . PRO B 1 163 ? 23.406 13.525 7.225  1.00 31.74 ? 163 PRO A CD  1 
ATOM   835  N  N   . PRO B 1 164 ? 25.211 15.344 3.335  1.00 34.99 ? 164 PRO A N   1 
ATOM   836  C  CA  . PRO B 1 164 ? 25.006 15.277 1.888  1.00 36.17 ? 164 PRO A CA  1 
ATOM   837  C  C   . PRO B 1 164 ? 24.900 13.858 1.298  1.00 36.60 ? 164 PRO A C   1 
ATOM   838  O  O   . PRO B 1 164 ? 24.466 13.715 0.162  1.00 36.70 ? 164 PRO A O   1 
ATOM   839  C  CB  . PRO B 1 164 ? 26.203 16.058 1.330  1.00 36.43 ? 164 PRO A CB  1 
ATOM   840  C  CG  . PRO B 1 164 ? 26.630 16.960 2.477  1.00 35.70 ? 164 PRO A CG  1 
ATOM   841  C  CD  . PRO B 1 164 ? 26.468 16.044 3.659  1.00 35.60 ? 164 PRO A CD  1 
ATOM   842  N  N   . ARG B 1 165 ? 25.266 12.838 2.070  1.00 37.75 ? 165 ARG A N   1 
ATOM   843  C  CA  . ARG B 1 165 ? 25.030 11.444 1.707  1.00 39.56 ? 165 ARG A CA  1 
ATOM   844  C  C   . ARG B 1 165 ? 24.630 10.628 2.938  1.00 40.60 ? 165 ARG A C   1 
ATOM   845  O  O   . ARG B 1 165 ? 25.319 10.653 3.952  1.00 40.81 ? 165 ARG A O   1 
ATOM   846  C  CB  . ARG B 1 165 ? 26.264 10.842 1.014  1.00 39.94 ? 165 ARG A CB  1 
ATOM   847  C  CG  . ARG B 1 165 ? 26.123 9.360  0.724  1.00 42.08 ? 165 ARG A CG  1 
ATOM   848  C  CD  . ARG B 1 165 ? 26.688 8.958  -0.626 1.00 46.31 ? 165 ARG A CD  1 
ATOM   849  N  NE  . ARG B 1 165 ? 26.403 7.542  -0.876 1.00 48.60 ? 165 ARG A NE  1 
ATOM   850  C  CZ  . ARG B 1 165 ? 26.446 6.952  -2.067 1.00 49.80 ? 165 ARG A CZ  1 
ATOM   851  N  NH1 . ARG B 1 165 ? 26.757 7.646  -3.154 1.00 49.69 ? 165 ARG A NH1 1 
ATOM   852  N  NH2 . ARG B 1 165 ? 26.158 5.660  -2.172 1.00 50.89 ? 165 ARG A NH2 1 
ATOM   853  N  N   . TYR B 1 166 ? 23.515 9.910  2.861  1.00 41.74 ? 166 TYR A N   1 
ATOM   854  C  CA  . TYR B 1 166 ? 22.991 9.199  4.029  1.00 43.45 ? 166 TYR A CA  1 
ATOM   855  C  C   . TYR B 1 166 ? 22.129 7.980  3.672  1.00 44.83 ? 166 TYR A C   1 
ATOM   856  O  O   . TYR B 1 166 ? 21.749 7.795  2.515  1.00 45.02 ? 166 TYR A O   1 
ATOM   857  C  CB  . TYR B 1 166 ? 22.215 10.165 4.944  1.00 43.46 ? 166 TYR A CB  1 
ATOM   858  C  CG  . TYR B 1 166 ? 20.945 10.736 4.343  1.00 43.46 ? 166 TYR A CG  1 
ATOM   859  C  CD1 . TYR B 1 166 ? 19.696 10.310 4.785  1.00 43.73 ? 166 TYR A CD1 1 
ATOM   860  C  CD2 . TYR B 1 166 ? 20.991 11.710 3.345  1.00 43.65 ? 166 TYR A CD2 1 
ATOM   861  C  CE1 . TYR B 1 166 ? 18.529 10.828 4.254  1.00 43.26 ? 166 TYR A CE1 1 
ATOM   862  C  CE2 . TYR B 1 166 ? 19.823 12.232 2.803  1.00 43.81 ? 166 TYR A CE2 1 
ATOM   863  C  CZ  . TYR B 1 166 ? 18.603 11.781 3.260  1.00 43.06 ? 166 TYR A CZ  1 
ATOM   864  O  OH  . TYR B 1 166 ? 17.449 12.288 2.724  1.00 44.46 ? 166 TYR A OH  1 
ATOM   865  N  N   . ARG B 1 167 ? 21.844 7.158  4.684  1.00 46.22 ? 167 ARG A N   1 
ATOM   866  C  CA  . ARG B 1 167 ? 20.968 5.997  4.558  1.00 47.88 ? 167 ARG A CA  1 
ATOM   867  C  C   . ARG B 1 167 ? 19.602 6.255  5.175  1.00 48.53 ? 167 ARG A C   1 
ATOM   868  O  O   . ARG B 1 167 ? 19.500 6.877  6.230  1.00 49.09 ? 167 ARG A O   1 
ATOM   869  C  CB  . ARG B 1 167 ? 21.586 4.777  5.247  1.00 48.23 ? 167 ARG A CB  1 
ATOM   870  C  CG  . ARG B 1 167 ? 22.933 4.371  4.696  1.00 50.00 ? 167 ARG A CG  1 
ATOM   871  C  CD  . ARG B 1 167 ? 22.977 2.896  4.426  1.00 53.36 ? 167 ARG A CD  1 
ATOM   872  N  NE  . ARG B 1 167 ? 23.621 2.649  3.139  1.00 56.67 ? 167 ARG A NE  1 
ATOM   873  C  CZ  . ARG B 1 167 ? 23.471 1.545  2.412  1.00 57.73 ? 167 ARG A CZ  1 
ATOM   874  N  NH1 . ARG B 1 167 ? 22.686 0.555  2.834  1.00 58.50 ? 167 ARG A NH1 1 
ATOM   875  N  NH2 . ARG B 1 167 ? 24.109 1.438  1.253  1.00 58.17 ? 167 ARG A NH2 1 
ATOM   876  N  N   . ALA B 1 168 ? 18.552 5.774  4.515  1.00 49.63 ? 168 ALA A N   1 
ATOM   877  C  CA  . ALA B 1 168 ? 17.206 5.801  5.098  1.00 50.45 ? 168 ALA A CA  1 
ATOM   878  C  C   . ALA B 1 168 ? 17.126 4.852  6.300  1.00 50.79 ? 168 ALA A C   1 
ATOM   879  O  O   . ALA B 1 168 ? 16.404 5.116  7.265  1.00 51.68 ? 168 ALA A O   1 
ATOM   880  C  CB  . ALA B 1 168 ? 16.154 5.437  4.057  1.00 50.39 ? 168 ALA A CB  1 
ATOM   881  N  N   . GLY B 1 176 ? 19.034 5.491  16.084 1.00 50.65 ? 176 GLY A N   1 
ATOM   882  C  CA  . GLY B 1 176 ? 19.575 6.333  17.151 1.00 50.02 ? 176 GLY A CA  1 
ATOM   883  C  C   . GLY B 1 176 ? 20.861 5.813  17.770 1.00 49.83 ? 176 GLY A C   1 
ATOM   884  O  O   . GLY B 1 176 ? 21.715 5.228  17.085 1.00 50.30 ? 176 GLY A O   1 
ATOM   885  N  N   . GLY B 1 177 ? 21.002 6.046  19.071 1.00 49.29 ? 177 GLY A N   1 
ATOM   886  C  CA  . GLY B 1 177 ? 22.124 5.531  19.858 1.00 47.93 ? 177 GLY A CA  1 
ATOM   887  C  C   . GLY B 1 177 ? 21.621 4.485  20.840 1.00 46.94 ? 177 GLY A C   1 
ATOM   888  O  O   . GLY B 1 177 ? 21.236 4.821  21.957 1.00 47.63 ? 177 GLY A O   1 
ATOM   889  N  N   . SER B 1 178 ? 21.616 3.220  20.422 1.00 45.38 ? 178 SER A N   1 
ATOM   890  C  CA  . SER B 1 178 ? 20.934 2.159  21.178 1.00 43.66 ? 178 SER A CA  1 
ATOM   891  C  C   . SER B 1 178 ? 21.764 1.565  22.327 1.00 41.37 ? 178 SER A C   1 
ATOM   892  O  O   . SER B 1 178 ? 21.213 1.216  23.369 1.00 41.63 ? 178 SER A O   1 
ATOM   893  C  CB  . SER B 1 178 ? 20.434 1.066  20.230 1.00 44.22 ? 178 SER A CB  1 
ATOM   894  O  OG  . SER B 1 178 ? 19.387 0.312  20.830 1.00 46.12 ? 178 SER A OG  1 
ATOM   895  N  N   . LEU B 1 179 ? 23.081 1.460  22.145 1.00 38.67 ? 179 LEU A N   1 
ATOM   896  C  CA  . LEU B 1 179 ? 23.964 1.032  23.233 1.00 35.39 ? 179 LEU A CA  1 
ATOM   897  C  C   . LEU B 1 179 ? 24.457 2.221  24.097 1.00 33.91 ? 179 LEU A C   1 
ATOM   898  O  O   . LEU B 1 179 ? 25.201 2.042  25.065 1.00 32.39 ? 179 LEU A O   1 
ATOM   899  C  CB  . LEU B 1 179 ? 25.126 0.191  22.693 1.00 36.08 ? 179 LEU A CB  1 
ATOM   900  C  CG  . LEU B 1 179 ? 26.112 0.732  21.656 1.00 34.86 ? 179 LEU A CG  1 
ATOM   901  C  CD1 . LEU B 1 179 ? 27.013 1.820  22.219 1.00 35.52 ? 179 LEU A CD1 1 
ATOM   902  C  CD2 . LEU B 1 179 ? 26.960 -0.397 21.154 1.00 34.78 ? 179 LEU A CD2 1 
ATOM   903  N  N   . VAL B 1 180 ? 23.998 3.418  23.734 1.00 32.50 ? 180 VAL A N   1 
ATOM   904  C  CA  . VAL B 1 180 ? 24.333 4.679  24.403 1.00 31.55 ? 180 VAL A CA  1 
ATOM   905  C  C   . VAL B 1 180 ? 23.192 5.053  25.341 1.00 31.24 ? 180 VAL A C   1 
ATOM   906  O  O   . VAL B 1 180 ? 22.020 4.824  25.037 1.00 31.56 ? 180 VAL A O   1 
ATOM   907  C  CB  . VAL B 1 180 ? 24.534 5.847  23.354 1.00 31.48 ? 180 VAL A CB  1 
ATOM   908  C  CG1 . VAL B 1 180 ? 24.993 7.150  24.031 1.00 30.17 ? 180 VAL A CG1 1 
ATOM   909  C  CG2 . VAL B 1 180 ? 25.518 5.462  22.286 1.00 30.86 ? 180 VAL A CG2 1 
ATOM   910  N  N   . GLU B 1 181 ? 23.522 5.629  26.487 1.00 30.63 ? 181 GLU A N   1 
ATOM   911  C  CA  . GLU B 1 181 ? 22.498 6.286  27.280 1.00 30.85 ? 181 GLU A CA  1 
ATOM   912  C  C   . GLU B 1 181 ? 22.726 7.797  27.295 1.00 28.79 ? 181 GLU A C   1 
ATOM   913  O  O   . GLU B 1 181 ? 23.872 8.263  27.338 1.00 27.54 ? 181 GLU A O   1 
ATOM   914  C  CB  . GLU B 1 181 ? 22.428 5.707  28.696 1.00 30.60 ? 181 GLU A CB  1 
ATOM   915  C  CG  . GLU B 1 181 ? 21.696 4.352  28.749 1.00 35.06 ? 181 GLU A CG  1 
ATOM   916  C  CD  . GLU B 1 181 ? 21.533 3.780  30.161 1.00 34.63 ? 181 GLU A CD  1 
ATOM   917  O  OE1 . GLU B 1 181 ? 21.691 4.530  31.150 1.00 39.20 ? 181 GLU A OE1 1 
ATOM   918  O  OE2 . GLU B 1 181 ? 21.223 2.568  30.263 1.00 40.21 ? 181 GLU A OE2 1 
ATOM   919  N  N   . VAL B 1 182 ? 21.627 8.545  27.229 1.00 27.56 ? 182 VAL A N   1 
ATOM   920  C  CA  . VAL B 1 182 ? 21.671 10.002 27.313 1.00 25.89 ? 182 VAL A CA  1 
ATOM   921  C  C   . VAL B 1 182 ? 21.010 10.429 28.616 1.00 24.98 ? 182 VAL A C   1 
ATOM   922  O  O   . VAL B 1 182 ? 19.830 10.177 28.836 1.00 24.11 ? 182 VAL A O   1 
ATOM   923  C  CB  . VAL B 1 182 ? 20.963 10.686 26.099 1.00 26.25 ? 182 VAL A CB  1 
ATOM   924  C  CG1 . VAL B 1 182 ? 21.074 12.178 26.185 1.00 26.01 ? 182 VAL A CG1 1 
ATOM   925  C  CG2 . VAL B 1 182 ? 21.569 10.216 24.767 1.00 26.05 ? 182 VAL A CG2 1 
ATOM   926  N  N   . TYR B 1 183 ? 21.762 11.081 29.487 1.00 24.15 ? 183 TYR A N   1 
ATOM   927  C  CA  . TYR B 1 183 ? 21.180 11.626 30.704 1.00 24.76 ? 183 TYR A CA  1 
ATOM   928  C  C   . TYR B 1 183 ? 20.725 13.071 30.490 1.00 25.06 ? 183 TYR A C   1 
ATOM   929  O  O   . TYR B 1 183 ? 21.443 13.866 29.883 1.00 25.43 ? 183 TYR A O   1 
ATOM   930  C  CB  . TYR B 1 183 ? 22.199 11.566 31.832 1.00 25.28 ? 183 TYR A CB  1 
ATOM   931  C  CG  . TYR B 1 183 ? 22.235 10.240 32.577 1.00 25.24 ? 183 TYR A CG  1 
ATOM   932  C  CD1 . TYR B 1 183 ? 23.040 9.178  32.142 1.00 26.54 ? 183 TYR A CD1 1 
ATOM   933  C  CD2 . TYR B 1 183 ? 21.470 10.059 33.713 1.00 23.99 ? 183 TYR A CD2 1 
ATOM   934  C  CE1 . TYR B 1 183 ? 23.060 7.943  32.857 1.00 24.62 ? 183 TYR A CE1 1 
ATOM   935  C  CE2 . TYR B 1 183 ? 21.498 8.866  34.442 1.00 27.44 ? 183 TYR A CE2 1 
ATOM   936  C  CZ  . TYR B 1 183 ? 22.297 7.815  34.011 1.00 26.77 ? 183 TYR A CZ  1 
ATOM   937  O  OH  . TYR B 1 183 ? 22.292 6.630  34.738 1.00 27.73 ? 183 TYR A OH  1 
ATOM   938  N  N   . LEU B 1 184 ? 19.541 13.405 30.978 1.00 25.55 ? 184 LEU A N   1 
ATOM   939  C  CA  . LEU B 1 184 ? 19.042 14.784 30.925 1.00 25.95 ? 184 LEU A CA  1 
ATOM   940  C  C   . LEU B 1 184 ? 18.842 15.388 32.316 1.00 25.67 ? 184 LEU A C   1 
ATOM   941  O  O   . LEU B 1 184 ? 18.035 14.884 33.104 1.00 25.72 ? 184 LEU A O   1 
ATOM   942  C  CB  . LEU B 1 184 ? 17.726 14.862 30.132 1.00 25.95 ? 184 LEU A CB  1 
ATOM   943  C  CG  . LEU B 1 184 ? 17.020 16.223 30.028 1.00 26.84 ? 184 LEU A CG  1 
ATOM   944  C  CD1 . LEU B 1 184 ? 17.822 17.248 29.187 1.00 24.40 ? 184 LEU A CD1 1 
ATOM   945  C  CD2 . LEU B 1 184 ? 15.609 16.045 29.470 1.00 26.95 ? 184 LEU A CD2 1 
ATOM   946  N  N   . LEU B 1 185 ? 19.536 16.495 32.594 1.00 24.71 ? 185 LEU A N   1 
ATOM   947  C  CA  . LEU B 1 185 ? 19.334 17.243 33.836 1.00 25.06 ? 185 LEU A CA  1 
ATOM   948  C  C   . LEU B 1 185 ? 18.540 18.502 33.517 1.00 25.03 ? 185 LEU A C   1 
ATOM   949  O  O   . LEU B 1 185 ? 19.067 19.437 32.913 1.00 24.13 ? 185 LEU A O   1 
ATOM   950  C  CB  . LEU B 1 185 ? 20.674 17.621 34.485 1.00 25.03 ? 185 LEU A CB  1 
ATOM   951  C  CG  . LEU B 1 185 ? 21.414 16.572 35.327 1.00 26.84 ? 185 LEU A CG  1 
ATOM   952  C  CD1 . LEU B 1 185 ? 21.951 15.494 34.433 1.00 28.10 ? 185 LEU A CD1 1 
ATOM   953  C  CD2 . LEU B 1 185 ? 22.525 17.252 36.079 1.00 28.65 ? 185 LEU A CD2 1 
ATOM   954  N  N   . ASP B 1 186 ? 17.268 18.520 33.891 1.00 25.40 ? 186 ASP A N   1 
ATOM   955  C  CA  . ASP B 1 186 ? 16.393 19.604 33.453 1.00 26.33 ? 186 ASP A CA  1 
ATOM   956  C  C   . ASP B 1 186 ? 15.168 19.717 34.365 1.00 25.27 ? 186 ASP A C   1 
ATOM   957  O  O   . ASP B 1 186 ? 15.247 19.381 35.542 1.00 24.64 ? 186 ASP A O   1 
ATOM   958  C  CB  . ASP B 1 186 ? 15.995 19.420 31.984 1.00 26.70 ? 186 ASP A CB  1 
ATOM   959  C  CG  . ASP B 1 186 ? 15.653 20.750 31.314 1.00 32.54 ? 186 ASP A CG  1 
ATOM   960  O  OD1 . ASP B 1 186 ? 14.471 21.010 31.038 1.00 34.60 ? 186 ASP A OD1 1 
ATOM   961  O  OD2 . ASP B 1 186 ? 16.564 21.593 31.118 1.00 41.23 ? 186 ASP A OD2 1 
ATOM   962  N  N   . THR B 1 187 ? 14.051 20.211 33.831 1.00 24.74 ? 187 THR A N   1 
ATOM   963  C  CA  . THR B 1 187 ? 12.789 20.261 34.578 1.00 24.70 ? 187 THR A CA  1 
ATOM   964  C  C   . THR B 1 187 ? 12.207 18.849 34.654 1.00 25.11 ? 187 THR A C   1 
ATOM   965  O  O   . THR B 1 187 ? 12.786 17.892 34.137 1.00 24.61 ? 187 THR A O   1 
ATOM   966  C  CB  . THR B 1 187 ? 11.749 21.159 33.882 1.00 24.84 ? 187 THR A CB  1 
ATOM   967  O  OG1 . THR B 1 187 ? 11.459 20.615 32.592 1.00 24.55 ? 187 THR A OG1 1 
ATOM   968  C  CG2 . THR B 1 187 ? 12.256 22.593 33.744 1.00 23.20 ? 187 THR A CG2 1 
ATOM   969  N  N   . SER B 1 188 ? 11.063 18.711 35.300 1.00 26.66 ? 188 SER A N   1 
ATOM   970  C  CA  . SER B 1 188 ? 10.362 17.434 35.258 1.00 27.54 ? 188 SER A CA  1 
ATOM   971  C  C   . SER B 1 188 ? 9.907  17.172 33.822 1.00 27.89 ? 188 SER A C   1 
ATOM   972  O  O   . SER B 1 188 ? 9.928  18.070 32.961 1.00 26.38 ? 188 SER A O   1 
ATOM   973  C  CB  . SER B 1 188 ? 9.199  17.426 36.250 1.00 28.50 ? 188 SER A CB  1 
ATOM   974  O  OG  . SER B 1 188 ? 8.398  18.566 36.074 1.00 31.56 ? 188 SER A OG  1 
ATOM   975  N  N   . ILE B 1 189 ? 9.575  15.928 33.525 1.00 28.00 ? 189 ILE A N   1 
ATOM   976  C  CA  . ILE B 1 189 ? 9.174  15.616 32.183 1.00 28.58 ? 189 ILE A CA  1 
ATOM   977  C  C   . ILE B 1 189 ? 7.871  14.803 32.175 1.00 29.44 ? 189 ILE A C   1 
ATOM   978  O  O   . ILE B 1 189 ? 7.539  14.096 33.148 1.00 28.61 ? 189 ILE A O   1 
ATOM   979  C  CB  . ILE B 1 189 ? 10.306 14.945 31.362 1.00 29.29 ? 189 ILE A CB  1 
ATOM   980  C  CG1 . ILE B 1 189 ? 10.377 13.456 31.642 1.00 30.02 ? 189 ILE A CG1 1 
ATOM   981  C  CG2 . ILE B 1 189 ? 11.703 15.639 31.586 1.00 29.00 ? 189 ILE A CG2 1 
ATOM   982  C  CD1 . ILE B 1 189 ? 10.889 12.709 30.459 1.00 34.15 ? 189 ILE A CD1 1 
ATOM   983  N  N   . GLN B 1 190 ? 7.136  14.923 31.076 1.00 29.69 ? 190 GLN A N   1 
ATOM   984  C  CA  . GLN B 1 190 ? 5.938  14.125 30.868 1.00 30.52 ? 190 GLN A CA  1 
ATOM   985  C  C   . GLN B 1 190 ? 6.345  12.840 30.142 1.00 30.17 ? 190 GLN A C   1 
ATOM   986  O  O   . GLN B 1 190 ? 6.340  12.771 28.914 1.00 28.81 ? 190 GLN A O   1 
ATOM   987  C  CB  . GLN B 1 190 ? 4.908  14.936 30.086 1.00 31.07 ? 190 GLN A CB  1 
ATOM   988  C  CG  . GLN B 1 190 ? 3.479  14.488 30.348 1.00 36.29 ? 190 GLN A CG  1 
ATOM   989  C  CD  . GLN B 1 190 ? 2.514  15.030 29.315 1.00 41.97 ? 190 GLN A CD  1 
ATOM   990  O  OE1 . GLN B 1 190 ? 2.043  14.293 28.444 1.00 44.91 ? 190 GLN A OE1 1 
ATOM   991  N  NE2 . GLN B 1 190 ? 2.204  16.325 29.410 1.00 43.60 ? 190 GLN A NE2 1 
ATOM   992  N  N   . SER B 1 191 ? 6.738  11.831 30.920 1.00 30.24 ? 191 SER A N   1 
ATOM   993  C  CA  . SER B 1 191 ? 7.355  10.613 30.388 1.00 31.73 ? 191 SER A CA  1 
ATOM   994  C  C   . SER B 1 191 ? 6.415  9.734  29.567 1.00 32.64 ? 191 SER A C   1 
ATOM   995  O  O   . SER B 1 191 ? 6.870  8.843  28.846 1.00 32.87 ? 191 SER A O   1 
ATOM   996  C  CB  . SER B 1 191 ? 7.974  9.786  31.520 1.00 31.46 ? 191 SER A CB  1 
ATOM   997  O  OG  . SER B 1 191 ? 7.041  9.647  32.582 1.00 33.21 ? 191 SER A OG  1 
ATOM   998  N  N   . ASP B 1 192 ? 5.116  9.995  29.662 1.00 33.84 ? 192 ASP A N   1 
ATOM   999  C  CA  . ASP B 1 192 ? 4.116  9.227  28.914 1.00 35.70 ? 192 ASP A CA  1 
ATOM   1000 C  C   . ASP B 1 192 ? 3.709  9.892  27.578 1.00 35.70 ? 192 ASP A C   1 
ATOM   1001 O  O   . ASP B 1 192 ? 2.802  9.415  26.873 1.00 35.75 ? 192 ASP A O   1 
ATOM   1002 C  CB  . ASP B 1 192 ? 2.890  8.958  29.804 1.00 36.54 ? 192 ASP A CB  1 
ATOM   1003 C  CG  . ASP B 1 192 ? 3.248  8.193  31.082 1.00 40.80 ? 192 ASP A CG  1 
ATOM   1004 O  OD1 . ASP B 1 192 ? 4.178  7.351  31.038 1.00 45.52 ? 192 ASP A OD1 1 
ATOM   1005 O  OD2 . ASP B 1 192 ? 2.613  8.432  32.144 1.00 45.34 ? 192 ASP A OD2 1 
ATOM   1006 N  N   . HIS B 1 193 ? 4.375  10.986 27.215 1.00 34.98 ? 193 HIS A N   1 
ATOM   1007 C  CA  . HIS B 1 193 ? 4.137  11.577 25.901 1.00 34.37 ? 193 HIS A CA  1 
ATOM   1008 C  C   . HIS B 1 193 ? 4.493  10.556 24.836 1.00 34.67 ? 193 HIS A C   1 
ATOM   1009 O  O   . HIS B 1 193 ? 5.488  9.857  24.970 1.00 34.53 ? 193 HIS A O   1 
ATOM   1010 C  CB  . HIS B 1 193 ? 4.988  12.825 25.707 1.00 34.25 ? 193 HIS A CB  1 
ATOM   1011 C  CG  . HIS B 1 193 ? 4.525  13.691 24.578 1.00 30.84 ? 193 HIS A CG  1 
ATOM   1012 N  ND1 . HIS B 1 193 ? 4.743  13.372 23.259 1.00 29.32 ? 193 HIS A ND1 1 
ATOM   1013 C  CD2 . HIS B 1 193 ? 3.836  14.852 24.577 1.00 26.58 ? 193 HIS A CD2 1 
ATOM   1014 C  CE1 . HIS B 1 193 ? 4.231  14.315 22.489 1.00 27.28 ? 193 HIS A CE1 1 
ATOM   1015 N  NE2 . HIS B 1 193 ? 3.675  15.225 23.266 1.00 27.14 ? 193 HIS A NE2 1 
ATOM   1016 N  N   . ARG B 1 194 ? 3.694  10.478 23.772 1.00 35.38 ? 194 ARG A N   1 
ATOM   1017 C  CA  . ARG B 1 194 ? 3.910  9.476  22.714 1.00 36.22 ? 194 ARG A CA  1 
ATOM   1018 C  C   . ARG B 1 194 ? 5.256  9.582  22.003 1.00 36.02 ? 194 ARG A C   1 
ATOM   1019 O  O   . ARG B 1 194 ? 5.761  8.585  21.485 1.00 36.09 ? 194 ARG A O   1 
ATOM   1020 C  CB  . ARG B 1 194 ? 2.770  9.489  21.678 1.00 37.04 ? 194 ARG A CB  1 
ATOM   1021 C  CG  . ARG B 1 194 ? 1.394  9.113  22.237 1.00 41.19 ? 194 ARG A CG  1 
ATOM   1022 C  CD  . ARG B 1 194 ? 1.255  7.627  22.645 1.00 48.32 ? 194 ARG A CD  1 
ATOM   1023 N  NE  . ARG B 1 194 ? 1.355  6.703  21.504 1.00 52.85 ? 194 ARG A NE  1 
ATOM   1024 C  CZ  . ARG B 1 194 ? 0.969  5.426  21.517 1.00 54.89 ? 194 ARG A CZ  1 
ATOM   1025 N  NH1 . ARG B 1 194 ? 0.429  4.882  22.613 1.00 55.96 ? 194 ARG A NH1 1 
ATOM   1026 N  NH2 . ARG B 1 194 ? 1.119  4.687  20.424 1.00 55.35 ? 194 ARG A NH2 1 
ATOM   1027 N  N   . GLU B 1 195 ? 5.840  10.781 21.974 1.00 35.68 ? 195 GLU A N   1 
ATOM   1028 C  CA  . GLU B 1 195 ? 7.173  10.969 21.382 1.00 35.17 ? 195 GLU A CA  1 
ATOM   1029 C  C   . GLU B 1 195 ? 8.254  10.162 22.076 1.00 34.90 ? 195 GLU A C   1 
ATOM   1030 O  O   . GLU B 1 195 ? 9.189  9.687  21.442 1.00 35.22 ? 195 GLU A O   1 
ATOM   1031 C  CB  . GLU B 1 195 ? 7.580  12.446 21.439 1.00 35.53 ? 195 GLU A CB  1 
ATOM   1032 C  CG  . GLU B 1 195 ? 7.193  13.266 20.231 1.00 33.31 ? 195 GLU A CG  1 
ATOM   1033 C  CD  . GLU B 1 195 ? 7.878  12.794 18.955 1.00 33.66 ? 195 GLU A CD  1 
ATOM   1034 O  OE1 . GLU B 1 195 ? 7.362  11.839 18.333 1.00 33.39 ? 195 GLU A OE1 1 
ATOM   1035 O  OE2 . GLU B 1 195 ? 8.918  13.382 18.555 1.00 32.29 ? 195 GLU A OE2 1 
ATOM   1036 N  N   . ILE B 1 196 ? 8.124  10.024 23.387 1.00 35.26 ? 196 ILE A N   1 
ATOM   1037 C  CA  . ILE B 1 196 ? 9.220  9.565  24.231 1.00 35.79 ? 196 ILE A CA  1 
ATOM   1038 C  C   . ILE B 1 196 ? 8.813  8.416  25.176 1.00 36.34 ? 196 ILE A C   1 
ATOM   1039 O  O   . ILE B 1 196 ? 9.659  7.822  25.836 1.00 35.52 ? 196 ILE A O   1 
ATOM   1040 C  CB  . ILE B 1 196 ? 9.827  10.756 25.041 1.00 35.60 ? 196 ILE A CB  1 
ATOM   1041 C  CG1 . ILE B 1 196 ? 8.783  11.379 25.972 1.00 35.57 ? 196 ILE A CG1 1 
ATOM   1042 C  CG2 . ILE B 1 196 ? 10.397 11.828 24.094 1.00 35.41 ? 196 ILE A CG2 1 
ATOM   1043 C  CD1 . ILE B 1 196 ? 9.354  12.204 27.105 1.00 35.71 ? 196 ILE A CD1 1 
ATOM   1044 N  N   . GLU B 1 197 ? 7.516  8.114  25.224 1.00 37.34 ? 197 GLU A N   1 
ATOM   1045 C  CA  . GLU B 1 197 ? 6.984  7.019  26.039 1.00 38.80 ? 197 GLU A CA  1 
ATOM   1046 C  C   . GLU B 1 197 ? 7.759  5.720  25.816 1.00 38.18 ? 197 GLU A C   1 
ATOM   1047 O  O   . GLU B 1 197 ? 7.980  5.294  24.678 1.00 38.25 ? 197 GLU A O   1 
ATOM   1048 C  CB  . GLU B 1 197 ? 5.484  6.850  25.748 1.00 38.86 ? 197 GLU A CB  1 
ATOM   1049 C  CG  . GLU B 1 197 ? 4.951  5.442  25.711 1.00 41.08 ? 197 GLU A CG  1 
ATOM   1050 C  CD  . GLU B 1 197 ? 3.518  5.404  25.221 1.00 42.07 ? 197 GLU A CD  1 
ATOM   1051 O  OE1 . GLU B 1 197 ? 3.292  5.541  23.985 1.00 44.48 ? 197 GLU A OE1 1 
ATOM   1052 O  OE2 . GLU B 1 197 ? 2.621  5.247  26.080 1.00 46.25 ? 197 GLU A OE2 1 
ATOM   1053 N  N   . GLY B 1 198 ? 8.207  5.126  26.917 1.00 38.46 ? 198 GLY A N   1 
ATOM   1054 C  CA  . GLY B 1 198 ? 8.924  3.854  26.880 1.00 38.92 ? 198 GLY A CA  1 
ATOM   1055 C  C   . GLY B 1 198 ? 10.410 3.976  26.628 1.00 39.48 ? 198 GLY A C   1 
ATOM   1056 O  O   . GLY B 1 198 ? 11.149 3.006  26.790 1.00 40.15 ? 198 GLY A O   1 
ATOM   1057 N  N   . ARG B 1 199 ? 10.859 5.161  26.223 1.00 39.44 ? 199 ARG A N   1 
ATOM   1058 C  CA  . ARG B 1 199 ? 12.264 5.359  25.880 1.00 39.28 ? 199 ARG A CA  1 
ATOM   1059 C  C   . ARG B 1 199 ? 13.015 6.223  26.909 1.00 38.63 ? 199 ARG A C   1 
ATOM   1060 O  O   . ARG B 1 199 ? 14.241 6.129  27.017 1.00 39.01 ? 199 ARG A O   1 
ATOM   1061 C  CB  . ARG B 1 199 ? 12.400 5.885  24.440 1.00 40.68 ? 199 ARG A CB  1 
ATOM   1062 C  CG  . ARG B 1 199 ? 11.836 4.913  23.338 1.00 42.31 ? 199 ARG A CG  1 
ATOM   1063 C  CD  . ARG B 1 199 ? 12.353 3.462  23.506 1.00 46.05 ? 199 ARG A CD  1 
ATOM   1064 N  NE  . ARG B 1 199 ? 11.789 2.502  22.543 1.00 47.66 ? 199 ARG A NE  1 
ATOM   1065 C  CZ  . ARG B 1 199 ? 10.830 1.605  22.801 1.00 50.45 ? 199 ARG A CZ  1 
ATOM   1066 N  NH1 . ARG B 1 199 ? 10.277 1.500  24.015 1.00 50.14 ? 199 ARG A NH1 1 
ATOM   1067 N  NH2 . ARG B 1 199 ? 10.421 0.792  21.829 1.00 51.33 ? 199 ARG A NH2 1 
ATOM   1068 N  N   . VAL B 1 200 ? 12.276 7.025  27.678 1.00 37.11 ? 200 VAL A N   1 
ATOM   1069 C  CA  . VAL B 1 200 ? 12.842 7.826  28.765 1.00 36.17 ? 200 VAL A CA  1 
ATOM   1070 C  C   . VAL B 1 200 ? 12.455 7.254  30.134 1.00 35.23 ? 200 VAL A C   1 
ATOM   1071 O  O   . VAL B 1 200 ? 11.274 7.071  30.430 1.00 34.79 ? 200 VAL A O   1 
ATOM   1072 C  CB  . VAL B 1 200 ? 12.404 9.316  28.690 1.00 36.56 ? 200 VAL A CB  1 
ATOM   1073 C  CG1 . VAL B 1 200 ? 13.123 10.135 29.750 1.00 36.08 ? 200 VAL A CG1 1 
ATOM   1074 C  CG2 . VAL B 1 200 ? 12.693 9.903  27.299 1.00 36.39 ? 200 VAL A CG2 1 
ATOM   1075 N  N   . MET B 1 201 ? 13.460 6.960  30.957 1.00 33.97 ? 201 MET A N   1 
ATOM   1076 C  CA  . MET B 1 201 ? 13.234 6.576  32.332 1.00 33.30 ? 201 MET A CA  1 
ATOM   1077 C  C   . MET B 1 201 ? 13.399 7.778  33.259 1.00 32.36 ? 201 MET A C   1 
ATOM   1078 O  O   . MET B 1 201 ? 14.424 8.452  33.235 1.00 32.02 ? 201 MET A O   1 
ATOM   1079 C  CB  . MET B 1 201 ? 14.184 5.439  32.736 1.00 33.79 ? 201 MET A CB  1 
ATOM   1080 C  CG  . MET B 1 201 ? 13.945 4.898  34.148 1.00 36.55 ? 201 MET A CG  1 
ATOM   1081 S  SD  . MET B 1 201 ? 15.108 5.490  35.418 1.00 43.40 ? 201 MET A SD  1 
ATOM   1082 C  CE  . MET B 1 201 ? 16.341 4.203  35.426 1.00 42.89 ? 201 MET A CE  1 
ATOM   1083 N  N   . VAL B 1 202 ? 12.388 8.045  34.077 1.00 31.30 ? 202 VAL A N   1 
ATOM   1084 C  CA  . VAL B 1 202 ? 12.488 9.077  35.103 1.00 30.43 ? 202 VAL A CA  1 
ATOM   1085 C  C   . VAL B 1 202 ? 13.164 8.508  36.361 1.00 30.83 ? 202 VAL A C   1 
ATOM   1086 O  O   . VAL B 1 202 ? 12.622 7.622  37.041 1.00 29.19 ? 202 VAL A O   1 
ATOM   1087 C  CB  . VAL B 1 202 ? 11.111 9.703  35.410 1.00 30.87 ? 202 VAL A CB  1 
ATOM   1088 C  CG1 . VAL B 1 202 ? 11.205 10.786 36.492 1.00 28.86 ? 202 VAL A CG1 1 
ATOM   1089 C  CG2 . VAL B 1 202 ? 10.510 10.288 34.122 1.00 29.58 ? 202 VAL A CG2 1 
ATOM   1090 N  N   . THR B 1 203 ? 14.360 9.026  36.666 1.00 30.48 ? 203 THR A N   1 
ATOM   1091 C  CA  . THR B 1 203 ? 15.127 8.554  37.821 1.00 29.85 ? 203 THR A CA  1 
ATOM   1092 C  C   . THR B 1 203 ? 14.445 8.925  39.129 1.00 30.57 ? 203 THR A C   1 
ATOM   1093 O  O   . THR B 1 203 ? 14.663 8.268  40.169 1.00 30.41 ? 203 THR A O   1 
ATOM   1094 C  CB  . THR B 1 203 ? 16.584 9.120  37.838 1.00 30.30 ? 203 THR A CB  1 
ATOM   1095 O  OG1 . THR B 1 203 ? 16.551 10.541 38.052 1.00 27.51 ? 203 THR A OG1 1 
ATOM   1096 C  CG2 . THR B 1 203 ? 17.314 8.802  36.540 1.00 28.59 ? 203 THR A CG2 1 
ATOM   1097 N  N   . ASP B 1 204 ? 13.626 9.981  39.076 1.00 30.50 ? 204 ASP A N   1 
ATOM   1098 C  CA  . ASP B 1 204 ? 13.027 10.594 40.263 1.00 30.90 ? 204 ASP A CA  1 
ATOM   1099 C  C   . ASP B 1 204 ? 14.062 11.183 41.237 1.00 30.02 ? 204 ASP A C   1 
ATOM   1100 O  O   . ASP B 1 204 ? 13.739 11.526 42.380 1.00 29.68 ? 204 ASP A O   1 
ATOM   1101 C  CB  . ASP B 1 204 ? 12.051 9.629  40.979 1.00 32.57 ? 204 ASP A CB  1 
ATOM   1102 C  CG  . ASP B 1 204 ? 10.625 9.672  40.402 1.00 35.36 ? 204 ASP A CG  1 
ATOM   1103 O  OD1 . ASP B 1 204 ? 10.130 10.764 40.025 1.00 38.07 ? 204 ASP A OD1 1 
ATOM   1104 O  OD2 . ASP B 1 204 ? 9.987  8.597  40.352 1.00 38.89 ? 204 ASP A OD2 1 
ATOM   1105 N  N   . PHE B 1 205 ? 15.308 11.331 40.783 1.00 29.35 ? 205 PHE A N   1 
ATOM   1106 C  CA  . PHE B 1 205 ? 16.201 12.258 41.474 1.00 27.72 ? 205 PHE A CA  1 
ATOM   1107 C  C   . PHE B 1 205 ? 15.639 13.655 41.281 1.00 27.66 ? 205 PHE A C   1 
ATOM   1108 O  O   . PHE B 1 205 ? 15.279 14.039 40.158 1.00 26.55 ? 205 PHE A O   1 
ATOM   1109 C  CB  . PHE B 1 205 ? 17.624 12.207 40.926 1.00 27.63 ? 205 PHE A CB  1 
ATOM   1110 C  CG  . PHE B 1 205 ? 18.508 13.305 41.475 1.00 27.63 ? 205 PHE A CG  1 
ATOM   1111 C  CD1 . PHE B 1 205 ? 19.212 13.115 42.658 1.00 27.89 ? 205 PHE A CD1 1 
ATOM   1112 C  CD2 . PHE B 1 205 ? 18.585 14.544 40.838 1.00 26.40 ? 205 PHE A CD2 1 
ATOM   1113 C  CE1 . PHE B 1 205 ? 20.018 14.127 43.184 1.00 27.54 ? 205 PHE A CE1 1 
ATOM   1114 C  CE2 . PHE B 1 205 ? 19.393 15.570 41.357 1.00 25.97 ? 205 PHE A CE2 1 
ATOM   1115 C  CZ  . PHE B 1 205 ? 20.108 15.350 42.529 1.00 24.89 ? 205 PHE A CZ  1 
ATOM   1116 N  N   . GLU B 1 206 ? 15.587 14.414 42.371 1.00 28.02 ? 206 GLU A N   1 
ATOM   1117 C  CA  . GLU B 1 206 ? 15.025 15.749 42.375 1.00 29.20 ? 206 GLU A CA  1 
ATOM   1118 C  C   . GLU B 1 206 ? 15.856 16.581 43.310 1.00 28.84 ? 206 GLU A C   1 
ATOM   1119 O  O   . GLU B 1 206 ? 16.036 16.203 44.471 1.00 28.40 ? 206 GLU A O   1 
ATOM   1120 C  CB  . GLU B 1 206 ? 13.600 15.658 42.928 1.00 30.15 ? 206 GLU A CB  1 
ATOM   1121 C  CG  . GLU B 1 206 ? 12.727 16.837 42.744 1.00 34.74 ? 206 GLU A CG  1 
ATOM   1122 C  CD  . GLU B 1 206 ? 11.299 16.439 42.339 1.00 39.68 ? 206 GLU A CD  1 
ATOM   1123 O  OE1 . GLU B 1 206 ? 11.085 15.373 41.700 1.00 42.55 ? 206 GLU A OE1 1 
ATOM   1124 O  OE2 . GLU B 1 206 ? 10.386 17.221 42.637 1.00 43.83 ? 206 GLU A OE2 1 
ATOM   1125 N  N   . ASN B 1 207 ? 16.385 17.703 42.820 1.00 28.30 ? 207 ASN A N   1 
ATOM   1126 C  CA  . ASN B 1 207 ? 17.013 18.678 43.726 1.00 27.84 ? 207 ASN A CA  1 
ATOM   1127 C  C   . ASN B 1 207 ? 16.800 20.061 43.159 1.00 27.61 ? 207 ASN A C   1 
ATOM   1128 O  O   . ASN B 1 207 ? 17.484 20.458 42.218 1.00 26.17 ? 207 ASN A O   1 
ATOM   1129 C  CB  . ASN B 1 207 ? 18.500 18.398 43.937 1.00 27.12 ? 207 ASN A CB  1 
ATOM   1130 C  CG  . ASN B 1 207 ? 19.056 19.123 45.162 1.00 27.96 ? 207 ASN A CG  1 
ATOM   1131 O  OD1 . ASN B 1 207 ? 19.142 20.351 45.184 1.00 26.36 ? 207 ASN A OD1 1 
ATOM   1132 N  ND2 . ASN B 1 207 ? 19.396 18.367 46.194 1.00 24.85 ? 207 ASN A ND2 1 
ATOM   1133 N  N   . VAL B 1 208 ? 15.819 20.761 43.718 1.00 27.95 ? 208 VAL A N   1 
ATOM   1134 C  CA  . VAL B 1 208 ? 15.298 21.999 43.138 1.00 28.45 ? 208 VAL A CA  1 
ATOM   1135 C  C   . VAL B 1 208 ? 14.981 23.042 44.224 1.00 29.71 ? 208 VAL A C   1 
ATOM   1136 O  O   . VAL B 1 208 ? 14.517 22.691 45.301 1.00 28.30 ? 208 VAL A O   1 
ATOM   1137 C  CB  . VAL B 1 208 ? 14.043 21.757 42.217 1.00 27.81 ? 208 VAL A CB  1 
ATOM   1138 C  CG1 . VAL B 1 208 ? 14.414 20.988 40.987 1.00 26.90 ? 208 VAL A CG1 1 
ATOM   1139 C  CG2 . VAL B 1 208 ? 12.891 21.048 42.958 1.00 29.68 ? 208 VAL A CG2 1 
ATOM   1140 N  N   . PRO B 1 209 ? 15.224 24.336 43.929 1.00 31.60 ? 209 PRO A N   1 
ATOM   1141 C  CA  . PRO B 1 209 ? 14.892 25.378 44.909 1.00 33.40 ? 209 PRO A CA  1 
ATOM   1142 C  C   . PRO B 1 209 ? 13.373 25.639 44.910 1.00 35.76 ? 209 PRO A C   1 
ATOM   1143 O  O   . PRO B 1 209 ? 12.686 25.296 43.941 1.00 35.23 ? 209 PRO A O   1 
ATOM   1144 C  CB  . PRO B 1 209 ? 15.675 26.596 44.395 1.00 33.04 ? 209 PRO A CB  1 
ATOM   1145 C  CG  . PRO B 1 209 ? 15.727 26.395 42.888 1.00 31.44 ? 209 PRO A CG  1 
ATOM   1146 C  CD  . PRO B 1 209 ? 15.809 24.895 42.689 1.00 31.47 ? 209 PRO A CD  1 
ATOM   1147 N  N   . GLU B 1 210 ? 12.855 26.227 45.984 1.00 38.69 ? 210 GLU A N   1 
ATOM   1148 C  CA  . GLU B 1 210 ? 11.432 26.584 46.045 1.00 42.51 ? 210 GLU A CA  1 
ATOM   1149 C  C   . GLU B 1 210 ? 11.090 27.594 44.965 1.00 43.63 ? 210 GLU A C   1 
ATOM   1150 O  O   . GLU B 1 210 ? 11.934 28.416 44.582 1.00 43.98 ? 210 GLU A O   1 
ATOM   1151 C  CB  . GLU B 1 210 ? 11.081 27.180 47.410 1.00 42.55 ? 210 GLU A CB  1 
ATOM   1152 C  CG  . GLU B 1 210 ? 11.173 26.206 48.573 1.00 44.68 ? 210 GLU A CG  1 
ATOM   1153 C  CD  . GLU B 1 210 ? 10.620 26.803 49.862 1.00 45.70 ? 210 GLU A CD  1 
ATOM   1154 O  OE1 . GLU B 1 210 ? 9.621  26.247 50.383 1.00 49.02 ? 210 GLU A OE1 1 
ATOM   1155 O  OE2 . GLU B 1 210 ? 11.170 27.839 50.335 1.00 49.18 ? 210 GLU A OE2 1 
ATOM   1156 N  N   . GLU B 1 211 ? 9.860  27.528 44.463 1.00 45.61 ? 211 GLU A N   1 
ATOM   1157 C  CA  . GLU B 1 211 ? 9.385  28.504 43.485 1.00 47.15 ? 211 GLU A CA  1 
ATOM   1158 C  C   . GLU B 1 211 ? 9.274  29.899 44.127 1.00 48.58 ? 211 GLU A C   1 
ATOM   1159 O  O   . GLU B 1 211 ? 9.089  30.026 45.346 1.00 48.94 ? 211 GLU A O   1 
ATOM   1160 C  CB  . GLU B 1 211 ? 8.066  28.042 42.849 1.00 47.15 ? 211 GLU A CB  1 
ATOM   1161 C  CG  . GLU B 1 211 ? 8.231  27.017 41.697 1.00 47.32 ? 211 GLU A CG  1 
ATOM   1162 C  CD  . GLU B 1 211 ? 8.431  25.561 42.157 1.00 48.91 ? 211 GLU A CD  1 
ATOM   1163 O  OE1 . GLU B 1 211 ? 8.695  24.692 41.292 1.00 46.56 ? 211 GLU A OE1 1 
ATOM   1164 O  OE2 . GLU B 1 211 ? 8.311  25.271 43.371 1.00 50.96 ? 211 GLU A OE2 1 
ATOM   1165 N  N   . ASP B 1 212 ? 9.412  30.942 43.311 1.00 50.08 ? 212 ASP A N   1 
ATOM   1166 C  CA  . ASP B 1 212 ? 9.469  32.314 43.823 1.00 51.24 ? 212 ASP A CA  1 
ATOM   1167 C  C   . ASP B 1 212 ? 8.085  32.865 44.172 1.00 51.58 ? 212 ASP A C   1 
ATOM   1168 O  O   . ASP B 1 212 ? 7.479  33.602 43.397 1.00 52.54 ? 212 ASP A O   1 
ATOM   1169 C  CB  . ASP B 1 212 ? 10.217 33.231 42.848 1.00 51.29 ? 212 ASP A CB  1 
ATOM   1170 C  CG  . ASP B 1 212 ? 11.736 33.109 42.978 1.00 53.44 ? 212 ASP A CG  1 
ATOM   1171 O  OD1 . ASP B 1 212 ? 12.406 32.893 41.940 1.00 54.14 ? 212 ASP A OD1 1 
ATOM   1172 O  OD2 . ASP B 1 212 ? 12.258 33.224 44.118 1.00 54.47 ? 212 ASP A OD2 1 
ATOM   1173 N  N   . GLN B 1 219 ? -0.421 23.261 37.474 1.00 58.52 ? 219 GLN A N   1 
ATOM   1174 C  CA  . GLN B 1 219 ? 0.991  23.521 37.217 1.00 58.03 ? 219 GLN A CA  1 
ATOM   1175 C  C   . GLN B 1 219 ? 1.609  22.537 36.206 1.00 57.14 ? 219 GLN A C   1 
ATOM   1176 O  O   . GLN B 1 219 ? 2.364  22.954 35.332 1.00 56.88 ? 219 GLN A O   1 
ATOM   1177 C  CB  . GLN B 1 219 ? 1.782  23.521 38.535 1.00 58.45 ? 219 GLN A CB  1 
ATOM   1178 C  CG  . GLN B 1 219 ? 1.866  24.885 39.239 1.00 60.50 ? 219 GLN A CG  1 
ATOM   1179 C  CD  . GLN B 1 219 ? 0.562  25.310 39.916 1.00 63.45 ? 219 GLN A CD  1 
ATOM   1180 O  OE1 . GLN B 1 219 ? 0.212  26.497 39.936 1.00 64.09 ? 219 GLN A OE1 1 
ATOM   1181 N  NE2 . GLN B 1 219 ? -0.160 24.342 40.478 1.00 64.71 ? 219 GLN A NE2 1 
ATOM   1182 N  N   . ALA B 1 220 ? 1.255  21.253 36.313 1.00 55.96 ? 220 ALA A N   1 
ATOM   1183 C  CA  . ALA B 1 220 ? 1.954  20.155 35.617 1.00 54.84 ? 220 ALA A CA  1 
ATOM   1184 C  C   . ALA B 1 220 ? 2.378  20.411 34.159 1.00 54.03 ? 220 ALA A C   1 
ATOM   1185 O  O   . ALA B 1 220 ? 3.534  20.172 33.804 1.00 54.19 ? 220 ALA A O   1 
ATOM   1186 C  CB  . ALA B 1 220 ? 1.169  18.843 35.739 1.00 55.01 ? 220 ALA A CB  1 
ATOM   1187 N  N   . SER B 1 221 ? 1.464  20.909 33.327 1.00 52.56 ? 221 SER A N   1 
ATOM   1188 C  CA  . SER B 1 221 ? 1.780  21.224 31.926 1.00 50.85 ? 221 SER A CA  1 
ATOM   1189 C  C   . SER B 1 221 ? 2.750  22.387 31.697 1.00 49.46 ? 221 SER A C   1 
ATOM   1190 O  O   . SER B 1 221 ? 3.387  22.458 30.649 1.00 49.90 ? 221 SER A O   1 
ATOM   1191 C  CB  . SER B 1 221 ? 0.500  21.437 31.124 1.00 51.09 ? 221 SER A CB  1 
ATOM   1192 O  OG  . SER B 1 221 ? -0.139 20.188 30.912 1.00 52.52 ? 221 SER A OG  1 
ATOM   1193 N  N   . LYS B 1 222 ? 2.861  23.309 32.647 1.00 47.42 ? 222 LYS A N   1 
ATOM   1194 C  CA  . LYS B 1 222 ? 3.900  24.333 32.551 1.00 45.58 ? 222 LYS A CA  1 
ATOM   1195 C  C   . LYS B 1 222 ? 5.230  23.841 33.122 1.00 43.52 ? 222 LYS A C   1 
ATOM   1196 O  O   . LYS B 1 222 ? 6.288  24.079 32.533 1.00 43.43 ? 222 LYS A O   1 
ATOM   1197 C  CB  . LYS B 1 222 ? 3.477  25.633 33.229 1.00 46.47 ? 222 LYS A CB  1 
ATOM   1198 C  CG  . LYS B 1 222 ? 4.072  26.885 32.572 1.00 47.83 ? 222 LYS A CG  1 
ATOM   1199 C  CD  . LYS B 1 222 ? 3.482  27.117 31.163 1.00 50.46 ? 222 LYS A CD  1 
ATOM   1200 C  CE  . LYS B 1 222 ? 3.903  28.472 30.572 1.00 50.48 ? 222 LYS A CE  1 
ATOM   1201 N  NZ  . LYS B 1 222 ? 3.154  28.799 29.307 1.00 51.65 ? 222 LYS A NZ  1 
ATOM   1202 N  N   . CYS B 1 223 ? 5.161  23.164 34.266 1.00 41.00 ? 223 CYS A N   1 
ATOM   1203 C  CA  . CYS B 1 223 ? 6.327  22.615 34.945 1.00 38.40 ? 223 CYS A CA  1 
ATOM   1204 C  C   . CYS B 1 223 ? 7.199  21.753 34.043 1.00 35.95 ? 223 CYS A C   1 
ATOM   1205 O  O   . CYS B 1 223 ? 8.417  21.893 34.081 1.00 36.04 ? 223 CYS A O   1 
ATOM   1206 C  CB  . CYS B 1 223 ? 5.922  21.813 36.196 1.00 38.51 ? 223 CYS A CB  1 
ATOM   1207 S  SG  . CYS B 1 223 ? 5.162  22.797 37.549 1.00 41.69 ? 223 CYS A SG  1 
ATOM   1208 N  N   . ASP B 1 224 ? 6.593  20.872 33.243 1.00 33.30 ? 224 ASP A N   1 
ATOM   1209 C  CA  . ASP B 1 224 ? 7.338  19.902 32.421 1.00 31.46 ? 224 ASP A CA  1 
ATOM   1210 C  C   . ASP B 1 224 ? 7.662  20.390 31.029 1.00 29.68 ? 224 ASP A C   1 
ATOM   1211 O  O   . ASP B 1 224 ? 8.144  19.608 30.210 1.00 28.58 ? 224 ASP A O   1 
ATOM   1212 C  CB  . ASP B 1 224 ? 6.528  18.640 32.125 1.00 32.35 ? 224 ASP A CB  1 
ATOM   1213 C  CG  . ASP B 1 224 ? 5.848  18.073 33.305 1.00 35.29 ? 224 ASP A CG  1 
ATOM   1214 O  OD1 . ASP B 1 224 ? 6.439  18.052 34.404 1.00 37.39 ? 224 ASP A OD1 1 
ATOM   1215 O  OD2 . ASP B 1 224 ? 4.707  17.608 33.095 1.00 38.82 ? 224 ASP A OD2 1 
ATOM   1216 N  N   . SER B 1 225 ? 7.349  21.637 30.726 1.00 27.36 ? 225 SER A N   1 
ATOM   1217 C  CA  . SER B 1 225 ? 7.438  22.093 29.358 1.00 26.61 ? 225 SER A CA  1 
ATOM   1218 C  C   . SER B 1 225 ? 8.855  21.964 28.763 1.00 25.80 ? 225 SER A C   1 
ATOM   1219 O  O   . SER B 1 225 ? 9.059  21.396 27.685 1.00 24.18 ? 225 SER A O   1 
ATOM   1220 C  CB  . SER B 1 225 ? 6.973  23.535 29.261 1.00 27.07 ? 225 SER A CB  1 
ATOM   1221 O  OG  . SER B 1 225 ? 7.191  23.981 27.935 1.00 30.48 ? 225 SER A OG  1 
ATOM   1222 N  N   . HIS B 1 226 ? 9.838  22.492 29.477 1.00 24.27 ? 226 HIS A N   1 
ATOM   1223 C  CA  . HIS B 1 226 ? 11.206 22.572 28.916 1.00 23.21 ? 226 HIS A CA  1 
ATOM   1224 C  C   . HIS B 1 226 ? 11.827 21.175 28.763 1.00 22.70 ? 226 HIS A C   1 
ATOM   1225 O  O   . HIS B 1 226 ? 12.255 20.792 27.666 1.00 21.95 ? 226 HIS A O   1 
ATOM   1226 C  CB  . HIS B 1 226 ? 12.036 23.512 29.804 1.00 22.97 ? 226 HIS A CB  1 
ATOM   1227 C  CG  . HIS B 1 226 ? 13.429 23.749 29.321 1.00 25.58 ? 226 HIS A CG  1 
ATOM   1228 N  ND1 . HIS B 1 226 ? 14.521 23.092 29.850 1.00 25.40 ? 226 HIS A ND1 1 
ATOM   1229 C  CD2 . HIS B 1 226 ? 13.911 24.583 28.371 1.00 25.91 ? 226 HIS A CD2 1 
ATOM   1230 C  CE1 . HIS B 1 226 ? 15.618 23.517 29.249 1.00 26.73 ? 226 HIS A CE1 1 
ATOM   1231 N  NE2 . HIS B 1 226 ? 15.275 24.423 28.347 1.00 28.95 ? 226 HIS A NE2 1 
ATOM   1232 N  N   . GLY B 1 227 ? 11.829 20.390 29.847 1.00 21.94 ? 227 GLY A N   1 
ATOM   1233 C  CA  . GLY B 1 227 ? 12.370 19.030 29.805 1.00 20.99 ? 227 GLY A CA  1 
ATOM   1234 C  C   . GLY B 1 227 ? 11.725 18.112 28.780 1.00 21.10 ? 227 GLY A C   1 
ATOM   1235 O  O   . GLY B 1 227 ? 12.421 17.390 28.060 1.00 20.82 ? 227 GLY A O   1 
ATOM   1236 N  N   . THR B 1 228 ? 10.398 18.151 28.687 1.00 20.69 ? 228 THR A N   1 
ATOM   1237 C  CA  . THR B 1 228 ? 9.694  17.287 27.742 1.00 21.23 ? 228 THR A CA  1 
ATOM   1238 C  C   . THR B 1 228 ? 10.068 17.610 26.299 1.00 20.57 ? 228 THR A C   1 
ATOM   1239 O  O   . THR B 1 228 ? 10.301 16.715 25.479 1.00 20.40 ? 228 THR A O   1 
ATOM   1240 C  CB  . THR B 1 228 ? 8.159  17.363 27.920 1.00 21.22 ? 228 THR A CB  1 
ATOM   1241 O  OG1 . THR B 1 228 ? 7.827  17.095 29.283 1.00 22.21 ? 228 THR A OG1 1 
ATOM   1242 C  CG2 . THR B 1 228 ? 7.442  16.338 27.012 1.00 22.15 ? 228 THR A CG2 1 
ATOM   1243 N  N   . HIS B 1 229 ? 10.158 18.898 25.981 1.00 19.88 ? 229 HIS A N   1 
ATOM   1244 C  CA  . HIS B 1 229 ? 10.543 19.253 24.623 1.00 19.72 ? 229 HIS A CA  1 
ATOM   1245 C  C   . HIS B 1 229 ? 11.955 18.737 24.290 1.00 19.98 ? 229 HIS A C   1 
ATOM   1246 O  O   . HIS B 1 229 ? 12.189 18.193 23.213 1.00 20.30 ? 229 HIS A O   1 
ATOM   1247 C  CB  . HIS B 1 229 ? 10.420 20.756 24.442 1.00 19.88 ? 229 HIS A CB  1 
ATOM   1248 C  CG  . HIS B 1 229 ? 10.599 21.201 23.033 1.00 20.71 ? 229 HIS A CG  1 
ATOM   1249 N  ND1 . HIS B 1 229 ? 11.820 21.591 22.546 1.00 19.10 ? 229 HIS A ND1 1 
ATOM   1250 C  CD2 . HIS B 1 229 ? 9.725  21.303 22.005 1.00 20.02 ? 229 HIS A CD2 1 
ATOM   1251 C  CE1 . HIS B 1 229 ? 11.699 21.919 21.270 1.00 21.37 ? 229 HIS A CE1 1 
ATOM   1252 N  NE2 . HIS B 1 229 ? 10.436 21.761 20.919 1.00 22.13 ? 229 HIS A NE2 1 
ATOM   1253 N  N   . LEU B 1 230 ? 12.884 18.879 25.226 1.00 19.64 ? 230 LEU A N   1 
ATOM   1254 C  CA  . LEU B 1 230 ? 14.275 18.483 25.000 1.00 20.25 ? 230 LEU A CA  1 
ATOM   1255 C  C   . LEU B 1 230 ? 14.457 16.960 24.884 1.00 20.60 ? 230 LEU A C   1 
ATOM   1256 O  O   . LEU B 1 230 ? 15.203 16.484 24.026 1.00 21.17 ? 230 LEU A O   1 
ATOM   1257 C  CB  . LEU B 1 230 ? 15.163 19.071 26.106 1.00 20.93 ? 230 LEU A CB  1 
ATOM   1258 C  CG  . LEU B 1 230 ? 15.250 20.604 26.112 1.00 21.43 ? 230 LEU A CG  1 
ATOM   1259 C  CD1 . LEU B 1 230 ? 16.208 21.001 27.164 1.00 22.10 ? 230 LEU A CD1 1 
ATOM   1260 C  CD2 . LEU B 1 230 ? 15.717 21.146 24.744 1.00 17.82 ? 230 LEU A CD2 1 
ATOM   1261 N  N   . ALA B 1 231 ? 13.768 16.200 25.730 1.00 20.94 ? 231 ALA A N   1 
ATOM   1262 C  CA  . ALA B 1 231 ? 13.759 14.733 25.583 1.00 22.07 ? 231 ALA A CA  1 
ATOM   1263 C  C   . ALA B 1 231 ? 13.277 14.326 24.196 1.00 22.79 ? 231 ALA A C   1 
ATOM   1264 O  O   . ALA B 1 231 ? 13.822 13.398 23.592 1.00 23.80 ? 231 ALA A O   1 
ATOM   1265 C  CB  . ALA B 1 231 ? 12.899 14.100 26.659 1.00 22.22 ? 231 ALA A CB  1 
ATOM   1266 N  N   . GLY B 1 232 ? 12.292 15.055 23.678 1.00 22.83 ? 232 GLY A N   1 
ATOM   1267 C  CA  . GLY B 1 232 ? 11.765 14.835 22.333 1.00 22.72 ? 232 GLY A CA  1 
ATOM   1268 C  C   . GLY B 1 232 ? 12.677 15.238 21.212 1.00 22.44 ? 232 GLY A C   1 
ATOM   1269 O  O   . GLY B 1 232 ? 12.767 14.528 20.198 1.00 22.67 ? 232 GLY A O   1 
ATOM   1270 N  N   . VAL B 1 233 ? 13.375 16.370 21.364 1.00 21.83 ? 233 VAL A N   1 
ATOM   1271 C  CA  . VAL B 1 233 ? 14.462 16.695 20.430 1.00 20.76 ? 233 VAL A CA  1 
ATOM   1272 C  C   . VAL B 1 233 ? 15.566 15.615 20.346 1.00 21.25 ? 233 VAL A C   1 
ATOM   1273 O  O   . VAL B 1 233 ? 16.016 15.232 19.248 1.00 19.21 ? 233 VAL A O   1 
ATOM   1274 C  CB  . VAL B 1 233 ? 15.111 18.087 20.705 1.00 21.32 ? 233 VAL A CB  1 
ATOM   1275 C  CG1 . VAL B 1 233 ? 16.126 18.376 19.606 1.00 18.46 ? 233 VAL A CG1 1 
ATOM   1276 C  CG2 . VAL B 1 233 ? 14.019 19.169 20.710 1.00 19.81 ? 233 VAL A CG2 1 
ATOM   1277 N  N   . VAL B 1 234 ? 16.024 15.144 21.496 1.00 22.21 ? 234 VAL A N   1 
ATOM   1278 C  CA  . VAL B 1 234 ? 17.078 14.121 21.493 1.00 24.19 ? 234 VAL A CA  1 
ATOM   1279 C  C   . VAL B 1 234 ? 16.552 12.829 20.864 1.00 25.70 ? 234 VAL A C   1 
ATOM   1280 O  O   . VAL B 1 234 ? 17.180 12.288 19.960 1.00 26.87 ? 234 VAL A O   1 
ATOM   1281 C  CB  . VAL B 1 234 ? 17.627 13.816 22.918 1.00 24.36 ? 234 VAL A CB  1 
ATOM   1282 C  CG1 . VAL B 1 234 ? 18.649 12.640 22.888 1.00 24.14 ? 234 VAL A CG1 1 
ATOM   1283 C  CG2 . VAL B 1 234 ? 18.290 15.049 23.517 1.00 23.60 ? 234 VAL A CG2 1 
ATOM   1284 N  N   . SER B 1 235 ? 15.398 12.357 21.327 1.00 26.86 ? 235 SER A N   1 
ATOM   1285 C  CA  . SER B 1 235 ? 15.001 10.967 21.088 1.00 28.53 ? 235 SER A CA  1 
ATOM   1286 C  C   . SER B 1 235 ? 13.546 10.727 20.643 1.00 29.25 ? 235 SER A C   1 
ATOM   1287 O  O   . SER B 1 235 ? 13.121 9.585  20.561 1.00 29.63 ? 235 SER A O   1 
ATOM   1288 C  CB  . SER B 1 235 ? 15.317 10.114 22.340 1.00 28.53 ? 235 SER A CB  1 
ATOM   1289 O  OG  . SER B 1 235 ? 14.454 10.444 23.422 1.00 31.47 ? 235 SER A OG  1 
ATOM   1290 N  N   . GLY B 1 236 ? 12.801 11.780 20.307 1.00 29.88 ? 236 GLY A N   1 
ATOM   1291 C  CA  . GLY B 1 236 ? 11.386 11.624 19.945 1.00 29.93 ? 236 GLY A CA  1 
ATOM   1292 C  C   . GLY B 1 236 ? 11.150 10.727 18.728 1.00 31.21 ? 236 GLY A C   1 
ATOM   1293 O  O   . GLY B 1 236 ? 11.884 10.800 17.732 1.00 29.62 ? 236 GLY A O   1 
ATOM   1294 N  N   . ARG B 1 237 ? 10.114 9.885  18.817 1.00 32.66 ? 237 ARG A N   1 
ATOM   1295 C  CA  . ARG B 1 237 ? 9.730  8.965  17.723 1.00 34.76 ? 237 ARG A CA  1 
ATOM   1296 C  C   . ARG B 1 237 ? 9.646  9.651  16.372 1.00 34.20 ? 237 ARG A C   1 
ATOM   1297 O  O   . ARG B 1 237 ? 10.172 9.149  15.384 1.00 34.43 ? 237 ARG A O   1 
ATOM   1298 C  CB  . ARG B 1 237 ? 8.366  8.320  18.004 1.00 34.47 ? 237 ARG A CB  1 
ATOM   1299 C  CG  . ARG B 1 237 ? 8.392  7.178  18.984 1.00 37.96 ? 237 ARG A CG  1 
ATOM   1300 C  CD  . ARG B 1 237 ? 7.024  6.463  19.028 1.00 37.99 ? 237 ARG A CD  1 
ATOM   1301 N  NE  . ARG B 1 237 ? 6.612  5.990  17.697 1.00 45.98 ? 237 ARG A NE  1 
ATOM   1302 C  CZ  . ARG B 1 237 ? 5.632  5.113  17.469 1.00 47.99 ? 237 ARG A CZ  1 
ATOM   1303 N  NH1 . ARG B 1 237 ? 4.932  4.602  18.479 1.00 48.70 ? 237 ARG A NH1 1 
ATOM   1304 N  NH2 . ARG B 1 237 ? 5.349  4.745  16.222 1.00 49.86 ? 237 ARG A NH2 1 
ATOM   1305 N  N   . ASP B 1 238 ? 8.966  10.794 16.319 1.00 34.47 ? 238 ASP A N   1 
ATOM   1306 C  CA  . ASP B 1 238 ? 8.713  11.452 15.029 1.00 34.58 ? 238 ASP A CA  1 
ATOM   1307 C  C   . ASP B 1 238 ? 9.595  12.653 14.714 1.00 33.85 ? 238 ASP A C   1 
ATOM   1308 O  O   . ASP B 1 238 ? 9.843  12.932 13.541 1.00 34.75 ? 238 ASP A O   1 
ATOM   1309 C  CB  . ASP B 1 238 ? 7.241  11.862 14.911 1.00 35.57 ? 238 ASP A CB  1 
ATOM   1310 C  CG  . ASP B 1 238 ? 6.300  10.670 14.951 1.00 39.13 ? 238 ASP A CG  1 
ATOM   1311 O  OD1 . ASP B 1 238 ? 6.574  9.648  14.271 1.00 42.38 ? 238 ASP A OD1 1 
ATOM   1312 O  OD2 . ASP B 1 238 ? 5.285  10.759 15.667 1.00 43.17 ? 238 ASP A OD2 1 
ATOM   1313 N  N   . ALA B 1 239 ? 10.037 13.380 15.737 1.00 31.74 ? 239 ALA A N   1 
ATOM   1314 C  CA  . ALA B 1 239 ? 10.775 14.629 15.517 1.00 30.56 ? 239 ALA A CA  1 
ATOM   1315 C  C   . ALA B 1 239 ? 12.132 14.677 16.230 1.00 29.77 ? 239 ALA A C   1 
ATOM   1316 O  O   . ALA B 1 239 ? 12.750 15.740 16.324 1.00 30.13 ? 239 ALA A O   1 
ATOM   1317 C  CB  . ALA B 1 239 ? 9.918  15.829 15.898 1.00 29.42 ? 239 ALA A CB  1 
ATOM   1318 N  N   . GLY B 1 240 ? 12.595 13.523 16.705 1.00 29.25 ? 240 GLY A N   1 
ATOM   1319 C  CA  . GLY B 1 240 ? 13.891 13.409 17.383 1.00 28.23 ? 240 GLY A CA  1 
ATOM   1320 C  C   . GLY B 1 240 ? 15.088 13.243 16.469 1.00 28.39 ? 240 GLY A C   1 
ATOM   1321 O  O   . GLY B 1 240 ? 14.959 12.841 15.305 1.00 27.12 ? 240 GLY A O   1 
ATOM   1322 N  N   . VAL B 1 241 ? 16.262 13.557 17.011 1.00 28.10 ? 241 VAL A N   1 
ATOM   1323 C  CA  . VAL B 1 241 ? 17.528 13.427 16.295 1.00 28.50 ? 241 VAL A CA  1 
ATOM   1324 C  C   . VAL B 1 241 ? 17.982 11.981 16.310 1.00 29.33 ? 241 VAL A C   1 
ATOM   1325 O  O   . VAL B 1 241 ? 18.365 11.432 15.284 1.00 29.64 ? 241 VAL A O   1 
ATOM   1326 C  CB  . VAL B 1 241 ? 18.635 14.383 16.904 1.00 28.05 ? 241 VAL A CB  1 
ATOM   1327 C  CG1 . VAL B 1 241 ? 20.000 14.125 16.296 1.00 27.31 ? 241 VAL A CG1 1 
ATOM   1328 C  CG2 . VAL B 1 241 ? 18.233 15.834 16.719 1.00 27.07 ? 241 VAL A CG2 1 
ATOM   1329 N  N   . ALA B 1 242 ? 17.919 11.363 17.479 1.00 30.48 ? 242 ALA A N   1 
ATOM   1330 C  CA  . ALA B 1 242 ? 18.351 9.991  17.634 1.00 31.97 ? 242 ALA A CA  1 
ATOM   1331 C  C   . ALA B 1 242 ? 17.113 9.190  18.014 1.00 33.34 ? 242 ALA A C   1 
ATOM   1332 O  O   . ALA B 1 242 ? 16.944 8.833  19.172 1.00 33.26 ? 242 ALA A O   1 
ATOM   1333 C  CB  . ALA B 1 242 ? 19.428 9.900  18.719 1.00 31.23 ? 242 ALA A CB  1 
ATOM   1334 N  N   . LYS B 1 243 ? 16.258 8.921  17.025 1.00 35.48 ? 243 LYS A N   1 
ATOM   1335 C  CA  . LYS B 1 243 ? 14.895 8.417  17.281 1.00 37.91 ? 243 LYS A CA  1 
ATOM   1336 C  C   . LYS B 1 243 ? 14.872 7.181  18.191 1.00 38.99 ? 243 LYS A C   1 
ATOM   1337 O  O   . LYS B 1 243 ? 13.968 7.033  19.025 1.00 40.23 ? 243 LYS A O   1 
ATOM   1338 C  CB  . LYS B 1 243 ? 14.139 8.136  15.978 1.00 37.86 ? 243 LYS A CB  1 
ATOM   1339 C  CG  . LYS B 1 243 ? 14.248 9.207  14.911 1.00 39.33 ? 243 LYS A CG  1 
ATOM   1340 C  CD  . LYS B 1 243 ? 12.997 10.059 14.795 1.00 41.92 ? 243 LYS A CD  1 
ATOM   1341 C  CE  . LYS B 1 243 ? 13.032 10.930 13.548 1.00 43.88 ? 243 LYS A CE  1 
ATOM   1342 N  NZ  . LYS B 1 243 ? 12.835 10.101 12.320 1.00 46.11 ? 243 LYS A NZ  1 
ATOM   1343 N  N   . GLY B 1 244 ? 15.868 6.313  18.051 1.00 39.89 ? 244 GLY A N   1 
ATOM   1344 C  CA  . GLY B 1 244 ? 16.010 5.148  18.945 1.00 40.98 ? 244 GLY A CA  1 
ATOM   1345 C  C   . GLY B 1 244 ? 16.270 5.445  20.423 1.00 41.39 ? 244 GLY A C   1 
ATOM   1346 O  O   . GLY B 1 244 ? 15.523 4.970  21.309 1.00 42.07 ? 244 GLY A O   1 
ATOM   1347 N  N   . ALA B 1 245 ? 17.298 6.267  20.658 1.00 40.61 ? 245 ALA A N   1 
ATOM   1348 C  CA  . ALA B 1 245 ? 18.016 6.462  21.940 1.00 39.19 ? 245 ALA A CA  1 
ATOM   1349 C  C   . ALA B 1 245 ? 17.283 6.394  23.278 1.00 38.18 ? 245 ALA A C   1 
ATOM   1350 O  O   . ALA B 1 245 ? 16.213 6.973  23.448 1.00 38.77 ? 245 ALA A O   1 
ATOM   1351 C  CB  . ALA B 1 245 ? 18.808 7.764  21.880 1.00 39.91 ? 245 ALA A CB  1 
ATOM   1352 N  N   . SER B 1 246 ? 17.937 5.734  24.236 1.00 36.23 ? 246 SER A N   1 
ATOM   1353 C  CA  . SER B 1 246 ? 17.504 5.639  25.630 1.00 34.98 ? 246 SER A CA  1 
ATOM   1354 C  C   . SER B 1 246 ? 17.936 6.847  26.442 1.00 33.35 ? 246 SER A C   1 
ATOM   1355 O  O   . SER B 1 246 ? 19.058 7.334  26.295 1.00 32.88 ? 246 SER A O   1 
ATOM   1356 C  CB  . SER B 1 246 ? 18.104 4.388  26.278 1.00 35.04 ? 246 SER A CB  1 
ATOM   1357 O  OG  . SER B 1 246 ? 17.433 3.244  25.790 1.00 38.57 ? 246 SER A OG  1 
ATOM   1358 N  N   . MET B 1 247 ? 17.061 7.297  27.328 1.00 31.58 ? 247 MET A N   1 
ATOM   1359 C  CA  . MET B 1 247 ? 17.320 8.493  28.105 1.00 30.77 ? 247 MET A CA  1 
ATOM   1360 C  C   . MET B 1 247 ? 16.990 8.234  29.541 1.00 29.35 ? 247 MET A C   1 
ATOM   1361 O  O   . MET B 1 247 ? 16.115 7.427  29.836 1.00 29.20 ? 247 MET A O   1 
ATOM   1362 C  CB  . MET B 1 247 ? 16.467 9.668  27.600 1.00 30.24 ? 247 MET A CB  1 
ATOM   1363 C  CG  . MET B 1 247 ? 16.730 10.058 26.142 1.00 30.62 ? 247 MET A CG  1 
ATOM   1364 S  SD  . MET B 1 247 ? 16.016 11.665 25.748 1.00 32.94 ? 247 MET A SD  1 
ATOM   1365 C  CE  . MET B 1 247 ? 17.035 12.769 26.757 1.00 28.92 ? 247 MET A CE  1 
ATOM   1366 N  N   . ARG B 1 248 ? 17.680 8.936  30.431 1.00 28.03 ? 248 ARG A N   1 
ATOM   1367 C  CA  . ARG B 1 248 ? 17.332 8.974  31.835 1.00 27.58 ? 248 ARG A CA  1 
ATOM   1368 C  C   . ARG B 1 248 ? 17.299 10.430 32.301 1.00 26.84 ? 248 ARG A C   1 
ATOM   1369 O  O   . ARG B 1 248 ? 18.233 11.198 32.028 1.00 26.20 ? 248 ARG A O   1 
ATOM   1370 C  CB  . ARG B 1 248 ? 18.343 8.177  32.659 1.00 27.65 ? 248 ARG A CB  1 
ATOM   1371 C  CG  . ARG B 1 248 ? 18.507 6.719  32.240 1.00 31.72 ? 248 ARG A CG  1 
ATOM   1372 C  CD  . ARG B 1 248 ? 19.094 5.918  33.387 1.00 35.57 ? 248 ARG A CD  1 
ATOM   1373 N  NE  . ARG B 1 248 ? 19.630 4.622  32.961 1.00 40.85 ? 248 ARG A NE  1 
ATOM   1374 C  CZ  . ARG B 1 248 ? 18.906 3.513  32.799 1.00 43.84 ? 248 ARG A CZ  1 
ATOM   1375 N  NH1 . ARG B 1 248 ? 17.592 3.517  33.008 1.00 44.25 ? 248 ARG A NH1 1 
ATOM   1376 N  NH2 . ARG B 1 248 ? 19.497 2.390  32.401 1.00 44.95 ? 248 ARG A NH2 1 
ATOM   1377 N  N   . SER B 1 249 ? 16.235 10.816 32.997 1.00 25.69 ? 249 SER A N   1 
ATOM   1378 C  CA  . SER B 1 249 ? 16.066 12.221 33.389 1.00 25.65 ? 249 SER A CA  1 
ATOM   1379 C  C   . SER B 1 249 ? 16.207 12.432 34.866 1.00 25.32 ? 249 SER A C   1 
ATOM   1380 O  O   . SER B 1 249 ? 15.727 11.614 35.660 1.00 26.25 ? 249 SER A O   1 
ATOM   1381 C  CB  . SER B 1 249 ? 14.720 12.777 32.944 1.00 25.78 ? 249 SER A CB  1 
ATOM   1382 O  OG  . SER B 1 249 ? 13.681 11.955 33.385 1.00 25.72 ? 249 SER A OG  1 
ATOM   1383 N  N   . LEU B 1 250 ? 16.874 13.531 35.212 1.00 24.42 ? 250 LEU A N   1 
ATOM   1384 C  CA  . LEU B 1 250 ? 17.072 13.993 36.587 1.00 24.29 ? 250 LEU A CA  1 
ATOM   1385 C  C   . LEU B 1 250 ? 16.466 15.386 36.707 1.00 24.28 ? 250 LEU A C   1 
ATOM   1386 O  O   . LEU B 1 250 ? 16.596 16.209 35.787 1.00 24.05 ? 250 LEU A O   1 
ATOM   1387 C  CB  . LEU B 1 250 ? 18.576 14.062 36.898 1.00 24.47 ? 250 LEU A CB  1 
ATOM   1388 C  CG  . LEU B 1 250 ? 19.386 12.788 37.201 1.00 23.77 ? 250 LEU A CG  1 
ATOM   1389 C  CD1 . LEU B 1 250 ? 19.666 11.927 35.957 1.00 25.96 ? 250 LEU A CD1 1 
ATOM   1390 C  CD2 . LEU B 1 250 ? 20.723 13.229 37.830 1.00 24.87 ? 250 LEU A CD2 1 
ATOM   1391 N  N   . ARG B 1 251 ? 15.766 15.665 37.798 1.00 22.97 ? 251 ARG A N   1 
ATOM   1392 C  CA  . ARG B 1 251 ? 15.137 16.973 37.901 1.00 23.20 ? 251 ARG A CA  1 
ATOM   1393 C  C   . ARG B 1 251 ? 16.029 17.898 38.722 1.00 23.21 ? 251 ARG A C   1 
ATOM   1394 O  O   . ARG B 1 251 ? 16.203 17.679 39.927 1.00 22.63 ? 251 ARG A O   1 
ATOM   1395 C  CB  . ARG B 1 251 ? 13.718 16.895 38.497 1.00 22.06 ? 251 ARG A CB  1 
ATOM   1396 C  CG  . ARG B 1 251 ? 13.024 18.240 38.517 1.00 23.41 ? 251 ARG A CG  1 
ATOM   1397 C  CD  . ARG B 1 251 ? 11.787 18.266 39.373 1.00 24.92 ? 251 ARG A CD  1 
ATOM   1398 N  NE  . ARG B 1 251 ? 10.977 19.447 39.080 1.00 27.06 ? 251 ARG A NE  1 
ATOM   1399 C  CZ  . ARG B 1 251 ? 10.153 20.042 39.939 1.00 28.24 ? 251 ARG A CZ  1 
ATOM   1400 N  NH1 . ARG B 1 251 ? 10.011 19.590 41.190 1.00 28.08 ? 251 ARG A NH1 1 
ATOM   1401 N  NH2 . ARG B 1 251 ? 9.473  21.103 39.542 1.00 24.55 ? 251 ARG A NH2 1 
ATOM   1402 N  N   . VAL B 1 252 ? 16.599 18.917 38.063 1.00 22.98 ? 252 VAL A N   1 
ATOM   1403 C  CA  . VAL B 1 252 ? 17.417 19.944 38.752 1.00 23.13 ? 252 VAL A CA  1 
ATOM   1404 C  C   . VAL B 1 252 ? 16.901 21.375 38.550 1.00 23.59 ? 252 VAL A C   1 
ATOM   1405 O  O   . VAL B 1 252 ? 17.449 22.320 39.141 1.00 23.25 ? 252 VAL A O   1 
ATOM   1406 C  CB  . VAL B 1 252 ? 18.966 19.853 38.402 1.00 22.96 ? 252 VAL A CB  1 
ATOM   1407 C  CG1 . VAL B 1 252 ? 19.511 18.464 38.736 1.00 24.00 ? 252 VAL A CG1 1 
ATOM   1408 C  CG2 . VAL B 1 252 ? 19.236 20.186 36.951 1.00 21.62 ? 252 VAL A CG2 1 
ATOM   1409 N  N   . LEU B 1 253 ? 15.851 21.520 37.730 1.00 23.34 ? 253 LEU A N   1 
ATOM   1410 C  CA  . LEU B 1 253 ? 15.169 22.817 37.510 1.00 22.84 ? 253 LEU A CA  1 
ATOM   1411 C  C   . LEU B 1 253 ? 13.734 22.749 37.988 1.00 23.55 ? 253 LEU A C   1 
ATOM   1412 O  O   . LEU B 1 253 ? 13.027 21.799 37.664 1.00 23.62 ? 253 LEU A O   1 
ATOM   1413 C  CB  . LEU B 1 253 ? 15.200 23.200 36.011 1.00 21.42 ? 253 LEU A CB  1 
ATOM   1414 C  CG  . LEU B 1 253 ? 16.579 23.177 35.325 1.00 20.83 ? 253 LEU A CG  1 
ATOM   1415 C  CD1 . LEU B 1 253 ? 16.446 23.484 33.824 1.00 20.08 ? 253 LEU A CD1 1 
ATOM   1416 C  CD2 . LEU B 1 253 ? 17.562 24.092 36.008 1.00 21.02 ? 253 LEU A CD2 1 
ATOM   1417 N  N   . ASN B 1 254 ? 13.315 23.750 38.771 1.00 24.25 ? 254 ASN A N   1 
ATOM   1418 C  CA  . ASN B 1 254 ? 11.949 23.851 39.264 1.00 24.86 ? 254 ASN A CA  1 
ATOM   1419 C  C   . ASN B 1 254 ? 10.938 24.226 38.158 1.00 26.28 ? 254 ASN A C   1 
ATOM   1420 O  O   . ASN B 1 254 ? 11.286 24.232 36.978 1.00 26.20 ? 254 ASN A O   1 
ATOM   1421 C  CB  . ASN B 1 254 ? 11.870 24.768 40.506 1.00 23.09 ? 254 ASN A CB  1 
ATOM   1422 C  CG  . ASN B 1 254 ? 12.064 26.250 40.203 1.00 23.30 ? 254 ASN A CG  1 
ATOM   1423 O  OD1 . ASN B 1 254 ? 11.992 26.677 39.064 1.00 20.46 ? 254 ASN A OD1 1 
ATOM   1424 N  ND2 . ASN B 1 254 ? 12.307 27.058 41.266 1.00 18.35 ? 254 ASN A ND2 1 
ATOM   1425 N  N   . CYS B 1 255 ? 9.702  24.537 38.549 1.00 27.67 ? 255 CYS A N   1 
ATOM   1426 C  CA  . CYS B 1 255 ? 8.625  24.846 37.603 1.00 30.35 ? 255 CYS A CA  1 
ATOM   1427 C  C   . CYS B 1 255 ? 8.825  26.107 36.762 1.00 29.83 ? 255 CYS A C   1 
ATOM   1428 O  O   . CYS B 1 255 ? 8.219  26.237 35.690 1.00 30.29 ? 255 CYS A O   1 
ATOM   1429 C  CB  . CYS B 1 255 ? 7.270  24.892 38.332 1.00 30.65 ? 255 CYS A CB  1 
ATOM   1430 S  SG  . CYS B 1 255 ? 6.706  23.238 38.865 1.00 37.51 ? 255 CYS A SG  1 
ATOM   1431 N  N   . GLN B 1 256 ? 9.660  27.021 37.264 1.00 30.13 ? 256 GLN A N   1 
ATOM   1432 C  CA  . GLN B 1 256 ? 9.999  28.288 36.604 1.00 30.57 ? 256 GLN A CA  1 
ATOM   1433 C  C   . GLN B 1 256 ? 11.367 28.195 35.891 1.00 29.20 ? 256 GLN A C   1 
ATOM   1434 O  O   . GLN B 1 256 ? 11.929 29.205 35.437 1.00 28.87 ? 256 GLN A O   1 
ATOM   1435 C  CB  . GLN B 1 256 ? 9.996  29.426 37.643 1.00 30.82 ? 256 GLN A CB  1 
ATOM   1436 C  CG  . GLN B 1 256 ? 8.616  29.675 38.296 1.00 32.68 ? 256 GLN A CG  1 
ATOM   1437 C  CD  . GLN B 1 256 ? 8.646  30.524 39.587 1.00 33.72 ? 256 GLN A CD  1 
ATOM   1438 O  OE1 . GLN B 1 256 ? 7.651  31.168 39.935 1.00 39.55 ? 256 GLN A OE1 1 
ATOM   1439 N  NE2 . GLN B 1 256 ? 9.762  30.516 40.293 1.00 37.55 ? 256 GLN A NE2 1 
ATOM   1440 N  N   . GLY B 1 257 ? 11.906 26.981 35.811 1.00 27.65 ? 257 GLY A N   1 
ATOM   1441 C  CA  . GLY B 1 257 ? 13.178 26.745 35.117 1.00 26.20 ? 257 GLY A CA  1 
ATOM   1442 C  C   . GLY B 1 257 ? 14.422 27.165 35.875 1.00 25.37 ? 257 GLY A C   1 
ATOM   1443 O  O   . GLY B 1 257 ? 15.470 27.336 35.267 1.00 24.61 ? 257 GLY A O   1 
ATOM   1444 N  N   . LYS B 1 258 ? 14.313 27.298 37.200 1.00 24.80 ? 258 LYS A N   1 
ATOM   1445 C  CA  . LYS B 1 258 ? 15.426 27.705 38.068 1.00 25.23 ? 258 LYS A CA  1 
ATOM   1446 C  C   . LYS B 1 258 ? 15.974 26.553 38.929 1.00 23.32 ? 258 LYS A C   1 
ATOM   1447 O  O   . LYS B 1 258 ? 15.218 25.782 39.529 1.00 22.65 ? 258 LYS A O   1 
ATOM   1448 C  CB  . LYS B 1 258 ? 15.013 28.832 39.031 1.00 24.65 ? 258 LYS A CB  1 
ATOM   1449 C  CG  . LYS B 1 258 ? 14.956 30.234 38.434 1.00 28.90 ? 258 LYS A CG  1 
ATOM   1450 C  CD  . LYS B 1 258 ? 14.608 31.280 39.509 1.00 29.06 ? 258 LYS A CD  1 
ATOM   1451 C  CE  . LYS B 1 258 ? 15.615 31.263 40.688 1.00 33.72 ? 258 LYS A CE  1 
ATOM   1452 N  NZ  . LYS B 1 258 ? 15.537 32.516 41.540 1.00 39.77 ? 258 LYS A NZ  1 
ATOM   1453 N  N   . GLY B 1 259 ? 17.291 26.498 39.035 1.00 22.29 ? 259 GLY A N   1 
ATOM   1454 C  CA  . GLY B 1 259 ? 17.960 25.450 39.796 1.00 21.62 ? 259 GLY A CA  1 
ATOM   1455 C  C   . GLY B 1 259 ? 19.094 26.088 40.545 1.00 21.40 ? 259 GLY A C   1 
ATOM   1456 O  O   . GLY B 1 259 ? 19.253 27.323 40.511 1.00 20.89 ? 259 GLY A O   1 
ATOM   1457 N  N   . THR B 1 260 ? 19.897 25.262 41.202 1.00 20.16 ? 260 THR A N   1 
ATOM   1458 C  CA  . THR B 1 260 ? 21.064 25.751 41.912 1.00 20.56 ? 260 THR A CA  1 
ATOM   1459 C  C   . THR B 1 260 ? 22.318 25.016 41.437 1.00 20.44 ? 260 THR A C   1 
ATOM   1460 O  O   . THR B 1 260 ? 22.241 23.911 40.848 1.00 20.56 ? 260 THR A O   1 
ATOM   1461 C  CB  . THR B 1 260 ? 20.905 25.611 43.432 1.00 20.98 ? 260 THR A CB  1 
ATOM   1462 O  OG1 . THR B 1 260 ? 20.941 24.225 43.789 1.00 20.74 ? 260 THR A OG1 1 
ATOM   1463 C  CG2 . THR B 1 260 ? 19.576 26.243 43.920 1.00 22.12 ? 260 THR A CG2 1 
ATOM   1464 N  N   . VAL B 1 261 ? 23.470 25.635 41.642 1.00 19.63 ? 261 VAL A N   1 
ATOM   1465 C  CA  . VAL B 1 261 ? 24.733 24.956 41.372 1.00 20.29 ? 261 VAL A CA  1 
ATOM   1466 C  C   . VAL B 1 261 ? 24.819 23.680 42.231 1.00 20.15 ? 261 VAL A C   1 
ATOM   1467 O  O   . VAL B 1 261 ? 25.154 22.620 41.723 1.00 20.23 ? 261 VAL A O   1 
ATOM   1468 C  CB  . VAL B 1 261 ? 25.955 25.853 41.622 1.00 20.40 ? 261 VAL A CB  1 
ATOM   1469 C  CG1 . VAL B 1 261 ? 27.267 25.013 41.633 1.00 21.89 ? 261 VAL A CG1 1 
ATOM   1470 C  CG2 . VAL B 1 261 ? 26.040 26.952 40.576 1.00 21.41 ? 261 VAL A CG2 1 
ATOM   1471 N  N   . SER B 1 262 ? 24.458 23.777 43.505 1.00 19.59 ? 262 SER A N   1 
ATOM   1472 C  CA  . SER B 1 262 ? 24.583 22.609 44.394 1.00 20.86 ? 262 SER A CA  1 
ATOM   1473 C  C   . SER B 1 262 ? 23.710 21.436 43.944 1.00 21.17 ? 262 SER A C   1 
ATOM   1474 O  O   . SER B 1 262 ? 24.163 20.297 43.978 1.00 22.66 ? 262 SER A O   1 
ATOM   1475 C  CB  . SER B 1 262 ? 24.279 22.989 45.842 1.00 20.43 ? 262 SER A CB  1 
ATOM   1476 O  OG  . SER B 1 262 ? 22.978 23.510 45.945 1.00 22.11 ? 262 SER A OG  1 
ATOM   1477 N  N   . GLY B 1 263 ? 22.482 21.721 43.505 1.00 20.69 ? 263 GLY A N   1 
ATOM   1478 C  CA  . GLY B 1 263 ? 21.569 20.706 43.028 1.00 20.63 ? 263 GLY A CA  1 
ATOM   1479 C  C   . GLY B 1 263 ? 22.092 20.085 41.759 1.00 20.93 ? 263 GLY A C   1 
ATOM   1480 O  O   . GLY B 1 263 ? 22.033 18.884 41.582 1.00 20.82 ? 263 GLY A O   1 
ATOM   1481 N  N   . THR B 1 264 ? 22.631 20.911 40.876 1.00 21.22 ? 264 THR A N   1 
ATOM   1482 C  CA  . THR B 1 264 ? 23.281 20.411 39.667 1.00 21.25 ? 264 THR A CA  1 
ATOM   1483 C  C   . THR B 1 264 ? 24.489 19.477 39.965 1.00 21.92 ? 264 THR A C   1 
ATOM   1484 O  O   . THR B 1 264 ? 24.650 18.428 39.326 1.00 21.91 ? 264 THR A O   1 
ATOM   1485 C  CB  . THR B 1 264 ? 23.651 21.580 38.744 1.00 21.63 ? 264 THR A CB  1 
ATOM   1486 O  OG1 . THR B 1 264 ? 22.474 22.407 38.562 1.00 21.72 ? 264 THR A OG1 1 
ATOM   1487 C  CG2 . THR B 1 264 ? 24.143 21.055 37.387 1.00 20.78 ? 264 THR A CG2 1 
ATOM   1488 N  N   . LEU B 1 265 ? 25.326 19.866 40.921 1.00 22.08 ? 265 LEU A N   1 
ATOM   1489 C  CA  . LEU B 1 265 ? 26.444 19.030 41.396 1.00 22.88 ? 265 LEU A CA  1 
ATOM   1490 C  C   . LEU B 1 265 ? 25.984 17.690 41.960 1.00 22.64 ? 265 LEU A C   1 
ATOM   1491 O  O   . LEU B 1 265 ? 26.597 16.651 41.697 1.00 22.47 ? 265 LEU A O   1 
ATOM   1492 C  CB  . LEU B 1 265 ? 27.216 19.751 42.513 1.00 22.60 ? 265 LEU A CB  1 
ATOM   1493 C  CG  . LEU B 1 265 ? 28.046 20.994 42.191 1.00 24.34 ? 265 LEU A CG  1 
ATOM   1494 C  CD1 . LEU B 1 265 ? 28.779 21.446 43.432 1.00 24.84 ? 265 LEU A CD1 1 
ATOM   1495 C  CD2 . LEU B 1 265 ? 29.069 20.711 41.086 1.00 26.82 ? 265 LEU A CD2 1 
ATOM   1496 N  N   . ILE B 1 266 ? 24.943 17.727 42.789 1.00 22.60 ? 266 ILE A N   1 
ATOM   1497 C  CA  . ILE B 1 266 ? 24.411 16.513 43.388 1.00 22.21 ? 266 ILE A CA  1 
ATOM   1498 C  C   . ILE B 1 266 ? 23.861 15.569 42.297 1.00 22.58 ? 266 ILE A C   1 
ATOM   1499 O  O   . ILE B 1 266 ? 24.048 14.350 42.363 1.00 22.50 ? 266 ILE A O   1 
ATOM   1500 C  CB  . ILE B 1 266 ? 23.376 16.826 44.477 1.00 22.43 ? 266 ILE A CB  1 
ATOM   1501 C  CG1 . ILE B 1 266 ? 24.042 17.576 45.634 1.00 20.43 ? 266 ILE A CG1 1 
ATOM   1502 C  CG2 . ILE B 1 266 ? 22.716 15.507 44.976 1.00 22.02 ? 266 ILE A CG2 1 
ATOM   1503 C  CD1 . ILE B 1 266 ? 23.082 18.006 46.758 1.00 22.08 ? 266 ILE A CD1 1 
ATOM   1504 N  N   . GLY B 1 267 ? 23.196 16.135 41.297 1.00 22.03 ? 267 GLY A N   1 
ATOM   1505 C  CA  . GLY B 1 267 ? 22.784 15.385 40.112 1.00 21.99 ? 267 GLY A CA  1 
ATOM   1506 C  C   . GLY B 1 267 ? 23.883 14.701 39.316 1.00 23.30 ? 267 GLY A C   1 
ATOM   1507 O  O   . GLY B 1 267 ? 23.745 13.527 38.920 1.00 22.20 ? 267 GLY A O   1 
ATOM   1508 N  N   . LEU B 1 268 ? 24.960 15.435 39.045 1.00 22.79 ? 268 LEU A N   1 
ATOM   1509 C  CA  . LEU B 1 268 ? 26.071 14.899 38.305 1.00 23.57 ? 268 LEU A CA  1 
ATOM   1510 C  C   . LEU B 1 268 ? 26.735 13.776 39.103 1.00 23.52 ? 268 LEU A C   1 
ATOM   1511 O  O   . LEU B 1 268 ? 27.078 12.734 38.548 1.00 22.69 ? 268 LEU A O   1 
ATOM   1512 C  CB  . LEU B 1 268 ? 27.090 16.003 37.976 1.00 24.03 ? 268 LEU A CB  1 
ATOM   1513 C  CG  . LEU B 1 268 ? 26.719 17.068 36.942 1.00 24.45 ? 268 LEU A CG  1 
ATOM   1514 C  CD1 . LEU B 1 268 ? 27.805 18.152 36.990 1.00 27.23 ? 268 LEU A CD1 1 
ATOM   1515 C  CD2 . LEU B 1 268 ? 26.571 16.483 35.517 1.00 23.36 ? 268 LEU A CD2 1 
ATOM   1516 N  N   . GLU B 1 269 ? 26.873 13.979 40.410 1.00 23.25 ? 269 GLU A N   1 
ATOM   1517 C  CA  . GLU B 1 269 ? 27.327 12.921 41.289 1.00 23.99 ? 269 GLU A CA  1 
ATOM   1518 C  C   . GLU B 1 269 ? 26.451 11.659 41.234 1.00 23.83 ? 269 GLU A C   1 
ATOM   1519 O  O   . GLU B 1 269 ? 26.972 10.532 41.243 1.00 22.90 ? 269 GLU A O   1 
ATOM   1520 C  CB  . GLU B 1 269 ? 27.405 13.453 42.708 1.00 24.27 ? 269 GLU A CB  1 
ATOM   1521 C  CG  . GLU B 1 269 ? 28.012 12.480 43.656 1.00 26.78 ? 269 GLU A CG  1 
ATOM   1522 C  CD  . GLU B 1 269 ? 28.000 13.000 45.062 1.00 29.83 ? 269 GLU A CD  1 
ATOM   1523 O  OE1 . GLU B 1 269 ? 26.906 13.001 45.668 1.00 32.08 ? 269 GLU A OE1 1 
ATOM   1524 O  OE2 . GLU B 1 269 ? 29.084 13.410 45.536 1.00 30.44 ? 269 GLU A OE2 1 
ATOM   1525 N  N   . PHE B 1 270 ? 25.130 11.859 41.180 1.00 23.55 ? 270 PHE A N   1 
ATOM   1526 C  CA  . PHE B 1 270 ? 24.140 10.782 41.095 1.00 23.52 ? 270 PHE A CA  1 
ATOM   1527 C  C   . PHE B 1 270 ? 24.382 9.938  39.856 1.00 23.60 ? 270 PHE A C   1 
ATOM   1528 O  O   . PHE B 1 270 ? 24.213 8.715  39.871 1.00 22.74 ? 270 PHE A O   1 
ATOM   1529 C  CB  . PHE B 1 270 ? 22.716 11.376 41.037 1.00 23.72 ? 270 PHE A CB  1 
ATOM   1530 C  CG  . PHE B 1 270 ? 21.613 10.351 40.965 1.00 24.75 ? 270 PHE A CG  1 
ATOM   1531 C  CD1 . PHE B 1 270 ? 21.022 9.866  42.124 1.00 27.14 ? 270 PHE A CD1 1 
ATOM   1532 C  CD2 . PHE B 1 270 ? 21.138 9.898  39.741 1.00 25.60 ? 270 PHE A CD2 1 
ATOM   1533 C  CE1 . PHE B 1 270 ? 19.994 8.920  42.064 1.00 27.05 ? 270 PHE A CE1 1 
ATOM   1534 C  CE2 . PHE B 1 270 ? 20.111 8.951  39.672 1.00 26.28 ? 270 PHE A CE2 1 
ATOM   1535 C  CZ  . PHE B 1 270 ? 19.538 8.471  40.839 1.00 27.26 ? 270 PHE A CZ  1 
ATOM   1536 N  N   . ILE B 1 271 ? 24.752 10.604 38.773 1.00 23.35 ? 271 ILE A N   1 
ATOM   1537 C  CA  . ILE B 1 271 ? 25.006 9.929  37.520 1.00 23.47 ? 271 ILE A CA  1 
ATOM   1538 C  C   . ILE B 1 271 ? 26.271 9.084  37.617 1.00 23.54 ? 271 ILE A C   1 
ATOM   1539 O  O   . ILE B 1 271 ? 26.270 7.926  37.197 1.00 22.42 ? 271 ILE A O   1 
ATOM   1540 C  CB  . ILE B 1 271 ? 25.177 10.934 36.354 1.00 23.47 ? 271 ILE A CB  1 
ATOM   1541 C  CG1 . ILE B 1 271 ? 23.897 11.744 36.157 1.00 23.43 ? 271 ILE A CG1 1 
ATOM   1542 C  CG2 . ILE B 1 271 ? 25.595 10.188 35.068 1.00 22.78 ? 271 ILE A CG2 1 
ATOM   1543 C  CD1 . ILE B 1 271 ? 23.940 12.604 34.873 1.00 24.09 ? 271 ILE A CD1 1 
ATOM   1544 N  N   . ARG B 1 272 ? 27.346 9.663  38.152 1.00 23.21 ? 272 ARG A N   1 
ATOM   1545 C  CA  . ARG B 1 272 ? 28.589 8.905  38.390 1.00 23.93 ? 272 ARG A CA  1 
ATOM   1546 C  C   . ARG B 1 272 ? 28.366 7.668  39.285 1.00 24.74 ? 272 ARG A C   1 
ATOM   1547 O  O   . ARG B 1 272 ? 28.859 6.570  38.993 1.00 24.01 ? 272 ARG A O   1 
ATOM   1548 C  CB  . ARG B 1 272 ? 29.686 9.817  38.973 1.00 24.22 ? 272 ARG A CB  1 
ATOM   1549 C  CG  . ARG B 1 272 ? 31.049 9.164  39.196 1.00 24.42 ? 272 ARG A CG  1 
ATOM   1550 C  CD  . ARG B 1 272 ? 31.510 8.446  37.961 1.00 23.44 ? 272 ARG A CD  1 
ATOM   1551 N  NE  . ARG B 1 272 ? 32.832 7.852  38.125 1.00 25.88 ? 272 ARG A NE  1 
ATOM   1552 C  CZ  . ARG B 1 272 ? 33.369 6.989  37.266 1.00 25.75 ? 272 ARG A CZ  1 
ATOM   1553 N  NH1 . ARG B 1 272 ? 32.708 6.625  36.185 1.00 26.19 ? 272 ARG A NH1 1 
ATOM   1554 N  NH2 . ARG B 1 272 ? 34.580 6.499  37.491 1.00 28.17 ? 272 ARG A NH2 1 
ATOM   1555 N  N   . LYS B 1 273 ? 27.618 7.852  40.361 1.00 25.05 ? 273 LYS A N   1 
ATOM   1556 C  CA  . LYS B 1 273 ? 27.274 6.754  41.293 1.00 26.66 ? 273 LYS A CA  1 
ATOM   1557 C  C   . LYS B 1 273 ? 26.443 5.637  40.642 1.00 27.12 ? 273 LYS A C   1 
ATOM   1558 O  O   . LYS B 1 273 ? 26.700 4.462  40.867 1.00 26.44 ? 273 LYS A O   1 
ATOM   1559 C  CB  . LYS B 1 273 ? 26.543 7.297  42.515 1.00 26.48 ? 273 LYS A CB  1 
ATOM   1560 C  CG  . LYS B 1 273 ? 27.429 8.006  43.489 1.00 29.77 ? 273 LYS A CG  1 
ATOM   1561 C  CD  . LYS B 1 273 ? 26.626 8.614  44.641 1.00 34.63 ? 273 LYS A CD  1 
ATOM   1562 C  CE  . LYS B 1 273 ? 27.533 8.884  45.832 1.00 35.12 ? 273 LYS A CE  1 
ATOM   1563 N  NZ  . LYS B 1 273 ? 26.932 9.934  46.705 1.00 37.64 ? 273 LYS A NZ  1 
ATOM   1564 N  N   . SER B 1 274 ? 25.441 6.001  39.849 1.00 28.13 ? 274 SER A N   1 
ATOM   1565 C  CA  . SER B 1 274 ? 24.663 5.003  39.116 1.00 29.15 ? 274 SER A CA  1 
ATOM   1566 C  C   . SER B 1 274 ? 25.586 4.152  38.246 1.00 28.79 ? 274 SER A C   1 
ATOM   1567 O  O   . SER B 1 274 ? 25.518 2.920  38.286 1.00 28.58 ? 274 SER A O   1 
ATOM   1568 C  CB  . SER B 1 274 ? 23.598 5.666  38.239 1.00 29.39 ? 274 SER A CB  1 
ATOM   1569 O  OG  . SER B 1 274 ? 22.730 6.466  39.022 1.00 31.62 ? 274 SER A OG  1 
ATOM   1570 N  N   . GLN B 1 275 ? 26.431 4.818  37.464 1.00 28.05 ? 275 GLN A N   1 
ATOM   1571 C  CA  . GLN B 1 275 ? 27.411 4.193  36.573 1.00 28.09 ? 275 GLN A CA  1 
ATOM   1572 C  C   . GLN B 1 275 ? 28.341 3.186  37.257 1.00 27.79 ? 275 GLN A C   1 
ATOM   1573 O  O   . GLN B 1 275 ? 28.634 2.140  36.694 1.00 27.24 ? 275 GLN A O   1 
ATOM   1574 C  CB  . GLN B 1 275 ? 28.300 5.278  35.973 1.00 28.23 ? 275 GLN A CB  1 
ATOM   1575 C  CG  . GLN B 1 275 ? 28.830 4.953  34.601 1.00 30.16 ? 275 GLN A CG  1 
ATOM   1576 C  CD  . GLN B 1 275 ? 29.921 5.902  34.112 1.00 29.47 ? 275 GLN A CD  1 
ATOM   1577 O  OE1 . GLN B 1 275 ? 30.381 6.794  34.828 1.00 31.31 ? 275 GLN A OE1 1 
ATOM   1578 N  NE2 . GLN B 1 275 ? 30.348 5.695  32.874 1.00 31.34 ? 275 GLN A NE2 1 
ATOM   1579 N  N   . LEU B 1 276 ? 28.860 3.552  38.428 1.00 26.56 ? 276 LEU A N   1 
ATOM   1580 C  CA  . LEU B 1 276 ? 29.705 2.664  39.238 1.00 26.71 ? 276 LEU A CA  1 
ATOM   1581 C  C   . LEU B 1 276 ? 28.910 1.443  39.726 1.00 26.77 ? 276 LEU A C   1 
ATOM   1582 O  O   . LEU B 1 276 ? 29.440 0.340  39.779 1.00 27.04 ? 276 LEU A O   1 
ATOM   1583 C  CB  . LEU B 1 276 ? 30.282 3.421  40.449 1.00 25.69 ? 276 LEU A CB  1 
ATOM   1584 C  CG  . LEU B 1 276 ? 31.246 4.562  40.099 1.00 24.60 ? 276 LEU A CG  1 
ATOM   1585 C  CD1 . LEU B 1 276 ? 31.513 5.430  41.304 1.00 24.72 ? 276 LEU A CD1 1 
ATOM   1586 C  CD2 . LEU B 1 276 ? 32.551 3.991  39.560 1.00 25.51 ? 276 LEU A CD2 1 
ATOM   1587 N  N   . VAL B 1 277 ? 27.640 1.653  40.060 1.00 27.44 ? 277 VAL A N   1 
ATOM   1588 C  CA  . VAL B 1 277 ? 26.799 0.605  40.635 1.00 28.79 ? 277 VAL A CA  1 
ATOM   1589 C  C   . VAL B 1 277 ? 26.267 -0.355 39.547 1.00 29.13 ? 277 VAL A C   1 
ATOM   1590 O  O   . VAL B 1 277 ? 26.157 -1.572 39.763 1.00 28.29 ? 277 VAL A O   1 
ATOM   1591 C  CB  . VAL B 1 277 ? 25.622 1.230  41.435 1.00 29.11 ? 277 VAL A CB  1 
ATOM   1592 C  CG1 . VAL B 1 277 ? 24.571 0.205  41.774 1.00 31.06 ? 277 VAL A CG1 1 
ATOM   1593 C  CG2 . VAL B 1 277 ? 26.118 1.855  42.719 1.00 30.12 ? 277 VAL A CG2 1 
ATOM   1594 N  N   . GLN B 1 278 ? 25.919 0.201  38.390 1.00 28.42 ? 278 GLN A N   1 
ATOM   1595 C  CA  . GLN B 1 278 ? 25.350 -0.584 37.306 1.00 30.49 ? 278 GLN A CA  1 
ATOM   1596 C  C   . GLN B 1 278 ? 25.941 -0.060 35.987 1.00 28.97 ? 278 GLN A C   1 
ATOM   1597 O  O   . GLN B 1 278 ? 25.326 0.744  35.320 1.00 27.48 ? 278 GLN A O   1 
ATOM   1598 C  CB  . GLN B 1 278 ? 23.808 -0.510 37.322 1.00 30.54 ? 278 GLN A CB  1 
ATOM   1599 C  CG  . GLN B 1 278 ? 23.107 -1.226 38.539 1.00 33.79 ? 278 GLN A CG  1 
ATOM   1600 C  CD  . GLN B 1 278 ? 21.714 -0.646 38.887 1.00 35.41 ? 278 GLN A CD  1 
ATOM   1601 O  OE1 . GLN B 1 278 ? 20.863 -0.443 38.004 1.00 42.42 ? 278 GLN A OE1 1 
ATOM   1602 N  NE2 . GLN B 1 278 ? 21.483 -0.374 40.180 1.00 39.68 ? 278 GLN A NE2 1 
ATOM   1603 N  N   . PRO B 1 279 ? 27.169 -0.518 35.641 1.00 29.06 ? 279 PRO A N   1 
ATOM   1604 C  CA  . PRO B 1 279 ? 27.919 -0.121 34.450 1.00 28.53 ? 279 PRO A CA  1 
ATOM   1605 C  C   . PRO B 1 279 ? 27.091 -0.359 33.197 1.00 28.27 ? 279 PRO A C   1 
ATOM   1606 O  O   . PRO B 1 279 ? 26.411 -1.381 33.105 1.00 27.74 ? 279 PRO A O   1 
ATOM   1607 C  CB  . PRO B 1 279 ? 29.113 -1.087 34.447 1.00 28.84 ? 279 PRO A CB  1 
ATOM   1608 C  CG  . PRO B 1 279 ? 29.277 -1.491 35.893 1.00 29.40 ? 279 PRO A CG  1 
ATOM   1609 C  CD  . PRO B 1 279 ? 27.913 -1.492 36.473 1.00 28.87 ? 279 PRO A CD  1 
ATOM   1610 N  N   . VAL B 1 280 ? 27.133 0.596  32.265 1.00 27.61 ? 280 VAL A N   1 
ATOM   1611 C  CA  . VAL B 1 280 ? 26.528 0.429  30.958 1.00 27.71 ? 280 VAL A CA  1 
ATOM   1612 C  C   . VAL B 1 280 ? 27.549 0.815  29.899 1.00 26.30 ? 280 VAL A C   1 
ATOM   1613 O  O   . VAL B 1 280 ? 28.733 0.631  30.110 1.00 25.96 ? 280 VAL A O   1 
ATOM   1614 C  CB  . VAL B 1 280 ? 25.184 1.182  30.791 1.00 28.68 ? 280 VAL A CB  1 
ATOM   1615 C  CG1 . VAL B 1 280 ? 24.049 0.397  31.451 1.00 29.53 ? 280 VAL A CG1 1 
ATOM   1616 C  CG2 . VAL B 1 280 ? 25.277 2.606  31.314 1.00 29.97 ? 280 VAL A CG2 1 
ATOM   1617 N  N   . GLY B 1 281 ? 27.115 1.347  28.766 1.00 25.98 ? 281 GLY A N   1 
ATOM   1618 C  CA  . GLY B 1 281 ? 28.081 1.668  27.715 1.00 25.70 ? 281 GLY A CA  1 
ATOM   1619 C  C   . GLY B 1 281 ? 28.430 3.143  27.720 1.00 25.73 ? 281 GLY A C   1 
ATOM   1620 O  O   . GLY B 1 281 ? 28.430 3.785  28.784 1.00 25.84 ? 281 GLY A O   1 
ATOM   1621 N  N   . PRO B 1 282 ? 28.701 3.705  26.534 1.00 25.15 ? 282 PRO A N   1 
ATOM   1622 C  CA  . PRO B 1 282 ? 28.958 5.155  26.482 1.00 25.00 ? 282 PRO A CA  1 
ATOM   1623 C  C   . PRO B 1 282 ? 27.811 5.969  27.089 1.00 24.24 ? 282 PRO A C   1 
ATOM   1624 O  O   . PRO B 1 282 ? 26.655 5.628  26.893 1.00 22.77 ? 282 PRO A O   1 
ATOM   1625 C  CB  . PRO B 1 282 ? 29.070 5.443  24.991 1.00 24.85 ? 282 PRO A CB  1 
ATOM   1626 C  CG  . PRO B 1 282 ? 29.392 4.124  24.358 1.00 25.74 ? 282 PRO A CG  1 
ATOM   1627 C  CD  . PRO B 1 282 ? 28.781 3.062  25.208 1.00 25.04 ? 282 PRO A CD  1 
ATOM   1628 N  N   . LEU B 1 283 ? 28.150 7.017  27.840 1.00 24.01 ? 283 LEU A N   1 
ATOM   1629 C  CA  . LEU B 1 283 ? 27.169 7.933  28.429 1.00 24.96 ? 283 LEU A CA  1 
ATOM   1630 C  C   . LEU B 1 283 ? 27.303 9.341  27.842 1.00 24.76 ? 283 LEU A C   1 
ATOM   1631 O  O   . LEU B 1 283 ? 28.426 9.866  27.742 1.00 24.62 ? 283 LEU A O   1 
ATOM   1632 C  CB  . LEU B 1 283 ? 27.404 8.043  29.929 1.00 25.30 ? 283 LEU A CB  1 
ATOM   1633 C  CG  . LEU B 1 283 ? 26.411 7.421  30.900 1.00 27.52 ? 283 LEU A CG  1 
ATOM   1634 C  CD1 . LEU B 1 283 ? 26.173 5.965  30.548 1.00 30.69 ? 283 LEU A CD1 1 
ATOM   1635 C  CD2 . LEU B 1 283 ? 26.880 7.570  32.341 1.00 26.22 ? 283 LEU A CD2 1 
ATOM   1636 N  N   . VAL B 1 284 ? 26.171 9.937  27.448 1.00 23.90 ? 284 VAL A N   1 
ATOM   1637 C  CA  . VAL B 1 284 ? 26.116 11.360 27.101 1.00 23.51 ? 284 VAL A CA  1 
ATOM   1638 C  C   . VAL B 1 284 ? 25.268 12.091 28.128 1.00 23.65 ? 284 VAL A C   1 
ATOM   1639 O  O   . VAL B 1 284 ? 24.152 11.673 28.429 1.00 24.14 ? 284 VAL A O   1 
ATOM   1640 C  CB  . VAL B 1 284 ? 25.504 11.605 25.698 1.00 23.40 ? 284 VAL A CB  1 
ATOM   1641 C  CG1 . VAL B 1 284 ? 25.444 13.112 25.380 1.00 22.59 ? 284 VAL A CG1 1 
ATOM   1642 C  CG2 . VAL B 1 284 ? 26.293 10.881 24.629 1.00 23.47 ? 284 VAL A CG2 1 
ATOM   1643 N  N   . VAL B 1 285 ? 25.793 13.178 28.678 1.00 23.14 ? 285 VAL A N   1 
ATOM   1644 C  CA  . VAL B 1 285 ? 25.070 13.953 29.684 1.00 22.30 ? 285 VAL A CA  1 
ATOM   1645 C  C   . VAL B 1 285 ? 24.730 15.294 29.045 1.00 22.21 ? 285 VAL A C   1 
ATOM   1646 O  O   . VAL B 1 285 ? 25.626 16.041 28.619 1.00 21.61 ? 285 VAL A O   1 
ATOM   1647 C  CB  . VAL B 1 285 ? 25.892 14.113 30.980 1.00 22.68 ? 285 VAL A CB  1 
ATOM   1648 C  CG1 . VAL B 1 285 ? 25.166 14.997 32.016 1.00 23.27 ? 285 VAL A CG1 1 
ATOM   1649 C  CG2 . VAL B 1 285 ? 26.173 12.725 31.613 1.00 21.65 ? 285 VAL A CG2 1 
ATOM   1650 N  N   . LEU B 1 286 ? 23.430 15.555 28.933 1.00 22.22 ? 286 LEU A N   1 
ATOM   1651 C  CA  . LEU B 1 286 ? 22.902 16.829 28.441 1.00 21.91 ? 286 LEU A CA  1 
ATOM   1652 C  C   . LEU B 1 286 ? 22.554 17.779 29.592 1.00 22.02 ? 286 LEU A C   1 
ATOM   1653 O  O   . LEU B 1 286 ? 21.754 17.455 30.485 1.00 22.46 ? 286 LEU A O   1 
ATOM   1654 C  CB  . LEU B 1 286 ? 21.696 16.603 27.518 1.00 21.28 ? 286 LEU A CB  1 
ATOM   1655 C  CG  . LEU B 1 286 ? 20.995 17.798 26.841 1.00 22.50 ? 286 LEU A CG  1 
ATOM   1656 C  CD1 . LEU B 1 286 ? 21.958 18.739 26.128 1.00 19.78 ? 286 LEU A CD1 1 
ATOM   1657 C  CD2 . LEU B 1 286 ? 19.931 17.271 25.874 1.00 21.71 ? 286 LEU A CD2 1 
ATOM   1658 N  N   . LEU B 1 287 ? 23.205 18.944 29.564 1.00 22.43 ? 287 LEU A N   1 
ATOM   1659 C  CA  . LEU B 1 287 ? 23.028 20.035 30.529 1.00 22.71 ? 287 LEU A CA  1 
ATOM   1660 C  C   . LEU B 1 287 ? 22.488 21.286 29.829 1.00 23.39 ? 287 LEU A C   1 
ATOM   1661 O  O   . LEU B 1 287 ? 23.256 22.147 29.384 1.00 23.22 ? 287 LEU A O   1 
ATOM   1662 C  CB  . LEU B 1 287 ? 24.370 20.362 31.189 1.00 22.83 ? 287 LEU A CB  1 
ATOM   1663 C  CG  . LEU B 1 287 ? 24.976 19.197 31.971 1.00 24.31 ? 287 LEU A CG  1 
ATOM   1664 C  CD1 . LEU B 1 287 ? 26.477 19.289 31.994 1.00 26.86 ? 287 LEU A CD1 1 
ATOM   1665 C  CD2 . LEU B 1 287 ? 24.407 19.223 33.395 1.00 26.12 ? 287 LEU A CD2 1 
ATOM   1666 N  N   . PRO B 1 288 ? 21.155 21.398 29.730 1.00 23.28 ? 288 PRO A N   1 
ATOM   1667 C  CA  . PRO B 1 288 ? 20.543 22.485 28.963 1.00 23.23 ? 288 PRO A CA  1 
ATOM   1668 C  C   . PRO B 1 288 ? 20.238 23.664 29.876 1.00 22.67 ? 288 PRO A C   1 
ATOM   1669 O  O   . PRO B 1 288 ? 19.084 24.100 29.971 1.00 23.21 ? 288 PRO A O   1 
ATOM   1670 C  CB  . PRO B 1 288 ? 19.253 21.841 28.456 1.00 23.09 ? 288 PRO A CB  1 
ATOM   1671 C  CG  . PRO B 1 288 ? 18.903 20.823 29.521 1.00 24.13 ? 288 PRO A CG  1 
ATOM   1672 C  CD  . PRO B 1 288 ? 20.145 20.517 30.328 1.00 23.56 ? 288 PRO A CD  1 
ATOM   1673 N  N   . LEU B 1 289 ? 21.278 24.157 30.541 1.00 21.92 ? 289 LEU A N   1 
ATOM   1674 C  CA  . LEU B 1 289 ? 21.160 25.117 31.624 1.00 21.79 ? 289 LEU A CA  1 
ATOM   1675 C  C   . LEU B 1 289 ? 22.455 25.916 31.741 1.00 21.61 ? 289 LEU A C   1 
ATOM   1676 O  O   . LEU B 1 289 ? 23.491 25.518 31.181 1.00 20.29 ? 289 LEU A O   1 
ATOM   1677 C  CB  . LEU B 1 289 ? 20.827 24.394 32.957 1.00 22.18 ? 289 LEU A CB  1 
ATOM   1678 C  CG  . LEU B 1 289 ? 21.751 23.266 33.464 1.00 24.00 ? 289 LEU A CG  1 
ATOM   1679 C  CD1 . LEU B 1 289 ? 22.967 23.818 34.229 1.00 23.94 ? 289 LEU A CD1 1 
ATOM   1680 C  CD2 . LEU B 1 289 ? 20.988 22.247 34.342 1.00 23.78 ? 289 LEU A CD2 1 
ATOM   1681 N  N   . ALA B 1 290 ? 22.393 27.039 32.465 1.00 20.80 ? 290 ALA A N   1 
ATOM   1682 C  CA  . ALA B 1 290 ? 23.546 27.937 32.608 1.00 21.44 ? 290 ALA A CA  1 
ATOM   1683 C  C   . ALA B 1 290 ? 23.346 28.845 33.811 1.00 21.38 ? 290 ALA A C   1 
ATOM   1684 O  O   . ALA B 1 290 ? 22.222 29.234 34.143 1.00 21.62 ? 290 ALA A O   1 
ATOM   1685 C  CB  . ALA B 1 290 ? 23.750 28.787 31.348 1.00 20.65 ? 290 ALA A CB  1 
ATOM   1686 N  N   . GLY B 1 291 ? 24.450 29.159 34.467 1.00 21.60 ? 291 GLY A N   1 
ATOM   1687 C  CA  . GLY B 1 291 ? 24.488 30.207 35.482 1.00 21.75 ? 291 GLY A CA  1 
ATOM   1688 C  C   . GLY B 1 291 ? 25.795 30.937 35.261 1.00 22.19 ? 291 GLY A C   1 
ATOM   1689 O  O   . GLY B 1 291 ? 26.428 30.761 34.217 1.00 22.25 ? 291 GLY A O   1 
ATOM   1690 N  N   . GLY B 1 292 ? 26.232 31.724 36.243 1.00 22.77 ? 292 GLY A N   1 
ATOM   1691 C  CA  . GLY B 1 292 ? 27.486 32.456 36.113 1.00 22.26 ? 292 GLY A CA  1 
ATOM   1692 C  C   . GLY B 1 292 ? 28.662 31.514 36.243 1.00 23.56 ? 292 GLY A C   1 
ATOM   1693 O  O   . GLY B 1 292 ? 28.488 30.363 36.652 1.00 22.85 ? 292 GLY A O   1 
ATOM   1694 N  N   . TYR B 1 293 ? 29.867 31.995 35.917 1.00 23.21 ? 293 TYR A N   1 
ATOM   1695 C  CA  . TYR B 1 293 ? 31.062 31.171 36.061 1.00 23.47 ? 293 TYR A CA  1 
ATOM   1696 C  C   . TYR B 1 293 ? 31.111 30.521 37.437 1.00 23.30 ? 293 TYR A C   1 
ATOM   1697 O  O   . TYR B 1 293 ? 30.998 31.195 38.467 1.00 23.59 ? 293 TYR A O   1 
ATOM   1698 C  CB  . TYR B 1 293 ? 32.342 31.972 35.793 1.00 24.11 ? 293 TYR A CB  1 
ATOM   1699 C  CG  . TYR B 1 293 ? 33.609 31.152 35.787 1.00 25.67 ? 293 TYR A CG  1 
ATOM   1700 C  CD1 . TYR B 1 293 ? 34.153 30.695 34.597 1.00 26.66 ? 293 TYR A CD1 1 
ATOM   1701 C  CD2 . TYR B 1 293 ? 34.260 30.818 36.978 1.00 26.50 ? 293 TYR A CD2 1 
ATOM   1702 C  CE1 . TYR B 1 293 ? 35.332 29.937 34.582 1.00 27.95 ? 293 TYR A CE1 1 
ATOM   1703 C  CE2 . TYR B 1 293 ? 35.409 30.038 36.978 1.00 26.96 ? 293 TYR A CE2 1 
ATOM   1704 C  CZ  . TYR B 1 293 ? 35.942 29.613 35.773 1.00 26.89 ? 293 TYR A CZ  1 
ATOM   1705 O  OH  . TYR B 1 293 ? 37.091 28.862 35.751 1.00 28.53 ? 293 TYR A OH  1 
ATOM   1706 N  N   . SER B 1 294 ? 31.264 29.200 37.439 1.00 22.36 ? 294 SER A N   1 
ATOM   1707 C  CA  . SER B 1 294 ? 31.351 28.453 38.666 1.00 21.86 ? 294 SER A CA  1 
ATOM   1708 C  C   . SER B 1 294 ? 32.606 27.601 38.632 1.00 21.58 ? 294 SER A C   1 
ATOM   1709 O  O   . SER B 1 294 ? 32.742 26.695 37.793 1.00 21.52 ? 294 SER A O   1 
ATOM   1710 C  CB  . SER B 1 294 ? 30.118 27.570 38.855 1.00 21.68 ? 294 SER A CB  1 
ATOM   1711 O  OG  . SER B 1 294 ? 30.230 26.843 40.067 1.00 23.55 ? 294 SER A OG  1 
ATOM   1712 N  N   . ARG B 1 295 ? 33.523 27.897 39.537 1.00 21.54 ? 295 ARG A N   1 
ATOM   1713 C  CA  . ARG B 1 295 ? 34.712 27.047 39.715 1.00 23.31 ? 295 ARG A CA  1 
ATOM   1714 C  C   . ARG B 1 295 ? 34.323 25.591 39.982 1.00 22.86 ? 295 ARG A C   1 
ATOM   1715 O  O   . ARG B 1 295 ? 34.859 24.659 39.357 1.00 23.96 ? 295 ARG A O   1 
ATOM   1716 C  CB  . ARG B 1 295 ? 35.605 27.592 40.844 1.00 22.83 ? 295 ARG A CB  1 
ATOM   1717 C  CG  . ARG B 1 295 ? 37.022 27.046 40.789 1.00 25.44 ? 295 ARG A CG  1 
ATOM   1718 C  CD  . ARG B 1 295 ? 37.827 27.425 42.017 1.00 24.77 ? 295 ARG A CD  1 
ATOM   1719 N  NE  . ARG B 1 295 ? 39.065 26.650 42.052 1.00 24.01 ? 295 ARG A NE  1 
ATOM   1720 C  CZ  . ARG B 1 295 ? 40.066 26.888 42.889 1.00 25.02 ? 295 ARG A CZ  1 
ATOM   1721 N  NH1 . ARG B 1 295 ? 39.985 27.882 43.773 1.00 23.66 ? 295 ARG A NH1 1 
ATOM   1722 N  NH2 . ARG B 1 295 ? 41.136 26.121 42.859 1.00 26.14 ? 295 ARG A NH2 1 
ATOM   1723 N  N   . VAL B 1 296 ? 33.372 25.392 40.888 1.00 23.61 ? 296 VAL A N   1 
ATOM   1724 C  CA  . VAL B 1 296 ? 33.017 24.044 41.319 1.00 23.79 ? 296 VAL A CA  1 
ATOM   1725 C  C   . VAL B 1 296 ? 32.245 23.268 40.249 1.00 24.18 ? 296 VAL A C   1 
ATOM   1726 O  O   . VAL B 1 296 ? 32.521 22.095 40.003 1.00 24.14 ? 296 VAL A O   1 
ATOM   1727 C  CB  . VAL B 1 296 ? 32.347 24.024 42.748 1.00 23.98 ? 296 VAL A CB  1 
ATOM   1728 C  CG1 . VAL B 1 296 ? 30.939 24.566 42.743 1.00 23.76 ? 296 VAL A CG1 1 
ATOM   1729 C  CG2 . VAL B 1 296 ? 32.374 22.602 43.350 1.00 24.75 ? 296 VAL A CG2 1 
ATOM   1730 N  N   . LEU B 1 297 ? 31.290 23.910 39.581 1.00 24.45 ? 297 LEU A N   1 
ATOM   1731 C  CA  . LEU B 1 297 ? 30.580 23.205 38.517 1.00 24.16 ? 297 LEU A CA  1 
ATOM   1732 C  C   . LEU B 1 297 ? 31.540 22.831 37.397 1.00 23.92 ? 297 LEU A C   1 
ATOM   1733 O  O   . LEU B 1 297 ? 31.460 21.731 36.842 1.00 23.83 ? 297 LEU A O   1 
ATOM   1734 C  CB  . LEU B 1 297 ? 29.420 24.035 37.985 1.00 24.52 ? 297 LEU A CB  1 
ATOM   1735 C  CG  . LEU B 1 297 ? 28.418 23.392 37.023 1.00 26.11 ? 297 LEU A CG  1 
ATOM   1736 C  CD1 . LEU B 1 297 ? 27.807 22.094 37.608 1.00 26.23 ? 297 LEU A CD1 1 
ATOM   1737 C  CD2 . LEU B 1 297 ? 27.336 24.421 36.730 1.00 25.54 ? 297 LEU A CD2 1 
ATOM   1738 N  N   . ASN B 1 298 ? 32.450 23.744 37.061 1.00 23.27 ? 298 ASN A N   1 
ATOM   1739 C  CA  . ASN B 1 298 ? 33.418 23.478 35.996 1.00 23.41 ? 298 ASN A CA  1 
ATOM   1740 C  C   . ASN B 1 298 ? 34.311 22.294 36.360 1.00 23.23 ? 298 ASN A C   1 
ATOM   1741 O  O   . ASN B 1 298 ? 34.590 21.442 35.515 1.00 22.97 ? 298 ASN A O   1 
ATOM   1742 C  CB  . ASN B 1 298 ? 34.266 24.726 35.693 1.00 22.69 ? 298 ASN A CB  1 
ATOM   1743 C  CG  . ASN B 1 298 ? 33.546 25.726 34.780 1.00 22.45 ? 298 ASN A CG  1 
ATOM   1744 O  OD1 . ASN B 1 298 ? 34.172 26.629 34.235 1.00 25.01 ? 298 ASN A OD1 1 
ATOM   1745 N  ND2 . ASN B 1 298 ? 32.251 25.556 34.594 1.00 19.73 ? 298 ASN A ND2 1 
ATOM   1746 N  N   . ALA B 1 299 ? 34.743 22.245 37.622 1.00 22.39 ? 299 ALA A N   1 
ATOM   1747 C  CA  . ALA B 1 299 ? 35.609 21.148 38.091 1.00 22.98 ? 299 ALA A CA  1 
ATOM   1748 C  C   . ALA B 1 299 ? 34.886 19.802 38.075 1.00 23.15 ? 299 ALA A C   1 
ATOM   1749 O  O   . ALA B 1 299 ? 35.471 18.792 37.701 1.00 23.00 ? 299 ALA A O   1 
ATOM   1750 C  CB  . ALA B 1 299 ? 36.176 21.440 39.482 1.00 23.04 ? 299 ALA A CB  1 
ATOM   1751 N  N   . ALA B 1 300 ? 33.612 19.801 38.472 1.00 23.61 ? 300 ALA A N   1 
ATOM   1752 C  CA  . ALA B 1 300 ? 32.797 18.575 38.505 1.00 24.31 ? 300 ALA A CA  1 
ATOM   1753 C  C   . ALA B 1 300 ? 32.580 18.049 37.090 1.00 24.96 ? 300 ALA A C   1 
ATOM   1754 O  O   . ALA B 1 300 ? 32.700 16.848 36.831 1.00 24.40 ? 300 ALA A O   1 
ATOM   1755 C  CB  . ALA B 1 300 ? 31.478 18.846 39.167 1.00 24.56 ? 300 ALA A CB  1 
ATOM   1756 N  N   . CYS B 1 301 ? 32.272 18.975 36.180 1.00 25.63 ? 301 CYS A N   1 
ATOM   1757 C  CA  . CYS B 1 301 ? 32.209 18.687 34.752 1.00 27.16 ? 301 CYS A CA  1 
ATOM   1758 C  C   . CYS B 1 301 ? 33.518 18.104 34.232 1.00 27.80 ? 301 CYS A C   1 
ATOM   1759 O  O   . CYS B 1 301 ? 33.500 17.096 33.542 1.00 28.38 ? 301 CYS A O   1 
ATOM   1760 C  CB  . CYS B 1 301 ? 31.785 19.951 33.979 1.00 26.19 ? 301 CYS A CB  1 
ATOM   1761 S  SG  . CYS B 1 301 ? 30.018 20.272 34.224 1.00 29.45 ? 301 CYS A SG  1 
ATOM   1762 N  N   . GLN B 1 302 ? 34.652 18.731 34.562 1.00 28.90 ? 302 GLN A N   1 
ATOM   1763 C  CA  . GLN B 1 302 ? 35.953 18.239 34.110 1.00 30.05 ? 302 GLN A CA  1 
ATOM   1764 C  C   . GLN B 1 302 ? 36.241 16.826 34.624 1.00 30.10 ? 302 GLN A C   1 
ATOM   1765 O  O   . GLN B 1 302 ? 36.694 15.968 33.868 1.00 29.18 ? 302 GLN A O   1 
ATOM   1766 C  CB  . GLN B 1 302 ? 37.070 19.193 34.529 1.00 30.55 ? 302 GLN A CB  1 
ATOM   1767 C  CG  . GLN B 1 302 ? 38.433 18.804 34.017 1.00 33.87 ? 302 GLN A CG  1 
ATOM   1768 C  CD  . GLN B 1 302 ? 39.520 19.774 34.420 1.00 38.68 ? 302 GLN A CD  1 
ATOM   1769 O  OE1 . GLN B 1 302 ? 40.281 20.242 33.580 1.00 42.21 ? 302 GLN A OE1 1 
ATOM   1770 N  NE2 . GLN B 1 302 ? 39.602 20.082 35.712 1.00 40.57 ? 302 GLN A NE2 1 
ATOM   1771 N  N   . ARG B 1 303 ? 35.961 16.596 35.905 1.00 30.61 ? 303 ARG A N   1 
ATOM   1772 C  CA  . ARG B 1 303 ? 36.159 15.289 36.514 1.00 31.36 ? 303 ARG A CA  1 
ATOM   1773 C  C   . ARG B 1 303 ? 35.266 14.209 35.921 1.00 31.01 ? 303 ARG A C   1 
ATOM   1774 O  O   . ARG B 1 303 ? 35.699 13.071 35.724 1.00 30.58 ? 303 ARG A O   1 
ATOM   1775 C  CB  . ARG B 1 303 ? 35.992 15.371 38.022 1.00 31.96 ? 303 ARG A CB  1 
ATOM   1776 C  CG  . ARG B 1 303 ? 35.906 14.007 38.715 1.00 36.79 ? 303 ARG A CG  1 
ATOM   1777 C  CD  . ARG B 1 303 ? 37.278 13.370 38.989 1.00 43.39 ? 303 ARG A CD  1 
ATOM   1778 N  NE  . ARG B 1 303 ? 37.512 12.127 38.238 1.00 48.12 ? 303 ARG A NE  1 
ATOM   1779 C  CZ  . ARG B 1 303 ? 37.385 10.898 38.748 1.00 50.27 ? 303 ARG A CZ  1 
ATOM   1780 N  NH1 . ARG B 1 303 ? 37.021 10.728 40.022 1.00 51.26 ? 303 ARG A NH1 1 
ATOM   1781 N  NH2 . ARG B 1 303 ? 37.635 9.833  37.989 1.00 49.62 ? 303 ARG A NH2 1 
ATOM   1782 N  N   . LEU B 1 304 ? 34.017 14.558 35.619 1.00 31.02 ? 304 LEU A N   1 
ATOM   1783 C  CA  . LEU B 1 304 ? 33.125 13.614 34.975 1.00 31.00 ? 304 LEU A CA  1 
ATOM   1784 C  C   . LEU B 1 304 ? 33.615 13.294 33.557 1.00 31.86 ? 304 LEU A C   1 
ATOM   1785 O  O   . LEU B 1 304 ? 33.543 12.154 33.117 1.00 32.01 ? 304 LEU A O   1 
ATOM   1786 C  CB  . LEU B 1 304 ? 31.673 14.136 34.998 1.00 30.73 ? 304 LEU A CB  1 
ATOM   1787 C  CG  . LEU B 1 304 ? 30.503 13.192 34.689 1.00 31.08 ? 304 LEU A CG  1 
ATOM   1788 C  CD1 . LEU B 1 304 ? 30.609 11.833 35.387 1.00 27.02 ? 304 LEU A CD1 1 
ATOM   1789 C  CD2 . LEU B 1 304 ? 29.155 13.859 34.996 1.00 30.11 ? 304 LEU A CD2 1 
ATOM   1790 N  N   . ALA B 1 305 ? 34.142 14.287 32.849 1.00 32.47 ? 305 ALA A N   1 
ATOM   1791 C  CA  . ALA B 1 305 ? 34.628 14.055 31.494 1.00 33.93 ? 305 ALA A CA  1 
ATOM   1792 C  C   . ALA B 1 305 ? 35.925 13.259 31.501 1.00 35.05 ? 305 ALA A C   1 
ATOM   1793 O  O   . ALA B 1 305 ? 36.152 12.421 30.630 1.00 35.74 ? 305 ALA A O   1 
ATOM   1794 C  CB  . ALA B 1 305 ? 34.815 15.375 30.748 1.00 33.43 ? 305 ALA A CB  1 
ATOM   1795 N  N   . ARG B 1 306 ? 36.780 13.514 32.486 1.00 36.47 ? 306 ARG A N   1 
ATOM   1796 C  CA  . ARG B 1 306 ? 38.052 12.785 32.591 1.00 38.07 ? 306 ARG A CA  1 
ATOM   1797 C  C   . ARG B 1 306 ? 37.827 11.315 32.943 1.00 37.91 ? 306 ARG A C   1 
ATOM   1798 O  O   . ARG B 1 306 ? 38.659 10.460 32.644 1.00 38.60 ? 306 ARG A O   1 
ATOM   1799 C  CB  . ARG B 1 306 ? 38.998 13.466 33.585 1.00 38.04 ? 306 ARG A CB  1 
ATOM   1800 C  CG  . ARG B 1 306 ? 39.688 14.673 32.997 1.00 41.65 ? 306 ARG A CG  1 
ATOM   1801 C  CD  . ARG B 1 306 ? 40.698 15.244 33.958 1.00 47.26 ? 306 ARG A CD  1 
ATOM   1802 N  NE  . ARG B 1 306 ? 41.846 15.797 33.245 1.00 51.42 ? 306 ARG A NE  1 
ATOM   1803 C  CZ  . ARG B 1 306 ? 43.033 16.037 33.802 1.00 53.59 ? 306 ARG A CZ  1 
ATOM   1804 N  NH1 . ARG B 1 306 ? 43.245 15.772 35.091 1.00 53.82 ? 306 ARG A NH1 1 
ATOM   1805 N  NH2 . ARG B 1 306 ? 44.016 16.536 33.064 1.00 54.65 ? 306 ARG A NH2 1 
ATOM   1806 N  N   . ALA B 1 307 ? 36.673 11.042 33.541 1.00 37.57 ? 307 ALA A N   1 
ATOM   1807 C  CA  . ALA B 1 307 ? 36.243 9.699  33.862 1.00 37.08 ? 307 ALA A CA  1 
ATOM   1808 C  C   . ALA B 1 307 ? 35.590 8.959  32.680 1.00 36.29 ? 307 ALA A C   1 
ATOM   1809 O  O   . ALA B 1 307 ? 35.117 7.847  32.847 1.00 36.87 ? 307 ALA A O   1 
ATOM   1810 C  CB  . ALA B 1 307 ? 35.298 9.742  35.074 1.00 37.57 ? 307 ALA A CB  1 
ATOM   1811 N  N   . GLY B 1 308 ? 35.560 9.581  31.498 1.00 35.61 ? 308 GLY A N   1 
ATOM   1812 C  CA  . GLY B 1 308 ? 35.034 8.951  30.272 1.00 33.23 ? 308 GLY A CA  1 
ATOM   1813 C  C   . GLY B 1 308 ? 33.626 9.320  29.800 1.00 32.18 ? 308 GLY A C   1 
ATOM   1814 O  O   . GLY B 1 308 ? 33.159 8.787  28.802 1.00 32.75 ? 308 GLY A O   1 
ATOM   1815 N  N   . VAL B 1 309 ? 32.950 10.239 30.488 1.00 30.72 ? 309 VAL A N   1 
ATOM   1816 C  CA  . VAL B 1 309 ? 31.569 10.644 30.135 1.00 28.47 ? 309 VAL A CA  1 
ATOM   1817 C  C   . VAL B 1 309 ? 31.566 11.838 29.155 1.00 27.52 ? 309 VAL A C   1 
ATOM   1818 O  O   . VAL B 1 309 ? 32.410 12.723 29.248 1.00 27.30 ? 309 VAL A O   1 
ATOM   1819 C  CB  . VAL B 1 309 ? 30.734 10.954 31.421 1.00 28.71 ? 309 VAL A CB  1 
ATOM   1820 C  CG1 . VAL B 1 309 ? 29.368 11.535 31.082 1.00 27.90 ? 309 VAL A CG1 1 
ATOM   1821 C  CG2 . VAL B 1 309 ? 30.556 9.689  32.266 1.00 27.78 ? 309 VAL A CG2 1 
ATOM   1822 N  N   . VAL B 1 310 ? 30.646 11.844 28.193 1.00 26.05 ? 310 VAL A N   1 
ATOM   1823 C  CA  . VAL B 1 310 ? 30.539 12.968 27.255 1.00 25.10 ? 310 VAL A CA  1 
ATOM   1824 C  C   . VAL B 1 310 ? 29.514 13.989 27.761 1.00 25.00 ? 310 VAL A C   1 
ATOM   1825 O  O   . VAL B 1 310 ? 28.336 13.648 27.966 1.00 24.82 ? 310 VAL A O   1 
ATOM   1826 C  CB  . VAL B 1 310 ? 30.181 12.471 25.853 1.00 25.25 ? 310 VAL A CB  1 
ATOM   1827 C  CG1 . VAL B 1 310 ? 29.946 13.650 24.873 1.00 24.40 ? 310 VAL A CG1 1 
ATOM   1828 C  CG2 . VAL B 1 310 ? 31.300 11.561 25.365 1.00 25.89 ? 310 VAL A CG2 1 
ATOM   1829 N  N   . LEU B 1 311 ? 29.970 15.217 28.012 1.00 23.57 ? 311 LEU A N   1 
ATOM   1830 C  CA  . LEU B 1 311 ? 29.090 16.284 28.494 1.00 22.95 ? 311 LEU A CA  1 
ATOM   1831 C  C   . LEU B 1 311 ? 28.760 17.254 27.371 1.00 22.05 ? 311 LEU A C   1 
ATOM   1832 O  O   . LEU B 1 311 ? 29.666 17.719 26.682 1.00 20.69 ? 311 LEU A O   1 
ATOM   1833 C  CB  . LEU B 1 311 ? 29.715 17.038 29.690 1.00 22.77 ? 311 LEU A CB  1 
ATOM   1834 C  CG  . LEU B 1 311 ? 29.337 16.457 31.065 1.00 23.46 ? 311 LEU A CG  1 
ATOM   1835 C  CD1 . LEU B 1 311 ? 30.021 15.146 31.254 1.00 24.48 ? 311 LEU A CD1 1 
ATOM   1836 C  CD2 . LEU B 1 311 ? 29.728 17.366 32.222 1.00 24.78 ? 311 LEU A CD2 1 
ATOM   1837 N  N   . VAL B 1 312 ? 27.469 17.512 27.160 1.00 21.04 ? 312 VAL A N   1 
ATOM   1838 C  CA  . VAL B 1 312 ? 27.035 18.499 26.155 1.00 21.32 ? 312 VAL A CA  1 
ATOM   1839 C  C   . VAL B 1 312 ? 26.247 19.594 26.877 1.00 21.77 ? 312 VAL A C   1 
ATOM   1840 O  O   . VAL B 1 312 ? 25.345 19.298 27.642 1.00 22.71 ? 312 VAL A O   1 
ATOM   1841 C  CB  . VAL B 1 312 ? 26.196 17.855 24.998 1.00 21.73 ? 312 VAL A CB  1 
ATOM   1842 C  CG1 . VAL B 1 312 ? 25.774 18.898 23.965 1.00 21.56 ? 312 VAL A CG1 1 
ATOM   1843 C  CG2 . VAL B 1 312 ? 26.982 16.739 24.324 1.00 19.64 ? 312 VAL A CG2 1 
ATOM   1844 N  N   . THR B 1 313 ? 26.608 20.859 26.670 1.00 21.78 ? 313 THR A N   1 
ATOM   1845 C  CA  . THR B 1 313 ? 25.932 21.937 27.395 1.00 22.06 ? 313 THR A CA  1 
ATOM   1846 C  C   . THR B 1 313 ? 25.446 23.069 26.481 1.00 21.12 ? 313 THR A C   1 
ATOM   1847 O  O   . THR B 1 313 ? 25.954 23.250 25.374 1.00 20.63 ? 313 THR A O   1 
ATOM   1848 C  CB  . THR B 1 313 ? 26.824 22.519 28.487 1.00 22.59 ? 313 THR A CB  1 
ATOM   1849 O  OG1 . THR B 1 313 ? 26.019 23.370 29.319 1.00 29.98 ? 313 THR A OG1 1 
ATOM   1850 C  CG2 . THR B 1 313 ? 27.958 23.335 27.885 1.00 20.09 ? 313 THR A CG2 1 
ATOM   1851 N  N   . ALA B 1 314 ? 24.419 23.787 26.938 1.00 21.03 ? 314 ALA A N   1 
ATOM   1852 C  CA  . ALA B 1 314 ? 23.933 24.976 26.250 1.00 19.77 ? 314 ALA A CA  1 
ATOM   1853 C  C   . ALA B 1 314 ? 24.993 26.089 26.367 1.00 19.42 ? 314 ALA A C   1 
ATOM   1854 O  O   . ALA B 1 314 ? 25.551 26.267 27.432 1.00 19.42 ? 314 ALA A O   1 
ATOM   1855 C  CB  . ALA B 1 314 ? 22.617 25.419 26.870 1.00 20.07 ? 314 ALA A CB  1 
ATOM   1856 N  N   . ALA B 1 315 ? 25.295 26.810 25.280 1.00 19.31 ? 315 ALA A N   1 
ATOM   1857 C  CA  . ALA B 1 315 ? 26.195 27.982 25.380 1.00 18.41 ? 315 ALA A CA  1 
ATOM   1858 C  C   . ALA B 1 315 ? 25.616 29.100 26.263 1.00 19.61 ? 315 ALA A C   1 
ATOM   1859 O  O   . ALA B 1 315 ? 26.384 29.913 26.786 1.00 18.39 ? 315 ALA A O   1 
ATOM   1860 C  CB  . ALA B 1 315 ? 26.522 28.548 24.003 1.00 18.94 ? 315 ALA A CB  1 
ATOM   1861 N  N   . GLY B 1 316 ? 24.280 29.153 26.388 1.00 18.72 ? 316 GLY A N   1 
ATOM   1862 C  CA  . GLY B 1 316 ? 23.603 30.209 27.165 1.00 19.01 ? 316 GLY A CA  1 
ATOM   1863 C  C   . GLY B 1 316 ? 22.924 31.197 26.230 1.00 18.81 ? 316 GLY A C   1 
ATOM   1864 O  O   . GLY B 1 316 ? 23.366 31.384 25.105 1.00 19.39 ? 316 GLY A O   1 
ATOM   1865 N  N   . ASN B 1 317 ? 21.853 31.829 26.692 1.00 19.48 ? 317 ASN A N   1 
ATOM   1866 C  CA  . ASN B 1 317 ? 21.037 32.699 25.860 1.00 20.78 ? 317 ASN A CA  1 
ATOM   1867 C  C   . ASN B 1 317 ? 21.224 34.191 26.165 1.00 21.90 ? 317 ASN A C   1 
ATOM   1868 O  O   . ASN B 1 317 ? 20.261 34.964 26.090 1.00 21.13 ? 317 ASN A O   1 
ATOM   1869 C  CB  . ASN B 1 317 ? 19.548 32.370 26.062 1.00 21.64 ? 317 ASN A CB  1 
ATOM   1870 C  CG  . ASN B 1 317 ? 19.196 30.974 25.649 1.00 21.09 ? 317 ASN A CG  1 
ATOM   1871 O  OD1 . ASN B 1 317 ? 19.884 30.365 24.836 1.00 19.72 ? 317 ASN A OD1 1 
ATOM   1872 N  ND2 . ASN B 1 317 ? 18.088 30.467 26.182 1.00 21.54 ? 317 ASN A ND2 1 
ATOM   1873 N  N   . PHE B 1 318 ? 22.454 34.609 26.465 1.00 22.57 ? 318 PHE A N   1 
ATOM   1874 C  CA  . PHE B 1 318 ? 22.660 35.981 26.966 1.00 22.91 ? 318 PHE A CA  1 
ATOM   1875 C  C   . PHE B 1 318 ? 23.323 36.931 25.971 1.00 23.11 ? 318 PHE A C   1 
ATOM   1876 O  O   . PHE B 1 318 ? 23.687 38.043 26.350 1.00 22.92 ? 318 PHE A O   1 
ATOM   1877 C  CB  . PHE B 1 318 ? 23.410 35.948 28.299 1.00 23.43 ? 318 PHE A CB  1 
ATOM   1878 C  CG  . PHE B 1 318 ? 22.807 35.005 29.302 1.00 24.40 ? 318 PHE A CG  1 
ATOM   1879 C  CD1 . PHE B 1 318 ? 21.603 35.299 29.915 1.00 28.91 ? 318 PHE A CD1 1 
ATOM   1880 C  CD2 . PHE B 1 318 ? 23.417 33.805 29.590 1.00 27.39 ? 318 PHE A CD2 1 
ATOM   1881 C  CE1 . PHE B 1 318 ? 21.020 34.402 30.827 1.00 29.05 ? 318 PHE A CE1 1 
ATOM   1882 C  CE2 . PHE B 1 318 ? 22.848 32.907 30.505 1.00 27.91 ? 318 PHE A CE2 1 
ATOM   1883 C  CZ  . PHE B 1 318 ? 21.649 33.217 31.117 1.00 27.80 ? 318 PHE A CZ  1 
ATOM   1884 N  N   . ARG B 1 319 ? 23.478 36.479 24.718 1.00 21.89 ? 319 ARG A N   1 
ATOM   1885 C  CA  . ARG B 1 319 ? 24.198 37.207 23.670 1.00 22.57 ? 319 ARG A CA  1 
ATOM   1886 C  C   . ARG B 1 319 ? 25.522 37.774 24.218 1.00 21.96 ? 319 ARG A C   1 
ATOM   1887 O  O   . ARG B 1 319 ? 25.846 38.948 24.042 1.00 20.75 ? 319 ARG A O   1 
ATOM   1888 C  CB  . ARG B 1 319 ? 23.305 38.289 23.020 1.00 21.82 ? 319 ARG A CB  1 
ATOM   1889 C  CG  . ARG B 1 319 ? 23.663 38.599 21.573 1.00 23.89 ? 319 ARG A CG  1 
ATOM   1890 C  CD  . ARG B 1 319 ? 22.764 39.692 20.915 1.00 24.68 ? 319 ARG A CD  1 
ATOM   1891 N  NE  . ARG B 1 319 ? 23.391 40.118 19.653 1.00 31.56 ? 319 ARG A NE  1 
ATOM   1892 C  CZ  . ARG B 1 319 ? 22.752 40.401 18.520 1.00 34.61 ? 319 ARG A CZ  1 
ATOM   1893 N  NH1 . ARG B 1 319 ? 21.434 40.319 18.450 1.00 35.86 ? 319 ARG A NH1 1 
ATOM   1894 N  NH2 . ARG B 1 319 ? 23.447 40.772 17.444 1.00 38.92 ? 319 ARG A NH2 1 
ATOM   1895 N  N   . ASP B 1 320 ? 26.296 36.899 24.868 1.00 21.58 ? 320 ASP A N   1 
ATOM   1896 C  CA  . ASP B 1 320 ? 27.476 37.282 25.625 1.00 21.34 ? 320 ASP A CA  1 
ATOM   1897 C  C   . ASP B 1 320 ? 28.537 36.213 25.412 1.00 21.08 ? 320 ASP A C   1 
ATOM   1898 O  O   . ASP B 1 320 ? 28.306 35.216 24.706 1.00 20.32 ? 320 ASP A O   1 
ATOM   1899 C  CB  . ASP B 1 320 ? 27.096 37.409 27.107 1.00 21.37 ? 320 ASP A CB  1 
ATOM   1900 C  CG  . ASP B 1 320 ? 28.105 38.214 27.934 1.00 24.49 ? 320 ASP A CG  1 
ATOM   1901 O  OD1 . ASP B 1 320 ? 29.097 38.761 27.374 1.00 23.47 ? 320 ASP A OD1 1 
ATOM   1902 O  OD2 . ASP B 1 320 ? 27.907 38.254 29.181 1.00 23.34 ? 320 ASP A OD2 1 
ATOM   1903 N  N   . ASP B 1 321 ? 29.701 36.429 26.010 1.00 20.36 ? 321 ASP A N   1 
ATOM   1904 C  CA  . ASP B 1 321 ? 30.805 35.506 25.918 1.00 20.88 ? 321 ASP A CA  1 
ATOM   1905 C  C   . ASP B 1 321 ? 30.489 34.252 26.754 1.00 20.18 ? 321 ASP A C   1 
ATOM   1906 O  O   . ASP B 1 321 ? 30.343 34.343 27.974 1.00 20.35 ? 321 ASP A O   1 
ATOM   1907 C  CB  . ASP B 1 321 ? 32.061 36.204 26.461 1.00 21.61 ? 321 ASP A CB  1 
ATOM   1908 C  CG  . ASP B 1 321 ? 33.335 35.510 26.082 1.00 23.41 ? 321 ASP A CG  1 
ATOM   1909 O  OD1 . ASP B 1 321 ? 33.336 34.306 25.741 1.00 26.75 ? 321 ASP A OD1 1 
ATOM   1910 O  OD2 . ASP B 1 321 ? 34.372 36.182 26.150 1.00 28.96 ? 321 ASP A OD2 1 
ATOM   1911 N  N   . ALA B 1 322 ? 30.375 33.097 26.113 1.00 19.88 ? 322 ALA A N   1 
ATOM   1912 C  CA  . ALA B 1 322 ? 30.091 31.834 26.865 1.00 20.39 ? 322 ALA A CA  1 
ATOM   1913 C  C   . ALA B 1 322 ? 31.100 31.534 27.987 1.00 20.45 ? 322 ALA A C   1 
ATOM   1914 O  O   . ALA B 1 322 ? 30.784 30.828 28.955 1.00 21.07 ? 322 ALA A O   1 
ATOM   1915 C  CB  . ALA B 1 322 ? 29.986 30.654 25.905 1.00 20.39 ? 322 ALA A CB  1 
ATOM   1916 N  N   . CYS B 1 323 ? 32.320 32.061 27.868 1.00 21.16 ? 323 CYS A N   1 
ATOM   1917 C  CA  . CYS B 1 323 ? 33.349 31.906 28.913 1.00 21.73 ? 323 CYS A CA  1 
ATOM   1918 C  C   . CYS B 1 323 ? 32.976 32.476 30.290 1.00 21.01 ? 323 CYS A C   1 
ATOM   1919 O  O   . CYS B 1 323 ? 33.599 32.124 31.310 1.00 19.86 ? 323 CYS A O   1 
ATOM   1920 C  CB  . CYS B 1 323 ? 34.741 32.430 28.450 1.00 22.97 ? 323 CYS A CB  1 
ATOM   1921 S  SG  . CYS B 1 323 ? 35.412 31.621 26.923 1.00 28.78 ? 323 CYS A SG  1 
ATOM   1922 N  N   . LEU B 1 324 ? 31.945 33.321 30.345 1.00 20.49 ? 324 LEU A N   1 
ATOM   1923 C  CA  . LEU B 1 324 ? 31.527 33.935 31.636 1.00 20.20 ? 324 LEU A CA  1 
ATOM   1924 C  C   . LEU B 1 324 ? 30.428 33.138 32.329 1.00 20.11 ? 324 LEU A C   1 
ATOM   1925 O  O   . LEU B 1 324 ? 29.920 33.551 33.362 1.00 19.51 ? 324 LEU A O   1 
ATOM   1926 C  CB  . LEU B 1 324 ? 31.094 35.401 31.421 1.00 21.02 ? 324 LEU A CB  1 
ATOM   1927 C  CG  . LEU B 1 324 ? 32.011 36.284 30.537 1.00 19.86 ? 324 LEU A CG  1 
ATOM   1928 C  CD1 . LEU B 1 324 ? 31.529 37.697 30.536 1.00 25.94 ? 324 LEU A CD1 1 
ATOM   1929 C  CD2 . LEU B 1 324 ? 33.446 36.260 30.911 1.00 24.32 ? 324 LEU A CD2 1 
ATOM   1930 N  N   . TYR B 1 325 ? 30.097 31.964 31.775 1.00 19.43 ? 325 TYR A N   1 
ATOM   1931 C  CA  . TYR B 1 325 ? 28.964 31.164 32.266 1.00 19.10 ? 325 TYR A CA  1 
ATOM   1932 C  C   . TYR B 1 325 ? 29.393 29.717 32.465 1.00 18.96 ? 325 TYR A C   1 
ATOM   1933 O  O   . TYR B 1 325 ? 30.404 29.274 31.904 1.00 19.22 ? 325 TYR A O   1 
ATOM   1934 C  CB  . TYR B 1 325 ? 27.800 31.234 31.265 1.00 19.23 ? 325 TYR A CB  1 
ATOM   1935 C  CG  . TYR B 1 325 ? 27.346 32.646 31.014 1.00 19.87 ? 325 TYR A CG  1 
ATOM   1936 C  CD1 . TYR B 1 325 ? 26.358 33.233 31.832 1.00 21.20 ? 325 TYR A CD1 1 
ATOM   1937 C  CD2 . TYR B 1 325 ? 27.930 33.428 29.994 1.00 16.77 ? 325 TYR A CD2 1 
ATOM   1938 C  CE1 . TYR B 1 325 ? 25.962 34.559 31.643 1.00 20.82 ? 325 TYR A CE1 1 
ATOM   1939 C  CE2 . TYR B 1 325 ? 27.547 34.759 29.815 1.00 19.33 ? 325 TYR A CE2 1 
ATOM   1940 C  CZ  . TYR B 1 325 ? 26.555 35.308 30.639 1.00 20.44 ? 325 TYR A CZ  1 
ATOM   1941 O  OH  . TYR B 1 325 ? 26.142 36.616 30.438 1.00 22.84 ? 325 TYR A OH  1 
ATOM   1942 N  N   . SER B 1 326 ? 28.633 28.998 33.272 1.00 19.60 ? 326 SER A N   1 
ATOM   1943 C  CA  . SER B 1 326 ? 28.879 27.588 33.537 1.00 20.01 ? 326 SER A CA  1 
ATOM   1944 C  C   . SER B 1 326 ? 27.573 26.810 33.456 1.00 20.17 ? 326 SER A C   1 
ATOM   1945 O  O   . SER B 1 326 ? 26.529 27.316 33.865 1.00 20.33 ? 326 SER A O   1 
ATOM   1946 C  CB  . SER B 1 326 ? 29.449 27.412 34.925 1.00 19.21 ? 326 SER A CB  1 
ATOM   1947 O  OG  . SER B 1 326 ? 30.819 27.727 34.950 1.00 20.56 ? 326 SER A OG  1 
ATOM   1948 N  N   . PRO B 1 327 ? 27.635 25.542 33.009 1.00 20.75 ? 327 PRO A N   1 
ATOM   1949 C  CA  . PRO B 1 327 ? 28.835 24.784 32.621 1.00 19.95 ? 327 PRO A CA  1 
ATOM   1950 C  C   . PRO B 1 327 ? 29.398 25.098 31.235 1.00 20.02 ? 327 PRO A C   1 
ATOM   1951 O  O   . PRO B 1 327 ? 30.383 24.485 30.846 1.00 18.65 ? 327 PRO A O   1 
ATOM   1952 C  CB  . PRO B 1 327 ? 28.387 23.302 32.730 1.00 20.12 ? 327 PRO A CB  1 
ATOM   1953 C  CG  . PRO B 1 327 ? 26.935 23.296 32.820 1.00 20.47 ? 327 PRO A CG  1 
ATOM   1954 C  CD  . PRO B 1 327 ? 26.410 24.718 32.972 1.00 20.07 ? 327 PRO A CD  1 
ATOM   1955 N  N   . ALA B 1 328 ? 28.815 26.069 30.522 1.00 19.01 ? 328 ALA A N   1 
ATOM   1956 C  CA  . ALA B 1 328 ? 29.319 26.485 29.186 1.00 19.32 ? 328 ALA A CA  1 
ATOM   1957 C  C   . ALA B 1 328 ? 30.844 26.631 29.072 1.00 19.43 ? 328 ALA A C   1 
ATOM   1958 O  O   . ALA B 1 328 ? 31.434 26.176 28.100 1.00 20.07 ? 328 ALA A O   1 
ATOM   1959 C  CB  . ALA B 1 328 ? 28.655 27.795 28.751 1.00 19.37 ? 328 ALA A CB  1 
ATOM   1960 N  N   . SER B 1 329 ? 31.474 27.243 30.077 1.00 19.74 ? 329 SER A N   1 
ATOM   1961 C  CA  . SER B 1 329 ? 32.916 27.532 30.060 1.00 20.18 ? 329 SER A CA  1 
ATOM   1962 C  C   . SER B 1 329 ? 33.790 26.348 30.533 1.00 21.27 ? 329 SER A C   1 
ATOM   1963 O  O   . SER B 1 329 ? 35.024 26.422 30.474 1.00 20.59 ? 329 SER A O   1 
ATOM   1964 C  CB  . SER B 1 329 ? 33.200 28.722 30.969 1.00 19.79 ? 329 SER A CB  1 
ATOM   1965 O  OG  . SER B 1 329 ? 32.839 28.387 32.309 1.00 18.93 ? 329 SER A OG  1 
ATOM   1966 N  N   . ALA B 1 330 ? 33.162 25.272 30.996 1.00 23.09 ? 330 ALA A N   1 
ATOM   1967 C  CA  . ALA B 1 330 ? 33.890 24.137 31.600 1.00 24.98 ? 330 ALA A CA  1 
ATOM   1968 C  C   . ALA B 1 330 ? 34.851 23.466 30.640 1.00 27.04 ? 330 ALA A C   1 
ATOM   1969 O  O   . ALA B 1 330 ? 34.505 23.257 29.476 1.00 27.38 ? 330 ALA A O   1 
ATOM   1970 C  CB  . ALA B 1 330 ? 32.915 23.112 32.216 1.00 24.88 ? 330 ALA A CB  1 
ATOM   1971 N  N   . PRO B 1 331 ? 36.090 23.170 31.114 1.00 29.00 ? 331 PRO A N   1 
ATOM   1972 C  CA  . PRO B 1 331 ? 37.015 22.409 30.287 1.00 30.37 ? 331 PRO A CA  1 
ATOM   1973 C  C   . PRO B 1 331 ? 36.389 21.060 29.971 1.00 30.58 ? 331 PRO A C   1 
ATOM   1974 O  O   . PRO B 1 331 ? 35.706 20.492 30.837 1.00 32.12 ? 331 PRO A O   1 
ATOM   1975 C  CB  . PRO B 1 331 ? 38.233 22.198 31.203 1.00 30.42 ? 331 PRO A CB  1 
ATOM   1976 C  CG  . PRO B 1 331 ? 37.759 22.506 32.601 1.00 30.86 ? 331 PRO A CG  1 
ATOM   1977 C  CD  . PRO B 1 331 ? 36.682 23.531 32.418 1.00 29.28 ? 331 PRO A CD  1 
ATOM   1978 N  N   . GLU B 1 332 ? 36.569 20.577 28.747 1.00 30.13 ? 332 GLU A N   1 
ATOM   1979 C  CA  . GLU B 1 332 ? 36.223 19.199 28.422 1.00 31.02 ? 332 GLU A CA  1 
ATOM   1980 C  C   . GLU B 1 332 ? 34.742 18.926 28.195 1.00 29.93 ? 332 GLU A C   1 
ATOM   1981 O  O   . GLU B 1 332 ? 34.348 17.761 28.171 1.00 31.09 ? 332 GLU A O   1 
ATOM   1982 C  CB  . GLU B 1 332 ? 36.696 18.263 29.543 1.00 32.40 ? 332 GLU A CB  1 
ATOM   1983 C  CG  . GLU B 1 332 ? 37.691 17.226 29.108 1.00 37.26 ? 332 GLU A CG  1 
ATOM   1984 C  CD  . GLU B 1 332 ? 38.960 17.834 28.594 1.00 42.70 ? 332 GLU A CD  1 
ATOM   1985 O  OE1 . GLU B 1 332 ? 39.805 18.193 29.434 1.00 47.69 ? 332 GLU A OE1 1 
ATOM   1986 O  OE2 . GLU B 1 332 ? 39.120 17.945 27.352 1.00 46.12 ? 332 GLU A OE2 1 
ATOM   1987 N  N   . VAL B 1 333 ? 33.919 19.963 28.102 1.00 27.70 ? 333 VAL A N   1 
ATOM   1988 C  CA  . VAL B 1 333 ? 32.508 19.768 27.738 1.00 25.83 ? 333 VAL A CA  1 
ATOM   1989 C  C   . VAL B 1 333 ? 32.310 20.288 26.333 1.00 24.96 ? 333 VAL A C   1 
ATOM   1990 O  O   . VAL B 1 333 ? 33.104 21.115 25.838 1.00 24.72 ? 333 VAL A O   1 
ATOM   1991 C  CB  . VAL B 1 333 ? 31.505 20.428 28.708 1.00 26.15 ? 333 VAL A CB  1 
ATOM   1992 C  CG1 . VAL B 1 333 ? 31.805 20.039 30.143 1.00 24.25 ? 333 VAL A CG1 1 
ATOM   1993 C  CG2 . VAL B 1 333 ? 31.496 21.944 28.554 1.00 26.65 ? 333 VAL A CG2 1 
ATOM   1994 N  N   . ILE B 1 334 ? 31.287 19.778 25.663 1.00 23.02 ? 334 ILE A N   1 
ATOM   1995 C  CA  . ILE B 1 334 ? 30.979 20.283 24.345 1.00 21.91 ? 334 ILE A CA  1 
ATOM   1996 C  C   . ILE B 1 334 ? 29.913 21.369 24.508 1.00 21.35 ? 334 ILE A C   1 
ATOM   1997 O  O   . ILE B 1 334 ? 28.805 21.105 24.948 1.00 20.39 ? 334 ILE A O   1 
ATOM   1998 C  CB  . ILE B 1 334 ? 30.562 19.170 23.385 1.00 22.05 ? 334 ILE A CB  1 
ATOM   1999 C  CG1 . ILE B 1 334 ? 31.750 18.216 23.204 1.00 22.87 ? 334 ILE A CG1 1 
ATOM   2000 C  CG2 . ILE B 1 334 ? 30.103 19.759 22.028 1.00 20.91 ? 334 ILE A CG2 1 
ATOM   2001 C  CD1 . ILE B 1 334 ? 31.359 16.753 23.278 1.00 29.46 ? 334 ILE A CD1 1 
ATOM   2002 N  N   . THR B 1 335 ? 30.270 22.593 24.137 1.00 19.29 ? 335 THR A N   1 
ATOM   2003 C  CA  . THR B 1 335 ? 29.387 23.741 24.375 1.00 18.06 ? 335 THR A CA  1 
ATOM   2004 C  C   . THR B 1 335 ? 28.757 24.202 23.071 1.00 17.21 ? 335 THR A C   1 
ATOM   2005 O  O   . THR B 1 335 ? 29.465 24.480 22.103 1.00 17.08 ? 335 THR A O   1 
ATOM   2006 C  CB  . THR B 1 335 ? 30.144 24.898 25.022 1.00 17.80 ? 335 THR A CB  1 
ATOM   2007 O  OG1 . THR B 1 335 ? 30.698 24.467 26.275 1.00 19.21 ? 335 THR A OG1 1 
ATOM   2008 C  CG2 . THR B 1 335 ? 29.207 26.091 25.271 1.00 17.31 ? 335 THR A CG2 1 
ATOM   2009 N  N   . VAL B 1 336 ? 27.425 24.283 23.057 1.00 16.41 ? 336 VAL A N   1 
ATOM   2010 C  CA  . VAL B 1 336 ? 26.702 24.470 21.809 1.00 15.54 ? 336 VAL A CA  1 
ATOM   2011 C  C   . VAL B 1 336 ? 25.884 25.782 21.745 1.00 15.18 ? 336 VAL A C   1 
ATOM   2012 O  O   . VAL B 1 336 ? 25.020 26.012 22.589 1.00 15.12 ? 336 VAL A O   1 
ATOM   2013 C  CB  . VAL B 1 336 ? 25.763 23.289 21.549 1.00 15.61 ? 336 VAL A CB  1 
ATOM   2014 C  CG1 . VAL B 1 336 ? 25.216 23.331 20.082 1.00 14.22 ? 336 VAL A CG1 1 
ATOM   2015 C  CG2 . VAL B 1 336 ? 26.492 21.950 21.865 1.00 16.21 ? 336 VAL A CG2 1 
ATOM   2016 N  N   . GLY B 1 337 ? 26.179 26.615 20.740 1.00 15.05 ? 337 GLY A N   1 
ATOM   2017 C  CA  . GLY B 1 337 ? 25.387 27.799 20.420 1.00 15.84 ? 337 GLY A CA  1 
ATOM   2018 C  C   . GLY B 1 337 ? 24.252 27.510 19.452 1.00 16.79 ? 337 GLY A C   1 
ATOM   2019 O  O   . GLY B 1 337 ? 24.223 26.444 18.816 1.00 17.08 ? 337 GLY A O   1 
ATOM   2020 N  N   . ALA B 1 338 ? 23.344 28.471 19.283 1.00 17.74 ? 338 ALA A N   1 
ATOM   2021 C  CA  . ALA B 1 338 ? 22.108 28.248 18.483 1.00 18.34 ? 338 ALA A CA  1 
ATOM   2022 C  C   . ALA B 1 338 ? 22.103 29.027 17.178 1.00 19.44 ? 338 ALA A C   1 
ATOM   2023 O  O   . ALA B 1 338 ? 22.374 30.214 17.183 1.00 19.79 ? 338 ALA A O   1 
ATOM   2024 C  CB  . ALA B 1 338 ? 20.900 28.638 19.288 1.00 17.89 ? 338 ALA A CB  1 
ATOM   2025 N  N   . THR B 1 339 ? 21.808 28.356 16.062 1.00 20.93 ? 339 THR A N   1 
ATOM   2026 C  CA  . THR B 1 339 ? 21.582 29.041 14.794 1.00 21.73 ? 339 THR A CA  1 
ATOM   2027 C  C   . THR B 1 339 ? 20.141 28.805 14.307 1.00 21.51 ? 339 THR A C   1 
ATOM   2028 O  O   . THR B 1 339 ? 19.437 27.903 14.789 1.00 20.41 ? 339 THR A O   1 
ATOM   2029 C  CB  . THR B 1 339 ? 22.582 28.598 13.705 1.00 22.14 ? 339 THR A CB  1 
ATOM   2030 O  OG1 . THR B 1 339 ? 22.740 27.176 13.773 1.00 23.55 ? 339 THR A OG1 1 
ATOM   2031 C  CG2 . THR B 1 339 ? 23.933 29.239 13.923 1.00 23.55 ? 339 THR A CG2 1 
ATOM   2032 N  N   . ASN B 1 340 ? 19.695 29.621 13.353 1.00 21.19 ? 340 ASN A N   1 
ATOM   2033 C  CA  . ASN B 1 340 ? 18.328 29.504 12.862 1.00 22.29 ? 340 ASN A CA  1 
ATOM   2034 C  C   . ASN B 1 340 ? 18.263 28.892 11.465 1.00 22.45 ? 340 ASN A C   1 
ATOM   2035 O  O   . ASN B 1 340 ? 19.257 28.386 10.957 1.00 21.82 ? 340 ASN A O   1 
ATOM   2036 C  CB  . ASN B 1 340 ? 17.597 30.848 12.948 1.00 21.59 ? 340 ASN A CB  1 
ATOM   2037 C  CG  . ASN B 1 340 ? 18.249 31.936 12.108 1.00 24.11 ? 340 ASN A CG  1 
ATOM   2038 O  OD1 . ASN B 1 340 ? 18.877 31.659 11.087 1.00 24.51 ? 340 ASN A OD1 1 
ATOM   2039 N  ND2 . ASN B 1 340 ? 18.107 33.183 12.548 1.00 25.32 ? 340 ASN A ND2 1 
ATOM   2040 N  N   . ALA B 1 341 ? 17.087 28.937 10.847 1.00 23.78 ? 341 ALA A N   1 
ATOM   2041 C  CA  . ALA B 1 341 ? 16.864 28.327 9.534  1.00 24.78 ? 341 ALA A CA  1 
ATOM   2042 C  C   . ALA B 1 341 ? 17.737 28.941 8.451  1.00 25.91 ? 341 ALA A C   1 
ATOM   2043 O  O   . ALA B 1 341 ? 17.958 28.326 7.399  1.00 26.16 ? 341 ALA A O   1 
ATOM   2044 C  CB  . ALA B 1 341 ? 15.377 28.419 9.150  1.00 24.58 ? 341 ALA A CB  1 
ATOM   2045 N  N   . GLN B 1 342 ? 18.241 30.142 8.697  1.00 26.89 ? 342 GLN A N   1 
ATOM   2046 C  CA  . GLN B 1 342 ? 19.141 30.780 7.726  1.00 29.13 ? 342 GLN A CA  1 
ATOM   2047 C  C   . GLN B 1 342 ? 20.623 30.620 8.104  1.00 28.53 ? 342 GLN A C   1 
ATOM   2048 O  O   . GLN B 1 342 ? 21.497 31.291 7.549  1.00 28.90 ? 342 GLN A O   1 
ATOM   2049 C  CB  . GLN B 1 342 ? 18.766 32.253 7.516  1.00 30.00 ? 342 GLN A CB  1 
ATOM   2050 C  CG  . GLN B 1 342 ? 17.434 32.455 6.762  1.00 35.13 ? 342 GLN A CG  1 
ATOM   2051 C  CD  . GLN B 1 342 ? 16.215 32.273 7.662  1.00 42.02 ? 342 GLN A CD  1 
ATOM   2052 O  OE1 . GLN B 1 342 ? 16.083 32.945 8.689  1.00 44.97 ? 342 GLN A OE1 1 
ATOM   2053 N  NE2 . GLN B 1 342 ? 15.318 31.361 7.281  1.00 43.47 ? 342 GLN A NE2 1 
ATOM   2054 N  N   . ASP B 1 343 ? 20.878 29.697 9.030  1.00 27.24 ? 343 ASP A N   1 
ATOM   2055 C  CA  . ASP B 1 343 ? 22.205 29.418 9.571  1.00 26.88 ? 343 ASP A CA  1 
ATOM   2056 C  C   . ASP B 1 343 ? 22.796 30.630 10.267 1.00 25.60 ? 343 ASP A C   1 
ATOM   2057 O  O   . ASP B 1 343 ? 24.013 30.755 10.347 1.00 24.61 ? 343 ASP A O   1 
ATOM   2058 C  CB  . ASP B 1 343 ? 23.182 28.906 8.493  1.00 26.74 ? 343 ASP A CB  1 
ATOM   2059 C  CG  . ASP B 1 343 ? 22.950 27.443 8.098  1.00 29.09 ? 343 ASP A CG  1 
ATOM   2060 O  OD1 . ASP B 1 343 ? 22.633 26.582 8.953  1.00 31.01 ? 343 ASP A OD1 1 
ATOM   2061 O  OD2 . ASP B 1 343 ? 23.108 27.145 6.896  1.00 33.08 ? 343 ASP A OD2 1 
ATOM   2062 N  N   . GLN B 1 344 ? 21.944 31.516 10.789 1.00 24.49 ? 344 GLN A N   1 
ATOM   2063 C  CA  . GLN B 1 344 ? 22.443 32.701 11.485 1.00 23.81 ? 344 GLN A CA  1 
ATOM   2064 C  C   . GLN B 1 344 ? 22.231 32.562 12.979 1.00 23.28 ? 344 GLN A C   1 
ATOM   2065 O  O   . GLN B 1 344 ? 21.323 31.833 13.391 1.00 22.77 ? 344 GLN A O   1 
ATOM   2066 C  CB  . GLN B 1 344 ? 21.768 33.970 10.941 1.00 24.02 ? 344 GLN A CB  1 
ATOM   2067 C  CG  . GLN B 1 344 ? 21.991 34.166 9.412  1.00 25.02 ? 344 GLN A CG  1 
ATOM   2068 C  CD  . GLN B 1 344 ? 23.469 33.977 8.992  1.00 27.23 ? 344 GLN A CD  1 
ATOM   2069 O  OE1 . GLN B 1 344 ? 23.795 33.180 8.082  1.00 28.70 ? 344 GLN A OE1 1 
ATOM   2070 N  NE2 . GLN B 1 344 ? 24.360 34.686 9.664  1.00 24.25 ? 344 GLN A NE2 1 
ATOM   2071 N  N   . PRO B 1 345 ? 23.041 33.264 13.801 1.00 23.16 ? 345 PRO A N   1 
ATOM   2072 C  CA  . PRO B 1 345 ? 22.883 33.079 15.251 1.00 23.29 ? 345 PRO A CA  1 
ATOM   2073 C  C   . PRO B 1 345 ? 21.509 33.544 15.720 1.00 23.53 ? 345 PRO A C   1 
ATOM   2074 O  O   . PRO B 1 345 ? 21.000 34.542 15.222 1.00 23.55 ? 345 PRO A O   1 
ATOM   2075 C  CB  . PRO B 1 345 ? 23.987 33.949 15.850 1.00 24.06 ? 345 PRO A CB  1 
ATOM   2076 C  CG  . PRO B 1 345 ? 24.972 34.182 14.721 1.00 22.88 ? 345 PRO A CG  1 
ATOM   2077 C  CD  . PRO B 1 345 ? 24.098 34.248 13.491 1.00 24.04 ? 345 PRO A CD  1 
ATOM   2078 N  N   . VAL B 1 346 ? 20.928 32.828 16.666 1.00 22.72 ? 346 VAL A N   1 
ATOM   2079 C  CA  . VAL B 1 346 ? 19.564 33.084 17.116 1.00 23.89 ? 346 VAL A CA  1 
ATOM   2080 C  C   . VAL B 1 346 ? 19.458 34.291 18.053 1.00 24.84 ? 346 VAL A C   1 
ATOM   2081 O  O   . VAL B 1 346 ? 20.189 34.394 19.059 1.00 23.99 ? 346 VAL A O   1 
ATOM   2082 C  CB  . VAL B 1 346 ? 18.979 31.815 17.808 1.00 23.43 ? 346 VAL A CB  1 
ATOM   2083 C  CG1 . VAL B 1 346 ? 17.645 32.103 18.466 1.00 25.31 ? 346 VAL A CG1 1 
ATOM   2084 C  CG2 . VAL B 1 346 ? 18.838 30.690 16.790 1.00 21.83 ? 346 VAL A CG2 1 
ATOM   2085 N  N   . THR B 1 347 ? 18.531 35.190 17.697 1.00 25.75 ? 347 THR A N   1 
ATOM   2086 C  CA  . THR B 1 347 ? 18.080 36.279 18.549 1.00 26.44 ? 347 THR A CA  1 
ATOM   2087 C  C   . THR B 1 347 ? 16.936 35.772 19.441 1.00 27.24 ? 347 THR A C   1 
ATOM   2088 O  O   . THR B 1 347 ? 15.996 35.122 18.981 1.00 26.71 ? 347 THR A O   1 
ATOM   2089 C  CB  . THR B 1 347 ? 17.568 37.486 17.685 1.00 27.26 ? 347 THR A CB  1 
ATOM   2090 O  OG1 . THR B 1 347 ? 18.622 37.960 16.836 1.00 27.18 ? 347 THR A OG1 1 
ATOM   2091 C  CG2 . THR B 1 347 ? 17.088 38.653 18.566 1.00 27.64 ? 347 THR A CG2 1 
ATOM   2092 N  N   . LEU B 1 348 ? 17.004 36.099 20.721 1.00 28.03 ? 348 LEU A N   1 
ATOM   2093 C  CA  . LEU B 1 348 ? 16.000 35.690 21.678 1.00 29.16 ? 348 LEU A CA  1 
ATOM   2094 C  C   . LEU B 1 348 ? 15.633 36.925 22.490 1.00 29.44 ? 348 LEU A C   1 
ATOM   2095 O  O   . LEU B 1 348 ? 16.334 37.298 23.424 1.00 29.82 ? 348 LEU A O   1 
ATOM   2096 C  CB  . LEU B 1 348 ? 16.564 34.593 22.599 1.00 28.57 ? 348 LEU A CB  1 
ATOM   2097 C  CG  . LEU B 1 348 ? 16.996 33.262 21.967 1.00 30.56 ? 348 LEU A CG  1 
ATOM   2098 C  CD1 . LEU B 1 348 ? 17.931 32.507 22.891 1.00 30.84 ? 348 LEU A CD1 1 
ATOM   2099 C  CD2 . LEU B 1 348 ? 15.804 32.374 21.571 1.00 29.74 ? 348 LEU A CD2 1 
ATOM   2100 N  N   . GLY B 1 349 ? 14.525 37.557 22.130 1.00 31.00 ? 349 GLY A N   1 
ATOM   2101 C  CA  . GLY B 1 349 ? 14.163 38.853 22.712 1.00 30.76 ? 349 GLY A CA  1 
ATOM   2102 C  C   . GLY B 1 349 ? 15.223 39.864 22.342 1.00 30.45 ? 349 GLY A C   1 
ATOM   2103 O  O   . GLY B 1 349 ? 15.571 40.008 21.182 1.00 31.03 ? 349 GLY A O   1 
ATOM   2104 N  N   . THR B 1 350 ? 15.754 40.542 23.349 1.00 30.36 ? 350 THR A N   1 
ATOM   2105 C  CA  . THR B 1 350 ? 16.828 41.499 23.171 1.00 29.70 ? 350 THR A CA  1 
ATOM   2106 C  C   . THR B 1 350 ? 18.183 40.837 23.292 1.00 28.30 ? 350 THR A C   1 
ATOM   2107 O  O   . THR B 1 350 ? 19.219 41.498 23.125 1.00 28.13 ? 350 THR A O   1 
ATOM   2108 C  CB  . THR B 1 350 ? 16.763 42.614 24.234 1.00 30.33 ? 350 THR A CB  1 
ATOM   2109 O  OG1 . THR B 1 350 ? 16.652 42.030 25.539 1.00 32.00 ? 350 THR A OG1 1 
ATOM   2110 C  CG2 . THR B 1 350 ? 15.570 43.516 23.983 1.00 33.33 ? 350 THR A CG2 1 
ATOM   2111 N  N   . LEU B 1 351 ? 18.185 39.535 23.599 1.00 26.31 ? 351 LEU A N   1 
ATOM   2112 C  CA  . LEU B 1 351 ? 19.446 38.797 23.720 1.00 24.69 ? 351 LEU A CA  1 
ATOM   2113 C  C   . LEU B 1 351 ? 19.529 37.735 22.638 1.00 23.62 ? 351 LEU A C   1 
ATOM   2114 O  O   . LEU B 1 351 ? 19.150 37.995 21.492 1.00 23.74 ? 351 LEU A O   1 
ATOM   2115 C  CB  . LEU B 1 351 ? 19.638 38.249 25.143 1.00 24.39 ? 351 LEU A CB  1 
ATOM   2116 C  CG  . LEU B 1 351 ? 19.648 39.302 26.272 1.00 26.70 ? 351 LEU A CG  1 
ATOM   2117 C  CD1 . LEU B 1 351 ? 19.716 38.690 27.663 1.00 27.62 ? 351 LEU A CD1 1 
ATOM   2118 C  CD2 . LEU B 1 351 ? 20.795 40.291 26.099 1.00 27.78 ? 351 LEU A CD2 1 
ATOM   2119 N  N   . GLY B 1 352 ? 20.014 36.538 22.964 1.00 22.58 ? 352 GLY A N   1 
ATOM   2120 C  CA  . GLY B 1 352 ? 20.247 35.545 21.908 1.00 21.08 ? 352 GLY A CA  1 
ATOM   2121 C  C   . GLY B 1 352 ? 21.398 34.612 22.222 1.00 19.86 ? 352 GLY A C   1 
ATOM   2122 O  O   . GLY B 1 352 ? 21.899 34.607 23.343 1.00 19.63 ? 352 GLY A O   1 
ATOM   2123 N  N   . THR B 1 353 ? 21.805 33.801 21.249 1.00 19.48 ? 353 THR A N   1 
ATOM   2124 C  CA  . THR B 1 353 ? 22.882 32.843 21.525 1.00 18.83 ? 353 THR A CA  1 
ATOM   2125 C  C   . THR B 1 353 ? 24.174 33.509 22.032 1.00 18.97 ? 353 THR A C   1 
ATOM   2126 O  O   . THR B 1 353 ? 24.594 34.566 21.516 1.00 18.96 ? 353 THR A O   1 
ATOM   2127 C  CB  . THR B 1 353 ? 23.209 31.921 20.333 1.00 18.32 ? 353 THR A CB  1 
ATOM   2128 O  OG1 . THR B 1 353 ? 24.175 30.962 20.771 1.00 17.86 ? 353 THR A OG1 1 
ATOM   2129 C  CG2 . THR B 1 353 ? 23.819 32.701 19.146 1.00 16.17 ? 353 THR A CG2 1 
ATOM   2130 N  N   . ASN B 1 354 ? 24.781 32.887 23.050 1.00 18.52 ? 354 ASN A N   1 
ATOM   2131 C  CA  . ASN B 1 354 ? 26.170 33.167 23.416 1.00 18.79 ? 354 ASN A CA  1 
ATOM   2132 C  C   . ASN B 1 354 ? 27.155 32.792 22.288 1.00 19.03 ? 354 ASN A C   1 
ATOM   2133 O  O   . ASN B 1 354 ? 26.787 32.109 21.324 1.00 19.51 ? 354 ASN A O   1 
ATOM   2134 C  CB  . ASN B 1 354 ? 26.534 32.470 24.756 1.00 17.88 ? 354 ASN A CB  1 
ATOM   2135 C  CG  . ASN B 1 354 ? 26.032 33.233 25.969 1.00 18.41 ? 354 ASN A CG  1 
ATOM   2136 O  OD1 . ASN B 1 354 ? 25.494 34.327 25.834 1.00 18.43 ? 354 ASN A OD1 1 
ATOM   2137 N  ND2 . ASN B 1 354 ? 26.218 32.665 27.169 1.00 17.26 ? 354 ASN A ND2 1 
ATOM   2138 N  N   . PHE B 1 355 ? 28.403 33.241 22.398 1.00 19.21 ? 355 PHE A N   1 
ATOM   2139 C  CA  . PHE B 1 355 ? 29.405 33.035 21.349 1.00 19.19 ? 355 PHE A CA  1 
ATOM   2140 C  C   . PHE B 1 355 ? 30.802 32.988 22.029 1.00 20.06 ? 355 PHE A C   1 
ATOM   2141 O  O   . PHE B 1 355 ? 30.895 32.878 23.275 1.00 20.09 ? 355 PHE A O   1 
ATOM   2142 C  CB  . PHE B 1 355 ? 29.324 34.210 20.334 1.00 19.88 ? 355 PHE A CB  1 
ATOM   2143 C  CG  . PHE B 1 355 ? 29.084 35.553 20.996 1.00 19.32 ? 355 PHE A CG  1 
ATOM   2144 C  CD1 . PHE B 1 355 ? 30.118 36.220 21.657 1.00 21.20 ? 355 PHE A CD1 1 
ATOM   2145 C  CD2 . PHE B 1 355 ? 27.819 36.121 20.991 1.00 21.94 ? 355 PHE A CD2 1 
ATOM   2146 C  CE1 . PHE B 1 355 ? 29.887 37.425 22.314 1.00 23.33 ? 355 PHE A CE1 1 
ATOM   2147 C  CE2 . PHE B 1 355 ? 27.586 37.349 21.634 1.00 20.69 ? 355 PHE A CE2 1 
ATOM   2148 C  CZ  . PHE B 1 355 ? 28.620 37.992 22.288 1.00 21.73 ? 355 PHE A CZ  1 
ATOM   2149 N  N   . GLY B 1 356 ? 31.861 33.101 21.224 1.00 19.74 ? 356 GLY A N   1 
ATOM   2150 C  CA  . GLY B 1 356 ? 33.235 33.151 21.719 1.00 20.16 ? 356 GLY A CA  1 
ATOM   2151 C  C   . GLY B 1 356 ? 33.944 31.819 21.769 1.00 21.88 ? 356 GLY A C   1 
ATOM   2152 O  O   . GLY B 1 356 ? 33.392 30.790 21.329 1.00 21.15 ? 356 GLY A O   1 
ATOM   2153 N  N   . ARG B 1 357 ? 35.174 31.846 22.299 1.00 22.19 ? 357 ARG A N   1 
ATOM   2154 C  CA  . ARG B 1 357 ? 36.092 30.707 22.247 1.00 24.24 ? 357 ARG A CA  1 
ATOM   2155 C  C   . ARG B 1 357 ? 35.668 29.484 23.066 1.00 23.33 ? 357 ARG A C   1 
ATOM   2156 O  O   . ARG B 1 357 ? 36.160 28.385 22.817 1.00 24.13 ? 357 ARG A O   1 
ATOM   2157 C  CB  . ARG B 1 357 ? 37.536 31.133 22.615 1.00 24.37 ? 357 ARG A CB  1 
ATOM   2158 C  CG  . ARG B 1 357 ? 37.686 31.559 24.049 1.00 26.50 ? 357 ARG A CG  1 
ATOM   2159 C  CD  . ARG B 1 357 ? 39.153 31.757 24.474 1.00 26.19 ? 357 ARG A CD  1 
ATOM   2160 N  NE  . ARG B 1 357 ? 39.127 31.891 25.921 1.00 31.45 ? 357 ARG A NE  1 
ATOM   2161 C  CZ  . ARG B 1 357 ? 39.292 30.882 26.759 1.00 31.39 ? 357 ARG A CZ  1 
ATOM   2162 N  NH1 . ARG B 1 357 ? 39.586 29.672 26.296 1.00 30.87 ? 357 ARG A NH1 1 
ATOM   2163 N  NH2 . ARG B 1 357 ? 39.209 31.104 28.057 1.00 34.29 ? 357 ARG A NH2 1 
ATOM   2164 N  N   . CYS B 1 358 ? 34.772 29.666 24.038 1.00 23.07 ? 358 CYS A N   1 
ATOM   2165 C  CA  . CYS B 1 358 ? 34.250 28.516 24.802 1.00 23.46 ? 358 CYS A CA  1 
ATOM   2166 C  C   . CYS B 1 358 ? 33.098 27.774 24.089 1.00 22.57 ? 358 CYS A C   1 
ATOM   2167 O  O   . CYS B 1 358 ? 32.617 26.746 24.575 1.00 23.06 ? 358 CYS A O   1 
ATOM   2168 C  CB  . CYS B 1 358 ? 33.863 28.934 26.227 1.00 22.84 ? 358 CYS A CB  1 
ATOM   2169 S  SG  . CYS B 1 358 ? 35.319 29.537 27.219 1.00 26.93 ? 358 CYS A SG  1 
ATOM   2170 N  N   . VAL B 1 359 ? 32.666 28.288 22.949 1.00 20.58 ? 359 VAL A N   1 
ATOM   2171 C  CA  . VAL B 1 359 ? 31.635 27.615 22.172 1.00 20.23 ? 359 VAL A CA  1 
ATOM   2172 C  C   . VAL B 1 359 ? 32.342 26.695 21.172 1.00 20.76 ? 359 VAL A C   1 
ATOM   2173 O  O   . VAL B 1 359 ? 33.177 27.153 20.429 1.00 20.32 ? 359 VAL A O   1 
ATOM   2174 C  CB  . VAL B 1 359 ? 30.714 28.633 21.432 1.00 20.62 ? 359 VAL A CB  1 
ATOM   2175 C  CG1 . VAL B 1 359 ? 29.767 27.918 20.436 1.00 18.51 ? 359 VAL A CG1 1 
ATOM   2176 C  CG2 . VAL B 1 359 ? 29.902 29.445 22.438 1.00 17.68 ? 359 VAL A CG2 1 
ATOM   2177 N  N   . ASP B 1 360 ? 31.992 25.409 21.169 1.00 20.42 ? 360 ASP A N   1 
ATOM   2178 C  CA  . ASP B 1 360 ? 32.576 24.432 20.245 1.00 21.36 ? 360 ASP A CA  1 
ATOM   2179 C  C   . ASP B 1 360 ? 31.987 24.485 18.842 1.00 20.90 ? 360 ASP A C   1 
ATOM   2180 O  O   . ASP B 1 360 ? 32.719 24.476 17.860 1.00 21.41 ? 360 ASP A O   1 
ATOM   2181 C  CB  . ASP B 1 360 ? 32.447 23.024 20.821 1.00 21.62 ? 360 ASP A CB  1 
ATOM   2182 C  CG  . ASP B 1 360 ? 33.297 22.845 22.057 1.00 23.91 ? 360 ASP A CG  1 
ATOM   2183 O  OD1 . ASP B 1 360 ? 34.543 22.792 21.940 1.00 28.75 ? 360 ASP A OD1 1 
ATOM   2184 O  OD2 . ASP B 1 360 ? 32.732 22.816 23.159 1.00 25.23 ? 360 ASP A OD2 1 
ATOM   2185 N  N   . LEU B 1 361 ? 30.666 24.532 18.767 1.00 20.42 ? 361 LEU A N   1 
ATOM   2186 C  CA  . LEU B 1 361 ? 29.953 24.651 17.508 1.00 19.79 ? 361 LEU A CA  1 
ATOM   2187 C  C   . LEU B 1 361 ? 28.542 25.169 17.712 1.00 19.31 ? 361 LEU A C   1 
ATOM   2188 O  O   . LEU B 1 361 ? 28.078 25.322 18.850 1.00 19.22 ? 361 LEU A O   1 
ATOM   2189 C  CB  . LEU B 1 361 ? 29.898 23.316 16.746 1.00 19.71 ? 361 LEU A CB  1 
ATOM   2190 C  CG  . LEU B 1 361 ? 29.701 21.919 17.387 1.00 23.03 ? 361 LEU A CG  1 
ATOM   2191 C  CD1 . LEU B 1 361 ? 29.010 21.853 18.768 1.00 22.08 ? 361 LEU A CD1 1 
ATOM   2192 C  CD2 . LEU B 1 361 ? 29.046 20.994 16.378 1.00 19.77 ? 361 LEU A CD2 1 
ATOM   2193 N  N   . PHE B 1 362 ? 27.858 25.427 16.594 1.00 18.09 ? 362 PHE A N   1 
ATOM   2194 C  CA  . PHE B 1 362 ? 26.462 25.830 16.627 1.00 17.15 ? 362 PHE A CA  1 
ATOM   2195 C  C   . PHE B 1 362 ? 25.613 24.695 16.088 1.00 17.20 ? 362 PHE A C   1 
ATOM   2196 O  O   . PHE B 1 362 ? 26.127 23.810 15.378 1.00 16.71 ? 362 PHE A O   1 
ATOM   2197 C  CB  . PHE B 1 362 ? 26.223 27.119 15.816 1.00 16.10 ? 362 PHE A CB  1 
ATOM   2198 C  CG  . PHE B 1 362 ? 26.886 28.346 16.435 1.00 16.79 ? 362 PHE A CG  1 
ATOM   2199 C  CD1 . PHE B 1 362 ? 26.157 29.193 17.268 1.00 13.48 ? 362 PHE A CD1 1 
ATOM   2200 C  CD2 . PHE B 1 362 ? 28.238 28.594 16.239 1.00 16.48 ? 362 PHE A CD2 1 
ATOM   2201 C  CE1 . PHE B 1 362 ? 26.758 30.292 17.897 1.00 17.56 ? 362 PHE A CE1 1 
ATOM   2202 C  CE2 . PHE B 1 362 ? 28.873 29.697 16.873 1.00 18.16 ? 362 PHE A CE2 1 
ATOM   2203 C  CZ  . PHE B 1 362 ? 28.123 30.537 17.704 1.00 15.30 ? 362 PHE A CZ  1 
ATOM   2204 N  N   . ALA B 1 363 ? 24.325 24.746 16.424 1.00 17.26 ? 363 ALA A N   1 
ATOM   2205 C  CA  . ALA B 1 363 ? 23.343 23.757 15.968 1.00 18.67 ? 363 ALA A CA  1 
ATOM   2206 C  C   . ALA B 1 363 ? 21.961 24.404 15.913 1.00 19.12 ? 363 ALA A C   1 
ATOM   2207 O  O   . ALA B 1 363 ? 21.741 25.450 16.544 1.00 18.95 ? 363 ALA A O   1 
ATOM   2208 C  CB  . ALA B 1 363 ? 23.321 22.519 16.923 1.00 17.47 ? 363 ALA A CB  1 
ATOM   2209 N  N   . PRO B 1 364 ? 21.023 23.805 15.149 1.00 19.03 ? 364 PRO A N   1 
ATOM   2210 C  CA  . PRO B 1 364 ? 19.682 24.381 15.113 1.00 19.14 ? 364 PRO A CA  1 
ATOM   2211 C  C   . PRO B 1 364 ? 19.053 24.675 16.467 1.00 20.16 ? 364 PRO A C   1 
ATOM   2212 O  O   . PRO B 1 364 ? 18.948 23.791 17.322 1.00 20.55 ? 364 PRO A O   1 
ATOM   2213 C  CB  . PRO B 1 364 ? 18.885 23.350 14.328 1.00 19.37 ? 364 PRO A CB  1 
ATOM   2214 C  CG  . PRO B 1 364 ? 19.931 22.811 13.315 1.00 18.03 ? 364 PRO A CG  1 
ATOM   2215 C  CD  . PRO B 1 364 ? 21.145 22.649 14.228 1.00 19.38 ? 364 PRO A CD  1 
ATOM   2216 N  N   . GLY B 1 365 ? 18.654 25.927 16.678 1.00 20.03 ? 365 GLY A N   1 
ATOM   2217 C  CA  . GLY B 1 365 ? 18.033 26.295 17.970 1.00 21.25 ? 365 GLY A CA  1 
ATOM   2218 C  C   . GLY B 1 365 ? 16.969 27.383 17.886 1.00 21.70 ? 365 GLY A C   1 
ATOM   2219 O  O   . GLY B 1 365 ? 16.694 28.070 18.878 1.00 22.08 ? 365 GLY A O   1 
ATOM   2220 N  N   . GLU B 1 366 ? 16.377 27.550 16.707 1.00 22.35 ? 366 GLU A N   1 
ATOM   2221 C  CA  . GLU B 1 366 ? 15.208 28.404 16.563 1.00 22.81 ? 366 GLU A CA  1 
ATOM   2222 C  C   . GLU B 1 366 ? 14.043 27.640 15.938 1.00 22.68 ? 366 GLU A C   1 
ATOM   2223 O  O   . GLU B 1 366 ? 14.243 26.918 14.963 1.00 23.32 ? 366 GLU A O   1 
ATOM   2224 C  CB  . GLU B 1 366 ? 15.515 29.633 15.709 1.00 23.53 ? 366 GLU A CB  1 
ATOM   2225 C  CG  . GLU B 1 366 ? 14.313 30.597 15.625 1.00 26.71 ? 366 GLU A CG  1 
ATOM   2226 C  CD  . GLU B 1 366 ? 14.638 31.900 14.941 1.00 32.57 ? 366 GLU A CD  1 
ATOM   2227 O  OE1 . GLU B 1 366 ? 15.101 32.826 15.617 1.00 37.70 ? 366 GLU A OE1 1 
ATOM   2228 O  OE2 . GLU B 1 366 ? 14.421 32.006 13.723 1.00 35.80 ? 366 GLU A OE2 1 
ATOM   2229 N  N   . ASP B 1 367 ? 12.838 27.784 16.497 1.00 22.43 ? 367 ASP A N   1 
ATOM   2230 C  CA  . ASP B 1 367 ? 11.630 27.184 15.875 1.00 22.99 ? 367 ASP A CA  1 
ATOM   2231 C  C   . ASP B 1 367 ? 11.818 25.678 15.715 1.00 22.66 ? 367 ASP A C   1 
ATOM   2232 O  O   . ASP B 1 367 ? 11.711 25.105 14.611 1.00 22.34 ? 367 ASP A O   1 
ATOM   2233 C  CB  . ASP B 1 367 ? 11.340 27.848 14.525 1.00 24.00 ? 367 ASP A CB  1 
ATOM   2234 C  CG  . ASP B 1 367 ? 10.118 27.263 13.822 1.00 28.75 ? 367 ASP A CG  1 
ATOM   2235 O  OD1 . ASP B 1 367 ? 9.095  26.988 14.493 1.00 32.64 ? 367 ASP A OD1 1 
ATOM   2236 O  OD2 . ASP B 1 367 ? 10.202 27.077 12.592 1.00 33.78 ? 367 ASP A OD2 1 
ATOM   2237 N  N   . ILE B 1 368 ? 12.100 25.039 16.837 1.00 21.58 ? 368 ILE A N   1 
ATOM   2238 C  CA  . ILE B 1 368 ? 12.411 23.614 16.845 1.00 21.82 ? 368 ILE A CA  1 
ATOM   2239 C  C   . ILE B 1 368 ? 11.194 22.851 17.331 1.00 21.76 ? 368 ILE A C   1 
ATOM   2240 O  O   . ILE B 1 368 ? 10.806 22.960 18.490 1.00 19.73 ? 368 ILE A O   1 
ATOM   2241 C  CB  . ILE B 1 368 ? 13.633 23.298 17.770 1.00 21.68 ? 368 ILE A CB  1 
ATOM   2242 C  CG1 . ILE B 1 368 ? 14.882 24.103 17.363 1.00 21.23 ? 368 ILE A CG1 1 
ATOM   2243 C  CG2 . ILE B 1 368 ? 13.899 21.759 17.906 1.00 20.14 ? 368 ILE A CG2 1 
ATOM   2244 C  CD1 . ILE B 1 368 ? 15.492 23.808 15.985 1.00 18.10 ? 368 ILE A CD1 1 
ATOM   2245 N  N   . ILE B 1 369 ? 10.606 22.065 16.445 1.00 22.59 ? 369 ILE A N   1 
ATOM   2246 C  CA  . ILE B 1 369 ? 9.386  21.352 16.815 1.00 24.58 ? 369 ILE A CA  1 
ATOM   2247 C  C   . ILE B 1 369 ? 9.744  20.150 17.713 1.00 24.46 ? 369 ILE A C   1 
ATOM   2248 O  O   . ILE B 1 369 ? 10.705 19.424 17.451 1.00 25.24 ? 369 ILE A O   1 
ATOM   2249 C  CB  . ILE B 1 369 ? 8.527  20.976 15.543 1.00 25.57 ? 369 ILE A CB  1 
ATOM   2250 C  CG1 . ILE B 1 369 ? 7.060  20.666 15.923 1.00 28.12 ? 369 ILE A CG1 1 
ATOM   2251 C  CG2 . ILE B 1 369 ? 9.111  19.789 14.847 1.00 23.18 ? 369 ILE A CG2 1 
ATOM   2252 C  CD1 . ILE B 1 369 ? 6.207  21.904 16.417 1.00 32.57 ? 369 ILE A CD1 1 
ATOM   2253 N  N   . GLY B 1 370 ? 9.018  19.981 18.807 1.00 24.92 ? 370 GLY A N   1 
ATOM   2254 C  CA  . GLY B 1 370 ? 9.185  18.781 19.633 1.00 24.85 ? 370 GLY A CA  1 
ATOM   2255 C  C   . GLY B 1 370 ? 7.998  18.573 20.543 1.00 26.17 ? 370 GLY A C   1 
ATOM   2256 O  O   . GLY B 1 370 ? 7.067  19.375 20.562 1.00 26.06 ? 370 GLY A O   1 
ATOM   2257 N  N   . ALA B 1 371 ? 8.051  17.494 21.313 1.00 25.87 ? 371 ALA A N   1 
ATOM   2258 C  CA  . ALA B 1 371 ? 6.996  17.109 22.228 1.00 26.11 ? 371 ALA A CA  1 
ATOM   2259 C  C   . ALA B 1 371 ? 6.560  18.232 23.152 1.00 26.30 ? 371 ALA A C   1 
ATOM   2260 O  O   . ALA B 1 371 ? 7.400  18.835 23.845 1.00 26.10 ? 371 ALA A O   1 
ATOM   2261 C  CB  . ALA B 1 371 ? 7.475  15.916 23.064 1.00 25.38 ? 371 ALA A CB  1 
ATOM   2262 N  N   . SER B 1 372 ? 5.247  18.477 23.191 1.00 26.82 ? 372 SER A N   1 
ATOM   2263 C  CA  . SER B 1 372 ? 4.638  19.435 24.105 1.00 27.83 ? 372 SER A CA  1 
ATOM   2264 C  C   . SER B 1 372 ? 3.999  18.754 25.302 1.00 29.82 ? 372 SER A C   1 
ATOM   2265 O  O   . SER B 1 372 ? 3.231  17.794 25.150 1.00 30.83 ? 372 SER A O   1 
ATOM   2266 C  CB  . SER B 1 372 ? 3.575  20.267 23.382 1.00 27.80 ? 372 SER A CB  1 
ATOM   2267 O  OG  . SER B 1 372 ? 2.945  21.170 24.286 1.00 27.89 ? 372 SER A OG  1 
ATOM   2268 N  N   . SER B 1 373 ? 4.284  19.260 26.499 1.00 30.43 ? 373 SER A N   1 
ATOM   2269 C  CA  . SER B 1 373 ? 3.654  18.711 27.683 1.00 32.13 ? 373 SER A CA  1 
ATOM   2270 C  C   . SER B 1 373 ? 2.180  19.155 27.852 1.00 32.91 ? 373 SER A C   1 
ATOM   2271 O  O   . SER B 1 373 ? 1.540  18.774 28.832 1.00 33.70 ? 373 SER A O   1 
ATOM   2272 C  CB  . SER B 1 373 ? 4.469  19.049 28.929 1.00 31.55 ? 373 SER A CB  1 
ATOM   2273 O  OG  . SER B 1 373 ? 4.491  20.446 29.121 1.00 32.36 ? 373 SER A OG  1 
ATOM   2274 N  N   . ASP B 1 374 ? 1.645  19.944 26.915 1.00 33.92 ? 374 ASP A N   1 
ATOM   2275 C  CA  . ASP B 1 374 ? 0.219  20.317 26.945 1.00 35.45 ? 374 ASP A CA  1 
ATOM   2276 C  C   . ASP B 1 374 ? -0.694 19.067 26.894 1.00 35.61 ? 374 ASP A C   1 
ATOM   2277 O  O   . ASP B 1 374 ? -1.657 18.948 27.667 1.00 36.33 ? 374 ASP A O   1 
ATOM   2278 C  CB  . ASP B 1 374 ? -0.133 21.337 25.837 1.00 35.56 ? 374 ASP A CB  1 
ATOM   2279 C  CG  . ASP B 1 374 ? -1.552 21.950 26.009 1.00 39.08 ? 374 ASP A CG  1 
ATOM   2280 O  OD1 . ASP B 1 374 ? -1.922 22.341 27.144 1.00 42.55 ? 374 ASP A OD1 1 
ATOM   2281 O  OD2 . ASP B 1 374 ? -2.297 22.049 25.007 1.00 37.21 ? 374 ASP A OD2 1 
ATOM   2282 N  N   . CYS B 1 375 ? -0.372 18.130 26.006 1.00 35.57 ? 375 CYS A N   1 
ATOM   2283 C  CA  . CYS B 1 375 ? -1.115 16.881 25.891 1.00 35.59 ? 375 CYS A CA  1 
ATOM   2284 C  C   . CYS B 1 375 ? -0.184 15.808 25.343 1.00 35.13 ? 375 CYS A C   1 
ATOM   2285 O  O   . CYS B 1 375 ? 0.864  16.143 24.780 1.00 35.18 ? 375 CYS A O   1 
ATOM   2286 C  CB  . CYS B 1 375 ? -2.354 17.080 25.006 1.00 35.79 ? 375 CYS A CB  1 
ATOM   2287 S  SG  . CYS B 1 375 ? -2.126 16.672 23.265 1.00 38.50 ? 375 CYS A SG  1 
ATOM   2288 N  N   . SER B 1 376 ? -0.552 14.530 25.486 1.00 34.24 ? 376 SER A N   1 
ATOM   2289 C  CA  . SER B 1 376 ? 0.362  13.420 25.152 1.00 33.65 ? 376 SER A CA  1 
ATOM   2290 C  C   . SER B 1 376 ? 0.720  13.261 23.677 1.00 32.53 ? 376 SER A C   1 
ATOM   2291 O  O   . SER B 1 376 ? 1.676  12.565 23.344 1.00 32.34 ? 376 SER A O   1 
ATOM   2292 C  CB  . SER B 1 376 ? -0.171 12.086 25.694 1.00 34.17 ? 376 SER A CB  1 
ATOM   2293 O  OG  . SER B 1 376 ? -1.446 11.813 25.136 1.00 37.21 ? 376 SER A OG  1 
ATOM   2294 N  N   . THR B 1 377 ? -0.033 13.873 22.772 1.00 31.68 ? 377 THR A N   1 
ATOM   2295 C  CA  . THR B 1 377 ? 0.368  13.802 21.369 1.00 30.92 ? 377 THR A CA  1 
ATOM   2296 C  C   . THR B 1 377 ? 0.584  15.199 20.777 1.00 30.12 ? 377 THR A C   1 
ATOM   2297 O  O   . THR B 1 377 ? 0.709  15.361 19.562 1.00 29.97 ? 377 THR A O   1 
ATOM   2298 C  CB  . THR B 1 377 ? -0.626 12.976 20.512 1.00 31.09 ? 377 THR A CB  1 
ATOM   2299 O  OG1 . THR B 1 377 ? -1.913 13.578 20.567 1.00 31.82 ? 377 THR A OG1 1 
ATOM   2300 C  CG2 . THR B 1 377 ? -0.745 11.548 21.026 1.00 32.94 ? 377 THR A CG2 1 
ATOM   2301 N  N   . CYS B 1 378 ? 0.644  16.196 21.648 1.00 28.79 ? 378 CYS A N   1 
ATOM   2302 C  CA  . CYS B 1 378 ? 0.828  17.580 21.237 1.00 29.27 ? 378 CYS A CA  1 
ATOM   2303 C  C   . CYS B 1 378 ? 2.303  17.962 20.952 1.00 28.15 ? 378 CYS A C   1 
ATOM   2304 O  O   . CYS B 1 378 ? 3.229  17.401 21.549 1.00 28.16 ? 378 CYS A O   1 
ATOM   2305 C  CB  . CYS B 1 378 ? 0.210  18.497 22.293 1.00 29.20 ? 378 CYS A CB  1 
ATOM   2306 S  SG  . CYS B 1 378 ? -1.661 18.442 22.353 1.00 33.91 ? 378 CYS A SG  1 
ATOM   2307 N  N   . PHE B 1 379 ? 2.507  18.925 20.050 1.00 26.63 ? 379 PHE A N   1 
ATOM   2308 C  CA  . PHE B 1 379 ? 3.832  19.406 19.683 1.00 26.35 ? 379 PHE A CA  1 
ATOM   2309 C  C   . PHE B 1 379 ? 3.913  20.919 19.835 1.00 26.33 ? 379 PHE A C   1 
ATOM   2310 O  O   . PHE B 1 379 ? 2.892  21.621 19.803 1.00 26.45 ? 379 PHE A O   1 
ATOM   2311 C  CB  . PHE B 1 379 ? 4.161  19.030 18.243 1.00 26.27 ? 379 PHE A CB  1 
ATOM   2312 C  CG  . PHE B 1 379 ? 4.549  17.591 18.056 1.00 28.59 ? 379 PHE A CG  1 
ATOM   2313 C  CD1 . PHE B 1 379 ? 3.575  16.617 17.873 1.00 30.21 ? 379 PHE A CD1 1 
ATOM   2314 C  CD2 . PHE B 1 379 ? 5.897  17.208 18.037 1.00 28.19 ? 379 PHE A CD2 1 
ATOM   2315 C  CE1 . PHE B 1 379 ? 3.930  15.280 17.687 1.00 33.45 ? 379 PHE A CE1 1 
ATOM   2316 C  CE2 . PHE B 1 379 ? 6.257  15.898 17.854 1.00 31.13 ? 379 PHE A CE2 1 
ATOM   2317 C  CZ  . PHE B 1 379 ? 5.275  14.920 17.681 1.00 31.53 ? 379 PHE A CZ  1 
ATOM   2318 N  N   . VAL B 1 380 ? 5.135  21.419 20.012 1.00 25.92 ? 380 VAL A N   1 
ATOM   2319 C  CA  . VAL B 1 380 ? 5.375  22.862 20.188 1.00 25.00 ? 380 VAL A CA  1 
ATOM   2320 C  C   . VAL B 1 380 ? 6.763  23.198 19.633 1.00 24.53 ? 380 VAL A C   1 
ATOM   2321 O  O   . VAL B 1 380 ? 7.684  22.383 19.754 1.00 23.28 ? 380 VAL A O   1 
ATOM   2322 C  CB  . VAL B 1 380 ? 5.196  23.308 21.698 1.00 25.21 ? 380 VAL A CB  1 
ATOM   2323 C  CG1 . VAL B 1 380 ? 6.328  22.784 22.611 1.00 25.66 ? 380 VAL A CG1 1 
ATOM   2324 C  CG2 . VAL B 1 380 ? 5.069  24.860 21.832 1.00 24.15 ? 380 VAL A CG2 1 
ATOM   2325 N  N   . SER B 1 381 ? 6.904  24.359 18.980 1.00 23.91 ? 381 SER A N   1 
ATOM   2326 C  CA  . SER B 1 381 ? 8.219  24.833 18.571 1.00 23.60 ? 381 SER A CA  1 
ATOM   2327 C  C   . SER B 1 381 ? 8.829  25.700 19.673 1.00 23.65 ? 381 SER A C   1 
ATOM   2328 O  O   . SER B 1 381 ? 8.177  26.580 20.225 1.00 23.07 ? 381 SER A O   1 
ATOM   2329 C  CB  . SER B 1 381 ? 8.161  25.620 17.262 1.00 24.42 ? 381 SER A CB  1 
ATOM   2330 O  OG  . SER B 1 381 ? 7.795  24.731 16.201 1.00 28.44 ? 381 SER A OG  1 
ATOM   2331 N  N   . GLN B 1 382 ? 10.092 25.442 19.981 1.00 22.57 ? 382 GLN A N   1 
ATOM   2332 C  CA  . GLN B 1 382 ? 10.799 26.214 20.992 1.00 22.60 ? 382 GLN A CA  1 
ATOM   2333 C  C   . GLN B 1 382 ? 12.160 26.626 20.438 1.00 21.84 ? 382 GLN A C   1 
ATOM   2334 O  O   . GLN B 1 382 ? 12.629 26.074 19.416 1.00 21.17 ? 382 GLN A O   1 
ATOM   2335 C  CB  . GLN B 1 382 ? 10.931 25.405 22.306 1.00 22.09 ? 382 GLN A CB  1 
ATOM   2336 C  CG  . GLN B 1 382 ? 9.590  25.074 23.014 1.00 23.25 ? 382 GLN A CG  1 
ATOM   2337 C  CD  . GLN B 1 382 ? 9.802  24.540 24.459 1.00 25.98 ? 382 GLN A CD  1 
ATOM   2338 O  OE1 . GLN B 1 382 ? 10.932 24.502 24.950 1.00 28.36 ? 382 GLN A OE1 1 
ATOM   2339 N  NE2 . GLN B 1 382 ? 8.710  24.125 25.132 1.00 27.35 ? 382 GLN A NE2 1 
ATOM   2340 N  N   . SER B 1 383 ? 12.765 27.633 21.075 1.00 20.80 ? 383 SER A N   1 
ATOM   2341 C  CA  . SER B 1 383 ? 14.038 28.206 20.641 1.00 20.24 ? 383 SER A CA  1 
ATOM   2342 C  C   . SER B 1 383 ? 14.991 28.336 21.839 1.00 20.11 ? 383 SER A C   1 
ATOM   2343 O  O   . SER B 1 383 ? 14.553 28.599 22.968 1.00 19.65 ? 383 SER A O   1 
ATOM   2344 C  CB  . SER B 1 383 ? 13.818 29.602 20.041 1.00 20.60 ? 383 SER A CB  1 
ATOM   2345 O  OG  . SER B 1 383 ? 12.943 29.542 18.911 1.00 21.77 ? 383 SER A OG  1 
ATOM   2346 N  N   . GLY B 1 384 ? 16.285 28.163 21.602 1.00 19.36 ? 384 GLY A N   1 
ATOM   2347 C  CA  . GLY B 1 384 ? 17.249 28.382 22.687 1.00 19.15 ? 384 GLY A CA  1 
ATOM   2348 C  C   . GLY B 1 384 ? 18.507 27.594 22.448 1.00 18.73 ? 384 GLY A C   1 
ATOM   2349 O  O   . GLY B 1 384 ? 18.535 26.716 21.571 1.00 18.47 ? 384 GLY A O   1 
ATOM   2350 N  N   . THR B 1 385 ? 19.561 27.928 23.188 1.00 18.03 ? 385 THR A N   1 
ATOM   2351 C  CA  . THR B 1 385 ? 20.779 27.082 23.161 1.00 17.61 ? 385 THR A CA  1 
ATOM   2352 C  C   . THR B 1 385 ? 20.536 25.702 23.831 1.00 18.17 ? 385 THR A C   1 
ATOM   2353 O  O   . THR B 1 385 ? 21.303 24.799 23.612 1.00 18.66 ? 385 THR A O   1 
ATOM   2354 C  CB  . THR B 1 385 ? 22.013 27.782 23.792 1.00 16.22 ? 385 THR A CB  1 
ATOM   2355 O  OG1 . THR B 1 385 ? 21.694 28.190 25.140 1.00 16.75 ? 385 THR A OG1 1 
ATOM   2356 C  CG2 . THR B 1 385 ? 22.391 28.985 23.001 1.00 15.20 ? 385 THR A CG2 1 
ATOM   2357 N  N   . SER B 1 386 ? 19.492 25.547 24.655 1.00 19.07 ? 386 SER A N   1 
ATOM   2358 C  CA  . SER B 1 386 ? 19.094 24.189 25.124 1.00 20.06 ? 386 SER A CA  1 
ATOM   2359 C  C   . SER B 1 386 ? 18.699 23.262 23.965 1.00 19.72 ? 386 SER A C   1 
ATOM   2360 O  O   . SER B 1 386 ? 19.099 22.092 23.936 1.00 18.51 ? 386 SER A O   1 
ATOM   2361 C  CB  . SER B 1 386 ? 17.904 24.274 26.072 1.00 20.87 ? 386 SER A CB  1 
ATOM   2362 O  OG  . SER B 1 386 ? 18.331 24.753 27.334 1.00 27.11 ? 386 SER A OG  1 
ATOM   2363 N  N   . GLN B 1 387 ? 17.906 23.783 23.017 1.00 18.81 ? 387 GLN A N   1 
ATOM   2364 C  CA  . GLN B 1 387 ? 17.465 22.978 21.869 1.00 19.79 ? 387 GLN A CA  1 
ATOM   2365 C  C   . GLN B 1 387 ? 18.651 22.665 20.959 1.00 19.92 ? 387 GLN A C   1 
ATOM   2366 O  O   . GLN B 1 387 ? 18.774 21.543 20.454 1.00 20.52 ? 387 GLN A O   1 
ATOM   2367 C  CB  . GLN B 1 387 ? 16.356 23.674 21.082 1.00 20.24 ? 387 GLN A CB  1 
ATOM   2368 C  CG  . GLN B 1 387 ? 14.939 23.600 21.685 1.00 19.90 ? 387 GLN A CG  1 
ATOM   2369 C  CD  . GLN B 1 387 ? 14.731 24.399 22.957 1.00 22.92 ? 387 GLN A CD  1 
ATOM   2370 O  OE1 . GLN B 1 387 ? 15.340 25.460 23.173 1.00 22.74 ? 387 GLN A OE1 1 
ATOM   2371 N  NE2 . GLN B 1 387 ? 13.836 23.907 23.806 1.00 22.76 ? 387 GLN A NE2 1 
ATOM   2372 N  N   . ALA B 1 388 ? 19.520 23.656 20.738 1.00 19.28 ? 388 ALA A N   1 
ATOM   2373 C  CA  . ALA B 1 388 ? 20.742 23.447 19.970 1.00 18.41 ? 388 ALA A CA  1 
ATOM   2374 C  C   . ALA B 1 388 ? 21.589 22.331 20.598 1.00 18.67 ? 388 ALA A C   1 
ATOM   2375 O  O   . ALA B 1 388 ? 22.058 21.435 19.904 1.00 19.35 ? 388 ALA A O   1 
ATOM   2376 C  CB  . ALA B 1 388 ? 21.540 24.738 19.895 1.00 18.41 ? 388 ALA A CB  1 
ATOM   2377 N  N   . ALA B 1 389 ? 21.802 22.423 21.899 1.00 17.86 ? 389 ALA A N   1 
ATOM   2378 C  CA  . ALA B 1 389 ? 22.599 21.434 22.632 1.00 19.01 ? 389 ALA A CA  1 
ATOM   2379 C  C   . ALA B 1 389 ? 21.961 20.038 22.604 1.00 19.44 ? 389 ALA A C   1 
ATOM   2380 O  O   . ALA B 1 389 ? 22.679 19.044 22.621 1.00 20.61 ? 389 ALA A O   1 
ATOM   2381 C  CB  . ALA B 1 389 ? 22.784 21.882 24.043 1.00 18.94 ? 389 ALA A CB  1 
ATOM   2382 N  N   . ALA B 1 390 ? 20.629 19.973 22.541 1.00 18.58 ? 390 ALA A N   1 
ATOM   2383 C  CA  . ALA B 1 390 ? 19.904 18.697 22.400 1.00 19.21 ? 390 ALA A CA  1 
ATOM   2384 C  C   . ALA B 1 390 ? 20.182 18.021 21.059 1.00 19.89 ? 390 ALA A C   1 
ATOM   2385 O  O   . ALA B 1 390 ? 20.302 16.806 21.003 1.00 19.11 ? 390 ALA A O   1 
ATOM   2386 C  CB  . ALA B 1 390 ? 18.388 18.885 22.607 1.00 19.08 ? 390 ALA A CB  1 
ATOM   2387 N  N   . HIS B 1 391 ? 20.303 18.811 19.997 1.00 19.86 ? 391 HIS A N   1 
ATOM   2388 C  CA  . HIS B 1 391 ? 20.718 18.300 18.693 1.00 20.89 ? 391 HIS A CA  1 
ATOM   2389 C  C   . HIS B 1 391 ? 22.094 17.649 18.750 1.00 21.29 ? 391 HIS A C   1 
ATOM   2390 O  O   . HIS B 1 391 ? 22.301 16.543 18.238 1.00 21.72 ? 391 HIS A O   1 
ATOM   2391 C  CB  . HIS B 1 391 ? 20.735 19.429 17.666 1.00 21.35 ? 391 HIS A CB  1 
ATOM   2392 C  CG  . HIS B 1 391 ? 19.379 19.764 17.136 1.00 21.52 ? 391 HIS A CG  1 
ATOM   2393 N  ND1 . HIS B 1 391 ? 18.485 20.553 17.829 1.00 22.47 ? 391 HIS A ND1 1 
ATOM   2394 C  CD2 . HIS B 1 391 ? 18.760 19.403 15.984 1.00 20.45 ? 391 HIS A CD2 1 
ATOM   2395 C  CE1 . HIS B 1 391 ? 17.374 20.670 17.121 1.00 24.20 ? 391 HIS A CE1 1 
ATOM   2396 N  NE2 . HIS B 1 391 ? 17.510 19.968 16.006 1.00 21.56 ? 391 HIS A NE2 1 
ATOM   2397 N  N   . VAL B 1 392 ? 23.044 18.331 19.382 1.00 20.68 ? 392 VAL A N   1 
ATOM   2398 C  CA  . VAL B 1 392 ? 24.392 17.783 19.503 1.00 20.72 ? 392 VAL A CA  1 
ATOM   2399 C  C   . VAL B 1 392 ? 24.430 16.545 20.397 1.00 19.94 ? 392 VAL A C   1 
ATOM   2400 O  O   . VAL B 1 392 ? 25.180 15.620 20.108 1.00 20.04 ? 392 VAL A O   1 
ATOM   2401 C  CB  . VAL B 1 392 ? 25.453 18.847 19.898 1.00 20.06 ? 392 VAL A CB  1 
ATOM   2402 C  CG1 . VAL B 1 392 ? 26.836 18.213 20.126 1.00 20.27 ? 392 VAL A CG1 1 
ATOM   2403 C  CG2 . VAL B 1 392 ? 25.570 19.900 18.810 1.00 19.77 ? 392 VAL A CG2 1 
ATOM   2404 N  N   . ALA B 1 393 ? 23.635 16.514 21.463 1.00 20.57 ? 393 ALA A N   1 
ATOM   2405 C  CA  . ALA B 1 393 ? 23.553 15.300 22.266 1.00 20.93 ? 393 ALA A CA  1 
ATOM   2406 C  C   . ALA B 1 393 ? 23.055 14.109 21.436 1.00 21.91 ? 393 ALA A C   1 
ATOM   2407 O  O   . ALA B 1 393 ? 23.578 12.999 21.571 1.00 21.30 ? 393 ALA A O   1 
ATOM   2408 C  CB  . ALA B 1 393 ? 22.680 15.513 23.500 1.00 21.84 ? 393 ALA A CB  1 
ATOM   2409 N  N   . GLY B 1 394 ? 22.056 14.340 20.573 1.00 21.82 ? 394 GLY A N   1 
ATOM   2410 C  CA  . GLY B 1 394 ? 21.525 13.283 19.702 1.00 22.35 ? 394 GLY A CA  1 
ATOM   2411 C  C   . GLY B 1 394 ? 22.520 12.852 18.645 1.00 22.27 ? 394 GLY A C   1 
ATOM   2412 O  O   . GLY B 1 394 ? 22.691 11.659 18.395 1.00 22.36 ? 394 GLY A O   1 
ATOM   2413 N  N   . ILE B 1 395 ? 23.204 13.822 18.041 1.00 22.56 ? 395 ILE A N   1 
ATOM   2414 C  CA  . ILE B 1 395 ? 24.313 13.529 17.107 1.00 21.66 ? 395 ILE A CA  1 
ATOM   2415 C  C   . ILE B 1 395 ? 25.440 12.718 17.784 1.00 22.43 ? 395 ILE A C   1 
ATOM   2416 O  O   . ILE B 1 395 ? 25.933 11.727 17.219 1.00 21.58 ? 395 ILE A O   1 
ATOM   2417 C  CB  . ILE B 1 395 ? 24.893 14.812 16.458 1.00 21.53 ? 395 ILE A CB  1 
ATOM   2418 C  CG1 . ILE B 1 395 ? 23.866 15.491 15.537 1.00 22.31 ? 395 ILE A CG1 1 
ATOM   2419 C  CG2 . ILE B 1 395 ? 26.191 14.513 15.708 1.00 19.41 ? 395 ILE A CG2 1 
ATOM   2420 C  CD1 . ILE B 1 395 ? 24.347 16.863 15.013 1.00 22.34 ? 395 ILE A CD1 1 
ATOM   2421 N  N   . ALA B 1 396 ? 25.833 13.124 18.990 1.00 22.76 ? 396 ALA A N   1 
ATOM   2422 C  CA  . ALA B 1 396 ? 26.889 12.418 19.729 1.00 23.61 ? 396 ALA A CA  1 
ATOM   2423 C  C   . ALA B 1 396 ? 26.463 10.976 20.009 1.00 24.04 ? 396 ALA A C   1 
ATOM   2424 O  O   . ALA B 1 396 ? 27.265 10.061 19.861 1.00 23.80 ? 396 ALA A O   1 
ATOM   2425 C  CB  . ALA B 1 396 ? 27.213 13.129 21.039 1.00 23.22 ? 396 ALA A CB  1 
ATOM   2426 N  N   . ALA B 1 397 ? 25.206 10.802 20.422 1.00 24.26 ? 397 ALA A N   1 
ATOM   2427 C  CA  . ALA B 1 397 ? 24.642 9.487  20.715 1.00 24.99 ? 397 ALA A CA  1 
ATOM   2428 C  C   . ALA B 1 397 ? 24.737 8.548  19.513 1.00 25.80 ? 397 ALA A C   1 
ATOM   2429 O  O   . ALA B 1 397 ? 25.100 7.382  19.663 1.00 25.68 ? 397 ALA A O   1 
ATOM   2430 C  CB  . ALA B 1 397 ? 23.197 9.618  21.188 1.00 24.03 ? 397 ALA A CB  1 
ATOM   2431 N  N   . MET B 1 398 ? 24.413 9.059  18.331 1.00 26.14 ? 398 MET A N   1 
ATOM   2432 C  CA  . MET B 1 398 ? 24.456 8.275  17.101 1.00 28.08 ? 398 MET A CA  1 
ATOM   2433 C  C   . MET B 1 398 ? 25.891 7.993  16.692 1.00 26.77 ? 398 MET A C   1 
ATOM   2434 O  O   . MET B 1 398 ? 26.197 6.900  16.219 1.00 25.67 ? 398 MET A O   1 
ATOM   2435 C  CB  . MET B 1 398 ? 23.692 8.984  15.979 1.00 27.18 ? 398 MET A CB  1 
ATOM   2436 C  CG  . MET B 1 398 ? 22.191 9.068  16.283 1.00 30.14 ? 398 MET A CG  1 
ATOM   2437 S  SD  . MET B 1 398 ? 21.181 8.936  14.816 1.00 36.20 ? 398 MET A SD  1 
ATOM   2438 C  CE  . MET B 1 398 ? 21.840 7.414  14.143 1.00 36.99 ? 398 MET A CE  1 
ATOM   2439 N  N   . MET B 1 399 ? 26.781 8.956  16.918 1.00 25.78 ? 399 MET A N   1 
ATOM   2440 C  CA  . MET B 1 399 ? 28.198 8.743  16.608 1.00 26.96 ? 399 MET A CA  1 
ATOM   2441 C  C   . MET B 1 399 ? 28.830 7.690  17.531 1.00 25.97 ? 399 MET A C   1 
ATOM   2442 O  O   . MET B 1 399 ? 29.647 6.882  17.099 1.00 26.45 ? 399 MET A O   1 
ATOM   2443 C  CB  . MET B 1 399 ? 29.001 10.055 16.678 1.00 25.97 ? 399 MET A CB  1 
ATOM   2444 C  CG  . MET B 1 399 ? 28.661 11.080 15.595 1.00 27.95 ? 399 MET A CG  1 
ATOM   2445 S  SD  . MET B 1 399 ? 29.605 12.593 15.881 1.00 28.84 ? 399 MET A SD  1 
ATOM   2446 C  CE  . MET B 1 399 ? 29.408 13.499 14.334 1.00 29.64 ? 399 MET A CE  1 
ATOM   2447 N  N   . LEU B 1 400 ? 28.456 7.720  18.800 1.00 26.51 ? 400 LEU A N   1 
ATOM   2448 C  CA  . LEU B 1 400 ? 28.967 6.763  19.777 1.00 26.23 ? 400 LEU A CA  1 
ATOM   2449 C  C   . LEU B 1 400 ? 28.341 5.366  19.618 1.00 27.39 ? 400 LEU A C   1 
ATOM   2450 O  O   . LEU B 1 400 ? 28.973 4.369  19.965 1.00 28.12 ? 400 LEU A O   1 
ATOM   2451 C  CB  . LEU B 1 400 ? 28.790 7.281  21.203 1.00 25.43 ? 400 LEU A CB  1 
ATOM   2452 C  CG  . LEU B 1 400 ? 29.634 8.483  21.653 1.00 24.87 ? 400 LEU A CG  1 
ATOM   2453 C  CD1 . LEU B 1 400 ? 29.110 9.032  22.979 1.00 25.49 ? 400 LEU A CD1 1 
ATOM   2454 C  CD2 . LEU B 1 400 ? 31.088 8.118  21.788 1.00 24.32 ? 400 LEU A CD2 1 
ATOM   2455 N  N   . SER B 1 401 ? 27.116 5.290  19.102 1.00 28.04 ? 401 SER A N   1 
ATOM   2456 C  CA  . SER B 1 401 ? 26.513 4.005  18.764 1.00 29.40 ? 401 SER A CA  1 
ATOM   2457 C  C   . SER B 1 401 ? 27.306 3.318  17.641 1.00 29.01 ? 401 SER A C   1 
ATOM   2458 O  O   . SER B 1 401 ? 27.573 2.110  17.711 1.00 29.12 ? 401 SER A O   1 
ATOM   2459 C  CB  . SER B 1 401 ? 25.035 4.176  18.403 1.00 29.97 ? 401 SER A CB  1 
ATOM   2460 O  OG  . SER B 1 401 ? 24.514 3.011  17.753 1.00 35.17 ? 401 SER A OG  1 
ATOM   2461 N  N   . ALA B 1 402 ? 27.730 4.093  16.641 1.00 27.85 ? 402 ALA A N   1 
ATOM   2462 C  CA  . ALA B 1 402 ? 28.501 3.566  15.498 1.00 27.44 ? 402 ALA A CA  1 
ATOM   2463 C  C   . ALA B 1 402 ? 29.967 3.264  15.822 1.00 27.08 ? 402 ALA A C   1 
ATOM   2464 O  O   . ALA B 1 402 ? 30.547 2.311  15.288 1.00 26.78 ? 402 ALA A O   1 
ATOM   2465 C  CB  . ALA B 1 402 ? 28.413 4.523  14.302 1.00 27.00 ? 402 ALA A CB  1 
ATOM   2466 N  N   . GLU B 1 403 ? 30.563 4.075  16.697 1.00 26.83 ? 403 GLU A N   1 
ATOM   2467 C  CA  . GLU B 1 403 ? 31.959 3.917  17.121 1.00 26.63 ? 403 GLU A CA  1 
ATOM   2468 C  C   . GLU B 1 403 ? 32.051 4.127  18.636 1.00 26.69 ? 403 GLU A C   1 
ATOM   2469 O  O   . GLU B 1 403 ? 32.412 5.230  19.101 1.00 26.63 ? 403 GLU A O   1 
ATOM   2470 C  CB  . GLU B 1 403 ? 32.867 4.926  16.408 1.00 27.27 ? 403 GLU A CB  1 
ATOM   2471 C  CG  . GLU B 1 403 ? 32.966 4.792  14.874 1.00 27.82 ? 403 GLU A CG  1 
ATOM   2472 C  CD  . GLU B 1 403 ? 33.790 5.914  14.265 1.00 28.11 ? 403 GLU A CD  1 
ATOM   2473 O  OE1 . GLU B 1 403 ? 33.217 6.995  13.996 1.00 28.29 ? 403 GLU A OE1 1 
ATOM   2474 O  OE2 . GLU B 1 403 ? 35.016 5.720  14.060 1.00 30.99 ? 403 GLU A OE2 1 
ATOM   2475 N  N   . PRO B 1 404 ? 31.665 3.105  19.420 1.00 26.64 ? 404 PRO A N   1 
ATOM   2476 C  CA  . PRO B 1 404 ? 31.566 3.211  20.879 1.00 26.85 ? 404 PRO A CA  1 
ATOM   2477 C  C   . PRO B 1 404 ? 32.864 3.458  21.616 1.00 27.57 ? 404 PRO A C   1 
ATOM   2478 O  O   . PRO B 1 404 ? 32.833 3.898  22.778 1.00 28.83 ? 404 PRO A O   1 
ATOM   2479 C  CB  . PRO B 1 404 ? 30.974 1.846  21.279 1.00 26.75 ? 404 PRO A CB  1 
ATOM   2480 C  CG  . PRO B 1 404 ? 30.278 1.379  20.054 1.00 26.03 ? 404 PRO A CG  1 
ATOM   2481 C  CD  . PRO B 1 404 ? 31.206 1.785  18.960 1.00 26.59 ? 404 PRO A CD  1 
ATOM   2482 N  N   . GLU B 1 405 ? 33.992 3.201  20.969 1.00 28.08 ? 405 GLU A N   1 
ATOM   2483 C  CA  . GLU B 1 405 ? 35.296 3.401  21.601 1.00 30.17 ? 405 GLU A CA  1 
ATOM   2484 C  C   . GLU B 1 405 ? 35.866 4.806  21.432 1.00 29.56 ? 405 GLU A C   1 
ATOM   2485 O  O   . GLU B 1 405 ? 36.992 5.056  21.872 1.00 30.51 ? 405 GLU A O   1 
ATOM   2486 C  CB  . GLU B 1 405 ? 36.308 2.376  21.090 1.00 29.86 ? 405 GLU A CB  1 
ATOM   2487 C  CG  . GLU B 1 405 ? 36.102 0.978  21.625 1.00 32.98 ? 405 GLU A CG  1 
ATOM   2488 C  CD  . GLU B 1 405 ? 37.171 -0.012 21.141 1.00 33.91 ? 405 GLU A CD  1 
ATOM   2489 O  OE1 . GLU B 1 405 ? 38.261 0.433  20.705 1.00 37.45 ? 405 GLU A OE1 1 
ATOM   2490 O  OE2 . GLU B 1 405 ? 36.913 -1.246 21.187 1.00 41.21 ? 405 GLU A OE2 1 
ATOM   2491 N  N   . LEU B 1 406 ? 35.113 5.710  20.804 1.00 29.13 ? 406 LEU A N   1 
ATOM   2492 C  CA  . LEU B 1 406 ? 35.594 7.083  20.595 1.00 29.08 ? 406 LEU A CA  1 
ATOM   2493 C  C   . LEU B 1 406 ? 35.896 7.704  21.930 1.00 29.12 ? 406 LEU A C   1 
ATOM   2494 O  O   . LEU B 1 406 ? 35.085 7.634  22.858 1.00 29.36 ? 406 LEU A O   1 
ATOM   2495 C  CB  . LEU B 1 406 ? 34.553 7.969  19.889 1.00 28.72 ? 406 LEU A CB  1 
ATOM   2496 C  CG  . LEU B 1 406 ? 34.220 7.668  18.424 1.00 27.30 ? 406 LEU A CG  1 
ATOM   2497 C  CD1 . LEU B 1 406 ? 33.122 8.576  17.931 1.00 28.72 ? 406 LEU A CD1 1 
ATOM   2498 C  CD2 . LEU B 1 406 ? 35.459 7.800  17.558 1.00 28.29 ? 406 LEU A CD2 1 
ATOM   2499 N  N   . THR B 1 407 ? 37.077 8.293  22.036 1.00 28.87 ? 407 THR A N   1 
ATOM   2500 C  CA  . THR B 1 407 ? 37.367 9.124  23.182 1.00 28.57 ? 407 THR A CA  1 
ATOM   2501 C  C   . THR B 1 407 ? 36.670 10.479 22.946 1.00 28.33 ? 407 THR A C   1 
ATOM   2502 O  O   . THR B 1 407 ? 36.203 10.766 21.834 1.00 27.29 ? 407 THR A O   1 
ATOM   2503 C  CB  . THR B 1 407 ? 38.884 9.333  23.365 1.00 28.79 ? 407 THR A CB  1 
ATOM   2504 O  OG1 . THR B 1 407 ? 39.396 10.051 22.248 1.00 28.45 ? 407 THR A OG1 1 
ATOM   2505 C  CG2 . THR B 1 407 ? 39.613 8.000  23.494 1.00 28.96 ? 407 THR A CG2 1 
ATOM   2506 N  N   . LEU B 1 408 ? 36.602 11.297 23.989 1.00 27.97 ? 408 LEU A N   1 
ATOM   2507 C  CA  . LEU B 1 408 ? 36.030 12.636 23.874 1.00 27.56 ? 408 LEU A CA  1 
ATOM   2508 C  C   . LEU B 1 408 ? 36.748 13.535 22.842 1.00 27.21 ? 408 LEU A C   1 
ATOM   2509 O  O   . LEU B 1 408 ? 36.090 14.262 22.083 1.00 27.40 ? 408 LEU A O   1 
ATOM   2510 C  CB  . LEU B 1 408 ? 35.984 13.300 25.252 1.00 28.22 ? 408 LEU A CB  1 
ATOM   2511 C  CG  . LEU B 1 408 ? 35.533 14.759 25.280 1.00 28.09 ? 408 LEU A CG  1 
ATOM   2512 C  CD1 . LEU B 1 408 ? 34.087 14.866 24.816 1.00 29.64 ? 408 LEU A CD1 1 
ATOM   2513 C  CD2 . LEU B 1 408 ? 35.678 15.280 26.693 1.00 31.31 ? 408 LEU A CD2 1 
ATOM   2514 N  N   . ALA B 1 409 ? 38.084 13.489 22.816 1.00 26.28 ? 409 ALA A N   1 
ATOM   2515 C  CA  . ALA B 1 409 ? 38.850 14.231 21.815 1.00 25.88 ? 409 ALA A CA  1 
ATOM   2516 C  C   . ALA B 1 409 ? 38.544 13.753 20.406 1.00 25.75 ? 409 ALA A C   1 
ATOM   2517 O  O   . ALA B 1 409 ? 38.386 14.567 19.502 1.00 25.01 ? 409 ALA A O   1 
ATOM   2518 C  CB  . ALA B 1 409 ? 40.377 14.146 22.089 1.00 26.00 ? 409 ALA A CB  1 
ATOM   2519 N  N   . GLU B 1 410 ? 38.439 12.434 20.221 1.00 25.98 ? 410 GLU A N   1 
ATOM   2520 C  CA  . GLU B 1 410 ? 38.049 11.881 18.927 1.00 26.83 ? 410 GLU A CA  1 
ATOM   2521 C  C   . GLU B 1 410 ? 36.619 12.257 18.533 1.00 25.15 ? 410 GLU A C   1 
ATOM   2522 O  O   . GLU B 1 410 ? 36.344 12.543 17.376 1.00 24.39 ? 410 GLU A O   1 
ATOM   2523 C  CB  . GLU B 1 410 ? 38.224 10.364 18.888 1.00 27.12 ? 410 GLU A CB  1 
ATOM   2524 C  CG  . GLU B 1 410 ? 39.660 9.891  19.010 1.00 28.85 ? 410 GLU A CG  1 
ATOM   2525 C  CD  . GLU B 1 410 ? 39.755 8.367  19.131 1.00 30.70 ? 410 GLU A CD  1 
ATOM   2526 O  OE1 . GLU B 1 410 ? 38.803 7.721  19.646 1.00 33.95 ? 410 GLU A OE1 1 
ATOM   2527 O  OE2 . GLU B 1 410 ? 40.783 7.816  18.709 1.00 34.01 ? 410 GLU A OE2 1 
ATOM   2528 N  N   . LEU B 1 411 ? 35.713 12.251 19.497 1.00 24.58 ? 411 LEU A N   1 
ATOM   2529 C  CA  . LEU B 1 411 ? 34.343 12.673 19.225 1.00 24.67 ? 411 LEU A CA  1 
ATOM   2530 C  C   . LEU B 1 411 ? 34.248 14.162 18.889 1.00 23.64 ? 411 LEU A C   1 
ATOM   2531 O  O   . LEU B 1 411 ? 33.554 14.538 17.956 1.00 23.03 ? 411 LEU A O   1 
ATOM   2532 C  CB  . LEU B 1 411 ? 33.450 12.365 20.424 1.00 24.97 ? 411 LEU A CB  1 
ATOM   2533 C  CG  . LEU B 1 411 ? 31.984 12.783 20.306 1.00 27.30 ? 411 LEU A CG  1 
ATOM   2534 C  CD1 . LEU B 1 411 ? 31.258 12.072 19.177 1.00 26.73 ? 411 LEU A CD1 1 
ATOM   2535 C  CD2 . LEU B 1 411 ? 31.358 12.428 21.617 1.00 28.58 ? 411 LEU A CD2 1 
ATOM   2536 N  N   . ARG B 1 412 ? 34.940 15.012 19.653 1.00 24.23 ? 412 ARG A N   1 
ATOM   2537 C  CA  . ARG B 1 412 ? 34.949 16.456 19.345 1.00 23.65 ? 412 ARG A CA  1 
ATOM   2538 C  C   . ARG B 1 412 ? 35.524 16.722 17.960 1.00 23.46 ? 412 ARG A C   1 
ATOM   2539 O  O   . ARG B 1 412 ? 34.993 17.542 17.205 1.00 22.92 ? 412 ARG A O   1 
ATOM   2540 C  CB  . ARG B 1 412 ? 35.731 17.248 20.412 1.00 24.86 ? 412 ARG A CB  1 
ATOM   2541 C  CG  . ARG B 1 412 ? 35.737 18.766 20.182 1.00 25.98 ? 412 ARG A CG  1 
ATOM   2542 C  CD  . ARG B 1 412 ? 36.807 19.408 21.075 1.00 28.93 ? 412 ARG A CD  1 
ATOM   2543 N  NE  . ARG B 1 412 ? 36.508 19.192 22.485 1.00 30.76 ? 412 ARG A NE  1 
ATOM   2544 C  CZ  . ARG B 1 412 ? 37.240 18.491 23.349 1.00 34.49 ? 412 ARG A CZ  1 
ATOM   2545 N  NH1 . ARG B 1 412 ? 38.379 17.892 22.982 1.00 34.98 ? 412 ARG A NH1 1 
ATOM   2546 N  NH2 . ARG B 1 412 ? 36.820 18.395 24.612 1.00 35.62 ? 412 ARG A NH2 1 
ATOM   2547 N  N   . GLN B 1 413 ? 36.606 16.027 17.604 1.00 22.92 ? 413 GLN A N   1 
ATOM   2548 C  CA  . GLN B 1 413 ? 37.220 16.231 16.268 1.00 22.79 ? 413 GLN A CA  1 
ATOM   2549 C  C   . GLN B 1 413 ? 36.252 15.864 15.136 1.00 23.00 ? 413 GLN A C   1 
ATOM   2550 O  O   . GLN B 1 413 ? 36.184 16.537 14.110 1.00 23.92 ? 413 GLN A O   1 
ATOM   2551 C  CB  . GLN B 1 413 ? 38.532 15.447 16.155 1.00 22.17 ? 413 GLN A CB  1 
ATOM   2552 C  CG  . GLN B 1 413 ? 39.678 15.992 17.067 1.00 21.65 ? 413 GLN A CG  1 
ATOM   2553 C  CD  . GLN B 1 413 ? 40.643 16.932 16.354 1.00 22.43 ? 413 GLN A CD  1 
ATOM   2554 O  OE1 . GLN B 1 413 ? 41.755 17.198 16.858 1.00 23.01 ? 413 GLN A OE1 1 
ATOM   2555 N  NE2 . GLN B 1 413 ? 40.238 17.444 15.189 1.00 17.37 ? 413 GLN A NE2 1 
ATOM   2556 N  N   . ARG B 1 414 ? 35.491 14.801 15.340 1.00 23.73 ? 414 ARG A N   1 
ATOM   2557 C  CA  . ARG B 1 414 ? 34.452 14.404 14.390 1.00 24.28 ? 414 ARG A CA  1 
ATOM   2558 C  C   . ARG B 1 414 ? 33.314 15.423 14.273 1.00 23.84 ? 414 ARG A C   1 
ATOM   2559 O  O   . ARG B 1 414 ? 32.966 15.814 13.170 1.00 23.88 ? 414 ARG A O   1 
ATOM   2560 C  CB  . ARG B 1 414 ? 33.924 13.014 14.732 1.00 24.85 ? 414 ARG A CB  1 
ATOM   2561 C  CG  . ARG B 1 414 ? 34.881 11.910 14.234 1.00 25.59 ? 414 ARG A CG  1 
ATOM   2562 C  CD  . ARG B 1 414 ? 34.769 10.636 15.063 1.00 27.92 ? 414 ARG A CD  1 
ATOM   2563 N  NE  . ARG B 1 414 ? 35.643 9.593  14.534 1.00 28.99 ? 414 ARG A NE  1 
ATOM   2564 C  CZ  . ARG B 1 414 ? 36.974 9.578  14.666 1.00 32.67 ? 414 ARG A CZ  1 
ATOM   2565 N  NH1 . ARG B 1 414 ? 37.617 10.551 15.319 1.00 28.71 ? 414 ARG A NH1 1 
ATOM   2566 N  NH2 . ARG B 1 414 ? 37.667 8.578  14.130 1.00 34.24 ? 414 ARG A NH2 1 
ATOM   2567 N  N   . LEU B 1 415 ? 32.748 15.858 15.402 1.00 23.27 ? 415 LEU A N   1 
ATOM   2568 C  CA  . LEU B 1 415 ? 31.697 16.892 15.385 1.00 22.86 ? 415 LEU A CA  1 
ATOM   2569 C  C   . LEU B 1 415 ? 32.143 18.126 14.610 1.00 23.15 ? 415 LEU A C   1 
ATOM   2570 O  O   . LEU B 1 415 ? 31.362 18.695 13.836 1.00 23.21 ? 415 LEU A O   1 
ATOM   2571 C  CB  . LEU B 1 415 ? 31.295 17.308 16.802 1.00 23.16 ? 415 LEU A CB  1 
ATOM   2572 C  CG  . LEU B 1 415 ? 30.540 16.286 17.642 1.00 22.56 ? 415 LEU A CG  1 
ATOM   2573 C  CD1 . LEU B 1 415 ? 30.589 16.716 19.116 1.00 20.70 ? 415 LEU A CD1 1 
ATOM   2574 C  CD2 . LEU B 1 415 ? 29.108 16.151 17.151 1.00 23.41 ? 415 LEU A CD2 1 
ATOM   2575 N  N   . ILE B 1 416 ? 33.399 18.533 14.816 1.00 22.99 ? 416 ILE A N   1 
ATOM   2576 C  CA  . ILE B 1 416 ? 33.976 19.668 14.080 1.00 23.14 ? 416 ILE A CA  1 
ATOM   2577 C  C   . ILE B 1 416 ? 34.090 19.340 12.596 1.00 23.65 ? 416 ILE A C   1 
ATOM   2578 O  O   . ILE B 1 416 ? 33.700 20.128 11.748 1.00 24.11 ? 416 ILE A O   1 
ATOM   2579 C  CB  . ILE B 1 416 ? 35.380 20.046 14.613 1.00 22.81 ? 416 ILE A CB  1 
ATOM   2580 C  CG1 . ILE B 1 416 ? 35.312 20.554 16.059 1.00 23.20 ? 416 ILE A CG1 1 
ATOM   2581 C  CG2 . ILE B 1 416 ? 36.071 21.044 13.665 1.00 22.84 ? 416 ILE A CG2 1 
ATOM   2582 C  CD1 . ILE B 1 416 ? 36.704 20.800 16.697 1.00 22.55 ? 416 ILE A CD1 1 
ATOM   2583 N  N   . HIS B 1 417 ? 34.670 18.184 12.288 1.00 24.45 ? 417 HIS A N   1 
ATOM   2584 C  CA  . HIS B 1 417 ? 34.930 17.821 10.905 1.00 25.74 ? 417 HIS A CA  1 
ATOM   2585 C  C   . HIS B 1 417 ? 33.652 17.725 10.076 1.00 25.22 ? 417 HIS A C   1 
ATOM   2586 O  O   . HIS B 1 417 ? 33.611 18.183 8.938  1.00 24.96 ? 417 HIS A O   1 
ATOM   2587 C  CB  . HIS B 1 417 ? 35.703 16.495 10.828 1.00 27.22 ? 417 HIS A CB  1 
ATOM   2588 C  CG  . HIS B 1 417 ? 36.025 16.082 9.428  1.00 29.78 ? 417 HIS A CG  1 
ATOM   2589 N  ND1 . HIS B 1 417 ? 36.837 16.832 8.607  1.00 32.94 ? 417 HIS A ND1 1 
ATOM   2590 C  CD2 . HIS B 1 417 ? 35.611 15.026 8.687  1.00 32.90 ? 417 HIS A CD2 1 
ATOM   2591 C  CE1 . HIS B 1 417 ? 36.917 16.251 7.421  1.00 33.25 ? 417 HIS A CE1 1 
ATOM   2592 N  NE2 . HIS B 1 417 ? 36.182 15.154 7.444  1.00 33.58 ? 417 HIS A NE2 1 
ATOM   2593 N  N   . PHE B 1 418 ? 32.617 17.117 10.651 1.00 24.75 ? 418 PHE A N   1 
ATOM   2594 C  CA  . PHE B 1 418 ? 31.373 16.876 9.919  1.00 24.86 ? 418 PHE A CA  1 
ATOM   2595 C  C   . PHE B 1 418 ? 30.388 18.041 9.887  1.00 24.78 ? 418 PHE A C   1 
ATOM   2596 O  O   . PHE B 1 418 ? 29.344 17.924 9.269  1.00 23.81 ? 418 PHE A O   1 
ATOM   2597 C  CB  . PHE B 1 418 ? 30.712 15.601 10.457 1.00 25.27 ? 418 PHE A CB  1 
ATOM   2598 C  CG  . PHE B 1 418 ? 31.519 14.362 10.150 1.00 27.29 ? 418 PHE A CG  1 
ATOM   2599 C  CD1 . PHE B 1 418 ? 31.952 14.121 8.847  1.00 26.52 ? 418 PHE A CD1 1 
ATOM   2600 C  CD2 . PHE B 1 418 ? 31.878 13.474 11.144 1.00 28.62 ? 418 PHE A CD2 1 
ATOM   2601 C  CE1 . PHE B 1 418 ? 32.716 12.970 8.534  1.00 29.06 ? 418 PHE A CE1 1 
ATOM   2602 C  CE2 . PHE B 1 418 ? 32.642 12.323 10.842 1.00 27.90 ? 418 PHE A CE2 1 
ATOM   2603 C  CZ  . PHE B 1 418 ? 33.059 12.078 9.545  1.00 27.84 ? 418 PHE A CZ  1 
ATOM   2604 N  N   . SER B 1 419 ? 30.708 19.130 10.602 1.00 24.12 ? 419 SER A N   1 
ATOM   2605 C  CA  . SER B 1 419 ? 29.893 20.341 10.589 1.00 24.17 ? 419 SER A CA  1 
ATOM   2606 C  C   . SER B 1 419 ? 29.941 21.051 9.258  1.00 23.98 ? 419 SER A C   1 
ATOM   2607 O  O   . SER B 1 419 ? 30.925 20.937 8.533  1.00 24.52 ? 419 SER A O   1 
ATOM   2608 C  CB  . SER B 1 419 ? 30.430 21.336 11.623 1.00 23.91 ? 419 SER A CB  1 
ATOM   2609 O  OG  . SER B 1 419 ? 30.132 20.886 12.916 1.00 24.24 ? 419 SER A OG  1 
ATOM   2610 N  N   . ALA B 1 420 ? 28.895 21.836 8.978  1.00 24.23 ? 420 ALA A N   1 
ATOM   2611 C  CA  . ALA B 1 420 ? 28.890 22.826 7.896  1.00 24.96 ? 420 ALA A CA  1 
ATOM   2612 C  C   . ALA B 1 420 ? 29.777 23.996 8.290  1.00 25.66 ? 420 ALA A C   1 
ATOM   2613 O  O   . ALA B 1 420 ? 29.706 24.465 9.432  1.00 24.84 ? 420 ALA A O   1 
ATOM   2614 C  CB  . ALA B 1 420 ? 27.449 23.326 7.614  1.00 24.23 ? 420 ALA A CB  1 
ATOM   2615 N  N   . LYS B 1 421 ? 30.612 24.455 7.350  1.00 26.94 ? 421 LYS A N   1 
ATOM   2616 C  CA  . LYS B 1 421 ? 31.649 25.463 7.624  1.00 28.16 ? 421 LYS A CA  1 
ATOM   2617 C  C   . LYS B 1 421 ? 31.315 26.816 6.970  1.00 28.48 ? 421 LYS A C   1 
ATOM   2618 O  O   . LYS B 1 421 ? 30.887 26.853 5.830  1.00 27.89 ? 421 LYS A O   1 
ATOM   2619 C  CB  . LYS B 1 421 ? 33.032 24.993 7.106  1.00 28.17 ? 421 LYS A CB  1 
ATOM   2620 C  CG  . LYS B 1 421 ? 33.415 23.505 7.371  1.00 30.06 ? 421 LYS A CG  1 
ATOM   2621 C  CD  . LYS B 1 421 ? 34.020 23.297 8.765  1.00 30.90 ? 421 LYS A CD  1 
ATOM   2622 C  CE  . LYS B 1 421 ? 34.234 21.829 9.160  1.00 30.09 ? 421 LYS A CE  1 
ATOM   2623 N  NZ  . LYS B 1 421 ? 34.086 20.812 8.073  1.00 31.33 ? 421 LYS A NZ  1 
ATOM   2624 N  N   . ASP B 1 422 ? 31.508 27.912 7.703  1.00 28.96 ? 422 ASP A N   1 
ATOM   2625 C  CA  . ASP B 1 422 ? 31.469 29.277 7.148  1.00 29.58 ? 422 ASP A CA  1 
ATOM   2626 C  C   . ASP B 1 422 ? 30.101 29.697 6.578  1.00 28.82 ? 422 ASP A C   1 
ATOM   2627 O  O   . ASP B 1 422 ? 30.020 30.417 5.584  1.00 29.01 ? 422 ASP A O   1 
ATOM   2628 C  CB  . ASP B 1 422 ? 32.609 29.457 6.122  1.00 31.01 ? 422 ASP A CB  1 
ATOM   2629 C  CG  . ASP B 1 422 ? 32.891 30.929 5.775  1.00 35.12 ? 422 ASP A CG  1 
ATOM   2630 O  OD1 . ASP B 1 422 ? 33.013 31.795 6.685  1.00 39.42 ? 422 ASP A OD1 1 
ATOM   2631 O  OD2 . ASP B 1 422 ? 33.011 31.218 4.564  1.00 41.91 ? 422 ASP A OD2 1 
ATOM   2632 N  N   . VAL B 1 423 ? 29.024 29.263 7.226  1.00 27.52 ? 423 VAL A N   1 
ATOM   2633 C  CA  . VAL B 1 423 ? 27.663 29.616 6.799  1.00 27.35 ? 423 VAL A CA  1 
ATOM   2634 C  C   . VAL B 1 423 ? 27.081 30.734 7.675  1.00 27.25 ? 423 VAL A C   1 
ATOM   2635 O  O   . VAL B 1 423 ? 26.076 31.364 7.330  1.00 26.90 ? 423 VAL A O   1 
ATOM   2636 C  CB  . VAL B 1 423 ? 26.719 28.387 6.807  1.00 27.42 ? 423 VAL A CB  1 
ATOM   2637 C  CG1 . VAL B 1 423 ? 27.124 27.385 5.716  1.00 27.20 ? 423 VAL A CG1 1 
ATOM   2638 C  CG2 . VAL B 1 423 ? 26.707 27.714 8.199  1.00 28.62 ? 423 VAL A CG2 1 
ATOM   2639 N  N   . ILE B 1 424 ? 27.730 30.978 8.810  1.00 26.87 ? 424 ILE A N   1 
ATOM   2640 C  CA  . ILE B 1 424 ? 27.324 32.053 9.710  1.00 26.60 ? 424 ILE A CA  1 
ATOM   2641 C  C   . ILE B 1 424 ? 27.986 33.370 9.276  1.00 27.18 ? 424 ILE A C   1 
ATOM   2642 O  O   . ILE B 1 424 ? 29.193 33.420 8.981  1.00 26.86 ? 424 ILE A O   1 
ATOM   2643 C  CB  . ILE B 1 424 ? 27.664 31.703 11.187 1.00 26.75 ? 424 ILE A CB  1 
ATOM   2644 C  CG1 . ILE B 1 424 ? 27.091 30.334 11.599 1.00 26.75 ? 424 ILE A CG1 1 
ATOM   2645 C  CG2 . ILE B 1 424 ? 27.171 32.784 12.144 1.00 27.31 ? 424 ILE A CG2 1 
ATOM   2646 C  CD1 . ILE B 1 424 ? 27.605 29.836 12.977 1.00 26.04 ? 424 ILE A CD1 1 
ATOM   2647 N  N   . ASN B 1 425 ? 27.182 34.428 9.190  1.00 27.88 ? 425 ASN A N   1 
ATOM   2648 C  CA  . ASN B 1 425 ? 27.699 35.773 8.978  1.00 28.14 ? 425 ASN A CA  1 
ATOM   2649 C  C   . ASN B 1 425 ? 28.242 36.287 10.313 1.00 28.25 ? 425 ASN A C   1 
ATOM   2650 O  O   . ASN B 1 425 ? 27.475 36.640 11.208 1.00 27.27 ? 425 ASN A O   1 
ATOM   2651 C  CB  . ASN B 1 425 ? 26.594 36.691 8.430  1.00 28.83 ? 425 ASN A CB  1 
ATOM   2652 C  CG  . ASN B 1 425 ? 27.107 38.094 8.040  1.00 30.31 ? 425 ASN A CG  1 
ATOM   2653 O  OD1 . ASN B 1 425 ? 28.208 38.495 8.389  1.00 30.75 ? 425 ASN A OD1 1 
ATOM   2654 N  ND2 . ASN B 1 425 ? 26.285 38.833 7.306  1.00 33.95 ? 425 ASN A ND2 1 
ATOM   2655 N  N   . GLU B 1 426 ? 29.568 36.306 10.442 1.00 28.25 ? 426 GLU A N   1 
ATOM   2656 C  CA  . GLU B 1 426 ? 30.240 36.676 11.704 1.00 29.44 ? 426 GLU A CA  1 
ATOM   2657 C  C   . GLU B 1 426 ? 29.997 38.125 12.177 1.00 27.92 ? 426 GLU A C   1 
ATOM   2658 O  O   . GLU B 1 426 ? 30.273 38.445 13.328 1.00 27.03 ? 426 GLU A O   1 
ATOM   2659 C  CB  . GLU B 1 426 ? 31.747 36.368 11.627 1.00 29.66 ? 426 GLU A CB  1 
ATOM   2660 C  CG  . GLU B 1 426 ? 32.477 37.052 10.458 1.00 32.80 ? 426 GLU A CG  1 
ATOM   2661 C  CD  . GLU B 1 426 ? 33.981 36.893 10.516 1.00 33.89 ? 426 GLU A CD  1 
ATOM   2662 O  OE1 . GLU B 1 426 ? 34.465 35.813 10.934 1.00 42.35 ? 426 GLU A OE1 1 
ATOM   2663 O  OE2 . GLU B 1 426 ? 34.700 37.847 10.145 1.00 39.18 ? 426 GLU A OE2 1 
ATOM   2664 N  N   . ALA B 1 427 ? 29.467 38.977 11.292 1.00 27.48 ? 427 ALA A N   1 
ATOM   2665 C  CA  . ALA B 1 427 ? 29.095 40.356 11.631 1.00 26.65 ? 427 ALA A CA  1 
ATOM   2666 C  C   . ALA B 1 427 ? 28.076 40.444 12.772 1.00 25.66 ? 427 ALA A C   1 
ATOM   2667 O  O   . ALA B 1 427 ? 27.978 41.456 13.454 1.00 25.20 ? 427 ALA A O   1 
ATOM   2668 C  CB  . ALA B 1 427 ? 28.572 41.098 10.393 1.00 27.69 ? 427 ALA A CB  1 
ATOM   2669 N  N   . TRP B 1 428 ? 27.312 39.376 12.970 1.00 24.35 ? 428 TRP A N   1 
ATOM   2670 C  CA  . TRP B 1 428 ? 26.359 39.301 14.064 1.00 23.95 ? 428 TRP A CA  1 
ATOM   2671 C  C   . TRP B 1 428 ? 27.079 39.374 15.419 1.00 22.91 ? 428 TRP A C   1 
ATOM   2672 O  O   . TRP B 1 428 ? 26.546 39.933 16.370 1.00 23.10 ? 428 TRP A O   1 
ATOM   2673 C  CB  . TRP B 1 428 ? 25.591 37.979 13.960 1.00 23.52 ? 428 TRP A CB  1 
ATOM   2674 C  CG  . TRP B 1 428 ? 24.341 37.892 14.754 1.00 24.08 ? 428 TRP A CG  1 
ATOM   2675 C  CD1 . TRP B 1 428 ? 23.083 38.170 14.319 1.00 23.94 ? 428 TRP A CD1 1 
ATOM   2676 C  CD2 . TRP B 1 428 ? 24.211 37.436 16.113 1.00 21.68 ? 428 TRP A CD2 1 
ATOM   2677 N  NE1 . TRP B 1 428 ? 22.174 37.947 15.328 1.00 27.16 ? 428 TRP A NE1 1 
ATOM   2678 C  CE2 . TRP B 1 428 ? 22.841 37.494 16.440 1.00 24.53 ? 428 TRP A CE2 1 
ATOM   2679 C  CE3 . TRP B 1 428 ? 25.126 36.994 17.088 1.00 23.78 ? 428 TRP A CE3 1 
ATOM   2680 C  CZ2 . TRP B 1 428 ? 22.349 37.112 17.695 1.00 23.07 ? 428 TRP A CZ2 1 
ATOM   2681 C  CZ3 . TRP B 1 428 ? 24.639 36.611 18.332 1.00 22.89 ? 428 TRP A CZ3 1 
ATOM   2682 C  CH2 . TRP B 1 428 ? 23.262 36.681 18.628 1.00 23.29 ? 428 TRP A CH2 1 
ATOM   2683 N  N   . PHE B 1 429 ? 28.271 38.777 15.506 1.00 22.49 ? 429 PHE A N   1 
ATOM   2684 C  CA  . PHE B 1 429 ? 29.039 38.761 16.752 1.00 21.59 ? 429 PHE A CA  1 
ATOM   2685 C  C   . PHE B 1 429 ? 29.766 40.087 16.942 1.00 21.81 ? 429 PHE A C   1 
ATOM   2686 O  O   . PHE B 1 429 ? 30.159 40.711 15.957 1.00 21.55 ? 429 PHE A O   1 
ATOM   2687 C  CB  . PHE B 1 429 ? 30.073 37.619 16.759 1.00 21.44 ? 429 PHE A CB  1 
ATOM   2688 C  CG  . PHE B 1 429 ? 29.476 36.260 16.452 1.00 20.47 ? 429 PHE A CG  1 
ATOM   2689 C  CD1 . PHE B 1 429 ? 28.481 35.738 17.246 1.00 17.74 ? 429 PHE A CD1 1 
ATOM   2690 C  CD2 . PHE B 1 429 ? 29.921 35.520 15.364 1.00 22.74 ? 429 PHE A CD2 1 
ATOM   2691 C  CE1 . PHE B 1 429 ? 27.904 34.484 16.961 1.00 20.93 ? 429 PHE A CE1 1 
ATOM   2692 C  CE2 . PHE B 1 429 ? 29.351 34.244 15.063 1.00 19.19 ? 429 PHE A CE2 1 
ATOM   2693 C  CZ  . PHE B 1 429 ? 28.330 33.744 15.868 1.00 18.92 ? 429 PHE A CZ  1 
ATOM   2694 N  N   . PRO B 1 430 ? 29.971 40.496 18.210 1.00 21.94 ? 430 PRO A N   1 
ATOM   2695 C  CA  . PRO B 1 430 ? 30.809 41.659 18.547 1.00 22.46 ? 430 PRO A CA  1 
ATOM   2696 C  C   . PRO B 1 430 ? 32.171 41.525 17.882 1.00 23.18 ? 430 PRO A C   1 
ATOM   2697 O  O   . PRO B 1 430 ? 32.671 40.409 17.758 1.00 22.41 ? 430 PRO A O   1 
ATOM   2698 C  CB  . PRO B 1 430 ? 30.975 41.534 20.053 1.00 22.29 ? 430 PRO A CB  1 
ATOM   2699 C  CG  . PRO B 1 430 ? 29.761 40.811 20.516 1.00 22.38 ? 430 PRO A CG  1 
ATOM   2700 C  CD  . PRO B 1 430 ? 29.392 39.862 19.417 1.00 21.51 ? 430 PRO A CD  1 
ATOM   2701 N  N   . GLU B 1 431 ? 32.774 42.643 17.482 1.00 23.66 ? 431 GLU A N   1 
ATOM   2702 C  CA  . GLU B 1 431 ? 34.007 42.622 16.682 1.00 25.05 ? 431 GLU A CA  1 
ATOM   2703 C  C   . GLU B 1 431 ? 35.139 41.725 17.198 1.00 25.33 ? 431 GLU A C   1 
ATOM   2704 O  O   . GLU B 1 431 ? 35.741 41.002 16.419 1.00 25.99 ? 431 GLU A O   1 
ATOM   2705 C  CB  . GLU B 1 431 ? 34.546 44.045 16.459 1.00 25.45 ? 431 GLU A CB  1 
ATOM   2706 C  CG  . GLU B 1 431 ? 33.590 44.897 15.665 1.00 27.62 ? 431 GLU A CG  1 
ATOM   2707 C  CD  . GLU B 1 431 ? 34.076 46.315 15.462 1.00 31.73 ? 431 GLU A CD  1 
ATOM   2708 O  OE1 . GLU B 1 431 ? 35.177 46.644 15.940 1.00 34.56 ? 431 GLU A OE1 1 
ATOM   2709 O  OE2 . GLU B 1 431 ? 33.361 47.100 14.798 1.00 36.30 ? 431 GLU A OE2 1 
ATOM   2710 N  N   . ASP B 1 432 ? 35.424 41.779 18.493 1.00 25.66 ? 432 ASP A N   1 
ATOM   2711 C  CA  . ASP B 1 432 ? 36.575 41.066 19.043 1.00 27.07 ? 432 ASP A CA  1 
ATOM   2712 C  C   . ASP B 1 432 ? 36.289 39.588 19.277 1.00 26.35 ? 432 ASP A C   1 
ATOM   2713 O  O   . ASP B 1 432 ? 37.187 38.831 19.631 1.00 26.84 ? 432 ASP A O   1 
ATOM   2714 C  CB  . ASP B 1 432 ? 37.093 41.727 20.338 1.00 27.64 ? 432 ASP A CB  1 
ATOM   2715 C  CG  . ASP B 1 432 ? 37.738 43.099 20.080 1.00 32.50 ? 432 ASP A CG  1 
ATOM   2716 O  OD1 . ASP B 1 432 ? 38.114 43.402 18.924 1.00 36.01 ? 432 ASP A OD1 1 
ATOM   2717 O  OD2 . ASP B 1 432 ? 37.841 43.900 21.033 1.00 37.38 ? 432 ASP A OD2 1 
ATOM   2718 N  N   . GLN B 1 433 ? 35.040 39.185 19.086 1.00 25.50 ? 433 GLN A N   1 
ATOM   2719 C  CA  . GLN B 1 433 ? 34.634 37.794 19.296 1.00 24.76 ? 433 GLN A CA  1 
ATOM   2720 C  C   . GLN B 1 433 ? 34.627 37.011 17.971 1.00 24.52 ? 433 GLN A C   1 
ATOM   2721 O  O   . GLN B 1 433 ? 34.517 35.802 17.974 1.00 24.34 ? 433 GLN A O   1 
ATOM   2722 C  CB  . GLN B 1 433 ? 33.264 37.730 19.991 1.00 24.24 ? 433 GLN A CB  1 
ATOM   2723 C  CG  . GLN B 1 433 ? 33.234 38.277 21.456 1.00 24.61 ? 433 GLN A CG  1 
ATOM   2724 C  CD  . GLN B 1 433 ? 33.966 37.405 22.426 1.00 27.54 ? 433 GLN A CD  1 
ATOM   2725 O  OE1 . GLN B 1 433 ? 34.338 36.276 22.101 1.00 27.11 ? 433 GLN A OE1 1 
ATOM   2726 N  NE2 . GLN B 1 433 ? 34.170 37.906 23.646 1.00 30.92 ? 433 GLN A NE2 1 
ATOM   2727 N  N   . ARG B 1 434 ? 34.763 37.707 16.851 1.00 23.95 ? 434 ARG A N   1 
ATOM   2728 C  CA  . ARG B 1 434 ? 34.688 37.078 15.532 1.00 24.66 ? 434 ARG A CA  1 
ATOM   2729 C  C   . ARG B 1 434 ? 35.796 36.051 15.242 1.00 25.31 ? 434 ARG A C   1 
ATOM   2730 O  O   . ARG B 1 434 ? 35.514 34.985 14.702 1.00 25.21 ? 434 ARG A O   1 
ATOM   2731 C  CB  . ARG B 1 434 ? 34.636 38.131 14.425 1.00 24.41 ? 434 ARG A CB  1 
ATOM   2732 C  CG  . ARG B 1 434 ? 33.351 38.946 14.476 1.00 24.53 ? 434 ARG A CG  1 
ATOM   2733 C  CD  . ARG B 1 434 ? 33.330 40.094 13.491 1.00 22.33 ? 434 ARG A CD  1 
ATOM   2734 N  NE  . ARG B 1 434 ? 32.230 40.983 13.838 1.00 24.37 ? 434 ARG A NE  1 
ATOM   2735 C  CZ  . ARG B 1 434 ? 32.017 42.176 13.309 1.00 23.95 ? 434 ARG A CZ  1 
ATOM   2736 N  NH1 . ARG B 1 434 ? 32.814 42.642 12.362 1.00 24.87 ? 434 ARG A NH1 1 
ATOM   2737 N  NH2 . ARG B 1 434 ? 30.985 42.886 13.718 1.00 25.06 ? 434 ARG A NH2 1 
ATOM   2738 N  N   . VAL B 1 435 ? 37.041 36.363 15.600 1.00 25.48 ? 435 VAL A N   1 
ATOM   2739 C  CA  . VAL B 1 435 ? 38.138 35.406 15.406 1.00 25.74 ? 435 VAL A CA  1 
ATOM   2740 C  C   . VAL B 1 435 ? 37.996 34.223 16.340 1.00 24.98 ? 435 VAL A C   1 
ATOM   2741 O  O   . VAL B 1 435 ? 38.443 33.130 16.014 1.00 26.70 ? 435 VAL A O   1 
ATOM   2742 C  CB  . VAL B 1 435 ? 39.532 36.031 15.621 1.00 26.01 ? 435 VAL A CB  1 
ATOM   2743 C  CG1 . VAL B 1 435 ? 39.846 37.039 14.527 1.00 27.07 ? 435 VAL A CG1 1 
ATOM   2744 C  CG2 . VAL B 1 435 ? 39.642 36.681 17.032 1.00 26.31 ? 435 VAL A CG2 1 
ATOM   2745 N  N   . LEU B 1 436 ? 37.378 34.445 17.504 1.00 24.25 ? 436 LEU A N   1 
ATOM   2746 C  CA  . LEU B 1 436 ? 37.293 33.447 18.566 1.00 23.59 ? 436 LEU A CA  1 
ATOM   2747 C  C   . LEU B 1 436 ? 36.113 32.477 18.413 1.00 23.56 ? 436 LEU A C   1 
ATOM   2748 O  O   . LEU B 1 436 ? 36.090 31.426 19.047 1.00 23.66 ? 436 LEU A O   1 
ATOM   2749 C  CB  . LEU B 1 436 ? 37.160 34.153 19.923 1.00 23.90 ? 436 LEU A CB  1 
ATOM   2750 C  CG  . LEU B 1 436 ? 38.277 35.101 20.365 1.00 24.62 ? 436 LEU A CG  1 
ATOM   2751 C  CD1 . LEU B 1 436 ? 37.952 35.863 21.675 1.00 27.23 ? 436 LEU A CD1 1 
ATOM   2752 C  CD2 . LEU B 1 436 ? 39.604 34.345 20.526 1.00 21.15 ? 436 LEU A CD2 1 
ATOM   2753 N  N   . THR B 1 437 ? 35.133 32.836 17.589 1.00 21.70 ? 437 THR A N   1 
ATOM   2754 C  CA  . THR B 1 437 ? 33.903 32.067 17.492 1.00 21.86 ? 437 THR A CA  1 
ATOM   2755 C  C   . THR B 1 437 ? 33.935 31.115 16.304 1.00 22.42 ? 437 THR A C   1 
ATOM   2756 O  O   . THR B 1 437 ? 34.096 31.542 15.161 1.00 22.55 ? 437 THR A O   1 
ATOM   2757 C  CB  . THR B 1 437 ? 32.699 32.990 17.393 1.00 21.28 ? 437 THR A CB  1 
ATOM   2758 O  OG1 . THR B 1 437 ? 32.702 33.865 18.524 1.00 19.91 ? 437 THR A OG1 1 
ATOM   2759 C  CG2 . THR B 1 437 ? 31.385 32.195 17.339 1.00 20.19 ? 437 THR A CG2 1 
ATOM   2760 N  N   . PRO B 1 438 ? 33.759 29.817 16.570 1.00 23.33 ? 438 PRO A N   1 
ATOM   2761 C  CA  . PRO B 1 438 ? 33.809 28.833 15.466 1.00 23.31 ? 438 PRO A CA  1 
ATOM   2762 C  C   . PRO B 1 438 ? 32.636 28.979 14.489 1.00 23.27 ? 438 PRO A C   1 
ATOM   2763 O  O   . PRO B 1 438 ? 31.480 29.037 14.899 1.00 23.87 ? 438 PRO A O   1 
ATOM   2764 C  CB  . PRO B 1 438 ? 33.787 27.477 16.202 1.00 22.62 ? 438 PRO A CB  1 
ATOM   2765 C  CG  . PRO B 1 438 ? 33.093 27.779 17.499 1.00 24.60 ? 438 PRO A CG  1 
ATOM   2766 C  CD  . PRO B 1 438 ? 33.557 29.176 17.883 1.00 23.11 ? 438 PRO A CD  1 
ATOM   2767 N  N   . ASN B 1 439 ? 32.934 29.101 13.200 1.00 22.99 ? 439 ASN A N   1 
ATOM   2768 C  CA  . ASN B 1 439 ? 31.891 29.196 12.198 1.00 22.61 ? 439 ASN A CA  1 
ATOM   2769 C  C   . ASN B 1 439 ? 31.547 27.766 11.728 1.00 22.48 ? 439 ASN A C   1 
ATOM   2770 O  O   . ASN B 1 439 ? 31.969 27.316 10.632 1.00 21.69 ? 439 ASN A O   1 
ATOM   2771 C  CB  . ASN B 1 439 ? 32.350 30.119 11.049 1.00 23.01 ? 439 ASN A CB  1 
ATOM   2772 C  CG  . ASN B 1 439 ? 31.191 30.694 10.259 1.00 23.36 ? 439 ASN A CG  1 
ATOM   2773 O  OD1 . ASN B 1 439 ? 30.232 30.000 9.966  1.00 24.44 ? 439 ASN A OD1 1 
ATOM   2774 N  ND2 . ASN B 1 439 ? 31.289 31.964 9.893  1.00 21.35 ? 439 ASN A ND2 1 
ATOM   2775 N  N   . LEU B 1 440 ? 30.777 27.077 12.582 1.00 21.87 ? 440 LEU A N   1 
ATOM   2776 C  CA  . LEU B 1 440 ? 30.434 25.641 12.462 1.00 21.45 ? 440 LEU A CA  1 
ATOM   2777 C  C   . LEU B 1 440 ? 28.977 25.411 12.825 1.00 21.06 ? 440 LEU A C   1 
ATOM   2778 O  O   . LEU B 1 440 ? 28.538 25.851 13.873 1.00 20.86 ? 440 LEU A O   1 
ATOM   2779 C  CB  . LEU B 1 440 ? 31.283 24.818 13.436 1.00 21.49 ? 440 LEU A CB  1 
ATOM   2780 C  CG  . LEU B 1 440 ? 32.808 24.788 13.237 1.00 22.73 ? 440 LEU A CG  1 
ATOM   2781 C  CD1 . LEU B 1 440 ? 33.393 23.916 14.277 1.00 20.58 ? 440 LEU A CD1 1 
ATOM   2782 C  CD2 . LEU B 1 440 ? 33.172 24.292 11.815 1.00 21.64 ? 440 LEU A CD2 1 
ATOM   2783 N  N   . VAL B 1 441 ? 28.219 24.745 11.954 1.00 21.44 ? 441 VAL A N   1 
ATOM   2784 C  CA  . VAL B 1 441 ? 26.855 24.298 12.303 1.00 20.72 ? 441 VAL A CA  1 
ATOM   2785 C  C   . VAL B 1 441 ? 26.819 22.771 12.244 1.00 21.03 ? 441 VAL A C   1 
ATOM   2786 O  O   . VAL B 1 441 ? 27.125 22.171 11.193 1.00 20.74 ? 441 VAL A O   1 
ATOM   2787 C  CB  . VAL B 1 441 ? 25.773 24.913 11.385 1.00 20.78 ? 441 VAL A CB  1 
ATOM   2788 C  CG1 . VAL B 1 441 ? 24.364 24.331 11.689 1.00 19.72 ? 441 VAL A CG1 1 
ATOM   2789 C  CG2 . VAL B 1 441 ? 25.766 26.443 11.515 1.00 20.66 ? 441 VAL A CG2 1 
ATOM   2790 N  N   . ALA B 1 442 ? 26.441 22.157 13.363 1.00 20.44 ? 442 ALA A N   1 
ATOM   2791 C  CA  . ALA B 1 442 ? 26.488 20.691 13.523 1.00 21.21 ? 442 ALA A CA  1 
ATOM   2792 C  C   . ALA B 1 442 ? 25.800 19.907 12.388 1.00 21.16 ? 442 ALA A C   1 
ATOM   2793 O  O   . ALA B 1 442 ? 24.801 20.346 11.836 1.00 20.10 ? 442 ALA A O   1 
ATOM   2794 C  CB  . ALA B 1 442 ? 25.874 20.283 14.877 1.00 19.61 ? 442 ALA A CB  1 
ATOM   2795 N  N   . ALA B 1 443 ? 26.354 18.744 12.034 1.00 22.37 ? 443 ALA A N   1 
ATOM   2796 C  CA  . ALA B 1 443 ? 25.640 17.804 11.144 1.00 22.16 ? 443 ALA A CA  1 
ATOM   2797 C  C   . ALA B 1 443 ? 26.071 16.393 11.506 1.00 23.15 ? 443 ALA A C   1 
ATOM   2798 O  O   . ALA B 1 443 ? 27.176 16.201 12.032 1.00 22.43 ? 443 ALA A O   1 
ATOM   2799 C  CB  . ALA B 1 443 ? 25.963 18.083 9.691  1.00 21.31 ? 443 ALA A CB  1 
ATOM   2800 N  N   . LEU B 1 444 ? 25.204 15.422 11.225 1.00 23.98 ? 444 LEU A N   1 
ATOM   2801 C  CA  . LEU B 1 444 ? 25.541 13.995 11.322 1.00 26.25 ? 444 LEU A CA  1 
ATOM   2802 C  C   . LEU B 1 444 ? 26.603 13.612 10.300 1.00 27.64 ? 444 LEU A C   1 
ATOM   2803 O  O   . LEU B 1 444 ? 26.684 14.243 9.248  1.00 26.20 ? 444 LEU A O   1 
ATOM   2804 C  CB  . LEU B 1 444 ? 24.289 13.130 11.061 1.00 26.22 ? 444 LEU A CB  1 
ATOM   2805 C  CG  . LEU B 1 444 ? 23.171 13.111 12.100 1.00 28.50 ? 444 LEU A CG  1 
ATOM   2806 C  CD1 . LEU B 1 444 ? 21.911 12.612 11.420 1.00 31.15 ? 444 LEU A CD1 1 
ATOM   2807 C  CD2 . LEU B 1 444 ? 23.509 12.239 13.351 1.00 29.81 ? 444 LEU A CD2 1 
ATOM   2808 N  N   . PRO B 1 445 ? 27.398 12.554 10.591 1.00 29.85 ? 445 PRO A N   1 
ATOM   2809 C  CA  . PRO B 1 445 ? 28.404 12.076 9.643  1.00 31.89 ? 445 PRO A CA  1 
ATOM   2810 C  C   . PRO B 1 445 ? 27.736 11.440 8.425  1.00 33.64 ? 445 PRO A C   1 
ATOM   2811 O  O   . PRO B 1 445 ? 26.680 10.834 8.567  1.00 32.99 ? 445 PRO A O   1 
ATOM   2812 C  CB  . PRO B 1 445 ? 29.158 10.988 10.432 1.00 31.91 ? 445 PRO A CB  1 
ATOM   2813 C  CG  . PRO B 1 445 ? 28.213 10.526 11.460 1.00 32.18 ? 445 PRO A CG  1 
ATOM   2814 C  CD  . PRO B 1 445 ? 27.346 11.723 11.811 1.00 30.21 ? 445 PRO A CD  1 
ATOM   2815 N  N   . PRO B 1 446 ? 28.342 11.594 7.236  1.00 36.27 ? 446 PRO A N   1 
ATOM   2816 C  CA  . PRO B 1 446 ? 27.795 10.993 6.022  1.00 38.78 ? 446 PRO A CA  1 
ATOM   2817 C  C   . PRO B 1 446 ? 27.934 9.474  6.005  1.00 41.87 ? 446 PRO A C   1 
ATOM   2818 O  O   . PRO B 1 446 ? 28.694 8.901  6.789  1.00 41.73 ? 446 PRO A O   1 
ATOM   2819 C  CB  . PRO B 1 446 ? 28.631 11.617 4.895  1.00 38.27 ? 446 PRO A CB  1 
ATOM   2820 C  CG  . PRO B 1 446 ? 29.886 12.028 5.529  1.00 37.72 ? 446 PRO A CG  1 
ATOM   2821 C  CD  . PRO B 1 446 ? 29.584 12.340 6.972  1.00 36.28 ? 446 PRO A CD  1 
ATOM   2822 N  N   . SER B 1 447 ? 27.175 8.850  5.108  1.00 45.21 ? 447 SER A N   1 
ATOM   2823 C  CA  . SER B 1 447 ? 27.181 7.410  4.876  1.00 48.55 ? 447 SER A CA  1 
ATOM   2824 C  C   . SER B 1 447 ? 28.567 6.923  4.429  1.00 50.26 ? 447 SER A C   1 
ATOM   2825 O  O   . SER B 1 447 ? 28.937 5.767  4.662  1.00 50.66 ? 447 SER A O   1 
ATOM   2826 C  CB  . SER B 1 447 ? 26.135 7.085  3.800  1.00 48.31 ? 447 SER A CB  1 
ATOM   2827 O  OG  . SER B 1 447 ? 25.784 5.716  3.813  1.00 50.53 ? 447 SER A OG  1 
ATOM   2828 N  N   . THR B 1 448 ? 29.318 7.818  3.789  1.00 52.63 ? 448 THR A N   1 
ATOM   2829 C  CA  . THR B 1 448 ? 30.664 7.530  3.286  1.00 55.00 ? 448 THR A CA  1 
ATOM   2830 C  C   . THR B 1 448 ? 31.694 7.286  4.405  1.00 56.15 ? 448 THR A C   1 
ATOM   2831 O  O   . THR B 1 448 ? 32.627 6.497  4.227  1.00 56.96 ? 448 THR A O   1 
ATOM   2832 C  CB  . THR B 1 448 ? 31.176 8.639  2.308  1.00 55.03 ? 448 THR A CB  1 
ATOM   2833 O  OG1 . THR B 1 448 ? 31.820 9.696  3.035  1.00 56.22 ? 448 THR A OG1 1 
ATOM   2834 C  CG2 . THR B 1 448 ? 30.031 9.216  1.480  1.00 55.47 ? 448 THR A CG2 1 
ATOM   2835 N  N   . HIS B 1 449 ? 31.522 7.964  5.543  1.00 57.56 ? 449 HIS A N   1 
ATOM   2836 C  CA  . HIS B 1 449 ? 32.393 7.785  6.715  1.00 58.61 ? 449 HIS A CA  1 
ATOM   2837 C  C   . HIS B 1 449 ? 32.244 6.384  7.309  1.00 58.79 ? 449 HIS A C   1 
ATOM   2838 O  O   . HIS B 1 449 ? 31.228 6.069  7.938  1.00 59.67 ? 449 HIS A O   1 
ATOM   2839 C  CB  . HIS B 1 449 ? 32.103 8.849  7.783  1.00 58.79 ? 449 HIS A CB  1 
ATOM   2840 C  CG  . HIS B 1 449 ? 32.864 8.650  9.063  1.00 60.36 ? 449 HIS A CG  1 
ATOM   2841 N  ND1 . HIS B 1 449 ? 34.208 8.945  9.185  1.00 61.72 ? 449 HIS A ND1 1 
ATOM   2842 C  CD2 . HIS B 1 449 ? 32.468 8.198  10.279 1.00 61.48 ? 449 HIS A CD2 1 
ATOM   2843 C  CE1 . HIS B 1 449 ? 34.607 8.681  10.419 1.00 61.79 ? 449 HIS A CE1 1 
ATOM   2844 N  NE2 . HIS B 1 449 ? 33.570 8.229  11.104 1.00 61.98 ? 449 HIS A NE2 1 
ATOM   2845 N  N   . TRP B 1 453 ? 41.677 5.500  7.732  1.00 44.56 ? 453 TRP A N   1 
ATOM   2846 C  CA  . TRP B 1 453 ? 42.200 6.496  8.675  1.00 44.38 ? 453 TRP A CA  1 
ATOM   2847 C  C   . TRP B 1 453 ? 42.426 7.849  8.007  1.00 43.24 ? 453 TRP A C   1 
ATOM   2848 O  O   . TRP B 1 453 ? 42.907 7.908  6.875  1.00 43.52 ? 453 TRP A O   1 
ATOM   2849 C  CB  . TRP B 1 453 ? 43.504 6.014  9.325  1.00 45.36 ? 453 TRP A CB  1 
ATOM   2850 C  CG  . TRP B 1 453 ? 43.987 6.939  10.415 1.00 46.44 ? 453 TRP A CG  1 
ATOM   2851 C  CD1 . TRP B 1 453 ? 43.633 6.912  11.740 1.00 47.13 ? 453 TRP A CD1 1 
ATOM   2852 C  CD2 . TRP B 1 453 ? 44.886 8.053  10.261 1.00 47.33 ? 453 TRP A CD2 1 
ATOM   2853 N  NE1 . TRP B 1 453 ? 44.269 7.940  12.420 1.00 48.31 ? 453 TRP A NE1 1 
ATOM   2854 C  CE2 . TRP B 1 453 ? 45.041 8.649  11.534 1.00 47.41 ? 453 TRP A CE2 1 
ATOM   2855 C  CE3 . TRP B 1 453 ? 45.570 8.606  9.168  1.00 47.12 ? 453 TRP A CE3 1 
ATOM   2856 C  CZ2 . TRP B 1 453 ? 45.859 9.768  11.742 1.00 46.89 ? 453 TRP A CZ2 1 
ATOM   2857 C  CZ3 . TRP B 1 453 ? 46.386 9.718  9.380  1.00 46.99 ? 453 TRP A CZ3 1 
ATOM   2858 C  CH2 . TRP B 1 453 ? 46.514 10.287 10.654 1.00 46.10 ? 453 TRP A CH2 1 
ATOM   2859 N  N   . GLN B 1 454 ? 42.076 8.925  8.722  1.00 41.87 ? 454 GLN A N   1 
ATOM   2860 C  CA  . GLN B 1 454 ? 42.210 10.312 8.220  1.00 39.77 ? 454 GLN A CA  1 
ATOM   2861 C  C   . GLN B 1 454 ? 42.750 11.250 9.300  1.00 37.11 ? 454 GLN A C   1 
ATOM   2862 O  O   . GLN B 1 454 ? 42.589 10.992 10.486 1.00 36.61 ? 454 GLN A O   1 
ATOM   2863 C  CB  . GLN B 1 454 ? 40.875 10.831 7.648  1.00 40.55 ? 454 GLN A CB  1 
ATOM   2864 C  CG  . GLN B 1 454 ? 40.466 12.254 8.096  1.00 43.36 ? 454 GLN A CG  1 
ATOM   2865 C  CD  . GLN B 1 454 ? 39.918 13.132 6.964  1.00 48.26 ? 454 GLN A CD  1 
ATOM   2866 O  OE1 . GLN B 1 454 ? 38.933 12.784 6.305  1.00 50.92 ? 454 GLN A OE1 1 
ATOM   2867 N  NE2 . GLN B 1 454 ? 40.550 14.286 6.749  1.00 47.97 ? 454 GLN A NE2 1 
ATOM   2868 N  N   . LEU B 1 455 ? 43.401 12.329 8.874  1.00 34.05 ? 455 LEU A N   1 
ATOM   2869 C  CA  . LEU B 1 455 ? 43.981 13.285 9.810  1.00 31.06 ? 455 LEU A CA  1 
ATOM   2870 C  C   . LEU B 1 455 ? 42.973 14.333 10.269 1.00 29.23 ? 455 LEU A C   1 
ATOM   2871 O  O   . LEU B 1 455 ? 42.520 15.167 9.490  1.00 29.08 ? 455 LEU A O   1 
ATOM   2872 C  CB  . LEU B 1 455 ? 45.220 13.968 9.207  1.00 30.84 ? 455 LEU A CB  1 
ATOM   2873 C  CG  . LEU B 1 455 ? 45.913 15.064 10.032 1.00 29.93 ? 455 LEU A CG  1 
ATOM   2874 C  CD1 . LEU B 1 455 ? 46.311 14.563 11.401 1.00 30.35 ? 455 LEU A CD1 1 
ATOM   2875 C  CD2 . LEU B 1 455 ? 47.120 15.550 9.287  1.00 30.64 ? 455 LEU A CD2 1 
ATOM   2876 N  N   . PHE B 1 456 ? 42.657 14.311 11.551 1.00 27.60 ? 456 PHE A N   1 
ATOM   2877 C  CA  . PHE B 1 456 ? 41.768 15.313 12.111 1.00 26.60 ? 456 PHE A CA  1 
ATOM   2878 C  C   . PHE B 1 456 ? 42.604 16.327 12.879 1.00 25.20 ? 456 PHE A C   1 
ATOM   2879 O  O   . PHE B 1 456 ? 43.366 15.935 13.758 1.00 23.41 ? 456 PHE A O   1 
ATOM   2880 C  CB  . PHE B 1 456 ? 40.798 14.679 13.093 1.00 27.28 ? 456 PHE A CB  1 
ATOM   2881 C  CG  . PHE B 1 456 ? 39.774 13.776 12.464 1.00 30.44 ? 456 PHE A CG  1 
ATOM   2882 C  CD1 . PHE B 1 456 ? 38.743 14.301 11.690 1.00 31.78 ? 456 PHE A CD1 1 
ATOM   2883 C  CD2 . PHE B 1 456 ? 39.811 12.403 12.694 1.00 30.57 ? 456 PHE A CD2 1 
ATOM   2884 C  CE1 . PHE B 1 456 ? 37.758 13.461 11.124 1.00 33.54 ? 456 PHE A CE1 1 
ATOM   2885 C  CE2 . PHE B 1 456 ? 38.844 11.556 12.127 1.00 33.69 ? 456 PHE A CE2 1 
ATOM   2886 C  CZ  . PHE B 1 456 ? 37.812 12.093 11.341 1.00 32.17 ? 456 PHE A CZ  1 
ATOM   2887 N  N   . CYS B 1 457 ? 42.415 17.611 12.572 1.00 23.58 ? 457 CYS A N   1 
ATOM   2888 C  CA  . CYS B 1 457 ? 43.026 18.719 13.342 1.00 23.78 ? 457 CYS A CA  1 
ATOM   2889 C  C   . CYS B 1 457 ? 41.966 19.739 13.726 1.00 23.02 ? 457 CYS A C   1 
ATOM   2890 O  O   . CYS B 1 457 ? 40.937 19.858 13.044 1.00 22.81 ? 457 CYS A O   1 
ATOM   2891 C  CB  . CYS B 1 457 ? 44.118 19.410 12.527 1.00 23.51 ? 457 CYS A CB  1 
ATOM   2892 S  SG  . CYS B 1 457 ? 45.569 18.400 12.175 1.00 26.48 ? 457 CYS A SG  1 
ATOM   2893 N  N   . ARG B 1 458 ? 42.195 20.432 14.842 1.00 22.51 ? 458 ARG A N   1 
ATOM   2894 C  CA  . ARG B 1 458 ? 41.331 21.508 15.306 1.00 22.42 ? 458 ARG A CA  1 
ATOM   2895 C  C   . ARG B 1 458 ? 42.183 22.653 15.839 1.00 23.03 ? 458 ARG A C   1 
ATOM   2896 O  O   . ARG B 1 458 ? 43.340 22.443 16.294 1.00 22.08 ? 458 ARG A O   1 
ATOM   2897 C  CB  . ARG B 1 458 ? 40.357 21.040 16.401 1.00 22.32 ? 458 ARG A CB  1 
ATOM   2898 C  CG  . ARG B 1 458 ? 41.040 20.600 17.720 1.00 22.84 ? 458 ARG A CG  1 
ATOM   2899 C  CD  . ARG B 1 458 ? 40.052 20.189 18.764 1.00 22.40 ? 458 ARG A CD  1 
ATOM   2900 N  NE  . ARG B 1 458 ? 40.771 19.811 19.976 1.00 25.18 ? 458 ARG A NE  1 
ATOM   2901 C  CZ  . ARG B 1 458 ? 40.625 20.395 21.161 1.00 25.84 ? 458 ARG A CZ  1 
ATOM   2902 N  NH1 . ARG B 1 458 ? 39.753 21.377 21.330 1.00 23.52 ? 458 ARG A NH1 1 
ATOM   2903 N  NH2 . ARG B 1 458 ? 41.346 19.965 22.195 1.00 29.13 ? 458 ARG A NH2 1 
ATOM   2904 N  N   . THR B 1 459 ? 41.611 23.855 15.776 1.00 22.09 ? 459 THR A N   1 
ATOM   2905 C  CA  . THR B 1 459 ? 42.263 25.050 16.296 1.00 23.03 ? 459 THR A CA  1 
ATOM   2906 C  C   . THR B 1 459 ? 41.758 25.333 17.705 1.00 22.97 ? 459 THR A C   1 
ATOM   2907 O  O   . THR B 1 459 ? 40.539 25.406 17.926 1.00 22.21 ? 459 THR A O   1 
ATOM   2908 C  CB  . THR B 1 459 ? 41.925 26.264 15.438 1.00 22.61 ? 459 THR A CB  1 
ATOM   2909 O  OG1 . THR B 1 459 ? 42.432 26.073 14.115 1.00 24.41 ? 459 THR A OG1 1 
ATOM   2910 C  CG2 . THR B 1 459 ? 42.523 27.565 16.050 1.00 22.72 ? 459 THR A CG2 1 
ATOM   2911 N  N   . VAL B 1 460 ? 42.700 25.535 18.626 1.00 23.40 ? 460 VAL A N   1 
ATOM   2912 C  CA  . VAL B 1 460 ? 42.430 25.841 20.030 1.00 23.31 ? 460 VAL A CA  1 
ATOM   2913 C  C   . VAL B 1 460 ? 42.981 27.256 20.386 1.00 23.99 ? 460 VAL A C   1 
ATOM   2914 O  O   . VAL B 1 460 ? 44.207 27.470 20.352 1.00 23.83 ? 460 VAL A O   1 
ATOM   2915 C  CB  . VAL B 1 460 ? 43.081 24.784 20.978 1.00 23.69 ? 460 VAL A CB  1 
ATOM   2916 C  CG1 . VAL B 1 460 ? 42.784 25.111 22.432 1.00 23.52 ? 460 VAL A CG1 1 
ATOM   2917 C  CG2 . VAL B 1 460 ? 42.597 23.353 20.667 1.00 23.65 ? 460 VAL A CG2 1 
ATOM   2918 N  N   . TRP B 1 461 ? 42.093 28.203 20.711 1.00 23.62 ? 461 TRP A N   1 
ATOM   2919 C  CA  . TRP B 1 461 ? 42.525 29.534 21.168 1.00 24.86 ? 461 TRP A CA  1 
ATOM   2920 C  C   . TRP B 1 461 ? 42.654 29.512 22.652 1.00 25.01 ? 461 TRP A C   1 
ATOM   2921 O  O   . TRP B 1 461 ? 41.793 28.979 23.343 1.00 25.86 ? 461 TRP A O   1 
ATOM   2922 C  CB  . TRP B 1 461 ? 41.512 30.631 20.816 1.00 24.29 ? 461 TRP A CB  1 
ATOM   2923 C  CG  . TRP B 1 461 ? 41.487 30.974 19.376 1.00 24.09 ? 461 TRP A CG  1 
ATOM   2924 C  CD1 . TRP B 1 461 ? 41.050 30.175 18.356 1.00 22.91 ? 461 TRP A CD1 1 
ATOM   2925 C  CD2 . TRP B 1 461 ? 41.937 32.180 18.777 1.00 23.67 ? 461 TRP A CD2 1 
ATOM   2926 N  NE1 . TRP B 1 461 ? 41.190 30.816 17.162 1.00 22.33 ? 461 TRP A NE1 1 
ATOM   2927 C  CE2 . TRP B 1 461 ? 41.743 32.049 17.386 1.00 22.33 ? 461 TRP A CE2 1 
ATOM   2928 C  CE3 . TRP B 1 461 ? 42.498 33.368 19.278 1.00 25.12 ? 461 TRP A CE3 1 
ATOM   2929 C  CZ2 . TRP B 1 461 ? 42.068 33.057 16.487 1.00 23.71 ? 461 TRP A CZ2 1 
ATOM   2930 C  CZ3 . TRP B 1 461 ? 42.812 34.373 18.388 1.00 22.80 ? 461 TRP A CZ3 1 
ATOM   2931 C  CH2 . TRP B 1 461 ? 42.608 34.212 17.002 1.00 23.46 ? 461 TRP A CH2 1 
ATOM   2932 N  N   . SER B 1 462 ? 43.710 30.127 23.165 1.00 26.39 ? 462 SER A N   1 
ATOM   2933 C  CA  . SER B 1 462 ? 43.886 30.207 24.609 1.00 27.14 ? 462 SER A CA  1 
ATOM   2934 C  C   . SER B 1 462 ? 43.009 31.334 25.142 1.00 27.98 ? 462 SER A C   1 
ATOM   2935 O  O   . SER B 1 462 ? 42.536 32.172 24.380 1.00 27.16 ? 462 SER A O   1 
ATOM   2936 C  CB  . SER B 1 462 ? 45.328 30.572 24.927 1.00 27.81 ? 462 SER A CB  1 
ATOM   2937 O  OG  . SER B 1 462 ? 45.545 31.929 24.604 1.00 27.07 ? 462 SER A OG  1 
ATOM   2938 N  N   . ALA B 1 463 ? 42.837 31.359 26.459 1.00 29.71 ? 463 ALA A N   1 
ATOM   2939 C  CA  . ALA B 1 463 ? 42.404 32.577 27.147 1.00 31.32 ? 463 ALA A CA  1 
ATOM   2940 C  C   . ALA B 1 463 ? 43.406 33.677 26.854 1.00 32.47 ? 463 ALA A C   1 
ATOM   2941 O  O   . ALA B 1 463 ? 44.596 33.399 26.713 1.00 33.99 ? 463 ALA A O   1 
ATOM   2942 C  CB  . ALA B 1 463 ? 42.334 32.331 28.645 1.00 31.18 ? 463 ALA A CB  1 
ATOM   2943 N  N   . HIS B 1 464 ? 42.931 34.914 26.739 1.00 33.91 ? 464 HIS A N   1 
ATOM   2944 C  CA  . HIS B 1 464 ? 43.800 36.099 26.673 1.00 34.34 ? 464 HIS A CA  1 
ATOM   2945 C  C   . HIS B 1 464 ? 44.809 36.088 27.837 1.00 34.49 ? 464 HIS A C   1 
ATOM   2946 O  O   . HIS B 1 464 ? 44.450 35.759 28.968 1.00 34.79 ? 464 HIS A O   1 
ATOM   2947 C  CB  . HIS B 1 464 ? 42.945 37.370 26.738 1.00 34.36 ? 464 HIS A CB  1 
ATOM   2948 C  CG  . HIS B 1 464 ? 43.591 38.570 26.116 1.00 34.99 ? 464 HIS A CG  1 
ATOM   2949 N  ND1 . HIS B 1 464 ? 44.017 39.653 26.854 1.00 34.21 ? 464 HIS A ND1 1 
ATOM   2950 C  CD2 . HIS B 1 464 ? 43.905 38.846 24.825 1.00 36.09 ? 464 HIS A CD2 1 
ATOM   2951 C  CE1 . HIS B 1 464 ? 44.554 40.548 26.043 1.00 34.96 ? 464 HIS A CE1 1 
ATOM   2952 N  NE2 . HIS B 1 464 ? 44.497 40.083 24.807 1.00 35.70 ? 464 HIS A NE2 1 
ATOM   2953 N  N   . SER B 1 465 ? 46.060 36.434 27.555 1.00 35.14 ? 465 SER A N   1 
ATOM   2954 C  CA  . SER B 1 465 ? 47.144 36.425 28.558 1.00 35.79 ? 465 SER A CA  1 
ATOM   2955 C  C   . SER B 1 465 ? 47.007 37.474 29.662 1.00 36.52 ? 465 SER A C   1 
ATOM   2956 O  O   . SER B 1 465 ? 47.547 37.314 30.772 1.00 36.54 ? 465 SER A O   1 
ATOM   2957 C  CB  . SER B 1 465 ? 48.499 36.630 27.873 1.00 35.25 ? 465 SER A CB  1 
ATOM   2958 O  OG  . SER B 1 465 ? 48.544 37.909 27.282 1.00 35.55 ? 465 SER A OG  1 
ATOM   2959 N  N   . GLY B 1 466 ? 46.315 38.563 29.351 1.00 37.37 ? 466 GLY A N   1 
ATOM   2960 C  CA  . GLY B 1 466 ? 46.239 39.695 30.275 1.00 38.24 ? 466 GLY A CA  1 
ATOM   2961 C  C   . GLY B 1 466 ? 47.439 40.583 29.992 1.00 38.97 ? 466 GLY A C   1 
ATOM   2962 O  O   . GLY B 1 466 ? 48.354 40.166 29.273 1.00 38.55 ? 466 GLY A O   1 
ATOM   2963 N  N   . PRO B 1 467 ? 47.441 41.812 30.552 1.00 39.50 ? 467 PRO A N   1 
ATOM   2964 C  CA  . PRO B 1 467 ? 48.414 42.852 30.197 1.00 39.90 ? 467 PRO A CA  1 
ATOM   2965 C  C   . PRO B 1 467 ? 49.800 42.781 30.862 1.00 40.49 ? 467 PRO A C   1 
ATOM   2966 O  O   . PRO B 1 467 ? 50.664 43.604 30.532 1.00 40.55 ? 467 PRO A O   1 
ATOM   2967 C  CB  . PRO B 1 467 ? 47.696 44.141 30.614 1.00 40.04 ? 467 PRO A CB  1 
ATOM   2968 C  CG  . PRO B 1 467 ? 46.867 43.734 31.800 1.00 39.55 ? 467 PRO A CG  1 
ATOM   2969 C  CD  . PRO B 1 467 ? 46.462 42.289 31.551 1.00 39.69 ? 467 PRO A CD  1 
ATOM   2970 N  N   . THR B 1 468 ? 50.030 41.835 31.772 1.00 41.38 ? 468 THR A N   1 
ATOM   2971 C  CA  . THR B 1 468 ? 51.322 41.810 32.473 1.00 42.90 ? 468 THR A CA  1 
ATOM   2972 C  C   . THR B 1 468 ? 52.515 41.746 31.511 1.00 43.69 ? 468 THR A C   1 
ATOM   2973 O  O   . THR B 1 468 ? 52.443 41.122 30.439 1.00 43.45 ? 468 THR A O   1 
ATOM   2974 C  CB  . THR B 1 468 ? 51.436 40.726 33.572 1.00 42.90 ? 468 THR A CB  1 
ATOM   2975 O  OG1 . THR B 1 468 ? 51.356 39.417 32.986 1.00 44.16 ? 468 THR A OG1 1 
ATOM   2976 C  CG2 . THR B 1 468 ? 50.367 40.913 34.649 1.00 42.64 ? 468 THR A CG2 1 
ATOM   2977 N  N   . ARG B 1 469 ? 53.595 42.426 31.902 1.00 44.86 ? 469 ARG A N   1 
ATOM   2978 C  CA  . ARG B 1 469 ? 54.759 42.680 31.029 1.00 45.88 ? 469 ARG A CA  1 
ATOM   2979 C  C   . ARG B 1 469 ? 55.482 41.399 30.607 1.00 46.04 ? 469 ARG A C   1 
ATOM   2980 O  O   . ARG B 1 469 ? 56.169 41.376 29.574 1.00 45.70 ? 469 ARG A O   1 
ATOM   2981 C  CB  . ARG B 1 469 ? 55.738 43.670 31.687 1.00 45.91 ? 469 ARG A CB  1 
ATOM   2982 C  CG  . ARG B 1 469 ? 56.313 43.213 33.032 1.00 46.76 ? 469 ARG A CG  1 
ATOM   2983 C  CD  . ARG B 1 469 ? 56.936 44.377 33.799 1.00 47.32 ? 469 ARG A CD  1 
ATOM   2984 N  NE  . ARG B 1 469 ? 55.916 45.200 34.451 1.00 50.75 ? 469 ARG A NE  1 
ATOM   2985 C  CZ  . ARG B 1 469 ? 56.157 46.286 35.185 1.00 52.51 ? 469 ARG A CZ  1 
ATOM   2986 N  NH1 . ARG B 1 469 ? 57.404 46.719 35.369 1.00 52.15 ? 469 ARG A NH1 1 
ATOM   2987 N  NH2 . ARG B 1 469 ? 55.143 46.947 35.737 1.00 52.71 ? 469 ARG A NH2 1 
ATOM   2988 N  N   . MET B 1 470 ? 55.319 40.350 31.419 1.00 46.06 ? 470 MET A N   1 
ATOM   2989 C  CA  . MET B 1 470 ? 55.849 39.017 31.117 1.00 47.25 ? 470 MET A CA  1 
ATOM   2990 C  C   . MET B 1 470 ? 54.725 37.972 30.976 1.00 45.29 ? 470 MET A C   1 
ATOM   2991 O  O   . MET B 1 470 ? 54.937 36.774 31.226 1.00 45.13 ? 470 MET A O   1 
ATOM   2992 C  CB  . MET B 1 470 ? 56.850 38.584 32.193 1.00 46.77 ? 470 MET A CB  1 
ATOM   2993 C  CG  . MET B 1 470 ? 58.059 39.506 32.332 1.00 49.44 ? 470 MET A CG  1 
ATOM   2994 S  SD  . MET B 1 470 ? 59.376 38.725 33.292 1.00 52.16 ? 470 MET A SD  1 
ATOM   2995 C  CE  . MET B 1 470 ? 60.039 37.573 32.077 1.00 52.49 ? 470 MET A CE  1 
ATOM   2996 N  N   . ALA B 1 471 ? 53.540 38.444 30.582 1.00 43.68 ? 471 ALA A N   1 
ATOM   2997 C  CA  . ALA B 1 471 ? 52.349 37.600 30.444 1.00 42.26 ? 471 ALA A CA  1 
ATOM   2998 C  C   . ALA B 1 471 ? 52.588 36.500 29.426 1.00 41.36 ? 471 ALA A C   1 
ATOM   2999 O  O   . ALA B 1 471 ? 53.225 36.725 28.380 1.00 40.66 ? 471 ALA A O   1 
ATOM   3000 C  CB  . ALA B 1 471 ? 51.133 38.435 30.025 1.00 42.07 ? 471 ALA A CB  1 
ATOM   3001 N  N   . THR B 1 472 ? 52.097 35.308 29.754 1.00 39.95 ? 472 THR A N   1 
ATOM   3002 C  CA  . THR B 1 472 ? 52.084 34.214 28.792 1.00 39.22 ? 472 THR A CA  1 
ATOM   3003 C  C   . THR B 1 472 ? 50.682 33.597 28.716 1.00 38.16 ? 472 THR A C   1 
ATOM   3004 O  O   . THR B 1 472 ? 50.014 33.391 29.748 1.00 38.10 ? 472 THR A O   1 
ATOM   3005 C  CB  . THR B 1 472 ? 53.198 33.130 29.051 1.00 39.12 ? 472 THR A CB  1 
ATOM   3006 O  OG1 . THR B 1 472 ? 52.859 32.318 30.181 1.00 40.07 ? 472 THR A OG1 1 
ATOM   3007 C  CG2 . THR B 1 472 ? 54.576 33.770 29.278 1.00 38.98 ? 472 THR A CG2 1 
ATOM   3008 N  N   . ALA B 1 473 ? 50.242 33.357 27.481 1.00 36.91 ? 473 ALA A N   1 
ATOM   3009 C  CA  . ALA B 1 473 ? 49.045 32.577 27.176 1.00 35.93 ? 473 ALA A CA  1 
ATOM   3010 C  C   . ALA B 1 473 ? 49.444 31.151 26.777 1.00 35.59 ? 473 ALA A C   1 
ATOM   3011 O  O   . ALA B 1 473 ? 50.466 30.953 26.122 1.00 35.33 ? 473 ALA A O   1 
ATOM   3012 C  CB  . ALA B 1 473 ? 48.271 33.241 26.067 1.00 36.04 ? 473 ALA A CB  1 
ATOM   3013 N  N   . ILE B 1 474 ? 48.662 30.166 27.211 1.00 34.56 ? 474 ILE A N   1 
ATOM   3014 C  CA  . ILE B 1 474 ? 48.927 28.760 26.899 1.00 34.66 ? 474 ILE A CA  1 
ATOM   3015 C  C   . ILE B 1 474 ? 47.700 28.133 26.236 1.00 33.85 ? 474 ILE A C   1 
ATOM   3016 O  O   . ILE B 1 474 ? 46.592 28.231 26.761 1.00 33.51 ? 474 ILE A O   1 
ATOM   3017 C  CB  . ILE B 1 474 ? 49.354 27.936 28.154 1.00 34.59 ? 474 ILE A CB  1 
ATOM   3018 C  CG1 . ILE B 1 474 ? 50.638 28.493 28.769 1.00 35.11 ? 474 ILE A CG1 1 
ATOM   3019 C  CG2 . ILE B 1 474 ? 49.584 26.480 27.807 1.00 34.82 ? 474 ILE A CG2 1 
ATOM   3020 C  CD1 . ILE B 1 474 ? 50.946 27.921 30.168 1.00 36.38 ? 474 ILE A CD1 1 
ATOM   3021 N  N   . ALA B 1 475 ? 47.916 27.519 25.070 1.00 32.80 ? 475 ALA A N   1 
ATOM   3022 C  CA  . ALA B 1 475 ? 46.911 26.699 24.406 1.00 31.73 ? 475 ALA A CA  1 
ATOM   3023 C  C   . ALA B 1 475 ? 47.356 25.244 24.486 1.00 32.20 ? 475 ALA A C   1 
ATOM   3024 O  O   . ALA B 1 475 ? 48.468 24.907 24.065 1.00 32.37 ? 475 ALA A O   1 
ATOM   3025 C  CB  . ALA B 1 475 ? 46.733 27.146 22.942 1.00 31.07 ? 475 ALA A CB  1 
ATOM   3026 N  N   . ARG B 1 476 ? 46.512 24.391 25.064 1.00 32.42 ? 476 ARG A N   1 
ATOM   3027 C  CA  . ARG B 1 476 ? 46.825 22.975 25.255 1.00 33.17 ? 476 ARG A CA  1 
ATOM   3028 C  C   . ARG B 1 476 ? 45.936 22.059 24.419 1.00 32.82 ? 476 ARG A C   1 
ATOM   3029 O  O   . ARG B 1 476 ? 44.764 22.350 24.204 1.00 32.27 ? 476 ARG A O   1 
ATOM   3030 C  CB  . ARG B 1 476 ? 46.651 22.561 26.716 1.00 33.14 ? 476 ARG A CB  1 
ATOM   3031 C  CG  . ARG B 1 476 ? 47.563 23.245 27.703 1.00 37.14 ? 476 ARG A CG  1 
ATOM   3032 C  CD  . ARG B 1 476 ? 47.311 22.671 29.089 1.00 40.92 ? 476 ARG A CD  1 
ATOM   3033 N  NE  . ARG B 1 476 ? 48.259 23.192 30.066 1.00 45.07 ? 476 ARG A NE  1 
ATOM   3034 C  CZ  . ARG B 1 476 ? 48.141 24.375 30.662 1.00 45.93 ? 476 ARG A CZ  1 
ATOM   3035 N  NH1 . ARG B 1 476 ? 47.114 25.172 30.381 1.00 46.99 ? 476 ARG A NH1 1 
ATOM   3036 N  NH2 . ARG B 1 476 ? 49.053 24.762 31.539 1.00 46.06 ? 476 ARG A NH2 1 
ATOM   3037 N  N   . CYS B 1 477 ? 46.501 20.932 24.002 1.00 33.20 ? 477 CYS A N   1 
ATOM   3038 C  CA  . CYS B 1 477 ? 45.753 19.868 23.346 1.00 33.87 ? 477 CYS A CA  1 
ATOM   3039 C  C   . CYS B 1 477 ? 45.294 18.826 24.362 1.00 34.85 ? 477 CYS A C   1 
ATOM   3040 O  O   . CYS B 1 477 ? 45.764 18.824 25.499 1.00 34.80 ? 477 CYS A O   1 
ATOM   3041 C  CB  . CYS B 1 477 ? 46.634 19.208 22.292 1.00 33.25 ? 477 CYS A CB  1 
ATOM   3042 S  SG  . CYS B 1 477 ? 47.227 20.358 21.050 1.00 33.67 ? 477 CYS A SG  1 
ATOM   3043 N  N   . ALA B 1 478 ? 44.387 17.940 23.950 1.00 35.74 ? 478 ALA A N   1 
ATOM   3044 C  CA  . ALA B 1 478 ? 43.935 16.838 24.800 1.00 36.75 ? 478 ALA A CA  1 
ATOM   3045 C  C   . ALA B 1 478 ? 45.011 15.750 24.890 1.00 37.31 ? 478 ALA A C   1 
ATOM   3046 O  O   . ALA B 1 478 ? 45.896 15.697 24.035 1.00 37.91 ? 478 ALA A O   1 
ATOM   3047 C  CB  . ALA B 1 478 ? 42.617 16.255 24.257 1.00 37.12 ? 478 ALA A CB  1 
ATOM   3048 N  N   . PRO B 1 479 ? 44.929 14.868 25.908 1.00 38.01 ? 479 PRO A N   1 
ATOM   3049 C  CA  . PRO B 1 479 ? 45.991 13.887 26.157 1.00 38.18 ? 479 PRO A CA  1 
ATOM   3050 C  C   . PRO B 1 479 ? 46.248 12.976 24.969 1.00 38.17 ? 479 PRO A C   1 
ATOM   3051 O  O   . PRO B 1 479 ? 47.394 12.584 24.746 1.00 38.38 ? 479 PRO A O   1 
ATOM   3052 C  CB  . PRO B 1 479 ? 45.458 13.088 27.351 1.00 38.65 ? 479 PRO A CB  1 
ATOM   3053 C  CG  . PRO B 1 479 ? 44.536 14.057 28.049 1.00 38.68 ? 479 PRO A CG  1 
ATOM   3054 C  CD  . PRO B 1 479 ? 43.846 14.743 26.902 1.00 37.99 ? 479 PRO A CD  1 
ATOM   3055 N  N   . ASP B 1 480 ? 45.213 12.662 24.194 1.00 37.59 ? 480 ASP A N   1 
ATOM   3056 C  CA  . ASP B 1 480 ? 45.405 11.814 23.015 1.00 37.24 ? 480 ASP A CA  1 
ATOM   3057 C  C   . ASP B 1 480 ? 45.592 12.579 21.705 1.00 36.41 ? 480 ASP A C   1 
ATOM   3058 O  O   . ASP B 1 480 ? 45.528 11.990 20.617 1.00 36.95 ? 480 ASP A O   1 
ATOM   3059 C  CB  . ASP B 1 480 ? 44.290 10.761 22.879 1.00 37.72 ? 480 ASP A CB  1 
ATOM   3060 C  CG  . ASP B 1 480 ? 42.878 11.345 23.005 1.00 39.52 ? 480 ASP A CG  1 
ATOM   3061 O  OD1 . ASP B 1 480 ? 42.671 12.318 23.772 1.00 41.67 ? 480 ASP A OD1 1 
ATOM   3062 O  OD2 . ASP B 1 480 ? 41.965 10.795 22.334 1.00 40.28 ? 480 ASP A OD2 1 
ATOM   3063 N  N   . GLU B 1 481 ? 45.823 13.884 21.805 1.00 35.33 ? 481 GLU A N   1 
ATOM   3064 C  CA  . GLU B 1 481 ? 46.108 14.720 20.629 1.00 33.60 ? 481 GLU A CA  1 
ATOM   3065 C  C   . GLU B 1 481 ? 47.579 15.122 20.611 1.00 33.33 ? 481 GLU A C   1 
ATOM   3066 O  O   . GLU B 1 481 ? 48.239 15.086 21.644 1.00 33.38 ? 481 GLU A O   1 
ATOM   3067 C  CB  . GLU B 1 481 ? 45.249 15.982 20.646 1.00 33.63 ? 481 GLU A CB  1 
ATOM   3068 C  CG  . GLU B 1 481 ? 43.786 15.764 20.218 1.00 32.45 ? 481 GLU A CG  1 
ATOM   3069 C  CD  . GLU B 1 481 ? 42.927 17.004 20.401 1.00 32.52 ? 481 GLU A CD  1 
ATOM   3070 O  OE1 . GLU B 1 481 ? 41.909 17.143 19.688 1.00 31.87 ? 481 GLU A OE1 1 
ATOM   3071 O  OE2 . GLU B 1 481 ? 43.260 17.840 21.264 1.00 31.96 ? 481 GLU A OE2 1 
ATOM   3072 N  N   . GLU B 1 482 ? 48.078 15.502 19.438 1.00 32.62 ? 482 GLU A N   1 
ATOM   3073 C  CA  . GLU B 1 482 ? 49.427 16.032 19.289 1.00 32.68 ? 482 GLU A CA  1 
ATOM   3074 C  C   . GLU B 1 482 ? 49.308 17.485 18.870 1.00 31.78 ? 482 GLU A C   1 
ATOM   3075 O  O   . GLU B 1 482 ? 48.419 17.855 18.090 1.00 31.67 ? 482 GLU A O   1 
ATOM   3076 C  CB  . GLU B 1 482 ? 50.234 15.260 18.228 1.00 32.51 ? 482 GLU A CB  1 
ATOM   3077 C  CG  . GLU B 1 482 ? 50.345 13.748 18.469 1.00 36.60 ? 482 GLU A CG  1 
ATOM   3078 C  CD  . GLU B 1 482 ? 51.401 13.367 19.510 1.00 41.31 ? 482 GLU A CD  1 
ATOM   3079 O  OE1 . GLU B 1 482 ? 51.125 12.439 20.306 1.00 44.40 ? 482 GLU A OE1 1 
ATOM   3080 O  OE2 . GLU B 1 482 ? 52.490 13.990 19.548 1.00 40.97 ? 482 GLU A OE2 1 
ATOM   3081 N  N   . LEU B 1 483 ? 50.215 18.306 19.385 1.00 30.92 ? 483 LEU A N   1 
ATOM   3082 C  CA  . LEU B 1 483 ? 50.304 19.697 18.996 1.00 29.42 ? 483 LEU A CA  1 
ATOM   3083 C  C   . LEU B 1 483 ? 51.173 19.761 17.767 1.00 28.53 ? 483 LEU A C   1 
ATOM   3084 O  O   . LEU B 1 483 ? 52.371 19.512 17.856 1.00 29.36 ? 483 LEU A O   1 
ATOM   3085 C  CB  . LEU B 1 483 ? 50.914 20.538 20.126 1.00 29.27 ? 483 LEU A CB  1 
ATOM   3086 C  CG  . LEU B 1 483 ? 51.224 22.008 19.830 1.00 29.60 ? 483 LEU A CG  1 
ATOM   3087 C  CD1 . LEU B 1 483 ? 49.953 22.806 19.956 1.00 29.64 ? 483 LEU A CD1 1 
ATOM   3088 C  CD2 . LEU B 1 483 ? 52.277 22.534 20.794 1.00 30.16 ? 483 LEU A CD2 1 
ATOM   3089 N  N   . LEU B 1 484 ? 50.590 20.116 16.626 1.00 26.80 ? 484 LEU A N   1 
ATOM   3090 C  CA  . LEU B 1 484 ? 51.333 20.146 15.370 1.00 26.09 ? 484 LEU A CA  1 
ATOM   3091 C  C   . LEU B 1 484 ? 51.853 21.503 14.965 1.00 25.66 ? 484 LEU A C   1 
ATOM   3092 O  O   . LEU B 1 484 ? 52.793 21.600 14.151 1.00 24.91 ? 484 LEU A O   1 
ATOM   3093 C  CB  . LEU B 1 484 ? 50.541 19.539 14.209 1.00 26.86 ? 484 LEU A CB  1 
ATOM   3094 C  CG  . LEU B 1 484 ? 50.258 18.037 14.273 1.00 27.09 ? 484 LEU A CG  1 
ATOM   3095 C  CD1 . LEU B 1 484 ? 50.162 17.434 12.866 1.00 25.42 ? 484 LEU A CD1 1 
ATOM   3096 C  CD2 . LEU B 1 484 ? 51.267 17.303 15.099 1.00 27.43 ? 484 LEU A CD2 1 
ATOM   3097 N  N   . SER B 1 485 ? 51.252 22.549 15.526 1.00 24.41 ? 485 SER A N   1 
ATOM   3098 C  CA  . SER B 1 485 ? 51.702 23.898 15.273 1.00 25.46 ? 485 SER A CA  1 
ATOM   3099 C  C   . SER B 1 485 ? 51.179 24.851 16.327 1.00 25.19 ? 485 SER A C   1 
ATOM   3100 O  O   . SER B 1 485 ? 50.343 24.497 17.146 1.00 24.86 ? 485 SER A O   1 
ATOM   3101 C  CB  . SER B 1 485 ? 51.284 24.389 13.893 1.00 25.20 ? 485 SER A CB  1 
ATOM   3102 O  OG  . SER B 1 485 ? 49.895 24.725 13.878 1.00 26.80 ? 485 SER A OG  1 
ATOM   3103 N  N   . CYS B 1 486 ? 51.679 26.068 16.271 1.00 27.10 ? 486 CYS A N   1 
ATOM   3104 C  CA  . CYS B 1 486 ? 51.441 27.039 17.317 1.00 27.00 ? 486 CYS A CA  1 
ATOM   3105 C  C   . CYS B 1 486 ? 51.580 28.409 16.697 1.00 26.84 ? 486 CYS A C   1 
ATOM   3106 O  O   . CYS B 1 486 ? 52.593 28.714 16.051 1.00 26.61 ? 486 CYS A O   1 
ATOM   3107 C  CB  . CYS B 1 486 ? 52.447 26.808 18.448 1.00 27.60 ? 486 CYS A CB  1 
ATOM   3108 S  SG  . CYS B 1 486 ? 52.458 28.021 19.818 1.00 31.18 ? 486 CYS A SG  1 
ATOM   3109 N  N   . SER B 1 487 ? 50.539 29.228 16.830 1.00 26.64 ? 487 SER A N   1 
ATOM   3110 C  CA  . SER B 1 487 ? 50.617 30.596 16.362 1.00 27.05 ? 487 SER A CA  1 
ATOM   3111 C  C   . SER B 1 487 ? 50.107 31.530 17.459 1.00 26.98 ? 487 SER A C   1 
ATOM   3112 O  O   . SER B 1 487 ? 49.818 31.088 18.577 1.00 26.00 ? 487 SER A O   1 
ATOM   3113 C  CB  . SER B 1 487 ? 49.921 30.807 14.995 1.00 27.69 ? 487 SER A CB  1 
ATOM   3114 O  OG  . SER B 1 487 ? 48.495 30.758 15.082 1.00 30.92 ? 487 SER A OG  1 
ATOM   3115 N  N   . SER B 1 488 ? 50.061 32.818 17.163 1.00 27.35 ? 488 SER A N   1 
ATOM   3116 C  CA  . SER B 1 488 ? 49.621 33.799 18.167 1.00 28.79 ? 488 SER A CA  1 
ATOM   3117 C  C   . SER B 1 488 ? 48.997 35.006 17.521 1.00 28.91 ? 488 SER A C   1 
ATOM   3118 O  O   . SER B 1 488 ? 49.138 35.217 16.316 1.00 29.40 ? 488 SER A O   1 
ATOM   3119 C  CB  . SER B 1 488 ? 50.775 34.218 19.092 1.00 28.09 ? 488 SER A CB  1 
ATOM   3120 O  OG  . SER B 1 488 ? 51.780 34.882 18.354 1.00 29.54 ? 488 SER A OG  1 
ATOM   3121 N  N   . PHE B 1 489 ? 48.294 35.795 18.329 1.00 30.61 ? 489 PHE A N   1 
ATOM   3122 C  CA  . PHE B 1 489 ? 47.514 36.924 17.824 1.00 32.12 ? 489 PHE A CA  1 
ATOM   3123 C  C   . PHE B 1 489 ? 47.369 37.991 18.901 1.00 32.70 ? 489 PHE A C   1 
ATOM   3124 O  O   . PHE B 1 489 ? 47.206 37.692 20.085 1.00 32.85 ? 489 PHE A O   1 
ATOM   3125 C  CB  . PHE B 1 489 ? 46.140 36.438 17.333 1.00 32.24 ? 489 PHE A CB  1 
ATOM   3126 C  CG  . PHE B 1 489 ? 45.240 37.521 16.799 1.00 32.25 ? 489 PHE A CG  1 
ATOM   3127 C  CD1 . PHE B 1 489 ? 45.428 38.039 15.517 1.00 33.21 ? 489 PHE A CD1 1 
ATOM   3128 C  CD2 . PHE B 1 489 ? 44.180 38.004 17.564 1.00 32.47 ? 489 PHE A CD2 1 
ATOM   3129 C  CE1 . PHE B 1 489 ? 44.583 39.034 15.011 1.00 34.58 ? 489 PHE A CE1 1 
ATOM   3130 C  CE2 . PHE B 1 489 ? 43.318 39.000 17.063 1.00 31.78 ? 489 PHE A CE2 1 
ATOM   3131 C  CZ  . PHE B 1 489 ? 43.516 39.506 15.779 1.00 32.74 ? 489 PHE A CZ  1 
ATOM   3132 N  N   . SER B 1 490 ? 47.474 39.232 18.460 1.00 34.94 ? 490 SER A N   1 
ATOM   3133 C  CA  . SER B 1 490 ? 47.222 40.408 19.280 1.00 37.24 ? 490 SER A CA  1 
ATOM   3134 C  C   . SER B 1 490 ? 46.511 41.419 18.394 1.00 38.34 ? 490 SER A C   1 
ATOM   3135 O  O   . SER B 1 490 ? 46.927 41.654 17.271 1.00 38.69 ? 490 SER A O   1 
ATOM   3136 C  CB  . SER B 1 490 ? 48.535 40.991 19.799 1.00 37.42 ? 490 SER A CB  1 
ATOM   3137 O  OG  . SER B 1 490 ? 48.320 42.245 20.431 1.00 40.29 ? 490 SER A OG  1 
ATOM   3138 N  N   . ARG B 1 491 ? 45.436 42.010 18.898 1.00 40.29 ? 491 ARG A N   1 
ATOM   3139 C  CA  . ARG B 1 491 ? 44.650 42.963 18.113 1.00 41.74 ? 491 ARG A CA  1 
ATOM   3140 C  C   . ARG B 1 491 ? 45.410 44.261 17.876 1.00 41.93 ? 491 ARG A C   1 
ATOM   3141 O  O   . ARG B 1 491 ? 45.205 44.919 16.857 1.00 42.77 ? 491 ARG A O   1 
ATOM   3142 C  CB  . ARG B 1 491 ? 43.324 43.265 18.808 1.00 42.04 ? 491 ARG A CB  1 
ATOM   3143 C  CG  . ARG B 1 491 ? 42.684 42.068 19.433 1.00 44.48 ? 491 ARG A CG  1 
ATOM   3144 C  CD  . ARG B 1 491 ? 41.177 42.184 19.398 1.00 48.07 ? 491 ARG A CD  1 
ATOM   3145 N  NE  . ARG B 1 491 ? 40.525 40.903 19.667 1.00 50.11 ? 491 ARG A NE  1 
ATOM   3146 C  CZ  . ARG B 1 491 ? 40.422 40.353 20.876 1.00 52.56 ? 491 ARG A CZ  1 
ATOM   3147 N  NH1 . ARG B 1 491 ? 40.941 40.964 21.942 1.00 52.97 ? 491 ARG A NH1 1 
ATOM   3148 N  NH2 . ARG B 1 491 ? 39.803 39.186 21.022 1.00 51.94 ? 491 ARG A NH2 1 
ATOM   3149 N  N   . SER B 1 492 ? 46.278 44.624 18.820 1.00 42.13 ? 492 SER A N   1 
ATOM   3150 C  CA  . SER B 1 492 ? 47.153 45.795 18.666 1.00 42.50 ? 492 SER A CA  1 
ATOM   3151 C  C   . SER B 1 492 ? 48.450 45.515 17.890 1.00 42.55 ? 492 SER A C   1 
ATOM   3152 O  O   . SER B 1 492 ? 49.025 46.428 17.302 1.00 43.25 ? 492 SER A O   1 
ATOM   3153 C  CB  . SER B 1 492 ? 47.478 46.410 20.028 1.00 42.43 ? 492 SER A CB  1 
ATOM   3154 O  OG  . SER B 1 492 ? 48.208 45.500 20.830 1.00 42.78 ? 492 SER A OG  1 
ATOM   3155 N  N   . GLY B 1 493 ? 48.895 44.260 17.864 1.00 42.56 ? 493 GLY A N   1 
ATOM   3156 C  CA  . GLY B 1 493 ? 50.128 43.903 17.165 1.00 42.05 ? 493 GLY A CA  1 
ATOM   3157 C  C   . GLY B 1 493 ? 51.329 43.916 18.094 1.00 42.08 ? 493 GLY A C   1 
ATOM   3158 O  O   . GLY B 1 493 ? 52.444 43.583 17.695 1.00 41.97 ? 493 GLY A O   1 
ATOM   3159 N  N   . LYS B 1 494 ? 51.093 44.285 19.347 1.00 41.47 ? 494 LYS A N   1 
ATOM   3160 C  CA  . LYS B 1 494 ? 52.142 44.319 20.346 1.00 40.97 ? 494 LYS A CA  1 
ATOM   3161 C  C   . LYS B 1 494 ? 52.338 42.938 20.963 1.00 40.25 ? 494 LYS A C   1 
ATOM   3162 O  O   . LYS B 1 494 ? 51.756 42.599 22.006 1.00 39.88 ? 494 LYS A O   1 
ATOM   3163 C  CB  . LYS B 1 494 ? 51.840 45.393 21.396 1.00 41.41 ? 494 LYS A CB  1 
ATOM   3164 C  CG  . LYS B 1 494 ? 51.784 46.793 20.795 1.00 42.48 ? 494 LYS A CG  1 
ATOM   3165 C  CD  . LYS B 1 494 ? 51.682 47.872 21.865 1.00 46.78 ? 494 LYS A CD  1 
ATOM   3166 C  CE  . LYS B 1 494 ? 51.425 49.238 21.243 1.00 46.35 ? 494 LYS A CE  1 
ATOM   3167 N  NZ  . LYS B 1 494 ? 49.959 49.472 20.995 1.00 48.77 ? 494 LYS A NZ  1 
ATOM   3168 N  N   . ARG B 1 495 ? 53.181 42.148 20.297 1.00 39.64 ? 495 ARG A N   1 
ATOM   3169 C  CA  . ARG B 1 495 ? 53.413 40.750 20.659 1.00 38.52 ? 495 ARG A CA  1 
ATOM   3170 C  C   . ARG B 1 495 ? 54.882 40.345 20.508 1.00 37.81 ? 495 ARG A C   1 
ATOM   3171 O  O   . ARG B 1 495 ? 55.608 40.908 19.687 1.00 36.89 ? 495 ARG A O   1 
ATOM   3172 C  CB  . ARG B 1 495 ? 52.532 39.844 19.791 1.00 38.82 ? 495 ARG A CB  1 
ATOM   3173 C  CG  . ARG B 1 495 ? 52.823 39.940 18.303 1.00 38.86 ? 495 ARG A CG  1 
ATOM   3174 C  CD  . ARG B 1 495 ? 51.840 39.104 17.505 1.00 40.72 ? 495 ARG A CD  1 
ATOM   3175 N  NE  . ARG B 1 495 ? 52.340 38.895 16.155 1.00 41.47 ? 495 ARG A NE  1 
ATOM   3176 C  CZ  . ARG B 1 495 ? 52.685 37.713 15.653 1.00 41.35 ? 495 ARG A CZ  1 
ATOM   3177 N  NH1 . ARG B 1 495 ? 52.559 36.614 16.382 1.00 41.10 ? 495 ARG A NH1 1 
ATOM   3178 N  NH2 . ARG B 1 495 ? 53.143 37.635 14.410 1.00 40.18 ? 495 ARG A NH2 1 
ATOM   3179 N  N   . ARG B 1 496 ? 55.298 39.361 21.300 1.00 37.10 ? 496 ARG A N   1 
ATOM   3180 C  CA  . ARG B 1 496 ? 56.647 38.785 21.198 1.00 37.27 ? 496 ARG A CA  1 
ATOM   3181 C  C   . ARG B 1 496 ? 56.611 37.349 20.623 1.00 36.26 ? 496 ARG A C   1 
ATOM   3182 O  O   . ARG B 1 496 ? 57.539 36.555 20.849 1.00 36.46 ? 496 ARG A O   1 
ATOM   3183 C  CB  . ARG B 1 496 ? 57.342 38.798 22.570 1.00 37.07 ? 496 ARG A CB  1 
ATOM   3184 C  CG  . ARG B 1 496 ? 57.954 40.148 22.959 1.00 38.08 ? 496 ARG A CG  1 
ATOM   3185 C  CD  . ARG B 1 496 ? 58.627 40.099 24.319 1.00 39.10 ? 496 ARG A CD  1 
ATOM   3186 N  NE  . ARG B 1 496 ? 59.179 41.419 24.634 1.00 45.90 ? 496 ARG A NE  1 
ATOM   3187 C  CZ  . ARG B 1 496 ? 60.155 41.660 25.509 1.00 48.25 ? 496 ARG A CZ  1 
ATOM   3188 N  NH1 . ARG B 1 496 ? 60.725 40.673 26.199 1.00 48.57 ? 496 ARG A NH1 1 
ATOM   3189 N  NH2 . ARG B 1 496 ? 60.573 42.908 25.689 1.00 50.38 ? 496 ARG A NH2 1 
ATOM   3190 N  N   . GLY B 1 497 ? 55.536 37.034 19.894 1.00 35.37 ? 497 GLY A N   1 
ATOM   3191 C  CA  . GLY B 1 497 ? 55.390 35.759 19.184 1.00 33.76 ? 497 GLY A CA  1 
ATOM   3192 C  C   . GLY B 1 497 ? 55.120 34.583 20.090 1.00 33.54 ? 497 GLY A C   1 
ATOM   3193 O  O   . GLY B 1 497 ? 54.541 34.729 21.187 1.00 32.80 ? 497 GLY A O   1 
ATOM   3194 N  N   . GLU B 1 498 ? 55.548 33.399 19.647 1.00 33.06 ? 498 GLU A N   1 
ATOM   3195 C  CA  . GLU B 1 498 ? 55.167 32.178 20.339 1.00 33.26 ? 498 GLU A CA  1 
ATOM   3196 C  C   . GLU B 1 498 ? 56.202 31.077 20.171 1.00 33.88 ? 498 GLU A C   1 
ATOM   3197 O  O   . GLU B 1 498 ? 57.032 31.120 19.260 1.00 33.58 ? 498 GLU A O   1 
ATOM   3198 C  CB  . GLU B 1 498 ? 53.799 31.687 19.809 1.00 32.90 ? 498 GLU A CB  1 
ATOM   3199 C  CG  . GLU B 1 498 ? 53.849 30.991 18.442 1.00 32.56 ? 498 GLU A CG  1 
ATOM   3200 C  CD  . GLU B 1 498 ? 54.081 31.924 17.269 1.00 33.50 ? 498 GLU A CD  1 
ATOM   3201 O  OE1 . GLU B 1 498 ? 54.908 31.573 16.383 1.00 32.59 ? 498 GLU A OE1 1 
ATOM   3202 O  OE2 . GLU B 1 498 ? 53.442 33.010 17.211 1.00 32.61 ? 498 GLU A OE2 1 
ATOM   3203 N  N   . ARG B 1 499 ? 56.120 30.088 21.045 1.00 35.26 ? 499 ARG A N   1 
ATOM   3204 C  CA  . ARG B 1 499 ? 56.988 28.918 20.995 1.00 37.24 ? 499 ARG A CA  1 
ATOM   3205 C  C   . ARG B 1 499 ? 56.219 27.695 21.465 1.00 38.19 ? 499 ARG A C   1 
ATOM   3206 O  O   . ARG B 1 499 ? 55.296 27.797 22.286 1.00 38.15 ? 499 ARG A O   1 
ATOM   3207 C  CB  . ARG B 1 499 ? 58.237 29.121 21.867 1.00 37.26 ? 499 ARG A CB  1 
ATOM   3208 C  CG  . ARG B 1 499 ? 57.943 29.507 23.295 1.00 39.02 ? 499 ARG A CG  1 
ATOM   3209 C  CD  . ARG B 1 499 ? 59.205 29.580 24.126 1.00 43.26 ? 499 ARG A CD  1 
ATOM   3210 N  NE  . ARG B 1 499 ? 58.869 29.632 25.547 1.00 46.25 ? 499 ARG A NE  1 
ATOM   3211 C  CZ  . ARG B 1 499 ? 59.756 29.693 26.539 1.00 50.02 ? 499 ARG A CZ  1 
ATOM   3212 N  NH1 . ARG B 1 499 ? 61.068 29.716 26.282 1.00 50.09 ? 499 ARG A NH1 1 
ATOM   3213 N  NH2 . ARG B 1 499 ? 59.326 29.737 27.800 1.00 50.31 ? 499 ARG A NH2 1 
ATOM   3214 N  N   . MET B 1 500 ? 56.603 26.546 20.927 1.00 39.29 ? 500 MET A N   1 
ATOM   3215 C  CA  . MET B 1 500 ? 56.124 25.269 21.396 1.00 40.88 ? 500 MET A CA  1 
ATOM   3216 C  C   . MET B 1 500 ? 57.138 24.774 22.405 1.00 41.82 ? 500 MET A C   1 
ATOM   3217 O  O   . MET B 1 500 ? 58.338 24.782 22.125 1.00 42.02 ? 500 MET A O   1 
ATOM   3218 C  CB  . MET B 1 500 ? 56.012 24.295 20.215 1.00 40.94 ? 500 MET A CB  1 
ATOM   3219 C  CG  . MET B 1 500 ? 55.101 24.803 19.091 1.00 40.85 ? 500 MET A CG  1 
ATOM   3220 S  SD  . MET B 1 500 ? 55.169 23.845 17.560 1.00 41.41 ? 500 MET A SD  1 
ATOM   3221 C  CE  . MET B 1 500 ? 56.600 24.593 16.776 1.00 42.21 ? 500 MET A CE  1 
ATOM   3222 N  N   . GLU B 1 501 ? 56.667 24.361 23.576 1.00 43.32 ? 501 GLU A N   1 
ATOM   3223 C  CA  . GLU B 1 501 ? 57.543 23.853 24.634 1.00 45.29 ? 501 GLU A CA  1 
ATOM   3224 C  C   . GLU B 1 501 ? 56.852 22.789 25.490 1.00 46.27 ? 501 GLU A C   1 
ATOM   3225 O  O   . GLU B 1 501 ? 55.628 22.780 25.595 1.00 45.82 ? 501 GLU A O   1 
ATOM   3226 C  CB  . GLU B 1 501 ? 58.047 25.002 25.515 1.00 45.71 ? 501 GLU A CB  1 
ATOM   3227 C  CG  . GLU B 1 501 ? 56.939 25.796 26.206 1.00 47.33 ? 501 GLU A CG  1 
ATOM   3228 C  CD  . GLU B 1 501 ? 57.357 26.318 27.572 1.00 50.54 ? 501 GLU A CD  1 
ATOM   3229 O  OE1 . GLU B 1 501 ? 56.778 25.856 28.587 1.00 50.42 ? 501 GLU A OE1 1 
ATOM   3230 O  OE2 . GLU B 1 501 ? 58.267 27.182 27.628 1.00 51.16 ? 501 GLU A OE2 1 
ATOM   3231 N  N   . ALA B 1 502 ? 57.639 21.896 26.094 1.00 47.70 ? 502 ALA A N   1 
ATOM   3232 C  CA  . ALA B 1 502 ? 57.093 20.741 26.831 1.00 49.50 ? 502 ALA A CA  1 
ATOM   3233 C  C   . ALA B 1 502 ? 56.701 21.045 28.280 1.00 50.82 ? 502 ALA A C   1 
ATOM   3234 O  O   . ALA B 1 502 ? 57.394 21.777 28.988 1.00 51.65 ? 502 ALA A O   1 
ATOM   3235 C  CB  . ALA B 1 502 ? 58.042 19.542 26.758 1.00 49.13 ? 502 ALA A CB  1 
ATOM   3236 N  N   . GLN B 1 503 ? 55.582 20.472 28.712 1.00 52.08 ? 503 GLN A N   1 
ATOM   3237 C  CA  . GLN B 1 503 ? 54.988 20.810 29.996 1.00 53.41 ? 503 GLN A CA  1 
ATOM   3238 C  C   . GLN B 1 503 ? 54.298 19.599 30.620 1.00 53.88 ? 503 GLN A C   1 
ATOM   3239 O  O   . GLN B 1 503 ? 53.177 19.251 30.239 1.00 54.64 ? 503 GLN A O   1 
ATOM   3240 C  CB  . GLN B 1 503 ? 53.998 21.960 29.815 1.00 53.38 ? 503 GLN A CB  1 
ATOM   3241 C  CG  . GLN B 1 503 ? 53.415 22.476 31.105 1.00 55.01 ? 503 GLN A CG  1 
ATOM   3242 C  CD  . GLN B 1 503 ? 53.006 23.921 30.999 1.00 56.90 ? 503 GLN A CD  1 
ATOM   3243 O  OE1 . GLN B 1 503 ? 53.790 24.774 30.566 1.00 57.55 ? 503 GLN A OE1 1 
ATOM   3244 N  NE2 . GLN B 1 503 ? 51.774 24.215 31.401 1.00 57.18 ? 503 GLN A NE2 1 
ATOM   3245 N  N   . GLY B 1 504 ? 54.973 18.965 31.580 1.00 54.13 ? 504 GLY A N   1 
ATOM   3246 C  CA  . GLY B 1 504 ? 54.497 17.715 32.171 1.00 53.58 ? 504 GLY A CA  1 
ATOM   3247 C  C   . GLY B 1 504 ? 54.563 16.566 31.175 1.00 53.30 ? 504 GLY A C   1 
ATOM   3248 O  O   . GLY B 1 504 ? 53.709 15.674 31.191 1.00 53.77 ? 504 GLY A O   1 
ATOM   3249 N  N   . GLY B 1 505 ? 55.579 16.595 30.310 1.00 52.56 ? 505 GLY A N   1 
ATOM   3250 C  CA  . GLY B 1 505 ? 55.782 15.572 29.284 1.00 51.11 ? 505 GLY A CA  1 
ATOM   3251 C  C   . GLY B 1 505 ? 54.919 15.728 28.039 1.00 50.10 ? 505 GLY A C   1 
ATOM   3252 O  O   . GLY B 1 505 ? 54.728 14.759 27.280 1.00 50.48 ? 505 GLY A O   1 
ATOM   3253 N  N   . LYS B 1 506 ? 54.397 16.938 27.821 1.00 48.42 ? 506 LYS A N   1 
ATOM   3254 C  CA  . LYS B 1 506 ? 53.526 17.208 26.672 1.00 46.35 ? 506 LYS A CA  1 
ATOM   3255 C  C   . LYS B 1 506 ? 53.765 18.599 26.100 1.00 44.45 ? 506 LYS A C   1 
ATOM   3256 O  O   . LYS B 1 506 ? 53.842 19.571 26.846 1.00 44.56 ? 506 LYS A O   1 
ATOM   3257 C  CB  . LYS B 1 506 ? 52.061 17.050 27.082 1.00 46.66 ? 506 LYS A CB  1 
ATOM   3258 C  CG  . LYS B 1 506 ? 51.111 16.903 25.922 1.00 47.42 ? 506 LYS A CG  1 
ATOM   3259 C  CD  . LYS B 1 506 ? 49.747 16.383 26.372 1.00 49.39 ? 506 LYS A CD  1 
ATOM   3260 C  CE  . LYS B 1 506 ? 48.655 16.814 25.390 1.00 47.73 ? 506 LYS A CE  1 
ATOM   3261 N  NZ  . LYS B 1 506 ? 48.989 16.439 23.991 1.00 47.54 ? 506 LYS A NZ  1 
ATOM   3262 N  N   . LEU B 1 507 ? 53.883 18.694 24.778 1.00 42.15 ? 507 LEU A N   1 
ATOM   3263 C  CA  . LEU B 1 507 ? 54.092 19.984 24.118 1.00 39.97 ? 507 LEU A CA  1 
ATOM   3264 C  C   . LEU B 1 507 ? 52.856 20.891 24.218 1.00 38.60 ? 507 LEU A C   1 
ATOM   3265 O  O   . LEU B 1 507 ? 51.741 20.471 23.878 1.00 38.00 ? 507 LEU A O   1 
ATOM   3266 C  CB  . LEU B 1 507 ? 54.481 19.804 22.638 1.00 40.08 ? 507 LEU A CB  1 
ATOM   3267 C  CG  . LEU B 1 507 ? 55.927 19.568 22.176 1.00 41.42 ? 507 LEU A CG  1 
ATOM   3268 C  CD1 . LEU B 1 507 ? 56.933 20.231 23.108 1.00 40.75 ? 507 LEU A CD1 1 
ATOM   3269 C  CD2 . LEU B 1 507 ? 56.264 18.083 21.986 1.00 42.47 ? 507 LEU A CD2 1 
ATOM   3270 N  N   . VAL B 1 508 ? 53.068 22.122 24.698 1.00 36.43 ? 508 VAL A N   1 
ATOM   3271 C  CA  . VAL B 1 508 ? 52.047 23.166 24.703 1.00 34.95 ? 508 VAL A CA  1 
ATOM   3272 C  C   . VAL B 1 508 ? 52.450 24.327 23.804 1.00 34.22 ? 508 VAL A C   1 
ATOM   3273 O  O   . VAL B 1 508 ? 53.618 24.454 23.391 1.00 33.31 ? 508 VAL A O   1 
ATOM   3274 C  CB  . VAL B 1 508 ? 51.706 23.700 26.125 1.00 34.79 ? 508 VAL A CB  1 
ATOM   3275 C  CG1 . VAL B 1 508 ? 51.207 22.564 27.028 1.00 34.69 ? 508 VAL A CG1 1 
ATOM   3276 C  CG2 . VAL B 1 508 ? 52.904 24.412 26.753 1.00 35.23 ? 508 VAL A CG2 1 
ATOM   3277 N  N   . CYS B 1 509 ? 51.464 25.157 23.488 1.00 33.51 ? 509 CYS A N   1 
ATOM   3278 C  CA  . CYS B 1 509 ? 51.666 26.353 22.686 1.00 33.49 ? 509 CYS A CA  1 
ATOM   3279 C  C   . CYS B 1 509 ? 51.658 27.554 23.635 1.00 34.31 ? 509 CYS A C   1 
ATOM   3280 O  O   . CYS B 1 509 ? 50.645 27.851 24.261 1.00 34.47 ? 509 CYS A O   1 
ATOM   3281 C  CB  . CYS B 1 509 ? 50.562 26.468 21.628 1.00 33.03 ? 509 CYS A CB  1 
ATOM   3282 S  SG  . CYS B 1 509 ? 50.580 27.950 20.598 1.00 32.75 ? 509 CYS A SG  1 
ATOM   3283 N  N   . ARG B 1 510 ? 52.796 28.235 23.749 1.00 34.94 ? 510 ARG A N   1 
ATOM   3284 C  CA  . ARG B 1 510 ? 52.907 29.379 24.658 1.00 36.43 ? 510 ARG A CA  1 
ATOM   3285 C  C   . ARG B 1 510 ? 53.170 30.651 23.870 1.00 35.60 ? 510 ARG A C   1 
ATOM   3286 O  O   . ARG B 1 510 ? 54.086 30.701 23.056 1.00 35.36 ? 510 ARG A O   1 
ATOM   3287 C  CB  . ARG B 1 510 ? 53.998 29.127 25.711 1.00 36.25 ? 510 ARG A CB  1 
ATOM   3288 C  CG  . ARG B 1 510 ? 54.078 30.188 26.813 1.00 38.51 ? 510 ARG A CG  1 
ATOM   3289 C  CD  . ARG B 1 510 ? 55.229 29.900 27.779 1.00 39.36 ? 510 ARG A CD  1 
ATOM   3290 N  NE  . ARG B 1 510 ? 54.978 28.694 28.576 1.00 46.79 ? 510 ARG A NE  1 
ATOM   3291 C  CZ  . ARG B 1 510 ? 54.412 28.684 29.780 1.00 49.94 ? 510 ARG A CZ  1 
ATOM   3292 N  NH1 . ARG B 1 510 ? 54.228 27.532 30.420 1.00 51.68 ? 510 ARG A NH1 1 
ATOM   3293 N  NH2 . ARG B 1 510 ? 54.022 29.821 30.348 1.00 53.44 ? 510 ARG A NH2 1 
ATOM   3294 N  N   . ALA B 1 511 ? 52.348 31.672 24.104 1.00 35.67 ? 511 ALA A N   1 
ATOM   3295 C  CA  . ALA B 1 511 ? 52.493 32.976 23.444 1.00 35.63 ? 511 ALA A CA  1 
ATOM   3296 C  C   . ALA B 1 511 ? 52.939 34.070 24.423 1.00 36.11 ? 511 ALA A C   1 
ATOM   3297 O  O   . ALA B 1 511 ? 52.587 34.052 25.601 1.00 36.21 ? 511 ALA A O   1 
ATOM   3298 C  CB  . ALA B 1 511 ? 51.212 33.377 22.775 1.00 35.26 ? 511 ALA A CB  1 
ATOM   3299 N  N   . HIS B 1 512 ? 53.695 35.026 23.904 1.00 36.42 ? 512 HIS A N   1 
ATOM   3300 C  CA  . HIS B 1 512 ? 54.345 36.039 24.724 1.00 37.47 ? 512 HIS A CA  1 
ATOM   3301 C  C   . HIS B 1 512 ? 53.801 37.430 24.481 1.00 36.72 ? 512 HIS A C   1 
ATOM   3302 O  O   . HIS B 1 512 ? 53.873 37.949 23.371 1.00 35.91 ? 512 HIS A O   1 
ATOM   3303 C  CB  . HIS B 1 512 ? 55.862 36.028 24.476 1.00 37.54 ? 512 HIS A CB  1 
ATOM   3304 C  CG  . HIS B 1 512 ? 56.531 34.780 24.957 1.00 40.08 ? 512 HIS A CG  1 
ATOM   3305 N  ND1 . HIS B 1 512 ? 56.676 34.487 26.295 1.00 41.83 ? 512 HIS A ND1 1 
ATOM   3306 C  CD2 . HIS B 1 512 ? 57.072 33.739 24.282 1.00 41.39 ? 512 HIS A CD2 1 
ATOM   3307 C  CE1 . HIS B 1 512 ? 57.282 33.321 26.422 1.00 43.59 ? 512 HIS A CE1 1 
ATOM   3308 N  NE2 . HIS B 1 512 ? 57.531 32.845 25.216 1.00 41.93 ? 512 HIS A NE2 1 
ATOM   3309 N  N   . ASN B 1 513 ? 53.269 38.028 25.543 1.00 37.59 ? 513 ASN A N   1 
ATOM   3310 C  CA  . ASN B 1 513 ? 52.901 39.436 25.535 1.00 38.71 ? 513 ASN A CA  1 
ATOM   3311 C  C   . ASN B 1 513 ? 54.163 40.265 25.316 1.00 39.74 ? 513 ASN A C   1 
ATOM   3312 O  O   . ASN B 1 513 ? 55.244 39.882 25.788 1.00 39.58 ? 513 ASN A O   1 
ATOM   3313 C  CB  . ASN B 1 513 ? 52.255 39.806 26.876 1.00 39.15 ? 513 ASN A CB  1 
ATOM   3314 C  CG  . ASN B 1 513 ? 51.469 41.109 26.821 1.00 38.94 ? 513 ASN A CG  1 
ATOM   3315 O  OD1 . ASN B 1 513 ? 51.178 41.713 27.865 1.00 43.02 ? 513 ASN A OD1 1 
ATOM   3316 N  ND2 . ASN B 1 513 ? 51.126 41.552 25.620 1.00 37.78 ? 513 ASN A ND2 1 
ATOM   3317 N  N   . ALA B 1 514 ? 54.037 41.365 24.571 1.00 40.69 ? 514 ALA A N   1 
ATOM   3318 C  CA  . ALA B 1 514 ? 55.100 42.363 24.497 1.00 42.03 ? 514 ALA A CA  1 
ATOM   3319 C  C   . ALA B 1 514 ? 55.112 43.102 25.828 1.00 43.04 ? 514 ALA A C   1 
ATOM   3320 O  O   . ALA B 1 514 ? 54.086 43.163 26.509 1.00 42.72 ? 514 ALA A O   1 
ATOM   3321 C  CB  . ALA B 1 514 ? 54.861 43.350 23.342 1.00 41.76 ? 514 ALA A CB  1 
ATOM   3322 N  N   . PHE B 1 515 ? 56.268 43.651 26.200 1.00 44.39 ? 515 PHE A N   1 
ATOM   3323 C  CA  . PHE B 1 515 ? 56.381 44.443 27.421 1.00 45.48 ? 515 PHE A CA  1 
ATOM   3324 C  C   . PHE B 1 515 ? 55.210 45.433 27.577 1.00 45.57 ? 515 PHE A C   1 
ATOM   3325 O  O   . PHE B 1 515 ? 54.518 45.418 28.607 1.00 45.74 ? 515 PHE A O   1 
ATOM   3326 C  CB  . PHE B 1 515 ? 57.728 45.183 27.478 1.00 46.20 ? 515 PHE A CB  1 
ATOM   3327 C  CG  . PHE B 1 515 ? 57.840 46.147 28.638 1.00 47.91 ? 515 PHE A CG  1 
ATOM   3328 C  CD1 . PHE B 1 515 ? 57.487 47.493 28.482 1.00 49.29 ? 515 PHE A CD1 1 
ATOM   3329 C  CD2 . PHE B 1 515 ? 58.284 45.706 29.886 1.00 48.82 ? 515 PHE A CD2 1 
ATOM   3330 C  CE1 . PHE B 1 515 ? 57.571 48.385 29.545 1.00 50.09 ? 515 PHE A CE1 1 
ATOM   3331 C  CE2 . PHE B 1 515 ? 58.376 46.594 30.964 1.00 50.30 ? 515 PHE A CE2 1 
ATOM   3332 C  CZ  . PHE B 1 515 ? 58.020 47.937 30.793 1.00 49.46 ? 515 PHE A CZ  1 
ATOM   3333 N  N   . GLY B 1 516 ? 54.990 46.271 26.557 1.00 45.36 ? 516 GLY A N   1 
ATOM   3334 C  CA  . GLY B 1 516 ? 53.935 47.287 26.591 1.00 45.29 ? 516 GLY A CA  1 
ATOM   3335 C  C   . GLY B 1 516 ? 52.620 46.955 25.895 1.00 45.31 ? 516 GLY A C   1 
ATOM   3336 O  O   . GLY B 1 516 ? 51.920 47.862 25.422 1.00 45.63 ? 516 GLY A O   1 
ATOM   3337 N  N   . GLY B 1 517 ? 52.274 45.665 25.836 1.00 44.83 ? 517 GLY A N   1 
ATOM   3338 C  CA  . GLY B 1 517 ? 51.029 45.213 25.195 1.00 43.59 ? 517 GLY A CA  1 
ATOM   3339 C  C   . GLY B 1 517 ? 49.885 44.928 26.158 1.00 43.14 ? 517 GLY A C   1 
ATOM   3340 O  O   . GLY B 1 517 ? 50.093 44.790 27.374 1.00 43.42 ? 517 GLY A O   1 
ATOM   3341 N  N   . GLU B 1 518 ? 48.678 44.843 25.598 1.00 42.16 ? 518 GLU A N   1 
ATOM   3342 C  CA  . GLU B 1 518 ? 47.442 44.547 26.336 1.00 41.72 ? 518 GLU A CA  1 
ATOM   3343 C  C   . GLU B 1 518 ? 47.263 43.049 26.624 1.00 40.21 ? 518 GLU A C   1 
ATOM   3344 O  O   . GLU B 1 518 ? 46.455 42.650 27.475 1.00 39.85 ? 518 GLU A O   1 
ATOM   3345 C  CB  . GLU B 1 518 ? 46.213 45.078 25.584 1.00 41.95 ? 518 GLU A CB  1 
ATOM   3346 C  CG  . GLU B 1 518 ? 46.309 45.008 24.064 1.00 45.98 ? 518 GLU A CG  1 
ATOM   3347 C  CD  . GLU B 1 518 ? 47.222 46.096 23.487 1.00 49.70 ? 518 GLU A CD  1 
ATOM   3348 O  OE1 . GLU B 1 518 ? 48.389 45.786 23.149 1.00 50.37 ? 518 GLU A OE1 1 
ATOM   3349 O  OE2 . GLU B 1 518 ? 46.788 47.267 23.392 1.00 52.51 ? 518 GLU A OE2 1 
ATOM   3350 N  N   . GLY B 1 519 ? 48.034 42.230 25.919 1.00 38.98 ? 519 GLY A N   1 
ATOM   3351 C  CA  . GLY B 1 519 ? 47.960 40.785 26.081 1.00 36.84 ? 519 GLY A CA  1 
ATOM   3352 C  C   . GLY B 1 519 ? 47.881 40.103 24.739 1.00 35.17 ? 519 GLY A C   1 
ATOM   3353 O  O   . GLY B 1 519 ? 47.691 40.754 23.714 1.00 34.79 ? 519 GLY A O   1 
ATOM   3354 N  N   . VAL B 1 520 ? 48.022 38.781 24.754 1.00 33.65 ? 520 VAL A N   1 
ATOM   3355 C  CA  . VAL B 1 520 ? 48.019 38.000 23.520 1.00 32.08 ? 520 VAL A CA  1 
ATOM   3356 C  C   . VAL B 1 520 ? 47.221 36.719 23.667 1.00 31.06 ? 520 VAL A C   1 
ATOM   3357 O  O   . VAL B 1 520 ? 46.916 36.285 24.798 1.00 30.31 ? 520 VAL A O   1 
ATOM   3358 C  CB  . VAL B 1 520 ? 49.475 37.624 23.073 1.00 32.18 ? 520 VAL A CB  1 
ATOM   3359 C  CG1 . VAL B 1 520 ? 50.226 38.824 22.584 1.00 31.77 ? 520 VAL A CG1 1 
ATOM   3360 C  CG2 . VAL B 1 520 ? 50.248 36.906 24.207 1.00 32.01 ? 520 VAL A CG2 1 
ATOM   3361 N  N   . TYR B 1 521 ? 46.919 36.101 22.519 1.00 30.47 ? 521 TYR A N   1 
ATOM   3362 C  CA  . TYR B 1 521 ? 46.367 34.747 22.473 1.00 29.74 ? 521 TYR A CA  1 
ATOM   3363 C  C   . TYR B 1 521 ? 47.390 33.793 21.888 1.00 28.83 ? 521 TYR A C   1 
ATOM   3364 O  O   . TYR B 1 521 ? 48.017 34.101 20.888 1.00 28.17 ? 521 TYR A O   1 
ATOM   3365 C  CB  . TYR B 1 521 ? 45.134 34.660 21.559 1.00 29.81 ? 521 TYR A CB  1 
ATOM   3366 C  CG  . TYR B 1 521 ? 43.947 35.495 21.967 1.00 29.77 ? 521 TYR A CG  1 
ATOM   3367 C  CD1 . TYR B 1 521 ? 43.677 36.702 21.329 1.00 27.08 ? 521 TYR A CD1 1 
ATOM   3368 C  CD2 . TYR B 1 521 ? 43.081 35.061 22.975 1.00 28.15 ? 521 TYR A CD2 1 
ATOM   3369 C  CE1 . TYR B 1 521 ? 42.575 37.470 21.686 1.00 30.21 ? 521 TYR A CE1 1 
ATOM   3370 C  CE2 . TYR B 1 521 ? 41.984 35.820 23.343 1.00 30.09 ? 521 TYR A CE2 1 
ATOM   3371 C  CZ  . TYR B 1 521 ? 41.737 37.024 22.703 1.00 29.55 ? 521 TYR A CZ  1 
ATOM   3372 O  OH  . TYR B 1 521 ? 40.640 37.781 23.080 1.00 32.39 ? 521 TYR A OH  1 
ATOM   3373 N  N   . ALA B 1 522 ? 47.517 32.631 22.513 1.00 28.40 ? 522 ALA A N   1 
ATOM   3374 C  CA  . ALA B 1 522 ? 48.158 31.475 21.889 1.00 28.25 ? 522 ALA A CA  1 
ATOM   3375 C  C   . ALA B 1 522 ? 47.084 30.671 21.140 1.00 27.96 ? 522 ALA A C   1 
ATOM   3376 O  O   . ALA B 1 522 ? 45.978 30.502 21.651 1.00 27.31 ? 522 ALA A O   1 
ATOM   3377 C  CB  . ALA B 1 522 ? 48.809 30.621 22.946 1.00 27.71 ? 522 ALA A CB  1 
ATOM   3378 N  N   . ILE B 1 523 ? 47.431 30.201 19.936 1.00 27.71 ? 523 ILE A N   1 
ATOM   3379 C  CA  . ILE B 1 523 ? 46.552 29.462 19.053 1.00 27.14 ? 523 ILE A CA  1 
ATOM   3380 C  C   . ILE B 1 523 ? 47.220 28.119 18.660 1.00 27.01 ? 523 ILE A C   1 
ATOM   3381 O  O   . ILE B 1 523 ? 48.179 28.093 17.888 1.00 26.56 ? 523 ILE A O   1 
ATOM   3382 C  CB  . ILE B 1 523 ? 46.194 30.303 17.801 1.00 27.72 ? 523 ILE A CB  1 
ATOM   3383 C  CG1 . ILE B 1 523 ? 45.532 31.629 18.201 1.00 27.90 ? 523 ILE A CG1 1 
ATOM   3384 C  CG2 . ILE B 1 523 ? 45.244 29.547 16.896 1.00 26.49 ? 523 ILE A CG2 1 
ATOM   3385 C  CD1 . ILE B 1 523 ? 46.021 32.826 17.438 1.00 29.28 ? 523 ILE A CD1 1 
ATOM   3386 N  N   . ALA B 1 524 ? 46.725 27.022 19.233 1.00 26.40 ? 524 ALA A N   1 
ATOM   3387 C  CA  . ALA B 1 524 ? 47.261 25.695 18.976 1.00 26.56 ? 524 ALA A CA  1 
ATOM   3388 C  C   . ALA B 1 524 ? 46.526 25.001 17.836 1.00 26.38 ? 524 ALA A C   1 
ATOM   3389 O  O   . ALA B 1 524 ? 45.301 25.151 17.688 1.00 26.20 ? 524 ALA A O   1 
ATOM   3390 C  CB  . ALA B 1 524 ? 47.183 24.846 20.222 1.00 26.58 ? 524 ALA A CB  1 
ATOM   3391 N  N   . ARG B 1 525 ? 47.274 24.232 17.053 1.00 25.47 ? 525 ARG A N   1 
ATOM   3392 C  CA  . ARG B 1 525 ? 46.687 23.269 16.131 1.00 25.33 ? 525 ARG A CA  1 
ATOM   3393 C  C   . ARG B 1 525 ? 46.881 21.861 16.707 1.00 25.62 ? 525 ARG A C   1 
ATOM   3394 O  O   . ARG B 1 525 ? 47.998 21.346 16.734 1.00 24.98 ? 525 ARG A O   1 
ATOM   3395 C  CB  . ARG B 1 525 ? 47.283 23.430 14.740 1.00 25.22 ? 525 ARG A CB  1 
ATOM   3396 C  CG  . ARG B 1 525 ? 46.493 22.776 13.626 1.00 25.53 ? 525 ARG A CG  1 
ATOM   3397 C  CD  . ARG B 1 525 ? 45.248 23.601 13.192 1.00 24.70 ? 525 ARG A CD  1 
ATOM   3398 N  NE  . ARG B 1 525 ? 44.657 22.980 12.006 1.00 24.73 ? 525 ARG A NE  1 
ATOM   3399 C  CZ  . ARG B 1 525 ? 43.389 23.065 11.627 1.00 23.51 ? 525 ARG A CZ  1 
ATOM   3400 N  NH1 . ARG B 1 525 ? 42.508 23.783 12.308 1.00 24.79 ? 525 ARG A NH1 1 
ATOM   3401 N  NH2 . ARG B 1 525 ? 43.010 22.438 10.523 1.00 24.19 ? 525 ARG A NH2 1 
ATOM   3402 N  N   . CYS B 1 526 ? 45.782 21.274 17.191 1.00 26.18 ? 526 CYS A N   1 
ATOM   3403 C  CA  . CYS B 1 526 ? 45.763 19.993 17.910 1.00 26.44 ? 526 CYS A CA  1 
ATOM   3404 C  C   . CYS B 1 526 ? 45.159 18.914 17.018 1.00 26.60 ? 526 CYS A C   1 
ATOM   3405 O  O   . CYS B 1 526 ? 44.028 19.073 16.515 1.00 24.82 ? 526 CYS A O   1 
ATOM   3406 C  CB  . CYS B 1 526 ? 44.905 20.132 19.158 1.00 27.21 ? 526 CYS A CB  1 
ATOM   3407 S  SG  . CYS B 1 526 ? 45.558 21.318 20.340 1.00 30.21 ? 526 CYS A SG  1 
ATOM   3408 N  N   . CYS B 1 527 ? 45.896 17.819 16.845 1.00 26.66 ? 527 CYS A N   1 
ATOM   3409 C  CA  . CYS B 1 527 ? 45.546 16.811 15.845 1.00 28.13 ? 527 CYS A CA  1 
ATOM   3410 C  C   . CYS B 1 527 ? 45.530 15.384 16.399 1.00 29.08 ? 527 CYS A C   1 
ATOM   3411 O  O   . CYS B 1 527 ? 46.186 15.083 17.395 1.00 29.70 ? 527 CYS A O   1 
ATOM   3412 C  CB  . CYS B 1 527 ? 46.484 16.916 14.640 1.00 27.33 ? 527 CYS A CB  1 
ATOM   3413 S  SG  . CYS B 1 527 ? 46.617 18.576 13.911 1.00 27.83 ? 527 CYS A SG  1 
ATOM   3414 N  N   . LEU B 1 528 ? 44.754 14.513 15.770 1.00 30.05 ? 528 LEU A N   1 
ATOM   3415 C  CA  . LEU B 1 528 ? 44.752 13.104 16.149 1.00 31.66 ? 528 LEU A CA  1 
ATOM   3416 C  C   . LEU B 1 528 ? 45.735 12.382 15.236 1.00 33.78 ? 528 LEU A C   1 
ATOM   3417 O  O   . LEU B 1 528 ? 45.523 12.273 14.028 1.00 33.62 ? 528 LEU A O   1 
ATOM   3418 C  CB  . LEU B 1 528 ? 43.351 12.513 16.072 1.00 30.95 ? 528 LEU A CB  1 
ATOM   3419 C  CG  . LEU B 1 528 ? 42.295 13.097 17.016 1.00 30.69 ? 528 LEU A CG  1 
ATOM   3420 C  CD1 . LEU B 1 528 ? 40.913 12.609 16.623 1.00 28.34 ? 528 LEU A CD1 1 
ATOM   3421 C  CD2 . LEU B 1 528 ? 42.600 12.755 18.475 1.00 29.93 ? 528 LEU A CD2 1 
ATOM   3422 N  N   . LEU B 1 529 ? 46.841 11.946 15.825 1.00 36.43 ? 529 LEU A N   1 
ATOM   3423 C  CA  . LEU B 1 529 ? 47.920 11.346 15.071 1.00 39.38 ? 529 LEU A CA  1 
ATOM   3424 C  C   . LEU B 1 529 ? 48.511 10.230 15.930 1.00 41.74 ? 529 LEU A C   1 
ATOM   3425 O  O   . LEU B 1 529 ? 49.461 10.451 16.689 1.00 42.59 ? 529 LEU A O   1 
ATOM   3426 C  CB  . LEU B 1 529 ? 48.952 12.416 14.701 1.00 38.90 ? 529 LEU A CB  1 
ATOM   3427 C  CG  . LEU B 1 529 ? 50.007 12.171 13.620 1.00 39.53 ? 529 LEU A CG  1 
ATOM   3428 C  CD1 . LEU B 1 529 ? 49.433 11.642 12.298 1.00 38.26 ? 529 LEU A CD1 1 
ATOM   3429 C  CD2 . LEU B 1 529 ? 50.793 13.457 13.386 1.00 39.57 ? 529 LEU A CD2 1 
ATOM   3430 N  N   . PRO B 1 530 ? 47.935 9.018  15.829 1.00 44.08 ? 530 PRO A N   1 
ATOM   3431 C  CA  . PRO B 1 530 ? 48.375 7.946  16.720 1.00 45.61 ? 530 PRO A CA  1 
ATOM   3432 C  C   . PRO B 1 530 ? 49.808 7.506  16.365 1.00 47.12 ? 530 PRO A C   1 
ATOM   3433 O  O   . PRO B 1 530 ? 50.660 7.403  17.257 1.00 47.32 ? 530 PRO A O   1 
ATOM   3434 C  CB  . PRO B 1 530 ? 47.358 6.826  16.452 1.00 45.64 ? 530 PRO A CB  1 
ATOM   3435 C  CG  . PRO B 1 530 ? 46.895 7.057  15.040 1.00 45.23 ? 530 PRO A CG  1 
ATOM   3436 C  CD  . PRO B 1 530 ? 46.901 8.563  14.874 1.00 44.28 ? 530 PRO A CD  1 
ATOM   3437 N  N   . GLN B 1 531 ? 50.064 7.324  15.067 1.00 48.19 ? 531 GLN A N   1 
ATOM   3438 C  CA  . GLN B 1 531 ? 51.327 6.796  14.549 1.00 50.08 ? 531 GLN A CA  1 
ATOM   3439 C  C   . GLN B 1 531 ? 52.573 7.651  14.848 1.00 50.11 ? 531 GLN A C   1 
ATOM   3440 O  O   . GLN B 1 531 ? 53.713 7.208  14.633 1.00 50.86 ? 531 GLN A O   1 
ATOM   3441 C  CB  . GLN B 1 531 ? 51.207 6.628  13.031 1.00 50.36 ? 531 GLN A CB  1 
ATOM   3442 C  CG  . GLN B 1 531 ? 50.959 7.943  12.282 1.00 51.28 ? 531 GLN A CG  1 
ATOM   3443 C  CD  . GLN B 1 531 ? 51.087 7.785  10.781 1.00 51.25 ? 531 GLN A CD  1 
ATOM   3444 O  OE1 . GLN B 1 531 ? 52.162 7.451  10.266 1.00 52.97 ? 531 GLN A OE1 1 
ATOM   3445 N  NE2 . GLN B 1 531 ? 49.988 8.020  10.067 1.00 52.19 ? 531 GLN A NE2 1 
ATOM   3446 N  N   . ALA B 1 532 ? 52.351 8.863  15.343 1.00 49.78 ? 532 ALA A N   1 
ATOM   3447 C  CA  . ALA B 1 532 ? 53.389 9.886  15.373 1.00 49.13 ? 532 ALA A CA  1 
ATOM   3448 C  C   . ALA B 1 532 ? 54.262 9.888  16.611 1.00 48.75 ? 532 ALA A C   1 
ATOM   3449 O  O   . ALA B 1 532 ? 53.808 9.592  17.720 1.00 48.71 ? 532 ALA A O   1 
ATOM   3450 C  CB  . ALA B 1 532 ? 52.778 11.246 15.193 1.00 49.06 ? 532 ALA A CB  1 
ATOM   3451 N  N   . ASN B 1 533 ? 55.530 10.219 16.380 1.00 47.89 ? 533 ASN A N   1 
ATOM   3452 C  CA  . ASN B 1 533 ? 56.440 10.673 17.415 1.00 47.18 ? 533 ASN A CA  1 
ATOM   3453 C  C   . ASN B 1 533 ? 56.803 12.087 16.998 1.00 45.95 ? 533 ASN A C   1 
ATOM   3454 O  O   . ASN B 1 533 ? 57.402 12.268 15.932 1.00 46.08 ? 533 ASN A O   1 
ATOM   3455 C  CB  . ASN B 1 533 ? 57.707 9.813  17.456 1.00 47.74 ? 533 ASN A CB  1 
ATOM   3456 C  CG  . ASN B 1 533 ? 57.443 8.386  17.898 1.00 49.12 ? 533 ASN A CG  1 
ATOM   3457 O  OD1 . ASN B 1 533 ? 57.894 7.435  17.256 1.00 51.48 ? 533 ASN A OD1 1 
ATOM   3458 N  ND2 . ASN B 1 533 ? 56.721 8.227  19.008 1.00 49.74 ? 533 ASN A ND2 1 
ATOM   3459 N  N   . CYS B 1 534 ? 56.423 13.077 17.810 1.00 44.31 ? 534 CYS A N   1 
ATOM   3460 C  CA  . CYS B 1 534 ? 56.633 14.490 17.463 1.00 42.45 ? 534 CYS A CA  1 
ATOM   3461 C  C   . CYS B 1 534 ? 57.623 15.171 18.398 1.00 41.27 ? 534 CYS A C   1 
ATOM   3462 O  O   . CYS B 1 534 ? 57.652 14.916 19.612 1.00 41.04 ? 534 CYS A O   1 
ATOM   3463 C  CB  . CYS B 1 534 ? 55.317 15.276 17.430 1.00 42.59 ? 534 CYS A CB  1 
ATOM   3464 S  SG  . CYS B 1 534 ? 54.140 14.737 16.160 1.00 42.76 ? 534 CYS A SG  1 
ATOM   3465 N  N   . SER B 1 535 ? 58.427 16.054 17.822 1.00 38.87 ? 535 SER A N   1 
ATOM   3466 C  CA  . SER B 1 535 ? 59.442 16.755 18.584 1.00 37.03 ? 535 SER A CA  1 
ATOM   3467 C  C   . SER B 1 535 ? 59.525 18.206 18.127 1.00 35.34 ? 535 SER A C   1 
ATOM   3468 O  O   . SER B 1 535 ? 59.018 18.557 17.059 1.00 35.02 ? 535 SER A O   1 
ATOM   3469 C  CB  . SER B 1 535 ? 60.776 16.063 18.387 1.00 36.79 ? 535 SER A CB  1 
ATOM   3470 O  OG  . SER B 1 535 ? 61.095 15.998 17.004 1.00 37.86 ? 535 SER A OG  1 
ATOM   3471 N  N   . VAL B 1 536 ? 60.157 19.046 18.937 1.00 33.22 ? 536 VAL A N   1 
ATOM   3472 C  CA  . VAL B 1 536 ? 60.415 20.427 18.528 1.00 31.52 ? 536 VAL A CA  1 
ATOM   3473 C  C   . VAL B 1 536 ? 61.917 20.613 18.310 1.00 30.32 ? 536 VAL A C   1 
ATOM   3474 O  O   . VAL B 1 536 ? 62.712 20.067 19.070 1.00 29.68 ? 536 VAL A O   1 
ATOM   3475 C  CB  . VAL B 1 536 ? 59.857 21.448 19.565 1.00 31.35 ? 536 VAL A CB  1 
ATOM   3476 C  CG1 . VAL B 1 536 ? 60.203 22.879 19.159 1.00 30.26 ? 536 VAL A CG1 1 
ATOM   3477 C  CG2 . VAL B 1 536 ? 58.329 21.292 19.681 1.00 31.15 ? 536 VAL A CG2 1 
ATOM   3478 N  N   . HIS B 1 537 ? 62.286 21.360 17.267 1.00 29.01 ? 537 HIS A N   1 
ATOM   3479 C  CA  . HIS B 1 537 ? 63.678 21.762 17.022 1.00 29.33 ? 537 HIS A CA  1 
ATOM   3480 C  C   . HIS B 1 537 ? 63.750 23.291 17.099 1.00 29.22 ? 537 HIS A C   1 
ATOM   3481 O  O   . HIS B 1 537 ? 63.100 23.985 16.311 1.00 29.47 ? 537 HIS A O   1 
ATOM   3482 C  CB  . HIS B 1 537 ? 64.146 21.301 15.634 1.00 29.18 ? 537 HIS A CB  1 
ATOM   3483 C  CG  . HIS B 1 537 ? 64.208 19.809 15.469 1.00 31.21 ? 537 HIS A CG  1 
ATOM   3484 N  ND1 . HIS B 1 537 ? 65.089 19.194 14.601 1.00 33.34 ? 537 HIS A ND1 1 
ATOM   3485 C  CD2 . HIS B 1 537 ? 63.499 18.813 16.056 1.00 31.49 ? 537 HIS A CD2 1 
ATOM   3486 C  CE1 . HIS B 1 537 ? 64.930 17.882 14.671 1.00 34.50 ? 537 HIS A CE1 1 
ATOM   3487 N  NE2 . HIS B 1 537 ? 63.967 17.625 15.543 1.00 35.67 ? 537 HIS A NE2 1 
ATOM   3488 N  N   . THR B 1 538 ? 64.548 23.809 18.026 1.00 29.21 ? 538 THR A N   1 
ATOM   3489 C  CA  . THR B 1 538 ? 64.634 25.236 18.285 1.00 29.35 ? 538 THR A CA  1 
ATOM   3490 C  C   . THR B 1 538 ? 66.015 25.822 17.953 1.00 30.30 ? 538 THR A C   1 
ATOM   3491 O  O   . THR B 1 538 ? 67.046 25.203 18.226 1.00 28.73 ? 538 THR A O   1 
ATOM   3492 C  CB  . THR B 1 538 ? 64.233 25.505 19.741 1.00 29.76 ? 538 THR A CB  1 
ATOM   3493 O  OG1 . THR B 1 538 ? 62.821 25.317 19.863 1.00 30.88 ? 538 THR A OG1 1 
ATOM   3494 C  CG2 . THR B 1 538 ? 64.586 26.919 20.207 1.00 29.49 ? 538 THR A CG2 1 
ATOM   3495 N  N   . ALA B 1 539 ? 66.033 27.002 17.336 1.00 31.10 ? 539 ALA A N   1 
ATOM   3496 C  CA  . ALA B 1 539 ? 67.296 27.756 17.184 1.00 32.99 ? 539 ALA A CA  1 
ATOM   3497 C  C   . ALA B 1 539 ? 67.142 29.208 17.654 1.00 34.43 ? 539 ALA A C   1 
ATOM   3498 O  O   . ALA B 1 539 ? 66.166 29.878 17.276 1.00 34.97 ? 539 ALA A O   1 
ATOM   3499 C  CB  . ALA B 1 539 ? 67.786 27.710 15.752 1.00 32.65 ? 539 ALA A CB  1 
ATOM   3500 N  N   . PRO B 1 540 ? 68.098 29.703 18.473 1.00 35.37 ? 540 PRO A N   1 
ATOM   3501 C  CA  . PRO B 1 540 ? 68.032 31.052 19.005 1.00 35.87 ? 540 PRO A CA  1 
ATOM   3502 C  C   . PRO B 1 540 ? 68.408 32.052 17.911 1.00 36.97 ? 540 PRO A C   1 
ATOM   3503 O  O   . PRO B 1 540 ? 68.804 31.624 16.822 1.00 36.28 ? 540 PRO A O   1 
ATOM   3504 C  CB  . PRO B 1 540 ? 69.071 31.018 20.125 1.00 36.39 ? 540 PRO A CB  1 
ATOM   3505 C  CG  . PRO B 1 540 ? 70.097 30.088 19.612 1.00 35.69 ? 540 PRO A CG  1 
ATOM   3506 C  CD  . PRO B 1 540 ? 69.317 29.010 18.924 1.00 35.32 ? 540 PRO A CD  1 
ATOM   3507 N  N   . PRO B 1 541 ? 68.268 33.374 18.173 1.00 38.58 ? 541 PRO A N   1 
ATOM   3508 C  CA  . PRO B 1 541 ? 68.567 34.371 17.139 1.00 40.42 ? 541 PRO A CA  1 
ATOM   3509 C  C   . PRO B 1 541 ? 69.976 34.202 16.556 1.00 42.89 ? 541 PRO A C   1 
ATOM   3510 O  O   . PRO B 1 541 ? 70.928 33.886 17.280 1.00 42.38 ? 541 PRO A O   1 
ATOM   3511 C  CB  . PRO B 1 541 ? 68.438 35.705 17.886 1.00 40.44 ? 541 PRO A CB  1 
ATOM   3512 C  CG  . PRO B 1 541 ? 67.501 35.419 19.003 1.00 39.55 ? 541 PRO A CG  1 
ATOM   3513 C  CD  . PRO B 1 541 ? 67.823 34.012 19.430 1.00 38.75 ? 541 PRO A CD  1 
ATOM   3514 N  N   . ALA B 1 542 ? 70.094 34.417 15.256 1.00 45.94 ? 542 ALA A N   1 
ATOM   3515 C  CA  . ALA B 1 542 ? 71.270 33.990 14.505 1.00 49.32 ? 542 ALA A CA  1 
ATOM   3516 C  C   . ALA B 1 542 ? 72.283 35.114 14.310 1.00 52.00 ? 542 ALA A C   1 
ATOM   3517 O  O   . ALA B 1 542 ? 72.162 36.186 14.914 1.00 52.61 ? 542 ALA A O   1 
ATOM   3518 C  CB  . ALA B 1 542 ? 70.830 33.455 13.165 1.00 48.90 ? 542 ALA A CB  1 
ATOM   3519 N  N   . GLU B 1 543 ? 73.286 34.854 13.466 1.00 55.01 ? 543 GLU A N   1 
ATOM   3520 C  CA  . GLU B 1 543 ? 74.095 35.922 12.877 1.00 58.12 ? 543 GLU A CA  1 
ATOM   3521 C  C   . GLU B 1 543 ? 73.198 36.818 12.000 1.00 59.34 ? 543 GLU A C   1 
ATOM   3522 O  O   . GLU B 1 543 ? 71.976 36.879 12.196 1.00 59.98 ? 543 GLU A O   1 
ATOM   3523 C  CB  . GLU B 1 543 ? 75.303 35.362 12.094 1.00 58.04 ? 543 GLU A CB  1 
ATOM   3524 C  CG  . GLU B 1 543 ? 74.963 34.313 11.027 1.00 59.16 ? 543 GLU A CG  1 
ATOM   3525 C  CD  . GLU B 1 543 ? 76.183 33.579 10.455 1.00 59.48 ? 543 GLU A CD  1 
ATOM   3526 O  OE1 . GLU B 1 543 ? 77.211 33.426 11.165 1.00 60.41 ? 543 GLU A OE1 1 
ATOM   3527 O  OE2 . GLU B 1 543 ? 76.101 33.134 9.283  1.00 61.93 ? 543 GLU A OE2 1 
ATOM   3528 N  N   . ALA B 1 544 ? 73.795 37.505 11.037 1.00 60.79 ? 544 ALA A N   1 
ATOM   3529 C  CA  . ALA B 1 544 ? 73.075 38.533 10.301 1.00 62.08 ? 544 ALA A CA  1 
ATOM   3530 C  C   . ALA B 1 544 ? 72.223 37.986 9.145  1.00 62.83 ? 544 ALA A C   1 
ATOM   3531 O  O   . ALA B 1 544 ? 71.116 37.475 9.357  1.00 63.02 ? 544 ALA A O   1 
ATOM   3532 C  CB  . ALA B 1 544 ? 74.061 39.617 9.807  1.00 62.24 ? 544 ALA A CB  1 
ATOM   3533 N  N   . SER B 1 545 ? 72.777 38.085 7.937  1.00 63.63 ? 545 SER A N   1 
ATOM   3534 C  CA  . SER B 1 545 ? 72.038 37.952 6.682  1.00 64.30 ? 545 SER A CA  1 
ATOM   3535 C  C   . SER B 1 545 ? 71.135 36.726 6.579  1.00 64.52 ? 545 SER A C   1 
ATOM   3536 O  O   . SER B 1 545 ? 69.965 36.844 6.191  1.00 64.71 ? 545 SER A O   1 
ATOM   3537 C  CB  . SER B 1 545 ? 73.012 37.976 5.492  1.00 64.40 ? 545 SER A CB  1 
ATOM   3538 O  OG  . SER B 1 545 ? 73.934 39.048 5.601  1.00 64.77 ? 545 SER A OG  1 
ATOM   3539 N  N   . MET B 1 546 ? 71.680 35.561 6.926  1.00 64.53 ? 546 MET A N   1 
ATOM   3540 C  CA  . MET B 1 546 ? 71.017 34.283 6.646  1.00 64.78 ? 546 MET A CA  1 
ATOM   3541 C  C   . MET B 1 546 ? 69.582 34.165 7.205  1.00 63.73 ? 546 MET A C   1 
ATOM   3542 O  O   . MET B 1 546 ? 68.717 33.556 6.563  1.00 63.96 ? 546 MET A O   1 
ATOM   3543 C  CB  . MET B 1 546 ? 71.898 33.095 7.078  1.00 64.80 ? 546 MET A CB  1 
ATOM   3544 C  CG  . MET B 1 546 ? 72.257 33.044 8.565  1.00 65.60 ? 546 MET A CG  1 
ATOM   3545 S  SD  . MET B 1 546 ? 72.559 31.336 9.078  1.00 66.77 ? 546 MET A SD  1 
ATOM   3546 C  CE  . MET B 1 546 ? 72.889 31.510 10.835 1.00 65.74 ? 546 MET A CE  1 
ATOM   3547 N  N   . GLY B 1 547 ? 69.338 34.778 8.369  1.00 62.63 ? 547 GLY A N   1 
ATOM   3548 C  CA  . GLY B 1 547 ? 68.079 34.628 9.106  1.00 60.65 ? 547 GLY A CA  1 
ATOM   3549 C  C   . GLY B 1 547 ? 68.241 33.551 10.165 1.00 59.31 ? 547 GLY A C   1 
ATOM   3550 O  O   . GLY B 1 547 ? 69.301 32.914 10.247 1.00 59.46 ? 547 GLY A O   1 
ATOM   3551 N  N   . THR B 1 548 ? 67.209 33.346 10.981 1.00 57.49 ? 548 THR A N   1 
ATOM   3552 C  CA  . THR B 1 548 ? 67.223 32.258 11.962 1.00 55.63 ? 548 THR A CA  1 
ATOM   3553 C  C   . THR B 1 548 ? 66.493 31.045 11.391 1.00 54.98 ? 548 THR A C   1 
ATOM   3554 O  O   . THR B 1 548 ? 65.304 31.123 11.077 1.00 54.61 ? 548 THR A O   1 
ATOM   3555 C  CB  . THR B 1 548 ? 66.608 32.676 13.318 1.00 55.65 ? 548 THR A CB  1 
ATOM   3556 O  OG1 . THR B 1 548 ? 67.159 33.930 13.733 1.00 54.58 ? 548 THR A OG1 1 
ATOM   3557 C  CG2 . THR B 1 548 ? 66.921 31.651 14.383 1.00 54.97 ? 548 THR A CG2 1 
ATOM   3558 N  N   . ARG B 1 549 ? 67.214 29.931 11.254 1.00 53.77 ? 549 ARG A N   1 
ATOM   3559 C  CA  . ARG B 1 549 ? 66.698 28.738 10.576 1.00 53.03 ? 549 ARG A CA  1 
ATOM   3560 C  C   . ARG B 1 549 ? 66.898 27.462 11.388 1.00 52.02 ? 549 ARG A C   1 
ATOM   3561 O  O   . ARG B 1 549 ? 67.924 27.296 12.052 1.00 51.67 ? 549 ARG A O   1 
ATOM   3562 C  CB  . ARG B 1 549 ? 67.364 28.571 9.200  1.00 53.03 ? 549 ARG A CB  1 
ATOM   3563 C  CG  . ARG B 1 549 ? 67.230 29.786 8.280  1.00 54.21 ? 549 ARG A CG  1 
ATOM   3564 C  CD  . ARG B 1 549 ? 68.092 29.690 7.029  1.00 54.31 ? 549 ARG A CD  1 
ATOM   3565 N  NE  . ARG B 1 549 ? 69.524 29.763 7.334  1.00 58.73 ? 549 ARG A NE  1 
ATOM   3566 C  CZ  . ARG B 1 549 ? 70.398 28.774 7.129  1.00 60.32 ? 549 ARG A CZ  1 
ATOM   3567 N  NH1 . ARG B 1 549 ? 71.677 28.944 7.439  1.00 60.59 ? 549 ARG A NH1 1 
ATOM   3568 N  NH2 . ARG B 1 549 ? 70.005 27.615 6.608  1.00 61.57 ? 549 ARG A NH2 1 
ATOM   3569 N  N   . VAL B 1 550 ? 65.896 26.584 11.342 1.00 50.79 ? 550 VAL A N   1 
ATOM   3570 C  CA  . VAL B 1 550 ? 65.995 25.197 11.815 1.00 49.84 ? 550 VAL A CA  1 
ATOM   3571 C  C   . VAL B 1 550 ? 65.305 24.299 10.811 1.00 49.75 ? 550 VAL A C   1 
ATOM   3572 O  O   . VAL B 1 550 ? 64.398 24.737 10.105 1.00 49.08 ? 550 VAL A O   1 
ATOM   3573 C  CB  . VAL B 1 550 ? 65.297 24.921 13.185 1.00 49.72 ? 550 VAL A CB  1 
ATOM   3574 C  CG1 . VAL B 1 550 ? 66.212 25.190 14.327 1.00 49.26 ? 550 VAL A CG1 1 
ATOM   3575 C  CG2 . VAL B 1 550 ? 63.953 25.649 13.320 1.00 48.95 ? 550 VAL A CG2 1 
ATOM   3576 N  N   . HIS B 1 551 ? 65.715 23.037 10.769 1.00 49.74 ? 551 HIS A N   1 
ATOM   3577 C  CA  . HIS B 1 551 ? 65.039 22.050 9.941  1.00 50.03 ? 551 HIS A CA  1 
ATOM   3578 C  C   . HIS B 1 551 ? 64.901 20.714 10.663 1.00 49.86 ? 551 HIS A C   1 
ATOM   3579 O  O   . HIS B 1 551 ? 65.596 20.456 11.643 1.00 49.28 ? 551 HIS A O   1 
ATOM   3580 C  CB  . HIS B 1 551 ? 65.744 21.885 8.588  1.00 50.21 ? 551 HIS A CB  1 
ATOM   3581 C  CG  . HIS B 1 551 ? 67.080 21.213 8.672  1.00 51.76 ? 551 HIS A CG  1 
ATOM   3582 N  ND1 . HIS B 1 551 ? 68.188 21.818 9.233  1.00 52.36 ? 551 HIS A ND1 1 
ATOM   3583 C  CD2 . HIS B 1 551 ? 67.493 19.999 8.238  1.00 52.60 ? 551 HIS A CD2 1 
ATOM   3584 C  CE1 . HIS B 1 551 ? 69.222 20.998 9.154  1.00 53.54 ? 551 HIS A CE1 1 
ATOM   3585 N  NE2 . HIS B 1 551 ? 68.828 19.887 8.556  1.00 53.65 ? 551 HIS A NE2 1 
ATOM   3586 N  N   . CYS B 1 552 ? 63.979 19.886 10.177 1.00 50.21 ? 552 CYS A N   1 
ATOM   3587 C  CA  . CYS B 1 552 ? 63.800 18.525 10.668 1.00 50.78 ? 552 CYS A CA  1 
ATOM   3588 C  C   . CYS B 1 552 ? 64.838 17.645 9.974  1.00 52.35 ? 552 CYS A C   1 
ATOM   3589 O  O   . CYS B 1 552 ? 64.561 17.054 8.919  1.00 52.75 ? 552 CYS A O   1 
ATOM   3590 C  CB  . CYS B 1 552 ? 62.372 18.030 10.380 1.00 50.23 ? 552 CYS A CB  1 
ATOM   3591 S  SG  . CYS B 1 552 ? 61.034 19.113 11.040 1.00 46.30 ? 552 CYS A SG  1 
ATOM   3592 N  N   . HIS B 1 553 ? 66.030 17.580 10.571 1.00 53.68 ? 553 HIS A N   1 
ATOM   3593 C  CA  . HIS B 1 553 ? 67.206 16.934 9.960  1.00 55.22 ? 553 HIS A CA  1 
ATOM   3594 C  C   . HIS B 1 553 ? 67.046 15.435 9.700  1.00 55.84 ? 553 HIS A C   1 
ATOM   3595 O  O   . HIS B 1 553 ? 67.513 14.936 8.674  1.00 56.16 ? 553 HIS A O   1 
ATOM   3596 C  CB  . HIS B 1 553 ? 68.495 17.214 10.764 1.00 55.40 ? 553 HIS A CB  1 
ATOM   3597 C  CG  . HIS B 1 553 ? 68.464 16.700 12.173 1.00 56.43 ? 553 HIS A CG  1 
ATOM   3598 N  ND1 . HIS B 1 553 ? 68.789 15.401 12.499 1.00 57.37 ? 553 HIS A ND1 1 
ATOM   3599 C  CD2 . HIS B 1 553 ? 68.151 17.313 13.340 1.00 57.18 ? 553 HIS A CD2 1 
ATOM   3600 C  CE1 . HIS B 1 553 ? 68.669 15.232 13.804 1.00 57.82 ? 553 HIS A CE1 1 
ATOM   3601 N  NE2 . HIS B 1 553 ? 68.284 16.377 14.339 1.00 57.31 ? 553 HIS A NE2 1 
ATOM   3602 N  N   . GLN B 1 554 ? 66.380 14.729 10.613 1.00 56.58 ? 554 GLN A N   1 
ATOM   3603 C  CA  . GLN B 1 554 ? 66.221 13.277 10.490 1.00 57.59 ? 554 GLN A CA  1 
ATOM   3604 C  C   . GLN B 1 554 ? 65.181 12.863 9.441  1.00 57.53 ? 554 GLN A C   1 
ATOM   3605 O  O   . GLN B 1 554 ? 64.561 13.713 8.794  1.00 57.71 ? 554 GLN A O   1 
ATOM   3606 C  CB  . GLN B 1 554 ? 65.928 12.629 11.854 1.00 57.72 ? 554 GLN A CB  1 
ATOM   3607 C  CG  . GLN B 1 554 ? 64.880 13.319 12.723 1.00 58.70 ? 554 GLN A CG  1 
ATOM   3608 C  CD  . GLN B 1 554 ? 64.892 12.801 14.163 1.00 58.89 ? 554 GLN A CD  1 
ATOM   3609 O  OE1 . GLN B 1 554 ? 64.928 11.588 14.399 1.00 61.12 ? 554 GLN A OE1 1 
ATOM   3610 N  NE2 . GLN B 1 554 ? 64.865 13.719 15.129 1.00 59.25 ? 554 GLN A NE2 1 
ATOM   3611 N  N   . GLN B 1 555 ? 65.018 11.556 9.246  1.00 57.56 ? 555 GLN A N   1 
ATOM   3612 C  CA  . GLN B 1 555 ? 63.946 11.072 8.380  1.00 57.13 ? 555 GLN A CA  1 
ATOM   3613 C  C   . GLN B 1 555 ? 62.973 10.124 9.087  1.00 56.37 ? 555 GLN A C   1 
ATOM   3614 O  O   . GLN B 1 555 ? 63.177 9.733  10.238 1.00 56.55 ? 555 GLN A O   1 
ATOM   3615 C  CB  . GLN B 1 555 ? 64.464 10.502 7.057  1.00 57.68 ? 555 GLN A CB  1 
ATOM   3616 C  CG  . GLN B 1 555 ? 63.733 11.047 5.809  1.00 59.49 ? 555 GLN A CG  1 
ATOM   3617 C  CD  . GLN B 1 555 ? 62.204 10.938 5.891  1.00 62.37 ? 555 GLN A CD  1 
ATOM   3618 O  OE1 . GLN B 1 555 ? 61.542 11.734 6.572  1.00 63.54 ? 555 GLN A OE1 1 
ATOM   3619 N  NE2 . GLN B 1 555 ? 61.640 9.951  5.193  1.00 63.61 ? 555 GLN A NE2 1 
ATOM   3620 N  N   . GLY B 1 556 ? 61.920 9.758  8.361  1.00 55.35 ? 556 GLY A N   1 
ATOM   3621 C  CA  . GLY B 1 556 ? 60.635 9.421  8.955  1.00 53.56 ? 556 GLY A CA  1 
ATOM   3622 C  C   . GLY B 1 556 ? 59.880 10.716 9.267  1.00 51.99 ? 556 GLY A C   1 
ATOM   3623 O  O   . GLY B 1 556 ? 58.682 10.678 9.572  1.00 52.40 ? 556 GLY A O   1 
ATOM   3624 N  N   . HIS B 1 557 ? 60.574 11.860 9.147  1.00 50.00 ? 557 HIS A N   1 
ATOM   3625 C  CA  . HIS B 1 557 ? 60.122 13.137 9.734  1.00 47.55 ? 557 HIS A CA  1 
ATOM   3626 C  C   . HIS B 1 557 ? 59.617 14.207 8.779  1.00 45.36 ? 557 HIS A C   1 
ATOM   3627 O  O   . HIS B 1 557 ? 60.334 14.654 7.864  1.00 45.24 ? 557 HIS A O   1 
ATOM   3628 C  CB  . HIS B 1 557 ? 61.201 13.730 10.649 1.00 47.69 ? 557 HIS A CB  1 
ATOM   3629 C  CG  . HIS B 1 557 ? 61.427 12.930 11.890 1.00 48.97 ? 557 HIS A CG  1 
ATOM   3630 N  ND1 . HIS B 1 557 ? 61.832 11.610 11.860 1.00 50.22 ? 557 HIS A ND1 1 
ATOM   3631 C  CD2 . HIS B 1 557 ? 61.303 13.257 13.197 1.00 49.42 ? 557 HIS A CD2 1 
ATOM   3632 C  CE1 . HIS B 1 557 ? 61.943 11.158 13.096 1.00 50.37 ? 557 HIS A CE1 1 
ATOM   3633 N  NE2 . HIS B 1 557 ? 61.626 12.137 13.926 1.00 50.82 ? 557 HIS A NE2 1 
ATOM   3634 N  N   . VAL B 1 558 ? 58.375 14.624 9.035  1.00 42.16 ? 558 VAL A N   1 
ATOM   3635 C  CA  . VAL B 1 558 ? 57.751 15.728 8.310  1.00 38.40 ? 558 VAL A CA  1 
ATOM   3636 C  C   . VAL B 1 558 ? 57.657 16.960 9.215  1.00 35.88 ? 558 VAL A C   1 
ATOM   3637 O  O   . VAL B 1 558 ? 57.403 16.842 10.412 1.00 34.68 ? 558 VAL A O   1 
ATOM   3638 C  CB  . VAL B 1 558 ? 56.334 15.352 7.754  1.00 38.66 ? 558 VAL A CB  1 
ATOM   3639 C  CG1 . VAL B 1 558 ? 56.434 14.279 6.663  1.00 38.64 ? 558 VAL A CG1 1 
ATOM   3640 C  CG2 . VAL B 1 558 ? 55.382 14.899 8.879  1.00 37.52 ? 558 VAL A CG2 1 
ATOM   3641 N  N   . LEU B 1 559 ? 57.906 18.127 8.633  1.00 33.53 ? 559 LEU A N   1 
ATOM   3642 C  CA  . LEU B 1 559 ? 57.638 19.388 9.295  1.00 31.91 ? 559 LEU A CA  1 
ATOM   3643 C  C   . LEU B 1 559 ? 56.128 19.669 9.270  1.00 30.64 ? 559 LEU A C   1 
ATOM   3644 O  O   . LEU B 1 559 ? 55.514 19.728 8.191  1.00 30.13 ? 559 LEU A O   1 
ATOM   3645 C  CB  . LEU B 1 559 ? 58.363 20.522 8.577  1.00 32.26 ? 559 LEU A CB  1 
ATOM   3646 C  CG  . LEU B 1 559 ? 58.009 21.898 9.142  1.00 32.35 ? 559 LEU A CG  1 
ATOM   3647 C  CD1 . LEU B 1 559 ? 58.711 22.086 10.484 1.00 29.96 ? 559 LEU A CD1 1 
ATOM   3648 C  CD2 . LEU B 1 559 ? 58.341 23.014 8.151  1.00 33.02 ? 559 LEU A CD2 1 
ATOM   3649 N  N   . THR B 1 560 ? 55.542 19.854 10.449 1.00 28.75 ? 560 THR A N   1 
ATOM   3650 C  CA  . THR B 1 560 ? 54.104 20.146 10.549 1.00 27.46 ? 560 THR A CA  1 
ATOM   3651 C  C   . THR B 1 560 ? 53.750 21.597 10.930 1.00 26.87 ? 560 THR A C   1 
ATOM   3652 O  O   . THR B 1 560 ? 52.600 22.018 10.747 1.00 26.91 ? 560 THR A O   1 
ATOM   3653 C  CB  . THR B 1 560 ? 53.406 19.165 11.521 1.00 27.07 ? 560 THR A CB  1 
ATOM   3654 O  OG1 . THR B 1 560 ? 53.920 19.380 12.834 1.00 25.48 ? 560 THR A OG1 1 
ATOM   3655 C  CG2 . THR B 1 560 ? 53.674 17.729 11.110 1.00 26.75 ? 560 THR A CG2 1 
ATOM   3656 N  N   . GLY B 1 561 ? 54.725 22.352 11.454 1.00 26.02 ? 561 GLY A N   1 
ATOM   3657 C  CA  . GLY B 1 561 ? 54.476 23.693 11.978 1.00 25.75 ? 561 GLY A CA  1 
ATOM   3658 C  C   . GLY B 1 561 ? 55.741 24.486 12.247 1.00 26.51 ? 561 GLY A C   1 
ATOM   3659 O  O   . GLY B 1 561 ? 56.760 23.920 12.620 1.00 25.17 ? 561 GLY A O   1 
ATOM   3660 N  N   . CYS B 1 562 ? 55.667 25.804 12.069 1.00 28.02 ? 562 CYS A N   1 
ATOM   3661 C  CA  . CYS B 1 562 ? 56.768 26.728 12.408 1.00 29.24 ? 562 CYS A CA  1 
ATOM   3662 C  C   . CYS B 1 562 ? 56.256 27.803 13.364 1.00 30.01 ? 562 CYS A C   1 
ATOM   3663 O  O   . CYS B 1 562 ? 55.159 28.368 13.150 1.00 29.39 ? 562 CYS A O   1 
ATOM   3664 C  CB  . CYS B 1 562 ? 57.308 27.424 11.157 1.00 30.40 ? 562 CYS A CB  1 
ATOM   3665 S  SG  . CYS B 1 562 ? 57.996 26.342 9.860  1.00 33.79 ? 562 CYS A SG  1 
ATOM   3666 N  N   . SER B 1 563 ? 57.032 28.077 14.408 1.00 29.15 ? 563 SER A N   1 
ATOM   3667 C  CA  . SER B 1 563 ? 56.733 29.138 15.368 1.00 29.89 ? 563 SER A CA  1 
ATOM   3668 C  C   . SER B 1 563 ? 57.973 30.025 15.498 1.00 30.97 ? 563 SER A C   1 
ATOM   3669 O  O   . SER B 1 563 ? 59.064 29.649 15.053 1.00 30.01 ? 563 SER A O   1 
ATOM   3670 C  CB  . SER B 1 563 ? 56.380 28.560 16.747 1.00 29.78 ? 563 SER A CB  1 
ATOM   3671 O  OG  . SER B 1 563 ? 55.219 27.727 16.694 1.00 30.07 ? 563 SER A OG  1 
ATOM   3672 N  N   . SER B 1 564 ? 57.807 31.188 16.116 1.00 32.15 ? 564 SER A N   1 
ATOM   3673 C  CA  . SER B 1 564 ? 58.938 32.104 16.355 1.00 33.82 ? 564 SER A CA  1 
ATOM   3674 C  C   . SER B 1 564 ? 58.594 33.075 17.472 1.00 35.04 ? 564 SER A C   1 
ATOM   3675 O  O   . SER B 1 564 ? 57.503 33.663 17.485 1.00 34.23 ? 564 SER A O   1 
ATOM   3676 C  CB  . SER B 1 564 ? 59.292 32.874 15.087 1.00 33.49 ? 564 SER A CB  1 
ATOM   3677 O  OG  . SER B 1 564 ? 60.365 33.772 15.324 1.00 36.35 ? 564 SER A OG  1 
ATOM   3678 N  N   . HIS B 1 565 ? 59.522 33.239 18.408 1.00 36.44 ? 565 HIS A N   1 
ATOM   3679 C  CA  . HIS B 1 565 ? 59.368 34.248 19.445 1.00 38.48 ? 565 HIS A CA  1 
ATOM   3680 C  C   . HIS B 1 565 ? 60.634 35.097 19.575 1.00 40.23 ? 565 HIS A C   1 
ATOM   3681 O  O   . HIS B 1 565 ? 61.711 34.705 19.109 1.00 39.74 ? 565 HIS A O   1 
ATOM   3682 C  CB  . HIS B 1 565 ? 58.976 33.614 20.786 1.00 38.23 ? 565 HIS A CB  1 
ATOM   3683 C  CG  . HIS B 1 565 ? 60.142 33.166 21.610 1.00 39.43 ? 565 HIS A CG  1 
ATOM   3684 N  ND1 . HIS B 1 565 ? 60.943 32.106 21.250 1.00 37.97 ? 565 HIS A ND1 1 
ATOM   3685 C  CD2 . HIS B 1 565 ? 60.644 33.639 22.777 1.00 39.57 ? 565 HIS A CD2 1 
ATOM   3686 C  CE1 . HIS B 1 565 ? 61.887 31.941 22.159 1.00 39.35 ? 565 HIS A CE1 1 
ATOM   3687 N  NE2 . HIS B 1 565 ? 61.729 32.859 23.095 1.00 38.54 ? 565 HIS A NE2 1 
ATOM   3688 N  N   . TRP B 1 566 ? 60.485 36.263 20.197 1.00 42.34 ? 566 TRP A N   1 
ATOM   3689 C  CA  . TRP B 1 566 ? 61.585 37.197 20.348 1.00 45.14 ? 566 TRP A CA  1 
ATOM   3690 C  C   . TRP B 1 566 ? 61.583 37.866 21.716 1.00 47.28 ? 566 TRP A C   1 
ATOM   3691 O  O   . TRP B 1 566 ? 60.542 37.996 22.361 1.00 47.10 ? 566 TRP A O   1 
ATOM   3692 C  CB  . TRP B 1 566 ? 61.627 38.213 19.195 1.00 44.69 ? 566 TRP A CB  1 
ATOM   3693 C  CG  . TRP B 1 566 ? 60.340 38.920 18.888 1.00 45.13 ? 566 TRP A CG  1 
ATOM   3694 C  CD1 . TRP B 1 566 ? 59.950 40.145 19.356 1.00 45.52 ? 566 TRP A CD1 1 
ATOM   3695 C  CD2 . TRP B 1 566 ? 59.281 38.469 18.014 1.00 46.18 ? 566 TRP A CD2 1 
ATOM   3696 N  NE1 . TRP B 1 566 ? 58.711 40.477 18.846 1.00 45.97 ? 566 TRP A NE1 1 
ATOM   3697 C  CE2 . TRP B 1 566 ? 58.280 39.472 18.016 1.00 46.22 ? 566 TRP A CE2 1 
ATOM   3698 C  CE3 . TRP B 1 566 ? 59.077 37.314 17.237 1.00 45.31 ? 566 TRP A CE3 1 
ATOM   3699 C  CZ2 . TRP B 1 566 ? 57.090 39.353 17.275 1.00 45.57 ? 566 TRP A CZ2 1 
ATOM   3700 C  CZ3 . TRP B 1 566 ? 57.898 37.200 16.495 1.00 45.26 ? 566 TRP A CZ3 1 
ATOM   3701 C  CH2 . TRP B 1 566 ? 56.921 38.217 16.521 1.00 45.21 ? 566 TRP A CH2 1 
ATOM   3702 N  N   . GLU B 1 567 ? 62.777 38.253 22.156 1.00 50.42 ? 567 GLU A N   1 
ATOM   3703 C  CA  . GLU B 1 567 ? 62.990 38.860 23.465 1.00 53.60 ? 567 GLU A CA  1 
ATOM   3704 C  C   . GLU B 1 567 ? 63.002 40.388 23.315 1.00 55.11 ? 567 GLU A C   1 
ATOM   3705 O  O   . GLU B 1 567 ? 62.645 41.117 24.231 1.00 55.49 ? 567 GLU A O   1 
ATOM   3706 C  CB  . GLU B 1 567 ? 64.319 38.374 24.046 1.00 53.73 ? 567 GLU A CB  1 
ATOM   3707 C  CG  . GLU B 1 567 ? 64.214 37.712 25.417 1.00 57.07 ? 567 GLU A CG  1 
ATOM   3708 C  CD  . GLU B 1 567 ? 64.005 36.199 25.343 1.00 60.91 ? 567 GLU A CD  1 
ATOM   3709 O  OE1 . GLU B 1 567 ? 64.105 35.619 24.237 1.00 62.26 ? 567 GLU A OE1 1 
ATOM   3710 O  OE2 . GLU B 1 567 ? 63.747 35.580 26.403 1.00 63.15 ? 567 GLU A OE2 1 
ATOM   3711 N  N   . VAL B 1 568 ? 63.410 40.848 22.136 1.00 57.30 ? 568 VAL A N   1 
ATOM   3712 C  CA  . VAL B 1 568 ? 63.483 42.270 21.796 1.00 59.32 ? 568 VAL A CA  1 
ATOM   3713 C  C   . VAL B 1 568 ? 62.141 42.985 21.948 1.00 60.71 ? 568 VAL A C   1 
ATOM   3714 O  O   . VAL B 1 568 ? 61.089 42.420 21.649 1.00 60.98 ? 568 VAL A O   1 
ATOM   3715 C  CB  . VAL B 1 568 ? 64.024 42.484 20.347 1.00 59.14 ? 568 VAL A CB  1 
ATOM   3716 C  CG1 . VAL B 1 568 ? 65.550 42.437 20.320 1.00 59.34 ? 568 VAL A CG1 1 
ATOM   3717 C  CG2 . VAL B 1 568 ? 63.443 41.448 19.387 1.00 59.16 ? 568 VAL A CG2 1 
ATOM   3718 N  N   . GLU B 1 569 ? 62.193 44.230 22.416 1.00 62.54 ? 569 GLU A N   1 
ATOM   3719 C  CA  . GLU B 1 569 ? 61.007 45.086 22.530 1.00 64.34 ? 569 GLU A CA  1 
ATOM   3720 C  C   . GLU B 1 569 ? 60.335 45.304 21.170 1.00 65.15 ? 569 GLU A C   1 
ATOM   3721 O  O   . GLU B 1 569 ? 59.103 45.281 21.069 1.00 65.16 ? 569 GLU A O   1 
ATOM   3722 C  CB  . GLU B 1 569 ? 61.380 46.444 23.143 1.00 64.72 ? 569 GLU A CB  1 
ATOM   3723 C  CG  . GLU B 1 569 ? 62.551 47.160 22.436 1.00 66.44 ? 569 GLU A CG  1 
ATOM   3724 C  CD  . GLU B 1 569 ? 62.479 48.680 22.530 1.00 68.97 ? 569 GLU A CD  1 
ATOM   3725 O  OE1 . GLU B 1 569 ? 62.342 49.338 21.468 1.00 70.21 ? 569 GLU A OE1 1 
ATOM   3726 O  OE2 . GLU B 1 569 ? 62.554 49.216 23.660 1.00 69.63 ? 569 GLU A OE2 1 
ATOM   3727 N  N   . ASP B 1 570 ? 61.165 45.493 20.140 1.00 66.19 ? 570 ASP A N   1 
ATOM   3728 C  CA  . ASP B 1 570 ? 60.734 45.874 18.796 1.00 67.18 ? 570 ASP A CA  1 
ATOM   3729 C  C   . ASP B 1 570 ? 61.737 45.357 17.767 1.00 67.57 ? 570 ASP A C   1 
ATOM   3730 O  O   . ASP B 1 570 ? 62.946 45.544 17.926 1.00 67.79 ? 570 ASP A O   1 
ATOM   3731 C  CB  . ASP B 1 570 ? 60.643 47.402 18.693 1.00 67.36 ? 570 ASP A CB  1 
ATOM   3732 C  CG  . ASP B 1 570 ? 60.019 47.870 17.388 1.00 68.19 ? 570 ASP A CG  1 
ATOM   3733 O  OD1 . ASP B 1 570 ? 60.723 48.539 16.593 1.00 68.65 ? 570 ASP A OD1 1 
ATOM   3734 O  OD2 . ASP B 1 570 ? 58.823 47.573 17.162 1.00 69.32 ? 570 ASP A OD2 1 
ATOM   3735 N  N   . LEU B 1 571 ? 61.227 44.718 16.713 1.00 68.03 ? 571 LEU A N   1 
ATOM   3736 C  CA  . LEU B 1 571 ? 62.068 44.061 15.704 1.00 68.30 ? 571 LEU A CA  1 
ATOM   3737 C  C   . LEU B 1 571 ? 62.684 45.044 14.695 1.00 68.58 ? 571 LEU A C   1 
ATOM   3738 O  O   . LEU B 1 571 ? 61.979 45.859 14.085 1.00 68.55 ? 571 LEU A O   1 
ATOM   3739 C  CB  . LEU B 1 571 ? 61.286 42.949 14.977 1.00 68.26 ? 571 LEU A CB  1 
ATOM   3740 C  CG  . LEU B 1 571 ? 60.929 41.662 15.743 1.00 68.31 ? 571 LEU A CG  1 
ATOM   3741 C  CD1 . LEU B 1 571 ? 59.838 40.884 15.020 1.00 67.82 ? 571 LEU A CD1 1 
ATOM   3742 C  CD2 . LEU B 1 571 ? 62.147 40.775 15.977 1.00 67.48 ? 571 LEU A CD2 1 
ATOM   3743 N  N   . GLY B 1 572 ? 64.004 44.953 14.530 1.00 68.66 ? 572 GLY A N   1 
ATOM   3744 C  CA  . GLY B 1 572 ? 64.732 45.816 13.605 1.00 68.92 ? 572 GLY A CA  1 
ATOM   3745 C  C   . GLY B 1 572 ? 65.090 45.096 12.319 1.00 69.02 ? 572 GLY A C   1 
ATOM   3746 O  O   . GLY B 1 572 ? 66.232 45.158 11.861 1.00 69.17 ? 572 GLY A O   1 
ATOM   3747 N  N   . PRO B 1 585 ? 63.065 22.687 2.054  1.00 53.29 ? 585 PRO A N   1 
ATOM   3748 C  CA  . PRO B 1 585 ? 62.156 21.641 2.511  1.00 52.95 ? 585 PRO A CA  1 
ATOM   3749 C  C   . PRO B 1 585 ? 62.387 21.228 3.964  1.00 52.37 ? 585 PRO A C   1 
ATOM   3750 O  O   . PRO B 1 585 ? 63.530 21.116 4.413  1.00 52.42 ? 585 PRO A O   1 
ATOM   3751 C  CB  . PRO B 1 585 ? 62.468 20.485 1.559  1.00 53.15 ? 585 PRO A CB  1 
ATOM   3752 C  CG  . PRO B 1 585 ? 62.761 21.186 0.265  1.00 53.38 ? 585 PRO A CG  1 
ATOM   3753 C  CD  . PRO B 1 585 ? 63.387 22.529 0.624  1.00 53.58 ? 585 PRO A CD  1 
ATOM   3754 N  N   . ASN B 1 586 ? 61.284 21.013 4.681  1.00 51.39 ? 586 ASN A N   1 
ATOM   3755 C  CA  . ASN B 1 586 ? 61.296 20.697 6.106  1.00 50.07 ? 586 ASN A CA  1 
ATOM   3756 C  C   . ASN B 1 586 ? 62.059 21.711 6.953  1.00 48.95 ? 586 ASN A C   1 
ATOM   3757 O  O   . ASN B 1 586 ? 62.548 21.380 8.032  1.00 48.61 ? 586 ASN A O   1 
ATOM   3758 C  CB  . ASN B 1 586 ? 61.817 19.268 6.356  1.00 50.48 ? 586 ASN A CB  1 
ATOM   3759 C  CG  . ASN B 1 586 ? 60.751 18.200 6.147  1.00 51.20 ? 586 ASN A CG  1 
ATOM   3760 O  OD1 . ASN B 1 586 ? 59.591 18.497 5.849  1.00 52.03 ? 586 ASN A OD1 1 
ATOM   3761 N  ND2 . ASN B 1 586 ? 61.143 16.942 6.321  1.00 52.75 ? 586 ASN A ND2 1 
ATOM   3762 N  N   . GLN B 1 587 ? 62.153 22.951 6.481  1.00 47.58 ? 587 GLN A N   1 
ATOM   3763 C  CA  . GLN B 1 587 ? 62.815 23.979 7.277  1.00 46.67 ? 587 GLN A CA  1 
ATOM   3764 C  C   . GLN B 1 587 ? 61.970 25.231 7.531  1.00 45.39 ? 587 GLN A C   1 
ATOM   3765 O  O   . GLN B 1 587 ? 61.114 25.597 6.724  1.00 44.64 ? 587 GLN A O   1 
ATOM   3766 C  CB  . GLN B 1 587 ? 64.244 24.272 6.763  1.00 46.98 ? 587 GLN A CB  1 
ATOM   3767 C  CG  . GLN B 1 587 ? 64.495 25.562 5.981  1.00 47.75 ? 587 GLN A CG  1 
ATOM   3768 C  CD  . GLN B 1 587 ? 65.995 25.925 5.901  1.00 47.73 ? 587 GLN A CD  1 
ATOM   3769 O  OE1 . GLN B 1 587 ? 66.353 27.027 5.492  1.00 48.87 ? 587 GLN A OE1 1 
ATOM   3770 N  NE2 . GLN B 1 587 ? 66.863 25.000 6.307  1.00 49.02 ? 587 GLN A NE2 1 
ATOM   3771 N  N   . CYS B 1 588 ? 62.207 25.851 8.686  1.00 44.28 ? 588 CYS A N   1 
ATOM   3772 C  CA  . CYS B 1 588 ? 61.526 27.081 9.082  1.00 43.11 ? 588 CYS A CA  1 
ATOM   3773 C  C   . CYS B 1 588 ? 62.517 28.235 9.092  1.00 43.60 ? 588 CYS A C   1 
ATOM   3774 O  O   . CYS B 1 588 ? 63.667 28.063 9.489  1.00 43.30 ? 588 CYS A O   1 
ATOM   3775 C  CB  . CYS B 1 588 ? 60.920 26.945 10.485 1.00 42.54 ? 588 CYS A CB  1 
ATOM   3776 S  SG  . CYS B 1 588 ? 59.717 25.635 10.707 1.00 37.96 ? 588 CYS A SG  1 
ATOM   3777 N  N   . VAL B 1 589 ? 62.061 29.414 8.677  1.00 43.84 ? 589 VAL A N   1 
ATOM   3778 C  CA  . VAL B 1 589 ? 62.889 30.615 8.730  1.00 44.48 ? 589 VAL A CA  1 
ATOM   3779 C  C   . VAL B 1 589 ? 62.190 31.757 9.472  1.00 44.41 ? 589 VAL A C   1 
ATOM   3780 O  O   . VAL B 1 589 ? 61.002 31.998 9.264  1.00 44.78 ? 589 VAL A O   1 
ATOM   3781 C  CB  . VAL B 1 589 ? 63.312 31.072 7.322  1.00 44.48 ? 589 VAL A CB  1 
ATOM   3782 C  CG1 . VAL B 1 589 ? 64.290 32.232 7.418  1.00 45.28 ? 589 VAL A CG1 1 
ATOM   3783 C  CG2 . VAL B 1 589 ? 63.935 29.914 6.547  1.00 44.96 ? 589 VAL A CG2 1 
ATOM   3784 N  N   . GLY B 1 590 ? 62.931 32.440 10.342 1.00 44.39 ? 590 GLY A N   1 
ATOM   3785 C  CA  . GLY B 1 590 ? 62.425 33.617 11.053 1.00 44.69 ? 590 GLY A CA  1 
ATOM   3786 C  C   . GLY B 1 590 ? 63.297 34.863 10.921 1.00 45.12 ? 590 GLY A C   1 
ATOM   3787 O  O   . GLY B 1 590 ? 64.330 34.842 10.242 1.00 44.93 ? 590 GLY A O   1 
ATOM   3788 N  N   . HIS B 1 591 ? 62.869 35.949 11.570 1.00 45.12 ? 591 HIS A N   1 
ATOM   3789 C  CA  . HIS B 1 591 ? 63.659 37.179 11.669 1.00 45.22 ? 591 HIS A CA  1 
ATOM   3790 C  C   . HIS B 1 591 ? 64.981 36.918 12.408 1.00 45.06 ? 591 HIS A C   1 
ATOM   3791 O  O   . HIS B 1 591 ? 65.026 36.117 13.354 1.00 44.53 ? 591 HIS A O   1 
ATOM   3792 C  CB  . HIS B 1 591 ? 62.865 38.274 12.391 1.00 45.35 ? 591 HIS A CB  1 
ATOM   3793 C  CG  . HIS B 1 591 ? 63.512 39.626 12.342 1.00 47.10 ? 591 HIS A CG  1 
ATOM   3794 N  ND1 . HIS B 1 591 ? 63.319 40.508 11.298 1.00 49.07 ? 591 HIS A ND1 1 
ATOM   3795 C  CD2 . HIS B 1 591 ? 64.355 40.245 13.203 1.00 48.19 ? 591 HIS A CD2 1 
ATOM   3796 C  CE1 . HIS B 1 591 ? 64.012 41.612 11.522 1.00 49.00 ? 591 HIS A CE1 1 
ATOM   3797 N  NE2 . HIS B 1 591 ? 64.645 41.480 12.675 1.00 48.50 ? 591 HIS A NE2 1 
ATOM   3798 N  N   . ARG B 1 592 ? 66.037 37.619 11.978 1.00 44.73 ? 592 ARG A N   1 
ATOM   3799 C  CA  . ARG B 1 592 ? 67.400 37.472 12.517 1.00 44.64 ? 592 ARG A CA  1 
ATOM   3800 C  C   . ARG B 1 592 ? 67.482 37.605 14.028 1.00 43.12 ? 592 ARG A C   1 
ATOM   3801 O  O   . ARG B 1 592 ? 68.386 37.043 14.652 1.00 43.57 ? 592 ARG A O   1 
ATOM   3802 C  CB  . ARG B 1 592 ? 68.354 38.497 11.874 1.00 44.61 ? 592 ARG A CB  1 
ATOM   3803 C  CG  . ARG B 1 592 ? 68.154 39.949 12.359 1.00 46.34 ? 592 ARG A CG  1 
ATOM   3804 C  CD  . ARG B 1 592 ? 69.028 40.983 11.621 1.00 47.13 ? 592 ARG A CD  1 
ATOM   3805 N  NE  . ARG B 1 592 ? 70.467 40.737 11.773 1.00 53.19 ? 592 ARG A NE  1 
ATOM   3806 C  CZ  . ARG B 1 592 ? 71.177 40.986 12.873 1.00 55.48 ? 592 ARG A CZ  1 
ATOM   3807 N  NH1 . ARG B 1 592 ? 72.480 40.719 12.889 1.00 57.67 ? 592 ARG A NH1 1 
ATOM   3808 N  NH2 . ARG B 1 592 ? 70.599 41.489 13.961 1.00 57.11 ? 592 ARG A NH2 1 
ATOM   3809 N  N   . GLU B 1 593 ? 66.556 38.364 14.609 1.00 41.74 ? 593 GLU A N   1 
ATOM   3810 C  CA  . GLU B 1 593 ? 66.570 38.654 16.049 1.00 40.29 ? 593 GLU A CA  1 
ATOM   3811 C  C   . GLU B 1 593 ? 65.630 37.748 16.824 1.00 38.46 ? 593 GLU A C   1 
ATOM   3812 O  O   . GLU B 1 593 ? 65.475 37.896 18.052 1.00 37.54 ? 593 GLU A O   1 
ATOM   3813 C  CB  . GLU B 1 593 ? 66.176 40.108 16.311 1.00 41.29 ? 593 GLU A CB  1 
ATOM   3814 C  CG  . GLU B 1 593 ? 67.193 41.142 15.868 1.00 43.80 ? 593 GLU A CG  1 
ATOM   3815 C  CD  . GLU B 1 593 ? 66.585 42.530 15.852 1.00 47.95 ? 593 GLU A CD  1 
ATOM   3816 O  OE1 . GLU B 1 593 ? 66.406 43.107 16.951 1.00 49.37 ? 593 GLU A OE1 1 
ATOM   3817 O  OE2 . GLU B 1 593 ? 66.274 43.028 14.742 1.00 49.34 ? 593 GLU A OE2 1 
ATOM   3818 N  N   . ALA B 1 594 ? 65.002 36.815 16.106 1.00 36.42 ? 594 ALA A N   1 
ATOM   3819 C  CA  . ALA B 1 594 ? 64.010 35.914 16.708 1.00 35.01 ? 594 ALA A CA  1 
ATOM   3820 C  C   . ALA B 1 594 ? 64.501 34.460 16.849 1.00 33.72 ? 594 ALA A C   1 
ATOM   3821 O  O   . ALA B 1 594 ? 65.277 33.979 16.024 1.00 33.11 ? 594 ALA A O   1 
ATOM   3822 C  CB  . ALA B 1 594 ? 62.704 35.962 15.891 1.00 34.93 ? 594 ALA A CB  1 
ATOM   3823 N  N   . SER B 1 595 ? 64.025 33.760 17.880 1.00 32.12 ? 595 SER A N   1 
ATOM   3824 C  CA  . SER B 1 595 ? 64.198 32.311 17.937 1.00 30.65 ? 595 SER A CA  1 
ATOM   3825 C  C   . SER B 1 595 ? 63.220 31.636 16.963 1.00 31.10 ? 595 SER A C   1 
ATOM   3826 O  O   . SER B 1 595 ? 62.159 32.182 16.650 1.00 30.69 ? 595 SER A O   1 
ATOM   3827 C  CB  . SER B 1 595 ? 64.000 31.781 19.346 1.00 30.79 ? 595 SER A CB  1 
ATOM   3828 O  OG  . SER B 1 595 ? 64.920 32.367 20.246 1.00 28.58 ? 595 SER A OG  1 
ATOM   3829 N  N   . ILE B 1 596 ? 63.578 30.466 16.465 1.00 30.57 ? 596 ILE A N   1 
ATOM   3830 C  CA  . ILE B 1 596 ? 62.712 29.754 15.550 1.00 30.79 ? 596 ILE A CA  1 
ATOM   3831 C  C   . ILE B 1 596 ? 62.446 28.346 16.048 1.00 30.32 ? 596 ILE A C   1 
ATOM   3832 O  O   . ILE B 1 596 ? 63.348 27.713 16.577 1.00 30.66 ? 596 ILE A O   1 
ATOM   3833 C  CB  . ILE B 1 596 ? 63.277 29.756 14.137 1.00 30.82 ? 596 ILE A CB  1 
ATOM   3834 C  CG1 . ILE B 1 596 ? 62.357 28.960 13.238 1.00 34.00 ? 596 ILE A CG1 1 
ATOM   3835 C  CG2 . ILE B 1 596 ? 64.712 29.203 14.073 1.00 34.03 ? 596 ILE A CG2 1 
ATOM   3836 C  CD1 . ILE B 1 596 ? 62.406 29.435 11.893 1.00 38.71 ? 596 ILE A CD1 1 
ATOM   3837 N  N   . HIS B 1 597 ? 61.211 27.862 15.899 1.00 29.00 ? 597 HIS A N   1 
ATOM   3838 C  CA  . HIS B 1 597 ? 60.817 26.564 16.445 1.00 28.76 ? 597 HIS A CA  1 
ATOM   3839 C  C   . HIS B 1 597 ? 60.086 25.727 15.398 1.00 28.70 ? 597 HIS A C   1 
ATOM   3840 O  O   . HIS B 1 597 ? 59.112 26.189 14.785 1.00 28.63 ? 597 HIS A O   1 
ATOM   3841 C  CB  . HIS B 1 597 ? 59.931 26.738 17.674 1.00 29.38 ? 597 HIS A CB  1 
ATOM   3842 C  CG  . HIS B 1 597 ? 60.400 27.808 18.605 1.00 30.42 ? 597 HIS A CG  1 
ATOM   3843 N  ND1 . HIS B 1 597 ? 61.367 27.587 19.564 1.00 31.55 ? 597 HIS A ND1 1 
ATOM   3844 C  CD2 . HIS B 1 597 ? 60.040 29.108 18.724 1.00 30.84 ? 597 HIS A CD2 1 
ATOM   3845 C  CE1 . HIS B 1 597 ? 61.579 28.706 20.236 1.00 31.30 ? 597 HIS A CE1 1 
ATOM   3846 N  NE2 . HIS B 1 597 ? 60.788 29.643 19.745 1.00 30.94 ? 597 HIS A NE2 1 
ATOM   3847 N  N   . ALA B 1 598 ? 60.567 24.515 15.166 1.00 27.87 ? 598 ALA A N   1 
ATOM   3848 C  CA  . ALA B 1 598 ? 59.955 23.651 14.156 1.00 27.84 ? 598 ALA A CA  1 
ATOM   3849 C  C   . ALA B 1 598 ? 59.322 22.455 14.839 1.00 28.05 ? 598 ALA A C   1 
ATOM   3850 O  O   . ALA B 1 598 ? 59.950 21.830 15.679 1.00 27.19 ? 598 ALA A O   1 
ATOM   3851 C  CB  . ALA B 1 598 ? 60.987 23.223 13.130 1.00 27.31 ? 598 ALA A CB  1 
ATOM   3852 N  N   . SER B 1 599 ? 58.058 22.166 14.519 1.00 28.18 ? 599 SER A N   1 
ATOM   3853 C  CA  . SER B 1 599 ? 57.436 20.935 14.973 1.00 28.97 ? 599 SER A CA  1 
ATOM   3854 C  C   . SER B 1 599 ? 57.728 19.851 13.941 1.00 30.57 ? 599 SER A C   1 
ATOM   3855 O  O   . SER B 1 599 ? 57.374 19.984 12.769 1.00 29.33 ? 599 SER A O   1 
ATOM   3856 C  CB  . SER B 1 599 ? 55.928 21.109 15.174 1.00 29.47 ? 599 SER A CB  1 
ATOM   3857 O  OG  . SER B 1 599 ? 55.282 19.848 15.114 1.00 29.29 ? 599 SER A OG  1 
ATOM   3858 N  N   . CYS B 1 600 ? 58.401 18.793 14.385 1.00 32.36 ? 600 CYS A N   1 
ATOM   3859 C  CA  . CYS B 1 600 ? 58.805 17.712 13.496 1.00 35.21 ? 600 CYS A CA  1 
ATOM   3860 C  C   . CYS B 1 600 ? 58.173 16.435 13.971 1.00 35.76 ? 600 CYS A C   1 
ATOM   3861 O  O   . CYS B 1 600 ? 58.280 16.104 15.145 1.00 35.92 ? 600 CYS A O   1 
ATOM   3862 C  CB  . CYS B 1 600 ? 60.333 17.552 13.502 1.00 35.44 ? 600 CYS A CB  1 
ATOM   3863 S  SG  . CYS B 1 600 ? 61.252 19.025 13.046 1.00 41.74 ? 600 CYS A SG  1 
ATOM   3864 N  N   . CYS B 1 601 ? 57.521 15.707 13.069 1.00 36.88 ? 601 CYS A N   1 
ATOM   3865 C  CA  . CYS B 1 601 ? 56.875 14.462 13.462 1.00 38.73 ? 601 CYS A CA  1 
ATOM   3866 C  C   . CYS B 1 601 ? 57.356 13.286 12.627 1.00 39.37 ? 601 CYS A C   1 
ATOM   3867 O  O   . CYS B 1 601 ? 57.443 13.378 11.404 1.00 39.24 ? 601 CYS A O   1 
ATOM   3868 C  CB  . CYS B 1 601 ? 55.348 14.573 13.374 1.00 38.78 ? 601 CYS A CB  1 
ATOM   3869 S  SG  . CYS B 1 601 ? 54.627 15.790 14.478 1.00 42.11 ? 601 CYS A SG  1 
ATOM   3870 N  N   . HIS B 1 602 ? 57.675 12.187 13.304 1.00 40.55 ? 602 HIS A N   1 
ATOM   3871 C  CA  . HIS B 1 602 ? 57.901 10.925 12.619 1.00 41.63 ? 602 HIS A CA  1 
ATOM   3872 C  C   . HIS B 1 602 ? 56.512 10.323 12.405 1.00 41.75 ? 602 HIS A C   1 
ATOM   3873 O  O   . HIS B 1 602 ? 55.851 9.919  13.353 1.00 41.56 ? 602 HIS A O   1 
ATOM   3874 C  CB  . HIS B 1 602 ? 58.798 10.004 13.456 1.00 42.48 ? 602 HIS A CB  1 
ATOM   3875 C  CG  . HIS B 1 602 ? 59.130 8.697  12.794 1.00 43.90 ? 602 HIS A CG  1 
ATOM   3876 N  ND1 . HIS B 1 602 ? 59.451 7.563  13.510 1.00 46.36 ? 602 HIS A ND1 1 
ATOM   3877 C  CD2 . HIS B 1 602 ? 59.167 8.336  11.488 1.00 45.07 ? 602 HIS A CD2 1 
ATOM   3878 C  CE1 . HIS B 1 602 ? 59.692 6.568  12.672 1.00 46.52 ? 602 HIS A CE1 1 
ATOM   3879 N  NE2 . HIS B 1 602 ? 59.526 7.011  11.439 1.00 45.00 ? 602 HIS A NE2 1 
ATOM   3880 N  N   . ALA B 1 603 ? 56.052 10.351 11.158 1.00 41.96 ? 603 ALA A N   1 
ATOM   3881 C  CA  . ALA B 1 603 ? 54.750 9.821  10.794 1.00 42.01 ? 603 ALA A CA  1 
ATOM   3882 C  C   . ALA B 1 603 ? 54.882 9.341  9.358  1.00 42.72 ? 603 ALA A C   1 
ATOM   3883 O  O   . ALA B 1 603 ? 54.634 10.097 8.414  1.00 42.93 ? 603 ALA A O   1 
ATOM   3884 C  CB  . ALA B 1 603 ? 53.677 10.882 10.923 1.00 42.08 ? 603 ALA A CB  1 
ATOM   3885 N  N   . PRO B 1 604 ? 55.322 8.082  9.186  1.00 43.02 ? 604 PRO A N   1 
ATOM   3886 C  CA  . PRO B 1 604 ? 55.616 7.541  7.861  1.00 42.96 ? 604 PRO A CA  1 
ATOM   3887 C  C   . PRO B 1 604 ? 54.357 7.456  7.003  1.00 42.90 ? 604 PRO A C   1 
ATOM   3888 O  O   . PRO B 1 604 ? 54.450 7.532  5.771  1.00 43.60 ? 604 PRO A O   1 
ATOM   3889 C  CB  . PRO B 1 604 ? 56.161 6.136  8.161  1.00 43.09 ? 604 PRO A CB  1 
ATOM   3890 C  CG  . PRO B 1 604 ? 56.512 6.132  9.620  1.00 43.43 ? 604 PRO A CG  1 
ATOM   3891 C  CD  . PRO B 1 604 ? 55.556 7.090  10.254 1.00 43.21 ? 604 PRO A CD  1 
ATOM   3892 N  N   . GLY B 1 605 ? 53.195 7.325  7.648  1.00 42.01 ? 605 GLY A N   1 
ATOM   3893 C  CA  . GLY B 1 605 ? 51.910 7.353  6.943  1.00 41.55 ? 605 GLY A CA  1 
ATOM   3894 C  C   . GLY B 1 605 ? 51.476 8.683  6.331  1.00 41.10 ? 605 GLY A C   1 
ATOM   3895 O  O   . GLY B 1 605 ? 50.547 8.704  5.518  1.00 41.47 ? 605 GLY A O   1 
ATOM   3896 N  N   . LEU B 1 606 ? 52.137 9.784  6.707  1.00 40.07 ? 606 LEU A N   1 
ATOM   3897 C  CA  . LEU B 1 606 ? 51.718 11.137 6.319  1.00 39.41 ? 606 LEU A CA  1 
ATOM   3898 C  C   . LEU B 1 606 ? 52.543 11.740 5.202  1.00 38.75 ? 606 LEU A C   1 
ATOM   3899 O  O   . LEU B 1 606 ? 53.758 11.608 5.205  1.00 39.03 ? 606 LEU A O   1 
ATOM   3900 C  CB  . LEU B 1 606 ? 51.813 12.103 7.512  1.00 39.51 ? 606 LEU A CB  1 
ATOM   3901 C  CG  . LEU B 1 606 ? 50.771 12.188 8.628  1.00 40.43 ? 606 LEU A CG  1 
ATOM   3902 C  CD1 . LEU B 1 606 ? 50.957 13.536 9.317  1.00 41.40 ? 606 LEU A CD1 1 
ATOM   3903 C  CD2 . LEU B 1 606 ? 49.319 12.028 8.131  1.00 39.69 ? 606 LEU A CD2 1 
ATOM   3904 N  N   . GLU B 1 607 ? 51.886 12.431 4.269  1.00 37.60 ? 607 GLU A N   1 
ATOM   3905 C  CA  . GLU B 1 607 ? 52.591 13.320 3.339  1.00 37.13 ? 607 GLU A CA  1 
ATOM   3906 C  C   . GLU B 1 607 ? 52.181 14.779 3.563  1.00 35.68 ? 607 GLU A C   1 
ATOM   3907 O  O   . GLU B 1 607 ? 51.003 15.072 3.748  1.00 34.57 ? 607 GLU A O   1 
ATOM   3908 C  CB  . GLU B 1 607 ? 52.407 12.890 1.865  1.00 37.06 ? 607 GLU A CB  1 
ATOM   3909 C  CG  . GLU B 1 607 ? 51.036 13.068 1.277  1.00 38.23 ? 607 GLU A CG  1 
ATOM   3910 C  CD  . GLU B 1 607 ? 50.998 12.990 -0.269 1.00 39.36 ? 607 GLU A CD  1 
ATOM   3911 O  OE1 . GLU B 1 607 ? 50.069 12.322 -0.788 1.00 43.63 ? 607 GLU A OE1 1 
ATOM   3912 O  OE2 . GLU B 1 607 ? 51.855 13.607 -0.960 1.00 40.49 ? 607 GLU A OE2 1 
ATOM   3913 N  N   . CYS B 1 608 ? 53.159 15.683 3.569  1.00 34.82 ? 608 CYS A N   1 
ATOM   3914 C  CA  . CYS B 1 608 ? 52.896 17.107 3.760  1.00 34.05 ? 608 CYS A CA  1 
ATOM   3915 C  C   . CYS B 1 608 ? 53.444 17.981 2.627  1.00 33.62 ? 608 CYS A C   1 
ATOM   3916 O  O   . CYS B 1 608 ? 54.499 17.676 2.040  1.00 34.01 ? 608 CYS A O   1 
ATOM   3917 C  CB  . CYS B 1 608 ? 53.445 17.594 5.108  1.00 34.05 ? 608 CYS A CB  1 
ATOM   3918 S  SG  . CYS B 1 608 ? 52.845 16.685 6.559  1.00 35.58 ? 608 CYS A SG  1 
ATOM   3919 N  N   . LYS B 1 609 ? 52.726 19.068 2.340  1.00 32.22 ? 609 LYS A N   1 
ATOM   3920 C  CA  . LYS B 1 609 ? 53.145 20.090 1.382  1.00 32.18 ? 609 LYS A CA  1 
ATOM   3921 C  C   . LYS B 1 609 ? 52.977 21.509 1.958  1.00 32.61 ? 609 LYS A C   1 
ATOM   3922 O  O   . LYS B 1 609 ? 52.206 21.714 2.884  1.00 31.56 ? 609 LYS A O   1 
ATOM   3923 C  CB  . LYS B 1 609 ? 52.370 19.952 0.071  1.00 32.11 ? 609 LYS A CB  1 
ATOM   3924 C  CG  . LYS B 1 609 ? 52.810 18.763 -0.778 1.00 32.44 ? 609 LYS A CG  1 
ATOM   3925 C  CD  . LYS B 1 609 ? 52.131 18.752 -2.160 1.00 32.45 ? 609 LYS A CD  1 
ATOM   3926 C  CE  . LYS B 1 609 ? 52.369 17.416 -2.879 1.00 31.97 ? 609 LYS A CE  1 
ATOM   3927 N  NZ  . LYS B 1 609 ? 51.733 17.371 -4.241 1.00 33.05 ? 609 LYS A NZ  1 
ATOM   3928 N  N   . VAL B 1 610 ? 53.697 22.476 1.393  1.00 32.95 ? 610 VAL A N   1 
ATOM   3929 C  CA  . VAL B 1 610 ? 53.647 23.866 1.846  1.00 33.70 ? 610 VAL A CA  1 
ATOM   3930 C  C   . VAL B 1 610 ? 53.069 24.739 0.735  1.00 34.58 ? 610 VAL A C   1 
ATOM   3931 O  O   . VAL B 1 610 ? 53.499 24.667 -0.413 1.00 34.54 ? 610 VAL A O   1 
ATOM   3932 C  CB  . VAL B 1 610 ? 55.047 24.386 2.304  1.00 33.36 ? 610 VAL A CB  1 
ATOM   3933 C  CG1 . VAL B 1 610 ? 54.953 25.806 2.842  1.00 34.28 ? 610 VAL A CG1 1 
ATOM   3934 C  CG2 . VAL B 1 610 ? 55.611 23.501 3.383  1.00 33.38 ? 610 VAL A CG2 1 
ATOM   3935 N  N   . LYS B 1 611 ? 52.063 25.533 1.073  1.00 34.97 ? 611 LYS A N   1 
ATOM   3936 C  CA  . LYS B 1 611 ? 51.367 26.344 0.099  1.00 36.71 ? 611 LYS A CA  1 
ATOM   3937 C  C   . LYS B 1 611 ? 51.415 27.781 0.589  1.00 38.16 ? 611 LYS A C   1 
ATOM   3938 O  O   . LYS B 1 611 ? 51.066 28.059 1.742  1.00 38.14 ? 611 LYS A O   1 
ATOM   3939 C  CB  . LYS B 1 611 ? 49.919 25.846 -0.054 1.00 36.18 ? 611 LYS A CB  1 
ATOM   3940 C  CG  . LYS B 1 611 ? 49.137 26.469 -1.198 1.00 37.17 ? 611 LYS A CG  1 
ATOM   3941 C  CD  . LYS B 1 611 ? 47.746 25.858 -1.338 1.00 36.82 ? 611 LYS A CD  1 
ATOM   3942 C  CE  . LYS B 1 611 ? 46.964 26.563 -2.439 1.00 38.19 ? 611 LYS A CE  1 
ATOM   3943 N  NZ  . LYS B 1 611 ? 45.512 26.246 -2.404 1.00 38.70 ? 611 LYS A NZ  1 
ATOM   3944 N  N   . GLU B 1 612 ? 51.859 28.694 -0.264 1.00 40.19 ? 612 GLU A N   1 
ATOM   3945 C  CA  . GLU B 1 612 ? 51.953 30.088 0.156  1.00 42.52 ? 612 GLU A CA  1 
ATOM   3946 C  C   . GLU B 1 612 ? 51.202 31.077 -0.740 1.00 43.36 ? 612 GLU A C   1 
ATOM   3947 O  O   . GLU B 1 612 ? 50.901 30.791 -1.897 1.00 43.12 ? 612 GLU A O   1 
ATOM   3948 C  CB  . GLU B 1 612 ? 53.411 30.497 0.369  1.00 42.67 ? 612 GLU A CB  1 
ATOM   3949 C  CG  . GLU B 1 612 ? 54.217 30.570 -0.902 1.00 45.55 ? 612 GLU A CG  1 
ATOM   3950 C  CD  . GLU B 1 612 ? 55.704 30.454 -0.659 1.00 48.66 ? 612 GLU A CD  1 
ATOM   3951 O  OE1 . GLU B 1 612 ? 56.362 29.751 -1.458 1.00 49.61 ? 612 GLU A OE1 1 
ATOM   3952 O  OE2 . GLU B 1 612 ? 56.214 31.049 0.324  1.00 48.35 ? 612 GLU A OE2 1 
ATOM   3953 N  N   . HIS B 1 613 ? 50.877 32.232 -0.170 1.00 45.11 ? 613 HIS A N   1 
ATOM   3954 C  CA  . HIS B 1 613 ? 50.235 33.297 -0.916 1.00 47.16 ? 613 HIS A CA  1 
ATOM   3955 C  C   . HIS B 1 613 ? 50.636 34.643 -0.324 1.00 48.68 ? 613 HIS A C   1 
ATOM   3956 O  O   . HIS B 1 613 ? 50.482 34.883 0.875  1.00 48.52 ? 613 HIS A O   1 
ATOM   3957 C  CB  . HIS B 1 613 ? 48.710 33.109 -0.939 1.00 47.19 ? 613 HIS A CB  1 
ATOM   3958 C  CG  . HIS B 1 613 ? 47.985 34.115 -1.785 1.00 48.06 ? 613 HIS A CG  1 
ATOM   3959 N  ND1 . HIS B 1 613 ? 47.083 35.017 -1.263 1.00 49.02 ? 613 HIS A ND1 1 
ATOM   3960 C  CD2 . HIS B 1 613 ? 48.039 34.365 -3.115 1.00 48.55 ? 613 HIS A CD2 1 
ATOM   3961 C  CE1 . HIS B 1 613 ? 46.614 35.780 -2.235 1.00 49.17 ? 613 HIS A CE1 1 
ATOM   3962 N  NE2 . HIS B 1 613 ? 47.178 35.403 -3.369 1.00 49.28 ? 613 HIS A NE2 1 
ATOM   3963 N  N   . GLY B 1 614 ? 51.182 35.505 -1.177 1.00 50.62 ? 614 GLY A N   1 
ATOM   3964 C  CA  . GLY B 1 614 ? 51.530 36.864 -0.802 1.00 52.71 ? 614 GLY A CA  1 
ATOM   3965 C  C   . GLY B 1 614 ? 50.790 37.851 -1.680 1.00 54.55 ? 614 GLY A C   1 
ATOM   3966 O  O   . GLY B 1 614 ? 50.591 37.607 -2.873 1.00 54.32 ? 614 GLY A O   1 
ATOM   3967 N  N   . ILE B 1 615 ? 50.369 38.963 -1.085 1.00 56.40 ? 615 ILE A N   1 
ATOM   3968 C  CA  . ILE B 1 615 ? 49.636 40.000 -1.811 1.00 58.59 ? 615 ILE A CA  1 
ATOM   3969 C  C   . ILE B 1 615 ? 50.209 41.395 -1.476 1.00 59.72 ? 615 ILE A C   1 
ATOM   3970 O  O   . ILE B 1 615 ? 50.615 41.631 -0.331 1.00 60.00 ? 615 ILE A O   1 
ATOM   3971 C  CB  . ILE B 1 615 ? 48.081 39.881 -1.556 1.00 58.57 ? 615 ILE A CB  1 
ATOM   3972 C  CG1 . ILE B 1 615 ? 47.263 40.689 -2.571 1.00 59.59 ? 615 ILE A CG1 1 
ATOM   3973 C  CG2 . ILE B 1 615 ? 47.705 40.247 -0.124 1.00 59.01 ? 615 ILE A CG2 1 
ATOM   3974 C  CD1 . ILE B 1 615 ? 47.040 39.983 -3.908 1.00 61.68 ? 615 ILE A CD1 1 
ATOM   3975 N  N   . PRO B 1 616 ? 50.321 42.289 -2.488 1.00 61.00 ? 616 PRO A N   1 
ATOM   3976 C  CA  . PRO B 1 616 ? 50.590 43.727 -2.303 1.00 61.91 ? 616 PRO A CA  1 
ATOM   3977 C  C   . PRO B 1 616 ? 49.971 44.357 -1.038 1.00 62.70 ? 616 PRO A C   1 
ATOM   3978 O  O   . PRO B 1 616 ? 48.785 44.169 -0.761 1.00 63.03 ? 616 PRO A O   1 
ATOM   3979 C  CB  . PRO B 1 616 ? 49.979 44.351 -3.558 1.00 61.90 ? 616 PRO A CB  1 
ATOM   3980 C  CG  . PRO B 1 616 ? 50.113 43.283 -4.617 1.00 61.79 ? 616 PRO A CG  1 
ATOM   3981 C  CD  . PRO B 1 616 ? 50.275 41.941 -3.922 1.00 61.11 ? 616 PRO A CD  1 
ATOM   3982 N  N   . ALA B 1 617 ? 50.788 45.133 -0.325 1.00 63.62 ? 617 ALA A N   1 
ATOM   3983 C  CA  . ALA B 1 617 ? 50.536 45.633 1.053  1.00 64.24 ? 617 ALA A CA  1 
ATOM   3984 C  C   . ALA B 1 617 ? 49.101 45.899 1.590  1.00 64.55 ? 617 ALA A C   1 
ATOM   3985 O  O   . ALA B 1 617 ? 48.692 45.233 2.547  1.00 64.82 ? 617 ALA A O   1 
ATOM   3986 C  CB  . ALA B 1 617 ? 51.462 46.846 1.361  1.00 64.32 ? 617 ALA A CB  1 
ATOM   3987 N  N   . PRO B 1 618 ? 48.349 46.865 0.995  1.00 64.74 ? 618 PRO A N   1 
ATOM   3988 C  CA  . PRO B 1 618 ? 47.168 47.481 1.662  1.00 64.57 ? 618 PRO A CA  1 
ATOM   3989 C  C   . PRO B 1 618 ? 46.131 46.573 2.372  1.00 64.23 ? 618 PRO A C   1 
ATOM   3990 O  O   . PRO B 1 618 ? 45.231 47.097 3.045  1.00 64.49 ? 618 PRO A O   1 
ATOM   3991 C  CB  . PRO B 1 618 ? 46.493 48.296 0.532  1.00 64.76 ? 618 PRO A CB  1 
ATOM   3992 C  CG  . PRO B 1 618 ? 47.170 47.872 -0.750 1.00 64.87 ? 618 PRO A CG  1 
ATOM   3993 C  CD  . PRO B 1 618 ? 48.552 47.438 -0.353 1.00 64.78 ? 618 PRO A CD  1 
ATOM   3994 N  N   . GLN B 1 619 ? 46.271 45.250 2.249  1.00 63.35 ? 619 GLN A N   1 
ATOM   3995 C  CA  . GLN B 1 619 ? 45.291 44.284 2.777  1.00 62.54 ? 619 GLN A CA  1 
ATOM   3996 C  C   . GLN B 1 619 ? 45.419 43.949 4.275  1.00 61.22 ? 619 GLN A C   1 
ATOM   3997 O  O   . GLN B 1 619 ? 46.493 43.547 4.745  1.00 61.42 ? 619 GLN A O   1 
ATOM   3998 C  CB  . GLN B 1 619 ? 45.345 42.990 1.954  1.00 62.79 ? 619 GLN A CB  1 
ATOM   3999 C  CG  . GLN B 1 619 ? 44.313 42.910 0.839  1.00 64.58 ? 619 GLN A CG  1 
ATOM   4000 C  CD  . GLN B 1 619 ? 44.504 43.959 -0.245 1.00 66.88 ? 619 GLN A CD  1 
ATOM   4001 O  OE1 . GLN B 1 619 ? 45.625 44.217 -0.702 1.00 67.95 ? 619 GLN A OE1 1 
ATOM   4002 N  NE2 . GLN B 1 619 ? 43.399 44.563 -0.675 1.00 67.81 ? 619 GLN A NE2 1 
ATOM   4003 N  N   . GLU B 1 620 ? 44.308 44.081 5.006  1.00 59.40 ? 620 GLU A N   1 
ATOM   4004 C  CA  . GLU B 1 620 ? 44.275 43.804 6.454  1.00 57.59 ? 620 GLU A CA  1 
ATOM   4005 C  C   . GLU B 1 620 ? 44.264 42.299 6.783  1.00 55.48 ? 620 GLU A C   1 
ATOM   4006 O  O   . GLU B 1 620 ? 44.351 41.903 7.954  1.00 55.08 ? 620 GLU A O   1 
ATOM   4007 C  CB  . GLU B 1 620 ? 43.093 44.533 7.128  1.00 58.23 ? 620 GLU A CB  1 
ATOM   4008 C  CG  . GLU B 1 620 ? 41.679 44.001 6.777  1.00 60.56 ? 620 GLU A CG  1 
ATOM   4009 C  CD  . GLU B 1 620 ? 41.091 43.059 7.846  1.00 63.89 ? 620 GLU A CD  1 
ATOM   4010 O  OE1 . GLU B 1 620 ? 41.452 43.196 9.041  1.00 64.66 ? 620 GLU A OE1 1 
ATOM   4011 O  OE2 . GLU B 1 620 ? 40.254 42.190 7.492  1.00 64.86 ? 620 GLU A OE2 1 
ATOM   4012 N  N   . GLN B 1 621 ? 44.164 41.476 5.739  1.00 52.74 ? 621 GLN A N   1 
ATOM   4013 C  CA  . GLN B 1 621 ? 44.051 40.035 5.877  1.00 50.20 ? 621 GLN A CA  1 
ATOM   4014 C  C   . GLN B 1 621 ? 44.458 39.334 4.582  1.00 48.21 ? 621 GLN A C   1 
ATOM   4015 O  O   . GLN B 1 621 ? 43.958 39.674 3.507  1.00 47.78 ? 621 GLN A O   1 
ATOM   4016 C  CB  . GLN B 1 621 ? 42.616 39.663 6.267  1.00 50.43 ? 621 GLN A CB  1 
ATOM   4017 C  CG  . GLN B 1 621 ? 42.220 38.229 5.959  1.00 50.94 ? 621 GLN A CG  1 
ATOM   4018 C  CD  . GLN B 1 621 ? 40.920 37.829 6.610  1.00 50.84 ? 621 GLN A CD  1 
ATOM   4019 O  OE1 . GLN B 1 621 ? 40.633 38.219 7.742  1.00 52.02 ? 621 GLN A OE1 1 
ATOM   4020 N  NE2 . GLN B 1 621 ? 40.131 37.030 5.907  1.00 51.52 ? 621 GLN A NE2 1 
ATOM   4021 N  N   . VAL B 1 622 ? 45.377 38.373 4.700  1.00 45.54 ? 622 VAL A N   1 
ATOM   4022 C  CA  . VAL B 1 622 ? 45.780 37.495 3.593  1.00 43.31 ? 622 VAL A CA  1 
ATOM   4023 C  C   . VAL B 1 622 ? 45.503 36.059 4.014  1.00 41.62 ? 622 VAL A C   1 
ATOM   4024 O  O   . VAL B 1 622 ? 45.715 35.707 5.171  1.00 41.56 ? 622 VAL A O   1 
ATOM   4025 C  CB  . VAL B 1 622 ? 47.296 37.613 3.269  1.00 43.60 ? 622 VAL A CB  1 
ATOM   4026 C  CG1 . VAL B 1 622 ? 47.644 36.879 1.951  1.00 43.45 ? 622 VAL A CG1 1 
ATOM   4027 C  CG2 . VAL B 1 622 ? 47.734 39.070 3.213  1.00 44.07 ? 622 VAL A CG2 1 
ATOM   4028 N  N   . THR B 1 623 ? 45.040 35.238 3.080  1.00 39.48 ? 623 THR A N   1 
ATOM   4029 C  CA  . THR B 1 623 ? 44.632 33.874 3.379  1.00 38.03 ? 623 THR A CA  1 
ATOM   4030 C  C   . THR B 1 623 ? 45.112 32.902 2.300  1.00 37.24 ? 623 THR A C   1 
ATOM   4031 O  O   . THR B 1 623 ? 45.226 33.266 1.124  1.00 36.66 ? 623 THR A O   1 
ATOM   4032 C  CB  . THR B 1 623 ? 43.098 33.737 3.438  1.00 38.02 ? 623 THR A CB  1 
ATOM   4033 O  OG1 . THR B 1 623 ? 42.571 33.905 2.120  1.00 37.30 ? 623 THR A OG1 1 
ATOM   4034 C  CG2 . THR B 1 623 ? 42.453 34.768 4.396  1.00 37.82 ? 623 THR A CG2 1 
ATOM   4035 N  N   . VAL B 1 624 ? 45.387 31.669 2.718  1.00 35.84 ? 624 VAL A N   1 
ATOM   4036 C  CA  . VAL B 1 624 ? 45.725 30.570 1.814  1.00 35.29 ? 624 VAL A CA  1 
ATOM   4037 C  C   . VAL B 1 624 ? 45.119 29.274 2.368  1.00 35.03 ? 624 VAL A C   1 
ATOM   4038 O  O   . VAL B 1 624 ? 45.205 29.002 3.574  1.00 34.29 ? 624 VAL A O   1 
ATOM   4039 C  CB  . VAL B 1 624 ? 47.269 30.432 1.587  1.00 35.34 ? 624 VAL A CB  1 
ATOM   4040 C  CG1 . VAL B 1 624 ? 47.999 30.071 2.873  1.00 34.87 ? 624 VAL A CG1 1 
ATOM   4041 C  CG2 . VAL B 1 624 ? 47.577 29.410 0.467  1.00 34.86 ? 624 VAL A CG2 1 
ATOM   4042 N  N   . ALA B 1 625 ? 44.491 28.503 1.485  1.00 34.48 ? 625 ALA A N   1 
ATOM   4043 C  CA  . ALA B 1 625 ? 43.744 27.304 1.874  1.00 34.86 ? 625 ALA A CA  1 
ATOM   4044 C  C   . ALA B 1 625 ? 44.385 26.035 1.343  1.00 34.93 ? 625 ALA A C   1 
ATOM   4045 O  O   . ALA B 1 625 ? 44.863 26.026 0.214  1.00 34.61 ? 625 ALA A O   1 
ATOM   4046 C  CB  . ALA B 1 625 ? 42.336 27.396 1.351  1.00 34.52 ? 625 ALA A CB  1 
ATOM   4047 N  N   . CYS B 1 626 ? 44.367 24.964 2.144  1.00 35.29 ? 626 CYS A N   1 
ATOM   4048 C  CA  . CYS B 1 626 ? 44.792 23.640 1.677  1.00 35.50 ? 626 CYS A CA  1 
ATOM   4049 C  C   . CYS B 1 626 ? 43.803 23.091 0.657  1.00 35.82 ? 626 CYS A C   1 
ATOM   4050 O  O   . CYS B 1 626 ? 42.629 23.467 0.658  1.00 35.41 ? 626 CYS A O   1 
ATOM   4051 C  CB  . CYS B 1 626 ? 44.878 22.654 2.840  1.00 35.46 ? 626 CYS A CB  1 
ATOM   4052 S  SG  . CYS B 1 626 ? 46.111 23.097 4.081  1.00 35.86 ? 626 CYS A SG  1 
ATOM   4053 N  N   . GLU B 1 627 ? 44.258 22.167 -0.181 1.00 36.30 ? 627 GLU A N   1 
ATOM   4054 C  CA  . GLU B 1 627 ? 43.364 21.564 -1.167 1.00 37.24 ? 627 GLU A CA  1 
ATOM   4055 C  C   . GLU B 1 627 ? 42.365 20.663 -0.456 1.00 37.03 ? 627 GLU A C   1 
ATOM   4056 O  O   . GLU B 1 627 ? 42.622 20.213 0.665  1.00 36.32 ? 627 GLU A O   1 
ATOM   4057 C  CB  . GLU B 1 627 ? 44.150 20.764 -2.211 1.00 37.79 ? 627 GLU A CB  1 
ATOM   4058 C  CG  . GLU B 1 627 ? 45.317 21.530 -2.851 1.00 40.29 ? 627 GLU A CG  1 
ATOM   4059 C  CD  . GLU B 1 627 ? 44.876 22.781 -3.594 1.00 43.10 ? 627 GLU A CD  1 
ATOM   4060 O  OE1 . GLU B 1 627 ? 45.694 23.729 -3.689 1.00 43.45 ? 627 GLU A OE1 1 
ATOM   4061 O  OE2 . GLU B 1 627 ? 43.716 22.824 -4.071 1.00 44.11 ? 627 GLU A OE2 1 
ATOM   4062 N  N   . GLU B 1 628 ? 41.231 20.408 -1.111 1.00 36.95 ? 628 GLU A N   1 
ATOM   4063 C  CA  . GLU B 1 628 ? 40.204 19.524 -0.573 1.00 37.33 ? 628 GLU A CA  1 
ATOM   4064 C  C   . GLU B 1 628 ? 40.806 18.149 -0.351 1.00 35.79 ? 628 GLU A C   1 
ATOM   4065 O  O   . GLU B 1 628 ? 41.561 17.645 -1.196 1.00 35.49 ? 628 GLU A O   1 
ATOM   4066 C  CB  . GLU B 1 628 ? 38.965 19.464 -1.492 1.00 37.35 ? 628 GLU A CB  1 
ATOM   4067 C  CG  . GLU B 1 628 ? 37.647 19.318 -0.705 1.00 39.93 ? 628 GLU A CG  1 
ATOM   4068 C  CD  . GLU B 1 628 ? 36.376 19.287 -1.571 1.00 40.69 ? 628 GLU A CD  1 
ATOM   4069 O  OE1 . GLU B 1 628 ? 35.471 18.476 -1.257 1.00 45.03 ? 628 GLU A OE1 1 
ATOM   4070 O  OE2 . GLU B 1 628 ? 36.264 20.074 -2.548 1.00 46.11 ? 628 GLU A OE2 1 
ATOM   4071 N  N   . GLY B 1 629 ? 40.497 17.561 0.803  1.00 34.48 ? 629 GLY A N   1 
ATOM   4072 C  CA  . GLY B 1 629 ? 41.098 16.301 1.220  1.00 33.67 ? 629 GLY A CA  1 
ATOM   4073 C  C   . GLY B 1 629 ? 42.391 16.425 2.029  1.00 33.29 ? 629 GLY A C   1 
ATOM   4074 O  O   . GLY B 1 629 ? 42.877 15.433 2.579  1.00 33.39 ? 629 GLY A O   1 
ATOM   4075 N  N   . TRP B 1 630 ? 42.956 17.632 2.110  1.00 32.04 ? 630 TRP A N   1 
ATOM   4076 C  CA  . TRP B 1 630 ? 44.171 17.841 2.919  1.00 30.34 ? 630 TRP A CA  1 
ATOM   4077 C  C   . TRP B 1 630 ? 43.794 18.539 4.228  1.00 30.05 ? 630 TRP A C   1 
ATOM   4078 O  O   . TRP B 1 630 ? 42.797 19.266 4.280  1.00 30.28 ? 630 TRP A O   1 
ATOM   4079 C  CB  . TRP B 1 630 ? 45.206 18.679 2.157  1.00 30.31 ? 630 TRP A CB  1 
ATOM   4080 C  CG  . TRP B 1 630 ? 45.816 18.004 0.970  1.00 29.92 ? 630 TRP A CG  1 
ATOM   4081 C  CD1 . TRP B 1 630 ? 45.220 17.789 -0.237 1.00 30.87 ? 630 TRP A CD1 1 
ATOM   4082 C  CD2 . TRP B 1 630 ? 47.154 17.475 0.857  1.00 29.28 ? 630 TRP A CD2 1 
ATOM   4083 N  NE1 . TRP B 1 630 ? 46.097 17.153 -1.096 1.00 31.31 ? 630 TRP A NE1 1 
ATOM   4084 C  CE2 . TRP B 1 630 ? 47.286 16.946 -0.445 1.00 30.48 ? 630 TRP A CE2 1 
ATOM   4085 C  CE3 . TRP B 1 630 ? 48.246 17.384 1.735  1.00 29.93 ? 630 TRP A CE3 1 
ATOM   4086 C  CZ2 . TRP B 1 630 ? 48.470 16.339 -0.894 1.00 30.68 ? 630 TRP A CZ2 1 
ATOM   4087 C  CZ3 . TRP B 1 630 ? 49.415 16.777 1.296  1.00 29.52 ? 630 TRP A CZ3 1 
ATOM   4088 C  CH2 . TRP B 1 630 ? 49.519 16.270 -0.018 1.00 30.30 ? 630 TRP A CH2 1 
ATOM   4089 N  N   . THR B 1 631 ? 44.591 18.332 5.278  1.00 27.98 ? 631 THR A N   1 
ATOM   4090 C  CA  . THR B 1 631 ? 44.335 18.974 6.554  1.00 26.93 ? 631 THR A CA  1 
ATOM   4091 C  C   . THR B 1 631 ? 45.425 19.987 6.867  1.00 26.18 ? 631 THR A C   1 
ATOM   4092 O  O   . THR B 1 631 ? 46.619 19.655 6.840  1.00 25.05 ? 631 THR A O   1 
ATOM   4093 C  CB  . THR B 1 631 ? 44.251 17.914 7.676  1.00 26.82 ? 631 THR A CB  1 
ATOM   4094 O  OG1 . THR B 1 631 ? 43.207 16.986 7.365  1.00 26.92 ? 631 THR A OG1 1 
ATOM   4095 C  CG2 . THR B 1 631 ? 43.936 18.568 9.007  1.00 27.34 ? 631 THR A CG2 1 
ATOM   4096 N  N   . LEU B 1 632 ? 45.020 21.227 7.134  1.00 25.90 ? 632 LEU A N   1 
ATOM   4097 C  CA  . LEU B 1 632 ? 45.963 22.270 7.568  1.00 26.04 ? 632 LEU A CA  1 
ATOM   4098 C  C   . LEU B 1 632 ? 46.537 21.885 8.922  1.00 25.68 ? 632 LEU A C   1 
ATOM   4099 O  O   . LEU B 1 632 ? 45.792 21.679 9.861  1.00 25.46 ? 632 LEU A O   1 
ATOM   4100 C  CB  . LEU B 1 632 ? 45.301 23.663 7.607  1.00 25.84 ? 632 LEU A CB  1 
ATOM   4101 C  CG  . LEU B 1 632 ? 46.069 24.934 8.039  1.00 26.39 ? 632 LEU A CG  1 
ATOM   4102 C  CD1 . LEU B 1 632 ? 47.157 25.266 7.057  1.00 29.33 ? 632 LEU A CD1 1 
ATOM   4103 C  CD2 . LEU B 1 632 ? 45.150 26.132 8.125  1.00 25.96 ? 632 LEU A CD2 1 
ATOM   4104 N  N   . THR B 1 633 ? 47.864 21.759 8.991  1.00 25.86 ? 633 THR A N   1 
ATOM   4105 C  CA  . THR B 1 633 ? 48.532 21.477 10.263 1.00 26.05 ? 633 THR A CA  1 
ATOM   4106 C  C   . THR B 1 633 ? 49.242 22.689 10.827 1.00 26.49 ? 633 THR A C   1 
ATOM   4107 O  O   . THR B 1 633 ? 49.446 22.764 12.037 1.00 27.32 ? 633 THR A O   1 
ATOM   4108 C  CB  . THR B 1 633 ? 49.534 20.303 10.193 1.00 25.69 ? 633 THR A CB  1 
ATOM   4109 O  OG1 . THR B 1 633 ? 50.665 20.657 9.370  1.00 24.65 ? 633 THR A OG1 1 
ATOM   4110 C  CG2 . THR B 1 633 ? 48.837 19.018 9.702  1.00 26.03 ? 633 THR A CG2 1 
ATOM   4111 N  N   . GLY B 1 634 ? 49.630 23.617 9.950  1.00 26.28 ? 634 GLY A N   1 
ATOM   4112 C  CA  . GLY B 1 634 ? 50.408 24.778 10.350 1.00 26.95 ? 634 GLY A CA  1 
ATOM   4113 C  C   . GLY B 1 634 ? 50.081 26.012 9.539  1.00 27.40 ? 634 GLY A C   1 
ATOM   4114 O  O   . GLY B 1 634 ? 49.898 25.926 8.340  1.00 27.05 ? 634 GLY A O   1 
ATOM   4115 N  N   . CYS B 1 635 ? 49.995 27.154 10.216 1.00 28.90 ? 635 CYS A N   1 
ATOM   4116 C  CA  . CYS B 1 635 ? 49.689 28.452 9.579  1.00 30.06 ? 635 CYS A CA  1 
ATOM   4117 C  C   . CYS B 1 635 ? 50.599 29.552 10.138 1.00 31.04 ? 635 CYS A C   1 
ATOM   4118 O  O   . CYS B 1 635 ? 50.643 29.763 11.348 1.00 29.87 ? 635 CYS A O   1 
ATOM   4119 C  CB  . CYS B 1 635 ? 48.220 28.842 9.823  1.00 29.65 ? 635 CYS A CB  1 
ATOM   4120 S  SG  . CYS B 1 635 ? 47.791 30.571 9.399  1.00 31.06 ? 635 CYS A SG  1 
ATOM   4121 N  N   . SER B 1 636 ? 51.305 30.256 9.257  1.00 32.71 ? 636 SER A N   1 
ATOM   4122 C  CA  . SER B 1 636 ? 52.180 31.358 9.695  1.00 34.43 ? 636 SER A CA  1 
ATOM   4123 C  C   . SER B 1 636 ? 52.345 32.421 8.623  1.00 35.51 ? 636 SER A C   1 
ATOM   4124 O  O   . SER B 1 636 ? 51.952 32.230 7.469  1.00 35.47 ? 636 SER A O   1 
ATOM   4125 C  CB  . SER B 1 636 ? 53.548 30.832 10.147 1.00 34.33 ? 636 SER A CB  1 
ATOM   4126 O  OG  . SER B 1 636 ? 54.220 30.188 9.065  1.00 36.56 ? 636 SER A OG  1 
ATOM   4127 N  N   . ALA B 1 637 ? 52.907 33.556 9.021  1.00 37.60 ? 637 ALA A N   1 
ATOM   4128 C  CA  . ALA B 1 637 ? 53.291 34.595 8.078  1.00 40.30 ? 637 ALA A CA  1 
ATOM   4129 C  C   . ALA B 1 637 ? 54.773 34.487 7.734  1.00 42.16 ? 637 ALA A C   1 
ATOM   4130 O  O   . ALA B 1 637 ? 55.589 34.152 8.593  1.00 42.24 ? 637 ALA A O   1 
ATOM   4131 C  CB  . ALA B 1 637 ? 52.987 35.962 8.654  1.00 40.17 ? 637 ALA A CB  1 
ATOM   4132 N  N   . LEU B 1 638 ? 55.108 34.762 6.477  1.00 44.70 ? 638 LEU A N   1 
ATOM   4133 C  CA  . LEU B 1 638 ? 56.502 34.895 6.059  1.00 47.76 ? 638 LEU A CA  1 
ATOM   4134 C  C   . LEU B 1 638 ? 57.100 36.143 6.727  1.00 49.85 ? 638 LEU A C   1 
ATOM   4135 O  O   . LEU B 1 638 ? 56.470 37.212 6.711  1.00 50.20 ? 638 LEU A O   1 
ATOM   4136 C  CB  . LEU B 1 638 ? 56.595 34.982 4.533  1.00 47.60 ? 638 LEU A CB  1 
ATOM   4137 C  CG  . LEU B 1 638 ? 57.762 34.323 3.786  1.00 48.08 ? 638 LEU A CG  1 
ATOM   4138 C  CD1 . LEU B 1 638 ? 57.827 32.822 4.022  1.00 47.09 ? 638 LEU A CD1 1 
ATOM   4139 C  CD2 . LEU B 1 638 ? 57.660 34.626 2.298  1.00 47.89 ? 638 LEU A CD2 1 
ATOM   4140 N  N   . PRO B 1 639 ? 58.303 36.004 7.341  1.00 51.83 ? 639 PRO A N   1 
ATOM   4141 C  CA  . PRO B 1 639 ? 58.925 37.059 8.164  1.00 53.17 ? 639 PRO A CA  1 
ATOM   4142 C  C   . PRO B 1 639 ? 59.326 38.312 7.387  1.00 54.50 ? 639 PRO A C   1 
ATOM   4143 O  O   . PRO B 1 639 ? 59.649 39.335 8.003  1.00 54.85 ? 639 PRO A O   1 
ATOM   4144 C  CB  . PRO B 1 639 ? 60.172 36.372 8.734  1.00 53.30 ? 639 PRO A CB  1 
ATOM   4145 C  CG  . PRO B 1 639 ? 60.484 35.286 7.753  1.00 52.53 ? 639 PRO A CG  1 
ATOM   4146 C  CD  . PRO B 1 639 ? 59.147 34.794 7.284  1.00 51.97 ? 639 PRO A CD  1 
ATOM   4147 N  N   . GLY B 1 640 ? 59.303 38.228 6.057  1.00 55.77 ? 640 GLY A N   1 
ATOM   4148 C  CA  . GLY B 1 640 ? 59.545 39.377 5.182  1.00 57.47 ? 640 GLY A CA  1 
ATOM   4149 C  C   . GLY B 1 640 ? 58.430 40.414 5.198  1.00 58.62 ? 640 GLY A C   1 
ATOM   4150 O  O   . GLY B 1 640 ? 57.887 40.777 4.147  1.00 58.85 ? 640 GLY A O   1 
ATOM   4151 N  N   . THR B 1 641 ? 58.095 40.888 6.398  1.00 59.45 ? 641 THR A N   1 
ATOM   4152 C  CA  . THR B 1 641 ? 57.045 41.897 6.599  1.00 60.19 ? 641 THR A CA  1 
ATOM   4153 C  C   . THR B 1 641 ? 57.495 42.846 7.726  1.00 60.12 ? 641 THR A C   1 
ATOM   4154 O  O   . THR B 1 641 ? 58.709 43.055 7.895  1.00 60.41 ? 641 THR A O   1 
ATOM   4155 C  CB  . THR B 1 641 ? 55.678 41.232 6.918  1.00 60.28 ? 641 THR A CB  1 
ATOM   4156 O  OG1 . THR B 1 641 ? 55.701 39.850 6.523  1.00 61.33 ? 641 THR A OG1 1 
ATOM   4157 C  CG2 . THR B 1 641 ? 54.566 41.931 6.170  1.00 60.66 ? 641 THR A CG2 1 
ATOM   4158 N  N   . SER B 1 642 ? 56.550 43.416 8.485  1.00 59.78 ? 642 SER A N   1 
ATOM   4159 C  CA  . SER B 1 642 ? 56.886 44.270 9.647  1.00 59.29 ? 642 SER A CA  1 
ATOM   4160 C  C   . SER B 1 642 ? 55.669 44.849 10.405 1.00 58.42 ? 642 SER A C   1 
ATOM   4161 O  O   . SER B 1 642 ? 55.810 45.816 11.174 1.00 58.45 ? 642 SER A O   1 
ATOM   4162 C  CB  . SER B 1 642 ? 57.819 45.419 9.222  1.00 59.71 ? 642 SER A CB  1 
ATOM   4163 O  OG  . SER B 1 642 ? 58.901 45.564 10.136 1.00 61.18 ? 642 SER A OG  1 
ATOM   4164 N  N   . HIS B 1 643 ? 54.493 44.253 10.202 1.00 56.96 ? 643 HIS A N   1 
ATOM   4165 C  CA  . HIS B 1 643 ? 53.230 44.809 10.713 1.00 55.44 ? 643 HIS A CA  1 
ATOM   4166 C  C   . HIS B 1 643 ? 52.162 43.733 10.927 1.00 53.84 ? 643 HIS A C   1 
ATOM   4167 O  O   . HIS B 1 643 ? 50.962 43.963 10.709 1.00 53.78 ? 643 HIS A O   1 
ATOM   4168 C  CB  . HIS B 1 643 ? 52.709 45.876 9.752  1.00 55.92 ? 643 HIS A CB  1 
ATOM   4169 C  CG  . HIS B 1 643 ? 52.544 45.398 8.340  1.00 57.47 ? 643 HIS A CG  1 
ATOM   4170 N  ND1 . HIS B 1 643 ? 53.560 44.795 7.628  1.00 58.90 ? 643 HIS A ND1 1 
ATOM   4171 C  CD2 . HIS B 1 643 ? 51.483 45.459 7.499  1.00 59.25 ? 643 HIS A CD2 1 
ATOM   4172 C  CE1 . HIS B 1 643 ? 53.130 44.501 6.413  1.00 59.89 ? 643 HIS A CE1 1 
ATOM   4173 N  NE2 . HIS B 1 643 ? 51.870 44.885 6.311  1.00 59.73 ? 643 HIS A NE2 1 
ATOM   4174 N  N   . VAL B 1 644 ? 52.605 42.562 11.365 1.00 51.71 ? 644 VAL A N   1 
ATOM   4175 C  CA  . VAL B 1 644 ? 51.713 41.433 11.552 1.00 49.29 ? 644 VAL A CA  1 
ATOM   4176 C  C   . VAL B 1 644 ? 51.085 41.445 12.949 1.00 47.70 ? 644 VAL A C   1 
ATOM   4177 O  O   . VAL B 1 644 ? 51.779 41.595 13.963 1.00 47.52 ? 644 VAL A O   1 
ATOM   4178 C  CB  . VAL B 1 644 ? 52.435 40.102 11.221 1.00 49.60 ? 644 VAL A CB  1 
ATOM   4179 C  CG1 . VAL B 1 644 ? 51.583 38.910 11.577 1.00 49.15 ? 644 VAL A CG1 1 
ATOM   4180 C  CG2 . VAL B 1 644 ? 52.770 40.056 9.734  1.00 49.47 ? 644 VAL A CG2 1 
ATOM   4181 N  N   . LEU B 1 645 ? 49.758 41.314 12.984 1.00 45.24 ? 645 LEU A N   1 
ATOM   4182 C  CA  . LEU B 1 645 ? 49.022 41.206 14.233 1.00 43.08 ? 645 LEU A CA  1 
ATOM   4183 C  C   . LEU B 1 645 ? 49.009 39.765 14.680 1.00 41.35 ? 645 LEU A C   1 
ATOM   4184 O  O   . LEU B 1 645 ? 48.959 39.472 15.872 1.00 40.75 ? 645 LEU A O   1 
ATOM   4185 C  CB  . LEU B 1 645 ? 47.585 41.707 14.071 1.00 43.50 ? 645 LEU A CB  1 
ATOM   4186 C  CG  . LEU B 1 645 ? 47.346 43.110 13.489 1.00 43.54 ? 645 LEU A CG  1 
ATOM   4187 C  CD1 . LEU B 1 645 ? 45.861 43.447 13.576 1.00 44.39 ? 645 LEU A CD1 1 
ATOM   4188 C  CD2 . LEU B 1 645 ? 48.191 44.169 14.196 1.00 44.03 ? 645 LEU A CD2 1 
ATOM   4189 N  N   . GLY B 1 646 ? 49.037 38.865 13.705 1.00 39.60 ? 646 GLY A N   1 
ATOM   4190 C  CA  . GLY B 1 646 ? 49.103 37.445 13.996 1.00 37.37 ? 646 GLY A CA  1 
ATOM   4191 C  C   . GLY B 1 646 ? 48.656 36.584 12.843 1.00 35.52 ? 646 GLY A C   1 
ATOM   4192 O  O   . GLY B 1 646 ? 48.489 37.053 11.713 1.00 35.04 ? 646 GLY A O   1 
ATOM   4193 N  N   . ALA B 1 647 ? 48.474 35.306 13.148 1.00 34.19 ? 647 ALA A N   1 
ATOM   4194 C  CA  . ALA B 1 647 ? 48.082 34.304 12.161 1.00 32.38 ? 647 ALA A CA  1 
ATOM   4195 C  C   . ALA B 1 647 ? 47.319 33.176 12.852 1.00 31.35 ? 647 ALA A C   1 
ATOM   4196 O  O   . ALA B 1 647 ? 47.574 32.865 14.025 1.00 30.91 ? 647 ALA A O   1 
ATOM   4197 C  CB  . ALA B 1 647 ? 49.317 33.760 11.448 1.00 32.88 ? 647 ALA A CB  1 
ATOM   4198 N  N   . TYR B 1 648 ? 46.374 32.575 12.132 1.00 29.89 ? 648 TYR A N   1 
ATOM   4199 C  CA  . TYR B 1 648 ? 45.526 31.504 12.699 1.00 28.42 ? 648 TYR A CA  1 
ATOM   4200 C  C   . TYR B 1 648 ? 44.899 30.653 11.607 1.00 27.03 ? 648 TYR A C   1 
ATOM   4201 O  O   . TYR B 1 648 ? 44.593 31.137 10.524 1.00 26.06 ? 648 TYR A O   1 
ATOM   4202 C  CB  . TYR B 1 648 ? 44.444 32.048 13.650 1.00 28.95 ? 648 TYR A CB  1 
ATOM   4203 C  CG  . TYR B 1 648 ? 43.722 33.279 13.154 1.00 29.90 ? 648 TYR A CG  1 
ATOM   4204 C  CD1 . TYR B 1 648 ? 42.579 33.175 12.375 1.00 30.40 ? 648 TYR A CD1 1 
ATOM   4205 C  CD2 . TYR B 1 648 ? 44.176 34.561 13.481 1.00 30.96 ? 648 TYR A CD2 1 
ATOM   4206 C  CE1 . TYR B 1 648 ? 41.905 34.314 11.937 1.00 30.21 ? 648 TYR A CE1 1 
ATOM   4207 C  CE2 . TYR B 1 648 ? 43.506 35.701 13.035 1.00 30.46 ? 648 TYR A CE2 1 
ATOM   4208 C  CZ  . TYR B 1 648 ? 42.379 35.563 12.268 1.00 29.99 ? 648 TYR A CZ  1 
ATOM   4209 O  OH  . TYR B 1 648 ? 41.720 36.685 11.807 1.00 32.39 ? 648 TYR A OH  1 
ATOM   4210 N  N   . ALA B 1 649 ? 44.756 29.373 11.916 1.00 26.71 ? 649 ALA A N   1 
ATOM   4211 C  CA  . ALA B 1 649 ? 44.044 28.429 11.084 1.00 26.85 ? 649 ALA A CA  1 
ATOM   4212 C  C   . ALA B 1 649 ? 42.555 28.609 11.344 1.00 26.68 ? 649 ALA A C   1 
ATOM   4213 O  O   . ALA B 1 649 ? 42.130 28.747 12.493 1.00 27.44 ? 649 ALA A O   1 
ATOM   4214 C  CB  . ALA B 1 649 ? 44.471 27.017 11.432 1.00 25.82 ? 649 ALA A CB  1 
ATOM   4215 N  N   . VAL B 1 650 ? 41.780 28.660 10.270 1.00 26.50 ? 650 VAL A N   1 
ATOM   4216 C  CA  . VAL B 1 650 ? 40.324 28.671 10.348 1.00 26.50 ? 650 VAL A CA  1 
ATOM   4217 C  C   . VAL B 1 650 ? 39.943 27.485 9.481  1.00 26.35 ? 650 VAL A C   1 
ATOM   4218 O  O   . VAL B 1 650 ? 40.058 27.561 8.266  1.00 27.39 ? 650 VAL A O   1 
ATOM   4219 C  CB  . VAL B 1 650 ? 39.711 29.993 9.794  1.00 25.95 ? 650 VAL A CB  1 
ATOM   4220 C  CG1 . VAL B 1 650 ? 38.184 29.959 9.864  1.00 26.66 ? 650 VAL A CG1 1 
ATOM   4221 C  CG2 . VAL B 1 650 ? 40.206 31.195 10.580 1.00 26.90 ? 650 VAL A CG2 1 
ATOM   4222 N  N   . ASP B 1 651 ? 39.563 26.370 10.105 1.00 27.07 ? 651 ASP A N   1 
ATOM   4223 C  CA  . ASP B 1 651 ? 39.313 25.098 9.386  1.00 27.50 ? 651 ASP A CA  1 
ATOM   4224 C  C   . ASP B 1 651 ? 40.564 24.685 8.579  1.00 27.71 ? 651 ASP A C   1 
ATOM   4225 O  O   . ASP B 1 651 ? 41.602 24.436 9.178  1.00 27.64 ? 651 ASP A O   1 
ATOM   4226 C  CB  . ASP B 1 651 ? 38.049 25.194 8.524  1.00 27.92 ? 651 ASP A CB  1 
ATOM   4227 C  CG  A ASP B 1 651 ? 36.796 25.415 9.347  0.50 28.24 ? 651 ASP A CG  1 
ATOM   4228 C  CG  B ASP B 1 651 ? 37.737 23.891 7.791  0.50 28.04 ? 651 ASP A CG  1 
ATOM   4229 O  OD1 A ASP B 1 651 ? 36.726 24.932 10.507 0.50 28.63 ? 651 ASP A OD1 1 
ATOM   4230 O  OD1 B ASP B 1 651 ? 37.343 23.953 6.605  0.50 29.61 ? 651 ASP A OD1 1 
ATOM   4231 O  OD2 A ASP B 1 651 ? 35.872 26.073 8.824  0.50 28.74 ? 651 ASP A OD2 1 
ATOM   4232 O  OD2 B ASP B 1 651 ? 37.893 22.807 8.389  0.50 28.58 ? 651 ASP A OD2 1 
ATOM   4233 N  N   . ASN B 1 652 ? 40.499 24.651 7.246  1.00 27.88 ? 652 ASN A N   1 
ATOM   4234 C  CA  . ASN B 1 652 ? 41.715 24.356 6.459  1.00 28.08 ? 652 ASN A CA  1 
ATOM   4235 C  C   . ASN B 1 652 ? 42.336 25.547 5.740  1.00 28.11 ? 652 ASN A C   1 
ATOM   4236 O  O   . ASN B 1 652 ? 43.124 25.378 4.809  1.00 27.55 ? 652 ASN A O   1 
ATOM   4237 C  CB  . ASN B 1 652 ? 41.514 23.135 5.544  1.00 28.20 ? 652 ASN A CB  1 
ATOM   4238 C  CG  . ASN B 1 652 ? 41.359 21.849 6.338  1.00 30.41 ? 652 ASN A CG  1 
ATOM   4239 O  OD1 . ASN B 1 652 ? 40.456 21.045 6.078  1.00 34.12 ? 652 ASN A OD1 1 
ATOM   4240 N  ND2 . ASN B 1 652 ? 42.200 21.678 7.354  1.00 29.15 ? 652 ASN A ND2 1 
ATOM   4241 N  N   . THR B 1 653 ? 42.016 26.748 6.232  1.00 28.62 ? 653 THR A N   1 
ATOM   4242 C  CA  . THR B 1 653 ? 42.495 27.998 5.669  1.00 29.28 ? 653 THR A CA  1 
ATOM   4243 C  C   . THR B 1 653 ? 43.390 28.741 6.661  1.00 29.37 ? 653 THR A C   1 
ATOM   4244 O  O   . THR B 1 653 ? 43.004 28.964 7.814  1.00 29.14 ? 653 THR A O   1 
ATOM   4245 C  CB  . THR B 1 653 ? 41.303 28.905 5.249  1.00 29.56 ? 653 THR A CB  1 
ATOM   4246 O  OG1 . THR B 1 653 ? 40.504 28.220 4.270  1.00 30.60 ? 653 THR A OG1 1 
ATOM   4247 C  CG2 . THR B 1 653 ? 41.802 30.218 4.663  1.00 30.54 ? 653 THR A CG2 1 
ATOM   4248 N  N   . CYS B 1 654 ? 44.588 29.111 6.207  1.00 29.06 ? 654 CYS A N   1 
ATOM   4249 C  CA  . CYS B 1 654 ? 45.509 29.911 7.017  1.00 29.68 ? 654 CYS A CA  1 
ATOM   4250 C  C   . CYS B 1 654 ? 45.208 31.406 6.849  1.00 29.22 ? 654 CYS A C   1 
ATOM   4251 O  O   . CYS B 1 654 ? 45.192 31.903 5.739  1.00 28.13 ? 654 CYS A O   1 
ATOM   4252 C  CB  . CYS B 1 654 ? 46.977 29.609 6.632  1.00 29.23 ? 654 CYS A CB  1 
ATOM   4253 S  SG  . CYS B 1 654 ? 48.215 30.686 7.416  1.00 29.09 ? 654 CYS A SG  1 
ATOM   4254 N  N   . VAL B 1 655 ? 44.995 32.108 7.959  1.00 30.58 ? 655 VAL A N   1 
ATOM   4255 C  CA  . VAL B 1 655 ? 44.737 33.554 7.922  1.00 31.10 ? 655 VAL A CA  1 
ATOM   4256 C  C   . VAL B 1 655 ? 45.876 34.357 8.531  1.00 31.83 ? 655 VAL A C   1 
ATOM   4257 O  O   . VAL B 1 655 ? 46.237 34.169 9.696  1.00 31.35 ? 655 VAL A O   1 
ATOM   4258 C  CB  . VAL B 1 655 ? 43.377 33.965 8.635  1.00 30.91 ? 655 VAL A CB  1 
ATOM   4259 C  CG1 . VAL B 1 655 ? 43.065 35.451 8.399  1.00 29.79 ? 655 VAL A CG1 1 
ATOM   4260 C  CG2 . VAL B 1 655 ? 42.204 33.113 8.152  1.00 31.69 ? 655 VAL A CG2 1 
ATOM   4261 N  N   . VAL B 1 656 ? 46.422 35.287 7.755  1.00 33.28 ? 656 VAL A N   1 
ATOM   4262 C  CA  . VAL B 1 656 ? 47.394 36.232 8.292  1.00 34.86 ? 656 VAL A CA  1 
ATOM   4263 C  C   . VAL B 1 656 ? 46.781 37.635 8.389  1.00 36.47 ? 656 VAL A C   1 
ATOM   4264 O  O   . VAL B 1 656 ? 46.242 38.150 7.409  1.00 36.31 ? 656 VAL A O   1 
ATOM   4265 C  CB  . VAL B 1 656 ? 48.696 36.279 7.448  1.00 35.19 ? 656 VAL A CB  1 
ATOM   4266 C  CG1 . VAL B 1 656 ? 49.585 37.437 7.919  1.00 35.19 ? 656 VAL A CG1 1 
ATOM   4267 C  CG2 . VAL B 1 656 ? 49.462 34.961 7.565  1.00 34.91 ? 656 VAL A CG2 1 
ATOM   4268 N  N   . ARG B 1 657 ? 46.892 38.242 9.569  1.00 38.50 ? 657 ARG A N   1 
ATOM   4269 C  CA  . ARG B 1 657 ? 46.317 39.558 9.831  1.00 40.97 ? 657 ARG A CA  1 
ATOM   4270 C  C   . ARG B 1 657 ? 47.406 40.619 10.031 1.00 42.52 ? 657 ARG A C   1 
ATOM   4271 O  O   . ARG B 1 657 ? 48.279 40.480 10.891 1.00 42.00 ? 657 ARG A O   1 
ATOM   4272 C  CB  . ARG B 1 657 ? 45.388 39.496 11.047 1.00 40.65 ? 657 ARG A CB  1 
ATOM   4273 C  CG  . ARG B 1 657 ? 44.127 38.628 10.839 1.00 41.74 ? 657 ARG A CG  1 
ATOM   4274 C  CD  . ARG B 1 657 ? 42.968 39.423 10.232 1.00 42.38 ? 657 ARG A CD  1 
ATOM   4275 N  NE  . ARG B 1 657 ? 42.678 40.598 11.049 1.00 43.65 ? 657 ARG A NE  1 
ATOM   4276 C  CZ  . ARG B 1 657 ? 41.886 40.610 12.120 1.00 44.85 ? 657 ARG A CZ  1 
ATOM   4277 N  NH1 . ARG B 1 657 ? 41.255 39.509 12.522 1.00 43.57 ? 657 ARG A NH1 1 
ATOM   4278 N  NH2 . ARG B 1 657 ? 41.719 41.741 12.794 1.00 45.66 ? 657 ARG A NH2 1 
ATOM   4279 N  N   . SER B 1 658 ? 47.343 41.670 9.219  1.00 45.02 ? 658 SER A N   1 
ATOM   4280 C  CA  . SER B 1 658 ? 48.304 42.786 9.283  1.00 47.84 ? 658 SER A CA  1 
ATOM   4281 C  C   . SER B 1 658 ? 47.611 44.133 9.545  1.00 49.35 ? 658 SER A C   1 
ATOM   4282 O  O   . SER B 1 658 ? 46.401 44.254 9.339  1.00 49.93 ? 658 SER A O   1 
ATOM   4283 C  CB  . SER B 1 658 ? 49.144 42.844 7.998  1.00 47.89 ? 658 SER A CB  1 
ATOM   4284 O  OG  . SER B 1 658 ? 48.364 42.527 6.851  1.00 49.90 ? 658 SER A OG  1 
ATOM   4285 N  N   . ARG B 1 659 ? 48.373 45.132 10.007 1.00 51.09 ? 659 ARG A N   1 
ATOM   4286 C  CA  . ARG B 1 659 ? 47.810 46.451 10.350 1.00 52.57 ? 659 ARG A CA  1 
ATOM   4287 C  C   . ARG B 1 659 ? 47.640 47.347 9.125  1.00 52.79 ? 659 ARG A C   1 
ATOM   4288 O  O   . ARG B 1 659 ? 48.441 47.301 8.189  1.00 53.43 ? 659 ARG A O   1 
ATOM   4289 C  CB  . ARG B 1 659 ? 48.665 47.158 11.414 1.00 53.04 ? 659 ARG A CB  1 
ATOM   4290 C  CG  . ARG B 1 659 ? 47.872 48.087 12.338 1.00 55.09 ? 659 ARG A CG  1 
ATOM   4291 C  CD  . ARG B 1 659 ? 48.335 47.956 13.793 1.00 58.73 ? 659 ARG A CD  1 
ATOM   4292 N  NE  . ARG B 1 659 ? 47.384 48.508 14.770 1.00 61.68 ? 659 ARG A NE  1 
ATOM   4293 C  CZ  . ARG B 1 659 ? 46.250 47.916 15.162 1.00 62.96 ? 659 ARG A CZ  1 
ATOM   4294 N  NH1 . ARG B 1 659 ? 45.879 46.749 14.648 1.00 64.10 ? 659 ARG A NH1 1 
ATOM   4295 N  NH2 . ARG B 1 659 ? 45.467 48.501 16.065 1.00 63.06 ? 659 ARG A NH2 1 
ATOM   4296 N  N   . SER B 1 668 ? 58.785 50.998 -2.187 1.00 71.03 ? 668 SER A N   1 
ATOM   4297 C  CA  . SER B 1 668 ? 58.140 49.949 -1.407 1.00 70.97 ? 668 SER A CA  1 
ATOM   4298 C  C   . SER B 1 668 ? 56.746 49.605 -1.925 1.00 70.90 ? 668 SER A C   1 
ATOM   4299 O  O   . SER B 1 668 ? 55.891 50.483 -2.112 1.00 70.95 ? 668 SER A O   1 
ATOM   4300 C  CB  . SER B 1 668 ? 58.074 50.322 0.080  1.00 71.05 ? 668 SER A CB  1 
ATOM   4301 O  OG  . SER B 1 668 ? 59.099 49.675 0.817  1.00 71.00 ? 668 SER A OG  1 
ATOM   4302 N  N   . GLU B 1 669 ? 56.551 48.309 -2.161 1.00 70.43 ? 669 GLU A N   1 
ATOM   4303 C  CA  . GLU B 1 669 ? 55.260 47.723 -2.491 1.00 69.97 ? 669 GLU A CA  1 
ATOM   4304 C  C   . GLU B 1 669 ? 55.255 46.323 -1.838 1.00 69.28 ? 669 GLU A C   1 
ATOM   4305 O  O   . GLU B 1 669 ? 54.886 45.319 -2.463 1.00 69.22 ? 669 GLU A O   1 
ATOM   4306 C  CB  . GLU B 1 669 ? 55.098 47.649 -4.016 1.00 70.05 ? 669 GLU A CB  1 
ATOM   4307 C  CG  . GLU B 1 669 ? 53.704 48.006 -4.540 1.00 70.64 ? 669 GLU A CG  1 
ATOM   4308 C  CD  . GLU B 1 669 ? 53.712 48.463 -6.001 1.00 70.76 ? 669 GLU A CD  1 
ATOM   4309 O  OE1 . GLU B 1 669 ? 54.150 47.686 -6.884 1.00 71.26 ? 669 GLU A OE1 1 
ATOM   4310 O  OE2 . GLU B 1 669 ? 53.266 49.604 -6.268 1.00 72.08 ? 669 GLU A OE2 1 
ATOM   4311 N  N   . GLU B 1 670 ? 55.674 46.279 -0.570 1.00 68.22 ? 670 GLU A N   1 
ATOM   4312 C  CA  . GLU B 1 670 ? 56.006 45.022 0.118  1.00 67.15 ? 670 GLU A CA  1 
ATOM   4313 C  C   . GLU B 1 670 ? 54.808 44.093 0.306  1.00 66.07 ? 670 GLU A C   1 
ATOM   4314 O  O   . GLU B 1 670 ? 53.681 44.549 0.519  1.00 66.45 ? 670 GLU A O   1 
ATOM   4315 C  CB  . GLU B 1 670 ? 56.706 45.285 1.465  1.00 67.18 ? 670 GLU A CB  1 
ATOM   4316 C  CG  . GLU B 1 670 ? 55.838 45.959 2.535  1.00 67.48 ? 670 GLU A CG  1 
ATOM   4317 C  CD  . GLU B 1 670 ? 56.375 45.774 3.952  1.00 67.61 ? 670 GLU A CD  1 
ATOM   4318 O  OE1 . GLU B 1 670 ? 55.598 45.987 4.910  1.00 67.98 ? 670 GLU A OE1 1 
ATOM   4319 O  OE2 . GLU B 1 670 ? 57.566 45.416 4.114  1.00 67.63 ? 670 GLU A OE2 1 
ATOM   4320 N  N   . ALA B 1 671 ? 55.065 42.789 0.233  1.00 64.34 ? 671 ALA A N   1 
ATOM   4321 C  CA  . ALA B 1 671 ? 54.005 41.794 0.362  1.00 62.43 ? 671 ALA A CA  1 
ATOM   4322 C  C   . ALA B 1 671 ? 53.893 41.239 1.783  1.00 60.78 ? 671 ALA A C   1 
ATOM   4323 O  O   . ALA B 1 671 ? 54.887 41.130 2.506  1.00 60.87 ? 671 ALA A O   1 
ATOM   4324 C  CB  . ALA B 1 671 ? 54.205 40.661 -0.646 1.00 62.46 ? 671 ALA A CB  1 
ATOM   4325 N  N   . VAL B 1 672 ? 52.660 40.929 2.175  1.00 58.49 ? 672 VAL A N   1 
ATOM   4326 C  CA  . VAL B 1 672 ? 52.388 40.102 3.341  1.00 55.92 ? 672 VAL A CA  1 
ATOM   4327 C  C   . VAL B 1 672 ? 52.131 38.712 2.769  1.00 53.75 ? 672 VAL A C   1 
ATOM   4328 O  O   . VAL B 1 672 ? 51.410 38.581 1.778  1.00 53.42 ? 672 VAL A O   1 
ATOM   4329 C  CB  . VAL B 1 672 ? 51.137 40.582 4.117  1.00 56.15 ? 672 VAL A CB  1 
ATOM   4330 C  CG1 . VAL B 1 672 ? 50.901 39.720 5.357  1.00 56.32 ? 672 VAL A CG1 1 
ATOM   4331 C  CG2 . VAL B 1 672 ? 51.270 42.046 4.510  1.00 56.79 ? 672 VAL A CG2 1 
ATOM   4332 N  N   . THR B 1 673 ? 52.723 37.687 3.378  1.00 51.01 ? 673 THR A N   1 
ATOM   4333 C  CA  . THR B 1 673 ? 52.586 36.322 2.865  1.00 48.40 ? 673 THR A CA  1 
ATOM   4334 C  C   . THR B 1 673 ? 52.050 35.317 3.891  1.00 46.00 ? 673 THR A C   1 
ATOM   4335 O  O   . THR B 1 673 ? 52.623 35.159 4.967  1.00 45.62 ? 673 THR A O   1 
ATOM   4336 C  CB  . THR B 1 673 ? 53.920 35.821 2.273  1.00 48.82 ? 673 THR A CB  1 
ATOM   4337 O  OG1 . THR B 1 673 ? 54.348 36.715 1.237  1.00 50.34 ? 673 THR A OG1 1 
ATOM   4338 C  CG2 . THR B 1 673 ? 53.772 34.411 1.692  1.00 48.63 ? 673 THR A CG2 1 
ATOM   4339 N  N   . ALA B 1 674 ? 50.951 34.646 3.535  1.00 43.29 ? 674 ALA A N   1 
ATOM   4340 C  CA  . ALA B 1 674 ? 50.417 33.513 4.301  1.00 40.45 ? 674 ALA A CA  1 
ATOM   4341 C  C   . ALA B 1 674 ? 51.078 32.214 3.856  1.00 38.45 ? 674 ALA A C   1 
ATOM   4342 O  O   . ALA B 1 674 ? 51.292 32.004 2.661  1.00 38.18 ? 674 ALA A O   1 
ATOM   4343 C  CB  . ALA B 1 674 ? 48.913 33.410 4.138  1.00 40.18 ? 674 ALA A CB  1 
ATOM   4344 N  N   . VAL B 1 675 ? 51.378 31.349 4.824  1.00 35.33 ? 675 VAL A N   1 
ATOM   4345 C  CA  . VAL B 1 675 ? 52.075 30.094 4.568  1.00 32.92 ? 675 VAL A CA  1 
ATOM   4346 C  C   . VAL B 1 675 ? 51.395 28.949 5.306  1.00 31.30 ? 675 VAL A C   1 
ATOM   4347 O  O   . VAL B 1 675 ? 51.426 28.889 6.526  1.00 29.73 ? 675 VAL A O   1 
ATOM   4348 C  CB  . VAL B 1 675 ? 53.580 30.139 4.999  1.00 33.04 ? 675 VAL A CB  1 
ATOM   4349 C  CG1 . VAL B 1 675 ? 54.229 28.758 4.803  1.00 32.81 ? 675 VAL A CG1 1 
ATOM   4350 C  CG2 . VAL B 1 675 ? 54.359 31.226 4.239  1.00 34.39 ? 675 VAL A CG2 1 
ATOM   4351 N  N   . ALA B 1 676 ? 50.801 28.044 4.535  1.00 29.58 ? 676 ALA A N   1 
ATOM   4352 C  CA  . ALA B 1 676 ? 50.029 26.931 5.050  1.00 29.02 ? 676 ALA A CA  1 
ATOM   4353 C  C   . ALA B 1 676 ? 50.824 25.656 4.875  1.00 28.86 ? 676 ALA A C   1 
ATOM   4354 O  O   . ALA B 1 676 ? 51.351 25.402 3.792  1.00 29.21 ? 676 ALA A O   1 
ATOM   4355 C  CB  . ALA B 1 676 ? 48.697 26.821 4.303  1.00 28.06 ? 676 ALA A CB  1 
ATOM   4356 N  N   . ILE B 1 677 ? 50.927 24.875 5.946  1.00 28.91 ? 677 ILE A N   1 
ATOM   4357 C  CA  . ILE B 1 677 ? 51.457 23.516 5.867  1.00 28.57 ? 677 ILE A CA  1 
ATOM   4358 C  C   . ILE B 1 677 ? 50.276 22.555 5.889  1.00 29.21 ? 677 ILE A C   1 
ATOM   4359 O  O   . ILE B 1 677 ? 49.500 22.553 6.838  1.00 28.57 ? 677 ILE A O   1 
ATOM   4360 C  CB  . ILE B 1 677 ? 52.440 23.194 7.010  1.00 28.67 ? 677 ILE A CB  1 
ATOM   4361 C  CG1 . ILE B 1 677 ? 53.650 24.146 6.956  1.00 28.04 ? 677 ILE A CG1 1 
ATOM   4362 C  CG2 . ILE B 1 677 ? 52.863 21.723 6.929  1.00 27.93 ? 677 ILE A CG2 1 
ATOM   4363 C  CD1 . ILE B 1 677 ? 54.467 24.168 8.250  1.00 30.60 ? 677 ILE A CD1 1 
ATOM   4364 N  N   . CYS B 1 678 ? 50.139 21.773 4.819  1.00 29.48 ? 678 CYS A N   1 
ATOM   4365 C  CA  . CYS B 1 678 ? 48.988 20.889 4.607  1.00 30.86 ? 678 CYS A CA  1 
ATOM   4366 C  C   . CYS B 1 678 ? 49.442 19.432 4.546  1.00 31.50 ? 678 CYS A C   1 
ATOM   4367 O  O   . CYS B 1 678 ? 50.347 19.109 3.769  1.00 30.92 ? 678 CYS A O   1 
ATOM   4368 C  CB  . CYS B 1 678 ? 48.316 21.248 3.281  1.00 30.77 ? 678 CYS A CB  1 
ATOM   4369 S  SG  . CYS B 1 678 ? 47.901 23.001 3.111  1.00 33.54 ? 678 CYS A SG  1 
ATOM   4370 N  N   . CYS B 1 679 ? 48.797 18.562 5.325  1.00 31.93 ? 679 CYS A N   1 
ATOM   4371 C  CA  . CYS B 1 679 ? 49.146 17.136 5.370  1.00 33.67 ? 679 CYS A CA  1 
ATOM   4372 C  C   . CYS B 1 679 ? 47.945 16.212 5.127  1.00 35.07 ? 679 CYS A C   1 
ATOM   4373 O  O   . CYS B 1 679 ? 46.807 16.570 5.419  1.00 33.87 ? 679 CYS A O   1 
ATOM   4374 C  CB  . CYS B 1 679 ? 49.794 16.759 6.703  1.00 33.08 ? 679 CYS A CB  1 
ATOM   4375 S  SG  . CYS B 1 679 ? 51.229 17.760 7.174  1.00 33.28 ? 679 CYS A SG  1 
ATOM   4376 N  N   . ARG B 1 680 ? 48.215 15.024 4.593  1.00 36.96 ? 680 ARG A N   1 
ATOM   4377 C  CA  . ARG B 1 680 ? 47.184 13.998 4.468  1.00 39.41 ? 680 ARG A CA  1 
ATOM   4378 C  C   . ARG B 1 680 ? 47.729 12.590 4.767  1.00 40.93 ? 680 ARG A C   1 
ATOM   4379 O  O   . ARG B 1 680 ? 48.931 12.340 4.695  1.00 40.92 ? 680 ARG A O   1 
ATOM   4380 C  CB  . ARG B 1 680 ? 46.508 14.061 3.085  1.00 38.73 ? 680 ARG A CB  1 
ATOM   4381 C  CG  . ARG B 1 680 ? 47.319 13.432 1.956  1.00 40.62 ? 680 ARG A CG  1 
ATOM   4382 C  CD  . ARG B 1 680 ? 46.574 13.406 0.628  1.00 40.19 ? 680 ARG A CD  1 
ATOM   4383 N  NE  . ARG B 1 680 ? 47.506 13.177 -0.481 1.00 43.50 ? 680 ARG A NE  1 
ATOM   4384 C  CZ  . ARG B 1 680 ? 47.202 13.295 -1.772 1.00 44.24 ? 680 ARG A CZ  1 
ATOM   4385 N  NH1 . ARG B 1 680 ? 45.978 13.635 -2.155 1.00 42.36 ? 680 ARG A NH1 1 
ATOM   4386 N  NH2 . ARG B 1 680 ? 48.139 13.076 -2.684 1.00 45.99 ? 680 ARG A NH2 1 
ATOM   4387 N  N   . SER B 1 681 ? 46.824 11.688 5.127  1.00 43.19 ? 681 SER A N   1 
ATOM   4388 C  CA  . SER B 1 681 ? 47.124 10.272 5.229  1.00 45.46 ? 681 SER A CA  1 
ATOM   4389 C  C   . SER B 1 681 ? 47.413 9.677  3.852  1.00 46.66 ? 681 SER A C   1 
ATOM   4390 O  O   . SER B 1 681 ? 46.785 10.058 2.860  1.00 46.57 ? 681 SER A O   1 
ATOM   4391 C  CB  . SER B 1 681 ? 45.925 9.548  5.838  1.00 45.85 ? 681 SER A CB  1 
ATOM   4392 O  OG  . SER B 1 681 ? 46.066 8.144  5.724  1.00 47.16 ? 681 SER A OG  1 
ATOM   4393 N  N   . ARG B 1 682 ? 48.365 8.751  3.791  1.00 48.24 ? 682 ARG A N   1 
ATOM   4394 C  CA  . ARG B 1 682 ? 48.511 7.892  2.612  1.00 50.07 ? 682 ARG A CA  1 
ATOM   4395 C  C   . ARG B 1 682 ? 47.761 6.580  2.865  1.00 50.48 ? 682 ARG A C   1 
ATOM   4396 O  O   . ARG B 1 682 ? 47.224 5.958  1.942  1.00 51.37 ? 682 ARG A O   1 
ATOM   4397 C  CB  . ARG B 1 682 ? 49.975 7.590  2.321  1.00 50.69 ? 682 ARG A CB  1 
ATOM   4398 C  CG  . ARG B 1 682 ? 50.863 8.804  2.118  1.00 52.69 ? 682 ARG A CG  1 
ATOM   4399 C  CD  . ARG B 1 682 ? 52.325 8.397  2.294  1.00 56.45 ? 682 ARG A CD  1 
ATOM   4400 N  NE  . ARG B 1 682 ? 53.260 9.450  1.901  1.00 58.96 ? 682 ARG A NE  1 
ATOM   4401 C  CZ  . ARG B 1 682 ? 54.523 9.518  2.313  1.00 60.69 ? 682 ARG A CZ  1 
ATOM   4402 N  NH1 . ARG B 1 682 ? 55.007 8.597  3.144  1.00 61.07 ? 682 ARG A NH1 1 
ATOM   4403 N  NH2 . ARG B 1 682 ? 55.303 10.515 1.905  1.00 61.32 ? 682 ARG A NH2 1 
HETATM 4404 HG HG  . HG  C 2 .   ? 28.820 31.751 40.919 0.20 25.99 ? 693 HG  P HG  1 
HETATM 4405 HG HG  . HG  D 2 .   ? 27.455 32.086 39.686 0.20 35.18 ? 694 HG  P HG  1 
HETATM 4406 O  O   . HOH E 3 .   ? 34.848 32.842 60.725 1.00 23.53 ? 695 HOH P O   1 
HETATM 4407 O  O   . HOH E 3 .   ? 34.761 7.510  58.977 1.00 24.55 ? 696 HOH P O   1 
HETATM 4408 O  O   . HOH E 3 .   ? 34.368 12.979 50.053 1.00 26.30 ? 697 HOH P O   1 
HETATM 4409 O  O   . HOH E 3 .   ? 27.334 32.882 44.639 1.00 26.98 ? 698 HOH P O   1 
HETATM 4410 O  O   . HOH E 3 .   ? 30.445 35.270 35.819 1.00 27.69 ? 699 HOH P O   1 
HETATM 4411 O  O   . HOH E 3 .   ? 36.411 8.672  49.101 1.00 27.78 ? 700 HOH P O   1 
HETATM 4412 O  O   . HOH E 3 .   ? 23.519 18.621 59.936 1.00 27.76 ? 701 HOH P O   1 
HETATM 4413 O  O   . HOH E 3 .   ? 24.838 29.809 61.085 1.00 28.59 ? 702 HOH P O   1 
HETATM 4414 O  O   . HOH E 3 .   ? 14.478 26.796 25.426 1.00 30.24 ? 703 HOH P O   1 
HETATM 4415 O  O   . HOH E 3 .   ? 32.551 37.512 42.419 1.00 29.31 ? 704 HOH P O   1 
HETATM 4416 O  O   . HOH E 3 .   ? 39.683 19.984 44.802 1.00 29.77 ? 705 HOH P O   1 
HETATM 4417 O  O   . HOH E 3 .   ? 25.733 41.995 39.375 1.00 29.79 ? 706 HOH P O   1 
HETATM 4418 O  O   . HOH E 3 .   ? 28.050 28.589 43.062 1.00 30.79 ? 707 HOH P O   1 
HETATM 4419 O  O   . HOH E 3 .   ? 28.671 7.882  54.409 1.00 32.07 ? 708 HOH P O   1 
HETATM 4420 O  O   . HOH E 3 .   ? 28.915 35.052 50.824 1.00 30.88 ? 709 HOH P O   1 
HETATM 4421 O  O   . HOH E 3 .   ? 28.169 37.171 56.939 1.00 32.55 ? 710 HOH P O   1 
HETATM 4422 O  O   . HOH E 3 .   ? 43.347 15.609 51.517 1.00 32.65 ? 711 HOH P O   1 
HETATM 4423 O  O   . HOH E 3 .   ? 15.016 30.210 32.355 1.00 33.66 ? 712 HOH P O   1 
HETATM 4424 O  O   . HOH E 3 .   ? 43.519 23.996 53.387 1.00 33.36 ? 713 HOH P O   1 
HETATM 4425 O  O   . HOH E 3 .   ? 20.918 26.644 47.763 1.00 34.09 ? 714 HOH P O   1 
HETATM 4426 O  O   . HOH E 3 .   ? 25.105 13.137 51.506 1.00 34.16 ? 715 HOH P O   1 
HETATM 4427 O  O   . HOH E 3 .   ? 33.186 9.575  59.078 1.00 35.09 ? 716 HOH P O   1 
HETATM 4428 O  O   . HOH E 3 .   ? 26.846 24.185 64.404 1.00 34.86 ? 717 HOH P O   1 
HETATM 4429 O  O   . HOH E 3 .   ? 34.104 8.042  41.247 1.00 33.31 ? 718 HOH P O   1 
HETATM 4430 O  O   . HOH E 3 .   ? 40.764 32.019 57.110 1.00 33.83 ? 719 HOH P O   1 
HETATM 4431 O  O   . HOH E 3 .   ? 31.407 14.182 44.026 1.00 35.55 ? 720 HOH P O   1 
HETATM 4432 O  O   . HOH E 3 .   ? 36.002 11.502 48.601 1.00 35.99 ? 721 HOH P O   1 
HETATM 4433 O  O   . HOH E 3 .   ? 28.558 39.700 43.397 1.00 36.32 ? 722 HOH P O   1 
HETATM 4434 O  O   . HOH E 3 .   ? 24.720 31.974 38.569 1.00 37.70 ? 723 HOH P O   1 
HETATM 4435 O  O   . HOH E 3 .   ? 41.253 32.976 51.436 1.00 37.84 ? 724 HOH P O   1 
HETATM 4436 O  O   . HOH E 3 .   ? 31.794 34.894 63.901 1.00 37.30 ? 725 HOH P O   1 
HETATM 4437 O  O   . HOH E 3 .   ? 18.445 33.772 41.492 1.00 39.34 ? 726 HOH P O   1 
HETATM 4438 O  O   . HOH E 3 .   ? 39.674 34.048 49.605 1.00 37.70 ? 727 HOH P O   1 
HETATM 4439 O  O   . HOH E 3 .   ? 38.541 26.089 61.350 1.00 39.95 ? 728 HOH P O   1 
HETATM 4440 O  O   . HOH E 3 .   ? 21.521 30.165 56.200 1.00 40.25 ? 729 HOH P O   1 
HETATM 4441 O  O   . HOH E 3 .   ? 27.375 11.208 54.750 1.00 40.09 ? 730 HOH P O   1 
HETATM 4442 O  O   . HOH E 3 .   ? 21.732 29.441 58.485 1.00 39.88 ? 731 HOH P O   1 
HETATM 4443 O  O   . HOH E 3 .   ? 42.583 25.052 55.029 1.00 41.19 ? 732 HOH P O   1 
HETATM 4444 O  O   . HOH E 3 .   ? 23.439 39.293 56.067 1.00 45.32 ? 733 HOH P O   1 
HETATM 4445 O  O   . HOH E 3 .   ? 39.441 35.115 47.458 1.00 40.02 ? 734 HOH P O   1 
HETATM 4446 O  O   . HOH E 3 .   ? 43.062 19.523 44.867 1.00 41.15 ? 735 HOH P O   1 
HETATM 4447 O  O   . HOH E 3 .   ? 22.743 30.385 64.113 1.00 44.79 ? 736 HOH P O   1 
HETATM 4448 O  O   . HOH E 3 .   ? 21.337 27.242 59.826 1.00 44.21 ? 737 HOH P O   1 
HETATM 4449 O  O   . HOH E 3 .   ? 40.489 14.023 58.433 1.00 44.32 ? 738 HOH P O   1 
HETATM 4450 O  O   . HOH E 3 .   ? 37.887 21.105 42.387 1.00 42.51 ? 739 HOH P O   1 
HETATM 4451 O  O   . HOH E 3 .   ? 35.848 12.120 45.229 1.00 43.01 ? 740 HOH P O   1 
HETATM 4452 O  O   . HOH E 3 .   ? 36.777 25.807 68.316 1.00 42.18 ? 741 HOH P O   1 
HETATM 4453 O  O   . HOH E 3 .   ? 22.780 31.740 61.814 1.00 46.60 ? 742 HOH P O   1 
HETATM 4454 O  O   . HOH E 3 .   ? 38.856 8.209  48.169 1.00 43.73 ? 743 HOH P O   1 
HETATM 4455 O  O   . HOH E 3 .   ? 28.357 26.096 45.037 1.00 43.73 ? 744 HOH P O   1 
HETATM 4456 O  O   . HOH E 3 .   ? 20.501 29.279 51.396 1.00 41.23 ? 745 HOH P O   1 
HETATM 4457 O  O   . HOH E 3 .   ? 20.310 13.328 47.148 1.00 43.35 ? 746 HOH P O   1 
HETATM 4458 O  O   . HOH E 3 .   ? 21.419 14.942 49.054 1.00 43.69 ? 747 HOH P O   1 
HETATM 4459 O  O   . HOH E 3 .   ? 26.603 38.840 59.685 1.00 46.75 ? 748 HOH P O   1 
HETATM 4460 O  O   . HOH E 3 .   ? 29.633 17.768 65.078 1.00 45.89 ? 749 HOH P O   1 
HETATM 4461 O  O   . HOH E 3 .   ? 21.920 38.389 47.316 1.00 45.38 ? 750 HOH P O   1 
HETATM 4462 O  O   . HOH E 3 .   ? 28.190 39.623 31.627 1.00 48.64 ? 751 HOH P O   1 
HETATM 4463 O  O   . HOH E 3 .   ? 44.898 32.222 49.535 1.00 44.68 ? 752 HOH P O   1 
HETATM 4464 O  O   . HOH E 3 .   ? 28.001 19.430 66.709 1.00 44.18 ? 753 HOH P O   1 
HETATM 4465 O  O   . HOH E 3 .   ? 41.455 9.005  48.699 1.00 45.72 ? 754 HOH P O   1 
HETATM 4466 O  O   . HOH E 3 .   ? 36.827 9.977  43.918 1.00 45.11 ? 755 HOH P O   1 
HETATM 4467 O  O   . HOH E 3 .   ? 17.607 25.080 58.968 1.00 46.25 ? 756 HOH P O   1 
HETATM 4468 O  O   . HOH E 3 .   ? 17.956 32.348 30.858 1.00 47.98 ? 757 HOH P O   1 
HETATM 4469 O  O   . HOH E 3 .   ? 23.977 14.682 55.159 1.00 48.24 ? 758 HOH P O   1 
HETATM 4470 O  O   . HOH E 3 .   ? 42.339 27.839 45.770 1.00 44.25 ? 759 HOH P O   1 
HETATM 4471 O  O   . HOH E 3 .   ? 17.488 35.053 34.314 1.00 47.15 ? 760 HOH P O   1 
HETATM 4472 O  O   . HOH E 3 .   ? 19.369 32.439 49.123 1.00 46.36 ? 761 HOH P O   1 
HETATM 4473 O  O   . HOH E 3 .   ? 24.282 23.195 64.927 1.00 52.15 ? 762 HOH P O   1 
HETATM 4474 O  O   . HOH E 3 .   ? 35.430 27.862 67.331 1.00 47.70 ? 763 HOH P O   1 
HETATM 4475 O  O   . HOH E 3 .   ? 44.350 14.350 58.560 1.00 48.66 ? 764 HOH P O   1 
HETATM 4476 O  O   . HOH E 3 .   ? 33.674 6.791  43.584 1.00 49.34 ? 765 HOH P O   1 
HETATM 4477 O  O   . HOH E 3 .   ? 35.993 19.479 66.871 1.00 53.52 ? 766 HOH P O   1 
HETATM 4478 O  O   . HOH E 3 .   ? 23.463 15.320 57.687 1.00 49.11 ? 767 HOH P O   1 
HETATM 4479 O  O   . HOH E 3 .   ? 17.319 22.086 54.288 1.00 55.20 ? 768 HOH P O   1 
HETATM 4480 O  O   . HOH E 3 .   ? 35.313 15.610 63.320 1.00 55.83 ? 769 HOH P O   1 
HETATM 4481 O  O   . HOH E 3 .   ? 34.843 17.476 66.038 1.00 52.15 ? 770 HOH P O   1 
HETATM 4482 O  O   . HOH E 3 .   ? 24.732 40.384 57.990 1.00 57.41 ? 771 HOH P O   1 
HETATM 4483 O  O   . HOH E 3 .   ? 25.920 21.061 66.073 1.00 61.32 ? 772 HOH P O   1 
HETATM 4484 O  O   . HOH E 3 .   ? 27.262 10.231 52.241 1.00 57.78 ? 773 HOH P O   1 
HETATM 4485 O  O   . HOH E 3 .   ? 30.646 39.724 45.298 1.00 60.54 ? 774 HOH P O   1 
HETATM 4486 O  O   . HOH E 3 .   ? 24.926 34.230 66.469 1.00 61.81 ? 775 HOH P O   1 
HETATM 4487 O  O   . HOH E 3 .   ? 27.796 8.969  50.245 1.00 61.92 ? 776 HOH P O   1 
HETATM 4488 O  O   . HOH E 3 .   ? 20.330 37.183 45.832 1.00 56.33 ? 777 HOH P O   1 
HETATM 4489 O  O   . HOH E 3 .   ? 38.716 32.530 62.540 1.00 60.39 ? 778 HOH P O   1 
HETATM 4490 O  O   . HOH E 3 .   ? 39.207 16.766 61.479 1.00 66.15 ? 779 HOH P O   1 
HETATM 4491 O  O   . HOH E 3 .   ? 35.033 22.582 69.316 1.00 55.13 ? 780 HOH P O   1 
HETATM 4492 O  O   . HOH E 3 .   ? 19.131 30.543 61.508 1.00 52.37 ? 781 HOH P O   1 
HETATM 4493 O  O   . HOH E 3 .   ? 20.131 33.850 61.698 1.00 50.08 ? 782 HOH P O   1 
HETATM 4494 O  O   . HOH E 3 .   ? 33.841 32.468 63.203 1.00 48.45 ? 783 HOH P O   1 
HETATM 4495 O  O   . HOH E 3 .   ? 16.791 33.666 32.718 1.00 56.52 ? 784 HOH P O   1 
HETATM 4496 O  O   . HOH F 3 .   ? 33.820 24.578 26.348 1.00 44.99 ? 693 HOH A O   1 
HETATM 4497 O  O   . HOH F 3 .   ? 33.021 31.865 24.790 1.00 21.85 ? 694 HOH A O   1 
HETATM 4498 O  O   . HOH F 3 .   ? 39.051 23.989 14.368 1.00 21.84 ? 695 HOH A O   1 
HETATM 4499 O  O   . HOH F 3 .   ? 13.525 12.883 38.116 1.00 21.11 ? 696 HOH A O   1 
HETATM 4500 O  O   . HOH F 3 .   ? 28.581 -0.262 17.029 1.00 22.54 ? 697 HOH A O   1 
HETATM 4501 O  O   . HOH F 3 .   ? 21.080 26.346 11.552 1.00 22.17 ? 698 HOH A O   1 
HETATM 4502 O  O   . HOH F 3 .   ? 18.868 22.572 41.203 1.00 22.29 ? 699 HOH A O   1 
HETATM 4503 O  O   . HOH F 3 .   ? 35.472 34.463 23.792 1.00 23.06 ? 700 HOH A O   1 
HETATM 4504 O  O   . HOH F 3 .   ? 39.278 16.980 20.402 1.00 24.01 ? 701 HOH A O   1 
HETATM 4505 O  O   . HOH F 3 .   ? 25.931 26.343 30.047 1.00 24.62 ? 702 HOH A O   1 
HETATM 4506 O  O   . HOH F 3 .   ? 6.991  20.525 26.038 1.00 24.35 ? 703 HOH A O   1 
HETATM 4507 O  O   . HOH F 3 .   ? 12.762 18.527 15.594 1.00 24.35 ? 704 HOH A O   1 
HETATM 4508 O  O   . HOH F 3 .   ? 10.128 21.235 36.911 1.00 25.72 ? 705 HOH A O   1 
HETATM 4509 O  O   . HOH F 3 .   ? 17.031 34.488 15.063 1.00 24.46 ? 706 HOH A O   1 
HETATM 4510 O  O   . HOH F 3 .   ? 38.389 18.009 13.303 1.00 24.17 ? 707 HOH A O   1 
HETATM 4511 O  O   . HOH F 3 .   ? 34.077 41.630 22.832 1.00 25.46 ? 708 HOH A O   1 
HETATM 4512 O  O   . HOH F 3 .   ? 35.365 24.242 17.692 1.00 24.64 ? 709 HOH A O   1 
HETATM 4513 O  O   . HOH F 3 .   ? 28.374 15.819 7.832  1.00 24.40 ? 710 HOH A O   1 
HETATM 4514 O  O   . HOH F 3 .   ? 10.929 29.314 23.046 1.00 26.47 ? 711 HOH A O   1 
HETATM 4515 O  O   . HOH F 3 .   ? 53.261 26.870 11.018 1.00 25.94 ? 712 HOH A O   1 
HETATM 4516 O  O   . HOH F 3 .   ? 9.533  23.814 31.909 1.00 26.24 ? 713 HOH A O   1 
HETATM 4517 O  O   . HOH F 3 .   ? 9.739  15.547 19.954 1.00 25.70 ? 714 HOH A O   1 
HETATM 4518 O  O   . HOH F 3 .   ? 36.882 24.825 15.582 1.00 27.35 ? 715 HOH A O   1 
HETATM 4519 O  O   . HOH F 3 .   ? 33.175 33.644 13.682 1.00 26.65 ? 716 HOH A O   1 
HETATM 4520 O  O   . HOH F 3 .   ? 33.582 33.562 11.073 1.00 26.27 ? 717 HOH A O   1 
HETATM 4521 O  O   . HOH F 3 .   ? 28.614 17.846 13.617 1.00 27.85 ? 718 HOH A O   1 
HETATM 4522 O  O   . HOH F 3 .   ? 39.507 22.145 12.142 1.00 26.61 ? 719 HOH A O   1 
HETATM 4523 O  O   . HOH F 3 .   ? 37.575 39.321 15.774 1.00 27.01 ? 720 HOH A O   1 
HETATM 4524 O  O   . HOH F 3 .   ? 24.387 21.683 9.325  1.00 28.21 ? 721 HOH A O   1 
HETATM 4525 O  O   . HOH F 3 .   ? 38.733 32.224 13.740 1.00 28.54 ? 722 HOH A O   1 
HETATM 4526 O  O   . HOH F 3 .   ? 40.257 18.272 10.473 1.00 28.31 ? 723 HOH A O   1 
HETATM 4527 O  O   . HOH F 3 .   ? 38.514 27.107 17.070 1.00 28.36 ? 724 HOH A O   1 
HETATM 4528 O  O   . HOH F 3 .   ? 18.519 22.849 44.356 1.00 28.92 ? 725 HOH A O   1 
HETATM 4529 O  O   . HOH F 3 .   ? 25.993 40.183 19.238 1.00 28.04 ? 726 HOH A O   1 
HETATM 4530 O  O   . HOH F 3 .   ? 11.450 22.452 13.738 1.00 28.63 ? 727 HOH A O   1 
HETATM 4531 O  O   . HOH F 3 .   ? 17.951 29.318 41.871 1.00 30.61 ? 728 HOH A O   1 
HETATM 4532 O  O   . HOH F 3 .   ? 25.148 3.325  27.549 1.00 28.74 ? 729 HOH A O   1 
HETATM 4533 O  O   . HOH F 3 .   ? 10.106 6.327  34.188 1.00 28.83 ? 730 HOH A O   1 
HETATM 4534 O  O   . HOH F 3 .   ? 37.190 24.869 38.135 1.00 29.37 ? 731 HOH A O   1 
HETATM 4535 O  O   . HOH F 3 .   ? 30.786 7.797  14.699 1.00 30.64 ? 732 HOH A O   1 
HETATM 4536 O  O   . HOH F 3 .   ? 39.270 26.429 12.884 1.00 30.08 ? 733 HOH A O   1 
HETATM 4537 O  O   . HOH F 3 .   ? 10.258 14.063 35.736 1.00 30.53 ? 734 HOH A O   1 
HETATM 4538 O  O   . HOH F 3 .   ? 24.488 12.544 44.521 1.00 30.41 ? 735 HOH A O   1 
HETATM 4539 O  O   . HOH F 3 .   ? 14.293 15.854 34.115 1.00 29.04 ? 736 HOH A O   1 
HETATM 4540 O  O   . HOH F 3 .   ? 30.630 22.877 4.792  1.00 31.03 ? 737 HOH A O   1 
HETATM 4541 O  O   . HOH F 3 .   ? 26.895 -3.846 34.435 1.00 30.15 ? 738 HOH A O   1 
HETATM 4542 O  O   . HOH F 3 .   ? 44.038 12.580 5.917  1.00 31.73 ? 739 HOH A O   1 
HETATM 4543 O  O   . HOH F 3 .   ? 35.584 28.640 12.273 1.00 33.80 ? 740 HOH A O   1 
HETATM 4544 O  O   . HOH F 3 .   ? 37.736 28.845 18.862 1.00 31.38 ? 741 HOH A O   1 
HETATM 4545 O  O   . HOH F 3 .   ? 14.316 19.397 46.075 1.00 32.00 ? 742 HOH A O   1 
HETATM 4546 O  O   . HOH F 3 .   ? 10.141 22.987 9.701  1.00 31.59 ? 743 HOH A O   1 
HETATM 4547 O  O   . HOH F 3 .   ? 49.724 27.104 13.187 1.00 32.57 ? 744 HOH A O   1 
HETATM 4548 O  O   . HOH F 3 .   ? 39.188 27.755 20.869 1.00 32.99 ? 745 HOH A O   1 
HETATM 4549 O  O   . HOH F 3 .   ? 49.143 42.966 22.980 1.00 33.57 ? 746 HOH A O   1 
HETATM 4550 O  O   . HOH F 3 .   ? 30.164 34.152 38.422 1.00 33.17 ? 747 HOH A O   1 
HETATM 4551 O  O   . HOH F 3 .   ? 11.774 17.167 18.767 1.00 33.53 ? 748 HOH A O   1 
HETATM 4552 O  O   . HOH F 3 .   ? 46.976 28.423 14.086 1.00 32.81 ? 749 HOH A O   1 
HETATM 4553 O  O   . HOH F 3 .   ? 17.631 24.249 46.505 1.00 32.12 ? 750 HOH A O   1 
HETATM 4554 O  O   . HOH F 3 .   ? 52.509 36.638 20.539 1.00 32.93 ? 751 HOH A O   1 
HETATM 4555 O  O   . HOH F 3 .   ? 26.641 28.349 37.512 1.00 33.84 ? 752 HOH A O   1 
HETATM 4556 O  O   . HOH F 3 .   ? 18.015 35.064 27.667 1.00 33.05 ? 753 HOH A O   1 
HETATM 4557 O  O   . HOH F 3 .   ? 16.418 5.869  39.672 1.00 33.58 ? 754 HOH A O   1 
HETATM 4558 O  O   . HOH F 3 .   ? 39.081 25.854 4.732  1.00 33.39 ? 755 HOH A O   1 
HETATM 4559 O  O   . HOH F 3 .   ? 53.217 27.815 8.453  1.00 34.63 ? 756 HOH A O   1 
HETATM 4560 O  O   . HOH F 3 .   ? 51.590 14.493 -4.377 1.00 34.41 ? 757 HOH A O   1 
HETATM 4561 O  O   . HOH F 3 .   ? 21.046 21.738 47.189 1.00 35.37 ? 758 HOH A O   1 
HETATM 4562 O  O   . HOH F 3 .   ? 43.312 14.942 5.498  1.00 32.88 ? 759 HOH A O   1 
HETATM 4563 O  O   . HOH F 3 .   ? 29.437 40.439 25.111 1.00 33.76 ? 760 HOH A O   1 
HETATM 4564 O  O   . HOH F 3 .   ? 43.115 11.698 12.672 1.00 35.11 ? 761 HOH A O   1 
HETATM 4565 O  O   . HOH F 3 .   ? 12.977 13.748 35.692 1.00 35.94 ? 762 HOH A O   1 
HETATM 4566 O  O   . HOH F 3 .   ? 7.807  12.552 35.558 1.00 35.00 ? 763 HOH A O   1 
HETATM 4567 O  O   . HOH F 3 .   ? 37.000 28.195 31.166 1.00 36.43 ? 764 HOH A O   1 
HETATM 4568 O  O   . HOH F 3 .   ? 13.514 17.888 3.982  1.00 34.21 ? 765 HOH A O   1 
HETATM 4569 O  O   . HOH F 3 .   ? 32.549 15.763 27.891 1.00 35.74 ? 766 HOH A O   1 
HETATM 4570 O  O   . HOH F 3 .   ? 7.280  27.865 22.314 1.00 35.21 ? 767 HOH A O   1 
HETATM 4571 O  O   . HOH F 3 .   ? 30.838 31.483 41.510 1.00 35.10 ? 768 HOH A O   1 
HETATM 4572 O  O   . HOH F 3 .   ? 39.546 22.866 23.952 1.00 36.25 ? 769 HOH A O   1 
HETATM 4573 O  O   . HOH F 3 .   ? 20.700 19.703 48.907 1.00 36.76 ? 770 HOH A O   1 
HETATM 4574 O  O   . HOH F 3 .   ? 32.360 40.172 24.340 1.00 36.46 ? 771 HOH A O   1 
HETATM 4575 O  O   . HOH F 3 .   ? 12.396 28.660 10.857 1.00 35.22 ? 772 HOH A O   1 
HETATM 4576 O  O   . HOH F 3 .   ? 39.979 12.551 25.062 1.00 36.11 ? 773 HOH A O   1 
HETATM 4577 O  O   . HOH F 3 .   ? 11.910 29.825 41.005 1.00 35.34 ? 774 HOH A O   1 
HETATM 4578 O  O   . HOH F 3 .   ? 34.794 30.670 8.499  1.00 37.21 ? 775 HOH A O   1 
HETATM 4579 O  O   . HOH F 3 .   ? 38.684 28.104 14.615 1.00 35.58 ? 776 HOH A O   1 
HETATM 4580 O  O   . HOH F 3 .   ? 14.627 30.325 25.092 1.00 36.74 ? 777 HOH A O   1 
HETATM 4581 O  O   . HOH F 3 .   ? 51.874 33.740 14.676 1.00 36.50 ? 778 HOH A O   1 
HETATM 4582 O  O   . HOH F 3 .   ? 12.693 20.214 5.538  1.00 36.20 ? 779 HOH A O   1 
HETATM 4583 O  O   . HOH F 3 .   ? 14.472 29.273 12.285 1.00 37.86 ? 780 HOH A O   1 
HETATM 4584 O  O   . HOH F 3 .   ? 19.622 40.287 20.010 1.00 35.34 ? 781 HOH A O   1 
HETATM 4585 O  O   . HOH F 3 .   ? 37.989 23.501 35.935 1.00 38.52 ? 782 HOH A O   1 
HETATM 4586 O  O   . HOH F 3 .   ? 45.052 41.533 22.648 1.00 38.04 ? 783 HOH A O   1 
HETATM 4587 O  O   . HOH F 3 .   ? 35.157 20.963 24.114 1.00 37.41 ? 784 HOH A O   1 
HETATM 4588 O  O   . HOH F 3 .   ? 4.855  10.879 18.223 1.00 35.47 ? 785 HOH A O   1 
HETATM 4589 O  O   . HOH F 3 .   ? 44.138 29.316 28.349 1.00 37.07 ? 786 HOH A O   1 
HETATM 4590 O  O   . HOH F 3 .   ? 18.549 15.644 46.249 1.00 37.89 ? 787 HOH A O   1 
HETATM 4591 O  O   . HOH F 3 .   ? 48.568 39.267 32.617 1.00 38.17 ? 788 HOH A O   1 
HETATM 4592 O  O   . HOH F 3 .   ? 35.802 27.125 20.303 1.00 38.54 ? 789 HOH A O   1 
HETATM 4593 O  O   . HOH F 3 .   ? 31.318 40.094 28.172 1.00 36.08 ? 790 HOH A O   1 
HETATM 4594 O  O   . HOH F 3 .   ? 49.176 20.065 24.720 1.00 37.59 ? 791 HOH A O   1 
HETATM 4595 O  O   . HOH F 3 .   ? 38.985 23.587 19.367 1.00 37.22 ? 792 HOH A O   1 
HETATM 4596 O  O   . HOH F 3 .   ? 55.509 34.933 15.411 1.00 37.54 ? 793 HOH A O   1 
HETATM 4597 O  O   . HOH F 3 .   ? 35.574 32.452 10.734 1.00 37.89 ? 794 HOH A O   1 
HETATM 4598 O  O   . HOH F 3 .   ? 39.324 24.272 40.275 1.00 40.57 ? 795 HOH A O   1 
HETATM 4599 O  O   . HOH F 3 .   ? 33.328 6.058  24.260 1.00 36.07 ? 796 HOH A O   1 
HETATM 4600 O  O   . HOH F 3 .   ? 46.333 31.441 28.723 1.00 38.49 ? 797 HOH A O   1 
HETATM 4601 O  O   . HOH F 3 .   ? 18.586 35.269 10.068 1.00 37.72 ? 798 HOH A O   1 
HETATM 4602 O  O   . HOH F 3 .   ? 1.079  22.019 21.951 1.00 38.53 ? 799 HOH A O   1 
HETATM 4603 O  O   . HOH F 3 .   ? 65.044 37.170 20.564 1.00 38.13 ? 800 HOH A O   1 
HETATM 4604 O  O   . HOH F 3 .   ? 54.180 26.224 14.774 1.00 38.11 ? 801 HOH A O   1 
HETATM 4605 O  O   . HOH F 3 .   ? 69.967 29.422 12.958 1.00 39.63 ? 802 HOH A O   1 
HETATM 4606 O  O   . HOH F 3 .   ? 27.182 41.869 6.683  1.00 39.36 ? 803 HOH A O   1 
HETATM 4607 O  O   . HOH F 3 .   ? 29.956 1.066  13.113 1.00 41.46 ? 804 HOH A O   1 
HETATM 4608 O  O   . HOH F 3 .   ? 38.489 0.256  15.877 1.00 39.58 ? 805 HOH A O   1 
HETATM 4609 O  O   . HOH F 3 .   ? 47.415 11.673 18.523 1.00 39.36 ? 806 HOH A O   1 
HETATM 4610 O  O   . HOH F 3 .   ? 24.213 23.857 8.136  1.00 39.19 ? 807 HOH A O   1 
HETATM 4611 O  O   . HOH F 3 .   ? 20.728 6.545  36.751 1.00 39.18 ? 808 HOH A O   1 
HETATM 4612 O  O   . HOH F 3 .   ? 51.143 17.572 22.655 1.00 41.48 ? 809 HOH A O   1 
HETATM 4613 O  O   . HOH F 3 .   ? 40.755 20.625 9.303  1.00 40.55 ? 810 HOH A O   1 
HETATM 4614 O  O   . HOH F 3 .   ? 65.492 30.328 21.819 1.00 38.16 ? 811 HOH A O   1 
HETATM 4615 O  O   . HOH F 3 .   ? 44.402 29.264 -1.496 1.00 40.16 ? 812 HOH A O   1 
HETATM 4616 O  O   . HOH F 3 .   ? 38.258 3.716  23.877 1.00 39.30 ? 813 HOH A O   1 
HETATM 4617 O  O   . HOH F 3 .   ? 37.275 26.493 34.086 1.00 37.66 ? 814 HOH A O   1 
HETATM 4618 O  O   . HOH F 3 .   ? 33.316 39.626 26.843 1.00 39.43 ? 815 HOH A O   1 
HETATM 4619 O  O   . HOH F 3 .   ? 18.360 11.016 45.165 1.00 40.57 ? 816 HOH A O   1 
HETATM 4620 O  O   . HOH F 3 .   ? 39.698 36.185 10.226 1.00 40.60 ? 817 HOH A O   1 
HETATM 4621 O  O   . HOH F 3 .   ? 29.855 3.987  31.052 1.00 40.33 ? 818 HOH A O   1 
HETATM 4622 O  O   . HOH F 3 .   ? 55.300 15.742 0.095  1.00 39.73 ? 819 HOH A O   1 
HETATM 4623 O  O   . HOH F 3 .   ? 60.345 35.819 13.147 1.00 42.40 ? 820 HOH A O   1 
HETATM 4624 O  O   . HOH F 3 .   ? 28.015 44.193 12.552 1.00 41.94 ? 821 HOH A O   1 
HETATM 4625 O  O   . HOH F 3 .   ? 46.869 20.945 -0.029 1.00 38.54 ? 822 HOH A O   1 
HETATM 4626 O  O   . HOH F 3 .   ? 24.330 23.666 5.828  1.00 42.86 ? 823 HOH A O   1 
HETATM 4627 O  O   . HOH F 3 .   ? 24.915 31.210 5.079  1.00 40.27 ? 824 HOH A O   1 
HETATM 4628 O  O   . HOH F 3 .   ? 64.686 34.788 21.823 1.00 40.06 ? 825 HOH A O   1 
HETATM 4629 O  O   . HOH F 3 .   ? 44.110 24.848 26.336 1.00 42.83 ? 826 HOH A O   1 
HETATM 4630 O  O   . HOH F 3 .   ? 17.197 14.979 2.072  1.00 42.46 ? 827 HOH A O   1 
HETATM 4631 O  O   . HOH F 3 .   ? 39.462 15.549 25.698 1.00 42.00 ? 828 HOH A O   1 
HETATM 4632 O  O   . HOH F 3 .   ? 40.051 40.538 16.858 1.00 43.73 ? 829 HOH A O   1 
HETATM 4633 O  O   . HOH F 3 .   ? 54.922 12.250 19.896 1.00 40.87 ? 830 HOH A O   1 
HETATM 4634 O  O   . HOH F 3 .   ? 40.450 29.946 14.226 1.00 42.80 ? 831 HOH A O   1 
HETATM 4635 O  O   . HOH F 3 .   ? 29.341 7.496  12.779 1.00 42.50 ? 832 HOH A O   1 
HETATM 4636 O  O   . HOH F 3 .   ? 56.120 19.712 5.263  1.00 42.42 ? 833 HOH A O   1 
HETATM 4637 O  O   . HOH F 3 .   ? 56.963 32.329 12.451 1.00 42.50 ? 834 HOH A O   1 
HETATM 4638 O  O   . HOH F 3 .   ? 38.875 8.252  36.133 1.00 43.13 ? 835 HOH A O   1 
HETATM 4639 O  O   . HOH F 3 .   ? 16.244 12.903 44.981 1.00 43.14 ? 836 HOH A O   1 
HETATM 4640 O  O   . HOH F 3 .   ? 52.720 16.961 20.665 1.00 42.51 ? 837 HOH A O   1 
HETATM 4641 O  O   . HOH F 3 .   ? 53.254 33.856 11.827 1.00 43.92 ? 838 HOH A O   1 
HETATM 4642 O  O   . HOH F 3 .   ? 4.629  23.154 26.162 1.00 45.12 ? 839 HOH A O   1 
HETATM 4643 O  O   . HOH F 3 .   ? 19.492 36.643 14.563 1.00 42.38 ? 840 HOH A O   1 
HETATM 4644 O  O   . HOH F 3 .   ? 45.730 12.896 -5.101 1.00 41.69 ? 841 HOH A O   1 
HETATM 4645 O  O   . HOH F 3 .   ? 10.138 29.015 18.430 1.00 43.01 ? 842 HOH A O   1 
HETATM 4646 O  O   . HOH F 3 .   ? 36.593 35.426 28.034 1.00 44.87 ? 843 HOH A O   1 
HETATM 4647 O  O   . HOH F 3 .   ? 17.381 8.972  14.202 1.00 44.15 ? 844 HOH A O   1 
HETATM 4648 O  O   . HOH F 3 .   ? 34.885 27.786 10.034 1.00 44.96 ? 845 HOH A O   1 
HETATM 4649 O  O   . HOH F 3 .   ? 40.074 34.980 27.772 1.00 41.41 ? 846 HOH A O   1 
HETATM 4650 O  O   . HOH F 3 .   ? 23.555 2.515  35.315 1.00 43.89 ? 847 HOH A O   1 
HETATM 4651 O  O   . HOH F 3 .   ? 24.037 36.928 10.759 1.00 42.62 ? 848 HOH A O   1 
HETATM 4652 O  O   . HOH F 3 .   ? 59.102 21.349 31.572 1.00 42.80 ? 849 HOH A O   1 
HETATM 4653 O  O   . HOH F 3 .   ? 11.172 13.707 11.024 1.00 43.19 ? 850 HOH A O   1 
HETATM 4654 O  O   . HOH F 3 .   ? 35.747 25.094 23.157 1.00 45.78 ? 851 HOH A O   1 
HETATM 4655 O  O   . HOH F 3 .   ? 14.611 14.115 46.499 1.00 43.93 ? 852 HOH A O   1 
HETATM 4656 O  O   . HOH F 3 .   ? 8.795  6.802  29.273 1.00 44.71 ? 853 HOH A O   1 
HETATM 4657 O  O   . HOH F 3 .   ? 24.792 5.344  13.894 1.00 47.00 ? 854 HOH A O   1 
HETATM 4658 O  O   . HOH F 3 .   ? 31.306 35.617 8.178  1.00 40.50 ? 855 HOH A O   1 
HETATM 4659 O  O   . HOH F 3 .   ? 23.310 28.763 4.872  1.00 46.54 ? 856 HOH A O   1 
HETATM 4660 O  O   . HOH F 3 .   ? 10.962 13.590 39.628 1.00 43.54 ? 857 HOH A O   1 
HETATM 4661 O  O   . HOH F 3 .   ? 24.551 40.580 26.855 1.00 43.27 ? 858 HOH A O   1 
HETATM 4662 O  O   . HOH F 3 .   ? 24.378 19.603 6.371  1.00 57.91 ? 859 HOH A O   1 
HETATM 4663 O  O   . HOH F 3 .   ? 70.290 30.579 15.057 1.00 46.79 ? 860 HOH A O   1 
HETATM 4664 O  O   . HOH F 3 .   ? 30.817 46.821 14.317 1.00 42.61 ? 861 HOH A O   1 
HETATM 4665 O  O   . HOH F 3 .   ? 65.725 46.942 18.907 1.00 48.48 ? 862 HOH A O   1 
HETATM 4666 O  O   . HOH F 3 .   ? 9.320  22.970 11.728 1.00 42.56 ? 863 HOH A O   1 
HETATM 4667 O  O   . HOH F 3 .   ? 36.083 31.161 13.290 1.00 43.81 ? 864 HOH A O   1 
HETATM 4668 O  O   . HOH F 3 .   ? 28.182 19.563 5.627  1.00 45.02 ? 865 HOH A O   1 
HETATM 4669 O  O   . HOH F 3 .   ? 36.265 23.888 20.086 1.00 44.82 ? 866 HOH A O   1 
HETATM 4670 O  O   . HOH F 3 .   ? 11.897 27.313 25.735 1.00 44.99 ? 867 HOH A O   1 
HETATM 4671 O  O   . HOH F 3 .   ? 23.062 4.653  33.168 1.00 44.18 ? 868 HOH A O   1 
HETATM 4672 O  O   . HOH F 3 .   ? 44.381 43.833 28.838 1.00 41.60 ? 869 HOH A O   1 
HETATM 4673 O  O   . HOH F 3 .   ? 19.824 23.707 48.516 1.00 44.25 ? 870 HOH A O   1 
HETATM 4674 O  O   . HOH F 3 .   ? 18.030 22.392 5.435  1.00 47.78 ? 871 HOH A O   1 
HETATM 4675 O  O   . HOH F 3 .   ? 40.341 18.209 6.926  1.00 44.38 ? 872 HOH A O   1 
HETATM 4676 O  O   . HOH F 3 .   ? 25.063 1.305  15.150 1.00 45.94 ? 873 HOH A O   1 
HETATM 4677 O  O   . HOH F 3 .   ? 37.155 0.331  18.414 1.00 46.07 ? 874 HOH A O   1 
HETATM 4678 O  O   . HOH F 3 .   ? 26.626 30.983 2.992  1.00 48.60 ? 875 HOH A O   1 
HETATM 4679 O  O   . HOH F 3 .   ? 28.034 30.497 39.231 1.00 39.10 ? 876 HOH A O   1 
HETATM 4680 O  O   . HOH F 3 .   ? -2.582 19.713 30.027 1.00 47.68 ? 877 HOH A O   1 
HETATM 4681 O  O   . HOH F 3 .   ? 33.258 30.582 41.117 1.00 45.57 ? 878 HOH A O   1 
HETATM 4682 O  O   . HOH F 3 .   ? 39.248 28.007 24.100 1.00 46.81 ? 879 HOH A O   1 
HETATM 4683 O  O   . HOH F 3 .   ? 48.317 35.262 31.889 1.00 43.92 ? 880 HOH A O   1 
HETATM 4684 O  O   . HOH F 3 .   ? 39.514 37.151 25.473 1.00 43.47 ? 881 HOH A O   1 
HETATM 4685 O  O   . HOH F 3 .   ? 38.235 34.995 25.180 1.00 47.71 ? 882 HOH A O   1 
HETATM 4686 O  O   . HOH F 3 .   ? 13.987 30.782 34.374 1.00 48.58 ? 883 HOH A O   1 
HETATM 4687 O  O   . HOH F 3 .   ? 10.905 16.867 3.882  1.00 47.15 ? 884 HOH A O   1 
HETATM 4688 O  O   . HOH F 3 .   ? 20.990 2.388  36.686 1.00 46.78 ? 885 HOH A O   1 
HETATM 4689 O  O   . HOH F 3 .   ? 42.324 21.227 24.490 1.00 46.75 ? 886 HOH A O   1 
HETATM 4690 O  O   . HOH F 3 .   ? 47.453 8.518  21.634 1.00 43.41 ? 887 HOH A O   1 
HETATM 4691 O  O   . HOH F 3 .   ? 38.034 33.796 11.730 1.00 44.78 ? 888 HOH A O   1 
HETATM 4692 O  O   . HOH F 3 .   ? 16.842 32.500 28.072 1.00 45.81 ? 889 HOH A O   1 
HETATM 4693 O  O   . HOH F 3 .   ? 10.469 6.051  37.243 1.00 49.10 ? 890 HOH A O   1 
HETATM 4694 O  O   . HOH F 3 .   ? 29.616 40.345 29.859 1.00 48.39 ? 891 HOH A O   1 
HETATM 4695 O  O   . HOH F 3 .   ? 21.494 -1.764 21.099 1.00 46.64 ? 892 HOH A O   1 
HETATM 4696 O  O   . HOH F 3 .   ? 30.016 48.180 12.209 1.00 48.86 ? 893 HOH A O   1 
HETATM 4697 O  O   . HOH F 3 .   ? 56.224 10.863 6.050  1.00 46.90 ? 894 HOH A O   1 
HETATM 4698 O  O   . HOH F 3 .   ? 16.546 29.564 45.347 1.00 46.95 ? 895 HOH A O   1 
HETATM 4699 O  O   . HOH F 3 .   ? 58.587 37.113 11.931 1.00 42.93 ? 896 HOH A O   1 
HETATM 4700 O  O   . HOH F 3 .   ? 60.407 13.628 15.761 1.00 46.19 ? 897 HOH A O   1 
HETATM 4701 O  O   . HOH F 3 .   ? 26.971 24.348 3.330  1.00 48.90 ? 898 HOH A O   1 
HETATM 4702 O  O   . HOH F 3 .   ? 17.959 12.472 12.617 1.00 46.79 ? 899 HOH A O   1 
HETATM 4703 O  O   . HOH F 3 .   ? 39.931 40.610 14.618 1.00 49.70 ? 900 HOH A O   1 
HETATM 4704 O  O   . HOH F 3 .   ? 22.810 43.253 19.583 1.00 49.16 ? 901 HOH A O   1 
HETATM 4705 O  O   . HOH F 3 .   ? 25.141 26.457 2.722  1.00 48.74 ? 902 HOH A O   1 
HETATM 4706 O  O   . HOH F 3 .   ? 9.573  20.743 43.770 1.00 45.82 ? 903 HOH A O   1 
HETATM 4707 O  O   . HOH F 3 .   ? 20.217 43.805 24.168 1.00 49.37 ? 904 HOH A O   1 
HETATM 4708 O  O   . HOH F 3 .   ? 51.939 46.021 29.775 1.00 49.54 ? 905 HOH A O   1 
HETATM 4709 O  O   . HOH F 3 .   ? 37.859 29.636 16.297 1.00 51.57 ? 906 HOH A O   1 
HETATM 4710 O  O   . HOH F 3 .   ? 10.347 30.552 20.447 1.00 49.75 ? 907 HOH A O   1 
HETATM 4711 O  O   . HOH F 3 .   ? 38.607 18.881 37.860 1.00 49.91 ? 908 HOH A O   1 
HETATM 4712 O  O   . HOH F 3 .   ? 23.957 40.158 29.012 1.00 48.29 ? 909 HOH A O   1 
HETATM 4713 O  O   . HOH F 3 .   ? 54.995 40.146 34.618 1.00 51.43 ? 910 HOH A O   1 
HETATM 4714 O  O   . HOH F 3 .   ? 37.539 22.365 10.583 1.00 48.26 ? 911 HOH A O   1 
HETATM 4715 O  O   . HOH F 3 .   ? 10.318 31.937 17.296 1.00 51.13 ? 912 HOH A O   1 
HETATM 4716 O  O   . HOH F 3 .   ? 33.172 17.152 6.140  1.00 49.26 ? 913 HOH A O   1 
HETATM 4717 O  O   . HOH F 3 .   ? 21.957 2.481  39.118 1.00 48.67 ? 914 HOH A O   1 
HETATM 4718 O  O   . HOH F 3 .   ? 7.833  16.139 39.891 1.00 48.17 ? 915 HOH A O   1 
HETATM 4719 O  O   . HOH F 3 .   ? 42.517 8.742  20.746 1.00 53.32 ? 916 HOH A O   1 
HETATM 4720 O  O   . HOH F 3 .   ? 30.665 20.219 5.708  1.00 50.57 ? 917 HOH A O   1 
HETATM 4721 O  O   . HOH F 3 .   ? -1.995 7.670  20.440 1.00 49.07 ? 918 HOH A O   1 
HETATM 4722 O  O   . HOH F 3 .   ? 52.786 6.853  18.415 1.00 46.48 ? 919 HOH A O   1 
HETATM 4723 O  O   . HOH F 3 .   ? 55.018 35.973 13.178 1.00 51.46 ? 920 HOH A O   1 
HETATM 4724 O  O   . HOH F 3 .   ? 38.634 21.653 26.902 1.00 49.36 ? 921 HOH A O   1 
HETATM 4725 O  O   . HOH F 3 .   ? 22.498 11.111 45.552 1.00 48.59 ? 922 HOH A O   1 
HETATM 4726 O  O   . HOH F 3 .   ? 27.827 26.694 2.421  1.00 52.30 ? 923 HOH A O   1 
HETATM 4727 O  O   . HOH F 3 .   ? 22.843 7.907  44.524 1.00 49.72 ? 924 HOH A O   1 
HETATM 4728 O  O   . HOH F 3 .   ? 16.101 36.653 26.185 1.00 56.20 ? 925 HOH A O   1 
HETATM 4729 O  O   . HOH F 3 .   ? 0.583  7.805  26.154 1.00 50.96 ? 926 HOH A O   1 
HETATM 4730 O  O   . HOH F 3 .   ? 41.823 25.419 38.899 1.00 53.30 ? 927 HOH A O   1 
HETATM 4731 O  O   . HOH F 3 .   ? 38.038 32.454 6.183  1.00 53.84 ? 928 HOH A O   1 
HETATM 4732 O  O   . HOH F 3 .   ? 21.544 1.059  34.385 1.00 52.93 ? 929 HOH A O   1 
HETATM 4733 O  O   . HOH F 3 .   ? 19.561 40.758 16.109 1.00 55.39 ? 930 HOH A O   1 
HETATM 4734 O  O   . HOH F 3 .   ? 17.078 1.687  20.832 1.00 52.19 ? 931 HOH A O   1 
HETATM 4735 O  O   . HOH F 3 .   ? 9.771  26.146 32.275 1.00 55.39 ? 932 HOH A O   1 
HETATM 4736 O  O   . HOH F 3 .   ? 19.831 1.531  25.958 1.00 55.16 ? 933 HOH A O   1 
HETATM 4737 O  O   . HOH F 3 .   ? 21.985 -1.556 42.772 1.00 55.45 ? 934 HOH A O   1 
HETATM 4738 O  O   . HOH F 3 .   ? 14.979 25.903 5.553  1.00 56.92 ? 935 HOH A O   1 
HETATM 4739 O  O   . HOH F 3 .   ? 20.455 25.361 3.597  1.00 56.10 ? 936 HOH A O   1 
HETATM 4740 O  O   . HOH F 3 .   ? 30.548 33.566 6.334  1.00 52.41 ? 937 HOH A O   1 
HETATM 4741 O  O   . HOH F 3 .   ? 40.710 8.395  11.569 1.00 53.81 ? 938 HOH A O   1 
HETATM 4742 O  O   . HOH F 3 .   ? 34.247 20.714 5.492  1.00 50.61 ? 939 HOH A O   1 
HETATM 4743 O  O   . HOH F 3 .   ? 24.239 -5.093 35.787 1.00 53.90 ? 940 HOH A O   1 
HETATM 4744 O  O   . HOH F 3 .   ? 48.320 3.623  0.533  1.00 57.49 ? 941 HOH A O   1 
HETATM 4745 O  O   . HOH F 3 .   ? 37.210 21.561 5.671  1.00 56.93 ? 942 HOH A O   1 
HETATM 4746 O  O   . HOH F 3 .   ? 16.532 21.593 47.765 1.00 53.65 ? 943 HOH A O   1 
HETATM 4747 O  O   . HOH F 3 .   ? 41.077 18.821 31.577 1.00 56.71 ? 944 HOH A O   1 
HETATM 4748 O  O   . HOH F 3 .   ? 42.846 26.714 25.900 1.00 54.78 ? 945 HOH A O   1 
HETATM 4749 O  O   . HOH F 3 .   ? 58.046 20.221 3.733  1.00 57.55 ? 946 HOH A O   1 
HETATM 4750 O  O   . HOH F 3 .   ? 36.902 36.035 7.122  1.00 51.96 ? 947 HOH A O   1 
HETATM 4751 O  O   . HOH F 3 .   ? 39.979 13.725 27.915 1.00 50.60 ? 948 HOH A O   1 
HETATM 4752 O  O   . HOH F 3 .   ? 58.308 31.803 10.699 1.00 54.81 ? 949 HOH A O   1 
HETATM 4753 O  O   . HOH F 3 .   ? 23.028 38.647 30.927 1.00 58.16 ? 950 HOH A O   1 
HETATM 4754 O  O   . HOH F 3 .   ? 30.258 27.390 2.865  1.00 51.57 ? 951 HOH A O   1 
HETATM 4755 O  O   . HOH F 3 .   ? 15.303 39.866 26.398 1.00 56.05 ? 952 HOH A O   1 
HETATM 4756 O  O   . HOH F 3 .   ? 53.699 52.330 -6.879 1.00 57.29 ? 953 HOH A O   1 
HETATM 4757 O  O   . HOH F 3 .   ? 16.917 34.792 39.763 1.00 52.77 ? 954 HOH A O   1 
HETATM 4758 O  O   . HOH F 3 .   ? 37.321 29.919 6.047  1.00 57.39 ? 955 HOH A O   1 
HETATM 4759 O  O   . HOH F 3 .   ? 59.445 23.769 30.389 1.00 58.04 ? 956 HOH A O   1 
HETATM 4760 O  O   . HOH F 3 .   ? 36.480 6.904  12.347 1.00 56.99 ? 957 HOH A O   1 
HETATM 4761 O  O   . HOH F 3 .   ? 36.137 26.928 5.940  1.00 56.09 ? 958 HOH A O   1 
HETATM 4762 O  O   . HOH F 3 .   ? 15.543 19.437 48.235 1.00 59.27 ? 959 HOH A O   1 
HETATM 4763 O  O   . HOH F 3 .   ? 7.998  6.139  22.154 1.00 58.99 ? 960 HOH A O   1 
HETATM 4764 O  O   . HOH F 3 .   ? 34.138 24.857 3.391  1.00 56.44 ? 961 HOH A O   1 
HETATM 4765 O  O   . HOH F 3 .   ? 5.551  11.789 33.547 1.00 59.47 ? 962 HOH A O   1 
HETATM 4766 O  O   . HOH F 3 .   ? 8.665  22.352 42.205 1.00 64.10 ? 963 HOH A O   1 
HETATM 4767 O  O   . HOH F 3 .   ? 58.108 4.285  21.750 1.00 63.39 ? 964 HOH A O   1 
HETATM 4768 O  O   . HOH F 3 .   ? 60.390 3.807  20.689 1.00 59.32 ? 965 HOH A O   1 
HETATM 4769 O  O   . HOH F 3 .   ? 57.716 5.764  19.629 1.00 66.24 ? 966 HOH A O   1 
HETATM 4770 O  O   . HOH F 3 .   ? 31.639 3.008  11.512 1.00 62.82 ? 967 HOH A O   1 
HETATM 4771 O  O   . HOH F 3 .   ? 18.231 4.134  9.372  1.00 49.61 ? 968 HOH A O   1 
HETATM 4772 O  O   . HOH F 3 .   ? 7.904  16.633 42.497 1.00 52.74 ? 969 HOH A O   1 
HETATM 4773 O  O   . HOH F 3 .   ? 67.489 9.863  11.220 1.00 53.85 ? 970 HOH A O   1 
HETATM 4774 O  O   . HOH F 3 .   ? 28.293 34.646 5.200  1.00 61.04 ? 971 HOH A O   1 
HETATM 4775 O  O   . HOH F 3 .   ? 57.147 46.165 24.256 1.00 49.14 ? 972 HOH A O   1 
HETATM 4776 O  O   . HOH F 3 .   ? 71.999 38.310 16.261 1.00 55.53 ? 973 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   P . n 
A 1 2   GLY 2   2   ?   ?   ?   P . n 
A 1 3   THR 3   3   ?   ?   ?   P . n 
A 1 4   VAL 4   4   ?   ?   ?   P . n 
A 1 5   SER 5   5   ?   ?   ?   P . n 
A 1 6   SER 6   6   ?   ?   ?   P . n 
A 1 7   ARG 7   7   ?   ?   ?   P . n 
A 1 8   ARG 8   8   ?   ?   ?   P . n 
A 1 9   SER 9   9   ?   ?   ?   P . n 
A 1 10  TRP 10  10  ?   ?   ?   P . n 
A 1 11  TRP 11  11  ?   ?   ?   P . n 
A 1 12  PRO 12  12  ?   ?   ?   P . n 
A 1 13  LEU 13  13  ?   ?   ?   P . n 
A 1 14  PRO 14  14  ?   ?   ?   P . n 
A 1 15  LEU 15  15  ?   ?   ?   P . n 
A 1 16  LEU 16  16  ?   ?   ?   P . n 
A 1 17  LEU 17  17  ?   ?   ?   P . n 
A 1 18  LEU 18  18  ?   ?   ?   P . n 
A 1 19  LEU 19  19  ?   ?   ?   P . n 
A 1 20  LEU 20  20  ?   ?   ?   P . n 
A 1 21  LEU 21  21  ?   ?   ?   P . n 
A 1 22  LEU 22  22  ?   ?   ?   P . n 
A 1 23  LEU 23  23  ?   ?   ?   P . n 
A 1 24  GLY 24  24  ?   ?   ?   P . n 
A 1 25  PRO 25  25  ?   ?   ?   P . n 
A 1 26  ALA 26  26  ?   ?   ?   P . n 
A 1 27  GLY 27  27  ?   ?   ?   P . n 
A 1 28  ALA 28  28  ?   ?   ?   P . n 
A 1 29  ARG 29  29  ?   ?   ?   P . n 
A 1 30  ALA 30  30  ?   ?   ?   P . n 
A 1 31  GLN 31  31  ?   ?   ?   P . n 
A 1 32  GLU 32  32  ?   ?   ?   P . n 
A 1 33  ASP 33  33  ?   ?   ?   P . n 
A 1 34  GLU 34  34  ?   ?   ?   P . n 
A 1 35  ASP 35  35  ?   ?   ?   P . n 
A 1 36  GLY 36  36  ?   ?   ?   P . n 
A 1 37  ASP 37  37  ?   ?   ?   P . n 
A 1 38  TYR 38  38  ?   ?   ?   P . n 
A 1 39  GLU 39  39  ?   ?   ?   P . n 
A 1 40  GLU 40  40  ?   ?   ?   P . n 
A 1 41  LEU 41  41  ?   ?   ?   P . n 
A 1 42  VAL 42  42  ?   ?   ?   P . n 
A 1 43  LEU 43  43  ?   ?   ?   P . n 
A 1 44  ALA 44  44  ?   ?   ?   P . n 
A 1 45  LEU 45  45  ?   ?   ?   P . n 
A 1 46  ARG 46  46  ?   ?   ?   P . n 
A 1 47  SER 47  47  ?   ?   ?   P . n 
A 1 48  GLU 48  48  ?   ?   ?   P . n 
A 1 49  GLU 49  49  ?   ?   ?   P . n 
A 1 50  ASP 50  50  ?   ?   ?   P . n 
A 1 51  GLY 51  51  ?   ?   ?   P . n 
A 1 52  LEU 52  52  ?   ?   ?   P . n 
A 1 53  ALA 53  53  ?   ?   ?   P . n 
A 1 54  GLU 54  54  ?   ?   ?   P . n 
A 1 55  ALA 55  55  ?   ?   ?   P . n 
A 1 56  PRO 56  56  ?   ?   ?   P . n 
A 1 57  GLU 57  57  ?   ?   ?   P . n 
A 1 58  HIS 58  58  ?   ?   ?   P . n 
A 1 59  GLY 59  59  ?   ?   ?   P . n 
A 1 60  THR 60  60  ?   ?   ?   P . n 
A 1 61  THR 61  61  61  THR THR P . n 
A 1 62  ALA 62  62  62  ALA ALA P . n 
A 1 63  THR 63  63  63  THR THR P . n 
A 1 64  PHE 64  64  64  PHE PHE P . n 
A 1 65  HIS 65  65  65  HIS HIS P . n 
A 1 66  ARG 66  66  66  ARG ARG P . n 
A 1 67  CYS 67  67  67  CYS CYS P . n 
A 1 68  ALA 68  68  68  ALA ALA P . n 
A 1 69  LYS 69  69  69  LYS LYS P . n 
A 1 70  ASP 70  70  70  ASP ASP P . n 
A 1 71  PRO 71  71  71  PRO PRO P . n 
A 1 72  TRP 72  72  72  TRP TRP P . n 
A 1 73  ARG 73  73  73  ARG ARG P . n 
A 1 74  LEU 74  74  74  LEU LEU P . n 
A 1 75  PRO 75  75  75  PRO PRO P . n 
A 1 76  GLY 76  76  76  GLY GLY P . n 
A 1 77  THR 77  77  77  THR THR P . n 
A 1 78  TYR 78  78  78  TYR TYR P . n 
A 1 79  VAL 79  79  79  VAL VAL P . n 
A 1 80  VAL 80  80  80  VAL VAL P . n 
A 1 81  VAL 81  81  81  VAL VAL P . n 
A 1 82  LEU 82  82  82  LEU LEU P . n 
A 1 83  LYS 83  83  83  LYS LYS P . n 
A 1 84  GLU 84  84  84  GLU GLU P . n 
A 1 85  GLU 85  85  85  GLU GLU P . n 
A 1 86  THR 86  86  86  THR THR P . n 
A 1 87  HIS 87  87  87  HIS HIS P . n 
A 1 88  LEU 88  88  88  LEU LEU P . n 
A 1 89  SER 89  89  89  SER SER P . n 
A 1 90  GLN 90  90  90  GLN GLN P . n 
A 1 91  SER 91  91  91  SER SER P . n 
A 1 92  GLU 92  92  92  GLU GLU P . n 
A 1 93  ARG 93  93  93  ARG ARG P . n 
A 1 94  THR 94  94  94  THR THR P . n 
A 1 95  ALA 95  95  95  ALA ALA P . n 
A 1 96  ARG 96  96  96  ARG ARG P . n 
A 1 97  ARG 97  97  97  ARG ARG P . n 
A 1 98  LEU 98  98  98  LEU LEU P . n 
A 1 99  GLN 99  99  99  GLN GLN P . n 
A 1 100 ALA 100 100 100 ALA ALA P . n 
A 1 101 GLN 101 101 101 GLN GLN P . n 
A 1 102 ALA 102 102 102 ALA ALA P . n 
A 1 103 ALA 103 103 103 ALA ALA P . n 
A 1 104 ARG 104 104 104 ARG ARG P . n 
A 1 105 ARG 105 105 105 ARG ARG P . n 
A 1 106 GLY 106 106 106 GLY GLY P . n 
A 1 107 TYR 107 107 107 TYR TYR P . n 
A 1 108 LEU 108 108 108 LEU LEU P . n 
A 1 109 THR 109 109 109 THR THR P . n 
A 1 110 LYS 110 110 110 LYS LYS P . n 
A 1 111 ILE 111 111 111 ILE ILE P . n 
A 1 112 LEU 112 112 112 LEU LEU P . n 
A 1 113 HIS 113 113 113 HIS HIS P . n 
A 1 114 VAL 114 114 114 VAL VAL P . n 
A 1 115 PHE 115 115 115 PHE PHE P . n 
A 1 116 HIS 116 116 116 HIS HIS P . n 
A 1 117 GLY 117 117 117 GLY GLY P . n 
A 1 118 LEU 118 118 118 LEU LEU P . n 
A 1 119 LEU 119 119 119 LEU LEU P . n 
A 1 120 PRO 120 120 120 PRO PRO P . n 
A 1 121 GLY 121 121 121 GLY GLY P . n 
A 1 122 PHE 122 122 122 PHE PHE P . n 
A 1 123 LEU 123 123 123 LEU LEU P . n 
A 1 124 VAL 124 124 124 VAL VAL P . n 
A 1 125 LYS 125 125 125 LYS LYS P . n 
A 1 126 MET 126 126 126 MET MET P . n 
A 1 127 SER 127 127 127 SER SER P . n 
A 1 128 GLY 128 128 128 GLY GLY P . n 
A 1 129 ASP 129 129 129 ASP ASP P . n 
A 1 130 LEU 130 130 130 LEU LEU P . n 
A 1 131 LEU 131 131 131 LEU LEU P . n 
A 1 132 GLU 132 132 132 GLU GLU P . n 
A 1 133 LEU 133 133 133 LEU LEU P . n 
A 1 134 ALA 134 134 134 ALA ALA P . n 
A 1 135 LEU 135 135 135 LEU LEU P . n 
A 1 136 LYS 136 136 136 LYS LYS P . n 
A 1 137 LEU 137 137 137 LEU LEU P . n 
A 1 138 PRO 138 138 138 PRO PRO P . n 
A 1 139 HIS 139 139 139 HIS HIS P . n 
A 1 140 VAL 140 140 140 VAL VAL P . n 
A 1 141 ASP 141 141 141 ASP ASP P . n 
A 1 142 TYR 142 142 142 TYR TYR P . n 
A 1 143 ILE 143 143 143 ILE ILE P . n 
A 1 144 GLU 144 144 144 GLU GLU P . n 
A 1 145 GLU 145 145 145 GLU GLU P . n 
A 1 146 ASP 146 146 146 ASP ASP P . n 
A 1 147 SER 147 147 147 SER SER P . n 
A 1 148 SER 148 148 148 SER SER P . n 
A 1 149 VAL 149 149 149 VAL VAL P . n 
A 1 150 PHE 150 150 150 PHE PHE P . n 
A 1 151 ALA 151 151 151 ALA ALA P . n 
A 1 152 GLN 152 152 152 GLN GLN P . n 
A 1 153 SER 153 153 ?   ?   ?   P . n 
A 1 154 ILE 154 154 ?   ?   ?   P . n 
A 1 155 PRO 155 155 ?   ?   ?   P . n 
A 1 156 TRP 156 156 ?   ?   ?   P . n 
A 1 157 ASN 157 157 ?   ?   ?   P . n 
A 1 158 LEU 158 158 ?   ?   ?   P . n 
A 1 159 GLU 159 159 ?   ?   ?   P . n 
A 1 160 ARG 160 160 ?   ?   ?   P . n 
A 1 161 ILE 161 161 ?   ?   ?   P . n 
A 1 162 THR 162 162 ?   ?   ?   P . n 
A 1 163 PRO 163 163 ?   ?   ?   P . n 
A 1 164 PRO 164 164 ?   ?   ?   P . n 
A 1 165 ARG 165 165 ?   ?   ?   P . n 
A 1 166 TYR 166 166 ?   ?   ?   P . n 
A 1 167 ARG 167 167 ?   ?   ?   P . n 
A 1 168 ALA 168 168 ?   ?   ?   P . n 
A 1 169 ASP 169 169 ?   ?   ?   P . n 
A 1 170 GLU 170 170 ?   ?   ?   P . n 
A 1 171 TYR 171 171 ?   ?   ?   P . n 
A 1 172 GLN 172 172 ?   ?   ?   P . n 
A 1 173 PRO 173 173 ?   ?   ?   P . n 
A 1 174 PRO 174 174 ?   ?   ?   P . n 
A 1 175 ASP 175 175 ?   ?   ?   P . n 
A 1 176 GLY 176 176 ?   ?   ?   P . n 
A 1 177 GLY 177 177 ?   ?   ?   P . n 
A 1 178 SER 178 178 ?   ?   ?   P . n 
A 1 179 LEU 179 179 ?   ?   ?   P . n 
A 1 180 VAL 180 180 ?   ?   ?   P . n 
A 1 181 GLU 181 181 ?   ?   ?   P . n 
A 1 182 VAL 182 182 ?   ?   ?   P . n 
A 1 183 TYR 183 183 ?   ?   ?   P . n 
A 1 184 LEU 184 184 ?   ?   ?   P . n 
A 1 185 LEU 185 185 ?   ?   ?   P . n 
A 1 186 ASP 186 186 ?   ?   ?   P . n 
A 1 187 THR 187 187 ?   ?   ?   P . n 
A 1 188 SER 188 188 ?   ?   ?   P . n 
A 1 189 ILE 189 189 ?   ?   ?   P . n 
A 1 190 GLN 190 190 ?   ?   ?   P . n 
A 1 191 SER 191 191 ?   ?   ?   P . n 
A 1 192 ASP 192 192 ?   ?   ?   P . n 
A 1 193 HIS 193 193 ?   ?   ?   P . n 
A 1 194 ARG 194 194 ?   ?   ?   P . n 
A 1 195 GLU 195 195 ?   ?   ?   P . n 
A 1 196 ILE 196 196 ?   ?   ?   P . n 
A 1 197 GLU 197 197 ?   ?   ?   P . n 
A 1 198 GLY 198 198 ?   ?   ?   P . n 
A 1 199 ARG 199 199 ?   ?   ?   P . n 
A 1 200 VAL 200 200 ?   ?   ?   P . n 
A 1 201 MET 201 201 ?   ?   ?   P . n 
A 1 202 VAL 202 202 ?   ?   ?   P . n 
A 1 203 THR 203 203 ?   ?   ?   P . n 
A 1 204 ASP 204 204 ?   ?   ?   P . n 
A 1 205 PHE 205 205 ?   ?   ?   P . n 
A 1 206 GLU 206 206 ?   ?   ?   P . n 
A 1 207 ASN 207 207 ?   ?   ?   P . n 
A 1 208 VAL 208 208 ?   ?   ?   P . n 
A 1 209 PRO 209 209 ?   ?   ?   P . n 
A 1 210 GLU 210 210 ?   ?   ?   P . n 
A 1 211 GLU 211 211 ?   ?   ?   P . n 
A 1 212 ASP 212 212 ?   ?   ?   P . n 
A 1 213 GLY 213 213 ?   ?   ?   P . n 
A 1 214 THR 214 214 ?   ?   ?   P . n 
A 1 215 ARG 215 215 ?   ?   ?   P . n 
A 1 216 PHE 216 216 ?   ?   ?   P . n 
A 1 217 HIS 217 217 ?   ?   ?   P . n 
A 1 218 ARG 218 218 ?   ?   ?   P . n 
A 1 219 GLN 219 219 ?   ?   ?   P . n 
A 1 220 ALA 220 220 ?   ?   ?   P . n 
A 1 221 SER 221 221 ?   ?   ?   P . n 
A 1 222 LYS 222 222 ?   ?   ?   P . n 
A 1 223 CYS 223 223 ?   ?   ?   P . n 
A 1 224 ASP 224 224 ?   ?   ?   P . n 
A 1 225 SER 225 225 ?   ?   ?   P . n 
A 1 226 HIS 226 226 ?   ?   ?   P . n 
A 1 227 GLY 227 227 ?   ?   ?   P . n 
A 1 228 THR 228 228 ?   ?   ?   P . n 
A 1 229 HIS 229 229 ?   ?   ?   P . n 
A 1 230 LEU 230 230 ?   ?   ?   P . n 
A 1 231 ALA 231 231 ?   ?   ?   P . n 
A 1 232 GLY 232 232 ?   ?   ?   P . n 
A 1 233 VAL 233 233 ?   ?   ?   P . n 
A 1 234 VAL 234 234 ?   ?   ?   P . n 
A 1 235 SER 235 235 ?   ?   ?   P . n 
A 1 236 GLY 236 236 ?   ?   ?   P . n 
A 1 237 ARG 237 237 ?   ?   ?   P . n 
A 1 238 ASP 238 238 ?   ?   ?   P . n 
A 1 239 ALA 239 239 ?   ?   ?   P . n 
A 1 240 GLY 240 240 ?   ?   ?   P . n 
A 1 241 VAL 241 241 ?   ?   ?   P . n 
A 1 242 ALA 242 242 ?   ?   ?   P . n 
A 1 243 LYS 243 243 ?   ?   ?   P . n 
A 1 244 GLY 244 244 ?   ?   ?   P . n 
A 1 245 ALA 245 245 ?   ?   ?   P . n 
A 1 246 SER 246 246 ?   ?   ?   P . n 
A 1 247 MET 247 247 ?   ?   ?   P . n 
A 1 248 ARG 248 248 ?   ?   ?   P . n 
A 1 249 SER 249 249 ?   ?   ?   P . n 
A 1 250 LEU 250 250 ?   ?   ?   P . n 
A 1 251 ARG 251 251 ?   ?   ?   P . n 
A 1 252 VAL 252 252 ?   ?   ?   P . n 
A 1 253 LEU 253 253 ?   ?   ?   P . n 
A 1 254 ASN 254 254 ?   ?   ?   P . n 
A 1 255 CYS 255 255 ?   ?   ?   P . n 
A 1 256 GLN 256 256 ?   ?   ?   P . n 
A 1 257 GLY 257 257 ?   ?   ?   P . n 
A 1 258 LYS 258 258 ?   ?   ?   P . n 
A 1 259 GLY 259 259 ?   ?   ?   P . n 
A 1 260 THR 260 260 ?   ?   ?   P . n 
A 1 261 VAL 261 261 ?   ?   ?   P . n 
A 1 262 SER 262 262 ?   ?   ?   P . n 
A 1 263 GLY 263 263 ?   ?   ?   P . n 
A 1 264 THR 264 264 ?   ?   ?   P . n 
A 1 265 LEU 265 265 ?   ?   ?   P . n 
A 1 266 ILE 266 266 ?   ?   ?   P . n 
A 1 267 GLY 267 267 ?   ?   ?   P . n 
A 1 268 LEU 268 268 ?   ?   ?   P . n 
A 1 269 GLU 269 269 ?   ?   ?   P . n 
A 1 270 PHE 270 270 ?   ?   ?   P . n 
A 1 271 ILE 271 271 ?   ?   ?   P . n 
A 1 272 ARG 272 272 ?   ?   ?   P . n 
A 1 273 LYS 273 273 ?   ?   ?   P . n 
A 1 274 SER 274 274 ?   ?   ?   P . n 
A 1 275 GLN 275 275 ?   ?   ?   P . n 
A 1 276 LEU 276 276 ?   ?   ?   P . n 
A 1 277 VAL 277 277 ?   ?   ?   P . n 
A 1 278 GLN 278 278 ?   ?   ?   P . n 
A 1 279 PRO 279 279 ?   ?   ?   P . n 
A 1 280 VAL 280 280 ?   ?   ?   P . n 
A 1 281 GLY 281 281 ?   ?   ?   P . n 
A 1 282 PRO 282 282 ?   ?   ?   P . n 
A 1 283 LEU 283 283 ?   ?   ?   P . n 
A 1 284 VAL 284 284 ?   ?   ?   P . n 
A 1 285 VAL 285 285 ?   ?   ?   P . n 
A 1 286 LEU 286 286 ?   ?   ?   P . n 
A 1 287 LEU 287 287 ?   ?   ?   P . n 
A 1 288 PRO 288 288 ?   ?   ?   P . n 
A 1 289 LEU 289 289 ?   ?   ?   P . n 
A 1 290 ALA 290 290 ?   ?   ?   P . n 
A 1 291 GLY 291 291 ?   ?   ?   P . n 
A 1 292 GLY 292 292 ?   ?   ?   P . n 
A 1 293 TYR 293 293 ?   ?   ?   P . n 
A 1 294 SER 294 294 ?   ?   ?   P . n 
A 1 295 ARG 295 295 ?   ?   ?   P . n 
A 1 296 VAL 296 296 ?   ?   ?   P . n 
A 1 297 LEU 297 297 ?   ?   ?   P . n 
A 1 298 ASN 298 298 ?   ?   ?   P . n 
A 1 299 ALA 299 299 ?   ?   ?   P . n 
A 1 300 ALA 300 300 ?   ?   ?   P . n 
A 1 301 CYS 301 301 ?   ?   ?   P . n 
A 1 302 GLN 302 302 ?   ?   ?   P . n 
A 1 303 ARG 303 303 ?   ?   ?   P . n 
A 1 304 LEU 304 304 ?   ?   ?   P . n 
A 1 305 ALA 305 305 ?   ?   ?   P . n 
A 1 306 ARG 306 306 ?   ?   ?   P . n 
A 1 307 ALA 307 307 ?   ?   ?   P . n 
A 1 308 GLY 308 308 ?   ?   ?   P . n 
A 1 309 VAL 309 309 ?   ?   ?   P . n 
A 1 310 VAL 310 310 ?   ?   ?   P . n 
A 1 311 LEU 311 311 ?   ?   ?   P . n 
A 1 312 VAL 312 312 ?   ?   ?   P . n 
A 1 313 THR 313 313 ?   ?   ?   P . n 
A 1 314 ALA 314 314 ?   ?   ?   P . n 
A 1 315 ALA 315 315 ?   ?   ?   P . n 
A 1 316 GLY 316 316 ?   ?   ?   P . n 
A 1 317 ASN 317 317 ?   ?   ?   P . n 
A 1 318 PHE 318 318 ?   ?   ?   P . n 
A 1 319 ARG 319 319 ?   ?   ?   P . n 
A 1 320 ASP 320 320 ?   ?   ?   P . n 
A 1 321 ASP 321 321 ?   ?   ?   P . n 
A 1 322 ALA 322 322 ?   ?   ?   P . n 
A 1 323 CYS 323 323 ?   ?   ?   P . n 
A 1 324 LEU 324 324 ?   ?   ?   P . n 
A 1 325 TYR 325 325 ?   ?   ?   P . n 
A 1 326 SER 326 326 ?   ?   ?   P . n 
A 1 327 PRO 327 327 ?   ?   ?   P . n 
A 1 328 ALA 328 328 ?   ?   ?   P . n 
A 1 329 SER 329 329 ?   ?   ?   P . n 
A 1 330 ALA 330 330 ?   ?   ?   P . n 
A 1 331 PRO 331 331 ?   ?   ?   P . n 
A 1 332 GLU 332 332 ?   ?   ?   P . n 
A 1 333 VAL 333 333 ?   ?   ?   P . n 
A 1 334 ILE 334 334 ?   ?   ?   P . n 
A 1 335 THR 335 335 ?   ?   ?   P . n 
A 1 336 VAL 336 336 ?   ?   ?   P . n 
A 1 337 GLY 337 337 ?   ?   ?   P . n 
A 1 338 ALA 338 338 ?   ?   ?   P . n 
A 1 339 THR 339 339 ?   ?   ?   P . n 
A 1 340 ASN 340 340 ?   ?   ?   P . n 
A 1 341 ALA 341 341 ?   ?   ?   P . n 
A 1 342 GLN 342 342 ?   ?   ?   P . n 
A 1 343 ASP 343 343 ?   ?   ?   P . n 
A 1 344 GLN 344 344 ?   ?   ?   P . n 
A 1 345 PRO 345 345 ?   ?   ?   P . n 
A 1 346 VAL 346 346 ?   ?   ?   P . n 
A 1 347 THR 347 347 ?   ?   ?   P . n 
A 1 348 LEU 348 348 ?   ?   ?   P . n 
A 1 349 GLY 349 349 ?   ?   ?   P . n 
A 1 350 THR 350 350 ?   ?   ?   P . n 
A 1 351 LEU 351 351 ?   ?   ?   P . n 
A 1 352 GLY 352 352 ?   ?   ?   P . n 
A 1 353 THR 353 353 ?   ?   ?   P . n 
A 1 354 ASN 354 354 ?   ?   ?   P . n 
A 1 355 PHE 355 355 ?   ?   ?   P . n 
A 1 356 GLY 356 356 ?   ?   ?   P . n 
A 1 357 ARG 357 357 ?   ?   ?   P . n 
A 1 358 CYS 358 358 ?   ?   ?   P . n 
A 1 359 VAL 359 359 ?   ?   ?   P . n 
A 1 360 ASP 360 360 ?   ?   ?   P . n 
A 1 361 LEU 361 361 ?   ?   ?   P . n 
A 1 362 PHE 362 362 ?   ?   ?   P . n 
A 1 363 ALA 363 363 ?   ?   ?   P . n 
A 1 364 PRO 364 364 ?   ?   ?   P . n 
A 1 365 GLY 365 365 ?   ?   ?   P . n 
A 1 366 GLU 366 366 ?   ?   ?   P . n 
A 1 367 ASP 367 367 ?   ?   ?   P . n 
A 1 368 ILE 368 368 ?   ?   ?   P . n 
A 1 369 ILE 369 369 ?   ?   ?   P . n 
A 1 370 GLY 370 370 ?   ?   ?   P . n 
A 1 371 ALA 371 371 ?   ?   ?   P . n 
A 1 372 SER 372 372 ?   ?   ?   P . n 
A 1 373 SER 373 373 ?   ?   ?   P . n 
A 1 374 ASP 374 374 ?   ?   ?   P . n 
A 1 375 CYS 375 375 ?   ?   ?   P . n 
A 1 376 SER 376 376 ?   ?   ?   P . n 
A 1 377 THR 377 377 ?   ?   ?   P . n 
A 1 378 CYS 378 378 ?   ?   ?   P . n 
A 1 379 PHE 379 379 ?   ?   ?   P . n 
A 1 380 VAL 380 380 ?   ?   ?   P . n 
A 1 381 SER 381 381 ?   ?   ?   P . n 
A 1 382 GLN 382 382 ?   ?   ?   P . n 
A 1 383 SER 383 383 ?   ?   ?   P . n 
A 1 384 GLY 384 384 ?   ?   ?   P . n 
A 1 385 THR 385 385 ?   ?   ?   P . n 
A 1 386 SER 386 386 ?   ?   ?   P . n 
A 1 387 GLN 387 387 ?   ?   ?   P . n 
A 1 388 ALA 388 388 ?   ?   ?   P . n 
A 1 389 ALA 389 389 ?   ?   ?   P . n 
A 1 390 ALA 390 390 ?   ?   ?   P . n 
A 1 391 HIS 391 391 ?   ?   ?   P . n 
A 1 392 VAL 392 392 ?   ?   ?   P . n 
A 1 393 ALA 393 393 ?   ?   ?   P . n 
A 1 394 GLY 394 394 ?   ?   ?   P . n 
A 1 395 ILE 395 395 ?   ?   ?   P . n 
A 1 396 ALA 396 396 ?   ?   ?   P . n 
A 1 397 ALA 397 397 ?   ?   ?   P . n 
A 1 398 MET 398 398 ?   ?   ?   P . n 
A 1 399 MET 399 399 ?   ?   ?   P . n 
A 1 400 LEU 400 400 ?   ?   ?   P . n 
A 1 401 SER 401 401 ?   ?   ?   P . n 
A 1 402 ALA 402 402 ?   ?   ?   P . n 
A 1 403 GLU 403 403 ?   ?   ?   P . n 
A 1 404 PRO 404 404 ?   ?   ?   P . n 
A 1 405 GLU 405 405 ?   ?   ?   P . n 
A 1 406 LEU 406 406 ?   ?   ?   P . n 
A 1 407 THR 407 407 ?   ?   ?   P . n 
A 1 408 LEU 408 408 ?   ?   ?   P . n 
A 1 409 ALA 409 409 ?   ?   ?   P . n 
A 1 410 GLU 410 410 ?   ?   ?   P . n 
A 1 411 LEU 411 411 ?   ?   ?   P . n 
A 1 412 ARG 412 412 ?   ?   ?   P . n 
A 1 413 GLN 413 413 ?   ?   ?   P . n 
A 1 414 ARG 414 414 ?   ?   ?   P . n 
A 1 415 LEU 415 415 ?   ?   ?   P . n 
A 1 416 ILE 416 416 ?   ?   ?   P . n 
A 1 417 HIS 417 417 ?   ?   ?   P . n 
A 1 418 PHE 418 418 ?   ?   ?   P . n 
A 1 419 SER 419 419 ?   ?   ?   P . n 
A 1 420 ALA 420 420 ?   ?   ?   P . n 
A 1 421 LYS 421 421 ?   ?   ?   P . n 
A 1 422 ASP 422 422 ?   ?   ?   P . n 
A 1 423 VAL 423 423 ?   ?   ?   P . n 
A 1 424 ILE 424 424 ?   ?   ?   P . n 
A 1 425 ASN 425 425 ?   ?   ?   P . n 
A 1 426 GLU 426 426 ?   ?   ?   P . n 
A 1 427 ALA 427 427 ?   ?   ?   P . n 
A 1 428 TRP 428 428 ?   ?   ?   P . n 
A 1 429 PHE 429 429 ?   ?   ?   P . n 
A 1 430 PRO 430 430 ?   ?   ?   P . n 
A 1 431 GLU 431 431 ?   ?   ?   P . n 
A 1 432 ASP 432 432 ?   ?   ?   P . n 
A 1 433 GLN 433 433 ?   ?   ?   P . n 
A 1 434 ARG 434 434 ?   ?   ?   P . n 
A 1 435 VAL 435 435 ?   ?   ?   P . n 
A 1 436 LEU 436 436 ?   ?   ?   P . n 
A 1 437 THR 437 437 ?   ?   ?   P . n 
A 1 438 PRO 438 438 ?   ?   ?   P . n 
A 1 439 ASN 439 439 ?   ?   ?   P . n 
A 1 440 LEU 440 440 ?   ?   ?   P . n 
A 1 441 VAL 441 441 ?   ?   ?   P . n 
A 1 442 ALA 442 442 ?   ?   ?   P . n 
A 1 443 ALA 443 443 ?   ?   ?   P . n 
A 1 444 LEU 444 444 ?   ?   ?   P . n 
A 1 445 PRO 445 445 ?   ?   ?   P . n 
A 1 446 PRO 446 446 ?   ?   ?   P . n 
A 1 447 SER 447 447 ?   ?   ?   P . n 
A 1 448 THR 448 448 ?   ?   ?   P . n 
A 1 449 HIS 449 449 ?   ?   ?   P . n 
A 1 450 GLY 450 450 ?   ?   ?   P . n 
A 1 451 ALA 451 451 ?   ?   ?   P . n 
A 1 452 GLY 452 452 ?   ?   ?   P . n 
A 1 453 TRP 453 453 ?   ?   ?   P . n 
A 1 454 GLN 454 454 ?   ?   ?   P . n 
A 1 455 LEU 455 455 ?   ?   ?   P . n 
A 1 456 PHE 456 456 ?   ?   ?   P . n 
A 1 457 CYS 457 457 ?   ?   ?   P . n 
A 1 458 ARG 458 458 ?   ?   ?   P . n 
A 1 459 THR 459 459 ?   ?   ?   P . n 
A 1 460 VAL 460 460 ?   ?   ?   P . n 
A 1 461 TRP 461 461 ?   ?   ?   P . n 
A 1 462 SER 462 462 ?   ?   ?   P . n 
A 1 463 ALA 463 463 ?   ?   ?   P . n 
A 1 464 HIS 464 464 ?   ?   ?   P . n 
A 1 465 SER 465 465 ?   ?   ?   P . n 
A 1 466 GLY 466 466 ?   ?   ?   P . n 
A 1 467 PRO 467 467 ?   ?   ?   P . n 
A 1 468 THR 468 468 ?   ?   ?   P . n 
A 1 469 ARG 469 469 ?   ?   ?   P . n 
A 1 470 MET 470 470 ?   ?   ?   P . n 
A 1 471 ALA 471 471 ?   ?   ?   P . n 
A 1 472 THR 472 472 ?   ?   ?   P . n 
A 1 473 ALA 473 473 ?   ?   ?   P . n 
A 1 474 ILE 474 474 ?   ?   ?   P . n 
A 1 475 ALA 475 475 ?   ?   ?   P . n 
A 1 476 ARG 476 476 ?   ?   ?   P . n 
A 1 477 CYS 477 477 ?   ?   ?   P . n 
A 1 478 ALA 478 478 ?   ?   ?   P . n 
A 1 479 PRO 479 479 ?   ?   ?   P . n 
A 1 480 ASP 480 480 ?   ?   ?   P . n 
A 1 481 GLU 481 481 ?   ?   ?   P . n 
A 1 482 GLU 482 482 ?   ?   ?   P . n 
A 1 483 LEU 483 483 ?   ?   ?   P . n 
A 1 484 LEU 484 484 ?   ?   ?   P . n 
A 1 485 SER 485 485 ?   ?   ?   P . n 
A 1 486 CYS 486 486 ?   ?   ?   P . n 
A 1 487 SER 487 487 ?   ?   ?   P . n 
A 1 488 SER 488 488 ?   ?   ?   P . n 
A 1 489 PHE 489 489 ?   ?   ?   P . n 
A 1 490 SER 490 490 ?   ?   ?   P . n 
A 1 491 ARG 491 491 ?   ?   ?   P . n 
A 1 492 SER 492 492 ?   ?   ?   P . n 
A 1 493 GLY 493 493 ?   ?   ?   P . n 
A 1 494 LYS 494 494 ?   ?   ?   P . n 
A 1 495 ARG 495 495 ?   ?   ?   P . n 
A 1 496 ARG 496 496 ?   ?   ?   P . n 
A 1 497 GLY 497 497 ?   ?   ?   P . n 
A 1 498 GLU 498 498 ?   ?   ?   P . n 
A 1 499 ARG 499 499 ?   ?   ?   P . n 
A 1 500 MET 500 500 ?   ?   ?   P . n 
A 1 501 GLU 501 501 ?   ?   ?   P . n 
A 1 502 ALA 502 502 ?   ?   ?   P . n 
A 1 503 GLN 503 503 ?   ?   ?   P . n 
A 1 504 GLY 504 504 ?   ?   ?   P . n 
A 1 505 GLY 505 505 ?   ?   ?   P . n 
A 1 506 LYS 506 506 ?   ?   ?   P . n 
A 1 507 LEU 507 507 ?   ?   ?   P . n 
A 1 508 VAL 508 508 ?   ?   ?   P . n 
A 1 509 CYS 509 509 ?   ?   ?   P . n 
A 1 510 ARG 510 510 ?   ?   ?   P . n 
A 1 511 ALA 511 511 ?   ?   ?   P . n 
A 1 512 HIS 512 512 ?   ?   ?   P . n 
A 1 513 ASN 513 513 ?   ?   ?   P . n 
A 1 514 ALA 514 514 ?   ?   ?   P . n 
A 1 515 PHE 515 515 ?   ?   ?   P . n 
A 1 516 GLY 516 516 ?   ?   ?   P . n 
A 1 517 GLY 517 517 ?   ?   ?   P . n 
A 1 518 GLU 518 518 ?   ?   ?   P . n 
A 1 519 GLY 519 519 ?   ?   ?   P . n 
A 1 520 VAL 520 520 ?   ?   ?   P . n 
A 1 521 TYR 521 521 ?   ?   ?   P . n 
A 1 522 ALA 522 522 ?   ?   ?   P . n 
A 1 523 ILE 523 523 ?   ?   ?   P . n 
A 1 524 ALA 524 524 ?   ?   ?   P . n 
A 1 525 ARG 525 525 ?   ?   ?   P . n 
A 1 526 CYS 526 526 ?   ?   ?   P . n 
A 1 527 CYS 527 527 ?   ?   ?   P . n 
A 1 528 LEU 528 528 ?   ?   ?   P . n 
A 1 529 LEU 529 529 ?   ?   ?   P . n 
A 1 530 PRO 530 530 ?   ?   ?   P . n 
A 1 531 GLN 531 531 ?   ?   ?   P . n 
A 1 532 ALA 532 532 ?   ?   ?   P . n 
A 1 533 ASN 533 533 ?   ?   ?   P . n 
A 1 534 CYS 534 534 ?   ?   ?   P . n 
A 1 535 SER 535 535 ?   ?   ?   P . n 
A 1 536 VAL 536 536 ?   ?   ?   P . n 
A 1 537 HIS 537 537 ?   ?   ?   P . n 
A 1 538 THR 538 538 ?   ?   ?   P . n 
A 1 539 ALA 539 539 ?   ?   ?   P . n 
A 1 540 PRO 540 540 ?   ?   ?   P . n 
A 1 541 PRO 541 541 ?   ?   ?   P . n 
A 1 542 ALA 542 542 ?   ?   ?   P . n 
A 1 543 GLU 543 543 ?   ?   ?   P . n 
A 1 544 ALA 544 544 ?   ?   ?   P . n 
A 1 545 SER 545 545 ?   ?   ?   P . n 
A 1 546 MET 546 546 ?   ?   ?   P . n 
A 1 547 GLY 547 547 ?   ?   ?   P . n 
A 1 548 THR 548 548 ?   ?   ?   P . n 
A 1 549 ARG 549 549 ?   ?   ?   P . n 
A 1 550 VAL 550 550 ?   ?   ?   P . n 
A 1 551 HIS 551 551 ?   ?   ?   P . n 
A 1 552 CYS 552 552 ?   ?   ?   P . n 
A 1 553 HIS 553 553 ?   ?   ?   P . n 
A 1 554 GLN 554 554 ?   ?   ?   P . n 
A 1 555 GLN 555 555 ?   ?   ?   P . n 
A 1 556 GLY 556 556 ?   ?   ?   P . n 
A 1 557 HIS 557 557 ?   ?   ?   P . n 
A 1 558 VAL 558 558 ?   ?   ?   P . n 
A 1 559 LEU 559 559 ?   ?   ?   P . n 
A 1 560 THR 560 560 ?   ?   ?   P . n 
A 1 561 GLY 561 561 ?   ?   ?   P . n 
A 1 562 CYS 562 562 ?   ?   ?   P . n 
A 1 563 SER 563 563 ?   ?   ?   P . n 
A 1 564 SER 564 564 ?   ?   ?   P . n 
A 1 565 HIS 565 565 ?   ?   ?   P . n 
A 1 566 TRP 566 566 ?   ?   ?   P . n 
A 1 567 GLU 567 567 ?   ?   ?   P . n 
A 1 568 VAL 568 568 ?   ?   ?   P . n 
A 1 569 GLU 569 569 ?   ?   ?   P . n 
A 1 570 ASP 570 570 ?   ?   ?   P . n 
A 1 571 LEU 571 571 ?   ?   ?   P . n 
A 1 572 GLY 572 572 ?   ?   ?   P . n 
A 1 573 THR 573 573 ?   ?   ?   P . n 
A 1 574 HIS 574 574 ?   ?   ?   P . n 
A 1 575 LYS 575 575 ?   ?   ?   P . n 
A 1 576 PRO 576 576 ?   ?   ?   P . n 
A 1 577 PRO 577 577 ?   ?   ?   P . n 
A 1 578 VAL 578 578 ?   ?   ?   P . n 
A 1 579 LEU 579 579 ?   ?   ?   P . n 
A 1 580 ARG 580 580 ?   ?   ?   P . n 
A 1 581 PRO 581 581 ?   ?   ?   P . n 
A 1 582 ARG 582 582 ?   ?   ?   P . n 
A 1 583 GLY 583 583 ?   ?   ?   P . n 
A 1 584 GLN 584 584 ?   ?   ?   P . n 
A 1 585 PRO 585 585 ?   ?   ?   P . n 
A 1 586 ASN 586 586 ?   ?   ?   P . n 
A 1 587 GLN 587 587 ?   ?   ?   P . n 
A 1 588 CYS 588 588 ?   ?   ?   P . n 
A 1 589 VAL 589 589 ?   ?   ?   P . n 
A 1 590 GLY 590 590 ?   ?   ?   P . n 
A 1 591 HIS 591 591 ?   ?   ?   P . n 
A 1 592 ARG 592 592 ?   ?   ?   P . n 
A 1 593 GLU 593 593 ?   ?   ?   P . n 
A 1 594 ALA 594 594 ?   ?   ?   P . n 
A 1 595 SER 595 595 ?   ?   ?   P . n 
A 1 596 ILE 596 596 ?   ?   ?   P . n 
A 1 597 HIS 597 597 ?   ?   ?   P . n 
A 1 598 ALA 598 598 ?   ?   ?   P . n 
A 1 599 SER 599 599 ?   ?   ?   P . n 
A 1 600 CYS 600 600 ?   ?   ?   P . n 
A 1 601 CYS 601 601 ?   ?   ?   P . n 
A 1 602 HIS 602 602 ?   ?   ?   P . n 
A 1 603 ALA 603 603 ?   ?   ?   P . n 
A 1 604 PRO 604 604 ?   ?   ?   P . n 
A 1 605 GLY 605 605 ?   ?   ?   P . n 
A 1 606 LEU 606 606 ?   ?   ?   P . n 
A 1 607 GLU 607 607 ?   ?   ?   P . n 
A 1 608 CYS 608 608 ?   ?   ?   P . n 
A 1 609 LYS 609 609 ?   ?   ?   P . n 
A 1 610 VAL 610 610 ?   ?   ?   P . n 
A 1 611 LYS 611 611 ?   ?   ?   P . n 
A 1 612 GLU 612 612 ?   ?   ?   P . n 
A 1 613 HIS 613 613 ?   ?   ?   P . n 
A 1 614 GLY 614 614 ?   ?   ?   P . n 
A 1 615 ILE 615 615 ?   ?   ?   P . n 
A 1 616 PRO 616 616 ?   ?   ?   P . n 
A 1 617 ALA 617 617 ?   ?   ?   P . n 
A 1 618 PRO 618 618 ?   ?   ?   P . n 
A 1 619 GLN 619 619 ?   ?   ?   P . n 
A 1 620 GLU 620 620 ?   ?   ?   P . n 
A 1 621 GLN 621 621 ?   ?   ?   P . n 
A 1 622 VAL 622 622 ?   ?   ?   P . n 
A 1 623 THR 623 623 ?   ?   ?   P . n 
A 1 624 VAL 624 624 ?   ?   ?   P . n 
A 1 625 ALA 625 625 ?   ?   ?   P . n 
A 1 626 CYS 626 626 ?   ?   ?   P . n 
A 1 627 GLU 627 627 ?   ?   ?   P . n 
A 1 628 GLU 628 628 ?   ?   ?   P . n 
A 1 629 GLY 629 629 ?   ?   ?   P . n 
A 1 630 TRP 630 630 ?   ?   ?   P . n 
A 1 631 THR 631 631 ?   ?   ?   P . n 
A 1 632 LEU 632 632 ?   ?   ?   P . n 
A 1 633 THR 633 633 ?   ?   ?   P . n 
A 1 634 GLY 634 634 ?   ?   ?   P . n 
A 1 635 CYS 635 635 ?   ?   ?   P . n 
A 1 636 SER 636 636 ?   ?   ?   P . n 
A 1 637 ALA 637 637 ?   ?   ?   P . n 
A 1 638 LEU 638 638 ?   ?   ?   P . n 
A 1 639 PRO 639 639 ?   ?   ?   P . n 
A 1 640 GLY 640 640 ?   ?   ?   P . n 
A 1 641 THR 641 641 ?   ?   ?   P . n 
A 1 642 SER 642 642 ?   ?   ?   P . n 
A 1 643 HIS 643 643 ?   ?   ?   P . n 
A 1 644 VAL 644 644 ?   ?   ?   P . n 
A 1 645 LEU 645 645 ?   ?   ?   P . n 
A 1 646 GLY 646 646 ?   ?   ?   P . n 
A 1 647 ALA 647 647 ?   ?   ?   P . n 
A 1 648 TYR 648 648 ?   ?   ?   P . n 
A 1 649 ALA 649 649 ?   ?   ?   P . n 
A 1 650 VAL 650 650 ?   ?   ?   P . n 
A 1 651 ASP 651 651 ?   ?   ?   P . n 
A 1 652 ASN 652 652 ?   ?   ?   P . n 
A 1 653 THR 653 653 ?   ?   ?   P . n 
A 1 654 CYS 654 654 ?   ?   ?   P . n 
A 1 655 VAL 655 655 ?   ?   ?   P . n 
A 1 656 VAL 656 656 ?   ?   ?   P . n 
A 1 657 ARG 657 657 ?   ?   ?   P . n 
A 1 658 SER 658 658 ?   ?   ?   P . n 
A 1 659 ARG 659 659 ?   ?   ?   P . n 
A 1 660 ASP 660 660 ?   ?   ?   P . n 
A 1 661 VAL 661 661 ?   ?   ?   P . n 
A 1 662 SER 662 662 ?   ?   ?   P . n 
A 1 663 THR 663 663 ?   ?   ?   P . n 
A 1 664 THR 664 664 ?   ?   ?   P . n 
A 1 665 GLY 665 665 ?   ?   ?   P . n 
A 1 666 SER 666 666 ?   ?   ?   P . n 
A 1 667 THR 667 667 ?   ?   ?   P . n 
A 1 668 SER 668 668 ?   ?   ?   P . n 
A 1 669 GLU 669 669 ?   ?   ?   P . n 
A 1 670 GLU 670 670 ?   ?   ?   P . n 
A 1 671 ALA 671 671 ?   ?   ?   P . n 
A 1 672 VAL 672 672 ?   ?   ?   P . n 
A 1 673 THR 673 673 ?   ?   ?   P . n 
A 1 674 ALA 674 674 ?   ?   ?   P . n 
A 1 675 VAL 675 675 ?   ?   ?   P . n 
A 1 676 ALA 676 676 ?   ?   ?   P . n 
A 1 677 ILE 677 677 ?   ?   ?   P . n 
A 1 678 CYS 678 678 ?   ?   ?   P . n 
A 1 679 CYS 679 679 ?   ?   ?   P . n 
A 1 680 ARG 680 680 ?   ?   ?   P . n 
A 1 681 SER 681 681 ?   ?   ?   P . n 
A 1 682 ARG 682 682 ?   ?   ?   P . n 
A 1 683 HIS 683 683 ?   ?   ?   P . n 
A 1 684 LEU 684 684 ?   ?   ?   P . n 
A 1 685 ALA 685 685 ?   ?   ?   P . n 
A 1 686 GLN 686 686 ?   ?   ?   P . n 
A 1 687 ALA 687 687 ?   ?   ?   P . n 
A 1 688 SER 688 688 ?   ?   ?   P . n 
A 1 689 GLN 689 689 ?   ?   ?   P . n 
A 1 690 GLU 690 690 ?   ?   ?   P . n 
A 1 691 LEU 691 691 ?   ?   ?   P . n 
A 1 692 GLN 692 692 ?   ?   ?   P . n 
B 1 1   MET 1   1   ?   ?   ?   A . n 
B 1 2   GLY 2   2   ?   ?   ?   A . n 
B 1 3   THR 3   3   ?   ?   ?   A . n 
B 1 4   VAL 4   4   ?   ?   ?   A . n 
B 1 5   SER 5   5   ?   ?   ?   A . n 
B 1 6   SER 6   6   ?   ?   ?   A . n 
B 1 7   ARG 7   7   ?   ?   ?   A . n 
B 1 8   ARG 8   8   ?   ?   ?   A . n 
B 1 9   SER 9   9   ?   ?   ?   A . n 
B 1 10  TRP 10  10  ?   ?   ?   A . n 
B 1 11  TRP 11  11  ?   ?   ?   A . n 
B 1 12  PRO 12  12  ?   ?   ?   A . n 
B 1 13  LEU 13  13  ?   ?   ?   A . n 
B 1 14  PRO 14  14  ?   ?   ?   A . n 
B 1 15  LEU 15  15  ?   ?   ?   A . n 
B 1 16  LEU 16  16  ?   ?   ?   A . n 
B 1 17  LEU 17  17  ?   ?   ?   A . n 
B 1 18  LEU 18  18  ?   ?   ?   A . n 
B 1 19  LEU 19  19  ?   ?   ?   A . n 
B 1 20  LEU 20  20  ?   ?   ?   A . n 
B 1 21  LEU 21  21  ?   ?   ?   A . n 
B 1 22  LEU 22  22  ?   ?   ?   A . n 
B 1 23  LEU 23  23  ?   ?   ?   A . n 
B 1 24  GLY 24  24  ?   ?   ?   A . n 
B 1 25  PRO 25  25  ?   ?   ?   A . n 
B 1 26  ALA 26  26  ?   ?   ?   A . n 
B 1 27  GLY 27  27  ?   ?   ?   A . n 
B 1 28  ALA 28  28  ?   ?   ?   A . n 
B 1 29  ARG 29  29  ?   ?   ?   A . n 
B 1 30  ALA 30  30  ?   ?   ?   A . n 
B 1 31  GLN 31  31  ?   ?   ?   A . n 
B 1 32  GLU 32  32  ?   ?   ?   A . n 
B 1 33  ASP 33  33  ?   ?   ?   A . n 
B 1 34  GLU 34  34  ?   ?   ?   A . n 
B 1 35  ASP 35  35  ?   ?   ?   A . n 
B 1 36  GLY 36  36  ?   ?   ?   A . n 
B 1 37  ASP 37  37  ?   ?   ?   A . n 
B 1 38  TYR 38  38  ?   ?   ?   A . n 
B 1 39  GLU 39  39  ?   ?   ?   A . n 
B 1 40  GLU 40  40  ?   ?   ?   A . n 
B 1 41  LEU 41  41  ?   ?   ?   A . n 
B 1 42  VAL 42  42  ?   ?   ?   A . n 
B 1 43  LEU 43  43  ?   ?   ?   A . n 
B 1 44  ALA 44  44  ?   ?   ?   A . n 
B 1 45  LEU 45  45  ?   ?   ?   A . n 
B 1 46  ARG 46  46  ?   ?   ?   A . n 
B 1 47  SER 47  47  ?   ?   ?   A . n 
B 1 48  GLU 48  48  ?   ?   ?   A . n 
B 1 49  GLU 49  49  ?   ?   ?   A . n 
B 1 50  ASP 50  50  ?   ?   ?   A . n 
B 1 51  GLY 51  51  ?   ?   ?   A . n 
B 1 52  LEU 52  52  ?   ?   ?   A . n 
B 1 53  ALA 53  53  ?   ?   ?   A . n 
B 1 54  GLU 54  54  ?   ?   ?   A . n 
B 1 55  ALA 55  55  ?   ?   ?   A . n 
B 1 56  PRO 56  56  ?   ?   ?   A . n 
B 1 57  GLU 57  57  ?   ?   ?   A . n 
B 1 58  HIS 58  58  ?   ?   ?   A . n 
B 1 59  GLY 59  59  ?   ?   ?   A . n 
B 1 60  THR 60  60  ?   ?   ?   A . n 
B 1 61  THR 61  61  ?   ?   ?   A . n 
B 1 62  ALA 62  62  ?   ?   ?   A . n 
B 1 63  THR 63  63  ?   ?   ?   A . n 
B 1 64  PHE 64  64  ?   ?   ?   A . n 
B 1 65  HIS 65  65  ?   ?   ?   A . n 
B 1 66  ARG 66  66  ?   ?   ?   A . n 
B 1 67  CYS 67  67  ?   ?   ?   A . n 
B 1 68  ALA 68  68  ?   ?   ?   A . n 
B 1 69  LYS 69  69  ?   ?   ?   A . n 
B 1 70  ASP 70  70  ?   ?   ?   A . n 
B 1 71  PRO 71  71  ?   ?   ?   A . n 
B 1 72  TRP 72  72  ?   ?   ?   A . n 
B 1 73  ARG 73  73  ?   ?   ?   A . n 
B 1 74  LEU 74  74  ?   ?   ?   A . n 
B 1 75  PRO 75  75  ?   ?   ?   A . n 
B 1 76  GLY 76  76  ?   ?   ?   A . n 
B 1 77  THR 77  77  ?   ?   ?   A . n 
B 1 78  TYR 78  78  ?   ?   ?   A . n 
B 1 79  VAL 79  79  ?   ?   ?   A . n 
B 1 80  VAL 80  80  ?   ?   ?   A . n 
B 1 81  VAL 81  81  ?   ?   ?   A . n 
B 1 82  LEU 82  82  ?   ?   ?   A . n 
B 1 83  LYS 83  83  ?   ?   ?   A . n 
B 1 84  GLU 84  84  ?   ?   ?   A . n 
B 1 85  GLU 85  85  ?   ?   ?   A . n 
B 1 86  THR 86  86  ?   ?   ?   A . n 
B 1 87  HIS 87  87  ?   ?   ?   A . n 
B 1 88  LEU 88  88  ?   ?   ?   A . n 
B 1 89  SER 89  89  ?   ?   ?   A . n 
B 1 90  GLN 90  90  ?   ?   ?   A . n 
B 1 91  SER 91  91  ?   ?   ?   A . n 
B 1 92  GLU 92  92  ?   ?   ?   A . n 
B 1 93  ARG 93  93  ?   ?   ?   A . n 
B 1 94  THR 94  94  ?   ?   ?   A . n 
B 1 95  ALA 95  95  ?   ?   ?   A . n 
B 1 96  ARG 96  96  ?   ?   ?   A . n 
B 1 97  ARG 97  97  ?   ?   ?   A . n 
B 1 98  LEU 98  98  ?   ?   ?   A . n 
B 1 99  GLN 99  99  ?   ?   ?   A . n 
B 1 100 ALA 100 100 ?   ?   ?   A . n 
B 1 101 GLN 101 101 ?   ?   ?   A . n 
B 1 102 ALA 102 102 ?   ?   ?   A . n 
B 1 103 ALA 103 103 ?   ?   ?   A . n 
B 1 104 ARG 104 104 ?   ?   ?   A . n 
B 1 105 ARG 105 105 ?   ?   ?   A . n 
B 1 106 GLY 106 106 ?   ?   ?   A . n 
B 1 107 TYR 107 107 ?   ?   ?   A . n 
B 1 108 LEU 108 108 ?   ?   ?   A . n 
B 1 109 THR 109 109 ?   ?   ?   A . n 
B 1 110 LYS 110 110 ?   ?   ?   A . n 
B 1 111 ILE 111 111 ?   ?   ?   A . n 
B 1 112 LEU 112 112 ?   ?   ?   A . n 
B 1 113 HIS 113 113 ?   ?   ?   A . n 
B 1 114 VAL 114 114 ?   ?   ?   A . n 
B 1 115 PHE 115 115 ?   ?   ?   A . n 
B 1 116 HIS 116 116 ?   ?   ?   A . n 
B 1 117 GLY 117 117 ?   ?   ?   A . n 
B 1 118 LEU 118 118 ?   ?   ?   A . n 
B 1 119 LEU 119 119 ?   ?   ?   A . n 
B 1 120 PRO 120 120 ?   ?   ?   A . n 
B 1 121 GLY 121 121 ?   ?   ?   A . n 
B 1 122 PHE 122 122 ?   ?   ?   A . n 
B 1 123 LEU 123 123 ?   ?   ?   A . n 
B 1 124 VAL 124 124 ?   ?   ?   A . n 
B 1 125 LYS 125 125 ?   ?   ?   A . n 
B 1 126 MET 126 126 ?   ?   ?   A . n 
B 1 127 SER 127 127 ?   ?   ?   A . n 
B 1 128 GLY 128 128 ?   ?   ?   A . n 
B 1 129 ASP 129 129 ?   ?   ?   A . n 
B 1 130 LEU 130 130 ?   ?   ?   A . n 
B 1 131 LEU 131 131 ?   ?   ?   A . n 
B 1 132 GLU 132 132 ?   ?   ?   A . n 
B 1 133 LEU 133 133 ?   ?   ?   A . n 
B 1 134 ALA 134 134 ?   ?   ?   A . n 
B 1 135 LEU 135 135 ?   ?   ?   A . n 
B 1 136 LYS 136 136 ?   ?   ?   A . n 
B 1 137 LEU 137 137 ?   ?   ?   A . n 
B 1 138 PRO 138 138 ?   ?   ?   A . n 
B 1 139 HIS 139 139 ?   ?   ?   A . n 
B 1 140 VAL 140 140 ?   ?   ?   A . n 
B 1 141 ASP 141 141 ?   ?   ?   A . n 
B 1 142 TYR 142 142 ?   ?   ?   A . n 
B 1 143 ILE 143 143 ?   ?   ?   A . n 
B 1 144 GLU 144 144 ?   ?   ?   A . n 
B 1 145 GLU 145 145 ?   ?   ?   A . n 
B 1 146 ASP 146 146 ?   ?   ?   A . n 
B 1 147 SER 147 147 ?   ?   ?   A . n 
B 1 148 SER 148 148 ?   ?   ?   A . n 
B 1 149 VAL 149 149 ?   ?   ?   A . n 
B 1 150 PHE 150 150 ?   ?   ?   A . n 
B 1 151 ALA 151 151 ?   ?   ?   A . n 
B 1 152 GLN 152 152 ?   ?   ?   A . n 
B 1 153 SER 153 153 153 SER SER A . n 
B 1 154 ILE 154 154 154 ILE ILE A . n 
B 1 155 PRO 155 155 155 PRO PRO A . n 
B 1 156 TRP 156 156 156 TRP TRP A . n 
B 1 157 ASN 157 157 157 ASN ASN A . n 
B 1 158 LEU 158 158 158 LEU LEU A . n 
B 1 159 GLU 159 159 159 GLU GLU A . n 
B 1 160 ARG 160 160 160 ARG ARG A . n 
B 1 161 ILE 161 161 161 ILE ILE A . n 
B 1 162 THR 162 162 162 THR THR A . n 
B 1 163 PRO 163 163 163 PRO PRO A . n 
B 1 164 PRO 164 164 164 PRO PRO A . n 
B 1 165 ARG 165 165 165 ARG ARG A . n 
B 1 166 TYR 166 166 166 TYR TYR A . n 
B 1 167 ARG 167 167 167 ARG ARG A . n 
B 1 168 ALA 168 168 168 ALA ALA A . n 
B 1 169 ASP 169 169 ?   ?   ?   A . n 
B 1 170 GLU 170 170 ?   ?   ?   A . n 
B 1 171 TYR 171 171 ?   ?   ?   A . n 
B 1 172 GLN 172 172 ?   ?   ?   A . n 
B 1 173 PRO 173 173 ?   ?   ?   A . n 
B 1 174 PRO 174 174 ?   ?   ?   A . n 
B 1 175 ASP 175 175 ?   ?   ?   A . n 
B 1 176 GLY 176 176 176 GLY GLY A . n 
B 1 177 GLY 177 177 177 GLY GLY A . n 
B 1 178 SER 178 178 178 SER SER A . n 
B 1 179 LEU 179 179 179 LEU LEU A . n 
B 1 180 VAL 180 180 180 VAL VAL A . n 
B 1 181 GLU 181 181 181 GLU GLU A . n 
B 1 182 VAL 182 182 182 VAL VAL A . n 
B 1 183 TYR 183 183 183 TYR TYR A . n 
B 1 184 LEU 184 184 184 LEU LEU A . n 
B 1 185 LEU 185 185 185 LEU LEU A . n 
B 1 186 ASP 186 186 186 ASP ASP A . n 
B 1 187 THR 187 187 187 THR THR A . n 
B 1 188 SER 188 188 188 SER SER A . n 
B 1 189 ILE 189 189 189 ILE ILE A . n 
B 1 190 GLN 190 190 190 GLN GLN A . n 
B 1 191 SER 191 191 191 SER SER A . n 
B 1 192 ASP 192 192 192 ASP ASP A . n 
B 1 193 HIS 193 193 193 HIS HIS A . n 
B 1 194 ARG 194 194 194 ARG ARG A . n 
B 1 195 GLU 195 195 195 GLU GLU A . n 
B 1 196 ILE 196 196 196 ILE ILE A . n 
B 1 197 GLU 197 197 197 GLU GLU A . n 
B 1 198 GLY 198 198 198 GLY GLY A . n 
B 1 199 ARG 199 199 199 ARG ARG A . n 
B 1 200 VAL 200 200 200 VAL VAL A . n 
B 1 201 MET 201 201 201 MET MET A . n 
B 1 202 VAL 202 202 202 VAL VAL A . n 
B 1 203 THR 203 203 203 THR THR A . n 
B 1 204 ASP 204 204 204 ASP ASP A . n 
B 1 205 PHE 205 205 205 PHE PHE A . n 
B 1 206 GLU 206 206 206 GLU GLU A . n 
B 1 207 ASN 207 207 207 ASN ASN A . n 
B 1 208 VAL 208 208 208 VAL VAL A . n 
B 1 209 PRO 209 209 209 PRO PRO A . n 
B 1 210 GLU 210 210 210 GLU GLU A . n 
B 1 211 GLU 211 211 211 GLU GLU A . n 
B 1 212 ASP 212 212 212 ASP ASP A . n 
B 1 213 GLY 213 213 ?   ?   ?   A . n 
B 1 214 THR 214 214 ?   ?   ?   A . n 
B 1 215 ARG 215 215 ?   ?   ?   A . n 
B 1 216 PHE 216 216 ?   ?   ?   A . n 
B 1 217 HIS 217 217 ?   ?   ?   A . n 
B 1 218 ARG 218 218 ?   ?   ?   A . n 
B 1 219 GLN 219 219 219 GLN GLN A . n 
B 1 220 ALA 220 220 220 ALA ALA A . n 
B 1 221 SER 221 221 221 SER SER A . n 
B 1 222 LYS 222 222 222 LYS LYS A . n 
B 1 223 CYS 223 223 223 CYS CYS A . n 
B 1 224 ASP 224 224 224 ASP ASP A . n 
B 1 225 SER 225 225 225 SER SER A . n 
B 1 226 HIS 226 226 226 HIS HIS A . n 
B 1 227 GLY 227 227 227 GLY GLY A . n 
B 1 228 THR 228 228 228 THR THR A . n 
B 1 229 HIS 229 229 229 HIS HIS A . n 
B 1 230 LEU 230 230 230 LEU LEU A . n 
B 1 231 ALA 231 231 231 ALA ALA A . n 
B 1 232 GLY 232 232 232 GLY GLY A . n 
B 1 233 VAL 233 233 233 VAL VAL A . n 
B 1 234 VAL 234 234 234 VAL VAL A . n 
B 1 235 SER 235 235 235 SER SER A . n 
B 1 236 GLY 236 236 236 GLY GLY A . n 
B 1 237 ARG 237 237 237 ARG ARG A . n 
B 1 238 ASP 238 238 238 ASP ASP A . n 
B 1 239 ALA 239 239 239 ALA ALA A . n 
B 1 240 GLY 240 240 240 GLY GLY A . n 
B 1 241 VAL 241 241 241 VAL VAL A . n 
B 1 242 ALA 242 242 242 ALA ALA A . n 
B 1 243 LYS 243 243 243 LYS LYS A . n 
B 1 244 GLY 244 244 244 GLY GLY A . n 
B 1 245 ALA 245 245 245 ALA ALA A . n 
B 1 246 SER 246 246 246 SER SER A . n 
B 1 247 MET 247 247 247 MET MET A . n 
B 1 248 ARG 248 248 248 ARG ARG A . n 
B 1 249 SER 249 249 249 SER SER A . n 
B 1 250 LEU 250 250 250 LEU LEU A . n 
B 1 251 ARG 251 251 251 ARG ARG A . n 
B 1 252 VAL 252 252 252 VAL VAL A . n 
B 1 253 LEU 253 253 253 LEU LEU A . n 
B 1 254 ASN 254 254 254 ASN ASN A . n 
B 1 255 CYS 255 255 255 CYS CYS A . n 
B 1 256 GLN 256 256 256 GLN GLN A . n 
B 1 257 GLY 257 257 257 GLY GLY A . n 
B 1 258 LYS 258 258 258 LYS LYS A . n 
B 1 259 GLY 259 259 259 GLY GLY A . n 
B 1 260 THR 260 260 260 THR THR A . n 
B 1 261 VAL 261 261 261 VAL VAL A . n 
B 1 262 SER 262 262 262 SER SER A . n 
B 1 263 GLY 263 263 263 GLY GLY A . n 
B 1 264 THR 264 264 264 THR THR A . n 
B 1 265 LEU 265 265 265 LEU LEU A . n 
B 1 266 ILE 266 266 266 ILE ILE A . n 
B 1 267 GLY 267 267 267 GLY GLY A . n 
B 1 268 LEU 268 268 268 LEU LEU A . n 
B 1 269 GLU 269 269 269 GLU GLU A . n 
B 1 270 PHE 270 270 270 PHE PHE A . n 
B 1 271 ILE 271 271 271 ILE ILE A . n 
B 1 272 ARG 272 272 272 ARG ARG A . n 
B 1 273 LYS 273 273 273 LYS LYS A . n 
B 1 274 SER 274 274 274 SER SER A . n 
B 1 275 GLN 275 275 275 GLN GLN A . n 
B 1 276 LEU 276 276 276 LEU LEU A . n 
B 1 277 VAL 277 277 277 VAL VAL A . n 
B 1 278 GLN 278 278 278 GLN GLN A . n 
B 1 279 PRO 279 279 279 PRO PRO A . n 
B 1 280 VAL 280 280 280 VAL VAL A . n 
B 1 281 GLY 281 281 281 GLY GLY A . n 
B 1 282 PRO 282 282 282 PRO PRO A . n 
B 1 283 LEU 283 283 283 LEU LEU A . n 
B 1 284 VAL 284 284 284 VAL VAL A . n 
B 1 285 VAL 285 285 285 VAL VAL A . n 
B 1 286 LEU 286 286 286 LEU LEU A . n 
B 1 287 LEU 287 287 287 LEU LEU A . n 
B 1 288 PRO 288 288 288 PRO PRO A . n 
B 1 289 LEU 289 289 289 LEU LEU A . n 
B 1 290 ALA 290 290 290 ALA ALA A . n 
B 1 291 GLY 291 291 291 GLY GLY A . n 
B 1 292 GLY 292 292 292 GLY GLY A . n 
B 1 293 TYR 293 293 293 TYR TYR A . n 
B 1 294 SER 294 294 294 SER SER A . n 
B 1 295 ARG 295 295 295 ARG ARG A . n 
B 1 296 VAL 296 296 296 VAL VAL A . n 
B 1 297 LEU 297 297 297 LEU LEU A . n 
B 1 298 ASN 298 298 298 ASN ASN A . n 
B 1 299 ALA 299 299 299 ALA ALA A . n 
B 1 300 ALA 300 300 300 ALA ALA A . n 
B 1 301 CYS 301 301 301 CYS CYS A . n 
B 1 302 GLN 302 302 302 GLN GLN A . n 
B 1 303 ARG 303 303 303 ARG ARG A . n 
B 1 304 LEU 304 304 304 LEU LEU A . n 
B 1 305 ALA 305 305 305 ALA ALA A . n 
B 1 306 ARG 306 306 306 ARG ARG A . n 
B 1 307 ALA 307 307 307 ALA ALA A . n 
B 1 308 GLY 308 308 308 GLY GLY A . n 
B 1 309 VAL 309 309 309 VAL VAL A . n 
B 1 310 VAL 310 310 310 VAL VAL A . n 
B 1 311 LEU 311 311 311 LEU LEU A . n 
B 1 312 VAL 312 312 312 VAL VAL A . n 
B 1 313 THR 313 313 313 THR THR A . n 
B 1 314 ALA 314 314 314 ALA ALA A . n 
B 1 315 ALA 315 315 315 ALA ALA A . n 
B 1 316 GLY 316 316 316 GLY GLY A . n 
B 1 317 ASN 317 317 317 ASN ASN A . n 
B 1 318 PHE 318 318 318 PHE PHE A . n 
B 1 319 ARG 319 319 319 ARG ARG A . n 
B 1 320 ASP 320 320 320 ASP ASP A . n 
B 1 321 ASP 321 321 321 ASP ASP A . n 
B 1 322 ALA 322 322 322 ALA ALA A . n 
B 1 323 CYS 323 323 323 CYS CYS A . n 
B 1 324 LEU 324 324 324 LEU LEU A . n 
B 1 325 TYR 325 325 325 TYR TYR A . n 
B 1 326 SER 326 326 326 SER SER A . n 
B 1 327 PRO 327 327 327 PRO PRO A . n 
B 1 328 ALA 328 328 328 ALA ALA A . n 
B 1 329 SER 329 329 329 SER SER A . n 
B 1 330 ALA 330 330 330 ALA ALA A . n 
B 1 331 PRO 331 331 331 PRO PRO A . n 
B 1 332 GLU 332 332 332 GLU GLU A . n 
B 1 333 VAL 333 333 333 VAL VAL A . n 
B 1 334 ILE 334 334 334 ILE ILE A . n 
B 1 335 THR 335 335 335 THR THR A . n 
B 1 336 VAL 336 336 336 VAL VAL A . n 
B 1 337 GLY 337 337 337 GLY GLY A . n 
B 1 338 ALA 338 338 338 ALA ALA A . n 
B 1 339 THR 339 339 339 THR THR A . n 
B 1 340 ASN 340 340 340 ASN ASN A . n 
B 1 341 ALA 341 341 341 ALA ALA A . n 
B 1 342 GLN 342 342 342 GLN GLN A . n 
B 1 343 ASP 343 343 343 ASP ASP A . n 
B 1 344 GLN 344 344 344 GLN GLN A . n 
B 1 345 PRO 345 345 345 PRO PRO A . n 
B 1 346 VAL 346 346 346 VAL VAL A . n 
B 1 347 THR 347 347 347 THR THR A . n 
B 1 348 LEU 348 348 348 LEU LEU A . n 
B 1 349 GLY 349 349 349 GLY GLY A . n 
B 1 350 THR 350 350 350 THR THR A . n 
B 1 351 LEU 351 351 351 LEU LEU A . n 
B 1 352 GLY 352 352 352 GLY GLY A . n 
B 1 353 THR 353 353 353 THR THR A . n 
B 1 354 ASN 354 354 354 ASN ASN A . n 
B 1 355 PHE 355 355 355 PHE PHE A . n 
B 1 356 GLY 356 356 356 GLY GLY A . n 
B 1 357 ARG 357 357 357 ARG ARG A . n 
B 1 358 CYS 358 358 358 CYS CYS A . n 
B 1 359 VAL 359 359 359 VAL VAL A . n 
B 1 360 ASP 360 360 360 ASP ASP A . n 
B 1 361 LEU 361 361 361 LEU LEU A . n 
B 1 362 PHE 362 362 362 PHE PHE A . n 
B 1 363 ALA 363 363 363 ALA ALA A . n 
B 1 364 PRO 364 364 364 PRO PRO A . n 
B 1 365 GLY 365 365 365 GLY GLY A . n 
B 1 366 GLU 366 366 366 GLU GLU A . n 
B 1 367 ASP 367 367 367 ASP ASP A . n 
B 1 368 ILE 368 368 368 ILE ILE A . n 
B 1 369 ILE 369 369 369 ILE ILE A . n 
B 1 370 GLY 370 370 370 GLY GLY A . n 
B 1 371 ALA 371 371 371 ALA ALA A . n 
B 1 372 SER 372 372 372 SER SER A . n 
B 1 373 SER 373 373 373 SER SER A . n 
B 1 374 ASP 374 374 374 ASP ASP A . n 
B 1 375 CYS 375 375 375 CYS CYS A . n 
B 1 376 SER 376 376 376 SER SER A . n 
B 1 377 THR 377 377 377 THR THR A . n 
B 1 378 CYS 378 378 378 CYS CYS A . n 
B 1 379 PHE 379 379 379 PHE PHE A . n 
B 1 380 VAL 380 380 380 VAL VAL A . n 
B 1 381 SER 381 381 381 SER SER A . n 
B 1 382 GLN 382 382 382 GLN GLN A . n 
B 1 383 SER 383 383 383 SER SER A . n 
B 1 384 GLY 384 384 384 GLY GLY A . n 
B 1 385 THR 385 385 385 THR THR A . n 
B 1 386 SER 386 386 386 SER SER A . n 
B 1 387 GLN 387 387 387 GLN GLN A . n 
B 1 388 ALA 388 388 388 ALA ALA A . n 
B 1 389 ALA 389 389 389 ALA ALA A . n 
B 1 390 ALA 390 390 390 ALA ALA A . n 
B 1 391 HIS 391 391 391 HIS HIS A . n 
B 1 392 VAL 392 392 392 VAL VAL A . n 
B 1 393 ALA 393 393 393 ALA ALA A . n 
B 1 394 GLY 394 394 394 GLY GLY A . n 
B 1 395 ILE 395 395 395 ILE ILE A . n 
B 1 396 ALA 396 396 396 ALA ALA A . n 
B 1 397 ALA 397 397 397 ALA ALA A . n 
B 1 398 MET 398 398 398 MET MET A . n 
B 1 399 MET 399 399 399 MET MET A . n 
B 1 400 LEU 400 400 400 LEU LEU A . n 
B 1 401 SER 401 401 401 SER SER A . n 
B 1 402 ALA 402 402 402 ALA ALA A . n 
B 1 403 GLU 403 403 403 GLU GLU A . n 
B 1 404 PRO 404 404 404 PRO PRO A . n 
B 1 405 GLU 405 405 405 GLU GLU A . n 
B 1 406 LEU 406 406 406 LEU LEU A . n 
B 1 407 THR 407 407 407 THR THR A . n 
B 1 408 LEU 408 408 408 LEU LEU A . n 
B 1 409 ALA 409 409 409 ALA ALA A . n 
B 1 410 GLU 410 410 410 GLU GLU A . n 
B 1 411 LEU 411 411 411 LEU LEU A . n 
B 1 412 ARG 412 412 412 ARG ARG A . n 
B 1 413 GLN 413 413 413 GLN GLN A . n 
B 1 414 ARG 414 414 414 ARG ARG A . n 
B 1 415 LEU 415 415 415 LEU LEU A . n 
B 1 416 ILE 416 416 416 ILE ILE A . n 
B 1 417 HIS 417 417 417 HIS HIS A . n 
B 1 418 PHE 418 418 418 PHE PHE A . n 
B 1 419 SER 419 419 419 SER SER A . n 
B 1 420 ALA 420 420 420 ALA ALA A . n 
B 1 421 LYS 421 421 421 LYS LYS A . n 
B 1 422 ASP 422 422 422 ASP ASP A . n 
B 1 423 VAL 423 423 423 VAL VAL A . n 
B 1 424 ILE 424 424 424 ILE ILE A . n 
B 1 425 ASN 425 425 425 ASN ASN A . n 
B 1 426 GLU 426 426 426 GLU GLU A . n 
B 1 427 ALA 427 427 427 ALA ALA A . n 
B 1 428 TRP 428 428 428 TRP TRP A . n 
B 1 429 PHE 429 429 429 PHE PHE A . n 
B 1 430 PRO 430 430 430 PRO PRO A . n 
B 1 431 GLU 431 431 431 GLU GLU A . n 
B 1 432 ASP 432 432 432 ASP ASP A . n 
B 1 433 GLN 433 433 433 GLN GLN A . n 
B 1 434 ARG 434 434 434 ARG ARG A . n 
B 1 435 VAL 435 435 435 VAL VAL A . n 
B 1 436 LEU 436 436 436 LEU LEU A . n 
B 1 437 THR 437 437 437 THR THR A . n 
B 1 438 PRO 438 438 438 PRO PRO A . n 
B 1 439 ASN 439 439 439 ASN ASN A . n 
B 1 440 LEU 440 440 440 LEU LEU A . n 
B 1 441 VAL 441 441 441 VAL VAL A . n 
B 1 442 ALA 442 442 442 ALA ALA A . n 
B 1 443 ALA 443 443 443 ALA ALA A . n 
B 1 444 LEU 444 444 444 LEU LEU A . n 
B 1 445 PRO 445 445 445 PRO PRO A . n 
B 1 446 PRO 446 446 446 PRO PRO A . n 
B 1 447 SER 447 447 447 SER SER A . n 
B 1 448 THR 448 448 448 THR THR A . n 
B 1 449 HIS 449 449 449 HIS HIS A . n 
B 1 450 GLY 450 450 ?   ?   ?   A . n 
B 1 451 ALA 451 451 ?   ?   ?   A . n 
B 1 452 GLY 452 452 ?   ?   ?   A . n 
B 1 453 TRP 453 453 453 TRP TRP A . n 
B 1 454 GLN 454 454 454 GLN GLN A . n 
B 1 455 LEU 455 455 455 LEU LEU A . n 
B 1 456 PHE 456 456 456 PHE PHE A . n 
B 1 457 CYS 457 457 457 CYS CYS A . n 
B 1 458 ARG 458 458 458 ARG ARG A . n 
B 1 459 THR 459 459 459 THR THR A . n 
B 1 460 VAL 460 460 460 VAL VAL A . n 
B 1 461 TRP 461 461 461 TRP TRP A . n 
B 1 462 SER 462 462 462 SER SER A . n 
B 1 463 ALA 463 463 463 ALA ALA A . n 
B 1 464 HIS 464 464 464 HIS HIS A . n 
B 1 465 SER 465 465 465 SER SER A . n 
B 1 466 GLY 466 466 466 GLY GLY A . n 
B 1 467 PRO 467 467 467 PRO PRO A . n 
B 1 468 THR 468 468 468 THR THR A . n 
B 1 469 ARG 469 469 469 ARG ARG A . n 
B 1 470 MET 470 470 470 MET MET A . n 
B 1 471 ALA 471 471 471 ALA ALA A . n 
B 1 472 THR 472 472 472 THR THR A . n 
B 1 473 ALA 473 473 473 ALA ALA A . n 
B 1 474 ILE 474 474 474 ILE ILE A . n 
B 1 475 ALA 475 475 475 ALA ALA A . n 
B 1 476 ARG 476 476 476 ARG ARG A . n 
B 1 477 CYS 477 477 477 CYS CYS A . n 
B 1 478 ALA 478 478 478 ALA ALA A . n 
B 1 479 PRO 479 479 479 PRO PRO A . n 
B 1 480 ASP 480 480 480 ASP ASP A . n 
B 1 481 GLU 481 481 481 GLU GLU A . n 
B 1 482 GLU 482 482 482 GLU GLU A . n 
B 1 483 LEU 483 483 483 LEU LEU A . n 
B 1 484 LEU 484 484 484 LEU LEU A . n 
B 1 485 SER 485 485 485 SER SER A . n 
B 1 486 CYS 486 486 486 CYS CYS A . n 
B 1 487 SER 487 487 487 SER SER A . n 
B 1 488 SER 488 488 488 SER SER A . n 
B 1 489 PHE 489 489 489 PHE PHE A . n 
B 1 490 SER 490 490 490 SER SER A . n 
B 1 491 ARG 491 491 491 ARG ARG A . n 
B 1 492 SER 492 492 492 SER SER A . n 
B 1 493 GLY 493 493 493 GLY GLY A . n 
B 1 494 LYS 494 494 494 LYS LYS A . n 
B 1 495 ARG 495 495 495 ARG ARG A . n 
B 1 496 ARG 496 496 496 ARG ARG A . n 
B 1 497 GLY 497 497 497 GLY GLY A . n 
B 1 498 GLU 498 498 498 GLU GLU A . n 
B 1 499 ARG 499 499 499 ARG ARG A . n 
B 1 500 MET 500 500 500 MET MET A . n 
B 1 501 GLU 501 501 501 GLU GLU A . n 
B 1 502 ALA 502 502 502 ALA ALA A . n 
B 1 503 GLN 503 503 503 GLN GLN A . n 
B 1 504 GLY 504 504 504 GLY GLY A . n 
B 1 505 GLY 505 505 505 GLY GLY A . n 
B 1 506 LYS 506 506 506 LYS LYS A . n 
B 1 507 LEU 507 507 507 LEU LEU A . n 
B 1 508 VAL 508 508 508 VAL VAL A . n 
B 1 509 CYS 509 509 509 CYS CYS A . n 
B 1 510 ARG 510 510 510 ARG ARG A . n 
B 1 511 ALA 511 511 511 ALA ALA A . n 
B 1 512 HIS 512 512 512 HIS HIS A . n 
B 1 513 ASN 513 513 513 ASN ASN A . n 
B 1 514 ALA 514 514 514 ALA ALA A . n 
B 1 515 PHE 515 515 515 PHE PHE A . n 
B 1 516 GLY 516 516 516 GLY GLY A . n 
B 1 517 GLY 517 517 517 GLY GLY A . n 
B 1 518 GLU 518 518 518 GLU GLU A . n 
B 1 519 GLY 519 519 519 GLY GLY A . n 
B 1 520 VAL 520 520 520 VAL VAL A . n 
B 1 521 TYR 521 521 521 TYR TYR A . n 
B 1 522 ALA 522 522 522 ALA ALA A . n 
B 1 523 ILE 523 523 523 ILE ILE A . n 
B 1 524 ALA 524 524 524 ALA ALA A . n 
B 1 525 ARG 525 525 525 ARG ARG A . n 
B 1 526 CYS 526 526 526 CYS CYS A . n 
B 1 527 CYS 527 527 527 CYS CYS A . n 
B 1 528 LEU 528 528 528 LEU LEU A . n 
B 1 529 LEU 529 529 529 LEU LEU A . n 
B 1 530 PRO 530 530 530 PRO PRO A . n 
B 1 531 GLN 531 531 531 GLN GLN A . n 
B 1 532 ALA 532 532 532 ALA ALA A . n 
B 1 533 ASN 533 533 533 ASN ASN A . n 
B 1 534 CYS 534 534 534 CYS CYS A . n 
B 1 535 SER 535 535 535 SER SER A . n 
B 1 536 VAL 536 536 536 VAL VAL A . n 
B 1 537 HIS 537 537 537 HIS HIS A . n 
B 1 538 THR 538 538 538 THR THR A . n 
B 1 539 ALA 539 539 539 ALA ALA A . n 
B 1 540 PRO 540 540 540 PRO PRO A . n 
B 1 541 PRO 541 541 541 PRO PRO A . n 
B 1 542 ALA 542 542 542 ALA ALA A . n 
B 1 543 GLU 543 543 543 GLU GLU A . n 
B 1 544 ALA 544 544 544 ALA ALA A . n 
B 1 545 SER 545 545 545 SER SER A . n 
B 1 546 MET 546 546 546 MET MET A . n 
B 1 547 GLY 547 547 547 GLY GLY A . n 
B 1 548 THR 548 548 548 THR THR A . n 
B 1 549 ARG 549 549 549 ARG ARG A . n 
B 1 550 VAL 550 550 550 VAL VAL A . n 
B 1 551 HIS 551 551 551 HIS HIS A . n 
B 1 552 CYS 552 552 552 CYS CYS A . n 
B 1 553 HIS 553 553 553 HIS HIS A . n 
B 1 554 GLN 554 554 554 GLN GLN A . n 
B 1 555 GLN 555 555 555 GLN GLN A . n 
B 1 556 GLY 556 556 556 GLY GLY A . n 
B 1 557 HIS 557 557 557 HIS HIS A . n 
B 1 558 VAL 558 558 558 VAL VAL A . n 
B 1 559 LEU 559 559 559 LEU LEU A . n 
B 1 560 THR 560 560 560 THR THR A . n 
B 1 561 GLY 561 561 561 GLY GLY A . n 
B 1 562 CYS 562 562 562 CYS CYS A . n 
B 1 563 SER 563 563 563 SER SER A . n 
B 1 564 SER 564 564 564 SER SER A . n 
B 1 565 HIS 565 565 565 HIS HIS A . n 
B 1 566 TRP 566 566 566 TRP TRP A . n 
B 1 567 GLU 567 567 567 GLU GLU A . n 
B 1 568 VAL 568 568 568 VAL VAL A . n 
B 1 569 GLU 569 569 569 GLU GLU A . n 
B 1 570 ASP 570 570 570 ASP ASP A . n 
B 1 571 LEU 571 571 571 LEU LEU A . n 
B 1 572 GLY 572 572 572 GLY GLY A . n 
B 1 573 THR 573 573 ?   ?   ?   A . n 
B 1 574 HIS 574 574 ?   ?   ?   A . n 
B 1 575 LYS 575 575 ?   ?   ?   A . n 
B 1 576 PRO 576 576 ?   ?   ?   A . n 
B 1 577 PRO 577 577 ?   ?   ?   A . n 
B 1 578 VAL 578 578 ?   ?   ?   A . n 
B 1 579 LEU 579 579 ?   ?   ?   A . n 
B 1 580 ARG 580 580 ?   ?   ?   A . n 
B 1 581 PRO 581 581 ?   ?   ?   A . n 
B 1 582 ARG 582 582 ?   ?   ?   A . n 
B 1 583 GLY 583 583 ?   ?   ?   A . n 
B 1 584 GLN 584 584 ?   ?   ?   A . n 
B 1 585 PRO 585 585 585 PRO PRO A . n 
B 1 586 ASN 586 586 586 ASN ASN A . n 
B 1 587 GLN 587 587 587 GLN GLN A . n 
B 1 588 CYS 588 588 588 CYS CYS A . n 
B 1 589 VAL 589 589 589 VAL VAL A . n 
B 1 590 GLY 590 590 590 GLY GLY A . n 
B 1 591 HIS 591 591 591 HIS HIS A . n 
B 1 592 ARG 592 592 592 ARG ARG A . n 
B 1 593 GLU 593 593 593 GLU GLU A . n 
B 1 594 ALA 594 594 594 ALA ALA A . n 
B 1 595 SER 595 595 595 SER SER A . n 
B 1 596 ILE 596 596 596 ILE ILE A . n 
B 1 597 HIS 597 597 597 HIS HIS A . n 
B 1 598 ALA 598 598 598 ALA ALA A . n 
B 1 599 SER 599 599 599 SER SER A . n 
B 1 600 CYS 600 600 600 CYS CYS A . n 
B 1 601 CYS 601 601 601 CYS CYS A . n 
B 1 602 HIS 602 602 602 HIS HIS A . n 
B 1 603 ALA 603 603 603 ALA ALA A . n 
B 1 604 PRO 604 604 604 PRO PRO A . n 
B 1 605 GLY 605 605 605 GLY GLY A . n 
B 1 606 LEU 606 606 606 LEU LEU A . n 
B 1 607 GLU 607 607 607 GLU GLU A . n 
B 1 608 CYS 608 608 608 CYS CYS A . n 
B 1 609 LYS 609 609 609 LYS LYS A . n 
B 1 610 VAL 610 610 610 VAL VAL A . n 
B 1 611 LYS 611 611 611 LYS LYS A . n 
B 1 612 GLU 612 612 612 GLU GLU A . n 
B 1 613 HIS 613 613 613 HIS HIS A . n 
B 1 614 GLY 614 614 614 GLY GLY A . n 
B 1 615 ILE 615 615 615 ILE ILE A . n 
B 1 616 PRO 616 616 616 PRO PRO A . n 
B 1 617 ALA 617 617 617 ALA ALA A . n 
B 1 618 PRO 618 618 618 PRO PRO A . n 
B 1 619 GLN 619 619 619 GLN GLN A . n 
B 1 620 GLU 620 620 620 GLU GLU A . n 
B 1 621 GLN 621 621 621 GLN GLN A . n 
B 1 622 VAL 622 622 622 VAL VAL A . n 
B 1 623 THR 623 623 623 THR THR A . n 
B 1 624 VAL 624 624 624 VAL VAL A . n 
B 1 625 ALA 625 625 625 ALA ALA A . n 
B 1 626 CYS 626 626 626 CYS CYS A . n 
B 1 627 GLU 627 627 627 GLU GLU A . n 
B 1 628 GLU 628 628 628 GLU GLU A . n 
B 1 629 GLY 629 629 629 GLY GLY A . n 
B 1 630 TRP 630 630 630 TRP TRP A . n 
B 1 631 THR 631 631 631 THR THR A . n 
B 1 632 LEU 632 632 632 LEU LEU A . n 
B 1 633 THR 633 633 633 THR THR A . n 
B 1 634 GLY 634 634 634 GLY GLY A . n 
B 1 635 CYS 635 635 635 CYS CYS A . n 
B 1 636 SER 636 636 636 SER SER A . n 
B 1 637 ALA 637 637 637 ALA ALA A . n 
B 1 638 LEU 638 638 638 LEU LEU A . n 
B 1 639 PRO 639 639 639 PRO PRO A . n 
B 1 640 GLY 640 640 640 GLY GLY A . n 
B 1 641 THR 641 641 641 THR THR A . n 
B 1 642 SER 642 642 642 SER SER A . n 
B 1 643 HIS 643 643 643 HIS HIS A . n 
B 1 644 VAL 644 644 644 VAL VAL A . n 
B 1 645 LEU 645 645 645 LEU LEU A . n 
B 1 646 GLY 646 646 646 GLY GLY A . n 
B 1 647 ALA 647 647 647 ALA ALA A . n 
B 1 648 TYR 648 648 648 TYR TYR A . n 
B 1 649 ALA 649 649 649 ALA ALA A . n 
B 1 650 VAL 650 650 650 VAL VAL A . n 
B 1 651 ASP 651 651 651 ASP ASP A . n 
B 1 652 ASN 652 652 652 ASN ASN A . n 
B 1 653 THR 653 653 653 THR THR A . n 
B 1 654 CYS 654 654 654 CYS CYS A . n 
B 1 655 VAL 655 655 655 VAL VAL A . n 
B 1 656 VAL 656 656 656 VAL VAL A . n 
B 1 657 ARG 657 657 657 ARG ARG A . n 
B 1 658 SER 658 658 658 SER SER A . n 
B 1 659 ARG 659 659 659 ARG ARG A . n 
B 1 660 ASP 660 660 ?   ?   ?   A . n 
B 1 661 VAL 661 661 ?   ?   ?   A . n 
B 1 662 SER 662 662 ?   ?   ?   A . n 
B 1 663 THR 663 663 ?   ?   ?   A . n 
B 1 664 THR 664 664 ?   ?   ?   A . n 
B 1 665 GLY 665 665 ?   ?   ?   A . n 
B 1 666 SER 666 666 ?   ?   ?   A . n 
B 1 667 THR 667 667 ?   ?   ?   A . n 
B 1 668 SER 668 668 668 SER SER A . n 
B 1 669 GLU 669 669 669 GLU GLU A . n 
B 1 670 GLU 670 670 670 GLU GLU A . n 
B 1 671 ALA 671 671 671 ALA ALA A . n 
B 1 672 VAL 672 672 672 VAL VAL A . n 
B 1 673 THR 673 673 673 THR THR A . n 
B 1 674 ALA 674 674 674 ALA ALA A . n 
B 1 675 VAL 675 675 675 VAL VAL A . n 
B 1 676 ALA 676 676 676 ALA ALA A . n 
B 1 677 ILE 677 677 677 ILE ILE A . n 
B 1 678 CYS 678 678 678 CYS CYS A . n 
B 1 679 CYS 679 679 679 CYS CYS A . n 
B 1 680 ARG 680 680 680 ARG ARG A . n 
B 1 681 SER 681 681 681 SER SER A . n 
B 1 682 ARG 682 682 682 ARG ARG A . n 
B 1 683 HIS 683 683 ?   ?   ?   A . n 
B 1 684 LEU 684 684 ?   ?   ?   A . n 
B 1 685 ALA 685 685 ?   ?   ?   A . n 
B 1 686 GLN 686 686 ?   ?   ?   A . n 
B 1 687 ALA 687 687 ?   ?   ?   A . n 
B 1 688 SER 688 688 ?   ?   ?   A . n 
B 1 689 GLN 689 689 ?   ?   ?   A . n 
B 1 690 GLU 690 690 ?   ?   ?   A . n 
B 1 691 LEU 691 691 ?   ?   ?   A . n 
B 1 692 GLN 692 692 ?   ?   ?   A . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?        monomeric 1 
2 author_defined_assembly   ?        monomeric 1 
3 software_defined_assembly PISA,PQS dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E     
2 1 B,F         
3 1 A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
3 'ABSA (A^2)' 2950  ? 
3 MORE         -71   ? 
3 'SSA (A^2)'  24860 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O  ? F HOH .   ? A HOH 876 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 O  ? F HOH .   ? A HOH 768 ? 1_555 118.2 ? 
2  O  ? F HOH .   ? A HOH 876 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 OG ? A SER 147 ? P SER 147 ? 1_555 63.9  ? 
3  O  ? F HOH .   ? A HOH 768 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 OG ? A SER 147 ? P SER 147 ? 1_555 135.9 ? 
4  O  ? F HOH .   ? A HOH 876 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 HG ? D HG  .   ? P HG  694 ? 1_555 49.4  ? 
5  O  ? F HOH .   ? A HOH 768 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 HG ? D HG  .   ? P HG  694 ? 1_555 154.4 ? 
6  OG ? A SER 147 ? P SER 147 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 HG ? D HG  .   ? P HG  694 ? 1_555 64.1  ? 
7  O  ? F HOH .   ? A HOH 876 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 N  ? A CYS 67  ? P CYS 67  ? 1_555 162.2 ? 
8  O  ? F HOH .   ? A HOH 768 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 N  ? A CYS 67  ? P CYS 67  ? 1_555 77.8  ? 
9  OG ? A SER 147 ? P SER 147 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 N  ? A CYS 67  ? P CYS 67  ? 1_555 111.2 ? 
10 HG ? D HG  .   ? P HG  694 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 N  ? A CYS 67  ? P CYS 67  ? 1_555 112.8 ? 
11 O  ? F HOH .   ? A HOH 876 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 SG ? A CYS 67  ? P CYS 67  ? 1_555 88.7  ? 
12 O  ? F HOH .   ? A HOH 768 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 SG ? A CYS 67  ? P CYS 67  ? 1_555 137.7 ? 
13 OG ? A SER 147 ? P SER 147 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 SG ? A CYS 67  ? P CYS 67  ? 1_555 84.1  ? 
14 HG ? D HG  .   ? P HG  694 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 SG ? A CYS 67  ? P CYS 67  ? 1_555 39.8  ? 
15 N  ? A CYS 67  ? P CYS 67  ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 SG ? A CYS 67  ? P CYS 67  ? 1_555 73.6  ? 
16 O  ? F HOH .   ? A HOH 876 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 O  ? B TYR 293 ? A TYR 293 ? 1_555 65.3  ? 
17 O  ? F HOH .   ? A HOH 768 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 O  ? B TYR 293 ? A TYR 293 ? 1_555 64.0  ? 
18 OG ? A SER 147 ? P SER 147 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 O  ? B TYR 293 ? A TYR 293 ? 1_555 127.7 ? 
19 HG ? D HG  .   ? P HG  694 ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 O  ? B TYR 293 ? A TYR 293 ? 1_555 91.3  ? 
20 N  ? A CYS 67  ? P CYS 67  ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 O  ? B TYR 293 ? A TYR 293 ? 1_555 120.9 ? 
21 SG ? A CYS 67  ? P CYS 67  ? 1_555 HG ? C HG . ? P HG 693 ? 1_555 O  ? B TYR 293 ? A TYR 293 ? 1_555 106.1 ? 
22 O  ? F HOH .   ? A HOH 876 ? 1_555 HG ? D HG . ? P HG 694 ? 1_555 O  ? E HOH .   ? P HOH 723 ? 1_555 100.0 ? 
23 O  ? F HOH .   ? A HOH 876 ? 1_555 HG ? D HG . ? P HG 694 ? 1_555 SG ? A CYS 67  ? P CYS 67  ? 1_555 168.9 ? 
24 O  ? E HOH .   ? P HOH 723 ? 1_555 HG ? D HG . ? P HG 694 ? 1_555 SG ? A CYS 67  ? P CYS 67  ? 1_555 80.3  ? 
25 O  ? F HOH .   ? A HOH 876 ? 1_555 HG ? D HG . ? P HG 694 ? 1_555 OG ? A SER 147 ? P SER 147 ? 1_555 75.1  ? 
26 O  ? E HOH .   ? P HOH 723 ? 1_555 HG ? D HG . ? P HG 694 ? 1_555 OG ? A SER 147 ? P SER 147 ? 1_555 76.0  ? 
27 SG ? A CYS 67  ? P CYS 67  ? 1_555 HG ? D HG . ? P HG 694 ? 1_555 OG ? A SER 147 ? P SER 147 ? 1_555 115.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-04-10 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CrystalClear 'data collection' '(MSC/RIGAKU)' ? 1 
AMoRE        phasing           .              ? 2 
REFMAC       refinement        5.1            ? 3 
HKL-2000     'data reduction'  .              ? 4 
HKL-2000     'data scaling'    .              ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O P HOH 713 ? ? O P HOH 732 ? ? 2.17 
2 1 O A HOH 743 ? ? O A HOH 863 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS P 113 ? ? -170.80 145.43  
2  1 HIS P 139 ? ? 77.95   -12.95  
3  1 ASP A 186 ? ? -159.59 -152.14 
4  1 ALA A 242 ? ? -115.87 76.25   
5  1 ALA A 245 ? ? -35.05  137.96  
6  1 VAL A 280 ? ? -130.33 -148.40 
7  1 PRO A 288 ? ? -92.98  56.95   
8  1 ASN A 340 ? ? -106.87 -169.73 
9  1 LEU A 351 ? ? -115.15 -138.95 
10 1 GLU A 543 ? ? -62.91  -156.22 
11 1 ALA A 544 ? ? -83.15  -99.30  
12 1 PRO A 616 ? ? -34.08  133.56  
13 1 ALA A 617 ? ? -29.69  -63.66  
14 1 PRO A 618 ? ? -45.98  -6.26   
15 1 THR A 641 ? ? -142.71 -150.03 
16 1 SER A 642 ? ? 179.77  18.27   
17 1 HIS A 643 ? ? -154.27 36.32   
18 1 ASP A 651 ? ? 56.32   -114.94 
19 1 GLU A 669 ? ? -145.34 46.61   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 P MET 1   ? A MET 1   
2   1 Y 1 P GLY 2   ? A GLY 2   
3   1 Y 1 P THR 3   ? A THR 3   
4   1 Y 1 P VAL 4   ? A VAL 4   
5   1 Y 1 P SER 5   ? A SER 5   
6   1 Y 1 P SER 6   ? A SER 6   
7   1 Y 1 P ARG 7   ? A ARG 7   
8   1 Y 1 P ARG 8   ? A ARG 8   
9   1 Y 1 P SER 9   ? A SER 9   
10  1 Y 1 P TRP 10  ? A TRP 10  
11  1 Y 1 P TRP 11  ? A TRP 11  
12  1 Y 1 P PRO 12  ? A PRO 12  
13  1 Y 1 P LEU 13  ? A LEU 13  
14  1 Y 1 P PRO 14  ? A PRO 14  
15  1 Y 1 P LEU 15  ? A LEU 15  
16  1 Y 1 P LEU 16  ? A LEU 16  
17  1 Y 1 P LEU 17  ? A LEU 17  
18  1 Y 1 P LEU 18  ? A LEU 18  
19  1 Y 1 P LEU 19  ? A LEU 19  
20  1 Y 1 P LEU 20  ? A LEU 20  
21  1 Y 1 P LEU 21  ? A LEU 21  
22  1 Y 1 P LEU 22  ? A LEU 22  
23  1 Y 1 P LEU 23  ? A LEU 23  
24  1 Y 1 P GLY 24  ? A GLY 24  
25  1 Y 1 P PRO 25  ? A PRO 25  
26  1 Y 1 P ALA 26  ? A ALA 26  
27  1 Y 1 P GLY 27  ? A GLY 27  
28  1 Y 1 P ALA 28  ? A ALA 28  
29  1 Y 1 P ARG 29  ? A ARG 29  
30  1 Y 1 P ALA 30  ? A ALA 30  
31  1 Y 1 P GLN 31  ? A GLN 31  
32  1 Y 1 P GLU 32  ? A GLU 32  
33  1 Y 1 P ASP 33  ? A ASP 33  
34  1 Y 1 P GLU 34  ? A GLU 34  
35  1 Y 1 P ASP 35  ? A ASP 35  
36  1 Y 1 P GLY 36  ? A GLY 36  
37  1 Y 1 P ASP 37  ? A ASP 37  
38  1 Y 1 P TYR 38  ? A TYR 38  
39  1 Y 1 P GLU 39  ? A GLU 39  
40  1 Y 1 P GLU 40  ? A GLU 40  
41  1 Y 1 P LEU 41  ? A LEU 41  
42  1 Y 1 P VAL 42  ? A VAL 42  
43  1 Y 1 P LEU 43  ? A LEU 43  
44  1 Y 1 P ALA 44  ? A ALA 44  
45  1 Y 1 P LEU 45  ? A LEU 45  
46  1 Y 1 P ARG 46  ? A ARG 46  
47  1 Y 1 P SER 47  ? A SER 47  
48  1 Y 1 P GLU 48  ? A GLU 48  
49  1 Y 1 P GLU 49  ? A GLU 49  
50  1 Y 1 P ASP 50  ? A ASP 50  
51  1 Y 1 P GLY 51  ? A GLY 51  
52  1 Y 1 P LEU 52  ? A LEU 52  
53  1 Y 1 P ALA 53  ? A ALA 53  
54  1 Y 1 P GLU 54  ? A GLU 54  
55  1 Y 1 P ALA 55  ? A ALA 55  
56  1 Y 1 P PRO 56  ? A PRO 56  
57  1 Y 1 P GLU 57  ? A GLU 57  
58  1 Y 1 P HIS 58  ? A HIS 58  
59  1 Y 1 P GLY 59  ? A GLY 59  
60  1 Y 1 P THR 60  ? A THR 60  
61  1 Y 1 P SER 153 ? A SER 153 
62  1 Y 1 P ILE 154 ? A ILE 154 
63  1 Y 1 P PRO 155 ? A PRO 155 
64  1 Y 1 P TRP 156 ? A TRP 156 
65  1 Y 1 P ASN 157 ? A ASN 157 
66  1 Y 1 P LEU 158 ? A LEU 158 
67  1 Y 1 P GLU 159 ? A GLU 159 
68  1 Y 1 P ARG 160 ? A ARG 160 
69  1 Y 1 P ILE 161 ? A ILE 161 
70  1 Y 1 P THR 162 ? A THR 162 
71  1 Y 1 P PRO 163 ? A PRO 163 
72  1 Y 1 P PRO 164 ? A PRO 164 
73  1 Y 1 P ARG 165 ? A ARG 165 
74  1 Y 1 P TYR 166 ? A TYR 166 
75  1 Y 1 P ARG 167 ? A ARG 167 
76  1 Y 1 P ALA 168 ? A ALA 168 
77  1 Y 1 P ASP 169 ? A ASP 169 
78  1 Y 1 P GLU 170 ? A GLU 170 
79  1 Y 1 P TYR 171 ? A TYR 171 
80  1 Y 1 P GLN 172 ? A GLN 172 
81  1 Y 1 P PRO 173 ? A PRO 173 
82  1 Y 1 P PRO 174 ? A PRO 174 
83  1 Y 1 P ASP 175 ? A ASP 175 
84  1 Y 1 P GLY 176 ? A GLY 176 
85  1 Y 1 P GLY 177 ? A GLY 177 
86  1 Y 1 P SER 178 ? A SER 178 
87  1 Y 1 P LEU 179 ? A LEU 179 
88  1 Y 1 P VAL 180 ? A VAL 180 
89  1 Y 1 P GLU 181 ? A GLU 181 
90  1 Y 1 P VAL 182 ? A VAL 182 
91  1 Y 1 P TYR 183 ? A TYR 183 
92  1 Y 1 P LEU 184 ? A LEU 184 
93  1 Y 1 P LEU 185 ? A LEU 185 
94  1 Y 1 P ASP 186 ? A ASP 186 
95  1 Y 1 P THR 187 ? A THR 187 
96  1 Y 1 P SER 188 ? A SER 188 
97  1 Y 1 P ILE 189 ? A ILE 189 
98  1 Y 1 P GLN 190 ? A GLN 190 
99  1 Y 1 P SER 191 ? A SER 191 
100 1 Y 1 P ASP 192 ? A ASP 192 
101 1 Y 1 P HIS 193 ? A HIS 193 
102 1 Y 1 P ARG 194 ? A ARG 194 
103 1 Y 1 P GLU 195 ? A GLU 195 
104 1 Y 1 P ILE 196 ? A ILE 196 
105 1 Y 1 P GLU 197 ? A GLU 197 
106 1 Y 1 P GLY 198 ? A GLY 198 
107 1 Y 1 P ARG 199 ? A ARG 199 
108 1 Y 1 P VAL 200 ? A VAL 200 
109 1 Y 1 P MET 201 ? A MET 201 
110 1 Y 1 P VAL 202 ? A VAL 202 
111 1 Y 1 P THR 203 ? A THR 203 
112 1 Y 1 P ASP 204 ? A ASP 204 
113 1 Y 1 P PHE 205 ? A PHE 205 
114 1 Y 1 P GLU 206 ? A GLU 206 
115 1 Y 1 P ASN 207 ? A ASN 207 
116 1 Y 1 P VAL 208 ? A VAL 208 
117 1 Y 1 P PRO 209 ? A PRO 209 
118 1 Y 1 P GLU 210 ? A GLU 210 
119 1 Y 1 P GLU 211 ? A GLU 211 
120 1 Y 1 P ASP 212 ? A ASP 212 
121 1 Y 1 P GLY 213 ? A GLY 213 
122 1 Y 1 P THR 214 ? A THR 214 
123 1 Y 1 P ARG 215 ? A ARG 215 
124 1 Y 1 P PHE 216 ? A PHE 216 
125 1 Y 1 P HIS 217 ? A HIS 217 
126 1 Y 1 P ARG 218 ? A ARG 218 
127 1 Y 1 P GLN 219 ? A GLN 219 
128 1 Y 1 P ALA 220 ? A ALA 220 
129 1 Y 1 P SER 221 ? A SER 221 
130 1 Y 1 P LYS 222 ? A LYS 222 
131 1 Y 1 P CYS 223 ? A CYS 223 
132 1 Y 1 P ASP 224 ? A ASP 224 
133 1 Y 1 P SER 225 ? A SER 225 
134 1 Y 1 P HIS 226 ? A HIS 226 
135 1 Y 1 P GLY 227 ? A GLY 227 
136 1 Y 1 P THR 228 ? A THR 228 
137 1 Y 1 P HIS 229 ? A HIS 229 
138 1 Y 1 P LEU 230 ? A LEU 230 
139 1 Y 1 P ALA 231 ? A ALA 231 
140 1 Y 1 P GLY 232 ? A GLY 232 
141 1 Y 1 P VAL 233 ? A VAL 233 
142 1 Y 1 P VAL 234 ? A VAL 234 
143 1 Y 1 P SER 235 ? A SER 235 
144 1 Y 1 P GLY 236 ? A GLY 236 
145 1 Y 1 P ARG 237 ? A ARG 237 
146 1 Y 1 P ASP 238 ? A ASP 238 
147 1 Y 1 P ALA 239 ? A ALA 239 
148 1 Y 1 P GLY 240 ? A GLY 240 
149 1 Y 1 P VAL 241 ? A VAL 241 
150 1 Y 1 P ALA 242 ? A ALA 242 
151 1 Y 1 P LYS 243 ? A LYS 243 
152 1 Y 1 P GLY 244 ? A GLY 244 
153 1 Y 1 P ALA 245 ? A ALA 245 
154 1 Y 1 P SER 246 ? A SER 246 
155 1 Y 1 P MET 247 ? A MET 247 
156 1 Y 1 P ARG 248 ? A ARG 248 
157 1 Y 1 P SER 249 ? A SER 249 
158 1 Y 1 P LEU 250 ? A LEU 250 
159 1 Y 1 P ARG 251 ? A ARG 251 
160 1 Y 1 P VAL 252 ? A VAL 252 
161 1 Y 1 P LEU 253 ? A LEU 253 
162 1 Y 1 P ASN 254 ? A ASN 254 
163 1 Y 1 P CYS 255 ? A CYS 255 
164 1 Y 1 P GLN 256 ? A GLN 256 
165 1 Y 1 P GLY 257 ? A GLY 257 
166 1 Y 1 P LYS 258 ? A LYS 258 
167 1 Y 1 P GLY 259 ? A GLY 259 
168 1 Y 1 P THR 260 ? A THR 260 
169 1 Y 1 P VAL 261 ? A VAL 261 
170 1 Y 1 P SER 262 ? A SER 262 
171 1 Y 1 P GLY 263 ? A GLY 263 
172 1 Y 1 P THR 264 ? A THR 264 
173 1 Y 1 P LEU 265 ? A LEU 265 
174 1 Y 1 P ILE 266 ? A ILE 266 
175 1 Y 1 P GLY 267 ? A GLY 267 
176 1 Y 1 P LEU 268 ? A LEU 268 
177 1 Y 1 P GLU 269 ? A GLU 269 
178 1 Y 1 P PHE 270 ? A PHE 270 
179 1 Y 1 P ILE 271 ? A ILE 271 
180 1 Y 1 P ARG 272 ? A ARG 272 
181 1 Y 1 P LYS 273 ? A LYS 273 
182 1 Y 1 P SER 274 ? A SER 274 
183 1 Y 1 P GLN 275 ? A GLN 275 
184 1 Y 1 P LEU 276 ? A LEU 276 
185 1 Y 1 P VAL 277 ? A VAL 277 
186 1 Y 1 P GLN 278 ? A GLN 278 
187 1 Y 1 P PRO 279 ? A PRO 279 
188 1 Y 1 P VAL 280 ? A VAL 280 
189 1 Y 1 P GLY 281 ? A GLY 281 
190 1 Y 1 P PRO 282 ? A PRO 282 
191 1 Y 1 P LEU 283 ? A LEU 283 
192 1 Y 1 P VAL 284 ? A VAL 284 
193 1 Y 1 P VAL 285 ? A VAL 285 
194 1 Y 1 P LEU 286 ? A LEU 286 
195 1 Y 1 P LEU 287 ? A LEU 287 
196 1 Y 1 P PRO 288 ? A PRO 288 
197 1 Y 1 P LEU 289 ? A LEU 289 
198 1 Y 1 P ALA 290 ? A ALA 290 
199 1 Y 1 P GLY 291 ? A GLY 291 
200 1 Y 1 P GLY 292 ? A GLY 292 
201 1 Y 1 P TYR 293 ? A TYR 293 
202 1 Y 1 P SER 294 ? A SER 294 
203 1 Y 1 P ARG 295 ? A ARG 295 
204 1 Y 1 P VAL 296 ? A VAL 296 
205 1 Y 1 P LEU 297 ? A LEU 297 
206 1 Y 1 P ASN 298 ? A ASN 298 
207 1 Y 1 P ALA 299 ? A ALA 299 
208 1 Y 1 P ALA 300 ? A ALA 300 
209 1 Y 1 P CYS 301 ? A CYS 301 
210 1 Y 1 P GLN 302 ? A GLN 302 
211 1 Y 1 P ARG 303 ? A ARG 303 
212 1 Y 1 P LEU 304 ? A LEU 304 
213 1 Y 1 P ALA 305 ? A ALA 305 
214 1 Y 1 P ARG 306 ? A ARG 306 
215 1 Y 1 P ALA 307 ? A ALA 307 
216 1 Y 1 P GLY 308 ? A GLY 308 
217 1 Y 1 P VAL 309 ? A VAL 309 
218 1 Y 1 P VAL 310 ? A VAL 310 
219 1 Y 1 P LEU 311 ? A LEU 311 
220 1 Y 1 P VAL 312 ? A VAL 312 
221 1 Y 1 P THR 313 ? A THR 313 
222 1 Y 1 P ALA 314 ? A ALA 314 
223 1 Y 1 P ALA 315 ? A ALA 315 
224 1 Y 1 P GLY 316 ? A GLY 316 
225 1 Y 1 P ASN 317 ? A ASN 317 
226 1 Y 1 P PHE 318 ? A PHE 318 
227 1 Y 1 P ARG 319 ? A ARG 319 
228 1 Y 1 P ASP 320 ? A ASP 320 
229 1 Y 1 P ASP 321 ? A ASP 321 
230 1 Y 1 P ALA 322 ? A ALA 322 
231 1 Y 1 P CYS 323 ? A CYS 323 
232 1 Y 1 P LEU 324 ? A LEU 324 
233 1 Y 1 P TYR 325 ? A TYR 325 
234 1 Y 1 P SER 326 ? A SER 326 
235 1 Y 1 P PRO 327 ? A PRO 327 
236 1 Y 1 P ALA 328 ? A ALA 328 
237 1 Y 1 P SER 329 ? A SER 329 
238 1 Y 1 P ALA 330 ? A ALA 330 
239 1 Y 1 P PRO 331 ? A PRO 331 
240 1 Y 1 P GLU 332 ? A GLU 332 
241 1 Y 1 P VAL 333 ? A VAL 333 
242 1 Y 1 P ILE 334 ? A ILE 334 
243 1 Y 1 P THR 335 ? A THR 335 
244 1 Y 1 P VAL 336 ? A VAL 336 
245 1 Y 1 P GLY 337 ? A GLY 337 
246 1 Y 1 P ALA 338 ? A ALA 338 
247 1 Y 1 P THR 339 ? A THR 339 
248 1 Y 1 P ASN 340 ? A ASN 340 
249 1 Y 1 P ALA 341 ? A ALA 341 
250 1 Y 1 P GLN 342 ? A GLN 342 
251 1 Y 1 P ASP 343 ? A ASP 343 
252 1 Y 1 P GLN 344 ? A GLN 344 
253 1 Y 1 P PRO 345 ? A PRO 345 
254 1 Y 1 P VAL 346 ? A VAL 346 
255 1 Y 1 P THR 347 ? A THR 347 
256 1 Y 1 P LEU 348 ? A LEU 348 
257 1 Y 1 P GLY 349 ? A GLY 349 
258 1 Y 1 P THR 350 ? A THR 350 
259 1 Y 1 P LEU 351 ? A LEU 351 
260 1 Y 1 P GLY 352 ? A GLY 352 
261 1 Y 1 P THR 353 ? A THR 353 
262 1 Y 1 P ASN 354 ? A ASN 354 
263 1 Y 1 P PHE 355 ? A PHE 355 
264 1 Y 1 P GLY 356 ? A GLY 356 
265 1 Y 1 P ARG 357 ? A ARG 357 
266 1 Y 1 P CYS 358 ? A CYS 358 
267 1 Y 1 P VAL 359 ? A VAL 359 
268 1 Y 1 P ASP 360 ? A ASP 360 
269 1 Y 1 P LEU 361 ? A LEU 361 
270 1 Y 1 P PHE 362 ? A PHE 362 
271 1 Y 1 P ALA 363 ? A ALA 363 
272 1 Y 1 P PRO 364 ? A PRO 364 
273 1 Y 1 P GLY 365 ? A GLY 365 
274 1 Y 1 P GLU 366 ? A GLU 366 
275 1 Y 1 P ASP 367 ? A ASP 367 
276 1 Y 1 P ILE 368 ? A ILE 368 
277 1 Y 1 P ILE 369 ? A ILE 369 
278 1 Y 1 P GLY 370 ? A GLY 370 
279 1 Y 1 P ALA 371 ? A ALA 371 
280 1 Y 1 P SER 372 ? A SER 372 
281 1 Y 1 P SER 373 ? A SER 373 
282 1 Y 1 P ASP 374 ? A ASP 374 
283 1 Y 1 P CYS 375 ? A CYS 375 
284 1 Y 1 P SER 376 ? A SER 376 
285 1 Y 1 P THR 377 ? A THR 377 
286 1 Y 1 P CYS 378 ? A CYS 378 
287 1 Y 1 P PHE 379 ? A PHE 379 
288 1 Y 1 P VAL 380 ? A VAL 380 
289 1 Y 1 P SER 381 ? A SER 381 
290 1 Y 1 P GLN 382 ? A GLN 382 
291 1 Y 1 P SER 383 ? A SER 383 
292 1 Y 1 P GLY 384 ? A GLY 384 
293 1 Y 1 P THR 385 ? A THR 385 
294 1 Y 1 P SER 386 ? A SER 386 
295 1 Y 1 P GLN 387 ? A GLN 387 
296 1 Y 1 P ALA 388 ? A ALA 388 
297 1 Y 1 P ALA 389 ? A ALA 389 
298 1 Y 1 P ALA 390 ? A ALA 390 
299 1 Y 1 P HIS 391 ? A HIS 391 
300 1 Y 1 P VAL 392 ? A VAL 392 
301 1 Y 1 P ALA 393 ? A ALA 393 
302 1 Y 1 P GLY 394 ? A GLY 394 
303 1 Y 1 P ILE 395 ? A ILE 395 
304 1 Y 1 P ALA 396 ? A ALA 396 
305 1 Y 1 P ALA 397 ? A ALA 397 
306 1 Y 1 P MET 398 ? A MET 398 
307 1 Y 1 P MET 399 ? A MET 399 
308 1 Y 1 P LEU 400 ? A LEU 400 
309 1 Y 1 P SER 401 ? A SER 401 
310 1 Y 1 P ALA 402 ? A ALA 402 
311 1 Y 1 P GLU 403 ? A GLU 403 
312 1 Y 1 P PRO 404 ? A PRO 404 
313 1 Y 1 P GLU 405 ? A GLU 405 
314 1 Y 1 P LEU 406 ? A LEU 406 
315 1 Y 1 P THR 407 ? A THR 407 
316 1 Y 1 P LEU 408 ? A LEU 408 
317 1 Y 1 P ALA 409 ? A ALA 409 
318 1 Y 1 P GLU 410 ? A GLU 410 
319 1 Y 1 P LEU 411 ? A LEU 411 
320 1 Y 1 P ARG 412 ? A ARG 412 
321 1 Y 1 P GLN 413 ? A GLN 413 
322 1 Y 1 P ARG 414 ? A ARG 414 
323 1 Y 1 P LEU 415 ? A LEU 415 
324 1 Y 1 P ILE 416 ? A ILE 416 
325 1 Y 1 P HIS 417 ? A HIS 417 
326 1 Y 1 P PHE 418 ? A PHE 418 
327 1 Y 1 P SER 419 ? A SER 419 
328 1 Y 1 P ALA 420 ? A ALA 420 
329 1 Y 1 P LYS 421 ? A LYS 421 
330 1 Y 1 P ASP 422 ? A ASP 422 
331 1 Y 1 P VAL 423 ? A VAL 423 
332 1 Y 1 P ILE 424 ? A ILE 424 
333 1 Y 1 P ASN 425 ? A ASN 425 
334 1 Y 1 P GLU 426 ? A GLU 426 
335 1 Y 1 P ALA 427 ? A ALA 427 
336 1 Y 1 P TRP 428 ? A TRP 428 
337 1 Y 1 P PHE 429 ? A PHE 429 
338 1 Y 1 P PRO 430 ? A PRO 430 
339 1 Y 1 P GLU 431 ? A GLU 431 
340 1 Y 1 P ASP 432 ? A ASP 432 
341 1 Y 1 P GLN 433 ? A GLN 433 
342 1 Y 1 P ARG 434 ? A ARG 434 
343 1 Y 1 P VAL 435 ? A VAL 435 
344 1 Y 1 P LEU 436 ? A LEU 436 
345 1 Y 1 P THR 437 ? A THR 437 
346 1 Y 1 P PRO 438 ? A PRO 438 
347 1 Y 1 P ASN 439 ? A ASN 439 
348 1 Y 1 P LEU 440 ? A LEU 440 
349 1 Y 1 P VAL 441 ? A VAL 441 
350 1 Y 1 P ALA 442 ? A ALA 442 
351 1 Y 1 P ALA 443 ? A ALA 443 
352 1 Y 1 P LEU 444 ? A LEU 444 
353 1 Y 1 P PRO 445 ? A PRO 445 
354 1 Y 1 P PRO 446 ? A PRO 446 
355 1 Y 1 P SER 447 ? A SER 447 
356 1 Y 1 P THR 448 ? A THR 448 
357 1 Y 1 P HIS 449 ? A HIS 449 
358 1 Y 1 P GLY 450 ? A GLY 450 
359 1 Y 1 P ALA 451 ? A ALA 451 
360 1 Y 1 P GLY 452 ? A GLY 452 
361 1 Y 1 P TRP 453 ? A TRP 453 
362 1 Y 1 P GLN 454 ? A GLN 454 
363 1 Y 1 P LEU 455 ? A LEU 455 
364 1 Y 1 P PHE 456 ? A PHE 456 
365 1 Y 1 P CYS 457 ? A CYS 457 
366 1 Y 1 P ARG 458 ? A ARG 458 
367 1 Y 1 P THR 459 ? A THR 459 
368 1 Y 1 P VAL 460 ? A VAL 460 
369 1 Y 1 P TRP 461 ? A TRP 461 
370 1 Y 1 P SER 462 ? A SER 462 
371 1 Y 1 P ALA 463 ? A ALA 463 
372 1 Y 1 P HIS 464 ? A HIS 464 
373 1 Y 1 P SER 465 ? A SER 465 
374 1 Y 1 P GLY 466 ? A GLY 466 
375 1 Y 1 P PRO 467 ? A PRO 467 
376 1 Y 1 P THR 468 ? A THR 468 
377 1 Y 1 P ARG 469 ? A ARG 469 
378 1 Y 1 P MET 470 ? A MET 470 
379 1 Y 1 P ALA 471 ? A ALA 471 
380 1 Y 1 P THR 472 ? A THR 472 
381 1 Y 1 P ALA 473 ? A ALA 473 
382 1 Y 1 P ILE 474 ? A ILE 474 
383 1 Y 1 P ALA 475 ? A ALA 475 
384 1 Y 1 P ARG 476 ? A ARG 476 
385 1 Y 1 P CYS 477 ? A CYS 477 
386 1 Y 1 P ALA 478 ? A ALA 478 
387 1 Y 1 P PRO 479 ? A PRO 479 
388 1 Y 1 P ASP 480 ? A ASP 480 
389 1 Y 1 P GLU 481 ? A GLU 481 
390 1 Y 1 P GLU 482 ? A GLU 482 
391 1 Y 1 P LEU 483 ? A LEU 483 
392 1 Y 1 P LEU 484 ? A LEU 484 
393 1 Y 1 P SER 485 ? A SER 485 
394 1 Y 1 P CYS 486 ? A CYS 486 
395 1 Y 1 P SER 487 ? A SER 487 
396 1 Y 1 P SER 488 ? A SER 488 
397 1 Y 1 P PHE 489 ? A PHE 489 
398 1 Y 1 P SER 490 ? A SER 490 
399 1 Y 1 P ARG 491 ? A ARG 491 
400 1 Y 1 P SER 492 ? A SER 492 
401 1 Y 1 P GLY 493 ? A GLY 493 
402 1 Y 1 P LYS 494 ? A LYS 494 
403 1 Y 1 P ARG 495 ? A ARG 495 
404 1 Y 1 P ARG 496 ? A ARG 496 
405 1 Y 1 P GLY 497 ? A GLY 497 
406 1 Y 1 P GLU 498 ? A GLU 498 
407 1 Y 1 P ARG 499 ? A ARG 499 
408 1 Y 1 P MET 500 ? A MET 500 
409 1 Y 1 P GLU 501 ? A GLU 501 
410 1 Y 1 P ALA 502 ? A ALA 502 
411 1 Y 1 P GLN 503 ? A GLN 503 
412 1 Y 1 P GLY 504 ? A GLY 504 
413 1 Y 1 P GLY 505 ? A GLY 505 
414 1 Y 1 P LYS 506 ? A LYS 506 
415 1 Y 1 P LEU 507 ? A LEU 507 
416 1 Y 1 P VAL 508 ? A VAL 508 
417 1 Y 1 P CYS 509 ? A CYS 509 
418 1 Y 1 P ARG 510 ? A ARG 510 
419 1 Y 1 P ALA 511 ? A ALA 511 
420 1 Y 1 P HIS 512 ? A HIS 512 
421 1 Y 1 P ASN 513 ? A ASN 513 
422 1 Y 1 P ALA 514 ? A ALA 514 
423 1 Y 1 P PHE 515 ? A PHE 515 
424 1 Y 1 P GLY 516 ? A GLY 516 
425 1 Y 1 P GLY 517 ? A GLY 517 
426 1 Y 1 P GLU 518 ? A GLU 518 
427 1 Y 1 P GLY 519 ? A GLY 519 
428 1 Y 1 P VAL 520 ? A VAL 520 
429 1 Y 1 P TYR 521 ? A TYR 521 
430 1 Y 1 P ALA 522 ? A ALA 522 
431 1 Y 1 P ILE 523 ? A ILE 523 
432 1 Y 1 P ALA 524 ? A ALA 524 
433 1 Y 1 P ARG 525 ? A ARG 525 
434 1 Y 1 P CYS 526 ? A CYS 526 
435 1 Y 1 P CYS 527 ? A CYS 527 
436 1 Y 1 P LEU 528 ? A LEU 528 
437 1 Y 1 P LEU 529 ? A LEU 529 
438 1 Y 1 P PRO 530 ? A PRO 530 
439 1 Y 1 P GLN 531 ? A GLN 531 
440 1 Y 1 P ALA 532 ? A ALA 532 
441 1 Y 1 P ASN 533 ? A ASN 533 
442 1 Y 1 P CYS 534 ? A CYS 534 
443 1 Y 1 P SER 535 ? A SER 535 
444 1 Y 1 P VAL 536 ? A VAL 536 
445 1 Y 1 P HIS 537 ? A HIS 537 
446 1 Y 1 P THR 538 ? A THR 538 
447 1 Y 1 P ALA 539 ? A ALA 539 
448 1 Y 1 P PRO 540 ? A PRO 540 
449 1 Y 1 P PRO 541 ? A PRO 541 
450 1 Y 1 P ALA 542 ? A ALA 542 
451 1 Y 1 P GLU 543 ? A GLU 543 
452 1 Y 1 P ALA 544 ? A ALA 544 
453 1 Y 1 P SER 545 ? A SER 545 
454 1 Y 1 P MET 546 ? A MET 546 
455 1 Y 1 P GLY 547 ? A GLY 547 
456 1 Y 1 P THR 548 ? A THR 548 
457 1 Y 1 P ARG 549 ? A ARG 549 
458 1 Y 1 P VAL 550 ? A VAL 550 
459 1 Y 1 P HIS 551 ? A HIS 551 
460 1 Y 1 P CYS 552 ? A CYS 552 
461 1 Y 1 P HIS 553 ? A HIS 553 
462 1 Y 1 P GLN 554 ? A GLN 554 
463 1 Y 1 P GLN 555 ? A GLN 555 
464 1 Y 1 P GLY 556 ? A GLY 556 
465 1 Y 1 P HIS 557 ? A HIS 557 
466 1 Y 1 P VAL 558 ? A VAL 558 
467 1 Y 1 P LEU 559 ? A LEU 559 
468 1 Y 1 P THR 560 ? A THR 560 
469 1 Y 1 P GLY 561 ? A GLY 561 
470 1 Y 1 P CYS 562 ? A CYS 562 
471 1 Y 1 P SER 563 ? A SER 563 
472 1 Y 1 P SER 564 ? A SER 564 
473 1 Y 1 P HIS 565 ? A HIS 565 
474 1 Y 1 P TRP 566 ? A TRP 566 
475 1 Y 1 P GLU 567 ? A GLU 567 
476 1 Y 1 P VAL 568 ? A VAL 568 
477 1 Y 1 P GLU 569 ? A GLU 569 
478 1 Y 1 P ASP 570 ? A ASP 570 
479 1 Y 1 P LEU 571 ? A LEU 571 
480 1 Y 1 P GLY 572 ? A GLY 572 
481 1 Y 1 P THR 573 ? A THR 573 
482 1 Y 1 P HIS 574 ? A HIS 574 
483 1 Y 1 P LYS 575 ? A LYS 575 
484 1 Y 1 P PRO 576 ? A PRO 576 
485 1 Y 1 P PRO 577 ? A PRO 577 
486 1 Y 1 P VAL 578 ? A VAL 578 
487 1 Y 1 P LEU 579 ? A LEU 579 
488 1 Y 1 P ARG 580 ? A ARG 580 
489 1 Y 1 P PRO 581 ? A PRO 581 
490 1 Y 1 P ARG 582 ? A ARG 582 
491 1 Y 1 P GLY 583 ? A GLY 583 
492 1 Y 1 P GLN 584 ? A GLN 584 
493 1 Y 1 P PRO 585 ? A PRO 585 
494 1 Y 1 P ASN 586 ? A ASN 586 
495 1 Y 1 P GLN 587 ? A GLN 587 
496 1 Y 1 P CYS 588 ? A CYS 588 
497 1 Y 1 P VAL 589 ? A VAL 589 
498 1 Y 1 P GLY 590 ? A GLY 590 
499 1 Y 1 P HIS 591 ? A HIS 591 
500 1 Y 1 P ARG 592 ? A ARG 592 
501 1 Y 1 P GLU 593 ? A GLU 593 
502 1 Y 1 P ALA 594 ? A ALA 594 
503 1 Y 1 P SER 595 ? A SER 595 
504 1 Y 1 P ILE 596 ? A ILE 596 
505 1 Y 1 P HIS 597 ? A HIS 597 
506 1 Y 1 P ALA 598 ? A ALA 598 
507 1 Y 1 P SER 599 ? A SER 599 
508 1 Y 1 P CYS 600 ? A CYS 600 
509 1 Y 1 P CYS 601 ? A CYS 601 
510 1 Y 1 P HIS 602 ? A HIS 602 
511 1 Y 1 P ALA 603 ? A ALA 603 
512 1 Y 1 P PRO 604 ? A PRO 604 
513 1 Y 1 P GLY 605 ? A GLY 605 
514 1 Y 1 P LEU 606 ? A LEU 606 
515 1 Y 1 P GLU 607 ? A GLU 607 
516 1 Y 1 P CYS 608 ? A CYS 608 
517 1 Y 1 P LYS 609 ? A LYS 609 
518 1 Y 1 P VAL 610 ? A VAL 610 
519 1 Y 1 P LYS 611 ? A LYS 611 
520 1 Y 1 P GLU 612 ? A GLU 612 
521 1 Y 1 P HIS 613 ? A HIS 613 
522 1 Y 1 P GLY 614 ? A GLY 614 
523 1 Y 1 P ILE 615 ? A ILE 615 
524 1 Y 1 P PRO 616 ? A PRO 616 
525 1 Y 1 P ALA 617 ? A ALA 617 
526 1 Y 1 P PRO 618 ? A PRO 618 
527 1 Y 1 P GLN 619 ? A GLN 619 
528 1 Y 1 P GLU 620 ? A GLU 620 
529 1 Y 1 P GLN 621 ? A GLN 621 
530 1 Y 1 P VAL 622 ? A VAL 622 
531 1 Y 1 P THR 623 ? A THR 623 
532 1 Y 1 P VAL 624 ? A VAL 624 
533 1 Y 1 P ALA 625 ? A ALA 625 
534 1 Y 1 P CYS 626 ? A CYS 626 
535 1 Y 1 P GLU 627 ? A GLU 627 
536 1 Y 1 P GLU 628 ? A GLU 628 
537 1 Y 1 P GLY 629 ? A GLY 629 
538 1 Y 1 P TRP 630 ? A TRP 630 
539 1 Y 1 P THR 631 ? A THR 631 
540 1 Y 1 P LEU 632 ? A LEU 632 
541 1 Y 1 P THR 633 ? A THR 633 
542 1 Y 1 P GLY 634 ? A GLY 634 
543 1 Y 1 P CYS 635 ? A CYS 635 
544 1 Y 1 P SER 636 ? A SER 636 
545 1 Y 1 P ALA 637 ? A ALA 637 
546 1 Y 1 P LEU 638 ? A LEU 638 
547 1 Y 1 P PRO 639 ? A PRO 639 
548 1 Y 1 P GLY 640 ? A GLY 640 
549 1 Y 1 P THR 641 ? A THR 641 
550 1 Y 1 P SER 642 ? A SER 642 
551 1 Y 1 P HIS 643 ? A HIS 643 
552 1 Y 1 P VAL 644 ? A VAL 644 
553 1 Y 1 P LEU 645 ? A LEU 645 
554 1 Y 1 P GLY 646 ? A GLY 646 
555 1 Y 1 P ALA 647 ? A ALA 647 
556 1 Y 1 P TYR 648 ? A TYR 648 
557 1 Y 1 P ALA 649 ? A ALA 649 
558 1 Y 1 P VAL 650 ? A VAL 650 
559 1 Y 1 P ASP 651 ? A ASP 651 
560 1 Y 1 P ASN 652 ? A ASN 652 
561 1 Y 1 P THR 653 ? A THR 653 
562 1 Y 1 P CYS 654 ? A CYS 654 
563 1 Y 1 P VAL 655 ? A VAL 655 
564 1 Y 1 P VAL 656 ? A VAL 656 
565 1 Y 1 P ARG 657 ? A ARG 657 
566 1 Y 1 P SER 658 ? A SER 658 
567 1 Y 1 P ARG 659 ? A ARG 659 
568 1 Y 1 P ASP 660 ? A ASP 660 
569 1 Y 1 P VAL 661 ? A VAL 661 
570 1 Y 1 P SER 662 ? A SER 662 
571 1 Y 1 P THR 663 ? A THR 663 
572 1 Y 1 P THR 664 ? A THR 664 
573 1 Y 1 P GLY 665 ? A GLY 665 
574 1 Y 1 P SER 666 ? A SER 666 
575 1 Y 1 P THR 667 ? A THR 667 
576 1 Y 1 P SER 668 ? A SER 668 
577 1 Y 1 P GLU 669 ? A GLU 669 
578 1 Y 1 P GLU 670 ? A GLU 670 
579 1 Y 1 P ALA 671 ? A ALA 671 
580 1 Y 1 P VAL 672 ? A VAL 672 
581 1 Y 1 P THR 673 ? A THR 673 
582 1 Y 1 P ALA 674 ? A ALA 674 
583 1 Y 1 P VAL 675 ? A VAL 675 
584 1 Y 1 P ALA 676 ? A ALA 676 
585 1 Y 1 P ILE 677 ? A ILE 677 
586 1 Y 1 P CYS 678 ? A CYS 678 
587 1 Y 1 P CYS 679 ? A CYS 679 
588 1 Y 1 P ARG 680 ? A ARG 680 
589 1 Y 1 P SER 681 ? A SER 681 
590 1 Y 1 P ARG 682 ? A ARG 682 
591 1 Y 1 P HIS 683 ? A HIS 683 
592 1 Y 1 P LEU 684 ? A LEU 684 
593 1 Y 1 P ALA 685 ? A ALA 685 
594 1 Y 1 P GLN 686 ? A GLN 686 
595 1 Y 1 P ALA 687 ? A ALA 687 
596 1 Y 1 P SER 688 ? A SER 688 
597 1 Y 1 P GLN 689 ? A GLN 689 
598 1 Y 1 P GLU 690 ? A GLU 690 
599 1 Y 1 P LEU 691 ? A LEU 691 
600 1 Y 1 P GLN 692 ? A GLN 692 
601 1 Y 1 A MET 1   ? B MET 1   
602 1 Y 1 A GLY 2   ? B GLY 2   
603 1 Y 1 A THR 3   ? B THR 3   
604 1 Y 1 A VAL 4   ? B VAL 4   
605 1 Y 1 A SER 5   ? B SER 5   
606 1 Y 1 A SER 6   ? B SER 6   
607 1 Y 1 A ARG 7   ? B ARG 7   
608 1 Y 1 A ARG 8   ? B ARG 8   
609 1 Y 1 A SER 9   ? B SER 9   
610 1 Y 1 A TRP 10  ? B TRP 10  
611 1 Y 1 A TRP 11  ? B TRP 11  
612 1 Y 1 A PRO 12  ? B PRO 12  
613 1 Y 1 A LEU 13  ? B LEU 13  
614 1 Y 1 A PRO 14  ? B PRO 14  
615 1 Y 1 A LEU 15  ? B LEU 15  
616 1 Y 1 A LEU 16  ? B LEU 16  
617 1 Y 1 A LEU 17  ? B LEU 17  
618 1 Y 1 A LEU 18  ? B LEU 18  
619 1 Y 1 A LEU 19  ? B LEU 19  
620 1 Y 1 A LEU 20  ? B LEU 20  
621 1 Y 1 A LEU 21  ? B LEU 21  
622 1 Y 1 A LEU 22  ? B LEU 22  
623 1 Y 1 A LEU 23  ? B LEU 23  
624 1 Y 1 A GLY 24  ? B GLY 24  
625 1 Y 1 A PRO 25  ? B PRO 25  
626 1 Y 1 A ALA 26  ? B ALA 26  
627 1 Y 1 A GLY 27  ? B GLY 27  
628 1 Y 1 A ALA 28  ? B ALA 28  
629 1 Y 1 A ARG 29  ? B ARG 29  
630 1 Y 1 A ALA 30  ? B ALA 30  
631 1 Y 1 A GLN 31  ? B GLN 31  
632 1 Y 1 A GLU 32  ? B GLU 32  
633 1 Y 1 A ASP 33  ? B ASP 33  
634 1 Y 1 A GLU 34  ? B GLU 34  
635 1 Y 1 A ASP 35  ? B ASP 35  
636 1 Y 1 A GLY 36  ? B GLY 36  
637 1 Y 1 A ASP 37  ? B ASP 37  
638 1 Y 1 A TYR 38  ? B TYR 38  
639 1 Y 1 A GLU 39  ? B GLU 39  
640 1 Y 1 A GLU 40  ? B GLU 40  
641 1 Y 1 A LEU 41  ? B LEU 41  
642 1 Y 1 A VAL 42  ? B VAL 42  
643 1 Y 1 A LEU 43  ? B LEU 43  
644 1 Y 1 A ALA 44  ? B ALA 44  
645 1 Y 1 A LEU 45  ? B LEU 45  
646 1 Y 1 A ARG 46  ? B ARG 46  
647 1 Y 1 A SER 47  ? B SER 47  
648 1 Y 1 A GLU 48  ? B GLU 48  
649 1 Y 1 A GLU 49  ? B GLU 49  
650 1 Y 1 A ASP 50  ? B ASP 50  
651 1 Y 1 A GLY 51  ? B GLY 51  
652 1 Y 1 A LEU 52  ? B LEU 52  
653 1 Y 1 A ALA 53  ? B ALA 53  
654 1 Y 1 A GLU 54  ? B GLU 54  
655 1 Y 1 A ALA 55  ? B ALA 55  
656 1 Y 1 A PRO 56  ? B PRO 56  
657 1 Y 1 A GLU 57  ? B GLU 57  
658 1 Y 1 A HIS 58  ? B HIS 58  
659 1 Y 1 A GLY 59  ? B GLY 59  
660 1 Y 1 A THR 60  ? B THR 60  
661 1 Y 1 A THR 61  ? B THR 61  
662 1 Y 1 A ALA 62  ? B ALA 62  
663 1 Y 1 A THR 63  ? B THR 63  
664 1 Y 1 A PHE 64  ? B PHE 64  
665 1 Y 1 A HIS 65  ? B HIS 65  
666 1 Y 1 A ARG 66  ? B ARG 66  
667 1 Y 1 A CYS 67  ? B CYS 67  
668 1 Y 1 A ALA 68  ? B ALA 68  
669 1 Y 1 A LYS 69  ? B LYS 69  
670 1 Y 1 A ASP 70  ? B ASP 70  
671 1 Y 1 A PRO 71  ? B PRO 71  
672 1 Y 1 A TRP 72  ? B TRP 72  
673 1 Y 1 A ARG 73  ? B ARG 73  
674 1 Y 1 A LEU 74  ? B LEU 74  
675 1 Y 1 A PRO 75  ? B PRO 75  
676 1 Y 1 A GLY 76  ? B GLY 76  
677 1 Y 1 A THR 77  ? B THR 77  
678 1 Y 1 A TYR 78  ? B TYR 78  
679 1 Y 1 A VAL 79  ? B VAL 79  
680 1 Y 1 A VAL 80  ? B VAL 80  
681 1 Y 1 A VAL 81  ? B VAL 81  
682 1 Y 1 A LEU 82  ? B LEU 82  
683 1 Y 1 A LYS 83  ? B LYS 83  
684 1 Y 1 A GLU 84  ? B GLU 84  
685 1 Y 1 A GLU 85  ? B GLU 85  
686 1 Y 1 A THR 86  ? B THR 86  
687 1 Y 1 A HIS 87  ? B HIS 87  
688 1 Y 1 A LEU 88  ? B LEU 88  
689 1 Y 1 A SER 89  ? B SER 89  
690 1 Y 1 A GLN 90  ? B GLN 90  
691 1 Y 1 A SER 91  ? B SER 91  
692 1 Y 1 A GLU 92  ? B GLU 92  
693 1 Y 1 A ARG 93  ? B ARG 93  
694 1 Y 1 A THR 94  ? B THR 94  
695 1 Y 1 A ALA 95  ? B ALA 95  
696 1 Y 1 A ARG 96  ? B ARG 96  
697 1 Y 1 A ARG 97  ? B ARG 97  
698 1 Y 1 A LEU 98  ? B LEU 98  
699 1 Y 1 A GLN 99  ? B GLN 99  
700 1 Y 1 A ALA 100 ? B ALA 100 
701 1 Y 1 A GLN 101 ? B GLN 101 
702 1 Y 1 A ALA 102 ? B ALA 102 
703 1 Y 1 A ALA 103 ? B ALA 103 
704 1 Y 1 A ARG 104 ? B ARG 104 
705 1 Y 1 A ARG 105 ? B ARG 105 
706 1 Y 1 A GLY 106 ? B GLY 106 
707 1 Y 1 A TYR 107 ? B TYR 107 
708 1 Y 1 A LEU 108 ? B LEU 108 
709 1 Y 1 A THR 109 ? B THR 109 
710 1 Y 1 A LYS 110 ? B LYS 110 
711 1 Y 1 A ILE 111 ? B ILE 111 
712 1 Y 1 A LEU 112 ? B LEU 112 
713 1 Y 1 A HIS 113 ? B HIS 113 
714 1 Y 1 A VAL 114 ? B VAL 114 
715 1 Y 1 A PHE 115 ? B PHE 115 
716 1 Y 1 A HIS 116 ? B HIS 116 
717 1 Y 1 A GLY 117 ? B GLY 117 
718 1 Y 1 A LEU 118 ? B LEU 118 
719 1 Y 1 A LEU 119 ? B LEU 119 
720 1 Y 1 A PRO 120 ? B PRO 120 
721 1 Y 1 A GLY 121 ? B GLY 121 
722 1 Y 1 A PHE 122 ? B PHE 122 
723 1 Y 1 A LEU 123 ? B LEU 123 
724 1 Y 1 A VAL 124 ? B VAL 124 
725 1 Y 1 A LYS 125 ? B LYS 125 
726 1 Y 1 A MET 126 ? B MET 126 
727 1 Y 1 A SER 127 ? B SER 127 
728 1 Y 1 A GLY 128 ? B GLY 128 
729 1 Y 1 A ASP 129 ? B ASP 129 
730 1 Y 1 A LEU 130 ? B LEU 130 
731 1 Y 1 A LEU 131 ? B LEU 131 
732 1 Y 1 A GLU 132 ? B GLU 132 
733 1 Y 1 A LEU 133 ? B LEU 133 
734 1 Y 1 A ALA 134 ? B ALA 134 
735 1 Y 1 A LEU 135 ? B LEU 135 
736 1 Y 1 A LYS 136 ? B LYS 136 
737 1 Y 1 A LEU 137 ? B LEU 137 
738 1 Y 1 A PRO 138 ? B PRO 138 
739 1 Y 1 A HIS 139 ? B HIS 139 
740 1 Y 1 A VAL 140 ? B VAL 140 
741 1 Y 1 A ASP 141 ? B ASP 141 
742 1 Y 1 A TYR 142 ? B TYR 142 
743 1 Y 1 A ILE 143 ? B ILE 143 
744 1 Y 1 A GLU 144 ? B GLU 144 
745 1 Y 1 A GLU 145 ? B GLU 145 
746 1 Y 1 A ASP 146 ? B ASP 146 
747 1 Y 1 A SER 147 ? B SER 147 
748 1 Y 1 A SER 148 ? B SER 148 
749 1 Y 1 A VAL 149 ? B VAL 149 
750 1 Y 1 A PHE 150 ? B PHE 150 
751 1 Y 1 A ALA 151 ? B ALA 151 
752 1 Y 1 A GLN 152 ? B GLN 152 
753 1 Y 1 A ASP 169 ? B ASP 169 
754 1 Y 1 A GLU 170 ? B GLU 170 
755 1 Y 1 A TYR 171 ? B TYR 171 
756 1 Y 1 A GLN 172 ? B GLN 172 
757 1 Y 1 A PRO 173 ? B PRO 173 
758 1 Y 1 A PRO 174 ? B PRO 174 
759 1 Y 1 A ASP 175 ? B ASP 175 
760 1 Y 1 A GLY 213 ? B GLY 213 
761 1 Y 1 A THR 214 ? B THR 214 
762 1 Y 1 A ARG 215 ? B ARG 215 
763 1 Y 1 A PHE 216 ? B PHE 216 
764 1 Y 1 A HIS 217 ? B HIS 217 
765 1 Y 1 A ARG 218 ? B ARG 218 
766 1 Y 1 A GLY 450 ? B GLY 450 
767 1 Y 1 A ALA 451 ? B ALA 451 
768 1 Y 1 A GLY 452 ? B GLY 452 
769 1 Y 1 A THR 573 ? B THR 573 
770 1 Y 1 A HIS 574 ? B HIS 574 
771 1 Y 1 A LYS 575 ? B LYS 575 
772 1 Y 1 A PRO 576 ? B PRO 576 
773 1 Y 1 A PRO 577 ? B PRO 577 
774 1 Y 1 A VAL 578 ? B VAL 578 
775 1 Y 1 A LEU 579 ? B LEU 579 
776 1 Y 1 A ARG 580 ? B ARG 580 
777 1 Y 1 A PRO 581 ? B PRO 581 
778 1 Y 1 A ARG 582 ? B ARG 582 
779 1 Y 1 A GLY 583 ? B GLY 583 
780 1 Y 1 A GLN 584 ? B GLN 584 
781 1 Y 1 A ASP 660 ? B ASP 660 
782 1 Y 1 A VAL 661 ? B VAL 661 
783 1 Y 1 A SER 662 ? B SER 662 
784 1 Y 1 A THR 663 ? B THR 663 
785 1 Y 1 A THR 664 ? B THR 664 
786 1 Y 1 A GLY 665 ? B GLY 665 
787 1 Y 1 A SER 666 ? B SER 666 
788 1 Y 1 A THR 667 ? B THR 667 
789 1 Y 1 A HIS 683 ? B HIS 683 
790 1 Y 1 A LEU 684 ? B LEU 684 
791 1 Y 1 A ALA 685 ? B ALA 685 
792 1 Y 1 A GLN 686 ? B GLN 686 
793 1 Y 1 A ALA 687 ? B ALA 687 
794 1 Y 1 A SER 688 ? B SER 688 
795 1 Y 1 A GLN 689 ? B GLN 689 
796 1 Y 1 A GLU 690 ? B GLU 690 
797 1 Y 1 A LEU 691 ? B LEU 691 
798 1 Y 1 A GLN 692 ? B GLN 692 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MERCURY (II) ION' HG  
3 water              HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HG  1   693 1   HG  HG  P . 
D 2 HG  1   694 2   HG  HG  P . 
E 3 HOH 1   695 9   HOH HOH P . 
E 3 HOH 2   696 18  HOH HOH P . 
E 3 HOH 3   697 20  HOH HOH P . 
E 3 HOH 4   698 25  HOH HOH P . 
E 3 HOH 5   699 30  HOH HOH P . 
E 3 HOH 6   700 32  HOH HOH P . 
E 3 HOH 7   701 39  HOH HOH P . 
E 3 HOH 8   702 40  HOH HOH P . 
E 3 HOH 9   703 51  HOH HOH P . 
E 3 HOH 10  704 54  HOH HOH P . 
E 3 HOH 11  705 55  HOH HOH P . 
E 3 HOH 12  706 56  HOH HOH P . 
E 3 HOH 13  707 59  HOH HOH P . 
E 3 HOH 14  708 61  HOH HOH P . 
E 3 HOH 15  709 66  HOH HOH P . 
E 3 HOH 16  710 69  HOH HOH P . 
E 3 HOH 17  711 71  HOH HOH P . 
E 3 HOH 18  712 72  HOH HOH P . 
E 3 HOH 19  713 78  HOH HOH P . 
E 3 HOH 20  714 84  HOH HOH P . 
E 3 HOH 21  715 87  HOH HOH P . 
E 3 HOH 22  716 92  HOH HOH P . 
E 3 HOH 23  717 95  HOH HOH P . 
E 3 HOH 24  718 96  HOH HOH P . 
E 3 HOH 25  719 97  HOH HOH P . 
E 3 HOH 26  720 98  HOH HOH P . 
E 3 HOH 27  721 101 HOH HOH P . 
E 3 HOH 28  722 118 HOH HOH P . 
E 3 HOH 29  723 128 HOH HOH P . 
E 3 HOH 30  724 135 HOH HOH P . 
E 3 HOH 31  725 138 HOH HOH P . 
E 3 HOH 32  726 141 HOH HOH P . 
E 3 HOH 33  727 142 HOH HOH P . 
E 3 HOH 34  728 148 HOH HOH P . 
E 3 HOH 35  729 154 HOH HOH P . 
E 3 HOH 36  730 164 HOH HOH P . 
E 3 HOH 37  731 169 HOH HOH P . 
E 3 HOH 38  732 175 HOH HOH P . 
E 3 HOH 39  733 176 HOH HOH P . 
E 3 HOH 40  734 177 HOH HOH P . 
E 3 HOH 41  735 189 HOH HOH P . 
E 3 HOH 42  736 193 HOH HOH P . 
E 3 HOH 43  737 199 HOH HOH P . 
E 3 HOH 44  738 200 HOH HOH P . 
E 3 HOH 45  739 201 HOH HOH P . 
E 3 HOH 46  740 204 HOH HOH P . 
E 3 HOH 47  741 208 HOH HOH P . 
E 3 HOH 48  742 213 HOH HOH P . 
E 3 HOH 49  743 214 HOH HOH P . 
E 3 HOH 50  744 215 HOH HOH P . 
E 3 HOH 51  745 218 HOH HOH P . 
E 3 HOH 52  746 220 HOH HOH P . 
E 3 HOH 53  747 231 HOH HOH P . 
E 3 HOH 54  748 236 HOH HOH P . 
E 3 HOH 55  749 245 HOH HOH P . 
E 3 HOH 56  750 246 HOH HOH P . 
E 3 HOH 57  751 248 HOH HOH P . 
E 3 HOH 58  752 249 HOH HOH P . 
E 3 HOH 59  753 251 HOH HOH P . 
E 3 HOH 60  754 253 HOH HOH P . 
E 3 HOH 61  755 257 HOH HOH P . 
E 3 HOH 62  756 259 HOH HOH P . 
E 3 HOH 63  757 264 HOH HOH P . 
E 3 HOH 64  758 269 HOH HOH P . 
E 3 HOH 65  759 275 HOH HOH P . 
E 3 HOH 66  760 279 HOH HOH P . 
E 3 HOH 67  761 280 HOH HOH P . 
E 3 HOH 68  762 281 HOH HOH P . 
E 3 HOH 69  763 284 HOH HOH P . 
E 3 HOH 70  764 288 HOH HOH P . 
E 3 HOH 71  765 298 HOH HOH P . 
E 3 HOH 72  766 299 HOH HOH P . 
E 3 HOH 73  767 304 HOH HOH P . 
E 3 HOH 74  768 314 HOH HOH P . 
E 3 HOH 75  769 317 HOH HOH P . 
E 3 HOH 76  770 320 HOH HOH P . 
E 3 HOH 77  771 337 HOH HOH P . 
E 3 HOH 78  772 343 HOH HOH P . 
E 3 HOH 79  773 344 HOH HOH P . 
E 3 HOH 80  774 345 HOH HOH P . 
E 3 HOH 81  775 347 HOH HOH P . 
E 3 HOH 82  776 350 HOH HOH P . 
E 3 HOH 83  777 352 HOH HOH P . 
E 3 HOH 84  778 359 HOH HOH P . 
E 3 HOH 85  779 360 HOH HOH P . 
E 3 HOH 86  780 361 HOH HOH P . 
E 3 HOH 87  781 366 HOH HOH P . 
E 3 HOH 88  782 367 HOH HOH P . 
E 3 HOH 89  783 368 HOH HOH P . 
E 3 HOH 90  784 369 HOH HOH P . 
F 3 HOH 1   693 1   HOH HOH A . 
F 3 HOH 2   694 2   HOH HOH A . 
F 3 HOH 3   695 3   HOH HOH A . 
F 3 HOH 4   696 4   HOH HOH A . 
F 3 HOH 5   697 5   HOH HOH A . 
F 3 HOH 6   698 6   HOH HOH A . 
F 3 HOH 7   699 7   HOH HOH A . 
F 3 HOH 8   700 8   HOH HOH A . 
F 3 HOH 9   701 10  HOH HOH A . 
F 3 HOH 10  702 11  HOH HOH A . 
F 3 HOH 11  703 12  HOH HOH A . 
F 3 HOH 12  704 13  HOH HOH A . 
F 3 HOH 13  705 14  HOH HOH A . 
F 3 HOH 14  706 15  HOH HOH A . 
F 3 HOH 15  707 16  HOH HOH A . 
F 3 HOH 16  708 17  HOH HOH A . 
F 3 HOH 17  709 19  HOH HOH A . 
F 3 HOH 18  710 21  HOH HOH A . 
F 3 HOH 19  711 22  HOH HOH A . 
F 3 HOH 20  712 23  HOH HOH A . 
F 3 HOH 21  713 24  HOH HOH A . 
F 3 HOH 22  714 26  HOH HOH A . 
F 3 HOH 23  715 27  HOH HOH A . 
F 3 HOH 24  716 28  HOH HOH A . 
F 3 HOH 25  717 29  HOH HOH A . 
F 3 HOH 26  718 31  HOH HOH A . 
F 3 HOH 27  719 33  HOH HOH A . 
F 3 HOH 28  720 34  HOH HOH A . 
F 3 HOH 29  721 35  HOH HOH A . 
F 3 HOH 30  722 36  HOH HOH A . 
F 3 HOH 31  723 37  HOH HOH A . 
F 3 HOH 32  724 38  HOH HOH A . 
F 3 HOH 33  725 41  HOH HOH A . 
F 3 HOH 34  726 42  HOH HOH A . 
F 3 HOH 35  727 43  HOH HOH A . 
F 3 HOH 36  728 44  HOH HOH A . 
F 3 HOH 37  729 45  HOH HOH A . 
F 3 HOH 38  730 46  HOH HOH A . 
F 3 HOH 39  731 47  HOH HOH A . 
F 3 HOH 40  732 48  HOH HOH A . 
F 3 HOH 41  733 49  HOH HOH A . 
F 3 HOH 42  734 50  HOH HOH A . 
F 3 HOH 43  735 52  HOH HOH A . 
F 3 HOH 44  736 53  HOH HOH A . 
F 3 HOH 45  737 57  HOH HOH A . 
F 3 HOH 46  738 58  HOH HOH A . 
F 3 HOH 47  739 60  HOH HOH A . 
F 3 HOH 48  740 62  HOH HOH A . 
F 3 HOH 49  741 63  HOH HOH A . 
F 3 HOH 50  742 64  HOH HOH A . 
F 3 HOH 51  743 65  HOH HOH A . 
F 3 HOH 52  744 67  HOH HOH A . 
F 3 HOH 53  745 68  HOH HOH A . 
F 3 HOH 54  746 70  HOH HOH A . 
F 3 HOH 55  747 73  HOH HOH A . 
F 3 HOH 56  748 74  HOH HOH A . 
F 3 HOH 57  749 75  HOH HOH A . 
F 3 HOH 58  750 76  HOH HOH A . 
F 3 HOH 59  751 77  HOH HOH A . 
F 3 HOH 60  752 79  HOH HOH A . 
F 3 HOH 61  753 80  HOH HOH A . 
F 3 HOH 62  754 81  HOH HOH A . 
F 3 HOH 63  755 82  HOH HOH A . 
F 3 HOH 64  756 83  HOH HOH A . 
F 3 HOH 65  757 85  HOH HOH A . 
F 3 HOH 66  758 86  HOH HOH A . 
F 3 HOH 67  759 88  HOH HOH A . 
F 3 HOH 68  760 89  HOH HOH A . 
F 3 HOH 69  761 90  HOH HOH A . 
F 3 HOH 70  762 91  HOH HOH A . 
F 3 HOH 71  763 93  HOH HOH A . 
F 3 HOH 72  764 94  HOH HOH A . 
F 3 HOH 73  765 99  HOH HOH A . 
F 3 HOH 74  766 100 HOH HOH A . 
F 3 HOH 75  767 102 HOH HOH A . 
F 3 HOH 76  768 103 HOH HOH A . 
F 3 HOH 77  769 104 HOH HOH A . 
F 3 HOH 78  770 105 HOH HOH A . 
F 3 HOH 79  771 106 HOH HOH A . 
F 3 HOH 80  772 107 HOH HOH A . 
F 3 HOH 81  773 108 HOH HOH A . 
F 3 HOH 82  774 109 HOH HOH A . 
F 3 HOH 83  775 110 HOH HOH A . 
F 3 HOH 84  776 111 HOH HOH A . 
F 3 HOH 85  777 112 HOH HOH A . 
F 3 HOH 86  778 113 HOH HOH A . 
F 3 HOH 87  779 114 HOH HOH A . 
F 3 HOH 88  780 115 HOH HOH A . 
F 3 HOH 89  781 116 HOH HOH A . 
F 3 HOH 90  782 117 HOH HOH A . 
F 3 HOH 91  783 119 HOH HOH A . 
F 3 HOH 92  784 120 HOH HOH A . 
F 3 HOH 93  785 121 HOH HOH A . 
F 3 HOH 94  786 122 HOH HOH A . 
F 3 HOH 95  787 123 HOH HOH A . 
F 3 HOH 96  788 124 HOH HOH A . 
F 3 HOH 97  789 125 HOH HOH A . 
F 3 HOH 98  790 126 HOH HOH A . 
F 3 HOH 99  791 127 HOH HOH A . 
F 3 HOH 100 792 129 HOH HOH A . 
F 3 HOH 101 793 130 HOH HOH A . 
F 3 HOH 102 794 131 HOH HOH A . 
F 3 HOH 103 795 132 HOH HOH A . 
F 3 HOH 104 796 133 HOH HOH A . 
F 3 HOH 105 797 134 HOH HOH A . 
F 3 HOH 106 798 136 HOH HOH A . 
F 3 HOH 107 799 137 HOH HOH A . 
F 3 HOH 108 800 139 HOH HOH A . 
F 3 HOH 109 801 140 HOH HOH A . 
F 3 HOH 110 802 143 HOH HOH A . 
F 3 HOH 111 803 144 HOH HOH A . 
F 3 HOH 112 804 145 HOH HOH A . 
F 3 HOH 113 805 146 HOH HOH A . 
F 3 HOH 114 806 147 HOH HOH A . 
F 3 HOH 115 807 149 HOH HOH A . 
F 3 HOH 116 808 150 HOH HOH A . 
F 3 HOH 117 809 151 HOH HOH A . 
F 3 HOH 118 810 152 HOH HOH A . 
F 3 HOH 119 811 153 HOH HOH A . 
F 3 HOH 120 812 155 HOH HOH A . 
F 3 HOH 121 813 156 HOH HOH A . 
F 3 HOH 122 814 157 HOH HOH A . 
F 3 HOH 123 815 158 HOH HOH A . 
F 3 HOH 124 816 159 HOH HOH A . 
F 3 HOH 125 817 160 HOH HOH A . 
F 3 HOH 126 818 161 HOH HOH A . 
F 3 HOH 127 819 162 HOH HOH A . 
F 3 HOH 128 820 163 HOH HOH A . 
F 3 HOH 129 821 165 HOH HOH A . 
F 3 HOH 130 822 166 HOH HOH A . 
F 3 HOH 131 823 167 HOH HOH A . 
F 3 HOH 132 824 168 HOH HOH A . 
F 3 HOH 133 825 170 HOH HOH A . 
F 3 HOH 134 826 171 HOH HOH A . 
F 3 HOH 135 827 172 HOH HOH A . 
F 3 HOH 136 828 173 HOH HOH A . 
F 3 HOH 137 829 174 HOH HOH A . 
F 3 HOH 138 830 178 HOH HOH A . 
F 3 HOH 139 831 179 HOH HOH A . 
F 3 HOH 140 832 180 HOH HOH A . 
F 3 HOH 141 833 181 HOH HOH A . 
F 3 HOH 142 834 182 HOH HOH A . 
F 3 HOH 143 835 183 HOH HOH A . 
F 3 HOH 144 836 184 HOH HOH A . 
F 3 HOH 145 837 185 HOH HOH A . 
F 3 HOH 146 838 186 HOH HOH A . 
F 3 HOH 147 839 187 HOH HOH A . 
F 3 HOH 148 840 188 HOH HOH A . 
F 3 HOH 149 841 190 HOH HOH A . 
F 3 HOH 150 842 191 HOH HOH A . 
F 3 HOH 151 843 192 HOH HOH A . 
F 3 HOH 152 844 194 HOH HOH A . 
F 3 HOH 153 845 195 HOH HOH A . 
F 3 HOH 154 846 196 HOH HOH A . 
F 3 HOH 155 847 197 HOH HOH A . 
F 3 HOH 156 848 198 HOH HOH A . 
F 3 HOH 157 849 202 HOH HOH A . 
F 3 HOH 158 850 203 HOH HOH A . 
F 3 HOH 159 851 205 HOH HOH A . 
F 3 HOH 160 852 206 HOH HOH A . 
F 3 HOH 161 853 207 HOH HOH A . 
F 3 HOH 162 854 209 HOH HOH A . 
F 3 HOH 163 855 210 HOH HOH A . 
F 3 HOH 164 856 211 HOH HOH A . 
F 3 HOH 165 857 212 HOH HOH A . 
F 3 HOH 166 858 216 HOH HOH A . 
F 3 HOH 167 859 217 HOH HOH A . 
F 3 HOH 168 860 219 HOH HOH A . 
F 3 HOH 169 861 221 HOH HOH A . 
F 3 HOH 170 862 222 HOH HOH A . 
F 3 HOH 171 863 223 HOH HOH A . 
F 3 HOH 172 864 224 HOH HOH A . 
F 3 HOH 173 865 225 HOH HOH A . 
F 3 HOH 174 866 226 HOH HOH A . 
F 3 HOH 175 867 227 HOH HOH A . 
F 3 HOH 176 868 228 HOH HOH A . 
F 3 HOH 177 869 229 HOH HOH A . 
F 3 HOH 178 870 230 HOH HOH A . 
F 3 HOH 179 871 232 HOH HOH A . 
F 3 HOH 180 872 233 HOH HOH A . 
F 3 HOH 181 873 234 HOH HOH A . 
F 3 HOH 182 874 235 HOH HOH A . 
F 3 HOH 183 875 237 HOH HOH A . 
F 3 HOH 184 876 238 HOH HOH A . 
F 3 HOH 185 877 239 HOH HOH A . 
F 3 HOH 186 878 240 HOH HOH A . 
F 3 HOH 187 879 241 HOH HOH A . 
F 3 HOH 188 880 242 HOH HOH A . 
F 3 HOH 189 881 243 HOH HOH A . 
F 3 HOH 190 882 244 HOH HOH A . 
F 3 HOH 191 883 247 HOH HOH A . 
F 3 HOH 192 884 250 HOH HOH A . 
F 3 HOH 193 885 252 HOH HOH A . 
F 3 HOH 194 886 254 HOH HOH A . 
F 3 HOH 195 887 255 HOH HOH A . 
F 3 HOH 196 888 256 HOH HOH A . 
F 3 HOH 197 889 258 HOH HOH A . 
F 3 HOH 198 890 260 HOH HOH A . 
F 3 HOH 199 891 261 HOH HOH A . 
F 3 HOH 200 892 262 HOH HOH A . 
F 3 HOH 201 893 263 HOH HOH A . 
F 3 HOH 202 894 265 HOH HOH A . 
F 3 HOH 203 895 266 HOH HOH A . 
F 3 HOH 204 896 267 HOH HOH A . 
F 3 HOH 205 897 268 HOH HOH A . 
F 3 HOH 206 898 270 HOH HOH A . 
F 3 HOH 207 899 271 HOH HOH A . 
F 3 HOH 208 900 272 HOH HOH A . 
F 3 HOH 209 901 273 HOH HOH A . 
F 3 HOH 210 902 274 HOH HOH A . 
F 3 HOH 211 903 276 HOH HOH A . 
F 3 HOH 212 904 277 HOH HOH A . 
F 3 HOH 213 905 278 HOH HOH A . 
F 3 HOH 214 906 282 HOH HOH A . 
F 3 HOH 215 907 283 HOH HOH A . 
F 3 HOH 216 908 285 HOH HOH A . 
F 3 HOH 217 909 286 HOH HOH A . 
F 3 HOH 218 910 287 HOH HOH A . 
F 3 HOH 219 911 289 HOH HOH A . 
F 3 HOH 220 912 290 HOH HOH A . 
F 3 HOH 221 913 291 HOH HOH A . 
F 3 HOH 222 914 292 HOH HOH A . 
F 3 HOH 223 915 293 HOH HOH A . 
F 3 HOH 224 916 294 HOH HOH A . 
F 3 HOH 225 917 295 HOH HOH A . 
F 3 HOH 226 918 296 HOH HOH A . 
F 3 HOH 227 919 297 HOH HOH A . 
F 3 HOH 228 920 300 HOH HOH A . 
F 3 HOH 229 921 301 HOH HOH A . 
F 3 HOH 230 922 302 HOH HOH A . 
F 3 HOH 231 923 303 HOH HOH A . 
F 3 HOH 232 924 305 HOH HOH A . 
F 3 HOH 233 925 306 HOH HOH A . 
F 3 HOH 234 926 307 HOH HOH A . 
F 3 HOH 235 927 308 HOH HOH A . 
F 3 HOH 236 928 309 HOH HOH A . 
F 3 HOH 237 929 310 HOH HOH A . 
F 3 HOH 238 930 311 HOH HOH A . 
F 3 HOH 239 931 312 HOH HOH A . 
F 3 HOH 240 932 313 HOH HOH A . 
F 3 HOH 241 933 315 HOH HOH A . 
F 3 HOH 242 934 316 HOH HOH A . 
F 3 HOH 243 935 318 HOH HOH A . 
F 3 HOH 244 936 319 HOH HOH A . 
F 3 HOH 245 937 321 HOH HOH A . 
F 3 HOH 246 938 322 HOH HOH A . 
F 3 HOH 247 939 323 HOH HOH A . 
F 3 HOH 248 940 324 HOH HOH A . 
F 3 HOH 249 941 325 HOH HOH A . 
F 3 HOH 250 942 326 HOH HOH A . 
F 3 HOH 251 943 327 HOH HOH A . 
F 3 HOH 252 944 328 HOH HOH A . 
F 3 HOH 253 945 329 HOH HOH A . 
F 3 HOH 254 946 330 HOH HOH A . 
F 3 HOH 255 947 331 HOH HOH A . 
F 3 HOH 256 948 332 HOH HOH A . 
F 3 HOH 257 949 333 HOH HOH A . 
F 3 HOH 258 950 334 HOH HOH A . 
F 3 HOH 259 951 335 HOH HOH A . 
F 3 HOH 260 952 336 HOH HOH A . 
F 3 HOH 261 953 338 HOH HOH A . 
F 3 HOH 262 954 339 HOH HOH A . 
F 3 HOH 263 955 340 HOH HOH A . 
F 3 HOH 264 956 341 HOH HOH A . 
F 3 HOH 265 957 342 HOH HOH A . 
F 3 HOH 266 958 346 HOH HOH A . 
F 3 HOH 267 959 348 HOH HOH A . 
F 3 HOH 268 960 349 HOH HOH A . 
F 3 HOH 269 961 351 HOH HOH A . 
F 3 HOH 270 962 353 HOH HOH A . 
F 3 HOH 271 963 354 HOH HOH A . 
F 3 HOH 272 964 355 HOH HOH A . 
F 3 HOH 273 965 356 HOH HOH A . 
F 3 HOH 274 966 357 HOH HOH A . 
F 3 HOH 275 967 358 HOH HOH A . 
F 3 HOH 276 968 362 HOH HOH A . 
F 3 HOH 277 969 363 HOH HOH A . 
F 3 HOH 278 970 364 HOH HOH A . 
F 3 HOH 279 971 365 HOH HOH A . 
F 3 HOH 280 972 370 HOH HOH A . 
F 3 HOH 281 973 371 HOH HOH A . 
#