data_2P80
# 
_entry.id   2P80 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2P80         
RCSB  RCSB042081   
WWPDB D_1000042081 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1SJM 'nitrite reductase structure' unspecified 
PDB 3PAZ 'pseudoazurin structure'      unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2P80 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vlasie, M.D.' 1 
'Ubbink, M.'   2 
# 
_citation.id                        primary 
_citation.title                     
;Low resolution solution structure of the 152 kDa complex between nitrite reductase and pseudoazurin from A. faecalis by paramagnetic NMR.
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vlasie, M.D.'             1 
primary 'Fernandez-Busnadiego, R.' 2 
primary 'Prudencio, M.'            3 
primary 'Ubbink, M.'               4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Copper-containing nitrite reductase' 36878.648 3 1.7.2.1 ? ? ? 
2 polymer     man Pseudoazurin                          13383.511 1 ?       ? ? ? 
3 non-polymer syn 'COPPER (II) ION'                     63.546    7 ?       ? ? ? 
4 non-polymer syn 'GADOLINIUM ATOM'                     157.250   9 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 Cu-NIR                            
2 'Cupredoxin, Blue copper protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLEL
TLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLH
DGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLI
VHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVT
GEWNDDLMTSVLAPSGTIEGR
;
;ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLEL
TLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLH
DGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLI
VHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVT
GEWNDDLMTSVLAPSGTIEGR
;
A,B,C ? 
2 'polypeptide(L)' no no 
;ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTP
HYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
;
;ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTP
HYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
;
D     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   THR n 
1 3   ALA n 
1 4   ALA n 
1 5   GLU n 
1 6   ILE n 
1 7   ALA n 
1 8   ALA n 
1 9   LEU n 
1 10  PRO n 
1 11  ARG n 
1 12  GLN n 
1 13  LYS n 
1 14  VAL n 
1 15  GLU n 
1 16  LEU n 
1 17  VAL n 
1 18  ASP n 
1 19  PRO n 
1 20  PRO n 
1 21  PHE n 
1 22  VAL n 
1 23  HIS n 
1 24  ALA n 
1 25  HIS n 
1 26  SER n 
1 27  GLN n 
1 28  VAL n 
1 29  ALA n 
1 30  GLU n 
1 31  GLY n 
1 32  GLY n 
1 33  PRO n 
1 34  LYS n 
1 35  VAL n 
1 36  VAL n 
1 37  GLU n 
1 38  PHE n 
1 39  THR n 
1 40  MET n 
1 41  VAL n 
1 42  ILE n 
1 43  GLU n 
1 44  GLU n 
1 45  LYS n 
1 46  LYS n 
1 47  ILE n 
1 48  VAL n 
1 49  ILE n 
1 50  ASP n 
1 51  ASP n 
1 52  ALA n 
1 53  GLY n 
1 54  THR n 
1 55  GLU n 
1 56  VAL n 
1 57  HIS n 
1 58  ALA n 
1 59  MET n 
1 60  ALA n 
1 61  PHE n 
1 62  ASN n 
1 63  GLY n 
1 64  THR n 
1 65  VAL n 
1 66  PRO n 
1 67  GLY n 
1 68  PRO n 
1 69  LEU n 
1 70  MET n 
1 71  VAL n 
1 72  VAL n 
1 73  HIS n 
1 74  GLN n 
1 75  ASP n 
1 76  ASP n 
1 77  TYR n 
1 78  LEU n 
1 79  GLU n 
1 80  LEU n 
1 81  THR n 
1 82  LEU n 
1 83  ILE n 
1 84  ASN n 
1 85  PRO n 
1 86  GLU n 
1 87  THR n 
1 88  ASN n 
1 89  THR n 
1 90  LEU n 
1 91  MET n 
1 92  HIS n 
1 93  ASN n 
1 94  ILE n 
1 95  ASP n 
1 96  PHE n 
1 97  HIS n 
1 98  ALA n 
1 99  ALA n 
1 100 THR n 
1 101 GLY n 
1 102 ALA n 
1 103 LEU n 
1 104 GLY n 
1 105 GLY n 
1 106 GLY n 
1 107 GLY n 
1 108 LEU n 
1 109 THR n 
1 110 GLU n 
1 111 ILE n 
1 112 ASN n 
1 113 PRO n 
1 114 GLY n 
1 115 GLU n 
1 116 LYS n 
1 117 THR n 
1 118 ILE n 
1 119 LEU n 
1 120 ARG n 
1 121 PHE n 
1 122 LYS n 
1 123 ALA n 
1 124 THR n 
1 125 LYS n 
1 126 PRO n 
1 127 GLY n 
1 128 VAL n 
1 129 PHE n 
1 130 VAL n 
1 131 TYR n 
1 132 HIS n 
1 133 CYS n 
1 134 ALA n 
1 135 PRO n 
1 136 PRO n 
1 137 GLY n 
1 138 MET n 
1 139 VAL n 
1 140 PRO n 
1 141 TRP n 
1 142 HIS n 
1 143 VAL n 
1 144 VAL n 
1 145 SER n 
1 146 GLY n 
1 147 MET n 
1 148 ASN n 
1 149 GLY n 
1 150 ALA n 
1 151 ILE n 
1 152 MET n 
1 153 VAL n 
1 154 LEU n 
1 155 PRO n 
1 156 ARG n 
1 157 GLU n 
1 158 GLY n 
1 159 LEU n 
1 160 HIS n 
1 161 ASP n 
1 162 GLY n 
1 163 LYS n 
1 164 GLY n 
1 165 LYS n 
1 166 ALA n 
1 167 LEU n 
1 168 THR n 
1 169 TYR n 
1 170 ASP n 
1 171 LYS n 
1 172 ILE n 
1 173 TYR n 
1 174 TYR n 
1 175 VAL n 
1 176 GLY n 
1 177 GLU n 
1 178 GLN n 
1 179 ASP n 
1 180 PHE n 
1 181 TYR n 
1 182 VAL n 
1 183 PRO n 
1 184 ARG n 
1 185 ASP n 
1 186 GLU n 
1 187 ASN n 
1 188 GLY n 
1 189 LYS n 
1 190 TYR n 
1 191 LYS n 
1 192 LYS n 
1 193 TYR n 
1 194 GLU n 
1 195 ALA n 
1 196 PRO n 
1 197 GLY n 
1 198 ASP n 
1 199 ALA n 
1 200 TYR n 
1 201 GLU n 
1 202 ASP n 
1 203 THR n 
1 204 VAL n 
1 205 LYS n 
1 206 VAL n 
1 207 MET n 
1 208 ARG n 
1 209 THR n 
1 210 LEU n 
1 211 THR n 
1 212 PRO n 
1 213 THR n 
1 214 HIS n 
1 215 VAL n 
1 216 VAL n 
1 217 PHE n 
1 218 ASN n 
1 219 GLY n 
1 220 ALA n 
1 221 VAL n 
1 222 GLY n 
1 223 ALA n 
1 224 LEU n 
1 225 THR n 
1 226 GLY n 
1 227 ASP n 
1 228 LYS n 
1 229 ALA n 
1 230 MET n 
1 231 THR n 
1 232 ALA n 
1 233 ALA n 
1 234 VAL n 
1 235 GLY n 
1 236 GLU n 
1 237 LYS n 
1 238 VAL n 
1 239 LEU n 
1 240 ILE n 
1 241 VAL n 
1 242 HIS n 
1 243 SER n 
1 244 GLN n 
1 245 ALA n 
1 246 ASN n 
1 247 ARG n 
1 248 ASP n 
1 249 THR n 
1 250 ARG n 
1 251 PRO n 
1 252 HIS n 
1 253 LEU n 
1 254 ILE n 
1 255 GLY n 
1 256 GLY n 
1 257 HIS n 
1 258 GLY n 
1 259 ASP n 
1 260 TYR n 
1 261 VAL n 
1 262 TRP n 
1 263 ALA n 
1 264 THR n 
1 265 GLY n 
1 266 LYS n 
1 267 PHE n 
1 268 ASN n 
1 269 THR n 
1 270 PRO n 
1 271 PRO n 
1 272 ASP n 
1 273 VAL n 
1 274 ASP n 
1 275 GLN n 
1 276 GLU n 
1 277 THR n 
1 278 TRP n 
1 279 PHE n 
1 280 ILE n 
1 281 PRO n 
1 282 GLY n 
1 283 GLY n 
1 284 ALA n 
1 285 ALA n 
1 286 GLY n 
1 287 ALA n 
1 288 ALA n 
1 289 PHE n 
1 290 TYR n 
1 291 THR n 
1 292 PHE n 
1 293 GLN n 
1 294 GLN n 
1 295 PRO n 
1 296 GLY n 
1 297 ILE n 
1 298 TYR n 
1 299 ALA n 
1 300 TYR n 
1 301 VAL n 
1 302 ASN n 
1 303 HIS n 
1 304 ASN n 
1 305 LEU n 
1 306 ILE n 
1 307 GLU n 
1 308 ALA n 
1 309 PHE n 
1 310 GLU n 
1 311 LEU n 
1 312 GLY n 
1 313 ALA n 
1 314 ALA n 
1 315 ALA n 
1 316 HIS n 
1 317 PHE n 
1 318 LYS n 
1 319 VAL n 
1 320 THR n 
1 321 GLY n 
1 322 GLU n 
1 323 TRP n 
1 324 ASN n 
1 325 ASP n 
1 326 ASP n 
1 327 LEU n 
1 328 MET n 
1 329 THR n 
1 330 SER n 
1 331 VAL n 
1 332 LEU n 
1 333 ALA n 
1 334 PRO n 
1 335 SER n 
1 336 GLY n 
1 337 THR n 
1 338 ILE n 
1 339 GLU n 
1 340 GLY n 
1 341 ARG n 
2 1   GLU n 
2 2   ASN n 
2 3   ILE n 
2 4   GLU n 
2 5   VAL n 
2 6   HIS n 
2 7   MET n 
2 8   LEU n 
2 9   ASN n 
2 10  LYS n 
2 11  GLY n 
2 12  ALA n 
2 13  GLU n 
2 14  GLY n 
2 15  ALA n 
2 16  MET n 
2 17  VAL n 
2 18  PHE n 
2 19  GLU n 
2 20  PRO n 
2 21  ALA n 
2 22  TYR n 
2 23  ILE n 
2 24  LYS n 
2 25  ALA n 
2 26  ASN n 
2 27  PRO n 
2 28  GLY n 
2 29  ASP n 
2 30  THR n 
2 31  VAL n 
2 32  THR n 
2 33  PHE n 
2 34  ILE n 
2 35  PRO n 
2 36  VAL n 
2 37  ASP n 
2 38  LYS n 
2 39  GLY n 
2 40  HIS n 
2 41  ASN n 
2 42  VAL n 
2 43  GLU n 
2 44  SER n 
2 45  ILE n 
2 46  LYS n 
2 47  ASP n 
2 48  MET n 
2 49  ILE n 
2 50  PRO n 
2 51  GLU n 
2 52  GLY n 
2 53  ALA n 
2 54  GLU n 
2 55  LYS n 
2 56  PHE n 
2 57  LYS n 
2 58  SER n 
2 59  LYS n 
2 60  ILE n 
2 61  ASN n 
2 62  GLU n 
2 63  ASN n 
2 64  TYR n 
2 65  VAL n 
2 66  LEU n 
2 67  THR n 
2 68  VAL n 
2 69  THR n 
2 70  GLN n 
2 71  PRO n 
2 72  GLY n 
2 73  ALA n 
2 74  TYR n 
2 75  LEU n 
2 76  VAL n 
2 77  LYS n 
2 78  CYS n 
2 79  THR n 
2 80  PRO n 
2 81  HIS n 
2 82  TYR n 
2 83  ALA n 
2 84  MET n 
2 85  GLY n 
2 86  MET n 
2 87  ILE n 
2 88  ALA n 
2 89  LEU n 
2 90  ILE n 
2 91  ALA n 
2 92  VAL n 
2 93  GLY n 
2 94  ASP n 
2 95  SER n 
2 96  PRO n 
2 97  ALA n 
2 98  ASN n 
2 99  LEU n 
2 100 ASP n 
2 101 GLN n 
2 102 ILE n 
2 103 VAL n 
2 104 SER n 
2 105 ALA n 
2 106 LYS n 
2 107 LYS n 
2 108 PRO n 
2 109 LYS n 
2 110 ILE n 
2 111 VAL n 
2 112 GLN n 
2 113 GLU n 
2 114 ARG n 
2 115 LEU n 
2 116 GLU n 
2 117 LYS n 
2 118 VAL n 
2 119 ILE n 
2 120 ALA n 
2 121 SER n 
2 122 ALA n 
2 123 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? Alcaligenes 'nirK, nir' ? S-6 ? ? ? ? 'Alcaligenes faecalis' 511 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 
469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21 (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET28A ? ? 
2 1 sample ? ? ? ? Alcaligenes ?           ? S-6 ? ? ? ? 'Alcaligenes faecalis' 511 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 
469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21 (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET28A ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP NIR_ALCFA  P38501 1 
;ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLEL
TLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLH
DGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLI
VHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVT
GEWNDDLMTSVLAPSGT
;
40 ? 
2 UNP AZUP_ALCFA P04377 2 
;ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTP
HYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
;
24 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2P80 A 1 ? 337 ? P38501 40 ? 376 ? 4 340 
2 1 2P80 B 1 ? 337 ? P38501 40 ? 376 ? 4 340 
3 1 2P80 C 1 ? 337 ? P38501 40 ? 376 ? 4 340 
4 2 2P80 D 1 ? 123 ? P04377 24 ? 146 ? 1 123 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2P80 ILE A 338 ? UNP P38501 ? ? 'EXPRESSION TAG' 341 1  
1 2P80 GLU A 339 ? UNP P38501 ? ? 'EXPRESSION TAG' 342 2  
1 2P80 GLY A 340 ? UNP P38501 ? ? 'EXPRESSION TAG' 343 3  
1 2P80 ARG A 341 ? UNP P38501 ? ? 'EXPRESSION TAG' 344 4  
2 2P80 ILE B 338 ? UNP P38501 ? ? 'EXPRESSION TAG' 341 5  
2 2P80 GLU B 339 ? UNP P38501 ? ? 'EXPRESSION TAG' 342 6  
2 2P80 GLY B 340 ? UNP P38501 ? ? 'EXPRESSION TAG' 343 7  
2 2P80 ARG B 341 ? UNP P38501 ? ? 'EXPRESSION TAG' 344 8  
3 2P80 ILE C 338 ? UNP P38501 ? ? 'EXPRESSION TAG' 341 9  
3 2P80 GLU C 339 ? UNP P38501 ? ? 'EXPRESSION TAG' 342 10 
3 2P80 GLY C 340 ? UNP P38501 ? ? 'EXPRESSION TAG' 343 11 
3 2P80 ARG C 341 ? UNP P38501 ? ? 'EXPRESSION TAG' 344 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CU  non-polymer         . 'COPPER (II) ION' ? 'Cu 2'           63.546  
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GD  non-polymer         . 'GADOLINIUM ATOM' ? Gd               157.250 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl.experiment_id   1 
_pdbx_nmr_exptl.conditions_id   1 
_pdbx_nmr_exptl.type            '2D_15N,1H TROSY' 
_pdbx_nmr_exptl.solution_id     1 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 298 1 6.5 '50 mM phosphate' atm K 
2 298 1 6.5 '50 mM phosphate' atm K 
3 298 1 6.5 '50 mM phosphate' atm K 
4 298 1 6.5 '50 mM phosphate' atm K 
5 298 1 6.5 '50 mM phosphate' atm K 
6 298 1 6.5 '50 mM phosphate' atm K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 
;250 mM 15N, 2H pseudoazurin  in complex with nitrite reductase -bound GdCLaNP at position 221/223 (0.38 eq), in 50 mM phosphate buffer, H2O, 6% (v/v) D2O
;
'H2O, 6% (v/v) D2O' 
2 
;250 mM 15N, 2H pseudoazurin  in complex with nitrite reductase -bound YCLaNP at position 221/223 (0.38 eq), in 50 mM phosphate buffer, H2O, 6% (v/v) D2O
;
'H2O, 6% (v/v) D2O' 
3 
;250 mM 15N, 2H pseudoazurin  in complex with nitrite reductase -bound GdCLaNP at position 234/236 (0.32 eq), in 50 mM phosphate buffer, H2O, 6% (v/v) D2O
;
'H2O, 6% (v/v) D2O' 
4 
;250 mM 15N, 2H pseudoazurin  in complex with nitrite reductase -bound YCLaNP at position 234/236 (0.32 eq), in 50 mM phosphate buffer, H2O, 6% (v/v) D2O
;
'H2O, 6% (v/v) D2O' 
5 
;250 mM 15N, 2H pseudoazurin in complex with nitrite reductase -bound GdCLaNP at position 333/336 (0.53 eq), in 50 mM phosphate buffer, H2O, 6% (v/v) D2O
;
'H2O, 6% (v/v) D2O' 
6 
;250 mM 15N, 2H pseudoazurin in complex with nitrite reductase -bound YCLaNP at position 333/336 (0.53 eq), in 50 mM phosphate buffer, H2O, 6% (v/v) D2O
;
'H2O, 6% (v/v) D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             DMX 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2P80 
_pdbx_nmr_refine.method             'distance geometry, rigid body molecular dynamics, restrained side-chains energy minimization' 
_pdbx_nmr_refine.details            
'324 distance restraints from paramagnetic relaxation, 5 restraints from chemical shift perturbations' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2P80 
_pdbx_nmr_details.text       '~80% deuteration of the nonexchangeable protons in pseudoazurin' 
# 
_pdbx_nmr_ensemble.entry_id                                      2P80 
_pdbx_nmr_ensemble.conformers_calculated_total_number            134 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures closest to the average' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2P80 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 2.6     Bruker                 1 
processing           AZARA   2.7     'Boucher, W.'          2 
'data analysis'      ANSIG   1.02    'Kraulis, P.'          3 
'structure solution' X-PLOR  2.9.9   'Brunger, A.T. et al.' 4 
'data analysis'      MestReC 4.8.6.0 'Mestrelab Research'   5 
refinement           X-PLOR  2.9.9   'Brunger, A.T. et al.' 6 
# 
_exptl.entry_id          2P80 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2P80 
_struct.title                     'Solution structure of the complex between nitrite reductase and pseudoazurin from A. faecalis' 
_struct.pdbx_descriptor           'Copper-containing nitrite reductase (E.C.1.7.2.1), Pseudoazurin' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2P80 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
'transient complex, protein-protein interaction, redox partners, electron transfer, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 3 ? 
K N N 3 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 4 ? 
T N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 2   ? LEU A 9   ? THR A 5   LEU A 12  1 ? 8  
HELX_P HELX_P2  2  ALA A 102 ? THR A 109 ? ALA A 105 THR A 112 5 ? 8  
HELX_P HELX_P3  3  MET A 138 ? SER A 145 ? MET A 141 SER A 148 1 ? 8  
HELX_P HELX_P4  4  PRO A 196 ? ASP A 198 ? PRO A 199 ASP A 201 5 ? 3  
HELX_P HELX_P5  5  ALA A 199 ? THR A 209 ? ALA A 202 THR A 212 1 ? 11 
HELX_P HELX_P6  6  THR A 225 ? ALA A 229 ? THR A 228 ALA A 232 5 ? 5  
HELX_P HELX_P7  7  ASN A 304 ? GLU A 310 ? ASN A 307 GLU A 313 1 ? 7  
HELX_P HELX_P8  8  THR B 2   ? ALA B 8   ? THR B 5   ALA B 11  1 ? 7  
HELX_P HELX_P9  9  ALA B 102 ? THR B 109 ? ALA B 105 THR B 112 5 ? 8  
HELX_P HELX_P10 10 MET B 138 ? SER B 145 ? MET B 141 SER B 148 1 ? 8  
HELX_P HELX_P11 11 ALA B 195 ? ASP B 198 ? ALA B 198 ASP B 201 5 ? 4  
HELX_P HELX_P12 12 ALA B 199 ? THR B 209 ? ALA B 202 THR B 212 1 ? 11 
HELX_P HELX_P13 13 THR B 225 ? ALA B 229 ? THR B 228 ALA B 232 5 ? 5  
HELX_P HELX_P14 14 ASN B 304 ? GLU B 310 ? ASN B 307 GLU B 313 1 ? 7  
HELX_P HELX_P15 15 THR C 2   ? ALA C 8   ? THR C 5   ALA C 11  1 ? 7  
HELX_P HELX_P16 16 ALA C 102 ? GLY C 106 ? ALA C 105 GLY C 109 5 ? 5  
HELX_P HELX_P17 17 MET C 138 ? SER C 145 ? MET C 141 SER C 148 1 ? 8  
HELX_P HELX_P18 18 PRO C 196 ? ASP C 198 ? PRO C 199 ASP C 201 5 ? 3  
HELX_P HELX_P19 19 ALA C 199 ? THR C 209 ? ALA C 202 THR C 212 1 ? 11 
HELX_P HELX_P20 20 THR C 225 ? ALA C 229 ? THR C 228 ALA C 232 5 ? 5  
HELX_P HELX_P21 21 ASN C 304 ? GLU C 310 ? ASN C 307 GLU C 313 1 ? 7  
HELX_P HELX_P22 22 HIS D 81  ? GLY D 85  ? HIS D 81  GLY D 85  5 ? 5  
HELX_P HELX_P23 23 ASN D 98  ? ALA D 105 ? ASN D 98  ALA D 105 1 ? 8  
HELX_P HELX_P24 24 PRO D 108 ? SER D 121 ? PRO D 108 SER D 121 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1   PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 1  0.02  
2   VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 1  1.70  
3   PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 1  0.24  
4   VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 1  1.41  
5   PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 1  0.18  
6   VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 1  1.56  
7   GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 1  -0.07 
8   PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 2  0.02  
9   VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 2  1.70  
10  PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 2  0.24  
11  VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 2  1.41  
12  PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 2  0.18  
13  VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 2  1.56  
14  GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 2  -0.05 
15  PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 3  0.02  
16  VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 3  1.70  
17  PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 3  0.24  
18  VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 3  1.41  
19  PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 3  0.18  
20  VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 3  1.56  
21  GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 3  0.02  
22  PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 4  0.02  
23  VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 4  1.70  
24  PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 4  0.24  
25  VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 4  1.41  
26  PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 4  0.18  
27  VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 4  1.56  
28  GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 4  -0.14 
29  PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 5  0.02  
30  VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 5  1.70  
31  PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 5  0.24  
32  VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 5  1.41  
33  PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 5  0.18  
34  VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 5  1.56  
35  GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 5  0.06  
36  PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 6  0.02  
37  VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 6  1.70  
38  PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 6  0.24  
39  VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 6  1.41  
40  PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 6  0.18  
41  VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 6  1.56  
42  GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 6  -0.10 
43  PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 7  0.02  
44  VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 7  1.70  
45  PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 7  0.24  
46  VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 7  1.41  
47  PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 7  0.18  
48  VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 7  1.56  
49  GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 7  -0.09 
50  PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 8  0.02  
51  VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 8  1.70  
52  PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 8  0.24  
53  VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 8  1.41  
54  PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 8  0.18  
55  VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 8  1.56  
56  GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 8  -0.07 
57  PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 9  0.02  
58  VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 9  1.70  
59  PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 9  0.24  
60  VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 9  1.41  
61  PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 9  0.18  
62  VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 9  1.56  
63  GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 9  -0.08 
64  PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 10 0.02  
65  VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 10 1.70  
66  PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 10 0.24  
67  VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 10 1.41  
68  PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 10 0.18  
69  VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 10 1.56  
70  GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 10 -0.04 
71  PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 11 0.02  
72  VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 11 1.70  
73  PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 11 0.24  
74  VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 11 1.41  
75  PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 11 0.18  
76  VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 11 1.56  
77  GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 11 -0.03 
78  PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 12 0.02  
79  VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 12 1.70  
80  PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 12 0.24  
81  VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 12 1.41  
82  PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 12 0.18  
83  VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 12 1.56  
84  GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 12 -0.20 
85  PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 13 0.02  
86  VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 13 1.70  
87  PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 13 0.24  
88  VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 13 1.41  
89  PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 13 0.18  
90  VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 13 1.56  
91  GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 13 -0.15 
92  PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 14 0.02  
93  VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 14 1.70  
94  PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 14 0.24  
95  VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 14 1.41  
96  PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 14 0.18  
97  VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 14 1.56  
98  GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 14 0.01  
99  PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 15 0.02  
100 VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 15 1.70  
101 PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 15 0.24  
102 VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 15 1.41  
103 PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 15 0.18  
104 VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 15 1.56  
105 GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 15 -0.15 
106 PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 16 0.02  
107 VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 16 1.70  
108 PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 16 0.24  
109 VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 16 1.41  
110 PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 16 0.18  
111 VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 16 1.56  
112 GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 16 0.00  
113 PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 17 0.02  
114 VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 17 1.70  
115 PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 17 0.24  
116 VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 17 1.41  
117 PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 17 0.18  
118 VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 17 1.56  
119 GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 17 -0.09 
120 PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 18 0.02  
121 VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 18 1.70  
122 PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 18 0.24  
123 VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 18 1.41  
124 PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 18 0.18  
125 VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 18 1.56  
126 GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 18 -0.02 
127 PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 19 0.02  
128 VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 19 1.70  
129 PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 19 0.24  
130 VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 19 1.41  
131 PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 19 0.18  
132 VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 19 1.56  
133 GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 19 0.14  
134 PRO 19 A . ? PRO 22 A PRO 20 A ? PRO 23 A 20 0.02  
135 VAL 65 A . ? VAL 68 A PRO 66 A ? PRO 69 A 20 1.70  
136 PRO 19 B . ? PRO 22 B PRO 20 B ? PRO 23 B 20 0.24  
137 VAL 65 B . ? VAL 68 B PRO 66 B ? PRO 69 B 20 1.41  
138 PRO 19 C . ? PRO 22 C PRO 20 C ? PRO 23 C 20 0.18  
139 VAL 65 C . ? VAL 68 C PRO 66 C ? PRO 69 C 20 1.56  
140 GLU 19 D . ? GLU 19 D PRO 20 D ? PRO 20 D 20 -0.16 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 5 ? 
C ? 3 ? 
D ? 2 ? 
E ? 2 ? 
F ? 6 ? 
G ? 3 ? 
H ? 5 ? 
I ? 5 ? 
J ? 3 ? 
K ? 5 ? 
L ? 3 ? 
M ? 2 ? 
N ? 2 ? 
O ? 6 ? 
P ? 3 ? 
Q ? 3 ? 
R ? 2 ? 
S ? 2 ? 
T ? 6 ? 
U ? 3 ? 
V ? 4 ? 
W ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
H 4 5 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? parallel      
I 4 5 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? parallel      
K 3 4 ? anti-parallel 
K 4 5 ? anti-parallel 
L 1 2 ? parallel      
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? parallel      
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
O 5 6 ? anti-parallel 
P 1 2 ? parallel      
P 2 3 ? anti-parallel 
Q 1 2 ? parallel      
Q 2 3 ? anti-parallel 
R 1 2 ? anti-parallel 
S 1 2 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? parallel      
T 3 4 ? anti-parallel 
T 4 5 ? anti-parallel 
T 5 6 ? anti-parallel 
U 1 2 ? parallel      
U 2 3 ? anti-parallel 
V 1 2 ? anti-parallel 
V 2 3 ? parallel      
V 3 4 ? anti-parallel 
W 1 2 ? parallel      
W 2 3 ? anti-parallel 
W 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 11  ? LYS A 13  ? ARG A 14  LYS A 16  
A 2 VAL A 35  ? VAL A 48  ? VAL A 38  VAL A 51  
A 3 GLU A 55  ? PHE A 61  ? GLU A 58  PHE A 64  
B 1 ARG A 11  ? LYS A 13  ? ARG A 14  LYS A 16  
B 2 VAL A 35  ? VAL A 48  ? VAL A 38  VAL A 51  
B 3 TYR A 77  ? ASN A 84  ? TYR A 80  ASN A 87  
B 4 GLU A 115 ? LYS A 122 ? GLU A 118 LYS A 125 
B 5 MET B 328 ? SER B 335 ? MET B 331 SER B 338 
C 1 MET A 70  ? HIS A 73  ? MET A 73  HIS A 76  
C 2 ILE A 151 ? LEU A 154 ? ILE A 154 LEU A 157 
C 3 GLY A 127 ? PHE A 129 ? GLY A 130 PHE A 132 
D 1 ASP A 95  ? PHE A 96  ? ASP A 98  PHE A 99  
D 2 TYR A 131 ? HIS A 132 ? TYR A 134 HIS A 135 
E 1 LEU A 159 ? HIS A 160 ? LEU A 162 HIS A 163 
E 2 ALA A 166 ? LEU A 167 ? ALA A 169 LEU A 170 
F 1 HIS A 214 ? PHE A 217 ? HIS A 217 PHE A 220 
F 2 LYS A 171 ? PHE A 180 ? LYS A 174 PHE A 183 
F 3 LYS A 237 ? GLN A 244 ? LYS A 240 GLN A 247 
F 4 ALA A 284 ? THR A 291 ? ALA A 287 THR A 294 
F 5 GLY A 258 ? TRP A 262 ? GLY A 261 TRP A 265 
F 6 ASP A 272 ? GLN A 275 ? ASP A 275 GLN A 278 
G 1 MET A 230 ? ALA A 233 ? MET A 233 ALA A 236 
G 2 ALA A 314 ? THR A 320 ? ALA A 317 THR A 323 
G 3 GLY A 296 ? VAL A 301 ? GLY A 299 VAL A 304 
H 1 MET A 328 ? SER A 335 ? MET A 331 SER A 338 
H 2 GLU C 115 ? LYS C 122 ? GLU C 118 LYS C 125 
H 3 TYR C 77  ? ASN C 84  ? TYR C 80  ASN C 87  
H 4 VAL C 35  ? VAL C 48  ? VAL C 38  VAL C 51  
H 5 ARG C 11  ? LYS C 13  ? ARG C 14  LYS C 16  
I 1 MET A 328 ? SER A 335 ? MET A 331 SER A 338 
I 2 GLU C 115 ? LYS C 122 ? GLU C 118 LYS C 125 
I 3 TYR C 77  ? ASN C 84  ? TYR C 80  ASN C 87  
I 4 VAL C 35  ? VAL C 48  ? VAL C 38  VAL C 51  
I 5 GLU C 55  ? PHE C 61  ? GLU C 58  PHE C 64  
J 1 ARG B 11  ? LYS B 13  ? ARG B 14  LYS B 16  
J 2 VAL B 35  ? VAL B 48  ? VAL B 38  VAL B 51  
J 3 GLU B 55  ? PHE B 61  ? GLU B 58  PHE B 64  
K 1 ARG B 11  ? LYS B 13  ? ARG B 14  LYS B 16  
K 2 VAL B 35  ? VAL B 48  ? VAL B 38  VAL B 51  
K 3 TYR B 77  ? ASN B 84  ? TYR B 80  ASN B 87  
K 4 GLU B 115 ? LYS B 122 ? GLU B 118 LYS B 125 
K 5 MET C 328 ? SER C 335 ? MET C 331 SER C 338 
L 1 MET B 70  ? HIS B 73  ? MET B 73  HIS B 76  
L 2 ILE B 151 ? LEU B 154 ? ILE B 154 LEU B 157 
L 3 GLY B 127 ? PHE B 129 ? GLY B 130 PHE B 132 
M 1 ASP B 95  ? PHE B 96  ? ASP B 98  PHE B 99  
M 2 TYR B 131 ? HIS B 132 ? TYR B 134 HIS B 135 
N 1 LEU B 159 ? HIS B 160 ? LEU B 162 HIS B 163 
N 2 ALA B 166 ? LEU B 167 ? ALA B 169 LEU B 170 
O 1 HIS B 214 ? PHE B 217 ? HIS B 217 PHE B 220 
O 2 LYS B 171 ? PHE B 180 ? LYS B 174 PHE B 183 
O 3 LYS B 237 ? GLN B 244 ? LYS B 240 GLN B 247 
O 4 ALA B 284 ? THR B 291 ? ALA B 287 THR B 294 
O 5 GLY B 258 ? TRP B 262 ? GLY B 261 TRP B 265 
O 6 ASP B 272 ? GLN B 275 ? ASP B 275 GLN B 278 
P 1 MET B 230 ? ALA B 233 ? MET B 233 ALA B 236 
P 2 ALA B 314 ? THR B 320 ? ALA B 317 THR B 323 
P 3 GLY B 296 ? VAL B 301 ? GLY B 299 VAL B 304 
Q 1 MET C 70  ? HIS C 73  ? MET C 73  HIS C 76  
Q 2 ILE C 151 ? LEU C 154 ? ILE C 154 LEU C 157 
Q 3 GLY C 127 ? PHE C 129 ? GLY C 130 PHE C 132 
R 1 ASP C 95  ? PHE C 96  ? ASP C 98  PHE C 99  
R 2 TYR C 131 ? HIS C 132 ? TYR C 134 HIS C 135 
S 1 LEU C 159 ? HIS C 160 ? LEU C 162 HIS C 163 
S 2 ALA C 166 ? LEU C 167 ? ALA C 169 LEU C 170 
T 1 HIS C 214 ? PHE C 217 ? HIS C 217 PHE C 220 
T 2 LYS C 171 ? PHE C 180 ? LYS C 174 PHE C 183 
T 3 LYS C 237 ? GLN C 244 ? LYS C 240 GLN C 247 
T 4 ALA C 284 ? THR C 291 ? ALA C 287 THR C 294 
T 5 GLY C 258 ? TRP C 262 ? GLY C 261 TRP C 265 
T 6 ASP C 272 ? GLN C 275 ? ASP C 275 GLN C 278 
U 1 MET C 230 ? ALA C 233 ? MET C 233 ALA C 236 
U 2 ALA C 314 ? THR C 320 ? ALA C 317 THR C 323 
U 3 GLY C 296 ? VAL C 301 ? GLY C 299 VAL C 304 
V 1 GLY D 14  ? GLU D 19  ? GLY D 14  GLU D 19  
V 2 ASN D 2   ? GLY D 11  ? ASN D 2   GLY D 11  
V 3 THR D 30  ? PRO D 35  ? THR D 30  PRO D 35  
V 4 TYR D 64  ? THR D 67  ? TYR D 64  THR D 67  
W 1 TYR D 22  ? ALA D 25  ? TYR D 22  ALA D 25  
W 2 ILE D 87  ? VAL D 92  ? ILE D 87  VAL D 92  
W 3 GLY D 72  ? LYS D 77  ? GLY D 72  LYS D 77  
W 4 GLU D 43  ? SER D 44  ? GLU D 43  SER D 44  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 12  ? N GLN A 15  O GLU A 37  ? O GLU A 40  
A 2 3 N GLU A 43  ? N GLU A 46  O ALA A 60  ? O ALA A 63  
B 1 2 N GLN A 12  ? N GLN A 15  O GLU A 37  ? O GLU A 40  
B 2 3 N VAL A 36  ? N VAL A 39  O GLU A 79  ? O GLU A 82  
B 3 4 N LEU A 80  ? N LEU A 83  O LEU A 119 ? O LEU A 122 
B 4 5 N ARG A 120 ? N ARG A 123 O THR B 329 ? O THR B 332 
C 1 2 N MET A 70  ? N MET A 73  O MET A 152 ? O MET A 155 
C 2 3 O ILE A 151 ? O ILE A 154 N PHE A 129 ? N PHE A 132 
D 1 2 N ASP A 95  ? N ASP A 98  O HIS A 132 ? O HIS A 135 
E 1 2 N LEU A 159 ? N LEU A 162 O LEU A 167 ? O LEU A 170 
F 1 2 O HIS A 214 ? O HIS A 217 N PHE A 180 ? N PHE A 183 
F 2 3 N VAL A 175 ? N VAL A 178 O VAL A 241 ? O VAL A 244 
F 3 4 N ILE A 240 ? N ILE A 243 O ALA A 288 ? O ALA A 291 
F 4 5 O PHE A 289 ? O PHE A 292 N TYR A 260 ? N TYR A 263 
F 5 6 N GLY A 258 ? N GLY A 261 O GLN A 275 ? O GLN A 278 
G 1 2 N ALA A 232 ? N ALA A 235 O LYS A 318 ? O LYS A 321 
G 2 3 O PHE A 317 ? O PHE A 320 N TYR A 298 ? N TYR A 301 
H 1 2 N THR A 329 ? N THR A 332 O ARG C 120 ? O ARG C 123 
H 2 3 O LEU C 119 ? O LEU C 122 N LEU C 80  ? N LEU C 83  
H 3 4 O GLU C 79  ? O GLU C 82  N VAL C 36  ? N VAL C 39  
H 4 5 O GLU C 37  ? O GLU C 40  N GLN C 12  ? N GLN C 15  
I 1 2 N THR A 329 ? N THR A 332 O ARG C 120 ? O ARG C 123 
I 2 3 O LEU C 119 ? O LEU C 122 N LEU C 80  ? N LEU C 83  
I 3 4 O GLU C 79  ? O GLU C 82  N VAL C 36  ? N VAL C 39  
I 4 5 N GLU C 43  ? N GLU C 46  O ALA C 60  ? O ALA C 63  
J 1 2 N GLN B 12  ? N GLN B 15  O GLU B 37  ? O GLU B 40  
J 2 3 N GLU B 43  ? N GLU B 46  O ALA B 60  ? O ALA B 63  
K 1 2 N GLN B 12  ? N GLN B 15  O GLU B 37  ? O GLU B 40  
K 2 3 N VAL B 36  ? N VAL B 39  O GLU B 79  ? O GLU B 82  
K 3 4 N LEU B 80  ? N LEU B 83  O LEU B 119 ? O LEU B 122 
K 4 5 N ARG B 120 ? N ARG B 123 O THR C 329 ? O THR C 332 
L 1 2 N MET B 70  ? N MET B 73  O MET B 152 ? O MET B 155 
L 2 3 O ILE B 151 ? O ILE B 154 N PHE B 129 ? N PHE B 132 
M 1 2 N ASP B 95  ? N ASP B 98  O HIS B 132 ? O HIS B 135 
N 1 2 N LEU B 159 ? N LEU B 162 O LEU B 167 ? O LEU B 170 
O 1 2 O HIS B 214 ? O HIS B 217 N PHE B 180 ? N PHE B 183 
O 2 3 N VAL B 175 ? N VAL B 178 O VAL B 241 ? O VAL B 244 
O 3 4 N ILE B 240 ? N ILE B 243 O ALA B 288 ? O ALA B 291 
O 4 5 O PHE B 289 ? O PHE B 292 N TYR B 260 ? N TYR B 263 
O 5 6 N GLY B 258 ? N GLY B 261 O GLN B 275 ? O GLN B 278 
P 1 2 N ALA B 232 ? N ALA B 235 O LYS B 318 ? O LYS B 321 
P 2 3 O PHE B 317 ? O PHE B 320 N TYR B 298 ? N TYR B 301 
Q 1 2 N MET C 70  ? N MET C 73  O MET C 152 ? O MET C 155 
Q 2 3 O ILE C 151 ? O ILE C 154 N PHE C 129 ? N PHE C 132 
R 1 2 N ASP C 95  ? N ASP C 98  O HIS C 132 ? O HIS C 135 
S 1 2 N LEU C 159 ? N LEU C 162 O LEU C 167 ? O LEU C 170 
T 1 2 O HIS C 214 ? O HIS C 217 N PHE C 180 ? N PHE C 183 
T 2 3 N VAL C 175 ? N VAL C 178 O VAL C 241 ? O VAL C 244 
T 3 4 N ILE C 240 ? N ILE C 243 O ALA C 288 ? O ALA C 291 
T 4 5 O PHE C 289 ? O PHE C 292 N TYR C 260 ? N TYR C 263 
T 5 6 N GLY C 258 ? N GLY C 261 O GLN C 275 ? O GLN C 278 
U 1 2 N MET C 230 ? N MET C 233 O LYS C 318 ? O LYS C 321 
U 2 3 O PHE C 317 ? O PHE C 320 N TYR C 298 ? N TYR C 301 
V 1 2 O GLU D 19  ? O GLU D 19  N HIS D 6   ? N HIS D 6   
V 2 3 N VAL D 5   ? N VAL D 5   O THR D 32  ? O THR D 32  
V 3 4 N VAL D 31  ? N VAL D 31  O LEU D 66  ? O LEU D 66  
W 1 2 N ILE D 23  ? N ILE D 23  O ALA D 91  ? O ALA D 91  
W 2 3 O ILE D 90  ? O ILE D 90  N TYR D 74  ? N TYR D 74  
W 3 4 O LYS D 77  ? O LYS D 77  N GLU D 43  ? N GLU D 43  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CU A 345' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CU A 346' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CU B 345' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CU B 346' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CU C 345' 
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CU C 346' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CU D 124' 
AC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE GD A 347' 
AC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE GD C 347' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 92  ? HIS A 95  . ? 1_555 ? 
2  AC1 4 CYS A 133 ? CYS A 136 . ? 1_555 ? 
3  AC1 4 HIS A 142 ? HIS A 145 . ? 1_555 ? 
4  AC1 4 MET A 147 ? MET A 150 . ? 1_555 ? 
5  AC2 3 HIS A 97  ? HIS A 100 . ? 1_555 ? 
6  AC2 3 HIS A 132 ? HIS A 135 . ? 1_555 ? 
7  AC2 3 HIS B 303 ? HIS B 306 . ? 1_555 ? 
8  AC3 4 HIS B 92  ? HIS B 95  . ? 1_555 ? 
9  AC3 4 CYS B 133 ? CYS B 136 . ? 1_555 ? 
10 AC3 4 HIS B 142 ? HIS B 145 . ? 1_555 ? 
11 AC3 4 MET B 147 ? MET B 150 . ? 1_555 ? 
12 AC4 3 HIS B 97  ? HIS B 100 . ? 1_555 ? 
13 AC4 3 HIS B 132 ? HIS B 135 . ? 1_555 ? 
14 AC4 3 HIS C 303 ? HIS C 306 . ? 1_555 ? 
15 AC5 4 HIS C 92  ? HIS C 95  . ? 1_555 ? 
16 AC5 4 CYS C 133 ? CYS C 136 . ? 1_555 ? 
17 AC5 4 HIS C 142 ? HIS C 145 . ? 1_555 ? 
18 AC5 4 MET C 147 ? MET C 150 . ? 1_555 ? 
19 AC6 3 HIS A 303 ? HIS A 306 . ? 1_555 ? 
20 AC6 3 HIS C 97  ? HIS C 100 . ? 1_555 ? 
21 AC6 3 HIS C 132 ? HIS C 135 . ? 1_555 ? 
22 AC7 4 HIS D 40  ? HIS D 40  . ? 1_555 ? 
23 AC7 4 CYS D 78  ? CYS D 78  . ? 1_555 ? 
24 AC7 4 HIS D 81  ? HIS D 81  . ? 1_555 ? 
25 AC7 4 MET D 86  ? MET D 86  . ? 1_555 ? 
26 AC8 1 LYS A 228 ? LYS A 231 . ? 1_555 ? 
27 AC9 1 LYS C 228 ? LYS C 231 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2P80 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2P80 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CU 
GD 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N  N    . THR A 1 2   ? -4.844  12.005 66.745 1.00 19.46  ? 5   THR A N    1  
ATOM   2      C  CA   . THR A 1 2   ? -4.559  11.454 68.110 1.00 18.41  ? 5   THR A CA   1  
ATOM   3      C  C    . THR A 1 2   ? -3.294  10.582 68.073 1.00 18.08  ? 5   THR A C    1  
ATOM   4      O  O    . THR A 1 2   ? -2.675  10.418 67.040 1.00 17.22  ? 5   THR A O    1  
ATOM   5      C  CB   . THR A 1 2   ? -5.746  10.606 68.572 1.00 19.10  ? 5   THR A CB   1  
ATOM   6      O  OG1  . THR A 1 2   ? -5.753  9.376  67.861 1.00 18.92  ? 5   THR A OG1  1  
ATOM   7      C  CG2  . THR A 1 2   ? -7.050  11.360 68.305 1.00 18.94  ? 5   THR A CG2  1  
ATOM   8      H  HA   . THR A 1 2   ? -4.411  12.270 68.801 1.00 0.00   ? 5   THR A HA   1  
ATOM   9      H  HB   . THR A 1 2   ? -5.659  10.410 69.630 1.00 0.00   ? 5   THR A HB   1  
ATOM   10     H  HG1  . THR A 1 2   ? -4.868  9.226  67.519 1.00 0.00   ? 5   THR A HG1  1  
ATOM   11     H  HG21 . THR A 1 2   ? -7.489  11.003 67.385 1.00 0.00   ? 5   THR A HG21 1  
ATOM   12     H  HG22 . THR A 1 2   ? -6.843  12.416 68.219 1.00 0.00   ? 5   THR A HG22 1  
ATOM   13     H  HG23 . THR A 1 2   ? -7.737  11.192 69.121 1.00 0.00   ? 5   THR A HG23 1  
ATOM   14     N  N    . ALA A 1 3   ? -2.903  10.020 69.195 1.00 17.34  ? 6   ALA A N    1  
ATOM   15     C  CA   . ALA A 1 3   ? -1.681  9.164  69.214 1.00 16.73  ? 6   ALA A CA   1  
ATOM   16     C  C    . ALA A 1 3   ? -1.908  7.891  68.383 1.00 16.24  ? 6   ALA A C    1  
ATOM   17     O  O    . ALA A 1 3   ? -1.051  7.475  67.628 1.00 16.53  ? 6   ALA A O    1  
ATOM   18     C  CB   . ALA A 1 3   ? -1.358  8.774  70.658 1.00 16.78  ? 6   ALA A CB   1  
ATOM   19     H  H    . ALA A 1 3   ? -3.414  10.163 70.019 1.00 0.00   ? 6   ALA A H    1  
ATOM   20     H  HA   . ALA A 1 3   ? -0.851  9.717  68.800 1.00 0.00   ? 6   ALA A HA   1  
ATOM   21     H  HB1  . ALA A 1 3   ? -1.700  9.552  71.325 1.00 0.00   ? 6   ALA A HB1  1  
ATOM   22     H  HB2  . ALA A 1 3   ? -0.291  8.649  70.767 1.00 0.00   ? 6   ALA A HB2  1  
ATOM   23     H  HB3  . ALA A 1 3   ? -1.856  7.847  70.900 1.00 0.00   ? 6   ALA A HB3  1  
ATOM   24     N  N    . ALA A 1 4   ? -3.046  7.262  68.522 1.00 15.76  ? 7   ALA A N    1  
ATOM   25     C  CA   . ALA A 1 4   ? -3.310  6.015  67.750 1.00 16.08  ? 7   ALA A CA   1  
ATOM   26     C  C    . ALA A 1 4   ? -3.269  6.320  66.254 1.00 15.69  ? 7   ALA A C    1  
ATOM   27     O  O    . ALA A 1 4   ? -2.759  5.549  65.466 1.00 17.24  ? 7   ALA A O    1  
ATOM   28     C  CB   . ALA A 1 4   ? -4.690  5.468  68.121 1.00 16.60  ? 7   ALA A CB   1  
ATOM   29     H  H    . ALA A 1 4   ? -3.722  7.606  69.142 1.00 0.00   ? 7   ALA A H    1  
ATOM   30     H  HA   . ALA A 1 4   ? -2.556  5.279  67.987 1.00 0.00   ? 7   ALA A HA   1  
ATOM   31     H  HB1  . ALA A 1 4   ? -4.628  4.944  69.063 1.00 0.00   ? 7   ALA A HB1  1  
ATOM   32     H  HB2  . ALA A 1 4   ? -5.026  4.788  67.352 1.00 0.00   ? 7   ALA A HB2  1  
ATOM   33     H  HB3  . ALA A 1 4   ? -5.389  6.286  68.209 1.00 0.00   ? 7   ALA A HB3  1  
ATOM   34     N  N    . GLU A 1 5   ? -3.805  7.438  65.858 1.00 15.45  ? 8   GLU A N    1  
ATOM   35     C  CA   . GLU A 1 5   ? -3.800  7.795  64.410 1.00 15.65  ? 8   GLU A CA   1  
ATOM   36     C  C    . GLU A 1 5   ? -2.358  7.949  63.916 1.00 15.72  ? 8   GLU A C    1  
ATOM   37     O  O    . GLU A 1 5   ? -1.996  7.450  62.869 1.00 16.30  ? 8   GLU A O    1  
ATOM   38     C  CB   . GLU A 1 5   ? -4.550  9.114  64.210 1.00 16.18  ? 8   GLU A CB   1  
ATOM   39     C  CG   . GLU A 1 5   ? -6.057  8.849  64.200 1.00 16.39  ? 8   GLU A CG   1  
ATOM   40     C  CD   . GLU A 1 5   ? -6.809  10.171 64.362 1.00 17.28  ? 8   GLU A CD   1  
ATOM   41     O  OE1  . GLU A 1 5   ? -6.154  11.183 64.547 1.00 17.60  ? 8   GLU A OE1  1  
ATOM   42     O  OE2  . GLU A 1 5   ? -8.027  10.148 64.299 1.00 18.54  ? 8   GLU A OE2  1  
ATOM   43     H  H    . GLU A 1 5   ? -4.213  8.045  66.511 1.00 0.00   ? 8   GLU A H    1  
ATOM   44     H  HA   . GLU A 1 5   ? -4.291  7.015  63.847 1.00 0.00   ? 8   GLU A HA   1  
ATOM   45     H  HB2  . GLU A 1 5   ? -4.308  9.791  65.016 1.00 0.00   ? 8   GLU A HB2  1  
ATOM   46     H  HB3  . GLU A 1 5   ? -4.258  9.554  63.268 1.00 0.00   ? 8   GLU A HB3  1  
ATOM   47     H  HG2  . GLU A 1 5   ? -6.334  8.388  63.263 1.00 0.00   ? 8   GLU A HG2  1  
ATOM   48     H  HG3  . GLU A 1 5   ? -6.312  8.189  65.015 1.00 0.00   ? 8   GLU A HG3  1  
ATOM   49     N  N    . ILE A 1 6   ? -1.533  8.641  64.655 1.00 15.48  ? 9   ILE A N    1  
ATOM   50     C  CA   . ILE A 1 6   ? -0.120  8.831  64.220 1.00 15.98  ? 9   ILE A CA   1  
ATOM   51     C  C    . ILE A 1 6   ? 0.587   7.476  64.164 1.00 15.55  ? 9   ILE A C    1  
ATOM   52     O  O    . ILE A 1 6   ? 1.333   7.192  63.248 1.00 15.92  ? 9   ILE A O    1  
ATOM   53     C  CB   . ILE A 1 6   ? 0.601   9.740  65.216 1.00 16.06  ? 9   ILE A CB   1  
ATOM   54     C  CG1  . ILE A 1 6   ? -0.057  11.122 65.212 1.00 17.14  ? 9   ILE A CG1  1  
ATOM   55     C  CG2  . ILE A 1 6   ? 2.071   9.876  64.812 1.00 17.24  ? 9   ILE A CG2  1  
ATOM   56     C  CD1  . ILE A 1 6   ? 0.384   11.902 66.452 1.00 18.43  ? 9   ILE A CD1  1  
ATOM   57     H  H    . ILE A 1 6   ? -1.845  9.040  65.494 1.00 0.00   ? 9   ILE A H    1  
ATOM   58     H  HA   . ILE A 1 6   ? -0.104  9.286  63.241 1.00 0.00   ? 9   ILE A HA   1  
ATOM   59     H  HB   . ILE A 1 6   ? 0.538   9.312  66.206 1.00 0.00   ? 9   ILE A HB   1  
ATOM   60     H  HG12 . ILE A 1 6   ? 0.240   11.660 64.323 1.00 0.00   ? 9   ILE A HG12 1  
ATOM   61     H  HG13 . ILE A 1 6   ? -1.131  11.010 65.222 1.00 0.00   ? 9   ILE A HG13 1  
ATOM   62     H  HG21 . ILE A 1 6   ? 2.504   10.730 65.312 1.00 0.00   ? 9   ILE A HG21 1  
ATOM   63     H  HG22 . ILE A 1 6   ? 2.139   10.012 63.743 1.00 0.00   ? 9   ILE A HG22 1  
ATOM   64     H  HG23 . ILE A 1 6   ? 2.606   8.983  65.097 1.00 0.00   ? 9   ILE A HG23 1  
ATOM   65     H  HD11 . ILE A 1 6   ? 0.985   12.747 66.151 1.00 0.00   ? 9   ILE A HD11 1  
ATOM   66     H  HD12 . ILE A 1 6   ? 0.964   11.257 67.095 1.00 0.00   ? 9   ILE A HD12 1  
ATOM   67     H  HD13 . ILE A 1 6   ? -0.488  12.252 66.985 1.00 0.00   ? 9   ILE A HD13 1  
ATOM   68     N  N    . ALA A 1 7   ? 0.362   6.638  65.137 1.00 15.92  ? 10  ALA A N    1  
ATOM   69     C  CA   . ALA A 1 7   ? 1.028   5.297  65.139 1.00 15.99  ? 10  ALA A CA   1  
ATOM   70     C  C    . ALA A 1 7   ? 0.468   4.382  64.026 1.00 15.79  ? 10  ALA A C    1  
ATOM   71     O  O    . ALA A 1 7   ? 1.113   3.434  63.623 1.00 16.45  ? 10  ALA A O    1  
ATOM   72     C  CB   . ALA A 1 7   ? 0.804   4.629  66.497 1.00 16.22  ? 10  ALA A CB   1  
ATOM   73     H  H    . ALA A 1 7   ? -0.241  6.887  65.868 1.00 0.00   ? 10  ALA A H    1  
ATOM   74     H  HA   . ALA A 1 7   ? 2.089   5.431  64.985 1.00 0.00   ? 10  ALA A HA   1  
ATOM   75     H  HB1  . ALA A 1 7   ? 0.328   5.329  67.168 1.00 0.00   ? 10  ALA A HB1  1  
ATOM   76     H  HB2  . ALA A 1 7   ? 1.754   4.324  66.909 1.00 0.00   ? 10  ALA A HB2  1  
ATOM   77     H  HB3  . ALA A 1 7   ? 0.171   3.763  66.371 1.00 0.00   ? 10  ALA A HB3  1  
ATOM   78     N  N    . ALA A 1 8   ? -0.722  4.634  63.536 1.00 15.71  ? 11  ALA A N    1  
ATOM   79     C  CA   . ALA A 1 8   ? -1.295  3.751  62.472 1.00 15.74  ? 11  ALA A CA   1  
ATOM   80     C  C    . ALA A 1 8   ? -0.872  4.207  61.060 1.00 15.57  ? 11  ALA A C    1  
ATOM   81     O  O    . ALA A 1 8   ? -1.112  3.513  60.092 1.00 16.18  ? 11  ALA A O    1  
ATOM   82     C  CB   . ALA A 1 8   ? -2.821  3.779  62.569 1.00 16.29  ? 11  ALA A CB   1  
ATOM   83     H  H    . ALA A 1 8   ? -1.241  5.393  63.875 1.00 0.00   ? 11  ALA A H    1  
ATOM   84     H  HA   . ALA A 1 8   ? -0.953  2.740  62.632 1.00 0.00   ? 11  ALA A HA   1  
ATOM   85     H  HB1  . ALA A 1 8   ? -3.186  4.737  62.229 1.00 0.00   ? 11  ALA A HB1  1  
ATOM   86     H  HB2  . ALA A 1 8   ? -3.120  3.624  63.595 1.00 0.00   ? 11  ALA A HB2  1  
ATOM   87     H  HB3  . ALA A 1 8   ? -3.236  2.996  61.951 1.00 0.00   ? 11  ALA A HB3  1  
ATOM   88     N  N    . LEU A 1 9   ? -0.259  5.355  60.916 1.00 14.72  ? 12  LEU A N    1  
ATOM   89     C  CA   . LEU A 1 9   ? 0.147   5.809  59.545 1.00 15.46  ? 12  LEU A CA   1  
ATOM   90     C  C    . LEU A 1 9   ? 1.197   4.851  58.962 1.00 15.27  ? 12  LEU A C    1  
ATOM   91     O  O    . LEU A 1 9   ? 2.086   4.403  59.658 1.00 15.49  ? 12  LEU A O    1  
ATOM   92     C  CB   . LEU A 1 9   ? 0.738   7.218  59.632 1.00 14.95  ? 12  LEU A CB   1  
ATOM   93     C  CG   . LEU A 1 9   ? -0.324  8.187  60.154 1.00 17.25  ? 12  LEU A CG   1  
ATOM   94     C  CD1  . LEU A 1 9   ? 0.314   9.552  60.415 1.00 17.75  ? 12  LEU A CD1  1  
ATOM   95     C  CD2  . LEU A 1 9   ? -1.433  8.335  59.110 1.00 18.70  ? 12  LEU A CD2  1  
ATOM   96     H  H    . LEU A 1 9   ? -0.072  5.916  61.697 1.00 0.00   ? 12  LEU A H    1  
ATOM   97     H  HA   . LEU A 1 9   ? -0.721  5.824  58.902 1.00 0.00   ? 12  LEU A HA   1  
ATOM   98     H  HB2  . LEU A 1 9   ? 1.583   7.212  60.306 1.00 0.00   ? 12  LEU A HB2  1  
ATOM   99     H  HB3  . LEU A 1 9   ? 1.061   7.534  58.652 1.00 0.00   ? 12  LEU A HB3  1  
ATOM   100    H  HG   . LEU A 1 9   ? -0.741  7.802  61.074 1.00 0.00   ? 12  LEU A HG   1  
ATOM   101    H  HD11 . LEU A 1 9   ? 0.504   9.664  61.472 1.00 0.00   ? 12  LEU A HD11 1  
ATOM   102    H  HD12 . LEU A 1 9   ? -0.356  10.332 60.085 1.00 0.00   ? 12  LEU A HD12 1  
ATOM   103    H  HD13 . LEU A 1 9   ? 1.245   9.624  59.872 1.00 0.00   ? 12  LEU A HD13 1  
ATOM   104    H  HD21 . LEU A 1 9   ? -1.215  7.705  58.260 1.00 0.00   ? 12  LEU A HD21 1  
ATOM   105    H  HD22 . LEU A 1 9   ? -1.491  9.364  58.789 1.00 0.00   ? 12  LEU A HD22 1  
ATOM   106    H  HD23 . LEU A 1 9   ? -2.377  8.040  59.544 1.00 0.00   ? 12  LEU A HD23 1  
ATOM   107    N  N    . PRO A 1 10  ? 1.097   4.541  57.686 1.00 15.69  ? 13  PRO A N    1  
ATOM   108    C  CA   . PRO A 1 10  ? 2.066   3.620  57.005 1.00 15.55  ? 13  PRO A CA   1  
ATOM   109    C  C    . PRO A 1 10  ? 3.510   4.175  56.949 1.00 15.04  ? 13  PRO A C    1  
ATOM   110    O  O    . PRO A 1 10  ? 3.735   5.306  56.569 1.00 15.44  ? 13  PRO A O    1  
ATOM   111    C  CB   . PRO A 1 10  ? 1.507   3.475  55.582 1.00 16.24  ? 13  PRO A CB   1  
ATOM   112    C  CG   . PRO A 1 10  ? 0.113   4.019  55.621 1.00 18.29  ? 13  PRO A CG   1  
ATOM   113    C  CD   . PRO A 1 10  ? 0.063   5.024  56.768 1.00 15.94  ? 13  PRO A CD   1  
ATOM   114    H  HA   . PRO A 1 10  ? 2.060   2.656  57.487 1.00 0.00   ? 13  PRO A HA   1  
ATOM   115    H  HB2  . PRO A 1 10  ? 2.111   4.042  54.887 1.00 0.00   ? 13  PRO A HB2  1  
ATOM   116    H  HB3  . PRO A 1 10  ? 1.486   2.435  55.294 1.00 0.00   ? 13  PRO A HB3  1  
ATOM   117    H  HG2  . PRO A 1 10  ? -0.117  4.510  54.684 1.00 0.00   ? 13  PRO A HG2  1  
ATOM   118    H  HG3  . PRO A 1 10  ? -0.591  3.223  55.805 1.00 0.00   ? 13  PRO A HG3  1  
ATOM   119    H  HD2  . PRO A 1 10  ? 0.299   6.019  56.412 1.00 0.00   ? 13  PRO A HD2  1  
ATOM   120    H  HD3  . PRO A 1 10  ? -0.902  5.008  57.249 1.00 0.00   ? 13  PRO A HD3  1  
ATOM   121    N  N    . ARG A 1 11  ? 4.487   3.366  57.305 1.00 14.90  ? 14  ARG A N    1  
ATOM   122    C  CA   . ARG A 1 11  ? 5.900   3.807  57.255 1.00 15.23  ? 14  ARG A CA   1  
ATOM   123    C  C    . ARG A 1 11  ? 6.505   3.249  55.973 1.00 15.70  ? 14  ARG A C    1  
ATOM   124    O  O    . ARG A 1 11  ? 6.293   2.105  55.622 1.00 17.69  ? 14  ARG A O    1  
ATOM   125    C  CB   . ARG A 1 11  ? 6.658   3.261  58.467 1.00 15.73  ? 14  ARG A CB   1  
ATOM   126    C  CG   . ARG A 1 11  ? 7.082   4.422  59.369 1.00 15.42  ? 14  ARG A CG   1  
ATOM   127    C  CD   . ARG A 1 11  ? 6.234   4.416  60.642 1.00 15.94  ? 14  ARG A CD   1  
ATOM   128    N  NE   . ARG A 1 11  ? 5.028   5.268  60.441 1.00 15.20  ? 14  ARG A NE   1  
ATOM   129    C  CZ   . ARG A 1 11  ? 4.381   5.737  61.472 1.00 14.69  ? 14  ARG A CZ   1  
ATOM   130    N  NH1  . ARG A 1 11  ? 4.789   5.459  62.680 1.00 16.13  ? 14  ARG A NH1  1  
ATOM   131    N  NH2  . ARG A 1 11  ? 3.325   6.484  61.296 1.00 15.45  ? 14  ARG A NH2  1  
ATOM   132    H  H    . ARG A 1 11  ? 4.277   2.452  57.590 1.00 0.00   ? 14  ARG A H    1  
ATOM   133    H  HA   . ARG A 1 11  ? 5.948   4.886  57.244 1.00 0.00   ? 14  ARG A HA   1  
ATOM   134    H  HB2  . ARG A 1 11  ? 6.017   2.590  59.020 1.00 0.00   ? 14  ARG A HB2  1  
ATOM   135    H  HB3  . ARG A 1 11  ? 7.536   2.729  58.134 1.00 0.00   ? 14  ARG A HB3  1  
ATOM   136    H  HG2  . ARG A 1 11  ? 8.125   4.313  59.630 1.00 0.00   ? 14  ARG A HG2  1  
ATOM   137    H  HG3  . ARG A 1 11  ? 6.936   5.356  58.847 1.00 0.00   ? 14  ARG A HG3  1  
ATOM   138    H  HD2  . ARG A 1 11  ? 5.926   3.405  60.865 1.00 0.00   ? 14  ARG A HD2  1  
ATOM   139    H  HD3  . ARG A 1 11  ? 6.816   4.804  61.465 1.00 0.00   ? 14  ARG A HD3  1  
ATOM   140    H  HE   . ARG A 1 11  ? 4.722   5.477  59.534 1.00 0.00   ? 14  ARG A HE   1  
ATOM   141    H  HH11 . ARG A 1 11  ? 5.598   4.887  62.816 1.00 0.00   ? 14  ARG A HH11 1  
ATOM   142    H  HH12 . ARG A 1 11  ? 4.293   5.818  63.471 1.00 0.00   ? 14  ARG A HH12 1  
ATOM   143    H  HH21 . ARG A 1 11  ? 3.013   6.697  60.370 1.00 0.00   ? 14  ARG A HH21 1  
ATOM   144    H  HH22 . ARG A 1 11  ? 2.829   6.843  62.086 1.00 0.00   ? 14  ARG A HH22 1  
ATOM   145    N  N    . GLN A 1 12  ? 7.225   4.048  55.256 1.00 15.45  ? 15  GLN A N    1  
ATOM   146    C  CA   . GLN A 1 12  ? 7.808   3.571  53.980 1.00 15.82  ? 15  GLN A CA   1  
ATOM   147    C  C    . GLN A 1 12  ? 9.249   4.043  53.868 1.00 14.75  ? 15  GLN A C    1  
ATOM   148    O  O    . GLN A 1 12  ? 9.546   5.218  53.953 1.00 14.27  ? 15  GLN A O    1  
ATOM   149    C  CB   . GLN A 1 12  ? 6.996   4.129  52.809 1.00 16.90  ? 15  GLN A CB   1  
ATOM   150    C  CG   . GLN A 1 12  ? 7.751   3.882  51.501 1.00 20.56  ? 15  GLN A CG   1  
ATOM   151    C  CD   . GLN A 1 12  ? 7.077   4.659  50.368 1.00 26.39  ? 15  GLN A CD   1  
ATOM   152    O  OE1  . GLN A 1 12  ? 7.119   4.249  49.226 1.00 31.29  ? 15  GLN A OE1  1  
ATOM   153    N  NE2  . GLN A 1 12  ? 6.454   5.773  50.639 1.00 29.32  ? 15  GLN A NE2  1  
ATOM   154    H  H    . GLN A 1 12  ? 7.364   4.975  55.543 1.00 0.00   ? 15  GLN A H    1  
ATOM   155    H  HA   . GLN A 1 12  ? 7.780   2.492  53.953 1.00 0.00   ? 15  GLN A HA   1  
ATOM   156    H  HB2  . GLN A 1 12  ? 6.036   3.635  52.770 1.00 0.00   ? 15  GLN A HB2  1  
ATOM   157    H  HB3  . GLN A 1 12  ? 6.851   5.190  52.944 1.00 0.00   ? 15  GLN A HB3  1  
ATOM   158    H  HG2  . GLN A 1 12  ? 8.774   4.213  51.608 1.00 0.00   ? 15  GLN A HG2  1  
ATOM   159    H  HG3  . GLN A 1 12  ? 7.736   2.828  51.270 1.00 0.00   ? 15  GLN A HG3  1  
ATOM   160    H  HE21 . GLN A 1 12  ? 6.420   6.105  51.560 1.00 0.00   ? 15  GLN A HE21 1  
ATOM   161    H  HE22 . GLN A 1 12  ? 6.020   6.279  49.920 1.00 0.00   ? 15  GLN A HE22 1  
ATOM   162    N  N    . LYS A 1 13  ? 10.139  3.127  53.674 1.00 14.54  ? 16  LYS A N    1  
ATOM   163    C  CA   . LYS A 1 13  ? 11.570  3.480  53.547 1.00 15.22  ? 16  LYS A CA   1  
ATOM   164    C  C    . LYS A 1 13  ? 11.856  3.854  52.099 1.00 14.52  ? 16  LYS A C    1  
ATOM   165    O  O    . LYS A 1 13  ? 11.285  3.309  51.175 1.00 16.82  ? 16  LYS A O    1  
ATOM   166    C  CB   . LYS A 1 13  ? 12.433  2.281  53.948 1.00 16.02  ? 16  LYS A CB   1  
ATOM   167    C  CG   . LYS A 1 13  ? 12.016  1.794  55.337 1.00 20.72  ? 16  LYS A CG   1  
ATOM   168    C  CD   . LYS A 1 13  ? 12.741  0.485  55.658 1.00 25.48  ? 16  LYS A CD   1  
ATOM   169    C  CE   . LYS A 1 13  ? 12.295  -0.022 57.031 1.00 28.67  ? 16  LYS A CE   1  
ATOM   170    N  NZ   . LYS A 1 13  ? 12.708  0.953  58.079 1.00 31.31  ? 16  LYS A NZ   1  
ATOM   171    H  H    . LYS A 1 13  ? 9.863   2.189  53.608 1.00 0.00   ? 16  LYS A H    1  
ATOM   172    H  HA   . LYS A 1 13  ? 11.795  4.319  54.189 1.00 0.00   ? 16  LYS A HA   1  
ATOM   173    H  HB2  . LYS A 1 13  ? 12.297  1.485  53.230 1.00 0.00   ? 16  LYS A HB2  1  
ATOM   174    H  HB3  . LYS A 1 13  ? 13.471  2.575  53.969 1.00 0.00   ? 16  LYS A HB3  1  
ATOM   175    H  HG2  . LYS A 1 13  ? 12.275  2.541  56.073 1.00 0.00   ? 16  LYS A HG2  1  
ATOM   176    H  HG3  . LYS A 1 13  ? 10.949  1.625  55.354 1.00 0.00   ? 16  LYS A HG3  1  
ATOM   177    H  HD2  . LYS A 1 13  ? 12.502  -0.252 54.905 1.00 0.00   ? 16  LYS A HD2  1  
ATOM   178    H  HD3  . LYS A 1 13  ? 13.806  0.657  55.669 1.00 0.00   ? 16  LYS A HD3  1  
ATOM   179    H  HE2  . LYS A 1 13  ? 11.220  -0.130 57.043 1.00 0.00   ? 16  LYS A HE2  1  
ATOM   180    H  HE3  . LYS A 1 13  ? 12.755  -0.979 57.227 1.00 0.00   ? 16  LYS A HE3  1  
ATOM   181    H  HZ1  . LYS A 1 13  ? 13.577  1.438  57.778 1.00 0.00   ? 16  LYS A HZ1  1  
ATOM   182    H  HZ2  . LYS A 1 13  ? 12.886  0.449  58.971 1.00 0.00   ? 16  LYS A HZ2  1  
ATOM   183    H  HZ3  . LYS A 1 13  ? 11.950  1.652  58.220 1.00 0.00   ? 16  LYS A HZ3  1  
ATOM   184    N  N    . VAL A 1 14  ? 12.730  4.785  51.900 1.00 13.33  ? 17  VAL A N    1  
ATOM   185    C  CA   . VAL A 1 14  ? 13.066  5.223  50.522 1.00 13.47  ? 17  VAL A CA   1  
ATOM   186    C  C    . VAL A 1 14  ? 14.586  5.271  50.358 1.00 13.20  ? 17  VAL A C    1  
ATOM   187    O  O    . VAL A 1 14  ? 15.304  5.770  51.201 1.00 15.44  ? 17  VAL A O    1  
ATOM   188    C  CB   . VAL A 1 14  ? 12.482  6.615  50.273 1.00 14.08  ? 17  VAL A CB   1  
ATOM   189    C  CG1  . VAL A 1 14  ? 13.100  7.209  49.006 1.00 15.57  ? 17  VAL A CG1  1  
ATOM   190    C  CG2  . VAL A 1 14  ? 10.966  6.506  50.097 1.00 16.17  ? 17  VAL A CG2  1  
ATOM   191    H  H    . VAL A 1 14  ? 13.169  5.210  52.666 1.00 0.00   ? 17  VAL A H    1  
ATOM   192    H  HA   . VAL A 1 14  ? 12.649  4.526  49.811 1.00 0.00   ? 17  VAL A HA   1  
ATOM   193    H  HB   . VAL A 1 14  ? 12.705  7.254  51.115 1.00 0.00   ? 17  VAL A HB   1  
ATOM   194    H  HG11 . VAL A 1 14  ? 14.132  7.464  49.194 1.00 0.00   ? 17  VAL A HG11 1  
ATOM   195    H  HG12 . VAL A 1 14  ? 12.555  8.097  48.722 1.00 0.00   ? 17  VAL A HG12 1  
ATOM   196    H  HG13 . VAL A 1 14  ? 13.048  6.484  48.207 1.00 0.00   ? 17  VAL A HG13 1  
ATOM   197    H  HG21 . VAL A 1 14  ? 10.704  6.739  49.076 1.00 0.00   ? 17  VAL A HG21 1  
ATOM   198    H  HG22 . VAL A 1 14  ? 10.476  7.202  50.762 1.00 0.00   ? 17  VAL A HG22 1  
ATOM   199    H  HG23 . VAL A 1 14  ? 10.648  5.501  50.330 1.00 0.00   ? 17  VAL A HG23 1  
ATOM   200    N  N    . GLU A 1 15  ? 15.068  4.751  49.272 1.00 11.94  ? 18  GLU A N    1  
ATOM   201    C  CA   . GLU A 1 15  ? 16.518  4.741  49.006 1.00 12.38  ? 18  GLU A CA   1  
ATOM   202    C  C    . GLU A 1 15  ? 16.871  6.086  48.423 1.00 11.64  ? 18  GLU A C    1  
ATOM   203    O  O    . GLU A 1 15  ? 16.182  6.607  47.569 1.00 11.81  ? 18  GLU A O    1  
ATOM   204    C  CB   . GLU A 1 15  ? 16.857  3.633  48.006 1.00 12.72  ? 18  GLU A CB   1  
ATOM   205    C  CG   . GLU A 1 15  ? 16.555  2.270  48.631 1.00 14.61  ? 18  GLU A CG   1  
ATOM   206    C  CD   . GLU A 1 15  ? 16.712  1.177  47.573 1.00 17.32  ? 18  GLU A CD   1  
ATOM   207    O  OE1  . GLU A 1 15  ? 16.488  1.469  46.410 1.00 18.76  ? 18  GLU A OE1  1  
ATOM   208    O  OE2  . GLU A 1 15  ? 17.054  0.066  47.943 1.00 23.35  ? 18  GLU A OE2  1  
ATOM   209    H  H    . GLU A 1 15  ? 14.456  4.358  48.615 1.00 0.00   ? 18  GLU A H    1  
ATOM   210    H  HA   . GLU A 1 15  ? 17.060  4.585  49.928 1.00 0.00   ? 18  GLU A HA   1  
ATOM   211    H  HB2  . GLU A 1 15  ? 16.261  3.761  47.113 1.00 0.00   ? 18  GLU A HB2  1  
ATOM   212    H  HB3  . GLU A 1 15  ? 17.904  3.686  47.751 1.00 0.00   ? 18  GLU A HB3  1  
ATOM   213    H  HG2  . GLU A 1 15  ? 17.243  2.087  49.444 1.00 0.00   ? 18  GLU A HG2  1  
ATOM   214    H  HG3  . GLU A 1 15  ? 15.543  2.262  49.007 1.00 0.00   ? 18  GLU A HG3  1  
ATOM   215    N  N    . LEU A 1 16  ? 17.909  6.672  48.895 1.00 10.90  ? 19  LEU A N    1  
ATOM   216    C  CA   . LEU A 1 16  ? 18.277  8.032  48.379 1.00 10.51  ? 19  LEU A CA   1  
ATOM   217    C  C    . LEU A 1 16  ? 19.374  7.949  47.311 1.00 10.57  ? 19  LEU A C    1  
ATOM   218    O  O    . LEU A 1 16  ? 20.209  7.067  47.329 1.00 11.64  ? 19  LEU A O    1  
ATOM   219    C  CB   . LEU A 1 16  ? 18.775  8.891  49.543 1.00 10.72  ? 19  LEU A CB   1  
ATOM   220    C  CG   . LEU A 1 16  ? 17.609  9.202  50.484 1.00 11.44  ? 19  LEU A CG   1  
ATOM   221    C  CD1  . LEU A 1 16  ? 18.135  9.366  51.911 1.00 12.35  ? 19  LEU A CD1  1  
ATOM   222    C  CD2  . LEU A 1 16  ? 16.929  10.498 50.040 1.00 12.55  ? 19  LEU A CD2  1  
ATOM   223    H  H    . LEU A 1 16  ? 18.438  6.250  49.604 1.00 0.00   ? 19  LEU A H    1  
ATOM   224    H  HA   . LEU A 1 16  ? 17.401  8.496  47.951 1.00 0.00   ? 19  LEU A HA   1  
ATOM   225    H  HB2  . LEU A 1 16  ? 19.542  8.355  50.083 1.00 0.00   ? 19  LEU A HB2  1  
ATOM   226    H  HB3  . LEU A 1 16  ? 19.182  9.815  49.161 1.00 0.00   ? 19  LEU A HB3  1  
ATOM   227    H  HG   . LEU A 1 16  ? 16.897  8.390  50.454 1.00 0.00   ? 19  LEU A HG   1  
ATOM   228    H  HD11 . LEU A 1 16  ? 19.195  9.164  51.930 1.00 0.00   ? 19  LEU A HD11 1  
ATOM   229    H  HD12 . LEU A 1 16  ? 17.624  8.674  52.564 1.00 0.00   ? 19  LEU A HD12 1  
ATOM   230    H  HD13 . LEU A 1 16  ? 17.955  10.377 52.247 1.00 0.00   ? 19  LEU A HD13 1  
ATOM   231    H  HD21 . LEU A 1 16  ? 17.301  10.785 49.067 1.00 0.00   ? 19  LEU A HD21 1  
ATOM   232    H  HD22 . LEU A 1 16  ? 17.144  11.281 50.753 1.00 0.00   ? 19  LEU A HD22 1  
ATOM   233    H  HD23 . LEU A 1 16  ? 15.861  10.345 49.986 1.00 0.00   ? 19  LEU A HD23 1  
ATOM   234    N  N    . VAL A 1 17  ? 19.389  8.886  46.386 1.00 10.50  ? 20  VAL A N    1  
ATOM   235    C  CA   . VAL A 1 17  ? 20.426  8.879  45.351 1.00 12.22  ? 20  VAL A CA   1  
ATOM   236    C  C    . VAL A 1 17  ? 21.378  10.005 45.682 1.00 11.38  ? 20  VAL A C    1  
ATOM   237    O  O    . VAL A 1 17  ? 21.256  10.655 46.701 1.00 11.51  ? 20  VAL A O    1  
ATOM   238    C  CB   . VAL A 1 17  ? 19.796  9.114  43.977 1.00 14.90  ? 20  VAL A CB   1  
ATOM   239    C  CG1  . VAL A 1 17  ? 18.886  7.936  43.624 1.00 15.01  ? 20  VAL A CG1  1  
ATOM   240    C  CG2  . VAL A 1 17  ? 18.971  10.402 44.010 1.00 16.47  ? 20  VAL A CG2  1  
ATOM   241    H  H    . VAL A 1 17  ? 18.716  9.598  46.400 1.00 0.00   ? 20  VAL A H    1  
ATOM   242    H  HA   . VAL A 1 17  ? 20.952  7.935  45.362 1.00 0.00   ? 20  VAL A HA   1  
ATOM   243    H  HB   . VAL A 1 17  ? 20.575  9.201  43.234 1.00 0.00   ? 20  VAL A HB   1  
ATOM   244    H  HG11 . VAL A 1 17  ? 19.434  7.012  43.736 1.00 0.00   ? 20  VAL A HG11 1  
ATOM   245    H  HG12 . VAL A 1 17  ? 18.550  8.034  42.603 1.00 0.00   ? 20  VAL A HG12 1  
ATOM   246    H  HG13 . VAL A 1 17  ? 18.032  7.930  44.286 1.00 0.00   ? 20  VAL A HG13 1  
ATOM   247    H  HG21 . VAL A 1 17  ? 18.185  10.345 43.271 1.00 0.00   ? 20  VAL A HG21 1  
ATOM   248    H  HG22 . VAL A 1 17  ? 19.610  11.245 43.791 1.00 0.00   ? 20  VAL A HG22 1  
ATOM   249    H  HG23 . VAL A 1 17  ? 18.535  10.526 44.990 1.00 0.00   ? 20  VAL A HG23 1  
ATOM   250    N  N    . ASP A 1 18  ? 22.312  10.250 44.845 1.00 10.54  ? 21  ASP A N    1  
ATOM   251    C  CA   . ASP A 1 18  ? 23.277  11.360 45.124 1.00 10.44  ? 21  ASP A CA   1  
ATOM   252    C  C    . ASP A 1 18  ? 23.046  12.515 44.138 1.00 9.71   ? 21  ASP A C    1  
ATOM   253    O  O    . ASP A 1 18  ? 22.813  12.297 42.966 1.00 10.44  ? 21  ASP A O    1  
ATOM   254    C  CB   . ASP A 1 18  ? 24.708  10.840 44.970 1.00 11.27  ? 21  ASP A CB   1  
ATOM   255    C  CG   . ASP A 1 18  ? 24.923  9.652  45.910 1.00 14.20  ? 21  ASP A CG   1  
ATOM   256    O  OD1  . ASP A 1 18  ? 24.203  9.560  46.890 1.00 15.24  ? 21  ASP A OD1  1  
ATOM   257    O  OD2  . ASP A 1 18  ? 25.804  8.855  45.633 1.00 18.07  ? 21  ASP A OD2  1  
ATOM   258    H  H    . ASP A 1 18  ? 22.393  9.719  44.026 1.00 0.00   ? 21  ASP A H    1  
ATOM   259    H  HA   . ASP A 1 18  ? 23.132  11.716 46.133 1.00 0.00   ? 21  ASP A HA   1  
ATOM   260    H  HB2  . ASP A 1 18  ? 24.868  10.526 43.948 1.00 0.00   ? 21  ASP A HB2  1  
ATOM   261    H  HB3  . ASP A 1 18  ? 25.405  11.625 45.219 1.00 0.00   ? 21  ASP A HB3  1  
ATOM   262    N  N    . PRO A 1 19  ? 23.120  13.739 44.611 1.00 9.37   ? 22  PRO A N    1  
ATOM   263    C  CA   . PRO A 1 19  ? 22.925  14.938 43.754 1.00 9.41   ? 22  PRO A CA   1  
ATOM   264    C  C    . PRO A 1 19  ? 23.729  14.841 42.454 1.00 9.21   ? 22  PRO A C    1  
ATOM   265    O  O    . PRO A 1 19  ? 24.731  14.157 42.385 1.00 9.01   ? 22  PRO A O    1  
ATOM   266    C  CB   . PRO A 1 19  ? 23.437  16.091 44.618 1.00 9.17   ? 22  PRO A CB   1  
ATOM   267    C  CG   . PRO A 1 19  ? 23.290  15.626 46.030 1.00 12.60  ? 22  PRO A CG   1  
ATOM   268    C  CD   . PRO A 1 19  ? 23.397  14.099 46.010 1.00 9.57   ? 22  PRO A CD   1  
ATOM   269    H  HA   . PRO A 1 19  ? 21.879  15.082 43.540 1.00 0.00   ? 22  PRO A HA   1  
ATOM   270    H  HB2  . PRO A 1 19  ? 24.476  16.293 44.394 1.00 0.00   ? 22  PRO A HB2  1  
ATOM   271    H  HB3  . PRO A 1 19  ? 22.839  16.975 44.458 1.00 0.00   ? 22  PRO A HB3  1  
ATOM   272    H  HG2  . PRO A 1 19  ? 24.078  16.047 46.641 1.00 0.00   ? 22  PRO A HG2  1  
ATOM   273    H  HG3  . PRO A 1 19  ? 22.326  15.915 46.417 1.00 0.00   ? 22  PRO A HG3  1  
ATOM   274    H  HD2  . PRO A 1 19  ? 24.393  13.787 46.294 1.00 0.00   ? 22  PRO A HD2  1  
ATOM   275    H  HD3  . PRO A 1 19  ? 22.659  13.657 46.661 1.00 0.00   ? 22  PRO A HD3  1  
ATOM   276    N  N    . PRO A 1 20  ? 23.289  15.522 41.434 1.00 9.29   ? 23  PRO A N    1  
ATOM   277    C  CA   . PRO A 1 20  ? 22.064  16.369 41.488 1.00 8.98   ? 23  PRO A CA   1  
ATOM   278    C  C    . PRO A 1 20  ? 20.771  15.572 41.251 1.00 8.63   ? 23  PRO A C    1  
ATOM   279    O  O    . PRO A 1 20  ? 19.690  16.126 41.217 1.00 9.23   ? 23  PRO A O    1  
ATOM   280    C  CB   . PRO A 1 20  ? 22.287  17.366 40.354 1.00 9.70   ? 23  PRO A CB   1  
ATOM   281    C  CG   . PRO A 1 20  ? 23.125  16.641 39.348 1.00 9.97   ? 23  PRO A CG   1  
ATOM   282    C  CD   . PRO A 1 20  ? 23.917  15.566 40.105 1.00 9.64   ? 23  PRO A CD   1  
ATOM   283    H  HA   . PRO A 1 20  ? 22.013  16.898 42.425 1.00 0.00   ? 23  PRO A HA   1  
ATOM   284    H  HB2  . PRO A 1 20  ? 21.340  17.654 39.919 1.00 0.00   ? 23  PRO A HB2  1  
ATOM   285    H  HB3  . PRO A 1 20  ? 22.815  18.234 40.716 1.00 0.00   ? 23  PRO A HB3  1  
ATOM   286    H  HG2  . PRO A 1 20  ? 22.489  16.179 38.605 1.00 0.00   ? 23  PRO A HG2  1  
ATOM   287    H  HG3  . PRO A 1 20  ? 23.809  17.327 38.874 1.00 0.00   ? 23  PRO A HG3  1  
ATOM   288    H  HD2  . PRO A 1 20  ? 23.824  14.610 39.608 1.00 0.00   ? 23  PRO A HD2  1  
ATOM   289    H  HD3  . PRO A 1 20  ? 24.954  15.850 40.192 1.00 0.00   ? 23  PRO A HD3  1  
ATOM   290    N  N    . PHE A 1 21  ? 20.871  14.281 41.083 1.00 9.14   ? 24  PHE A N    1  
ATOM   291    C  CA   . PHE A 1 21  ? 19.660  13.465 40.847 1.00 9.46   ? 24  PHE A CA   1  
ATOM   292    C  C    . PHE A 1 21  ? 18.764  13.494 42.085 1.00 9.73   ? 24  PHE A C    1  
ATOM   293    O  O    . PHE A 1 21  ? 19.114  14.025 43.120 1.00 10.27  ? 24  PHE A O    1  
ATOM   294    C  CB   . PHE A 1 21  ? 20.069  12.021 40.549 1.00 9.66   ? 24  PHE A CB   1  
ATOM   295    C  CG   . PHE A 1 21  ? 20.904  11.983 39.292 1.00 11.36  ? 24  PHE A CG   1  
ATOM   296    C  CD1  . PHE A 1 21  ? 20.284  12.043 38.038 1.00 12.93  ? 24  PHE A CD1  1  
ATOM   297    C  CD2  . PHE A 1 21  ? 22.298  11.888 39.380 1.00 12.68  ? 24  PHE A CD2  1  
ATOM   298    C  CE1  . PHE A 1 21  ? 21.058  12.008 36.872 1.00 14.07  ? 24  PHE A CE1  1  
ATOM   299    C  CE2  . PHE A 1 21  ? 23.072  11.853 38.214 1.00 14.73  ? 24  PHE A CE2  1  
ATOM   300    C  CZ   . PHE A 1 21  ? 22.452  11.913 36.960 1.00 13.93  ? 24  PHE A CZ   1  
ATOM   301    H  H    . PHE A 1 21  ? 21.752  13.852 41.111 1.00 0.00   ? 24  PHE A H    1  
ATOM   302    H  HA   . PHE A 1 21  ? 19.117  13.863 40.003 1.00 0.00   ? 24  PHE A HA   1  
ATOM   303    H  HB2  . PHE A 1 21  ? 20.645  11.633 41.377 1.00 0.00   ? 24  PHE A HB2  1  
ATOM   304    H  HB3  . PHE A 1 21  ? 19.185  11.417 40.412 1.00 0.00   ? 24  PHE A HB3  1  
ATOM   305    H  HD1  . PHE A 1 21  ? 19.208  12.116 37.970 1.00 0.00   ? 24  PHE A HD1  1  
ATOM   306    H  HD2  . PHE A 1 21  ? 22.776  11.842 40.347 1.00 0.00   ? 24  PHE A HD2  1  
ATOM   307    H  HE1  . PHE A 1 21  ? 20.580  12.054 35.905 1.00 0.00   ? 24  PHE A HE1  1  
ATOM   308    H  HE2  . PHE A 1 21  ? 24.147  11.780 38.281 1.00 0.00   ? 24  PHE A HE2  1  
ATOM   309    H  HZ   . PHE A 1 21  ? 23.049  11.886 36.060 1.00 0.00   ? 24  PHE A HZ   1  
ATOM   310    N  N    . VAL A 1 22  ? 17.611  12.918 41.964 1.00 10.66  ? 25  VAL A N    1  
ATOM   311    C  CA   . VAL A 1 22  ? 16.650  12.870 43.076 1.00 10.83  ? 25  VAL A CA   1  
ATOM   312    C  C    . VAL A 1 22  ? 16.077  11.464 43.109 1.00 11.09  ? 25  VAL A C    1  
ATOM   313    O  O    . VAL A 1 22  ? 15.995  10.788 42.103 1.00 13.28  ? 25  VAL A O    1  
ATOM   314    C  CB   . VAL A 1 22  ? 15.529  13.884 42.839 1.00 11.49  ? 25  VAL A CB   1  
ATOM   315    C  CG1  . VAL A 1 22  ? 14.524  13.813 43.990 1.00 12.03  ? 25  VAL A CG1  1  
ATOM   316    C  CG2  . VAL A 1 22  ? 16.123  15.293 42.770 1.00 12.00  ? 25  VAL A CG2  1  
ATOM   317    H  H    . VAL A 1 22  ? 17.373  12.502 41.109 1.00 0.00   ? 25  VAL A H    1  
ATOM   318    H  HA   . VAL A 1 22  ? 17.153  13.085 44.007 1.00 0.00   ? 25  VAL A HA   1  
ATOM   319    H  HB   . VAL A 1 22  ? 15.028  13.656 41.909 1.00 0.00   ? 25  VAL A HB   1  
ATOM   320    H  HG11 . VAL A 1 22  ? 14.434  12.790 44.327 1.00 0.00   ? 25  VAL A HG11 1  
ATOM   321    H  HG12 . VAL A 1 22  ? 13.562  14.166 43.650 1.00 0.00   ? 25  VAL A HG12 1  
ATOM   322    H  HG13 . VAL A 1 22  ? 14.867  14.431 44.806 1.00 0.00   ? 25  VAL A HG13 1  
ATOM   323    H  HG21 . VAL A 1 22  ? 16.651  15.415 41.836 1.00 0.00   ? 25  VAL A HG21 1  
ATOM   324    H  HG22 . VAL A 1 22  ? 16.809  15.435 43.592 1.00 0.00   ? 25  VAL A HG22 1  
ATOM   325    H  HG23 . VAL A 1 22  ? 15.329  16.022 42.833 1.00 0.00   ? 25  VAL A HG23 1  
ATOM   326    N  N    . HIS A 1 23  ? 15.711  11.014 44.252 1.00 11.03  ? 26  HIS A N    1  
ATOM   327    C  CA   . HIS A 1 23  ? 15.169  9.636  44.381 1.00 12.07  ? 26  HIS A CA   1  
ATOM   328    C  C    . HIS A 1 23  ? 13.860  9.515  43.611 1.00 13.83  ? 26  HIS A C    1  
ATOM   329    O  O    . HIS A 1 23  ? 13.510  10.362 42.813 1.00 12.60  ? 26  HIS A O    1  
ATOM   330    C  CB   . HIS A 1 23  ? 14.919  9.325  45.858 1.00 12.54  ? 26  HIS A CB   1  
ATOM   331    C  CG   . HIS A 1 23  ? 13.884  10.270 46.402 1.00 12.62  ? 26  HIS A CG   1  
ATOM   332    N  ND1  . HIS A 1 23  ? 14.222  11.489 46.974 1.00 13.90  ? 26  HIS A ND1  1  
ATOM   333    C  CD2  . HIS A 1 23  ? 12.514  10.191 46.469 1.00 10.87  ? 26  HIS A CD2  1  
ATOM   334    C  CE1  . HIS A 1 23  ? 13.079  12.089 47.357 1.00 9.23   ? 26  HIS A CE1  1  
ATOM   335    N  NE2  . HIS A 1 23  ? 12.013  11.340 47.072 1.00 13.53  ? 26  HIS A NE2  1  
ATOM   336    H  H    . HIS A 1 23  ? 15.808  11.575 45.050 1.00 0.00   ? 26  HIS A H    1  
ATOM   337    H  HA   . HIS A 1 23  ? 15.884  8.931  43.984 1.00 0.00   ? 26  HIS A HA   1  
ATOM   338    H  HB2  . HIS A 1 23  ? 14.567  8.309  45.957 1.00 0.00   ? 26  HIS A HB2  1  
ATOM   339    H  HB3  . HIS A 1 23  ? 15.839  9.443  46.411 1.00 0.00   ? 26  HIS A HB3  1  
ATOM   340    H  HD1  . HIS A 1 23  ? 15.128  11.848 47.079 1.00 0.00   ? 26  HIS A HD1  1  
ATOM   341    H  HD2  . HIS A 1 23  ? 11.919  9.365  46.110 1.00 0.00   ? 26  HIS A HD2  1  
ATOM   342    H  HE1  . HIS A 1 23  ? 13.031  13.056 47.835 1.00 0.00   ? 26  HIS A HE1  1  
ATOM   343    H  HE2  . HIS A 1 23  ? 11.073  11.554 47.249 1.00 0.00   ? 26  HIS A HE2  1  
ATOM   344    N  N    . ALA A 1 24  ? 13.136  8.461  43.847 1.00 15.80  ? 27  ALA A N    1  
ATOM   345    C  CA   . ALA A 1 24  ? 11.844  8.266  43.133 1.00 15.93  ? 27  ALA A CA   1  
ATOM   346    C  C    . ALA A 1 24  ? 10.692  8.785  43.996 1.00 14.00  ? 27  ALA A C    1  
ATOM   347    O  O    . ALA A 1 24  ? 10.552  8.426  45.148 1.00 16.35  ? 27  ALA A O    1  
ATOM   348    C  CB   . ALA A 1 24  ? 11.638  6.776  42.852 1.00 16.85  ? 27  ALA A CB   1  
ATOM   349    H  H    . ALA A 1 24  ? 13.443  7.792  44.494 1.00 0.00   ? 27  ALA A H    1  
ATOM   350    H  HA   . ALA A 1 24  ? 11.865  8.807  42.198 1.00 0.00   ? 27  ALA A HA   1  
ATOM   351    H  HB1  . ALA A 1 24  ? 11.984  6.199  43.698 1.00 0.00   ? 27  ALA A HB1  1  
ATOM   352    H  HB2  . ALA A 1 24  ? 12.197  6.495  41.972 1.00 0.00   ? 27  ALA A HB2  1  
ATOM   353    H  HB3  . ALA A 1 24  ? 10.588  6.582  42.689 1.00 0.00   ? 27  ALA A HB3  1  
ATOM   354    N  N    . HIS A 1 25  ? 9.865   9.626  43.441 1.00 14.81  ? 28  HIS A N    1  
ATOM   355    C  CA   . HIS A 1 25  ? 8.713   10.175 44.212 1.00 13.20  ? 28  HIS A CA   1  
ATOM   356    C  C    . HIS A 1 25  ? 7.627   10.654 43.238 1.00 13.35  ? 28  HIS A C    1  
ATOM   357    O  O    . HIS A 1 25  ? 7.871   10.833 42.062 1.00 15.01  ? 28  HIS A O    1  
ATOM   358    C  CB   . HIS A 1 25  ? 9.186   11.353 45.067 1.00 11.89  ? 28  HIS A CB   1  
ATOM   359    C  CG   . HIS A 1 25  ? 9.643   12.471 44.171 1.00 10.73  ? 28  HIS A CG   1  
ATOM   360    N  ND1  . HIS A 1 25  ? 10.911  12.496 43.607 1.00 11.55  ? 28  HIS A ND1  1  
ATOM   361    C  CD2  . HIS A 1 25  ? 9.014   13.610 43.732 1.00 11.51  ? 28  HIS A CD2  1  
ATOM   362    C  CE1  . HIS A 1 25  ? 11.004  13.617 42.867 1.00 12.69  ? 28  HIS A CE1  1  
ATOM   363    N  NE2  . HIS A 1 25  ? 9.876   14.328 42.911 1.00 12.04  ? 28  HIS A NE2  1  
ATOM   364    H  H    . HIS A 1 25  ? 9.999   9.896  42.509 1.00 0.00   ? 28  HIS A H    1  
ATOM   365    H  HA   . HIS A 1 25  ? 8.308   9.405  44.852 1.00 0.00   ? 28  HIS A HA   1  
ATOM   366    H  HB2  . HIS A 1 25  ? 8.371   11.698 45.687 1.00 0.00   ? 28  HIS A HB2  1  
ATOM   367    H  HB3  . HIS A 1 25  ? 10.006  11.036 45.694 1.00 0.00   ? 28  HIS A HB3  1  
ATOM   368    H  HD1  . HIS A 1 25  ? 11.611  11.821 43.726 1.00 0.00   ? 28  HIS A HD1  1  
ATOM   369    H  HD2  . HIS A 1 25  ? 8.006   13.903 43.985 1.00 0.00   ? 28  HIS A HD2  1  
ATOM   370    H  HE1  . HIS A 1 25  ? 11.882  13.904 42.308 1.00 0.00   ? 28  HIS A HE1  1  
ATOM   371    H  HE2  . HIS A 1 25  ? 9.694   15.178 42.459 1.00 0.00   ? 28  HIS A HE2  1  
ATOM   372    N  N    . SER A 1 26  ? 6.431   10.860 43.722 1.00 13.96  ? 29  SER A N    1  
ATOM   373    C  CA   . SER A 1 26  ? 5.332   11.323 42.838 1.00 14.43  ? 29  SER A CA   1  
ATOM   374    C  C    . SER A 1 26  ? 4.978   12.757 43.212 1.00 13.24  ? 29  SER A C    1  
ATOM   375    O  O    . SER A 1 26  ? 4.973   13.125 44.370 1.00 13.75  ? 29  SER A O    1  
ATOM   376    C  CB   . SER A 1 26  ? 4.109   10.426 43.027 1.00 15.02  ? 29  SER A CB   1  
ATOM   377    O  OG   . SER A 1 26  ? 3.655   10.527 44.371 1.00 21.00  ? 29  SER A OG   1  
ATOM   378    H  H    . SER A 1 26  ? 6.258   10.708 44.675 1.00 0.00   ? 29  SER A H    1  
ATOM   379    H  HA   . SER A 1 26  ? 5.655   11.285 41.808 1.00 0.00   ? 29  SER A HA   1  
ATOM   380    H  HB2  . SER A 1 26  ? 3.322   10.742 42.363 1.00 0.00   ? 29  SER A HB2  1  
ATOM   381    H  HB3  . SER A 1 26  ? 4.376   9.402  42.803 1.00 0.00   ? 29  SER A HB3  1  
ATOM   382    H  HG   . SER A 1 26  ? 4.338   10.168 44.942 1.00 0.00   ? 29  SER A HG   1  
ATOM   383    N  N    . GLN A 1 27  ? 4.694   13.573 42.244 1.00 12.89  ? 30  GLN A N    1  
ATOM   384    C  CA   . GLN A 1 27  ? 4.354   14.988 42.546 1.00 13.19  ? 30  GLN A CA   1  
ATOM   385    C  C    . GLN A 1 27  ? 3.127   14.960 43.420 1.00 13.55  ? 30  GLN A C    1  
ATOM   386    O  O    . GLN A 1 27  ? 3.175   15.241 44.602 1.00 13.01  ? 30  GLN A O    1  
ATOM   387    C  CB   . GLN A 1 27  ? 4.053   15.742 41.248 1.00 12.58  ? 30  GLN A CB   1  
ATOM   388    C  CG   . GLN A 1 27  ? 5.366   16.175 40.593 1.00 12.85  ? 30  GLN A CG   1  
ATOM   389    C  CD   . GLN A 1 27  ? 5.123   16.480 39.114 1.00 12.25  ? 30  GLN A CD   1  
ATOM   390    O  OE1  . GLN A 1 27  ? 4.269   17.276 38.778 1.00 12.92  ? 30  GLN A OE1  1  
ATOM   391    N  NE2  . GLN A 1 27  ? 5.844   15.876 38.209 1.00 13.60  ? 30  GLN A NE2  1  
ATOM   392    H  H    . GLN A 1 27  ? 4.712   13.259 41.316 1.00 0.00   ? 30  GLN A H    1  
ATOM   393    H  HA   . GLN A 1 27  ? 5.171   15.461 43.070 1.00 0.00   ? 30  GLN A HA   1  
ATOM   394    H  HB2  . GLN A 1 27  ? 3.510   15.095 40.574 1.00 0.00   ? 30  GLN A HB2  1  
ATOM   395    H  HB3  . GLN A 1 27  ? 3.458   16.615 41.468 1.00 0.00   ? 30  GLN A HB3  1  
ATOM   396    H  HG2  . GLN A 1 27  ? 5.740   17.060 41.088 1.00 0.00   ? 30  GLN A HG2  1  
ATOM   397    H  HG3  . GLN A 1 27  ? 6.092   15.380 40.680 1.00 0.00   ? 30  GLN A HG3  1  
ATOM   398    H  HE21 . GLN A 1 27  ? 6.533   15.234 38.479 1.00 0.00   ? 30  GLN A HE21 1  
ATOM   399    H  HE22 . GLN A 1 27  ? 5.696   16.065 37.258 1.00 0.00   ? 30  GLN A HE22 1  
ATOM   400    N  N    . VAL A 1 28  ? 2.036   14.560 42.858 1.00 14.63  ? 31  VAL A N    1  
ATOM   401    C  CA   . VAL A 1 28  ? 0.796   14.436 43.673 1.00 15.85  ? 31  VAL A CA   1  
ATOM   402    C  C    . VAL A 1 28  ? 1.012   13.307 44.696 1.00 15.72  ? 31  VAL A C    1  
ATOM   403    O  O    . VAL A 1 28  ? 1.531   12.258 44.372 1.00 16.80  ? 31  VAL A O    1  
ATOM   404    C  CB   . VAL A 1 28  ? -0.386  14.091 42.765 1.00 15.89  ? 31  VAL A CB   1  
ATOM   405    C  CG1  . VAL A 1 28  ? -1.646  13.908 43.614 1.00 17.28  ? 31  VAL A CG1  1  
ATOM   406    C  CG2  . VAL A 1 28  ? -0.608  15.227 41.764 1.00 17.07  ? 31  VAL A CG2  1  
ATOM   407    H  H    . VAL A 1 28  ? 2.035   14.295 41.914 1.00 0.00   ? 31  VAL A H    1  
ATOM   408    H  HA   . VAL A 1 28  ? 0.604   15.366 44.190 1.00 0.00   ? 31  VAL A HA   1  
ATOM   409    H  HB   . VAL A 1 28  ? -0.175  13.174 42.233 1.00 0.00   ? 31  VAL A HB   1  
ATOM   410    H  HG11 . VAL A 1 28  ? -1.472  13.144 44.357 1.00 0.00   ? 31  VAL A HG11 1  
ATOM   411    H  HG12 . VAL A 1 28  ? -2.468  13.612 42.979 1.00 0.00   ? 31  VAL A HG12 1  
ATOM   412    H  HG13 . VAL A 1 28  ? -1.888  14.839 44.104 1.00 0.00   ? 31  VAL A HG13 1  
ATOM   413    H  HG21 . VAL A 1 28  ? -0.828  14.811 40.792 1.00 0.00   ? 31  VAL A HG21 1  
ATOM   414    H  HG22 . VAL A 1 28  ? 0.284   15.832 41.703 1.00 0.00   ? 31  VAL A HG22 1  
ATOM   415    H  HG23 . VAL A 1 28  ? -1.436  15.838 42.090 1.00 0.00   ? 31  VAL A HG23 1  
ATOM   416    N  N    . ALA A 1 29  ? 0.643   13.524 45.929 1.00 15.80  ? 32  ALA A N    1  
ATOM   417    C  CA   . ALA A 1 29  ? 0.847   12.490 46.976 1.00 17.09  ? 32  ALA A CA   1  
ATOM   418    C  C    . ALA A 1 29  ? 0.016   11.250 46.664 1.00 18.39  ? 32  ALA A C    1  
ATOM   419    O  O    . ALA A 1 29  ? -1.118  11.332 46.237 1.00 18.70  ? 32  ALA A O    1  
ATOM   420    C  CB   . ALA A 1 29  ? 0.427   13.054 48.334 1.00 17.32  ? 32  ALA A CB   1  
ATOM   421    H  H    . ALA A 1 29  ? 0.243   14.385 46.171 1.00 0.00   ? 32  ALA A H    1  
ATOM   422    H  HA   . ALA A 1 29  ? 1.892   12.220 47.011 1.00 0.00   ? 32  ALA A HA   1  
ATOM   423    H  HB1  . ALA A 1 29  ? 1.035   13.915 48.570 1.00 0.00   ? 32  ALA A HB1  1  
ATOM   424    H  HB2  . ALA A 1 29  ? 0.561   12.299 49.094 1.00 0.00   ? 32  ALA A HB2  1  
ATOM   425    H  HB3  . ALA A 1 29  ? -0.612  13.346 48.296 1.00 0.00   ? 32  ALA A HB3  1  
ATOM   426    N  N    . GLU A 1 30  ? 0.579   10.102 46.893 1.00 19.90  ? 33  GLU A N    1  
ATOM   427    C  CA   . GLU A 1 30  ? -0.155  8.833  46.636 1.00 21.00  ? 33  GLU A CA   1  
ATOM   428    C  C    . GLU A 1 30  ? -0.579  8.240  47.979 1.00 21.07  ? 33  GLU A C    1  
ATOM   429    O  O    . GLU A 1 30  ? 0.232   7.740  48.733 1.00 21.92  ? 33  GLU A O    1  
ATOM   430    C  CB   . GLU A 1 30  ? 0.759   7.848  45.904 1.00 22.09  ? 33  GLU A CB   1  
ATOM   431    C  CG   . GLU A 1 30  ? 1.045   8.368  44.493 1.00 25.02  ? 33  GLU A CG   1  
ATOM   432    C  CD   . GLU A 1 30  ? 2.173   7.547  43.865 1.00 28.02  ? 33  GLU A CD   1  
ATOM   433    O  OE1  . GLU A 1 30  ? 3.013   7.066  44.607 1.00 32.46  ? 33  GLU A OE1  1  
ATOM   434    O  OE2  . GLU A 1 30  ? 2.177   7.414  42.652 1.00 31.44  ? 33  GLU A OE2  1  
ATOM   435    H  H    . GLU A 1 30  ? 1.492   10.071 47.247 1.00 0.00   ? 33  GLU A H    1  
ATOM   436    H  HA   . GLU A 1 30  ? -1.030  9.034  46.035 1.00 0.00   ? 33  GLU A HA   1  
ATOM   437    H  HB2  . GLU A 1 30  ? 1.688   7.749  46.447 1.00 0.00   ? 33  GLU A HB2  1  
ATOM   438    H  HB3  . GLU A 1 30  ? 0.275   6.886  45.839 1.00 0.00   ? 33  GLU A HB3  1  
ATOM   439    H  HG2  . GLU A 1 30  ? 0.153   8.278  43.890 1.00 0.00   ? 33  GLU A HG2  1  
ATOM   440    H  HG3  . GLU A 1 30  ? 1.342   9.405  44.545 1.00 0.00   ? 33  GLU A HG3  1  
ATOM   441    N  N    . GLY A 1 31  ? -1.839  8.313  48.291 1.00 20.99  ? 34  GLY A N    1  
ATOM   442    C  CA   . GLY A 1 31  ? -2.316  7.784  49.585 1.00 21.14  ? 34  GLY A CA   1  
ATOM   443    C  C    . GLY A 1 31  ? -2.371  8.940  50.571 1.00 20.28  ? 34  GLY A C    1  
ATOM   444    O  O    . GLY A 1 31  ? -2.153  10.082 50.217 1.00 21.99  ? 34  GLY A O    1  
ATOM   445    H  H    . GLY A 1 31  ? -2.471  8.736  47.673 1.00 0.00   ? 34  GLY A H    1  
ATOM   446    H  HA2  . GLY A 1 31  ? -3.302  7.356  49.462 1.00 0.00   ? 34  GLY A HA2  1  
ATOM   447    H  HA3  . GLY A 1 31  ? -1.633  7.032  49.948 1.00 0.00   ? 34  GLY A HA3  1  
ATOM   448    N  N    . GLY A 1 32  ? -2.653  8.662  51.800 1.00 19.68  ? 35  GLY A N    1  
ATOM   449    C  CA   . GLY A 1 32  ? -2.716  9.748  52.808 1.00 18.20  ? 35  GLY A CA   1  
ATOM   450    C  C    . GLY A 1 32  ? -1.325  9.967  53.395 1.00 17.55  ? 35  GLY A C    1  
ATOM   451    O  O    . GLY A 1 32  ? -0.332  9.525  52.849 1.00 17.01  ? 35  GLY A O    1  
ATOM   452    H  H    . GLY A 1 32  ? -2.822  7.734  52.067 1.00 0.00   ? 35  GLY A H    1  
ATOM   453    H  HA2  . GLY A 1 32  ? -3.059  10.659 52.337 1.00 0.00   ? 35  GLY A HA2  1  
ATOM   454    H  HA3  . GLY A 1 32  ? -3.397  9.470  53.598 1.00 0.00   ? 35  GLY A HA3  1  
ATOM   455    N  N    . PRO A 1 33  ? -1.261  10.644 54.500 1.00 16.39  ? 36  PRO A N    1  
ATOM   456    C  CA   . PRO A 1 33  ? 0.022   10.942 55.197 1.00 15.94  ? 36  PRO A CA   1  
ATOM   457    C  C    . PRO A 1 33  ? 0.796   9.669  55.539 1.00 15.13  ? 36  PRO A C    1  
ATOM   458    O  O    . PRO A 1 33  ? 0.225   8.666  55.919 1.00 14.93  ? 36  PRO A O    1  
ATOM   459    C  CB   . PRO A 1 33  ? -0.404  11.666 56.479 1.00 16.13  ? 36  PRO A CB   1  
ATOM   460    C  CG   . PRO A 1 33  ? -1.788  12.162 56.225 1.00 17.37  ? 36  PRO A CG   1  
ATOM   461    C  CD   . PRO A 1 33  ? -2.416  11.207 55.212 1.00 17.87  ? 36  PRO A CD   1  
ATOM   462    H  HA   . PRO A 1 33  ? 0.630   11.599 54.598 1.00 0.00   ? 36  PRO A HA   1  
ATOM   463    H  HB2  . PRO A 1 33  ? -0.399  10.978 57.314 1.00 0.00   ? 36  PRO A HB2  1  
ATOM   464    H  HB3  . PRO A 1 33  ? 0.255   12.497 56.675 1.00 0.00   ? 36  PRO A HB3  1  
ATOM   465    H  HG2  . PRO A 1 33  ? -2.357  12.158 57.145 1.00 0.00   ? 36  PRO A HG2  1  
ATOM   466    H  HG3  . PRO A 1 33  ? -1.756  13.158 55.812 1.00 0.00   ? 36  PRO A HG3  1  
ATOM   467    H  HD2  . PRO A 1 33  ? -2.970  10.429 55.719 1.00 0.00   ? 36  PRO A HD2  1  
ATOM   468    H  HD3  . PRO A 1 33  ? -3.052  11.744 54.526 1.00 0.00   ? 36  PRO A HD3  1  
ATOM   469    N  N    . LYS A 1 34  ? 2.090   9.702  55.407 1.00 14.11  ? 37  LYS A N    1  
ATOM   470    C  CA   . LYS A 1 34  ? 2.904   8.491  55.725 1.00 14.35  ? 37  LYS A CA   1  
ATOM   471    C  C    . LYS A 1 34  ? 4.296   8.882  56.261 1.00 12.87  ? 37  LYS A C    1  
ATOM   472    O  O    . LYS A 1 34  ? 4.927   9.806  55.789 1.00 12.06  ? 37  LYS A O    1  
ATOM   473    C  CB   . LYS A 1 34  ? 3.072   7.652  54.456 1.00 16.57  ? 37  LYS A CB   1  
ATOM   474    C  CG   . LYS A 1 34  ? 1.722   7.518  53.749 1.00 21.81  ? 37  LYS A CG   1  
ATOM   475    C  CD   . LYS A 1 34  ? 1.934   6.938  52.349 1.00 26.86  ? 37  LYS A CD   1  
ATOM   476    C  CE   . LYS A 1 34  ? 0.668   6.203  51.905 1.00 28.10  ? 37  LYS A CE   1  
ATOM   477    N  NZ   . LYS A 1 34  ? -0.463  7.169  51.818 1.00 26.07  ? 37  LYS A NZ   1  
ATOM   478    H  H    . LYS A 1 34  ? 2.530   10.521 55.099 1.00 0.00   ? 37  LYS A H    1  
ATOM   479    H  HA   . LYS A 1 34  ? 2.389   7.904  56.470 1.00 0.00   ? 37  LYS A HA   1  
ATOM   480    H  HB2  . LYS A 1 34  ? 3.779   8.134  53.797 1.00 0.00   ? 37  LYS A HB2  1  
ATOM   481    H  HB3  . LYS A 1 34  ? 3.437   6.670  54.719 1.00 0.00   ? 37  LYS A HB3  1  
ATOM   482    H  HG2  . LYS A 1 34  ? 1.081   6.862  54.319 1.00 0.00   ? 37  LYS A HG2  1  
ATOM   483    H  HG3  . LYS A 1 34  ? 1.261   8.491  53.667 1.00 0.00   ? 37  LYS A HG3  1  
ATOM   484    H  HD2  . LYS A 1 34  ? 2.148   7.739  51.657 1.00 0.00   ? 37  LYS A HD2  1  
ATOM   485    H  HD3  . LYS A 1 34  ? 2.762   6.246  52.368 1.00 0.00   ? 37  LYS A HD3  1  
ATOM   486    H  HE2  . LYS A 1 34  ? 0.834   5.755  50.936 1.00 0.00   ? 37  LYS A HE2  1  
ATOM   487    H  HE3  . LYS A 1 34  ? 0.429   5.431  52.622 1.00 0.00   ? 37  LYS A HE3  1  
ATOM   488    H  HZ1  . LYS A 1 34  ? -0.344  7.769  50.978 1.00 0.00   ? 37  LYS A HZ1  1  
ATOM   489    H  HZ2  . LYS A 1 34  ? -0.475  7.766  52.669 1.00 0.00   ? 37  LYS A HZ2  1  
ATOM   490    H  HZ3  . LYS A 1 34  ? -1.360  6.646  51.748 1.00 0.00   ? 37  LYS A HZ3  1  
ATOM   491    N  N    . VAL A 1 35  ? 4.770   8.149  57.237 1.00 11.73  ? 38  VAL A N    1  
ATOM   492    C  CA   . VAL A 1 35  ? 6.105   8.394  57.832 1.00 10.99  ? 38  VAL A CA   1  
ATOM   493    C  C    . VAL A 1 35  ? 7.159   7.863  56.870 1.00 10.57  ? 38  VAL A C    1  
ATOM   494    O  O    . VAL A 1 35  ? 7.325   6.674  56.679 1.00 12.50  ? 38  VAL A O    1  
ATOM   495    C  CB   . VAL A 1 35  ? 6.215   7.663  59.171 1.00 11.56  ? 38  VAL A CB   1  
ATOM   496    C  CG1  . VAL A 1 35  ? 7.683   7.345  59.461 1.00 11.66  ? 38  VAL A CG1  1  
ATOM   497    C  CG2  . VAL A 1 35  ? 5.658   8.555  60.284 1.00 12.81  ? 38  VAL A CG2  1  
ATOM   498    H  H    . VAL A 1 35  ? 4.231   7.403  57.574 1.00 0.00   ? 38  VAL A H    1  
ATOM   499    H  HA   . VAL A 1 35  ? 6.249   9.454  57.981 1.00 0.00   ? 38  VAL A HA   1  
ATOM   500    H  HB   . VAL A 1 35  ? 5.649   6.744  59.127 1.00 0.00   ? 38  VAL A HB   1  
ATOM   501    H  HG11 . VAL A 1 35  ? 8.099   6.784  58.638 1.00 0.00   ? 38  VAL A HG11 1  
ATOM   502    H  HG12 . VAL A 1 35  ? 7.752   6.760  60.367 1.00 0.00   ? 38  VAL A HG12 1  
ATOM   503    H  HG13 . VAL A 1 35  ? 8.233   8.265  59.584 1.00 0.00   ? 38  VAL A HG13 1  
ATOM   504    H  HG21 . VAL A 1 35  ? 6.236   9.466  60.337 1.00 0.00   ? 38  VAL A HG21 1  
ATOM   505    H  HG22 . VAL A 1 35  ? 5.720   8.033  61.228 1.00 0.00   ? 38  VAL A HG22 1  
ATOM   506    H  HG23 . VAL A 1 35  ? 4.627   8.794  60.071 1.00 0.00   ? 38  VAL A HG23 1  
ATOM   507    N  N    . VAL A 1 36  ? 7.838   8.758  56.253 1.00 10.29  ? 39  VAL A N    1  
ATOM   508    C  CA   . VAL A 1 36  ? 8.869   8.423  55.269 1.00 9.84   ? 39  VAL A CA   1  
ATOM   509    C  C    . VAL A 1 36  ? 10.140  8.217  56.026 1.00 10.13  ? 39  VAL A C    1  
ATOM   510    O  O    . VAL A 1 36  ? 10.513  8.990  56.886 1.00 10.49  ? 39  VAL A O    1  
ATOM   511    C  CB   . VAL A 1 36  ? 9.034   9.571  54.273 1.00 9.93   ? 39  VAL A CB   1  
ATOM   512    C  CG1  . VAL A 1 36  ? 9.505   9.017  52.927 1.00 11.04  ? 39  VAL A CG1  1  
ATOM   513    C  CG2  . VAL A 1 36  ? 7.690   10.281 54.088 1.00 12.53  ? 39  VAL A CG2  1  
ATOM   514    H  H    . VAL A 1 36  ? 7.646   9.702  56.431 1.00 0.00   ? 39  VAL A H    1  
ATOM   515    H  HA   . VAL A 1 36  ? 8.599   7.517  54.747 1.00 0.00   ? 39  VAL A HA   1  
ATOM   516    H  HB   . VAL A 1 36  ? 9.765   10.272 54.649 1.00 0.00   ? 39  VAL A HB   1  
ATOM   517    H  HG11 . VAL A 1 36  ? 9.713   9.835  52.254 1.00 0.00   ? 39  VAL A HG11 1  
ATOM   518    H  HG12 . VAL A 1 36  ? 8.733   8.391  52.506 1.00 0.00   ? 39  VAL A HG12 1  
ATOM   519    H  HG13 . VAL A 1 36  ? 10.402  8.433  53.073 1.00 0.00   ? 39  VAL A HG13 1  
ATOM   520    H  HG21 . VAL A 1 36  ? 7.475   10.376 53.034 1.00 0.00   ? 39  VAL A HG21 1  
ATOM   521    H  HG22 . VAL A 1 36  ? 7.738   11.263 54.535 1.00 0.00   ? 39  VAL A HG22 1  
ATOM   522    H  HG23 . VAL A 1 36  ? 6.911   9.706  54.565 1.00 0.00   ? 39  VAL A HG23 1  
ATOM   523    N  N    . GLU A 1 37  ? 10.781  7.162  55.747 1.00 9.81   ? 40  GLU A N    1  
ATOM   524    C  CA   . GLU A 1 37  ? 12.030  6.845  56.484 1.00 10.59  ? 40  GLU A CA   1  
ATOM   525    C  C    . GLU A 1 37  ? 13.241  6.905  55.560 1.00 10.33  ? 40  GLU A C    1  
ATOM   526    O  O    . GLU A 1 37  ? 13.280  6.293  54.511 1.00 11.53  ? 40  GLU A O    1  
ATOM   527    C  CB   . GLU A 1 37  ? 11.921  5.440  57.080 1.00 10.70  ? 40  GLU A CB   1  
ATOM   528    C  CG   . GLU A 1 37  ? 10.734  5.385  58.044 1.00 12.56  ? 40  GLU A CG   1  
ATOM   529    C  CD   . GLU A 1 37  ? 10.408  3.926  58.370 1.00 16.79  ? 40  GLU A CD   1  
ATOM   530    O  OE1  . GLU A 1 37  ? 10.218  3.161  57.439 1.00 22.01  ? 40  GLU A OE1  1  
ATOM   531    O  OE2  . GLU A 1 37  ? 10.352  3.600  59.544 1.00 22.44  ? 40  GLU A OE2  1  
ATOM   532    H  H    . GLU A 1 37  ? 10.436  6.541  55.072 1.00 0.00   ? 40  GLU A H    1  
ATOM   533    H  HA   . GLU A 1 37  ? 12.160  7.557  57.285 1.00 0.00   ? 40  GLU A HA   1  
ATOM   534    H  HB2  . GLU A 1 37  ? 11.773  4.723  56.285 1.00 0.00   ? 40  GLU A HB2  1  
ATOM   535    H  HB3  . GLU A 1 37  ? 12.828  5.204  57.615 1.00 0.00   ? 40  GLU A HB3  1  
ATOM   536    H  HG2  . GLU A 1 37  ? 10.986  5.911  58.954 1.00 0.00   ? 40  GLU A HG2  1  
ATOM   537    H  HG3  . GLU A 1 37  ? 9.875   5.850  57.585 1.00 0.00   ? 40  GLU A HG3  1  
ATOM   538    N  N    . PHE A 1 38  ? 14.239  7.624  55.973 1.00 9.74   ? 41  PHE A N    1  
ATOM   539    C  CA   . PHE A 1 38  ? 15.494  7.735  55.172 1.00 9.86   ? 41  PHE A CA   1  
ATOM   540    C  C    . PHE A 1 38  ? 16.694  7.589  56.123 1.00 9.93   ? 41  PHE A C    1  
ATOM   541    O  O    . PHE A 1 38  ? 16.653  8.039  57.251 1.00 10.22  ? 41  PHE A O    1  
ATOM   542    C  CB   . PHE A 1 38  ? 15.546  9.101  54.484 1.00 10.38  ? 41  PHE A CB   1  
ATOM   543    C  CG   . PHE A 1 38  ? 14.386  9.227  53.526 1.00 9.73   ? 41  PHE A CG   1  
ATOM   544    C  CD1  . PHE A 1 38  ? 13.133  9.639  53.994 1.00 10.69  ? 41  PHE A CD1  1  
ATOM   545    C  CD2  . PHE A 1 38  ? 14.564  8.931  52.169 1.00 11.19  ? 41  PHE A CD2  1  
ATOM   546    C  CE1  . PHE A 1 38  ? 12.057  9.755  53.105 1.00 10.69  ? 41  PHE A CE1  1  
ATOM   547    C  CE2  . PHE A 1 38  ? 13.489  9.048  51.280 1.00 11.54  ? 41  PHE A CE2  1  
ATOM   548    C  CZ   . PHE A 1 38  ? 12.235  9.460  51.749 1.00 11.02  ? 41  PHE A CZ   1  
ATOM   549    H  H    . PHE A 1 38  ? 14.176  8.085  56.836 1.00 0.00   ? 41  PHE A H    1  
ATOM   550    H  HA   . PHE A 1 38  ? 15.522  6.950  54.430 1.00 0.00   ? 41  PHE A HA   1  
ATOM   551    H  HB2  . PHE A 1 38  ? 15.485  9.881  55.229 1.00 0.00   ? 41  PHE A HB2  1  
ATOM   552    H  HB3  . PHE A 1 38  ? 16.474  9.194  53.940 1.00 0.00   ? 41  PHE A HB3  1  
ATOM   553    H  HD1  . PHE A 1 38  ? 12.996  9.866  55.041 1.00 0.00   ? 41  PHE A HD1  1  
ATOM   554    H  HD2  . PHE A 1 38  ? 15.531  8.613  51.808 1.00 0.00   ? 41  PHE A HD2  1  
ATOM   555    H  HE1  . PHE A 1 38  ? 11.090  10.073 53.467 1.00 0.00   ? 41  PHE A HE1  1  
ATOM   556    H  HE2  . PHE A 1 38  ? 13.626  8.820  50.234 1.00 0.00   ? 41  PHE A HE2  1  
ATOM   557    H  HZ   . PHE A 1 38  ? 11.406  9.550  51.063 1.00 0.00   ? 41  PHE A HZ   1  
ATOM   558    N  N    . THR A 1 39  ? 17.755  6.957  55.689 1.00 10.09  ? 42  THR A N    1  
ATOM   559    C  CA   . THR A 1 39  ? 18.930  6.783  56.583 1.00 10.89  ? 42  THR A CA   1  
ATOM   560    C  C    . THR A 1 39  ? 20.180  7.296  55.878 1.00 10.83  ? 42  THR A C    1  
ATOM   561    O  O    . THR A 1 39  ? 20.446  6.966  54.740 1.00 11.52  ? 42  THR A O    1  
ATOM   562    C  CB   . THR A 1 39  ? 19.104  5.299  56.915 1.00 11.70  ? 42  THR A CB   1  
ATOM   563    O  OG1  . THR A 1 39  ? 18.100  4.901  57.837 1.00 14.68  ? 42  THR A OG1  1  
ATOM   564    C  CG2  . THR A 1 39  ? 20.485  5.070  57.530 1.00 13.06  ? 42  THR A CG2  1  
ATOM   565    H  H    . THR A 1 39  ? 17.771  6.591  54.780 1.00 0.00   ? 42  THR A H    1  
ATOM   566    H  HA   . THR A 1 39  ? 18.775  7.340  57.495 1.00 0.00   ? 42  THR A HA   1  
ATOM   567    H  HB   . THR A 1 39  ? 19.016  4.714  56.012 1.00 0.00   ? 42  THR A HB   1  
ATOM   568    H  HG1  . THR A 1 39  ? 17.287  5.358  57.607 1.00 0.00   ? 42  THR A HG1  1  
ATOM   569    H  HG21 . THR A 1 39  ? 20.604  5.707  58.394 1.00 0.00   ? 42  THR A HG21 1  
ATOM   570    H  HG22 . THR A 1 39  ? 21.247  5.305  56.802 1.00 0.00   ? 42  THR A HG22 1  
ATOM   571    H  HG23 . THR A 1 39  ? 20.579  4.036  57.829 1.00 0.00   ? 42  THR A HG23 1  
ATOM   572    N  N    . MET A 1 40  ? 20.950  8.105  56.545 1.00 10.23  ? 43  MET A N    1  
ATOM   573    C  CA   . MET A 1 40  ? 22.188  8.644  55.908 1.00 9.88   ? 43  MET A CA   1  
ATOM   574    C  C    . MET A 1 40  ? 23.390  8.537  56.865 1.00 10.22  ? 43  MET A C    1  
ATOM   575    O  O    . MET A 1 40  ? 23.339  8.967  58.001 1.00 10.28  ? 43  MET A O    1  
ATOM   576    C  CB   . MET A 1 40  ? 21.967  10.113 55.541 1.00 9.93   ? 43  MET A CB   1  
ATOM   577    C  CG   . MET A 1 40  ? 20.742  10.234 54.632 1.00 10.33  ? 43  MET A CG   1  
ATOM   578    S  SD   . MET A 1 40  ? 20.729  11.866 53.851 1.00 10.91  ? 43  MET A SD   1  
ATOM   579    C  CE   . MET A 1 40  ? 20.536  12.840 55.364 1.00 11.07  ? 43  MET A CE   1  
ATOM   580    H  H    . MET A 1 40  ? 20.717  8.361  57.462 1.00 0.00   ? 43  MET A H    1  
ATOM   581    H  HA   . MET A 1 40  ? 22.399  8.084  55.010 1.00 0.00   ? 43  MET A HA   1  
ATOM   582    H  HB2  . MET A 1 40  ? 21.806  10.689 56.442 1.00 0.00   ? 43  MET A HB2  1  
ATOM   583    H  HB3  . MET A 1 40  ? 22.836  10.490 55.023 1.00 0.00   ? 43  MET A HB3  1  
ATOM   584    H  HG2  . MET A 1 40  ? 20.784  9.470  53.870 1.00 0.00   ? 43  MET A HG2  1  
ATOM   585    H  HG3  . MET A 1 40  ? 19.845  10.108 55.219 1.00 0.00   ? 43  MET A HG3  1  
ATOM   586    H  HE1  . MET A 1 40  ? 20.923  13.836 55.202 1.00 0.00   ? 43  MET A HE1  1  
ATOM   587    H  HE2  . MET A 1 40  ? 21.078  12.364 56.169 1.00 0.00   ? 43  MET A HE2  1  
ATOM   588    H  HE3  . MET A 1 40  ? 19.491  12.900 55.624 1.00 0.00   ? 43  MET A HE3  1  
ATOM   589    N  N    . VAL A 1 41  ? 24.477  7.985  56.388 1.00 10.67  ? 44  VAL A N    1  
ATOM   590    C  CA   . VAL A 1 41  ? 25.698  7.856  57.206 1.00 10.52  ? 44  VAL A CA   1  
ATOM   591    C  C    . VAL A 1 41  ? 26.594  9.033  56.860 1.00 10.11  ? 44  VAL A C    1  
ATOM   592    O  O    . VAL A 1 41  ? 26.721  9.420  55.715 1.00 10.84  ? 44  VAL A O    1  
ATOM   593    C  CB   . VAL A 1 41  ? 26.411  6.543  56.873 1.00 11.21  ? 44  VAL A CB   1  
ATOM   594    C  CG1  . VAL A 1 41  ? 27.675  6.418  57.725 1.00 13.84  ? 44  VAL A CG1  1  
ATOM   595    C  CG2  . VAL A 1 41  ? 25.478  5.368  57.171 1.00 12.94  ? 44  VAL A CG2  1  
ATOM   596    H  H    . VAL A 1 41  ? 24.486  7.667  55.461 1.00 0.00   ? 44  VAL A H    1  
ATOM   597    H  HA   . VAL A 1 41  ? 25.443  7.883  58.255 1.00 0.00   ? 44  VAL A HA   1  
ATOM   598    H  HB   . VAL A 1 41  ? 26.680  6.536  55.826 1.00 0.00   ? 44  VAL A HB   1  
ATOM   599    H  HG11 . VAL A 1 41  ? 28.252  5.568  57.391 1.00 0.00   ? 44  VAL A HG11 1  
ATOM   600    H  HG12 . VAL A 1 41  ? 27.399  6.281  58.760 1.00 0.00   ? 44  VAL A HG12 1  
ATOM   601    H  HG13 . VAL A 1 41  ? 28.267  7.316  57.626 1.00 0.00   ? 44  VAL A HG13 1  
ATOM   602    H  HG21 . VAL A 1 41  ? 24.961  5.546  58.103 1.00 0.00   ? 44  VAL A HG21 1  
ATOM   603    H  HG22 . VAL A 1 41  ? 26.056  4.459  57.248 1.00 0.00   ? 44  VAL A HG22 1  
ATOM   604    H  HG23 . VAL A 1 41  ? 24.757  5.269  56.373 1.00 0.00   ? 44  VAL A HG23 1  
ATOM   605    N  N    . ILE A 1 42  ? 27.183  9.623  57.838 1.00 9.72   ? 45  ILE A N    1  
ATOM   606    C  CA   . ILE A 1 42  ? 28.041  10.805 57.593 1.00 9.68   ? 45  ILE A CA   1  
ATOM   607    C  C    . ILE A 1 42  ? 29.457  10.338 57.341 1.00 9.58   ? 45  ILE A C    1  
ATOM   608    O  O    . ILE A 1 42  ? 29.961  9.459  58.010 1.00 10.99  ? 45  ILE A O    1  
ATOM   609    C  CB   . ILE A 1 42  ? 28.013  11.722 58.816 1.00 9.28   ? 45  ILE A CB   1  
ATOM   610    C  CG1  . ILE A 1 42  ? 26.580  12.198 59.063 1.00 9.99   ? 45  ILE A CG1  1  
ATOM   611    C  CG2  . ILE A 1 42  ? 28.915  12.932 58.569 1.00 10.20  ? 45  ILE A CG2  1  
ATOM   612    C  CD1  . ILE A 1 42  ? 26.384  12.479 60.554 1.00 10.52  ? 45  ILE A CD1  1  
ATOM   613    H  H    . ILE A 1 42  ? 27.041  9.306  58.754 1.00 0.00   ? 45  ILE A H    1  
ATOM   614    H  HA   . ILE A 1 42  ? 27.679  11.343 56.730 1.00 0.00   ? 45  ILE A HA   1  
ATOM   615    H  HB   . ILE A 1 42  ? 28.369  11.179 59.681 1.00 0.00   ? 45  ILE A HB   1  
ATOM   616    H  HG12 . ILE A 1 42  ? 26.399  13.101 58.499 1.00 0.00   ? 45  ILE A HG12 1  
ATOM   617    H  HG13 . ILE A 1 42  ? 25.887  11.431 58.749 1.00 0.00   ? 45  ILE A HG13 1  
ATOM   618    H  HG21 . ILE A 1 42  ? 29.412  13.205 59.488 1.00 0.00   ? 45  ILE A HG21 1  
ATOM   619    H  HG22 . ILE A 1 42  ? 28.317  13.762 58.222 1.00 0.00   ? 45  ILE A HG22 1  
ATOM   620    H  HG23 . ILE A 1 42  ? 29.654  12.684 57.821 1.00 0.00   ? 45  ILE A HG23 1  
ATOM   621    H  HD11 . ILE A 1 42  ? 26.514  13.534 60.742 1.00 0.00   ? 45  ILE A HD11 1  
ATOM   622    H  HD12 . ILE A 1 42  ? 27.111  11.919 61.124 1.00 0.00   ? 45  ILE A HD12 1  
ATOM   623    H  HD13 . ILE A 1 42  ? 25.389  12.181 60.849 1.00 0.00   ? 45  ILE A HD13 1  
ATOM   624    N  N    . GLU A 1 43  ? 30.105  10.907 56.379 1.00 10.17  ? 46  GLU A N    1  
ATOM   625    C  CA   . GLU A 1 43  ? 31.503  10.466 56.093 1.00 11.07  ? 46  GLU A CA   1  
ATOM   626    C  C    . GLU A 1 43  ? 32.454  11.667 56.050 1.00 10.70  ? 46  GLU A C    1  
ATOM   627    O  O    . GLU A 1 43  ? 32.337  12.530 55.203 1.00 11.69  ? 46  GLU A O    1  
ATOM   628    C  CB   . GLU A 1 43  ? 31.539  9.746  54.744 1.00 12.12  ? 46  GLU A CB   1  
ATOM   629    C  CG   . GLU A 1 43  ? 30.705  8.466  54.825 1.00 16.74  ? 46  GLU A CG   1  
ATOM   630    C  CD   . GLU A 1 43  ? 30.617  7.825  53.439 1.00 19.15  ? 46  GLU A CD   1  
ATOM   631    O  OE1  . GLU A 1 43  ? 31.382  8.222  52.575 1.00 20.18  ? 46  GLU A OE1  1  
ATOM   632    O  OE2  . GLU A 1 43  ? 29.786  6.949  53.265 1.00 25.16  ? 46  GLU A OE2  1  
ATOM   633    H  H    . GLU A 1 43  ? 29.685  11.611 55.842 1.00 0.00   ? 46  GLU A H    1  
ATOM   634    H  HA   . GLU A 1 43  ? 31.826  9.785  56.866 1.00 0.00   ? 46  GLU A HA   1  
ATOM   635    H  HB2  . GLU A 1 43  ? 31.133  10.394 53.980 1.00 0.00   ? 46  GLU A HB2  1  
ATOM   636    H  HB3  . GLU A 1 43  ? 32.559  9.494  54.497 1.00 0.00   ? 46  GLU A HB3  1  
ATOM   637    H  HG2  . GLU A 1 43  ? 31.172  7.776  55.513 1.00 0.00   ? 46  GLU A HG2  1  
ATOM   638    H  HG3  . GLU A 1 43  ? 29.711  8.705  55.173 1.00 0.00   ? 46  GLU A HG3  1  
ATOM   639    N  N    . GLU A 1 44  ? 33.415  11.719 56.942 1.00 10.88  ? 47  GLU A N    1  
ATOM   640    C  CA   . GLU A 1 44  ? 34.381  12.856 56.916 1.00 11.18  ? 47  GLU A CA   1  
ATOM   641    C  C    . GLU A 1 44  ? 35.620  12.421 56.128 1.00 11.84  ? 47  GLU A C    1  
ATOM   642    O  O    . GLU A 1 44  ? 36.373  11.575 56.570 1.00 13.00  ? 47  GLU A O    1  
ATOM   643    C  CB   . GLU A 1 44  ? 34.784  13.222 58.347 1.00 11.26  ? 47  GLU A CB   1  
ATOM   644    C  CG   . GLU A 1 44  ? 33.542  13.643 59.135 1.00 11.72  ? 47  GLU A CG   1  
ATOM   645    C  CD   . GLU A 1 44  ? 33.859  13.633 60.632 1.00 12.23  ? 47  GLU A CD   1  
ATOM   646    O  OE1  . GLU A 1 44  ? 34.986  13.318 60.976 1.00 14.96  ? 47  GLU A OE1  1  
ATOM   647    O  OE2  . GLU A 1 44  ? 32.969  13.940 61.408 1.00 11.85  ? 47  GLU A OE2  1  
ATOM   648    H  H    . GLU A 1 44  ? 33.510  11.006 57.608 1.00 0.00   ? 47  GLU A H    1  
ATOM   649    H  HA   . GLU A 1 44  ? 33.926  13.709 56.435 1.00 0.00   ? 47  GLU A HA   1  
ATOM   650    H  HB2  . GLU A 1 44  ? 35.240  12.365 58.822 1.00 0.00   ? 47  GLU A HB2  1  
ATOM   651    H  HB3  . GLU A 1 44  ? 35.488  14.040 58.325 1.00 0.00   ? 47  GLU A HB3  1  
ATOM   652    H  HG2  . GLU A 1 44  ? 33.246  14.638 58.836 1.00 0.00   ? 47  GLU A HG2  1  
ATOM   653    H  HG3  . GLU A 1 44  ? 32.737  12.952 58.935 1.00 0.00   ? 47  GLU A HG3  1  
ATOM   654    N  N    . LYS A 1 45  ? 35.837  12.965 54.956 1.00 11.50  ? 48  LYS A N    1  
ATOM   655    C  CA   . LYS A 1 45  ? 37.012  12.536 54.177 1.00 13.24  ? 48  LYS A CA   1  
ATOM   656    C  C    . LYS A 1 45  ? 37.581  13.725 53.434 1.00 12.82  ? 48  LYS A C    1  
ATOM   657    O  O    . LYS A 1 45  ? 37.053  14.818 53.472 1.00 12.73  ? 48  LYS A O    1  
ATOM   658    C  CB   . LYS A 1 45  ? 36.596  11.458 53.174 1.00 14.86  ? 48  LYS A CB   1  
ATOM   659    C  CG   . LYS A 1 45  ? 35.385  11.944 52.375 1.00 17.12  ? 48  LYS A CG   1  
ATOM   660    C  CD   . LYS A 1 45  ? 34.897  10.824 51.455 1.00 21.24  ? 48  LYS A CD   1  
ATOM   661    C  CE   . LYS A 1 45  ? 33.760  11.345 50.574 1.00 23.43  ? 48  LYS A CE   1  
ATOM   662    N  NZ   . LYS A 1 45  ? 33.166  10.212 49.808 1.00 25.07  ? 48  LYS A NZ   1  
ATOM   663    H  H    . LYS A 1 45  ? 35.218  13.634 54.596 1.00 0.00   ? 48  LYS A H    1  
ATOM   664    H  HA   . LYS A 1 45  ? 37.760  12.135 54.844 1.00 0.00   ? 48  LYS A HA   1  
ATOM   665    H  HB2  . LYS A 1 45  ? 37.416  11.257 52.501 1.00 0.00   ? 48  LYS A HB2  1  
ATOM   666    H  HB3  . LYS A 1 45  ? 36.334  10.555 53.705 1.00 0.00   ? 48  LYS A HB3  1  
ATOM   667    H  HG2  . LYS A 1 45  ? 34.594  12.224 53.055 1.00 0.00   ? 48  LYS A HG2  1  
ATOM   668    H  HG3  . LYS A 1 45  ? 35.667  12.799 51.778 1.00 0.00   ? 48  LYS A HG3  1  
ATOM   669    H  HD2  . LYS A 1 45  ? 35.713  10.489 50.831 1.00 0.00   ? 48  LYS A HD2  1  
ATOM   670    H  HD3  . LYS A 1 45  ? 34.538  9.999  52.052 1.00 0.00   ? 48  LYS A HD3  1  
ATOM   671    H  HE2  . LYS A 1 45  ? 33.001  11.796 51.195 1.00 0.00   ? 48  LYS A HE2  1  
ATOM   672    H  HE3  . LYS A 1 45  ? 34.147  12.081 49.886 1.00 0.00   ? 48  LYS A HE3  1  
ATOM   673    H  HZ1  . LYS A 1 45  ? 33.813  9.399  49.833 1.00 0.00   ? 48  LYS A HZ1  1  
ATOM   674    H  HZ2  . LYS A 1 45  ? 33.015  10.502 48.821 1.00 0.00   ? 48  LYS A HZ2  1  
ATOM   675    H  HZ3  . LYS A 1 45  ? 32.255  9.946  50.235 1.00 0.00   ? 48  LYS A HZ3  1  
ATOM   676    N  N    . LYS A 1 46  ? 38.657  13.513 52.760 1.00 12.59  ? 49  LYS A N    1  
ATOM   677    C  CA   . LYS A 1 46  ? 39.293  14.623 51.995 1.00 12.90  ? 49  LYS A CA   1  
ATOM   678    C  C    . LYS A 1 46  ? 38.904  14.531 50.515 1.00 12.37  ? 49  LYS A C    1  
ATOM   679    O  O    . LYS A 1 46  ? 39.105  13.523 49.867 1.00 15.04  ? 49  LYS A O    1  
ATOM   680    C  CB   . LYS A 1 46  ? 40.814  14.524 52.128 1.00 13.86  ? 49  LYS A CB   1  
ATOM   681    C  CG   . LYS A 1 46  ? 41.230  14.924 53.545 1.00 17.31  ? 49  LYS A CG   1  
ATOM   682    C  CD   . LYS A 1 46  ? 42.757  14.930 53.646 1.00 21.62  ? 49  LYS A CD   1  
ATOM   683    C  CE   . LYS A 1 46  ? 43.269  13.490 53.723 1.00 26.11  ? 49  LYS A CE   1  
ATOM   684    N  NZ   . LYS A 1 46  ? 44.759  13.490 53.670 1.00 26.09  ? 49  LYS A NZ   1  
ATOM   685    H  H    . LYS A 1 46  ? 39.059  12.619 52.749 1.00 0.00   ? 49  LYS A H    1  
ATOM   686    H  HA   . LYS A 1 46  ? 38.960  15.569 52.395 1.00 0.00   ? 49  LYS A HA   1  
ATOM   687    H  HB2  . LYS A 1 46  ? 41.127  13.509 51.932 1.00 0.00   ? 49  LYS A HB2  1  
ATOM   688    H  HB3  . LYS A 1 46  ? 41.281  15.189 51.417 1.00 0.00   ? 49  LYS A HB3  1  
ATOM   689    H  HG2  . LYS A 1 46  ? 40.850  15.910 53.767 1.00 0.00   ? 49  LYS A HG2  1  
ATOM   690    H  HG3  . LYS A 1 46  ? 40.827  14.215 54.252 1.00 0.00   ? 49  LYS A HG3  1  
ATOM   691    H  HD2  . LYS A 1 46  ? 43.173  15.415 52.775 1.00 0.00   ? 49  LYS A HD2  1  
ATOM   692    H  HD3  . LYS A 1 46  ? 43.057  15.464 54.535 1.00 0.00   ? 49  LYS A HD3  1  
ATOM   693    H  HE2  . LYS A 1 46  ? 42.942  13.040 54.649 1.00 0.00   ? 49  LYS A HE2  1  
ATOM   694    H  HE3  . LYS A 1 46  ? 42.879  12.924 52.890 1.00 0.00   ? 49  LYS A HE3  1  
ATOM   695    H  HZ1  . LYS A 1 46  ? 45.118  14.404 54.009 1.00 0.00   ? 49  LYS A HZ1  1  
ATOM   696    H  HZ2  . LYS A 1 46  ? 45.071  13.338 52.691 1.00 0.00   ? 49  LYS A HZ2  1  
ATOM   697    H  HZ3  . LYS A 1 46  ? 45.126  12.726 54.275 1.00 0.00   ? 49  LYS A HZ3  1  
ATOM   698    N  N    . ILE A 1 47  ? 38.356  15.587 49.979 1.00 11.33  ? 50  ILE A N    1  
ATOM   699    C  CA   . ILE A 1 47  ? 37.956  15.598 48.549 1.00 11.33  ? 50  ILE A CA   1  
ATOM   700    C  C    . ILE A 1 47  ? 38.628  16.782 47.838 1.00 11.13  ? 50  ILE A C    1  
ATOM   701    O  O    . ILE A 1 47  ? 38.834  17.836 48.407 1.00 11.60  ? 50  ILE A O    1  
ATOM   702    C  CB   . ILE A 1 47  ? 36.436  15.738 48.446 1.00 11.64  ? 50  ILE A CB   1  
ATOM   703    C  CG1  . ILE A 1 47  ? 36.002  17.057 49.090 1.00 11.10  ? 50  ILE A CG1  1  
ATOM   704    C  CG2  . ILE A 1 47  ? 35.765  14.571 49.173 1.00 11.60  ? 50  ILE A CG2  1  
ATOM   705    C  CD1  . ILE A 1 47  ? 34.579  17.399 48.642 1.00 11.92  ? 50  ILE A CD1  1  
ATOM   706    H  H    . ILE A 1 47  ? 38.214  16.387 50.526 1.00 0.00   ? 50  ILE A H    1  
ATOM   707    H  HA   . ILE A 1 47  ? 38.265  14.675 48.081 1.00 0.00   ? 50  ILE A HA   1  
ATOM   708    H  HB   . ILE A 1 47  ? 36.144  15.729 47.405 1.00 0.00   ? 50  ILE A HB   1  
ATOM   709    H  HG12 . ILE A 1 47  ? 36.028  16.957 50.165 1.00 0.00   ? 50  ILE A HG12 1  
ATOM   710    H  HG13 . ILE A 1 47  ? 36.673  17.845 48.784 1.00 0.00   ? 50  ILE A HG13 1  
ATOM   711    H  HG21 . ILE A 1 47  ? 36.480  14.097 49.829 1.00 0.00   ? 50  ILE A HG21 1  
ATOM   712    H  HG22 . ILE A 1 47  ? 35.409  13.853 48.449 1.00 0.00   ? 50  ILE A HG22 1  
ATOM   713    H  HG23 . ILE A 1 47  ? 34.933  14.940 49.753 1.00 0.00   ? 50  ILE A HG23 1  
ATOM   714    H  HD11 . ILE A 1 47  ? 34.373  16.917 47.698 1.00 0.00   ? 50  ILE A HD11 1  
ATOM   715    H  HD12 . ILE A 1 47  ? 34.486  18.469 48.528 1.00 0.00   ? 50  ILE A HD12 1  
ATOM   716    H  HD13 . ILE A 1 47  ? 33.876  17.053 49.385 1.00 0.00   ? 50  ILE A HD13 1  
ATOM   717    N  N    . VAL A 1 48  ? 38.966  16.597 46.597 1.00 10.82  ? 51  VAL A N    1  
ATOM   718    C  CA   . VAL A 1 48  ? 39.612  17.643 45.810 1.00 10.61  ? 51  VAL A CA   1  
ATOM   719    C  C    . VAL A 1 48  ? 38.510  18.490 45.253 1.00 10.49  ? 51  VAL A C    1  
ATOM   720    O  O    . VAL A 1 48  ? 37.429  18.020 44.957 1.00 11.44  ? 51  VAL A O    1  
ATOM   721    C  CB   . VAL A 1 48  ? 40.421  17.019 44.671 1.00 11.50  ? 51  VAL A CB   1  
ATOM   722    C  CG1  . VAL A 1 48  ? 40.975  18.125 43.772 1.00 12.06  ? 51  VAL A CG1  1  
ATOM   723    C  CG2  . VAL A 1 48  ? 41.582  16.210 45.255 1.00 13.80  ? 51  VAL A CG2  1  
ATOM   724    H  H    . VAL A 1 48  ? 38.781  15.731 46.177 1.00 0.00   ? 51  VAL A H    1  
ATOM   725    H  HA   . VAL A 1 48  ? 40.256  18.238 46.441 1.00 0.00   ? 51  VAL A HA   1  
ATOM   726    H  HB   . VAL A 1 48  ? 39.783  16.369 44.090 1.00 0.00   ? 51  VAL A HB   1  
ATOM   727    H  HG11 . VAL A 1 48  ? 41.471  18.868 44.379 1.00 0.00   ? 51  VAL A HG11 1  
ATOM   728    H  HG12 . VAL A 1 48  ? 40.164  18.587 43.229 1.00 0.00   ? 51  VAL A HG12 1  
ATOM   729    H  HG13 . VAL A 1 48  ? 41.681  17.702 43.073 1.00 0.00   ? 51  VAL A HG13 1  
ATOM   730    H  HG21 . VAL A 1 48  ? 41.496  16.183 46.332 1.00 0.00   ? 51  VAL A HG21 1  
ATOM   731    H  HG22 . VAL A 1 48  ? 42.518  16.672 44.980 1.00 0.00   ? 51  VAL A HG22 1  
ATOM   732    H  HG23 . VAL A 1 48  ? 41.550  15.203 44.867 1.00 0.00   ? 51  VAL A HG23 1  
ATOM   733    N  N    . ILE A 1 49  ? 38.749  19.729 45.149 1.00 9.88   ? 52  ILE A N    1  
ATOM   734    C  CA   . ILE A 1 49  ? 37.675  20.648 44.646 1.00 10.20  ? 52  ILE A CA   1  
ATOM   735    C  C    . ILE A 1 49  ? 38.264  21.734 43.740 1.00 10.37  ? 52  ILE A C    1  
ATOM   736    O  O    . ILE A 1 49  ? 37.833  22.870 43.748 1.00 10.93  ? 52  ILE A O    1  
ATOM   737    C  CB   . ILE A 1 49  ? 36.980  21.309 45.838 1.00 9.64   ? 52  ILE A CB   1  
ATOM   738    C  CG1  . ILE A 1 49  ? 37.931  22.319 46.485 1.00 10.29  ? 52  ILE A CG1  1  
ATOM   739    C  CG2  . ILE A 1 49  ? 36.598  20.241 46.863 1.00 10.31  ? 52  ILE A CG2  1  
ATOM   740    C  CD1  . ILE A 1 49  ? 37.122  23.350 47.273 1.00 10.50  ? 52  ILE A CD1  1  
ATOM   741    H  H    . ILE A 1 49  ? 39.618  20.089 45.425 1.00 0.00   ? 52  ILE A H    1  
ATOM   742    H  HA   . ILE A 1 49  ? 36.950  20.075 44.088 1.00 0.00   ? 52  ILE A HA   1  
ATOM   743    H  HB   . ILE A 1 49  ? 36.089  21.817 45.498 1.00 0.00   ? 52  ILE A HB   1  
ATOM   744    H  HG12 . ILE A 1 49  ? 38.605  21.801 47.153 1.00 0.00   ? 52  ILE A HG12 1  
ATOM   745    H  HG13 . ILE A 1 49  ? 38.500  22.821 45.717 1.00 0.00   ? 52  ILE A HG13 1  
ATOM   746    H  HG21 . ILE A 1 49  ? 37.449  20.025 47.492 1.00 0.00   ? 52  ILE A HG21 1  
ATOM   747    H  HG22 . ILE A 1 49  ? 36.292  19.342 46.350 1.00 0.00   ? 52  ILE A HG22 1  
ATOM   748    H  HG23 . ILE A 1 49  ? 35.783  20.602 47.473 1.00 0.00   ? 52  ILE A HG23 1  
ATOM   749    H  HD11 . ILE A 1 49  ? 37.684  24.269 47.346 1.00 0.00   ? 52  ILE A HD11 1  
ATOM   750    H  HD12 . ILE A 1 49  ? 36.923  22.970 48.265 1.00 0.00   ? 52  ILE A HD12 1  
ATOM   751    H  HD13 . ILE A 1 49  ? 36.187  23.539 46.766 1.00 0.00   ? 52  ILE A HD13 1  
ATOM   752    N  N    . ASP A 1 50  ? 39.226  21.380 42.951 1.00 11.39  ? 53  ASP A N    1  
ATOM   753    C  CA   . ASP A 1 50  ? 39.861  22.361 42.002 1.00 12.97  ? 53  ASP A CA   1  
ATOM   754    C  C    . ASP A 1 50  ? 40.892  21.631 41.108 1.00 14.54  ? 53  ASP A C    1  
ATOM   755    O  O    . ASP A 1 50  ? 41.538  20.698 41.542 1.00 15.93  ? 53  ASP A O    1  
ATOM   756    C  CB   . ASP A 1 50  ? 40.568  23.457 42.803 1.00 13.32  ? 53  ASP A CB   1  
ATOM   757    C  CG   . ASP A 1 50  ? 41.980  22.994 43.165 1.00 14.89  ? 53  ASP A CG   1  
ATOM   758    O  OD1  . ASP A 1 50  ? 42.179  21.796 43.276 1.00 15.53  ? 53  ASP A OD1  1  
ATOM   759    O  OD2  . ASP A 1 50  ? 42.838  23.846 43.325 1.00 14.37  ? 53  ASP A OD2  1  
ATOM   760    H  H    . ASP A 1 50  ? 39.538  20.451 42.961 1.00 0.00   ? 53  ASP A H    1  
ATOM   761    H  HA   . ASP A 1 50  ? 39.096  22.804 41.380 1.00 0.00   ? 53  ASP A HA   1  
ATOM   762    H  HB2  . ASP A 1 50  ? 40.624  24.357 42.208 1.00 0.00   ? 53  ASP A HB2  1  
ATOM   763    H  HB3  . ASP A 1 50  ? 40.014  23.657 43.707 1.00 0.00   ? 53  ASP A HB3  1  
ATOM   764    N  N    . ASP A 1 51  ? 41.058  22.046 39.862 1.00 15.27  ? 54  ASP A N    1  
ATOM   765    C  CA   . ASP A 1 51  ? 42.053  21.361 38.972 1.00 18.46  ? 54  ASP A CA   1  
ATOM   766    C  C    . ASP A 1 51  ? 43.495  21.425 39.545 1.00 18.83  ? 54  ASP A C    1  
ATOM   767    O  O    . ASP A 1 51  ? 44.386  20.777 39.032 1.00 20.56  ? 54  ASP A O    1  
ATOM   768    C  CB   . ASP A 1 51  ? 42.034  22.032 37.597 1.00 19.36  ? 54  ASP A CB   1  
ATOM   769    C  CG   . ASP A 1 51  ? 42.396  23.511 37.746 1.00 21.75  ? 54  ASP A CG   1  
ATOM   770    O  OD1  . ASP A 1 51  ? 42.893  23.876 38.798 1.00 25.33  ? 54  ASP A OD1  1  
ATOM   771    O  OD2  . ASP A 1 51  ? 42.170  24.253 36.804 1.00 26.36  ? 54  ASP A OD2  1  
ATOM   772    H  H    . ASP A 1 51  ? 40.534  22.801 39.522 1.00 0.00   ? 54  ASP A H    1  
ATOM   773    H  HA   . ASP A 1 51  ? 41.767  20.326 38.858 1.00 0.00   ? 54  ASP A HA   1  
ATOM   774    H  HB2  . ASP A 1 51  ? 42.752  21.548 36.951 1.00 0.00   ? 54  ASP A HB2  1  
ATOM   775    H  HB3  . ASP A 1 51  ? 41.047  21.946 37.168 1.00 0.00   ? 54  ASP A HB3  1  
ATOM   776    N  N    . ALA A 1 52  ? 43.748  22.192 40.583 1.00 18.13  ? 55  ALA A N    1  
ATOM   777    C  CA   . ALA A 1 52  ? 45.136  22.270 41.137 1.00 17.97  ? 55  ALA A CA   1  
ATOM   778    C  C    . ALA A 1 52  ? 45.332  21.276 42.299 1.00 17.37  ? 55  ALA A C    1  
ATOM   779    O  O    . ALA A 1 52  ? 46.331  21.321 42.990 1.00 18.99  ? 55  ALA A O    1  
ATOM   780    C  CB   . ALA A 1 52  ? 45.396  23.690 41.641 1.00 18.46  ? 55  ALA A CB   1  
ATOM   781    H  H    . ALA A 1 52  ? 43.028  22.719 40.990 1.00 0.00   ? 55  ALA A H    1  
ATOM   782    H  HA   . ALA A 1 52  ? 45.843  22.040 40.353 1.00 0.00   ? 55  ALA A HA   1  
ATOM   783    H  HB1  . ALA A 1 52  ? 44.637  24.354 41.255 1.00 0.00   ? 55  ALA A HB1  1  
ATOM   784    H  HB2  . ALA A 1 52  ? 46.368  24.020 41.305 1.00 0.00   ? 55  ALA A HB2  1  
ATOM   785    H  HB3  . ALA A 1 52  ? 45.366  23.700 42.721 1.00 0.00   ? 55  ALA A HB3  1  
ATOM   786    N  N    . GLY A 1 53  ? 44.406  20.380 42.524 1.00 16.39  ? 56  GLY A N    1  
ATOM   787    C  CA   . GLY A 1 53  ? 44.574  19.394 43.645 1.00 15.09  ? 56  GLY A CA   1  
ATOM   788    C  C    . GLY A 1 53  ? 44.260  20.013 45.034 1.00 14.67  ? 56  GLY A C    1  
ATOM   789    O  O    . GLY A 1 53  ? 44.677  19.488 46.047 1.00 15.98  ? 56  GLY A O    1  
ATOM   790    H  H    . GLY A 1 53  ? 43.606  20.348 41.958 1.00 0.00   ? 56  GLY A H    1  
ATOM   791    H  HA2  . GLY A 1 53  ? 43.911  18.559 43.477 1.00 0.00   ? 56  GLY A HA2  1  
ATOM   792    H  HA3  . GLY A 1 53  ? 45.593  19.037 43.645 1.00 0.00   ? 56  GLY A HA3  1  
ATOM   793    N  N    . THR A 1 54  ? 43.520  21.095 45.104 1.00 13.26  ? 57  THR A N    1  
ATOM   794    C  CA   . THR A 1 54  ? 43.187  21.686 46.418 1.00 12.06  ? 57  THR A CA   1  
ATOM   795    C  C    . THR A 1 54  ? 42.331  20.673 47.150 1.00 10.80  ? 57  THR A C    1  
ATOM   796    O  O    . THR A 1 54  ? 41.535  19.980 46.549 1.00 10.77  ? 57  THR A O    1  
ATOM   797    C  CB   . THR A 1 54  ? 42.404  22.987 46.223 1.00 11.74  ? 57  THR A CB   1  
ATOM   798    O  OG1  . THR A 1 54  ? 43.277  23.992 45.725 1.00 12.00  ? 57  THR A OG1  1  
ATOM   799    C  CG2  . THR A 1 54  ? 41.815  23.436 47.561 1.00 11.99  ? 57  THR A CG2  1  
ATOM   800    H  H    . THR A 1 54  ? 43.173  21.503 44.283 1.00 0.00   ? 57  THR A H    1  
ATOM   801    H  HA   . THR A 1 54  ? 44.092  21.877 46.977 1.00 0.00   ? 57  THR A HA   1  
ATOM   802    H  HB   . THR A 1 54  ? 41.603  22.824 45.518 1.00 0.00   ? 57  THR A HB   1  
ATOM   803    H  HG1  . THR A 1 54  ? 43.223  23.984 44.767 1.00 0.00   ? 57  THR A HG1  1  
ATOM   804    H  HG21 . THR A 1 54  ? 40.984  24.103 47.382 1.00 0.00   ? 57  THR A HG21 1  
ATOM   805    H  HG22 . THR A 1 54  ? 42.572  23.951 48.133 1.00 0.00   ? 57  THR A HG22 1  
ATOM   806    H  HG23 . THR A 1 54  ? 41.472  22.573 48.111 1.00 0.00   ? 57  THR A HG23 1  
ATOM   807    N  N    . GLU A 1 55  ? 42.496  20.541 48.423 1.00 11.50  ? 58  GLU A N    1  
ATOM   808    C  CA   . GLU A 1 55  ? 41.683  19.514 49.139 1.00 12.29  ? 58  GLU A CA   1  
ATOM   809    C  C    . GLU A 1 55  ? 40.985  20.105 50.363 1.00 12.43  ? 58  GLU A C    1  
ATOM   810    O  O    . GLU A 1 55  ? 41.562  20.854 51.126 1.00 12.72  ? 58  GLU A O    1  
ATOM   811    C  CB   . GLU A 1 55  ? 42.599  18.374 49.587 1.00 13.94  ? 58  GLU A CB   1  
ATOM   812    C  CG   . GLU A 1 55  ? 43.466  17.922 48.410 1.00 16.78  ? 58  GLU A CG   1  
ATOM   813    C  CD   . GLU A 1 55  ? 44.611  17.049 48.924 1.00 19.58  ? 58  GLU A CD   1  
ATOM   814    O  OE1  . GLU A 1 55  ? 44.938  17.163 50.094 1.00 19.99  ? 58  GLU A OE1  1  
ATOM   815    O  OE2  . GLU A 1 55  ? 45.142  16.280 48.140 1.00 24.59  ? 58  GLU A OE2  1  
ATOM   816    H  H    . GLU A 1 55  ? 43.158  21.082 48.903 1.00 0.00   ? 58  GLU A H    1  
ATOM   817    H  HA   . GLU A 1 55  ? 40.939  19.120 48.464 1.00 0.00   ? 58  GLU A HA   1  
ATOM   818    H  HB2  . GLU A 1 55  ? 43.233  18.716 50.392 1.00 0.00   ? 58  GLU A HB2  1  
ATOM   819    H  HB3  . GLU A 1 55  ? 41.999  17.544 49.929 1.00 0.00   ? 58  GLU A HB3  1  
ATOM   820    H  HG2  . GLU A 1 55  ? 42.862  17.355 47.716 1.00 0.00   ? 58  GLU A HG2  1  
ATOM   821    H  HG3  . GLU A 1 55  ? 43.873  18.788 47.910 1.00 0.00   ? 58  GLU A HG3  1  
ATOM   822    N  N    . VAL A 1 56  ? 39.746  19.738 50.569 1.00 11.64  ? 59  VAL A N    1  
ATOM   823    C  CA   . VAL A 1 56  ? 38.998  20.241 51.768 1.00 12.23  ? 59  VAL A CA   1  
ATOM   824    C  C    . VAL A 1 56  ? 38.389  19.060 52.571 1.00 11.18  ? 59  VAL A C    1  
ATOM   825    O  O    . VAL A 1 56  ? 37.603  18.289 52.057 1.00 11.07  ? 59  VAL A O    1  
ATOM   826    C  CB   . VAL A 1 56  ? 37.873  21.169 51.307 1.00 12.34  ? 59  VAL A CB   1  
ATOM   827    C  CG1  . VAL A 1 56  ? 36.774  21.207 52.370 1.00 14.57  ? 59  VAL A CG1  1  
ATOM   828    C  CG2  . VAL A 1 56  ? 38.430  22.579 51.101 1.00 13.58  ? 59  VAL A CG2  1  
ATOM   829    H  H    . VAL A 1 56  ? 39.313  19.113 49.951 1.00 0.00   ? 59  VAL A H    1  
ATOM   830    H  HA   . VAL A 1 56  ? 39.675  20.791 52.405 1.00 0.00   ? 59  VAL A HA   1  
ATOM   831    H  HB   . VAL A 1 56  ? 37.462  20.802 50.377 1.00 0.00   ? 59  VAL A HB   1  
ATOM   832    H  HG11 . VAL A 1 56  ? 37.223  21.246 53.351 1.00 0.00   ? 59  VAL A HG11 1  
ATOM   833    H  HG12 . VAL A 1 56  ? 36.164  20.319 52.288 1.00 0.00   ? 59  VAL A HG12 1  
ATOM   834    H  HG13 . VAL A 1 56  ? 36.158  22.081 52.220 1.00 0.00   ? 59  VAL A HG13 1  
ATOM   835    H  HG21 . VAL A 1 56  ? 39.406  22.518 50.643 1.00 0.00   ? 59  VAL A HG21 1  
ATOM   836    H  HG22 . VAL A 1 56  ? 38.511  23.077 52.056 1.00 0.00   ? 59  VAL A HG22 1  
ATOM   837    H  HG23 . VAL A 1 56  ? 37.766  23.139 50.459 1.00 0.00   ? 59  VAL A HG23 1  
ATOM   838    N  N    . HIS A 1 57  ? 38.737  18.938 53.838 1.00 11.29  ? 60  HIS A N    1  
ATOM   839    C  CA   . HIS A 1 57  ? 38.187  17.856 54.694 1.00 11.33  ? 60  HIS A CA   1  
ATOM   840    C  C    . HIS A 1 57  ? 36.683  18.029 54.726 1.00 11.04  ? 60  HIS A C    1  
ATOM   841    O  O    . HIS A 1 57  ? 36.139  18.811 55.480 1.00 11.68  ? 60  HIS A O    1  
ATOM   842    C  CB   . HIS A 1 57  ? 38.754  17.974 56.110 1.00 12.03  ? 60  HIS A CB   1  
ATOM   843    C  CG   . HIS A 1 57  ? 40.168  17.463 56.129 1.00 12.41  ? 60  HIS A CG   1  
ATOM   844    N  ND1  . HIS A 1 57  ? 40.483  16.170 56.523 1.00 15.90  ? 60  HIS A ND1  1  
ATOM   845    C  CD2  . HIS A 1 57  ? 41.363  18.058 55.805 1.00 12.77  ? 60  HIS A CD2  1  
ATOM   846    C  CE1  . HIS A 1 57  ? 41.818  16.030 56.427 1.00 13.87  ? 60  HIS A CE1  1  
ATOM   847    N  NE2  . HIS A 1 57  ? 42.399  17.151 55.995 1.00 16.83  ? 60  HIS A NE2  1  
ATOM   848    H  H    . HIS A 1 57  ? 39.360  19.586 54.228 1.00 0.00   ? 60  HIS A H    1  
ATOM   849    H  HA   . HIS A 1 57  ? 38.437  16.892 54.275 1.00 0.00   ? 60  HIS A HA   1  
ATOM   850    H  HB2  . HIS A 1 57  ? 38.741  19.010 56.418 1.00 0.00   ? 60  HIS A HB2  1  
ATOM   851    H  HB3  . HIS A 1 57  ? 38.151  17.389 56.790 1.00 0.00   ? 60  HIS A HB3  1  
ATOM   852    H  HD1  . HIS A 1 57  ? 39.848  15.484 56.817 1.00 0.00   ? 60  HIS A HD1  1  
ATOM   853    H  HD2  . HIS A 1 57  ? 41.480  19.074 55.457 1.00 0.00   ? 60  HIS A HD2  1  
ATOM   854    H  HE1  . HIS A 1 57  ? 42.353  15.124 56.670 1.00 0.00   ? 60  HIS A HE1  1  
ATOM   855    H  HE2  . HIS A 1 57  ? 43.355  17.302 55.843 1.00 0.00   ? 60  HIS A HE2  1  
ATOM   856    N  N    . ALA A 1 58  ? 36.023  17.337 53.869 1.00 9.79   ? 61  ALA A N    1  
ATOM   857    C  CA   . ALA A 1 58  ? 34.553  17.462 53.761 1.00 9.72   ? 61  ALA A CA   1  
ATOM   858    C  C    . ALA A 1 58  ? 33.839  16.643 54.829 1.00 9.75   ? 61  ALA A C    1  
ATOM   859    O  O    . ALA A 1 58  ? 34.250  15.566 55.214 1.00 10.33  ? 61  ALA A O    1  
ATOM   860    C  CB   . ALA A 1 58  ? 34.110  16.979 52.380 1.00 10.50  ? 61  ALA A CB   1  
ATOM   861    H  H    . ALA A 1 58  ? 36.504  16.747 53.252 1.00 0.00   ? 61  ALA A H    1  
ATOM   862    H  HA   . ALA A 1 58  ? 34.279  18.500 53.871 1.00 0.00   ? 61  ALA A HA   1  
ATOM   863    H  HB1  . ALA A 1 58  ? 33.816  15.942 52.438 1.00 0.00   ? 61  ALA A HB1  1  
ATOM   864    H  HB2  . ALA A 1 58  ? 34.928  17.083 51.682 1.00 0.00   ? 61  ALA A HB2  1  
ATOM   865    H  HB3  . ALA A 1 58  ? 33.272  17.572 52.043 1.00 0.00   ? 61  ALA A HB3  1  
ATOM   866    N  N    . MET A 1 59  ? 32.743  17.168 55.268 1.00 9.36   ? 62  MET A N    1  
ATOM   867    C  CA   . MET A 1 59  ? 31.890  16.508 56.279 1.00 9.54   ? 62  MET A CA   1  
ATOM   868    C  C    . MET A 1 59  ? 30.651  16.295 55.490 1.00 9.50   ? 62  MET A C    1  
ATOM   869    O  O    . MET A 1 59  ? 30.054  17.237 55.007 1.00 10.33  ? 62  MET A O    1  
ATOM   870    C  CB   . MET A 1 59  ? 31.631  17.437 57.468 1.00 9.62   ? 62  MET A CB   1  
ATOM   871    C  CG   . MET A 1 59  ? 32.965  17.869 58.080 1.00 9.70   ? 62  MET A CG   1  
ATOM   872    S  SD   . MET A 1 59  ? 32.656  18.946 59.501 1.00 11.09  ? 62  MET A SD   1  
ATOM   873    C  CE   . MET A 1 59  ? 34.351  19.547 59.703 1.00 12.88  ? 62  MET A CE   1  
ATOM   874    H  H    . MET A 1 59  ? 32.454  18.029 54.899 1.00 0.00   ? 62  MET A H    1  
ATOM   875    H  HA   . MET A 1 59  ? 32.319  15.565 56.592 1.00 0.00   ? 62  MET A HA   1  
ATOM   876    H  HB2  . MET A 1 59  ? 31.088  18.309 57.132 1.00 0.00   ? 62  MET A HB2  1  
ATOM   877    H  HB3  . MET A 1 59  ? 31.048  16.915 58.212 1.00 0.00   ? 62  MET A HB3  1  
ATOM   878    H  HG2  . MET A 1 59  ? 33.513  16.996 58.402 1.00 0.00   ? 62  MET A HG2  1  
ATOM   879    H  HG3  . MET A 1 59  ? 33.543  18.405 57.341 1.00 0.00   ? 62  MET A HG3  1  
ATOM   880    H  HE1  . MET A 1 59  ? 34.996  19.047 58.994 1.00 0.00   ? 62  MET A HE1  1  
ATOM   881    H  HE2  . MET A 1 59  ? 34.687  19.342 60.710 1.00 0.00   ? 62  MET A HE2  1  
ATOM   882    H  HE3  . MET A 1 59  ? 34.381  20.610 59.525 1.00 0.00   ? 62  MET A HE3  1  
ATOM   883    N  N    . ALA A 1 60  ? 30.336  15.103 55.182 1.00 9.66   ? 63  ALA A N    1  
ATOM   884    C  CA   . ALA A 1 60  ? 29.240  14.971 54.233 1.00 9.55   ? 63  ALA A CA   1  
ATOM   885    C  C    . ALA A 1 60  ? 28.211  14.015 54.683 1.00 9.40   ? 63  ALA A C    1  
ATOM   886    O  O    . ALA A 1 60  ? 28.471  12.901 55.092 1.00 10.48  ? 63  ALA A O    1  
ATOM   887    C  CB   . ALA A 1 60  ? 29.798  14.504 52.889 1.00 9.66   ? 63  ALA A CB   1  
ATOM   888    H  H    . ALA A 1 60  ? 30.888  14.337 55.447 1.00 0.00   ? 63  ALA A H    1  
ATOM   889    H  HA   . ALA A 1 60  ? 28.782  15.936 54.092 1.00 0.00   ? 63  ALA A HA   1  
ATOM   890    H  HB1  . ALA A 1 60  ? 29.226  13.660 52.535 1.00 0.00   ? 63  ALA A HB1  1  
ATOM   891    H  HB2  . ALA A 1 60  ? 30.832  14.214 53.010 1.00 0.00   ? 63  ALA A HB2  1  
ATOM   892    H  HB3  . ALA A 1 60  ? 29.732  15.310 52.173 1.00 0.00   ? 63  ALA A HB3  1  
ATOM   893    N  N    . PHE A 1 61  ? 27.029  14.442 54.538 1.00 9.05   ? 64  PHE A N    1  
ATOM   894    C  CA   . PHE A 1 61  ? 25.879  13.553 54.882 1.00 9.49   ? 64  PHE A CA   1  
ATOM   895    C  C    . PHE A 1 61  ? 25.629  12.625 53.679 1.00 9.70   ? 64  PHE A C    1  
ATOM   896    O  O    . PHE A 1 61  ? 25.441  13.083 52.570 1.00 9.89   ? 64  PHE A O    1  
ATOM   897    C  CB   . PHE A 1 61  ? 24.633  14.399 55.150 1.00 9.59   ? 64  PHE A CB   1  
ATOM   898    C  CG   . PHE A 1 61  ? 24.646  14.877 56.582 1.00 9.02   ? 64  PHE A CG   1  
ATOM   899    C  CD1  . PHE A 1 61  ? 24.821  13.958 57.624 1.00 9.30   ? 64  PHE A CD1  1  
ATOM   900    C  CD2  . PHE A 1 61  ? 24.484  16.238 56.868 1.00 8.76   ? 64  PHE A CD2  1  
ATOM   901    C  CE1  . PHE A 1 61  ? 24.834  14.401 58.953 1.00 9.23   ? 64  PHE A CE1  1  
ATOM   902    C  CE2  . PHE A 1 61  ? 24.497  16.680 58.196 1.00 8.86   ? 64  PHE A CE2  1  
ATOM   903    C  CZ   . PHE A 1 61  ? 24.672  15.762 59.239 1.00 9.02   ? 64  PHE A CZ   1  
ATOM   904    H  H    . PHE A 1 61  ? 26.869  15.331 54.157 1.00 0.00   ? 64  PHE A H    1  
ATOM   905    H  HA   . PHE A 1 61  ? 26.120  12.963 55.755 1.00 0.00   ? 64  PHE A HA   1  
ATOM   906    H  HB2  . PHE A 1 61  ? 24.627  15.252 54.486 1.00 0.00   ? 64  PHE A HB2  1  
ATOM   907    H  HB3  . PHE A 1 61  ? 23.749  13.803 54.978 1.00 0.00   ? 64  PHE A HB3  1  
ATOM   908    H  HD1  . PHE A 1 61  ? 24.946  12.908 57.404 1.00 0.00   ? 64  PHE A HD1  1  
ATOM   909    H  HD2  . PHE A 1 61  ? 24.350  16.946 56.064 1.00 0.00   ? 64  PHE A HD2  1  
ATOM   910    H  HE1  . PHE A 1 61  ? 24.969  13.692 59.756 1.00 0.00   ? 64  PHE A HE1  1  
ATOM   911    H  HE2  . PHE A 1 61  ? 24.372  17.730 58.417 1.00 0.00   ? 64  PHE A HE2  1  
ATOM   912    H  HZ   . PHE A 1 61  ? 24.682  16.103 60.263 1.00 0.00   ? 64  PHE A HZ   1  
ATOM   913    N  N    . ASN A 1 62  ? 25.655  11.328 53.873 1.00 10.87  ? 65  ASN A N    1  
ATOM   914    C  CA   . ASN A 1 62  ? 25.452  10.402 52.719 1.00 11.42  ? 65  ASN A CA   1  
ATOM   915    C  C    . ASN A 1 62  ? 26.721  10.361 51.835 1.00 11.95  ? 65  ASN A C    1  
ATOM   916    O  O    . ASN A 1 62  ? 26.678  9.908  50.708 1.00 13.65  ? 65  ASN A O    1  
ATOM   917    C  CB   . ASN A 1 62  ? 24.268  10.889 51.882 1.00 12.47  ? 65  ASN A CB   1  
ATOM   918    C  CG   . ASN A 1 62  ? 23.411  9.692  51.464 1.00 14.45  ? 65  ASN A CG   1  
ATOM   919    O  OD1  . ASN A 1 62  ? 23.029  8.887  52.290 1.00 17.63  ? 65  ASN A OD1  1  
ATOM   920    N  ND2  . ASN A 1 62  ? 23.092  9.541  50.208 1.00 15.85  ? 65  ASN A ND2  1  
ATOM   921    H  H    . ASN A 1 62  ? 25.831  10.968 54.767 1.00 0.00   ? 65  ASN A H    1  
ATOM   922    H  HA   . ASN A 1 62  ? 25.243  9.410  53.090 1.00 0.00   ? 65  ASN A HA   1  
ATOM   923    H  HB2  . ASN A 1 62  ? 23.671  11.574 52.467 1.00 0.00   ? 65  ASN A HB2  1  
ATOM   924    H  HB3  . ASN A 1 62  ? 24.633  11.393 51.000 1.00 0.00   ? 65  ASN A HB3  1  
ATOM   925    H  HD21 . ASN A 1 62  ? 23.400  10.190 49.542 1.00 0.00   ? 65  ASN A HD21 1  
ATOM   926    H  HD22 . ASN A 1 62  ? 22.544  8.777  49.931 1.00 0.00   ? 65  ASN A HD22 1  
ATOM   927    N  N    . GLY A 1 63  ? 27.849  10.822 52.332 1.00 11.79  ? 66  GLY A N    1  
ATOM   928    C  CA   . GLY A 1 63  ? 29.098  10.796 51.517 1.00 12.21  ? 66  GLY A CA   1  
ATOM   929    C  C    . GLY A 1 63  ? 29.027  11.745 50.296 1.00 12.02  ? 66  GLY A C    1  
ATOM   930    O  O    . GLY A 1 63  ? 29.803  11.597 49.372 1.00 13.35  ? 66  GLY A O    1  
ATOM   931    H  H    . GLY A 1 63  ? 27.869  11.181 53.244 1.00 0.00   ? 66  GLY A H    1  
ATOM   932    H  HA2  . GLY A 1 63  ? 29.928  11.092 52.141 1.00 0.00   ? 66  GLY A HA2  1  
ATOM   933    H  HA3  . GLY A 1 63  ? 29.265  9.789  51.166 1.00 0.00   ? 66  GLY A HA3  1  
ATOM   934    N  N    . THR A 1 64  ? 28.145  12.725 50.259 1.00 10.56  ? 67  THR A N    1  
ATOM   935    C  CA   . THR A 1 64  ? 28.137  13.635 49.052 1.00 10.18  ? 67  THR A CA   1  
ATOM   936    C  C    . THR A 1 64  ? 27.815  15.114 49.405 1.00 9.49   ? 67  THR A C    1  
ATOM   937    O  O    . THR A 1 64  ? 26.855  15.401 50.092 1.00 9.48   ? 67  THR A O    1  
ATOM   938    C  CB   . THR A 1 64  ? 27.090  13.126 48.059 1.00 9.97   ? 67  THR A CB   1  
ATOM   939    O  OG1  . THR A 1 64  ? 25.812  13.128 48.679 1.00 10.04  ? 67  THR A OG1  1  
ATOM   940    C  CG2  . THR A 1 64  ? 27.446  11.705 47.622 1.00 11.45  ? 67  THR A CG2  1  
ATOM   941    H  H    . THR A 1 64  ? 27.522  12.869 51.001 1.00 0.00   ? 67  THR A H    1  
ATOM   942    H  HA   . THR A 1 64  ? 29.107  13.594 48.581 1.00 0.00   ? 67  THR A HA   1  
ATOM   943    H  HB   . THR A 1 64  ? 27.071  13.770 47.193 1.00 0.00   ? 67  THR A HB   1  
ATOM   944    H  HG1  . THR A 1 64  ? 25.658  12.254 49.045 1.00 0.00   ? 67  THR A HG1  1  
ATOM   945    H  HG21 . THR A 1 64  ? 28.150  11.279 48.321 1.00 0.00   ? 67  THR A HG21 1  
ATOM   946    H  HG22 . THR A 1 64  ? 27.887  11.731 46.637 1.00 0.00   ? 67  THR A HG22 1  
ATOM   947    H  HG23 . THR A 1 64  ? 26.551  11.100 47.600 1.00 0.00   ? 67  THR A HG23 1  
ATOM   948    N  N    . VAL A 1 65  ? 28.593  16.060 48.879 1.00 9.35   ? 68  VAL A N    1  
ATOM   949    C  CA   . VAL A 1 65  ? 28.314  17.488 49.112 1.00 8.89   ? 68  VAL A CA   1  
ATOM   950    C  C    . VAL A 1 65  ? 27.730  18.027 47.811 1.00 8.89   ? 68  VAL A C    1  
ATOM   951    O  O    . VAL A 1 65  ? 28.354  17.969 46.770 1.00 9.68   ? 68  VAL A O    1  
ATOM   952    C  CB   . VAL A 1 65  ? 29.610  18.227 49.450 1.00 9.64   ? 68  VAL A CB   1  
ATOM   953    C  CG1  . VAL A 1 65  ? 29.322  19.722 49.601 1.00 9.53   ? 68  VAL A CG1  1  
ATOM   954    C  CG2  . VAL A 1 65  ? 30.178  17.683 50.764 1.00 10.03  ? 68  VAL A CG2  1  
ATOM   955    H  H    . VAL A 1 65  ? 29.335  15.803 48.293 1.00 0.00   ? 68  VAL A H    1  
ATOM   956    H  HA   . VAL A 1 65  ? 27.599  17.599 49.914 1.00 0.00   ? 68  VAL A HA   1  
ATOM   957    H  HB   . VAL A 1 65  ? 30.327  18.077 48.656 1.00 0.00   ? 68  VAL A HB   1  
ATOM   958    H  HG11 . VAL A 1 65  ? 30.254  20.265 49.651 1.00 0.00   ? 68  VAL A HG11 1  
ATOM   959    H  HG12 . VAL A 1 65  ? 28.758  19.890 50.507 1.00 0.00   ? 68  VAL A HG12 1  
ATOM   960    H  HG13 . VAL A 1 65  ? 28.750  20.065 48.752 1.00 0.00   ? 68  VAL A HG13 1  
ATOM   961    H  HG21 . VAL A 1 65  ? 29.983  18.388 51.559 1.00 0.00   ? 68  VAL A HG21 1  
ATOM   962    H  HG22 . VAL A 1 65  ? 31.243  17.539 50.663 1.00 0.00   ? 68  VAL A HG22 1  
ATOM   963    H  HG23 . VAL A 1 65  ? 29.707  16.739 50.996 1.00 0.00   ? 68  VAL A HG23 1  
ATOM   964    N  N    . PRO A 1 66  ? 26.532  18.515 47.863 1.00 8.38   ? 69  PRO A N    1  
ATOM   965    C  CA   . PRO A 1 66  ? 25.740  18.602 49.114 1.00 8.39   ? 69  PRO A CA   1  
ATOM   966    C  C    . PRO A 1 66  ? 24.948  17.327 49.408 1.00 8.28   ? 69  PRO A C    1  
ATOM   967    O  O    . PRO A 1 66  ? 24.644  16.553 48.522 1.00 9.18   ? 69  PRO A O    1  
ATOM   968    C  CB   . PRO A 1 66  ? 24.782  19.773 48.856 1.00 8.47   ? 69  PRO A CB   1  
ATOM   969    C  CG   . PRO A 1 66  ? 24.845  20.074 47.383 1.00 8.50   ? 69  PRO A CG   1  
ATOM   970    C  CD   . PRO A 1 66  ? 25.783  19.053 46.733 1.00 8.44   ? 69  PRO A CD   1  
ATOM   971    H  HA   . PRO A 1 66  ? 26.380  18.843 49.946 1.00 0.00   ? 69  PRO A HA   1  
ATOM   972    H  HB2  . PRO A 1 66  ? 23.776  19.494 49.135 1.00 0.00   ? 69  PRO A HB2  1  
ATOM   973    H  HB3  . PRO A 1 66  ? 25.096  20.638 49.419 1.00 0.00   ? 69  PRO A HB3  1  
ATOM   974    H  HG2  . PRO A 1 66  ? 23.857  19.996 46.951 1.00 0.00   ? 69  PRO A HG2  1  
ATOM   975    H  HG3  . PRO A 1 66  ? 25.235  21.069 47.229 1.00 0.00   ? 69  PRO A HG3  1  
ATOM   976    H  HD2  . PRO A 1 66  ? 25.214  18.275 46.243 1.00 0.00   ? 69  PRO A HD2  1  
ATOM   977    H  HD3  . PRO A 1 66  ? 26.450  19.537 46.037 1.00 0.00   ? 69  PRO A HD3  1  
ATOM   978    N  N    . GLY A 1 67  ? 24.603  17.111 50.648 1.00 8.64   ? 70  GLY A N    1  
ATOM   979    C  CA   . GLY A 1 67  ? 23.824  15.900 50.998 1.00 8.31   ? 70  GLY A CA   1  
ATOM   980    C  C    . GLY A 1 67  ? 22.771  15.669 49.923 1.00 8.06   ? 70  GLY A C    1  
ATOM   981    O  O    . GLY A 1 67  ? 22.603  16.467 49.021 1.00 8.56   ? 70  GLY A O    1  
ATOM   982    H  H    . GLY A 1 67  ? 24.852  17.753 51.345 1.00 0.00   ? 70  GLY A H    1  
ATOM   983    H  HA2  . GLY A 1 67  ? 24.486  15.047 51.052 1.00 0.00   ? 70  GLY A HA2  1  
ATOM   984    H  HA3  . GLY A 1 67  ? 23.338  16.044 51.951 1.00 0.00   ? 70  GLY A HA3  1  
ATOM   985    N  N    . PRO A 1 68  ? 22.073  14.582 50.017 1.00 7.95   ? 71  PRO A N    1  
ATOM   986    C  CA   . PRO A 1 68  ? 21.013  14.213 49.040 1.00 8.29   ? 71  PRO A CA   1  
ATOM   987    C  C    . PRO A 1 68  ? 19.683  14.914 49.326 1.00 8.10   ? 71  PRO A C    1  
ATOM   988    O  O    . PRO A 1 68  ? 19.358  15.209 50.459 1.00 8.17   ? 71  PRO A O    1  
ATOM   989    C  CB   . PRO A 1 68  ? 20.872  12.704 49.232 1.00 8.89   ? 71  PRO A CB   1  
ATOM   990    C  CG   . PRO A 1 68  ? 21.254  12.449 50.655 1.00 8.85   ? 71  PRO A CG   1  
ATOM   991    C  CD   . PRO A 1 68  ? 22.216  13.568 51.073 1.00 8.85   ? 71  PRO A CD   1  
ATOM   992    H  HA   . PRO A 1 68  ? 21.339  14.419 48.034 1.00 0.00   ? 71  PRO A HA   1  
ATOM   993    H  HB2  . PRO A 1 68  ? 19.849  12.400 49.055 1.00 0.00   ? 71  PRO A HB2  1  
ATOM   994    H  HB3  . PRO A 1 68  ? 21.541  12.177 48.570 1.00 0.00   ? 71  PRO A HB3  1  
ATOM   995    H  HG2  . PRO A 1 68  ? 20.372  12.464 51.281 1.00 0.00   ? 71  PRO A HG2  1  
ATOM   996    H  HG3  . PRO A 1 68  ? 21.751  11.495 50.738 1.00 0.00   ? 71  PRO A HG3  1  
ATOM   997    H  HD2  . PRO A 1 68  ? 21.927  13.974 52.033 1.00 0.00   ? 71  PRO A HD2  1  
ATOM   998    H  HD3  . PRO A 1 68  ? 23.231  13.203 51.104 1.00 0.00   ? 71  PRO A HD3  1  
ATOM   999    N  N    . LEU A 1 69  ? 18.909  15.180 48.309 1.00 8.23   ? 72  LEU A N    1  
ATOM   1000   C  CA   . LEU A 1 69  ? 17.596  15.859 48.533 1.00 7.84   ? 72  LEU A CA   1  
ATOM   1001   C  C    . LEU A 1 69  ? 16.498  14.830 48.867 1.00 8.59   ? 72  LEU A C    1  
ATOM   1002   O  O    . LEU A 1 69  ? 16.165  13.977 48.067 1.00 10.48  ? 72  LEU A O    1  
ATOM   1003   C  CB   . LEU A 1 69  ? 17.202  16.624 47.267 1.00 8.21   ? 72  LEU A CB   1  
ATOM   1004   C  CG   . LEU A 1 69  ? 15.861  17.324 47.490 1.00 8.54   ? 72  LEU A CG   1  
ATOM   1005   C  CD1  . LEU A 1 69  ? 16.097  18.817 47.724 1.00 9.70   ? 72  LEU A CD1  1  
ATOM   1006   C  CD2  . LEU A 1 69  ? 14.977  17.136 46.255 1.00 9.38   ? 72  LEU A CD2  1  
ATOM   1007   H  H    . LEU A 1 69  ? 19.186  14.932 47.402 1.00 0.00   ? 72  LEU A H    1  
ATOM   1008   H  HA   . LEU A 1 69  ? 17.692  16.556 49.352 1.00 0.00   ? 72  LEU A HA   1  
ATOM   1009   H  HB2  . LEU A 1 69  ? 17.961  17.359 47.041 1.00 0.00   ? 72  LEU A HB2  1  
ATOM   1010   H  HB3  . LEU A 1 69  ? 17.113  15.933 46.442 1.00 0.00   ? 72  LEU A HB3  1  
ATOM   1011   H  HG   . LEU A 1 69  ? 15.372  16.898 48.354 1.00 0.00   ? 72  LEU A HG   1  
ATOM   1012   H  HD11 . LEU A 1 69  ? 16.832  18.948 48.505 1.00 0.00   ? 72  LEU A HD11 1  
ATOM   1013   H  HD12 . LEU A 1 69  ? 15.170  19.287 48.019 1.00 0.00   ? 72  LEU A HD12 1  
ATOM   1014   H  HD13 . LEU A 1 69  ? 16.457  19.272 46.812 1.00 0.00   ? 72  LEU A HD13 1  
ATOM   1015   H  HD21 . LEU A 1 69  ? 14.939  16.088 45.997 1.00 0.00   ? 72  LEU A HD21 1  
ATOM   1016   H  HD22 . LEU A 1 69  ? 15.390  17.696 45.429 1.00 0.00   ? 72  LEU A HD22 1  
ATOM   1017   H  HD23 . LEU A 1 69  ? 13.980  17.491 46.469 1.00 0.00   ? 72  LEU A HD23 1  
ATOM   1018   N  N    . MET A 1 70  ? 15.919  14.929 50.040 1.00 8.43   ? 73  MET A N    1  
ATOM   1019   C  CA   . MET A 1 70  ? 14.840  14.011 50.440 1.00 8.80   ? 73  MET A CA   1  
ATOM   1020   C  C    . MET A 1 70  ? 13.544  14.674 50.028 1.00 8.98   ? 73  MET A C    1  
ATOM   1021   O  O    . MET A 1 70  ? 13.411  15.881 50.077 1.00 8.95   ? 73  MET A O    1  
ATOM   1022   C  CB   . MET A 1 70  ? 14.863  13.803 51.956 1.00 8.92   ? 73  MET A CB   1  
ATOM   1023   C  CG   . MET A 1 70  ? 16.069  12.941 52.334 1.00 9.52   ? 73  MET A CG   1  
ATOM   1024   S  SD   . MET A 1 70  ? 16.302  12.984 54.129 1.00 10.39  ? 73  MET A SD   1  
ATOM   1025   C  CE   . MET A 1 70  ? 17.566  14.278 54.163 1.00 10.64  ? 73  MET A CE   1  
ATOM   1026   H  H    . MET A 1 70  ? 16.198  15.640 50.654 1.00 0.00   ? 73  MET A H    1  
ATOM   1027   H  HA   . MET A 1 70  ? 14.950  13.065 49.931 1.00 0.00   ? 73  MET A HA   1  
ATOM   1028   H  HB2  . MET A 1 70  ? 14.935  14.761 52.450 1.00 0.00   ? 73  MET A HB2  1  
ATOM   1029   H  HB3  . MET A 1 70  ? 13.956  13.305 52.265 1.00 0.00   ? 73  MET A HB3  1  
ATOM   1030   H  HG2  . MET A 1 70  ? 15.897  11.923 52.018 1.00 0.00   ? 73  MET A HG2  1  
ATOM   1031   H  HG3  . MET A 1 70  ? 16.953  13.325 51.847 1.00 0.00   ? 73  MET A HG3  1  
ATOM   1032   H  HE1  . MET A 1 70  ? 17.578  14.794 53.212 1.00 0.00   ? 73  MET A HE1  1  
ATOM   1033   H  HE2  . MET A 1 70  ? 18.533  13.831 54.348 1.00 0.00   ? 73  MET A HE2  1  
ATOM   1034   H  HE3  . MET A 1 70  ? 17.342  14.982 54.948 1.00 0.00   ? 73  MET A HE3  1  
ATOM   1035   N  N    . VAL A 1 71  ? 12.608  13.920 49.584 1.00 9.00   ? 74  VAL A N    1  
ATOM   1036   C  CA   . VAL A 1 71  ? 11.337  14.538 49.123 1.00 8.98   ? 74  VAL A CA   1  
ATOM   1037   C  C    . VAL A 1 71  ? 10.112  13.824 49.699 1.00 9.41   ? 74  VAL A C    1  
ATOM   1038   O  O    . VAL A 1 71  ? 9.883   12.651 49.476 1.00 10.66  ? 74  VAL A O    1  
ATOM   1039   C  CB   . VAL A 1 71  ? 11.278  14.477 47.596 1.00 9.82   ? 74  VAL A CB   1  
ATOM   1040   C  CG1  . VAL A 1 71  ? 9.953   15.068 47.112 1.00 9.61   ? 74  VAL A CG1  1  
ATOM   1041   C  CG2  . VAL A 1 71  ? 12.439  15.283 47.009 1.00 10.01  ? 74  VAL A CG2  1  
ATOM   1042   H  H    . VAL A 1 71  ? 12.740  12.951 49.519 1.00 0.00   ? 74  VAL A H    1  
ATOM   1043   H  HA   . VAL A 1 71  ? 11.318  15.572 49.430 1.00 0.00   ? 74  VAL A HA   1  
ATOM   1044   H  HB   . VAL A 1 71  ? 11.352  13.448 47.274 1.00 0.00   ? 74  VAL A HB   1  
ATOM   1045   H  HG11 . VAL A 1 71  ? 10.121  15.637 46.209 1.00 0.00   ? 74  VAL A HG11 1  
ATOM   1046   H  HG12 . VAL A 1 71  ? 9.548   15.716 47.875 1.00 0.00   ? 74  VAL A HG12 1  
ATOM   1047   H  HG13 . VAL A 1 71  ? 9.255   14.270 46.910 1.00 0.00   ? 74  VAL A HG13 1  
ATOM   1048   H  HG21 . VAL A 1 71  ? 12.604  14.983 45.985 1.00 0.00   ? 74  VAL A HG21 1  
ATOM   1049   H  HG22 . VAL A 1 71  ? 13.333  15.099 47.587 1.00 0.00   ? 74  VAL A HG22 1  
ATOM   1050   H  HG23 . VAL A 1 71  ? 12.200  16.335 47.042 1.00 0.00   ? 74  VAL A HG23 1  
ATOM   1051   N  N    . VAL A 1 72  ? 9.305   14.565 50.398 1.00 9.03   ? 75  VAL A N    1  
ATOM   1052   C  CA   . VAL A 1 72  ? 8.045   14.032 50.975 1.00 9.31   ? 75  VAL A CA   1  
ATOM   1053   C  C    . VAL A 1 72  ? 6.941   15.068 50.702 1.00 9.53   ? 75  VAL A C    1  
ATOM   1054   O  O    . VAL A 1 72  ? 7.192   16.107 50.124 1.00 9.68   ? 75  VAL A O    1  
ATOM   1055   C  CB   . VAL A 1 72  ? 8.208   13.834 52.484 1.00 10.18  ? 75  VAL A CB   1  
ATOM   1056   C  CG1  . VAL A 1 72  ? 9.452   12.986 52.756 1.00 10.24  ? 75  VAL A CG1  1  
ATOM   1057   C  CG2  . VAL A 1 72  ? 8.362   15.197 53.162 1.00 10.88  ? 75  VAL A CG2  1  
ATOM   1058   H  H    . VAL A 1 72  ? 9.517   15.514 50.517 1.00 0.00   ? 75  VAL A H    1  
ATOM   1059   H  HA   . VAL A 1 72  ? 7.793   13.093 50.503 1.00 0.00   ? 75  VAL A HA   1  
ATOM   1060   H  HB   . VAL A 1 72  ? 7.337   13.330 52.877 1.00 0.00   ? 75  VAL A HB   1  
ATOM   1061   H  HG11 . VAL A 1 72  ? 10.029  12.892 51.848 1.00 0.00   ? 75  VAL A HG11 1  
ATOM   1062   H  HG12 . VAL A 1 72  ? 9.152   12.006 53.096 1.00 0.00   ? 75  VAL A HG12 1  
ATOM   1063   H  HG13 . VAL A 1 72  ? 10.053  13.463 53.517 1.00 0.00   ? 75  VAL A HG13 1  
ATOM   1064   H  HG21 . VAL A 1 72  ? 7.760   15.928 52.643 1.00 0.00   ? 75  VAL A HG21 1  
ATOM   1065   H  HG22 . VAL A 1 72  ? 9.399   15.498 53.133 1.00 0.00   ? 75  VAL A HG22 1  
ATOM   1066   H  HG23 . VAL A 1 72  ? 8.037   15.126 54.189 1.00 0.00   ? 75  VAL A HG23 1  
ATOM   1067   N  N    . HIS A 1 73  ? 5.730   14.803 51.103 1.00 10.03  ? 76  HIS A N    1  
ATOM   1068   C  CA   . HIS A 1 73  ? 4.639   15.769 50.860 1.00 10.19  ? 76  HIS A CA   1  
ATOM   1069   C  C    . HIS A 1 73  ? 4.297   16.474 52.167 1.00 10.17  ? 76  HIS A C    1  
ATOM   1070   O  O    . HIS A 1 73  ? 4.759   16.110 53.230 1.00 10.00  ? 76  HIS A O    1  
ATOM   1071   C  CB   . HIS A 1 73  ? 3.405   15.028 50.340 1.00 10.61  ? 76  HIS A CB   1  
ATOM   1072   C  CG   . HIS A 1 73  ? 3.637   14.606 48.916 1.00 10.26  ? 76  HIS A CG   1  
ATOM   1073   N  ND1  . HIS A 1 73  ? 4.358   13.465 48.590 1.00 11.47  ? 76  HIS A ND1  1  
ATOM   1074   C  CD2  . HIS A 1 73  ? 3.250   15.160 47.720 1.00 11.28  ? 76  HIS A CD2  1  
ATOM   1075   C  CE1  . HIS A 1 73  ? 4.383   13.370 47.247 1.00 12.07  ? 76  HIS A CE1  1  
ATOM   1076   N  NE2  . HIS A 1 73  ? 3.723   14.377 46.673 1.00 11.45  ? 76  HIS A NE2  1  
ATOM   1077   H  H    . HIS A 1 73  ? 5.542   13.960 51.567 1.00 0.00   ? 76  HIS A H    1  
ATOM   1078   H  HA   . HIS A 1 73  ? 4.957   16.497 50.129 1.00 0.00   ? 76  HIS A HA   1  
ATOM   1079   H  HB2  . HIS A 1 73  ? 3.226   14.155 50.951 1.00 0.00   ? 76  HIS A HB2  1  
ATOM   1080   H  HB3  . HIS A 1 73  ? 2.547   15.681 50.386 1.00 0.00   ? 76  HIS A HB3  1  
ATOM   1081   H  HD1  . HIS A 1 73  ? 4.774   12.842 49.222 1.00 0.00   ? 76  HIS A HD1  1  
ATOM   1082   H  HD2  . HIS A 1 73  ? 2.669   16.064 47.610 1.00 0.00   ? 76  HIS A HD2  1  
ATOM   1083   H  HE1  . HIS A 1 73  ? 4.875   12.578 46.703 1.00 0.00   ? 76  HIS A HE1  1  
ATOM   1084   H  HE2  . HIS A 1 73  ? 3.598   14.533 45.713 1.00 0.00   ? 76  HIS A HE2  1  
ATOM   1085   N  N    . GLN A 1 74  ? 3.491   17.480 52.085 1.00 10.44  ? 77  GLN A N    1  
ATOM   1086   C  CA   . GLN A 1 74  ? 3.093   18.238 53.291 1.00 11.32  ? 77  GLN A CA   1  
ATOM   1087   C  C    . GLN A 1 74  ? 2.209   17.351 54.148 1.00 11.31  ? 77  GLN A C    1  
ATOM   1088   O  O    . GLN A 1 74  ? 1.312   16.690 53.664 1.00 12.05  ? 77  GLN A O    1  
ATOM   1089   C  CB   . GLN A 1 74  ? 2.320   19.492 52.880 1.00 11.50  ? 77  GLN A CB   1  
ATOM   1090   C  CG   . GLN A 1 74  ? 1.877   20.253 54.131 1.00 12.47  ? 77  GLN A CG   1  
ATOM   1091   C  CD   . GLN A 1 74  ? 1.127   21.521 53.719 1.00 14.65  ? 77  GLN A CD   1  
ATOM   1092   O  OE1  . GLN A 1 74  ? 0.786   22.336 54.553 1.00 22.78  ? 77  GLN A OE1  1  
ATOM   1093   N  NE2  . GLN A 1 74  ? 0.854   21.723 52.459 1.00 17.48  ? 77  GLN A NE2  1  
ATOM   1094   H  H    . GLN A 1 74  ? 3.139   17.746 51.210 1.00 0.00   ? 77  GLN A H    1  
ATOM   1095   H  HA   . GLN A 1 74  ? 3.974   18.520 53.849 1.00 0.00   ? 77  GLN A HA   1  
ATOM   1096   H  HB2  . GLN A 1 74  ? 2.956   20.126 52.278 1.00 0.00   ? 77  GLN A HB2  1  
ATOM   1097   H  HB3  . GLN A 1 74  ? 1.450   19.207 52.307 1.00 0.00   ? 77  GLN A HB3  1  
ATOM   1098   H  HG2  . GLN A 1 74  ? 1.227   19.625 54.723 1.00 0.00   ? 77  GLN A HG2  1  
ATOM   1099   H  HG3  . GLN A 1 74  ? 2.745   20.524 54.714 1.00 0.00   ? 77  GLN A HG3  1  
ATOM   1100   H  HE21 . GLN A 1 74  ? 1.129   21.065 51.787 1.00 0.00   ? 77  GLN A HE21 1  
ATOM   1101   H  HE22 . GLN A 1 74  ? 0.373   22.532 52.185 1.00 0.00   ? 77  GLN A HE22 1  
ATOM   1102   N  N    . ASP A 1 75  ? 2.466   17.321 55.411 1.00 12.06  ? 78  ASP A N    1  
ATOM   1103   C  CA   . ASP A 1 75  ? 1.654   16.461 56.317 1.00 12.53  ? 78  ASP A CA   1  
ATOM   1104   C  C    . ASP A 1 75  ? 2.436   15.181 56.634 1.00 12.15  ? 78  ASP A C    1  
ATOM   1105   O  O    . ASP A 1 75  ? 2.398   14.676 57.738 1.00 12.95  ? 78  ASP A O    1  
ATOM   1106   C  CB   . ASP A 1 75  ? 0.336   16.097 55.629 1.00 13.20  ? 78  ASP A CB   1  
ATOM   1107   C  CG   . ASP A 1 75  ? -0.171  17.297 54.829 1.00 15.81  ? 78  ASP A CG   1  
ATOM   1108   O  OD1  . ASP A 1 75  ? 0.047   18.414 55.270 1.00 17.32  ? 78  ASP A OD1  1  
ATOM   1109   O  OD2  . ASP A 1 75  ? -0.769  17.080 53.788 1.00 21.42  ? 78  ASP A OD2  1  
ATOM   1110   H  H    . ASP A 1 75  ? 3.203   17.855 55.774 1.00 0.00   ? 78  ASP A H    1  
ATOM   1111   H  HA   . ASP A 1 75  ? 1.448   16.994 57.233 1.00 0.00   ? 78  ASP A HA   1  
ATOM   1112   H  HB2  . ASP A 1 75  ? 0.496   15.260 54.964 1.00 0.00   ? 78  ASP A HB2  1  
ATOM   1113   H  HB3  . ASP A 1 75  ? -0.397  15.828 56.375 1.00 0.00   ? 78  ASP A HB3  1  
ATOM   1114   N  N    . ASP A 1 76  ? 3.149   14.655 55.672 1.00 11.02  ? 79  ASP A N    1  
ATOM   1115   C  CA   . ASP A 1 76  ? 3.934   13.417 55.913 1.00 10.90  ? 79  ASP A CA   1  
ATOM   1116   C  C    . ASP A 1 76  ? 5.053   13.711 56.912 1.00 10.59  ? 79  ASP A C    1  
ATOM   1117   O  O    . ASP A 1 76  ? 5.552   14.816 57.000 1.00 10.41  ? 79  ASP A O    1  
ATOM   1118   C  CB   . ASP A 1 76  ? 4.541   12.933 54.594 1.00 10.45  ? 79  ASP A CB   1  
ATOM   1119   C  CG   . ASP A 1 76  ? 3.424   12.476 53.655 1.00 11.07  ? 79  ASP A CG   1  
ATOM   1120   O  OD1  . ASP A 1 76  ? 2.348   12.177 54.147 1.00 12.09  ? 79  ASP A OD1  1  
ATOM   1121   O  OD2  . ASP A 1 76  ? 3.663   12.433 52.459 1.00 12.10  ? 79  ASP A OD2  1  
ATOM   1122   H  H    . ASP A 1 76  ? 3.167   15.081 54.789 1.00 0.00   ? 79  ASP A H    1  
ATOM   1123   H  HA   . ASP A 1 76  ? 3.286   12.652 56.313 1.00 0.00   ? 79  ASP A HA   1  
ATOM   1124   H  HB2  . ASP A 1 76  ? 5.092   13.741 54.134 1.00 0.00   ? 79  ASP A HB2  1  
ATOM   1125   H  HB3  . ASP A 1 76  ? 5.208   12.106 54.787 1.00 0.00   ? 79  ASP A HB3  1  
ATOM   1126   N  N    . TYR A 1 77  ? 5.445   12.726 57.663 1.00 9.86   ? 80  TYR A N    1  
ATOM   1127   C  CA   . TYR A 1 77  ? 6.527   12.920 58.663 1.00 10.05  ? 80  TYR A CA   1  
ATOM   1128   C  C    . TYR A 1 77  ? 7.827   12.285 58.156 1.00 10.21  ? 80  TYR A C    1  
ATOM   1129   O  O    . TYR A 1 77  ? 7.856   11.156 57.706 1.00 11.49  ? 80  TYR A O    1  
ATOM   1130   C  CB   . TYR A 1 77  ? 6.122   12.262 59.984 1.00 10.19  ? 80  TYR A CB   1  
ATOM   1131   C  CG   . TYR A 1 77  ? 4.796   12.821 60.440 1.00 10.36  ? 80  TYR A CG   1  
ATOM   1132   C  CD1  . TYR A 1 77  ? 3.636   12.565 59.698 1.00 11.41  ? 80  TYR A CD1  1  
ATOM   1133   C  CD2  . TYR A 1 77  ? 4.726   13.596 61.603 1.00 9.79   ? 80  TYR A CD2  1  
ATOM   1134   C  CE1  . TYR A 1 77  ? 2.406   13.084 60.121 1.00 11.49  ? 80  TYR A CE1  1  
ATOM   1135   C  CE2  . TYR A 1 77  ? 3.496   14.115 62.026 1.00 10.76  ? 80  TYR A CE2  1  
ATOM   1136   C  CZ   . TYR A 1 77  ? 2.337   13.859 61.285 1.00 10.43  ? 80  TYR A CZ   1  
ATOM   1137   O  OH   . TYR A 1 77  ? 1.125   14.371 61.702 1.00 12.90  ? 80  TYR A OH   1  
ATOM   1138   H  H    . TYR A 1 77  ? 5.023   11.847 57.569 1.00 0.00   ? 80  TYR A H    1  
ATOM   1139   H  HA   . TYR A 1 77  ? 6.682   13.976 58.823 1.00 0.00   ? 80  TYR A HA   1  
ATOM   1140   H  HB2  . TYR A 1 77  ? 6.033   11.194 59.841 1.00 0.00   ? 80  TYR A HB2  1  
ATOM   1141   H  HB3  . TYR A 1 77  ? 6.873   12.464 60.732 1.00 0.00   ? 80  TYR A HB3  1  
ATOM   1142   H  HD1  . TYR A 1 77  ? 3.690   11.967 58.801 1.00 0.00   ? 80  TYR A HD1  1  
ATOM   1143   H  HD2  . TYR A 1 77  ? 5.621   13.794 62.175 1.00 0.00   ? 80  TYR A HD2  1  
ATOM   1144   H  HE1  . TYR A 1 77  ? 1.512   12.887 59.550 1.00 0.00   ? 80  TYR A HE1  1  
ATOM   1145   H  HE2  . TYR A 1 77  ? 3.443   14.713 62.924 1.00 0.00   ? 80  TYR A HE2  1  
ATOM   1146   H  HH   . TYR A 1 77  ? 1.177   14.525 62.648 1.00 0.00   ? 80  TYR A HH   1  
ATOM   1147   N  N    . LEU A 1 78  ? 8.897   13.017 58.240 1.00 9.40   ? 81  LEU A N    1  
ATOM   1148   C  CA   . LEU A 1 78  ? 10.215  12.522 57.794 1.00 9.58   ? 81  LEU A CA   1  
ATOM   1149   C  C    . LEU A 1 78  ? 10.924  11.939 59.003 1.00 8.94   ? 81  LEU A C    1  
ATOM   1150   O  O    . LEU A 1 78  ? 11.061  12.568 60.033 1.00 9.77   ? 81  LEU A O    1  
ATOM   1151   C  CB   . LEU A 1 78  ? 11.036  13.678 57.220 1.00 9.22   ? 81  LEU A CB   1  
ATOM   1152   C  CG   . LEU A 1 78  ? 12.219  13.120 56.428 1.00 10.04  ? 81  LEU A CG   1  
ATOM   1153   C  CD1  . LEU A 1 78  ? 12.685  14.158 55.405 1.00 9.91   ? 81  LEU A CD1  1  
ATOM   1154   C  CD2  . LEU A 1 78  ? 13.368  12.800 57.387 1.00 9.71   ? 81  LEU A CD2  1  
ATOM   1155   H  H    . LEU A 1 78  ? 8.829   13.920 58.615 1.00 0.00   ? 81  LEU A H    1  
ATOM   1156   H  HA   . LEU A 1 78  ? 10.083  11.756 57.043 1.00 0.00   ? 81  LEU A HA   1  
ATOM   1157   H  HB2  . LEU A 1 78  ? 10.412  14.272 56.567 1.00 0.00   ? 81  LEU A HB2  1  
ATOM   1158   H  HB3  . LEU A 1 78  ? 11.404  14.294 58.026 1.00 0.00   ? 81  LEU A HB3  1  
ATOM   1159   H  HG   . LEU A 1 78  ? 11.915  12.220 55.913 1.00 0.00   ? 81  LEU A HG   1  
ATOM   1160   H  HD11 . LEU A 1 78  ? 13.740  14.347 55.538 1.00 0.00   ? 81  LEU A HD11 1  
ATOM   1161   H  HD12 . LEU A 1 78  ? 12.134  15.077 55.548 1.00 0.00   ? 81  LEU A HD12 1  
ATOM   1162   H  HD13 . LEU A 1 78  ? 12.509  13.785 54.407 1.00 0.00   ? 81  LEU A HD13 1  
ATOM   1163   H  HD21 . LEU A 1 78  ? 13.486  13.611 58.091 1.00 0.00   ? 81  LEU A HD21 1  
ATOM   1164   H  HD22 . LEU A 1 78  ? 14.282  12.676 56.825 1.00 0.00   ? 81  LEU A HD22 1  
ATOM   1165   H  HD23 . LEU A 1 78  ? 13.147  11.889 57.921 1.00 0.00   ? 81  LEU A HD23 1  
ATOM   1166   N  N    . GLU A 1 79  ? 11.343  10.731 58.886 1.00 9.33   ? 82  GLU A N    1  
ATOM   1167   C  CA   . GLU A 1 79  ? 12.017  10.045 60.008 1.00 9.80   ? 82  GLU A CA   1  
ATOM   1168   C  C    . GLU A 1 79  ? 13.369  9.660  59.497 1.00 9.98   ? 82  GLU A C    1  
ATOM   1169   O  O    . GLU A 1 79  ? 13.503  8.841  58.609 1.00 10.50  ? 82  GLU A O    1  
ATOM   1170   C  CB   . GLU A 1 79  ? 11.230  8.795  60.410 1.00 10.68  ? 82  GLU A CB   1  
ATOM   1171   C  CG   . GLU A 1 79  ? 11.779  8.248  61.730 1.00 11.77  ? 82  GLU A CG   1  
ATOM   1172   C  CD   . GLU A 1 79  ? 10.751  7.305  62.358 1.00 13.19  ? 82  GLU A CD   1  
ATOM   1173   O  OE1  . GLU A 1 79  ? 10.801  6.123  62.060 1.00 18.54  ? 82  GLU A OE1  1  
ATOM   1174   O  OE2  . GLU A 1 79  ? 9.932   7.781  63.127 1.00 14.16  ? 82  GLU A OE2  1  
ATOM   1175   H  H    . GLU A 1 79  ? 11.193  10.248 58.046 1.00 0.00   ? 82  GLU A H    1  
ATOM   1176   H  HA   . GLU A 1 79  ? 12.114  10.715 60.850 1.00 0.00   ? 82  GLU A HA   1  
ATOM   1177   H  HB2  . GLU A 1 79  ? 10.187  9.050  60.531 1.00 0.00   ? 82  GLU A HB2  1  
ATOM   1178   H  HB3  . GLU A 1 79  ? 11.331  8.043  59.642 1.00 0.00   ? 82  GLU A HB3  1  
ATOM   1179   H  HG2  . GLU A 1 79  ? 12.696  7.709  61.542 1.00 0.00   ? 82  GLU A HG2  1  
ATOM   1180   H  HG3  . GLU A 1 79  ? 11.974  9.067  62.406 1.00 0.00   ? 82  GLU A HG3  1  
ATOM   1181   N  N    . LEU A 1 80  ? 14.370  10.291 59.979 1.00 9.47   ? 83  LEU A N    1  
ATOM   1182   C  CA   . LEU A 1 80  ? 15.719  9.999  59.425 1.00 8.96   ? 83  LEU A CA   1  
ATOM   1183   C  C    . LEU A 1 80  ? 16.666  9.397  60.456 1.00 8.63   ? 83  LEU A C    1  
ATOM   1184   O  O    . LEU A 1 80  ? 16.990  10.000 61.460 1.00 8.85   ? 83  LEU A O    1  
ATOM   1185   C  CB   . LEU A 1 80  ? 16.327  11.297 58.893 1.00 8.85   ? 83  LEU A CB   1  
ATOM   1186   C  CG   . LEU A 1 80  ? 17.850  11.169 58.851 1.00 8.84   ? 83  LEU A CG   1  
ATOM   1187   C  CD1  . LEU A 1 80  ? 18.278  10.593 57.500 1.00 10.22  ? 83  LEU A CD1  1  
ATOM   1188   C  CD2  . LEU A 1 80  ? 18.483  12.549 59.039 1.00 9.74   ? 83  LEU A CD2  1  
ATOM   1189   H  H    . LEU A 1 80  ? 14.244  10.993 60.651 1.00 0.00   ? 83  LEU A H    1  
ATOM   1190   H  HA   . LEU A 1 80  ? 15.615  9.308  58.603 1.00 0.00   ? 83  LEU A HA   1  
ATOM   1191   H  HB2  . LEU A 1 80  ? 15.953  11.488 57.897 1.00 0.00   ? 83  LEU A HB2  1  
ATOM   1192   H  HB3  . LEU A 1 80  ? 16.054  12.116 59.542 1.00 0.00   ? 83  LEU A HB3  1  
ATOM   1193   H  HG   . LEU A 1 80  ? 18.177  10.510 59.642 1.00 0.00   ? 83  LEU A HG   1  
ATOM   1194   H  HD11 . LEU A 1 80  ? 19.073  11.196 57.087 1.00 0.00   ? 83  LEU A HD11 1  
ATOM   1195   H  HD12 . LEU A 1 80  ? 17.435  10.597 56.824 1.00 0.00   ? 83  LEU A HD12 1  
ATOM   1196   H  HD13 . LEU A 1 80  ? 18.626  9.580  57.634 1.00 0.00   ? 83  LEU A HD13 1  
ATOM   1197   H  HD21 . LEU A 1 80  ? 19.405  12.602 58.479 1.00 0.00   ? 83  LEU A HD21 1  
ATOM   1198   H  HD22 . LEU A 1 80  ? 18.688  12.712 60.086 1.00 0.00   ? 83  LEU A HD22 1  
ATOM   1199   H  HD23 . LEU A 1 80  ? 17.802  13.309 58.683 1.00 0.00   ? 83  LEU A HD23 1  
ATOM   1200   N  N    . THR A 1 81  ? 17.166  8.231  60.161 1.00 9.29   ? 84  THR A N    1  
ATOM   1201   C  CA   . THR A 1 81  ? 18.167  7.583  61.057 1.00 9.32   ? 84  THR A CA   1  
ATOM   1202   C  C    . THR A 1 81  ? 19.571  8.015  60.586 1.00 9.45   ? 84  THR A C    1  
ATOM   1203   O  O    . THR A 1 81  ? 20.018  7.652  59.516 1.00 9.77   ? 84  THR A O    1  
ATOM   1204   C  CB   . THR A 1 81  ? 18.036  6.060  60.963 1.00 10.17  ? 84  THR A CB   1  
ATOM   1205   O  OG1  . THR A 1 81  ? 16.813  5.654  61.560 1.00 10.55  ? 84  THR A OG1  1  
ATOM   1206   C  CG2  . THR A 1 81  ? 19.207  5.399  61.692 1.00 11.69  ? 84  THR A CG2  1  
ATOM   1207   H  H    . THR A 1 81  ? 16.922  7.799  59.316 1.00 0.00   ? 84  THR A H    1  
ATOM   1208   H  HA   . THR A 1 81  ? 18.008  7.905  62.076 1.00 0.00   ? 84  THR A HA   1  
ATOM   1209   H  HB   . THR A 1 81  ? 18.049  5.761  59.926 1.00 0.00   ? 84  THR A HB   1  
ATOM   1210   H  HG1  . THR A 1 81  ? 16.096  6.090  61.093 1.00 0.00   ? 84  THR A HG1  1  
ATOM   1211   H  HG21 . THR A 1 81  ? 19.758  6.148  62.242 1.00 0.00   ? 84  THR A HG21 1  
ATOM   1212   H  HG22 . THR A 1 81  ? 19.859  4.927  60.973 1.00 0.00   ? 84  THR A HG22 1  
ATOM   1213   H  HG23 . THR A 1 81  ? 18.829  4.655  62.378 1.00 0.00   ? 84  THR A HG23 1  
ATOM   1214   N  N    . LEU A 1 82  ? 20.243  8.816  61.367 1.00 9.32   ? 85  LEU A N    1  
ATOM   1215   C  CA   . LEU A 1 82  ? 21.559  9.314  60.998 1.00 9.31   ? 85  LEU A CA   1  
ATOM   1216   C  C    . LEU A 1 82  ? 22.557  8.461  61.705 1.00 9.43   ? 85  LEU A C    1  
ATOM   1217   O  O    . LEU A 1 82  ? 22.311  7.930  62.770 1.00 10.08  ? 85  LEU A O    1  
ATOM   1218   C  CB   . LEU A 1 82  ? 21.709  10.772 61.438 1.00 9.15   ? 85  LEU A CB   1  
ATOM   1219   C  CG   . LEU A 1 82  ? 23.052  11.317 60.949 1.00 9.58   ? 85  LEU A CG   1  
ATOM   1220   C  CD1  . LEU A 1 82  ? 22.986  11.564 59.441 1.00 10.06  ? 85  LEU A CD1  1  
ATOM   1221   C  CD2  . LEU A 1 82  ? 23.359  12.633 61.668 1.00 9.96   ? 85  LEU A CD2  1  
ATOM   1222   H  H    . LEU A 1 82  ? 19.840  9.110  62.211 1.00 0.00   ? 85  LEU A H    1  
ATOM   1223   H  HA   . LEU A 1 82  ? 21.697  9.236  59.929 1.00 0.00   ? 85  LEU A HA   1  
ATOM   1224   H  HB2  . LEU A 1 82  ? 20.906  11.360 61.017 1.00 0.00   ? 85  LEU A HB2  1  
ATOM   1225   H  HB3  . LEU A 1 82  ? 21.671  10.828 62.515 1.00 0.00   ? 85  LEU A HB3  1  
ATOM   1226   H  HG   . LEU A 1 82  ? 23.831  10.598 61.162 1.00 0.00   ? 85  LEU A HG   1  
ATOM   1227   H  HD11 . LEU A 1 82  ? 23.953  11.372 59.002 1.00 0.00   ? 85  LEU A HD11 1  
ATOM   1228   H  HD12 . LEU A 1 82  ? 22.703  12.590 59.257 1.00 0.00   ? 85  LEU A HD12 1  
ATOM   1229   H  HD13 . LEU A 1 82  ? 22.253  10.904 59.001 1.00 0.00   ? 85  LEU A HD13 1  
ATOM   1230   H  HD21 . LEU A 1 82  ? 23.497  13.417 60.938 1.00 0.00   ? 85  LEU A HD21 1  
ATOM   1231   H  HD22 . LEU A 1 82  ? 24.260  12.522 62.253 1.00 0.00   ? 85  LEU A HD22 1  
ATOM   1232   H  HD23 . LEU A 1 82  ? 22.536  12.888 62.319 1.00 0.00   ? 85  LEU A HD23 1  
ATOM   1233   N  N    . ILE A 1 83  ? 23.659  8.299  61.115 1.00 9.54   ? 86  ILE A N    1  
ATOM   1234   C  CA   . ILE A 1 83  ? 24.697  7.435  61.730 1.00 9.71   ? 86  ILE A CA   1  
ATOM   1235   C  C    . ILE A 1 83  ? 26.080  8.055  61.559 1.00 9.72   ? 86  ILE A C    1  
ATOM   1236   O  O    . ILE A 1 83  ? 26.501  8.402  60.473 1.00 9.90   ? 86  ILE A O    1  
ATOM   1237   C  CB   . ILE A 1 83  ? 24.673  6.061  61.058 1.00 9.67   ? 86  ILE A CB   1  
ATOM   1238   C  CG1  . ILE A 1 83  ? 23.317  5.397  61.306 1.00 11.40  ? 86  ILE A CG1  1  
ATOM   1239   C  CG2  . ILE A 1 83  ? 25.782  5.186  61.645 1.00 11.36  ? 86  ILE A CG2  1  
ATOM   1240   C  CD1  . ILE A 1 83  ? 23.065  4.334  60.235 1.00 12.58  ? 86  ILE A CD1  1  
ATOM   1241   H  H    . ILE A 1 83  ? 23.820  8.721  60.245 1.00 0.00   ? 86  ILE A H    1  
ATOM   1242   H  HA   . ILE A 1 83  ? 24.486  7.318  62.782 1.00 0.00   ? 86  ILE A HA   1  
ATOM   1243   H  HB   . ILE A 1 83  ? 24.831  6.177  59.996 1.00 0.00   ? 86  ILE A HB   1  
ATOM   1244   H  HG12 . ILE A 1 83  ? 23.316  4.933  62.282 1.00 0.00   ? 86  ILE A HG12 1  
ATOM   1245   H  HG13 . ILE A 1 83  ? 22.537  6.143  61.261 1.00 0.00   ? 86  ILE A HG13 1  
ATOM   1246   H  HG21 . ILE A 1 83  ? 26.701  5.751  61.689 1.00 0.00   ? 86  ILE A HG21 1  
ATOM   1247   H  HG22 . ILE A 1 83  ? 25.924  4.317  61.020 1.00 0.00   ? 86  ILE A HG22 1  
ATOM   1248   H  HG23 . ILE A 1 83  ? 25.504  4.872  62.641 1.00 0.00   ? 86  ILE A HG23 1  
ATOM   1249   H  HD11 . ILE A 1 83  ? 23.000  3.362  60.701 1.00 0.00   ? 86  ILE A HD11 1  
ATOM   1250   H  HD12 . ILE A 1 83  ? 23.878  4.339  59.525 1.00 0.00   ? 86  ILE A HD12 1  
ATOM   1251   H  HD13 . ILE A 1 83  ? 22.138  4.551  59.724 1.00 0.00   ? 86  ILE A HD13 1  
ATOM   1252   N  N    . ASN A 1 84  ? 26.789  8.172  62.638 1.00 10.12  ? 87  ASN A N    1  
ATOM   1253   C  CA   . ASN A 1 84  ? 28.167  8.741  62.604 1.00 10.58  ? 87  ASN A CA   1  
ATOM   1254   C  C    . ASN A 1 84  ? 29.145  7.622  62.964 1.00 11.38  ? 87  ASN A C    1  
ATOM   1255   O  O    . ASN A 1 84  ? 29.313  7.270  64.114 1.00 12.26  ? 87  ASN A O    1  
ATOM   1256   C  CB   . ASN A 1 84  ? 28.282  9.877  63.623 1.00 10.52  ? 87  ASN A CB   1  
ATOM   1257   C  CG   . ASN A 1 84  ? 29.569  10.664 63.367 1.00 10.22  ? 87  ASN A CG   1  
ATOM   1258   O  OD1  . ASN A 1 84  ? 30.195  10.508 62.338 1.00 11.68  ? 87  ASN A OD1  1  
ATOM   1259   N  ND2  . ASN A 1 84  ? 29.992  11.509 64.266 1.00 9.65   ? 87  ASN A ND2  1  
ATOM   1260   H  H    . ASN A 1 84  ? 26.417  7.866  63.492 1.00 0.00   ? 87  ASN A H    1  
ATOM   1261   H  HA   . ASN A 1 84  ? 28.384  9.112  61.612 1.00 0.00   ? 87  ASN A HA   1  
ATOM   1262   H  HB2  . ASN A 1 84  ? 27.431  10.535 63.526 1.00 0.00   ? 87  ASN A HB2  1  
ATOM   1263   H  HB3  . ASN A 1 84  ? 28.307  9.465  64.620 1.00 0.00   ? 87  ASN A HB3  1  
ATOM   1264   H  HD21 . ASN A 1 84  ? 29.487  11.635 65.097 1.00 0.00   ? 87  ASN A HD21 1  
ATOM   1265   H  HD22 . ASN A 1 84  ? 30.815  12.018 64.112 1.00 0.00   ? 87  ASN A HD22 1  
ATOM   1266   N  N    . PRO A 1 85  ? 29.748  7.047  61.968 1.00 12.11  ? 88  PRO A N    1  
ATOM   1267   C  CA   . PRO A 1 85  ? 30.701  5.905  62.122 1.00 13.38  ? 88  PRO A CA   1  
ATOM   1268   C  C    . PRO A 1 85  ? 31.799  6.156  63.155 1.00 13.92  ? 88  PRO A C    1  
ATOM   1269   O  O    . PRO A 1 85  ? 32.217  7.275  63.377 1.00 13.40  ? 88  PRO A O    1  
ATOM   1270   C  CB   . PRO A 1 85  ? 31.317  5.749  60.730 1.00 14.32  ? 88  PRO A CB   1  
ATOM   1271   C  CG   . PRO A 1 85  ? 30.323  6.338  59.787 1.00 16.02  ? 88  PRO A CG   1  
ATOM   1272   C  CD   . PRO A 1 85  ? 29.582  7.430  60.557 1.00 12.96  ? 88  PRO A CD   1  
ATOM   1273   H  HA   . PRO A 1 85  ? 30.162  5.006  62.371 1.00 0.00   ? 88  PRO A HA   1  
ATOM   1274   H  HB2  . PRO A 1 85  ? 32.254  6.287  60.674 1.00 0.00   ? 88  PRO A HB2  1  
ATOM   1275   H  HB3  . PRO A 1 85  ? 31.468  4.706  60.502 1.00 0.00   ? 88  PRO A HB3  1  
ATOM   1276   H  HG2  . PRO A 1 85  ? 30.832  6.763  58.932 1.00 0.00   ? 88  PRO A HG2  1  
ATOM   1277   H  HG3  . PRO A 1 85  ? 29.623  5.583  59.465 1.00 0.00   ? 88  PRO A HG3  1  
ATOM   1278   H  HD2  . PRO A 1 85  ? 30.031  8.396  60.368 1.00 0.00   ? 88  PRO A HD2  1  
ATOM   1279   H  HD3  . PRO A 1 85  ? 28.536  7.438  60.294 1.00 0.00   ? 88  PRO A HD3  1  
ATOM   1280   N  N    . GLU A 1 86  ? 32.281  5.111  63.775 1.00 14.92  ? 89  GLU A N    1  
ATOM   1281   C  CA   . GLU A 1 86  ? 33.369  5.282  64.779 1.00 16.71  ? 89  GLU A CA   1  
ATOM   1282   C  C    . GLU A 1 86  ? 34.634  5.827  64.094 1.00 16.30  ? 89  GLU A C    1  
ATOM   1283   O  O    . GLU A 1 86  ? 35.458  6.465  64.720 1.00 17.01  ? 89  GLU A O    1  
ATOM   1284   C  CB   . GLU A 1 86  ? 33.682  3.930  65.424 1.00 18.33  ? 89  GLU A CB   1  
ATOM   1285   C  CG   . GLU A 1 86  ? 34.091  2.930  64.341 1.00 22.48  ? 89  GLU A CG   1  
ATOM   1286   C  CD   . GLU A 1 86  ? 34.115  1.519  64.931 1.00 28.61  ? 89  GLU A CD   1  
ATOM   1287   O  OE1  . GLU A 1 86  ? 34.017  1.403  66.141 1.00 31.71  ? 89  GLU A OE1  1  
ATOM   1288   O  OE2  . GLU A 1 86  ? 34.230  0.579  64.162 1.00 35.14  ? 89  GLU A OE2  1  
ATOM   1289   H  H    . GLU A 1 86  ? 31.938  4.216  63.570 1.00 0.00   ? 89  GLU A H    1  
ATOM   1290   H  HA   . GLU A 1 86  ? 33.047  5.976  65.541 1.00 0.00   ? 89  GLU A HA   1  
ATOM   1291   H  HB2  . GLU A 1 86  ? 34.490  4.048  66.131 1.00 0.00   ? 89  GLU A HB2  1  
ATOM   1292   H  HB3  . GLU A 1 86  ? 32.805  3.564  65.936 1.00 0.00   ? 89  GLU A HB3  1  
ATOM   1293   H  HG2  . GLU A 1 86  ? 33.381  2.970  63.528 1.00 0.00   ? 89  GLU A HG2  1  
ATOM   1294   H  HG3  . GLU A 1 86  ? 35.075  3.181  63.973 1.00 0.00   ? 89  GLU A HG3  1  
ATOM   1295   N  N    . THR A 1 87  ? 34.803  5.580  62.816 1.00 15.42  ? 90  THR A N    1  
ATOM   1296   C  CA   . THR A 1 87  ? 36.020  6.086  62.113 1.00 16.44  ? 90  THR A CA   1  
ATOM   1297   C  C    . THR A 1 87  ? 36.058  7.622  62.146 1.00 15.69  ? 90  THR A C    1  
ATOM   1298   O  O    . THR A 1 87  ? 37.114  8.222  62.179 1.00 17.29  ? 90  THR A O    1  
ATOM   1299   C  CB   . THR A 1 87  ? 35.998  5.612  60.658 1.00 16.92  ? 90  THR A CB   1  
ATOM   1300   O  OG1  . THR A 1 87  ? 34.710  5.845  60.106 1.00 18.38  ? 90  THR A OG1  1  
ATOM   1301   C  CG2  . THR A 1 87  ? 36.318  4.117  60.602 1.00 18.62  ? 90  THR A CG2  1  
ATOM   1302   H  H    . THR A 1 87  ? 34.133  5.061  62.324 1.00 0.00   ? 90  THR A H    1  
ATOM   1303   H  HA   . THR A 1 87  ? 36.901  5.697  62.601 1.00 0.00   ? 90  THR A HA   1  
ATOM   1304   H  HB   . THR A 1 87  ? 36.738  6.155  60.091 1.00 0.00   ? 90  THR A HB   1  
ATOM   1305   H  HG1  . THR A 1 87  ? 34.583  6.794  60.039 1.00 0.00   ? 90  THR A HG1  1  
ATOM   1306   H  HG21 . THR A 1 87  ? 36.169  3.680  61.578 1.00 0.00   ? 90  THR A HG21 1  
ATOM   1307   H  HG22 . THR A 1 87  ? 37.345  3.980  60.298 1.00 0.00   ? 90  THR A HG22 1  
ATOM   1308   H  HG23 . THR A 1 87  ? 35.664  3.636  59.889 1.00 0.00   ? 90  THR A HG23 1  
ATOM   1309   N  N    . ASN A 1 88  ? 34.920  8.263  62.126 1.00 14.32  ? 91  ASN A N    1  
ATOM   1310   C  CA   . ASN A 1 88  ? 34.897  9.751  62.143 1.00 12.93  ? 91  ASN A CA   1  
ATOM   1311   C  C    . ASN A 1 88  ? 35.512  10.259 63.444 1.00 12.97  ? 91  ASN A C    1  
ATOM   1312   O  O    . ASN A 1 88  ? 35.644  9.531  64.408 1.00 13.31  ? 91  ASN A O    1  
ATOM   1313   C  CB   . ASN A 1 88  ? 33.450  10.239 62.039 1.00 12.62  ? 91  ASN A CB   1  
ATOM   1314   C  CG   . ASN A 1 88  ? 32.928  9.992  60.623 1.00 11.55  ? 91  ASN A CG   1  
ATOM   1315   O  OD1  . ASN A 1 88  ? 33.676  9.606  59.746 1.00 13.21  ? 91  ASN A OD1  1  
ATOM   1316   N  ND2  . ASN A 1 88  ? 31.667  10.199 60.360 1.00 12.60  ? 91  ASN A ND2  1  
ATOM   1317   H  H    . ASN A 1 88  ? 34.078  7.762  62.091 1.00 0.00   ? 91  ASN A H    1  
ATOM   1318   H  HA   . ASN A 1 88  ? 35.464  10.129 61.306 1.00 0.00   ? 91  ASN A HA   1  
ATOM   1319   H  HB2  . ASN A 1 88  ? 32.837  9.701  62.749 1.00 0.00   ? 91  ASN A HB2  1  
ATOM   1320   H  HB3  . ASN A 1 88  ? 33.410  11.295 62.256 1.00 0.00   ? 91  ASN A HB3  1  
ATOM   1321   H  HD21 . ASN A 1 88  ? 31.064  10.510 61.067 1.00 0.00   ? 91  ASN A HD21 1  
ATOM   1322   H  HD22 . ASN A 1 88  ? 31.323  10.044 59.455 1.00 0.00   ? 91  ASN A HD22 1  
ATOM   1323   N  N    . THR A 1 89  ? 35.889  11.505 63.479 1.00 12.89  ? 92  THR A N    1  
ATOM   1324   C  CA   . THR A 1 89  ? 36.498  12.067 64.723 1.00 14.40  ? 92  THR A CA   1  
ATOM   1325   C  C    . THR A 1 89  ? 35.760  13.339 65.213 1.00 12.77  ? 92  THR A C    1  
ATOM   1326   O  O    . THR A 1 89  ? 36.226  14.001 66.118 1.00 13.45  ? 92  THR A O    1  
ATOM   1327   C  CB   . THR A 1 89  ? 37.962  12.416 64.447 1.00 15.65  ? 92  THR A CB   1  
ATOM   1328   O  OG1  . THR A 1 89  ? 38.034  13.700 63.842 1.00 20.27  ? 92  THR A OG1  1  
ATOM   1329   C  CG2  . THR A 1 89  ? 38.570  11.373 63.509 1.00 19.82  ? 92  THR A CG2  1  
ATOM   1330   H  H    . THR A 1 89  ? 35.772  12.075 62.690 1.00 0.00   ? 92  THR A H    1  
ATOM   1331   H  HA   . THR A 1 89  ? 36.460  11.319 65.501 1.00 0.00   ? 92  THR A HA   1  
ATOM   1332   H  HB   . THR A 1 89  ? 38.513  12.424 65.375 1.00 0.00   ? 92  THR A HB   1  
ATOM   1333   H  HG1  . THR A 1 89  ? 38.924  13.818 63.502 1.00 0.00   ? 92  THR A HG1  1  
ATOM   1334   H  HG21 . THR A 1 89  ? 38.713  10.446 64.045 1.00 0.00   ? 92  THR A HG21 1  
ATOM   1335   H  HG22 . THR A 1 89  ? 39.522  11.728 63.144 1.00 0.00   ? 92  THR A HG22 1  
ATOM   1336   H  HG23 . THR A 1 89  ? 37.904  11.207 62.675 1.00 0.00   ? 92  THR A HG23 1  
ATOM   1337   N  N    . LEU A 1 90  ? 34.622  13.697 64.653 1.00 11.49  ? 93  LEU A N    1  
ATOM   1338   C  CA   . LEU A 1 90  ? 33.921  14.927 65.151 1.00 10.96  ? 93  LEU A CA   1  
ATOM   1339   C  C    . LEU A 1 90  ? 32.422  14.653 65.365 1.00 9.90   ? 93  LEU A C    1  
ATOM   1340   O  O    . LEU A 1 90  ? 31.765  14.075 64.522 1.00 10.36  ? 93  LEU A O    1  
ATOM   1341   C  CB   . LEU A 1 90  ? 34.086  16.051 64.126 1.00 11.12  ? 93  LEU A CB   1  
ATOM   1342   C  CG   . LEU A 1 90  ? 35.574  16.273 63.847 1.00 12.68  ? 93  LEU A CG   1  
ATOM   1343   C  CD1  . LEU A 1 90  ? 35.736  17.091 62.565 1.00 12.93  ? 93  LEU A CD1  1  
ATOM   1344   C  CD2  . LEU A 1 90  ? 36.202  17.032 65.018 1.00 14.89  ? 93  LEU A CD2  1  
ATOM   1345   H  H    . LEU A 1 90  ? 34.236  13.164 63.927 1.00 0.00   ? 93  LEU A H    1  
ATOM   1346   H  HA   . LEU A 1 90  ? 34.364  15.233 66.087 1.00 0.00   ? 93  LEU A HA   1  
ATOM   1347   H  HB2  . LEU A 1 90  ? 33.584  15.778 63.209 1.00 0.00   ? 93  LEU A HB2  1  
ATOM   1348   H  HB3  . LEU A 1 90  ? 33.655  16.960 64.516 1.00 0.00   ? 93  LEU A HB3  1  
ATOM   1349   H  HG   . LEU A 1 90  ? 36.064  15.318 63.729 1.00 0.00   ? 93  LEU A HG   1  
ATOM   1350   H  HD11 . LEU A 1 90  ? 36.698  17.582 62.571 1.00 0.00   ? 93  LEU A HD11 1  
ATOM   1351   H  HD12 . LEU A 1 90  ? 34.953  17.833 62.509 1.00 0.00   ? 93  LEU A HD12 1  
ATOM   1352   H  HD13 . LEU A 1 90  ? 35.672  16.435 61.709 1.00 0.00   ? 93  LEU A HD13 1  
ATOM   1353   H  HD21 . LEU A 1 90  ? 35.639  17.934 65.207 1.00 0.00   ? 93  LEU A HD21 1  
ATOM   1354   H  HD22 . LEU A 1 90  ? 37.222  17.290 64.773 1.00 0.00   ? 93  LEU A HD22 1  
ATOM   1355   H  HD23 . LEU A 1 90  ? 36.190  16.409 65.899 1.00 0.00   ? 93  LEU A HD23 1  
ATOM   1356   N  N    . MET A 1 91  ? 31.866  15.082 66.482 1.00 9.87   ? 94  MET A N    1  
ATOM   1357   C  CA   . MET A 1 91  ? 30.410  14.857 66.716 1.00 9.69   ? 94  MET A CA   1  
ATOM   1358   C  C    . MET A 1 91  ? 29.607  15.772 65.783 1.00 9.26   ? 94  MET A C    1  
ATOM   1359   O  O    . MET A 1 91  ? 29.972  16.908 65.552 1.00 9.34   ? 94  MET A O    1  
ATOM   1360   C  CB   . MET A 1 91  ? 30.069  15.184 68.172 1.00 10.14  ? 94  MET A CB   1  
ATOM   1361   C  CG   . MET A 1 91  ? 28.552  15.310 68.326 1.00 10.65  ? 94  MET A CG   1  
ATOM   1362   S  SD   . MET A 1 91  ? 28.009  16.902 67.657 1.00 11.77  ? 94  MET A SD   1  
ATOM   1363   C  CE   . MET A 1 91  ? 28.257  17.877 69.161 1.00 13.02  ? 94  MET A CE   1  
ATOM   1364   H  H    . MET A 1 91  ? 32.404  15.560 67.147 1.00 0.00   ? 94  MET A H    1  
ATOM   1365   H  HA   . MET A 1 91  ? 30.166  13.825 66.509 1.00 0.00   ? 94  MET A HA   1  
ATOM   1366   H  HB2  . MET A 1 91  ? 30.433  14.393 68.813 1.00 0.00   ? 94  MET A HB2  1  
ATOM   1367   H  HB3  . MET A 1 91  ? 30.536  16.117 68.450 1.00 0.00   ? 94  MET A HB3  1  
ATOM   1368   H  HG2  . MET A 1 91  ? 28.068  14.509 67.787 1.00 0.00   ? 94  MET A HG2  1  
ATOM   1369   H  HG3  . MET A 1 91  ? 28.290  15.251 69.372 1.00 0.00   ? 94  MET A HG3  1  
ATOM   1370   H  HE1  . MET A 1 91  ? 28.903  18.716 68.943 1.00 0.00   ? 94  MET A HE1  1  
ATOM   1371   H  HE2  . MET A 1 91  ? 28.709  17.255 69.921 1.00 0.00   ? 94  MET A HE2  1  
ATOM   1372   H  HE3  . MET A 1 91  ? 27.306  18.241 69.517 1.00 0.00   ? 94  MET A HE3  1  
ATOM   1373   N  N    . HIS A 1 92  ? 28.521  15.289 65.238 1.00 8.73   ? 95  HIS A N    1  
ATOM   1374   C  CA   . HIS A 1 92  ? 27.713  16.131 64.322 1.00 8.70   ? 95  HIS A CA   1  
ATOM   1375   C  C    . HIS A 1 92  ? 26.290  16.317 64.868 1.00 8.95   ? 95  HIS A C    1  
ATOM   1376   O  O    . HIS A 1 92  ? 26.038  16.237 66.053 1.00 9.25   ? 95  HIS A O    1  
ATOM   1377   C  CB   . HIS A 1 92  ? 27.644  15.448 62.955 1.00 8.76   ? 95  HIS A CB   1  
ATOM   1378   C  CG   . HIS A 1 92  ? 29.028  15.354 62.377 1.00 8.77   ? 95  HIS A CG   1  
ATOM   1379   N  ND1  . HIS A 1 92  ? 29.666  16.449 61.835 1.00 8.56   ? 95  HIS A ND1  1  
ATOM   1380   C  CD2  . HIS A 1 92  ? 29.892  14.316 62.255 1.00 9.24   ? 95  HIS A CD2  1  
ATOM   1381   C  CE1  . HIS A 1 92  ? 30.862  16.069 61.408 1.00 9.37   ? 95  HIS A CE1  1  
ATOM   1382   N  NE2  . HIS A 1 92  ? 31.025  14.782 61.647 1.00 9.55   ? 95  HIS A NE2  1  
ATOM   1383   H  H    . HIS A 1 92  ? 28.244  14.369 65.431 1.00 0.00   ? 95  HIS A H    1  
ATOM   1384   H  HA   . HIS A 1 92  ? 28.184  17.096 64.213 1.00 0.00   ? 95  HIS A HA   1  
ATOM   1385   H  HB2  . HIS A 1 92  ? 27.232  14.456 63.069 1.00 0.00   ? 95  HIS A HB2  1  
ATOM   1386   H  HB3  . HIS A 1 92  ? 27.017  16.026 62.294 1.00 0.00   ? 95  HIS A HB3  1  
ATOM   1387   H  HD2  . HIS A 1 92  ? 29.718  13.301 62.581 1.00 0.00   ? 95  HIS A HD2  1  
ATOM   1388   H  HE1  . HIS A 1 92  ? 31.590  16.713 60.938 1.00 0.00   ? 95  HIS A HE1  1  
ATOM   1389   H  HE2  . HIS A 1 92  ? 31.819  14.252 61.426 1.00 0.00   ? 95  HIS A HE2  1  
ATOM   1390   N  N    . ASN A 1 93  ? 25.375  16.578 63.981 1.00 8.76   ? 96  ASN A N    1  
ATOM   1391   C  CA   . ASN A 1 93  ? 23.944  16.799 64.347 1.00 8.82   ? 96  ASN A CA   1  
ATOM   1392   C  C    . ASN A 1 93  ? 23.226  17.345 63.101 1.00 8.80   ? 96  ASN A C    1  
ATOM   1393   O  O    . ASN A 1 93  ? 23.859  17.869 62.206 1.00 8.72   ? 96  ASN A O    1  
ATOM   1394   C  CB   . ASN A 1 93  ? 23.852  17.817 65.486 1.00 9.01   ? 96  ASN A CB   1  
ATOM   1395   C  CG   . ASN A 1 93  ? 23.982  19.231 64.919 1.00 8.73   ? 96  ASN A CG   1  
ATOM   1396   O  OD1  . ASN A 1 93  ? 24.361  19.409 63.779 1.00 10.80  ? 96  ASN A OD1  1  
ATOM   1397   N  ND2  . ASN A 1 93  ? 23.682  20.254 65.673 1.00 10.34  ? 96  ASN A ND2  1  
ATOM   1398   H  H    . ASN A 1 93  ? 25.635  16.639 63.038 1.00 0.00   ? 96  ASN A H    1  
ATOM   1399   H  HA   . ASN A 1 93  ? 23.494  15.863 64.649 1.00 0.00   ? 96  ASN A HA   1  
ATOM   1400   H  HB2  . ASN A 1 93  ? 22.899  17.714 65.984 1.00 0.00   ? 96  ASN A HB2  1  
ATOM   1401   H  HB3  . ASN A 1 93  ? 24.649  17.640 66.193 1.00 0.00   ? 96  ASN A HB3  1  
ATOM   1402   H  HD21 . ASN A 1 93  ? 23.376  20.111 66.593 1.00 0.00   ? 96  ASN A HD21 1  
ATOM   1403   H  HD22 . ASN A 1 93  ? 23.762  21.164 65.319 1.00 0.00   ? 96  ASN A HD22 1  
ATOM   1404   N  N    . ILE A 1 94  ? 21.924  17.225 63.011 1.00 8.83   ? 97  ILE A N    1  
ATOM   1405   C  CA   . ILE A 1 94  ? 21.231  17.740 61.793 1.00 8.90   ? 97  ILE A CA   1  
ATOM   1406   C  C    . ILE A 1 94  ? 20.054  18.654 62.165 1.00 8.97   ? 97  ILE A C    1  
ATOM   1407   O  O    . ILE A 1 94  ? 19.200  18.301 62.954 1.00 10.13  ? 97  ILE A O    1  
ATOM   1408   C  CB   . ILE A 1 94  ? 20.708  16.558 60.975 1.00 8.74   ? 97  ILE A CB   1  
ATOM   1409   C  CG1  . ILE A 1 94  ? 20.245  17.054 59.603 1.00 8.97   ? 97  ILE A CG1  1  
ATOM   1410   C  CG2  . ILE A 1 94  ? 19.530  15.912 61.707 1.00 9.62   ? 97  ILE A CG2  1  
ATOM   1411   C  CD1  . ILE A 1 94  ? 20.318  15.906 58.594 1.00 9.95   ? 97  ILE A CD1  1  
ATOM   1412   H  H    . ILE A 1 94  ? 21.414  16.793 63.728 1.00 0.00   ? 97  ILE A H    1  
ATOM   1413   H  HA   . ILE A 1 94  ? 21.935  18.297 61.194 1.00 0.00   ? 97  ILE A HA   1  
ATOM   1414   H  HB   . ILE A 1 94  ? 21.497  15.830 60.851 1.00 0.00   ? 97  ILE A HB   1  
ATOM   1415   H  HG12 . ILE A 1 94  ? 19.227  17.408 59.673 1.00 0.00   ? 97  ILE A HG12 1  
ATOM   1416   H  HG13 . ILE A 1 94  ? 20.885  17.859 59.276 1.00 0.00   ? 97  ILE A HG13 1  
ATOM   1417   H  HG21 . ILE A 1 94  ? 19.869  15.510 62.650 1.00 0.00   ? 97  ILE A HG21 1  
ATOM   1418   H  HG22 . ILE A 1 94  ? 19.123  15.116 61.101 1.00 0.00   ? 97  ILE A HG22 1  
ATOM   1419   H  HG23 . ILE A 1 94  ? 18.766  16.655 61.885 1.00 0.00   ? 97  ILE A HG23 1  
ATOM   1420   H  HD11 . ILE A 1 94  ? 21.316  15.493 58.590 1.00 0.00   ? 97  ILE A HD11 1  
ATOM   1421   H  HD12 . ILE A 1 94  ? 20.077  16.277 57.609 1.00 0.00   ? 97  ILE A HD12 1  
ATOM   1422   H  HD13 . ILE A 1 94  ? 19.611  15.137 58.872 1.00 0.00   ? 97  ILE A HD13 1  
ATOM   1423   N  N    . ASP A 1 95  ? 19.996  19.819 61.568 1.00 9.21   ? 98  ASP A N    1  
ATOM   1424   C  CA   . ASP A 1 95  ? 18.871  20.760 61.837 1.00 10.20  ? 98  ASP A CA   1  
ATOM   1425   C  C    . ASP A 1 95  ? 18.131  21.023 60.517 1.00 9.15   ? 98  ASP A C    1  
ATOM   1426   O  O    . ASP A 1 95  ? 18.657  21.647 59.617 1.00 9.66   ? 98  ASP A O    1  
ATOM   1427   C  CB   . ASP A 1 95  ? 19.422  22.077 62.389 1.00 10.49  ? 98  ASP A CB   1  
ATOM   1428   C  CG   . ASP A 1 95  ? 18.471  23.220 62.029 1.00 13.68  ? 98  ASP A CG   1  
ATOM   1429   O  OD1  . ASP A 1 95  ? 17.409  22.936 61.499 1.00 17.44  ? 98  ASP A OD1  1  
ATOM   1430   O  OD2  . ASP A 1 95  ? 18.821  24.360 62.288 1.00 18.98  ? 98  ASP A OD2  1  
ATOM   1431   H  H    . ASP A 1 95  ? 20.688  20.065 60.919 1.00 0.00   ? 98  ASP A H    1  
ATOM   1432   H  HA   . ASP A 1 95  ? 18.191  20.320 62.553 1.00 0.00   ? 98  ASP A HA   1  
ATOM   1433   H  HB2  . ASP A 1 95  ? 19.512  22.007 63.463 1.00 0.00   ? 98  ASP A HB2  1  
ATOM   1434   H  HB3  . ASP A 1 95  ? 20.393  22.270 61.958 1.00 0.00   ? 98  ASP A HB3  1  
ATOM   1435   N  N    . PHE A 1 96  ? 16.927  20.532 60.386 1.00 8.05   ? 99  PHE A N    1  
ATOM   1436   C  CA   . PHE A 1 96  ? 16.169  20.730 59.121 1.00 8.06   ? 99  PHE A CA   1  
ATOM   1437   C  C    . PHE A 1 96  ? 15.275  21.966 59.222 1.00 7.67   ? 99  PHE A C    1  
ATOM   1438   O  O    . PHE A 1 96  ? 14.338  22.014 59.994 1.00 8.43   ? 99  PHE A O    1  
ATOM   1439   C  CB   . PHE A 1 96  ? 15.300  19.499 58.854 1.00 7.89   ? 99  PHE A CB   1  
ATOM   1440   C  CG   . PHE A 1 96  ? 16.176  18.350 58.416 1.00 7.92   ? 99  PHE A CG   1  
ATOM   1441   C  CD1  . PHE A 1 96  ? 16.753  17.505 59.373 1.00 9.22   ? 99  PHE A CD1  1  
ATOM   1442   C  CD2  . PHE A 1 96  ? 16.412  18.129 57.054 1.00 8.01   ? 99  PHE A CD2  1  
ATOM   1443   C  CE1  . PHE A 1 96  ? 17.566  16.440 58.967 1.00 10.05  ? 99  PHE A CE1  1  
ATOM   1444   C  CE2  . PHE A 1 96  ? 17.224  17.063 56.648 1.00 8.76   ? 99  PHE A CE2  1  
ATOM   1445   C  CZ   . PHE A 1 96  ? 17.801  16.219 57.604 1.00 9.86   ? 99  PHE A CZ   1  
ATOM   1446   H  H    . PHE A 1 96  ? 16.528  20.017 61.118 1.00 0.00   ? 99  PHE A H    1  
ATOM   1447   H  HA   . PHE A 1 96  ? 16.864  20.858 58.305 1.00 0.00   ? 99  PHE A HA   1  
ATOM   1448   H  HB2  . PHE A 1 96  ? 14.774  19.227 59.758 1.00 0.00   ? 99  PHE A HB2  1  
ATOM   1449   H  HB3  . PHE A 1 96  ? 14.587  19.723 58.076 1.00 0.00   ? 99  PHE A HB3  1  
ATOM   1450   H  HD1  . PHE A 1 96  ? 16.572  17.676 60.423 1.00 0.00   ? 99  PHE A HD1  1  
ATOM   1451   H  HD2  . PHE A 1 96  ? 15.967  18.780 56.317 1.00 0.00   ? 99  PHE A HD2  1  
ATOM   1452   H  HE1  . PHE A 1 96  ? 18.011  15.789 59.704 1.00 0.00   ? 99  PHE A HE1  1  
ATOM   1453   H  HE2  . PHE A 1 96  ? 17.406  16.892 55.597 1.00 0.00   ? 99  PHE A HE2  1  
ATOM   1454   H  HZ   . PHE A 1 96  ? 18.428  15.397 57.291 1.00 0.00   ? 99  PHE A HZ   1  
ATOM   1455   N  N    . HIS A 1 97  ? 15.555  22.956 58.426 1.00 7.86   ? 100 HIS A N    1  
ATOM   1456   C  CA   . HIS A 1 97  ? 14.729  24.199 58.431 1.00 7.56   ? 100 HIS A CA   1  
ATOM   1457   C  C    . HIS A 1 97  ? 13.231  23.846 58.303 1.00 7.89   ? 100 HIS A C    1  
ATOM   1458   O  O    . HIS A 1 97  ? 12.377  24.565 58.784 1.00 9.17   ? 100 HIS A O    1  
ATOM   1459   C  CB   . HIS A 1 97  ? 15.125  25.061 57.225 1.00 7.22   ? 100 HIS A CB   1  
ATOM   1460   C  CG   . HIS A 1 97  ? 16.304  25.946 57.551 1.00 7.20   ? 100 HIS A CG   1  
ATOM   1461   N  ND1  . HIS A 1 97  ? 16.253  27.324 57.389 1.00 7.82   ? 100 HIS A ND1  1  
ATOM   1462   C  CD2  . HIS A 1 97  ? 17.578  25.676 57.984 1.00 7.58   ? 100 HIS A CD2  1  
ATOM   1463   C  CE1  . HIS A 1 97  ? 17.452  27.827 57.713 1.00 8.02   ? 100 HIS A CE1  1  
ATOM   1464   N  NE2  . HIS A 1 97  ? 18.277  26.855 58.075 1.00 8.31   ? 100 HIS A NE2  1  
ATOM   1465   H  H    . HIS A 1 97  ? 16.309  22.879 57.804 1.00 0.00   ? 100 HIS A H    1  
ATOM   1466   H  HA   . HIS A 1 97  ? 14.900  24.750 59.343 1.00 0.00   ? 100 HIS A HA   1  
ATOM   1467   H  HB2  . HIS A 1 97  ? 15.386  24.416 56.399 1.00 0.00   ? 100 HIS A HB2  1  
ATOM   1468   H  HB3  . HIS A 1 97  ? 14.285  25.678 56.940 1.00 0.00   ? 100 HIS A HB3  1  
ATOM   1469   H  HD1  . HIS A 1 97  ? 15.475  27.839 57.089 1.00 0.00   ? 100 HIS A HD1  1  
ATOM   1470   H  HD2  . HIS A 1 97  ? 17.967  24.696 58.216 1.00 0.00   ? 100 HIS A HD2  1  
ATOM   1471   H  HE1  . HIS A 1 97  ? 17.710  28.875 57.683 1.00 0.00   ? 100 HIS A HE1  1  
ATOM   1472   N  N    . ALA A 1 98  ? 12.904  22.766 57.631 1.00 8.22   ? 101 ALA A N    1  
ATOM   1473   C  CA   . ALA A 1 98  ? 11.460  22.396 57.441 1.00 8.27   ? 101 ALA A CA   1  
ATOM   1474   C  C    . ALA A 1 98  ? 10.849  21.757 58.705 1.00 8.75   ? 101 ALA A C    1  
ATOM   1475   O  O    . ALA A 1 98  ? 9.726   21.294 58.683 1.00 10.90  ? 101 ALA A O    1  
ATOM   1476   C  CB   . ALA A 1 98  ? 11.350  21.404 56.281 1.00 8.51   ? 101 ALA A CB   1  
ATOM   1477   H  H    . ALA A 1 98  ? 13.605  22.212 57.229 1.00 0.00   ? 101 ALA A H    1  
ATOM   1478   H  HA   . ALA A 1 98  ? 10.901  23.284 57.193 1.00 0.00   ? 101 ALA A HA   1  
ATOM   1479   H  HB1  . ALA A 1 98  ? 10.669  20.610 56.550 1.00 0.00   ? 101 ALA A HB1  1  
ATOM   1480   H  HB2  . ALA A 1 98  ? 12.324  20.988 56.070 1.00 0.00   ? 101 ALA A HB2  1  
ATOM   1481   H  HB3  . ALA A 1 98  ? 10.979  21.916 55.405 1.00 0.00   ? 101 ALA A HB3  1  
ATOM   1482   N  N    . ALA A 1 99  ? 11.556  21.730 59.800 1.00 8.79   ? 102 ALA A N    1  
ATOM   1483   C  CA   . ALA A 1 99  ? 10.992  21.128 61.040 1.00 9.16   ? 102 ALA A CA   1  
ATOM   1484   C  C    . ALA A 1 99  ? 10.716  22.239 62.054 1.00 9.58   ? 102 ALA A C    1  
ATOM   1485   O  O    . ALA A 1 99  ? 11.126  23.369 61.875 1.00 10.61  ? 102 ALA A O    1  
ATOM   1486   C  CB   . ALA A 1 99  ? 11.995  20.135 61.629 1.00 9.41   ? 102 ALA A CB   1  
ATOM   1487   H  H    . ALA A 1 99  ? 12.459  22.111 59.809 1.00 0.00   ? 102 ALA A H    1  
ATOM   1488   H  HA   . ALA A 1 99  ? 10.070  20.616 60.805 1.00 0.00   ? 102 ALA A HA   1  
ATOM   1489   H  HB1  . ALA A 1 99  ? 12.836  20.673 62.039 1.00 0.00   ? 102 ALA A HB1  1  
ATOM   1490   H  HB2  . ALA A 1 99  ? 12.339  19.467 60.853 1.00 0.00   ? 102 ALA A HB2  1  
ATOM   1491   H  HB3  . ALA A 1 99  ? 11.518  19.562 62.411 1.00 0.00   ? 102 ALA A HB3  1  
ATOM   1492   N  N    . THR A 1 100 ? 10.024  21.933 63.116 1.00 10.01  ? 103 THR A N    1  
ATOM   1493   C  CA   . THR A 1 100 ? 9.726   22.983 64.135 1.00 9.72   ? 103 THR A CA   1  
ATOM   1494   C  C    . THR A 1 100 ? 9.979   22.453 65.558 1.00 9.40   ? 103 THR A C    1  
ATOM   1495   O  O    . THR A 1 100 ? 9.279   21.588 66.045 1.00 9.91   ? 103 THR A O    1  
ATOM   1496   C  CB   . THR A 1 100 ? 8.261   23.406 64.009 1.00 10.15  ? 103 THR A CB   1  
ATOM   1497   O  OG1  . THR A 1 100 ? 8.069   24.076 62.770 1.00 11.13  ? 103 THR A OG1  1  
ATOM   1498   C  CG2  . THR A 1 100 ? 7.898   24.345 65.160 1.00 11.70  ? 103 THR A CG2  1  
ATOM   1499   H  H    . THR A 1 100 ? 9.700   21.017 63.244 1.00 0.00   ? 103 THR A H    1  
ATOM   1500   H  HA   . THR A 1 100 ? 10.359  23.839 63.958 1.00 0.00   ? 103 THR A HA   1  
ATOM   1501   H  HB   . THR A 1 100 ? 7.628   22.533 64.049 1.00 0.00   ? 103 THR A HB   1  
ATOM   1502   H  HG1  . THR A 1 100 ? 8.933   24.289 62.411 1.00 0.00   ? 103 THR A HG1  1  
ATOM   1503   H  HG21 . THR A 1 100 ? 8.657   25.108 65.256 1.00 0.00   ? 103 THR A HG21 1  
ATOM   1504   H  HG22 . THR A 1 100 ? 7.837   23.781 66.079 1.00 0.00   ? 103 THR A HG22 1  
ATOM   1505   H  HG23 . THR A 1 100 ? 6.944   24.809 64.959 1.00 0.00   ? 103 THR A HG23 1  
ATOM   1506   N  N    . GLY A 1 101 ? 10.963  22.995 66.231 1.00 9.21   ? 104 GLY A N    1  
ATOM   1507   C  CA   . GLY A 1 101 ? 11.269  22.566 67.646 1.00 9.61   ? 104 GLY A CA   1  
ATOM   1508   C  C    . GLY A 1 101 ? 12.684  21.950 67.766 1.00 9.16   ? 104 GLY A C    1  
ATOM   1509   O  O    . GLY A 1 101 ? 13.092  21.164 66.935 1.00 9.49   ? 104 GLY A O    1  
ATOM   1510   H  H    . GLY A 1 101 ? 11.496  23.706 65.817 1.00 0.00   ? 104 GLY A H    1  
ATOM   1511   H  HA2  . GLY A 1 101 ? 11.203  23.426 68.296 1.00 0.00   ? 104 GLY A HA2  1  
ATOM   1512   H  HA3  . GLY A 1 101 ? 10.539  21.833 67.957 1.00 0.00   ? 104 GLY A HA3  1  
ATOM   1513   N  N    . ALA A 1 102 ? 13.428  22.277 68.819 1.00 9.80   ? 105 ALA A N    1  
ATOM   1514   C  CA   . ALA A 1 102 ? 14.787  21.670 68.986 1.00 10.09  ? 105 ALA A CA   1  
ATOM   1515   C  C    . ALA A 1 102 ? 15.783  22.200 67.939 1.00 9.67   ? 105 ALA A C    1  
ATOM   1516   O  O    . ALA A 1 102 ? 16.533  21.447 67.350 1.00 9.76   ? 105 ALA A O    1  
ATOM   1517   C  CB   . ALA A 1 102 ? 14.676  20.151 68.845 1.00 10.57  ? 105 ALA A CB   1  
ATOM   1518   H  H    . ALA A 1 102 ? 13.078  22.894 69.496 1.00 0.00   ? 105 ALA A H    1  
ATOM   1519   H  HA   . ALA A 1 102 ? 15.157  21.903 69.973 1.00 0.00   ? 105 ALA A HA   1  
ATOM   1520   H  HB1  . ALA A 1 102 ? 15.429  19.677 69.457 1.00 0.00   ? 105 ALA A HB1  1  
ATOM   1521   H  HB2  . ALA A 1 102 ? 14.826  19.874 67.812 1.00 0.00   ? 105 ALA A HB2  1  
ATOM   1522   H  HB3  . ALA A 1 102 ? 13.696  19.830 69.166 1.00 0.00   ? 105 ALA A HB3  1  
ATOM   1523   N  N    . LEU A 1 103 ? 15.824  23.486 67.731 1.00 9.58   ? 106 LEU A N    1  
ATOM   1524   C  CA   . LEU A 1 103 ? 16.797  24.069 66.760 1.00 9.86   ? 106 LEU A CA   1  
ATOM   1525   C  C    . LEU A 1 103 ? 16.725  23.332 65.428 1.00 10.19  ? 106 LEU A C    1  
ATOM   1526   O  O    . LEU A 1 103 ? 17.715  23.163 64.744 1.00 13.12  ? 106 LEU A O    1  
ATOM   1527   C  CB   . LEU A 1 103 ? 18.212  23.950 67.328 1.00 10.19  ? 106 LEU A CB   1  
ATOM   1528   C  CG   . LEU A 1 103 ? 18.286  24.676 68.672 1.00 10.73  ? 106 LEU A CG   1  
ATOM   1529   C  CD1  . LEU A 1 103 ? 19.657  24.437 69.308 1.00 12.73  ? 106 LEU A CD1  1  
ATOM   1530   C  CD2  . LEU A 1 103 ? 18.082  26.177 68.452 1.00 11.21  ? 106 LEU A CD2  1  
ATOM   1531   H  H    . LEU A 1 103 ? 15.230  24.078 68.237 1.00 0.00   ? 106 LEU A H    1  
ATOM   1532   H  HA   . LEU A 1 103 ? 16.564  25.112 66.604 1.00 0.00   ? 106 LEU A HA   1  
ATOM   1533   H  HB2  . LEU A 1 103 ? 18.457  22.907 67.468 1.00 0.00   ? 106 LEU A HB2  1  
ATOM   1534   H  HB3  . LEU A 1 103 ? 18.915  24.397 66.641 1.00 0.00   ? 106 LEU A HB3  1  
ATOM   1535   H  HG   . LEU A 1 103 ? 17.515  24.299 69.328 1.00 0.00   ? 106 LEU A HG   1  
ATOM   1536   H  HD11 . LEU A 1 103 ? 20.182  23.674 68.754 1.00 0.00   ? 106 LEU A HD11 1  
ATOM   1537   H  HD12 . LEU A 1 103 ? 19.528  24.115 70.331 1.00 0.00   ? 106 LEU A HD12 1  
ATOM   1538   H  HD13 . LEU A 1 103 ? 20.227  25.354 69.289 1.00 0.00   ? 106 LEU A HD13 1  
ATOM   1539   H  HD21 . LEU A 1 103 ? 18.655  26.496 67.593 1.00 0.00   ? 106 LEU A HD21 1  
ATOM   1540   H  HD22 . LEU A 1 103 ? 18.414  26.718 69.326 1.00 0.00   ? 106 LEU A HD22 1  
ATOM   1541   H  HD23 . LEU A 1 103 ? 17.035  26.377 68.280 1.00 0.00   ? 106 LEU A HD23 1  
ATOM   1542   N  N    . GLY A 1 104 ? 15.562  22.902 65.048 1.00 9.27   ? 107 GLY A N    1  
ATOM   1543   C  CA   . GLY A 1 104 ? 15.421  22.184 63.747 1.00 9.41   ? 107 GLY A CA   1  
ATOM   1544   C  C    . GLY A 1 104 ? 15.914  20.738 63.879 1.00 9.04   ? 107 GLY A C    1  
ATOM   1545   O  O    . GLY A 1 104 ? 16.313  20.121 62.912 1.00 9.00   ? 107 GLY A O    1  
ATOM   1546   H  H    . GLY A 1 104 ? 14.774  23.057 65.610 1.00 0.00   ? 107 GLY A H    1  
ATOM   1547   H  HA2  . GLY A 1 104 ? 14.382  22.182 63.451 1.00 0.00   ? 107 GLY A HA2  1  
ATOM   1548   H  HA3  . GLY A 1 104 ? 16.006  22.690 62.994 1.00 0.00   ? 107 GLY A HA3  1  
ATOM   1549   N  N    . GLY A 1 105 ? 15.883  20.190 65.062 1.00 9.19   ? 108 GLY A N    1  
ATOM   1550   C  CA   . GLY A 1 105 ? 16.345  18.775 65.246 1.00 9.80   ? 108 GLY A CA   1  
ATOM   1551   C  C    . GLY A 1 105 ? 17.825  18.699 65.692 1.00 9.51   ? 108 GLY A C    1  
ATOM   1552   O  O    . GLY A 1 105 ? 18.313  17.636 66.022 1.00 9.40   ? 108 GLY A O    1  
ATOM   1553   H  H    . GLY A 1 105 ? 15.552  20.701 65.830 1.00 0.00   ? 108 GLY A H    1  
ATOM   1554   H  HA2  . GLY A 1 105 ? 15.728  18.300 65.994 1.00 0.00   ? 108 GLY A HA2  1  
ATOM   1555   H  HA3  . GLY A 1 105 ? 16.233  18.246 64.311 1.00 0.00   ? 108 GLY A HA3  1  
ATOM   1556   N  N    . GLY A 1 106 ? 18.549  19.792 65.702 1.00 9.67   ? 109 GLY A N    1  
ATOM   1557   C  CA   . GLY A 1 106 ? 19.982  19.735 66.121 1.00 9.98   ? 109 GLY A CA   1  
ATOM   1558   C  C    . GLY A 1 106 ? 20.105  19.432 67.625 1.00 10.17  ? 109 GLY A C    1  
ATOM   1559   O  O    . GLY A 1 106 ? 21.035  18.780 68.056 1.00 10.96  ? 109 GLY A O    1  
ATOM   1560   H  H    . GLY A 1 106 ? 18.152  20.645 65.429 1.00 0.00   ? 109 GLY A H    1  
ATOM   1561   H  HA2  . GLY A 1 106 ? 20.485  18.960 65.560 1.00 0.00   ? 109 GLY A HA2  1  
ATOM   1562   H  HA3  . GLY A 1 106 ? 20.451  20.685 65.914 1.00 0.00   ? 109 GLY A HA3  1  
ATOM   1563   N  N    . GLY A 1 107 ? 19.190  19.908 68.429 1.00 10.53  ? 110 GLY A N    1  
ATOM   1564   C  CA   . GLY A 1 107 ? 19.280  19.655 69.904 1.00 10.77  ? 110 GLY A CA   1  
ATOM   1565   C  C    . GLY A 1 107 ? 18.965  18.185 70.255 1.00 10.43  ? 110 GLY A C    1  
ATOM   1566   O  O    . GLY A 1 107 ? 19.206  17.750 71.363 1.00 12.37  ? 110 GLY A O    1  
ATOM   1567   H  H    . GLY A 1 107 ? 18.452  20.443 68.068 1.00 0.00   ? 110 GLY A H    1  
ATOM   1568   H  HA2  . GLY A 1 107 ? 20.279  19.891 70.240 1.00 0.00   ? 110 GLY A HA2  1  
ATOM   1569   H  HA3  . GLY A 1 107 ? 18.576  20.296 70.414 1.00 0.00   ? 110 GLY A HA3  1  
ATOM   1570   N  N    . LEU A 1 108 ? 18.426  17.420 69.342 1.00 10.36  ? 111 LEU A N    1  
ATOM   1571   C  CA   . LEU A 1 108 ? 18.099  15.995 69.658 1.00 9.86   ? 111 LEU A CA   1  
ATOM   1572   C  C    . LEU A 1 108 ? 18.766  15.055 68.644 1.00 9.96   ? 111 LEU A C    1  
ATOM   1573   O  O    . LEU A 1 108 ? 18.279  13.976 68.371 1.00 10.96  ? 111 LEU A O    1  
ATOM   1574   C  CB   . LEU A 1 108 ? 16.582  15.801 69.605 1.00 10.20  ? 111 LEU A CB   1  
ATOM   1575   C  CG   . LEU A 1 108 ? 15.894  16.948 70.347 1.00 11.80  ? 111 LEU A CG   1  
ATOM   1576   C  CD1  . LEU A 1 108 ? 14.460  17.099 69.838 1.00 12.74  ? 111 LEU A CD1  1  
ATOM   1577   C  CD2  . LEU A 1 108 ? 15.872  16.642 71.847 1.00 14.04  ? 111 LEU A CD2  1  
ATOM   1578   H  H    . LEU A 1 108 ? 18.228  17.782 68.453 1.00 0.00   ? 111 LEU A H    1  
ATOM   1579   H  HA   . LEU A 1 108 ? 18.453  15.760 70.650 1.00 0.00   ? 111 LEU A HA   1  
ATOM   1580   H  HB2  . LEU A 1 108 ? 16.257  15.791 68.575 1.00 0.00   ? 111 LEU A HB2  1  
ATOM   1581   H  HB3  . LEU A 1 108 ? 16.322  14.864 70.074 1.00 0.00   ? 111 LEU A HB3  1  
ATOM   1582   H  HG   . LEU A 1 108 ? 16.436  17.866 70.173 1.00 0.00   ? 111 LEU A HG   1  
ATOM   1583   H  HD11 . LEU A 1 108 ? 14.450  17.749 68.976 1.00 0.00   ? 111 LEU A HD11 1  
ATOM   1584   H  HD12 . LEU A 1 108 ? 13.844  17.524 70.616 1.00 0.00   ? 111 LEU A HD12 1  
ATOM   1585   H  HD13 . LEU A 1 108 ? 14.072  16.129 69.562 1.00 0.00   ? 111 LEU A HD13 1  
ATOM   1586   H  HD21 . LEU A 1 108 ? 15.033  17.146 72.304 1.00 0.00   ? 111 LEU A HD21 1  
ATOM   1587   H  HD22 . LEU A 1 108 ? 16.790  16.989 72.298 1.00 0.00   ? 111 LEU A HD22 1  
ATOM   1588   H  HD23 . LEU A 1 108 ? 15.777  15.577 71.996 1.00 0.00   ? 111 LEU A HD23 1  
ATOM   1589   N  N    . THR A 1 109 ? 19.880  15.451 68.095 1.00 9.38   ? 112 THR A N    1  
ATOM   1590   C  CA   . THR A 1 109 ? 20.593  14.580 67.106 1.00 9.31   ? 112 THR A CA   1  
ATOM   1591   C  C    . THR A 1 109 ? 22.132  14.687 67.264 1.00 9.35   ? 112 THR A C    1  
ATOM   1592   O  O    . THR A 1 109 ? 22.869  14.363 66.354 1.00 9.91   ? 112 THR A O    1  
ATOM   1593   C  CB   . THR A 1 109 ? 20.203  15.010 65.690 1.00 8.67   ? 112 THR A CB   1  
ATOM   1594   O  OG1  . THR A 1 109 ? 20.344  16.418 65.568 1.00 9.57   ? 112 THR A OG1  1  
ATOM   1595   C  CG2  . THR A 1 109 ? 18.752  14.614 65.415 1.00 9.81   ? 112 THR A CG2  1  
ATOM   1596   H  H    . THR A 1 109 ? 20.258  16.322 68.337 1.00 0.00   ? 112 THR A H    1  
ATOM   1597   H  HA   . THR A 1 109 ? 20.292  13.555 67.258 1.00 0.00   ? 112 THR A HA   1  
ATOM   1598   H  HB   . THR A 1 109 ? 20.847  14.520 64.975 1.00 0.00   ? 112 THR A HB   1  
ATOM   1599   H  HG1  . THR A 1 109 ? 21.187  16.597 65.145 1.00 0.00   ? 112 THR A HG1  1  
ATOM   1600   H  HG21 . THR A 1 109 ? 18.610  13.573 65.664 1.00 0.00   ? 112 THR A HG21 1  
ATOM   1601   H  HG22 . THR A 1 109 ? 18.529  14.767 64.369 1.00 0.00   ? 112 THR A HG22 1  
ATOM   1602   H  HG23 . THR A 1 109 ? 18.093  15.222 66.016 1.00 0.00   ? 112 THR A HG23 1  
ATOM   1603   N  N    . GLU A 1 110 ? 22.628  15.119 68.403 1.00 9.89   ? 113 GLU A N    1  
ATOM   1604   C  CA   . GLU A 1 110 ? 24.098  15.217 68.593 1.00 9.98   ? 113 GLU A CA   1  
ATOM   1605   C  C    . GLU A 1 110 ? 24.637  13.805 68.752 1.00 9.57   ? 113 GLU A C    1  
ATOM   1606   O  O    . GLU A 1 110 ? 24.360  13.131 69.725 1.00 11.00  ? 113 GLU A O    1  
ATOM   1607   C  CB   . GLU A 1 110 ? 24.406  16.034 69.850 1.00 10.77  ? 113 GLU A CB   1  
ATOM   1608   C  CG   . GLU A 1 110 ? 24.088  17.508 69.592 1.00 12.27  ? 113 GLU A CG   1  
ATOM   1609   C  CD   . GLU A 1 110 ? 24.411  18.327 70.843 1.00 14.86  ? 113 GLU A CD   1  
ATOM   1610   O  OE1  . GLU A 1 110 ? 25.055  17.789 71.729 1.00 17.43  ? 113 GLU A OE1  1  
ATOM   1611   O  OE2  . GLU A 1 110 ? 24.010  19.478 70.893 1.00 16.69  ? 113 GLU A OE2  1  
ATOM   1612   H  H    . GLU A 1 110 ? 22.025  15.367 69.134 1.00 0.00   ? 113 GLU A H    1  
ATOM   1613   H  HA   . GLU A 1 110 ? 24.549  15.685 67.730 1.00 0.00   ? 113 GLU A HA   1  
ATOM   1614   H  HB2  . GLU A 1 110 ? 23.802  15.673 70.670 1.00 0.00   ? 113 GLU A HB2  1  
ATOM   1615   H  HB3  . GLU A 1 110 ? 25.451  15.931 70.100 1.00 0.00   ? 113 GLU A HB3  1  
ATOM   1616   H  HG2  . GLU A 1 110 ? 24.683  17.864 68.763 1.00 0.00   ? 113 GLU A HG2  1  
ATOM   1617   H  HG3  . GLU A 1 110 ? 23.040  17.615 69.355 1.00 0.00   ? 113 GLU A HG3  1  
ATOM   1618   N  N    . ILE A 1 111 ? 25.369  13.331 67.793 1.00 9.01   ? 114 ILE A N    1  
ATOM   1619   C  CA   . ILE A 1 111 ? 25.878  11.941 67.887 1.00 9.65   ? 114 ILE A CA   1  
ATOM   1620   C  C    . ILE A 1 111 ? 27.379  11.927 67.674 1.00 10.01  ? 114 ILE A C    1  
ATOM   1621   O  O    . ILE A 1 111 ? 27.881  12.364 66.658 1.00 9.50   ? 114 ILE A O    1  
ATOM   1622   C  CB   . ILE A 1 111 ? 25.204  11.079 66.818 1.00 9.26   ? 114 ILE A CB   1  
ATOM   1623   C  CG1  . ILE A 1 111 ? 25.299  11.783 65.463 1.00 9.80   ? 114 ILE A CG1  1  
ATOM   1624   C  CG2  . ILE A 1 111 ? 23.733  10.871 67.181 1.00 9.49   ? 114 ILE A CG2  1  
ATOM   1625   C  CD1  . ILE A 1 111 ? 24.792  10.848 64.364 1.00 9.81   ? 114 ILE A CD1  1  
ATOM   1626   H  H    . ILE A 1 111 ? 25.560  13.875 67.001 1.00 0.00   ? 114 ILE A H    1  
ATOM   1627   H  HA   . ILE A 1 111 ? 25.650  11.540 68.864 1.00 0.00   ? 114 ILE A HA   1  
ATOM   1628   H  HB   . ILE A 1 111 ? 25.700  10.120 66.764 1.00 0.00   ? 114 ILE A HB   1  
ATOM   1629   H  HG12 . ILE A 1 111 ? 24.697  12.680 65.480 1.00 0.00   ? 114 ILE A HG12 1  
ATOM   1630   H  HG13 . ILE A 1 111 ? 26.328  12.044 65.264 1.00 0.00   ? 114 ILE A HG13 1  
ATOM   1631   H  HG21 . ILE A 1 111 ? 23.540  9.816  67.312 1.00 0.00   ? 114 ILE A HG21 1  
ATOM   1632   H  HG22 . ILE A 1 111 ? 23.109  11.255 66.388 1.00 0.00   ? 114 ILE A HG22 1  
ATOM   1633   H  HG23 . ILE A 1 111 ? 23.511  11.394 68.099 1.00 0.00   ? 114 ILE A HG23 1  
ATOM   1634   H  HD11 . ILE A 1 111 ? 25.229  9.869  64.494 1.00 0.00   ? 114 ILE A HD11 1  
ATOM   1635   H  HD12 . ILE A 1 111 ? 25.072  11.241 63.398 1.00 0.00   ? 114 ILE A HD12 1  
ATOM   1636   H  HD13 . ILE A 1 111 ? 23.716  10.773 64.423 1.00 0.00   ? 114 ILE A HD13 1  
ATOM   1637   N  N    . ASN A 1 112 ? 28.101  11.422 68.624 1.00 10.20  ? 115 ASN A N    1  
ATOM   1638   C  CA   . ASN A 1 112 ? 29.585  11.371 68.474 1.00 10.71  ? 115 ASN A CA   1  
ATOM   1639   C  C    . ASN A 1 112 ? 29.974  10.068 67.772 1.00 11.35  ? 115 ASN A C    1  
ATOM   1640   O  O    . ASN A 1 112 ? 29.216  9.120  67.751 1.00 11.07  ? 115 ASN A O    1  
ATOM   1641   C  CB   . ASN A 1 112 ? 30.240  11.424 69.856 1.00 11.18  ? 115 ASN A CB   1  
ATOM   1642   C  CG   . ASN A 1 112 ? 29.690  12.618 70.638 1.00 11.50  ? 115 ASN A CG   1  
ATOM   1643   O  OD1  . ASN A 1 112 ? 28.715  12.494 71.352 1.00 13.23  ? 115 ASN A OD1  1  
ATOM   1644   N  ND2  . ASN A 1 112 ? 30.277  13.778 70.532 1.00 11.74  ? 115 ASN A ND2  1  
ATOM   1645   H  H    . ASN A 1 112 ? 27.675  11.070 69.433 1.00 0.00   ? 115 ASN A H    1  
ATOM   1646   H  HA   . ASN A 1 112 ? 29.917  12.213 67.884 1.00 0.00   ? 115 ASN A HA   1  
ATOM   1647   H  HB2  . ASN A 1 112 ? 30.023  10.510 70.391 1.00 0.00   ? 115 ASN A HB2  1  
ATOM   1648   H  HB3  . ASN A 1 112 ? 31.308  11.531 69.744 1.00 0.00   ? 115 ASN A HB3  1  
ATOM   1649   H  HD21 . ASN A 1 112 ? 31.064  13.878 69.956 1.00 0.00   ? 115 ASN A HD21 1  
ATOM   1650   H  HD22 . ASN A 1 112 ? 29.932  14.549 71.029 1.00 0.00   ? 115 ASN A HD22 1  
ATOM   1651   N  N    . PRO A 1 113 ? 31.152  10.018 67.205 1.00 11.21  ? 116 PRO A N    1  
ATOM   1652   C  CA   . PRO A 1 113 ? 31.647  8.808  66.499 1.00 11.82  ? 116 PRO A CA   1  
ATOM   1653   C  C    . PRO A 1 113 ? 31.198  7.515  67.194 1.00 11.89  ? 116 PRO A C    1  
ATOM   1654   O  O    . PRO A 1 113 ? 31.396  7.336  68.380 1.00 13.30  ? 116 PRO A O    1  
ATOM   1655   C  CB   . PRO A 1 113 ? 33.163  8.967  66.567 1.00 12.36  ? 116 PRO A CB   1  
ATOM   1656   C  CG   . PRO A 1 113 ? 33.407  10.444 66.608 1.00 12.21  ? 116 PRO A CG   1  
ATOM   1657   C  CD   . PRO A 1 113 ? 32.142  11.103 67.179 1.00 11.82  ? 116 PRO A CD   1  
ATOM   1658   H  HA   . PRO A 1 113 ? 31.327  8.814  65.470 1.00 0.00   ? 116 PRO A HA   1  
ATOM   1659   H  HB2  . PRO A 1 113 ? 33.548  8.495  67.461 1.00 0.00   ? 116 PRO A HB2  1  
ATOM   1660   H  HB3  . PRO A 1 113 ? 33.625  8.542  65.689 1.00 0.00   ? 116 PRO A HB3  1  
ATOM   1661   H  HG2  . PRO A 1 113 ? 34.256  10.658 67.244 1.00 0.00   ? 116 PRO A HG2  1  
ATOM   1662   H  HG3  . PRO A 1 113 ? 33.589  10.816 65.612 1.00 0.00   ? 116 PRO A HG3  1  
ATOM   1663   H  HD2  . PRO A 1 113 ? 32.328  11.474 68.177 1.00 0.00   ? 116 PRO A HD2  1  
ATOM   1664   H  HD3  . PRO A 1 113 ? 31.805  11.899 66.533 1.00 0.00   ? 116 PRO A HD3  1  
ATOM   1665   N  N    . GLY A 1 114 ? 30.584  6.618  66.468 1.00 11.93  ? 117 GLY A N    1  
ATOM   1666   C  CA   . GLY A 1 114 ? 30.112  5.350  67.086 1.00 12.43  ? 117 GLY A CA   1  
ATOM   1667   C  C    . GLY A 1 114 ? 28.669  5.505  67.599 1.00 13.06  ? 117 GLY A C    1  
ATOM   1668   O  O    . GLY A 1 114 ? 28.191  4.682  68.354 1.00 15.15  ? 117 GLY A O    1  
ATOM   1669   H  H    . GLY A 1 114 ? 30.426  6.785  65.515 1.00 0.00   ? 117 GLY A H    1  
ATOM   1670   H  HA2  . GLY A 1 114 ? 30.147  4.560  66.350 1.00 0.00   ? 117 GLY A HA2  1  
ATOM   1671   H  HA3  . GLY A 1 114 ? 30.756  5.096  67.914 1.00 0.00   ? 117 GLY A HA3  1  
ATOM   1672   N  N    . GLU A 1 115 ? 27.959  6.540  67.204 1.00 11.63  ? 118 GLU A N    1  
ATOM   1673   C  CA   . GLU A 1 115 ? 26.547  6.688  67.701 1.00 11.38  ? 118 GLU A CA   1  
ATOM   1674   C  C    . GLU A 1 115 ? 25.581  7.086  66.563 1.00 10.89  ? 118 GLU A C    1  
ATOM   1675   O  O    . GLU A 1 115 ? 25.915  7.871  65.697 1.00 11.26  ? 118 GLU A O    1  
ATOM   1676   C  CB   . GLU A 1 115 ? 26.510  7.765  68.787 1.00 11.51  ? 118 GLU A CB   1  
ATOM   1677   C  CG   . GLU A 1 115 ? 27.193  7.239  70.051 1.00 13.29  ? 118 GLU A CG   1  
ATOM   1678   C  CD   . GLU A 1 115 ? 26.931  8.201  71.211 1.00 13.33  ? 118 GLU A CD   1  
ATOM   1679   O  OE1  . GLU A 1 115 ? 27.211  9.378  71.054 1.00 13.95  ? 118 GLU A OE1  1  
ATOM   1680   O  OE2  . GLU A 1 115 ? 26.454  7.744  72.237 1.00 15.54  ? 118 GLU A OE2  1  
ATOM   1681   H  H    . GLU A 1 115 ? 28.343  7.202  66.592 1.00 0.00   ? 118 GLU A H    1  
ATOM   1682   H  HA   . GLU A 1 115 ? 26.223  5.750  68.126 1.00 0.00   ? 118 GLU A HA   1  
ATOM   1683   H  HB2  . GLU A 1 115 ? 27.027  8.646  68.437 1.00 0.00   ? 118 GLU A HB2  1  
ATOM   1684   H  HB3  . GLU A 1 115 ? 25.484  8.014  69.012 1.00 0.00   ? 118 GLU A HB3  1  
ATOM   1685   H  HG2  . GLU A 1 115 ? 26.797  6.263  70.294 1.00 0.00   ? 118 GLU A HG2  1  
ATOM   1686   H  HG3  . GLU A 1 115 ? 28.256  7.164  69.881 1.00 0.00   ? 118 GLU A HG3  1  
ATOM   1687   N  N    . LYS A 1 116 ? 24.367  6.563  66.584 1.00 10.73  ? 119 LYS A N    1  
ATOM   1688   C  CA   . LYS A 1 116 ? 23.358  6.922  65.539 1.00 10.97  ? 119 LYS A CA   1  
ATOM   1689   C  C    . LYS A 1 116 ? 22.003  7.165  66.224 1.00 10.55  ? 119 LYS A C    1  
ATOM   1690   O  O    . LYS A 1 116 ? 21.712  6.577  67.247 1.00 10.38  ? 119 LYS A O    1  
ATOM   1691   C  CB   . LYS A 1 116 ? 23.228  5.773  64.536 1.00 11.85  ? 119 LYS A CB   1  
ATOM   1692   C  CG   . LYS A 1 116 ? 22.633  4.549  65.236 1.00 14.05  ? 119 LYS A CG   1  
ATOM   1693   C  CD   . LYS A 1 116 ? 22.209  3.518  64.188 1.00 17.91  ? 119 LYS A CD   1  
ATOM   1694   C  CE   . LYS A 1 116 ? 21.459  2.374  64.873 1.00 22.32  ? 119 LYS A CE   1  
ATOM   1695   N  NZ   . LYS A 1 116 ? 21.072  1.355  63.856 1.00 24.82  ? 119 LYS A NZ   1  
ATOM   1696   H  H    . LYS A 1 116 ? 24.117  5.949  67.306 1.00 0.00   ? 119 LYS A H    1  
ATOM   1697   H  HA   . LYS A 1 116 ? 23.671  7.820  65.026 1.00 0.00   ? 119 LYS A HA   1  
ATOM   1698   H  HB2  . LYS A 1 116 ? 22.580  6.075  63.725 1.00 0.00   ? 119 LYS A HB2  1  
ATOM   1699   H  HB3  . LYS A 1 116 ? 24.202  5.524  64.145 1.00 0.00   ? 119 LYS A HB3  1  
ATOM   1700   H  HG2  . LYS A 1 116 ? 23.374  4.115  65.891 1.00 0.00   ? 119 LYS A HG2  1  
ATOM   1701   H  HG3  . LYS A 1 116 ? 21.772  4.848  65.813 1.00 0.00   ? 119 LYS A HG3  1  
ATOM   1702   H  HD2  . LYS A 1 116 ? 21.564  3.988  63.461 1.00 0.00   ? 119 LYS A HD2  1  
ATOM   1703   H  HD3  . LYS A 1 116 ? 23.085  3.126  63.693 1.00 0.00   ? 119 LYS A HD3  1  
ATOM   1704   H  HE2  . LYS A 1 116 ? 22.098  1.917  65.615 1.00 0.00   ? 119 LYS A HE2  1  
ATOM   1705   H  HE3  . LYS A 1 116 ? 20.571  2.760  65.351 1.00 0.00   ? 119 LYS A HE3  1  
ATOM   1706   H  HZ1  . LYS A 1 116 ? 21.687  0.521  63.949 1.00 0.00   ? 119 LYS A HZ1  1  
ATOM   1707   H  HZ2  . LYS A 1 116 ? 21.179  1.757  62.904 1.00 0.00   ? 119 LYS A HZ2  1  
ATOM   1708   H  HZ3  . LYS A 1 116 ? 20.081  1.075  64.006 1.00 0.00   ? 119 LYS A HZ3  1  
ATOM   1709   N  N    . THR A 1 117 ? 21.171  8.027  65.687 1.00 9.39   ? 120 THR A N    1  
ATOM   1710   C  CA   . THR A 1 117 ? 19.879  8.278  66.333 1.00 9.62   ? 120 THR A CA   1  
ATOM   1711   C  C    . THR A 1 117 ? 18.802  8.278  65.272 1.00 9.59   ? 120 THR A C    1  
ATOM   1712   O  O    . THR A 1 117 ? 19.041  8.006  64.112 1.00 9.81   ? 120 THR A O    1  
ATOM   1713   C  CB   . THR A 1 117 ? 19.910  9.638  67.035 1.00 9.73   ? 120 THR A CB   1  
ATOM   1714   O  OG1  . THR A 1 117 ? 18.626  9.918  67.576 1.00 10.36  ? 120 THR A OG1  1  
ATOM   1715   C  CG2  . THR A 1 117 ? 20.291  10.725 66.030 1.00 9.90   ? 120 THR A CG2  1  
ATOM   1716   H  H    . THR A 1 117 ? 21.414  8.503  64.866 1.00 0.00   ? 120 THR A H    1  
ATOM   1717   H  HA   . THR A 1 117 ? 19.677  7.502  67.056 1.00 0.00   ? 120 THR A HA   1  
ATOM   1718   H  HB   . THR A 1 117 ? 20.639  9.616  67.830 1.00 0.00   ? 120 THR A HB   1  
ATOM   1719   H  HG1  . THR A 1 117 ? 18.735  10.561 68.280 1.00 0.00   ? 120 THR A HG1  1  
ATOM   1720   H  HG21 . THR A 1 117 ? 20.550  10.268 65.086 1.00 0.00   ? 120 THR A HG21 1  
ATOM   1721   H  HG22 . THR A 1 117 ? 21.138  11.281 66.405 1.00 0.00   ? 120 THR A HG22 1  
ATOM   1722   H  HG23 . THR A 1 117 ? 19.455  11.394 65.889 1.00 0.00   ? 120 THR A HG23 1  
ATOM   1723   N  N    . ILE A 1 118 ? 17.625  8.583  65.669 1.00 9.23   ? 121 ILE A N    1  
ATOM   1724   C  CA   . ILE A 1 118 ? 16.487  8.617  64.711 1.00 10.03  ? 121 ILE A CA   1  
ATOM   1725   C  C    . ILE A 1 118 ? 15.556  9.755  65.116 1.00 9.87   ? 121 ILE A C    1  
ATOM   1726   O  O    . ILE A 1 118 ? 15.006  9.763  66.199 1.00 10.66  ? 121 ILE A O    1  
ATOM   1727   C  CB   . ILE A 1 118 ? 15.730  7.288  64.764 1.00 10.26  ? 121 ILE A CB   1  
ATOM   1728   C  CG1  . ILE A 1 118 ? 16.680  6.146  64.394 1.00 10.75  ? 121 ILE A CG1  1  
ATOM   1729   C  CG2  . ILE A 1 118 ? 14.567  7.323  63.771 1.00 11.39  ? 121 ILE A CG2  1  
ATOM   1730   C  CD1  . ILE A 1 118 ? 15.941  4.812  64.502 1.00 11.81  ? 121 ILE A CD1  1  
ATOM   1731   H  H    . ILE A 1 118 ? 17.471  8.798  66.613 1.00 0.00   ? 121 ILE A H    1  
ATOM   1732   H  HA   . ILE A 1 118 ? 16.858  8.787  63.711 1.00 0.00   ? 121 ILE A HA   1  
ATOM   1733   H  HB   . ILE A 1 118 ? 15.347  7.132  65.762 1.00 0.00   ? 121 ILE A HB   1  
ATOM   1734   H  HG12 . ILE A 1 118 ? 17.031  6.284  63.382 1.00 0.00   ? 121 ILE A HG12 1  
ATOM   1735   H  HG13 . ILE A 1 118 ? 17.522  6.145  65.070 1.00 0.00   ? 121 ILE A HG13 1  
ATOM   1736   H  HG21 . ILE A 1 118 ? 14.925  7.661  62.809 1.00 0.00   ? 121 ILE A HG21 1  
ATOM   1737   H  HG22 . ILE A 1 118 ? 13.807  8.001  64.130 1.00 0.00   ? 121 ILE A HG22 1  
ATOM   1738   H  HG23 . ILE A 1 118 ? 14.148  6.333  63.672 1.00 0.00   ? 121 ILE A HG23 1  
ATOM   1739   H  HD11 . ILE A 1 118 ? 15.926  4.490  65.533 1.00 0.00   ? 121 ILE A HD11 1  
ATOM   1740   H  HD12 . ILE A 1 118 ? 16.446  4.070  63.901 1.00 0.00   ? 121 ILE A HD12 1  
ATOM   1741   H  HD13 . ILE A 1 118 ? 14.927  4.932  64.148 1.00 0.00   ? 121 ILE A HD13 1  
ATOM   1742   N  N    . LEU A 1 119 ? 15.392  10.729 64.270 1.00 9.96   ? 122 LEU A N    1  
ATOM   1743   C  CA   . LEU A 1 119 ? 14.516  11.875 64.630 1.00 9.62   ? 122 LEU A CA   1  
ATOM   1744   C  C    . LEU A 1 119 ? 13.379  11.997 63.623 1.00 9.18   ? 122 LEU A C    1  
ATOM   1745   O  O    . LEU A 1 119 ? 13.588  12.000 62.426 1.00 10.27  ? 122 LEU A O    1  
ATOM   1746   C  CB   . LEU A 1 119 ? 15.339  13.165 64.625 1.00 9.46   ? 122 LEU A CB   1  
ATOM   1747   C  CG   . LEU A 1 119 ? 14.404  14.367 64.489 1.00 10.92  ? 122 LEU A CG   1  
ATOM   1748   C  CD1  . LEU A 1 119 ? 14.104  14.940 65.876 1.00 12.24  ? 122 LEU A CD1  1  
ATOM   1749   C  CD2  . LEU A 1 119 ? 15.076  15.441 63.630 1.00 12.06  ? 122 LEU A CD2  1  
ATOM   1750   H  H    . LEU A 1 119 ? 15.858  10.716 63.408 1.00 0.00   ? 122 LEU A H    1  
ATOM   1751   H  HA   . LEU A 1 119 ? 14.107  11.717 65.616 1.00 0.00   ? 122 LEU A HA   1  
ATOM   1752   H  HB2  . LEU A 1 119 ? 15.894  13.241 65.549 1.00 0.00   ? 122 LEU A HB2  1  
ATOM   1753   H  HB3  . LEU A 1 119 ? 16.026  13.150 63.792 1.00 0.00   ? 122 LEU A HB3  1  
ATOM   1754   H  HG   . LEU A 1 119 ? 13.481  14.054 64.022 1.00 0.00   ? 122 LEU A HG   1  
ATOM   1755   H  HD11 . LEU A 1 119 ? 14.194  14.158 66.615 1.00 0.00   ? 122 LEU A HD11 1  
ATOM   1756   H  HD12 . LEU A 1 119 ? 13.099  15.336 65.892 1.00 0.00   ? 122 LEU A HD12 1  
ATOM   1757   H  HD13 . LEU A 1 119 ? 14.806  15.729 66.099 1.00 0.00   ? 122 LEU A HD13 1  
ATOM   1758   H  HD21 . LEU A 1 119 ? 14.458  15.653 62.771 1.00 0.00   ? 122 LEU A HD21 1  
ATOM   1759   H  HD22 . LEU A 1 119 ? 16.041  15.086 63.301 1.00 0.00   ? 122 LEU A HD22 1  
ATOM   1760   H  HD23 . LEU A 1 119 ? 15.204  16.341 64.214 1.00 0.00   ? 122 LEU A HD23 1  
ATOM   1761   N  N    . ARG A 1 120 ? 12.175  12.105 64.103 1.00 9.06   ? 123 ARG A N    1  
ATOM   1762   C  CA   . ARG A 1 120 ? 11.010  12.238 63.178 1.00 9.27   ? 123 ARG A CA   1  
ATOM   1763   C  C    . ARG A 1 120 ? 10.313  13.594 63.391 1.00 9.18   ? 123 ARG A C    1  
ATOM   1764   O  O    . ARG A 1 120 ? 10.062  14.008 64.505 1.00 10.78  ? 123 ARG A O    1  
ATOM   1765   C  CB   . ARG A 1 120 ? 10.014  11.109 63.451 1.00 9.82   ? 123 ARG A CB   1  
ATOM   1766   C  CG   . ARG A 1 120 ? 8.805   11.258 62.526 1.00 10.75  ? 123 ARG A CG   1  
ATOM   1767   C  CD   . ARG A 1 120 ? 7.520   11.219 63.354 1.00 10.89  ? 123 ARG A CD   1  
ATOM   1768   N  NE   . ARG A 1 120 ? 7.637   10.168 64.404 1.00 10.89  ? 123 ARG A NE   1  
ATOM   1769   C  CZ   . ARG A 1 120 ? 6.695   10.029 65.296 1.00 11.62  ? 123 ARG A CZ   1  
ATOM   1770   N  NH1  . ARG A 1 120 ? 5.651   10.811 65.269 1.00 13.01  ? 123 ARG A NH1  1  
ATOM   1771   N  NH2  . ARG A 1 120 ? 6.798   9.108  66.215 1.00 12.44  ? 123 ARG A NH2  1  
ATOM   1772   H  H    . ARG A 1 120 ? 12.033  12.106 65.073 1.00 0.00   ? 123 ARG A H    1  
ATOM   1773   H  HA   . ARG A 1 120 ? 11.355  12.170 62.157 1.00 0.00   ? 123 ARG A HA   1  
ATOM   1774   H  HB2  . ARG A 1 120 ? 10.492  10.157 63.270 1.00 0.00   ? 123 ARG A HB2  1  
ATOM   1775   H  HB3  . ARG A 1 120 ? 9.687   11.158 64.479 1.00 0.00   ? 123 ARG A HB3  1  
ATOM   1776   H  HG2  . ARG A 1 120 ? 8.868   12.201 62.001 1.00 0.00   ? 123 ARG A HG2  1  
ATOM   1777   H  HG3  . ARG A 1 120 ? 8.796   10.448 61.812 1.00 0.00   ? 123 ARG A HG3  1  
ATOM   1778   H  HD2  . ARG A 1 120 ? 7.364   12.180 63.823 1.00 0.00   ? 123 ARG A HD2  1  
ATOM   1779   H  HD3  . ARG A 1 120 ? 6.683   10.993 62.710 1.00 0.00   ? 123 ARG A HD3  1  
ATOM   1780   H  HE   . ARG A 1 120 ? 8.422   9.581  64.424 1.00 0.00   ? 123 ARG A HE   1  
ATOM   1781   H  HH11 . ARG A 1 120 ? 5.572   11.516 64.565 1.00 0.00   ? 123 ARG A HH11 1  
ATOM   1782   H  HH12 . ARG A 1 120 ? 4.929   10.704 65.953 1.00 0.00   ? 123 ARG A HH12 1  
ATOM   1783   H  HH21 . ARG A 1 120 ? 7.599   8.510  66.236 1.00 0.00   ? 123 ARG A HH21 1  
ATOM   1784   H  HH22 . ARG A 1 120 ? 6.076   9.002  66.899 1.00 0.00   ? 123 ARG A HH22 1  
ATOM   1785   N  N    . PHE A 1 121 ? 9.992   14.277 62.320 1.00 8.33   ? 124 PHE A N    1  
ATOM   1786   C  CA   . PHE A 1 121 ? 9.303   15.592 62.427 1.00 8.94   ? 124 PHE A CA   1  
ATOM   1787   C  C    . PHE A 1 121 ? 8.211   15.680 61.349 1.00 8.88   ? 124 PHE A C    1  
ATOM   1788   O  O    . PHE A 1 121 ? 8.349   15.158 60.261 1.00 9.10   ? 124 PHE A O    1  
ATOM   1789   C  CB   . PHE A 1 121 ? 10.318  16.718 62.218 1.00 8.98   ? 124 PHE A CB   1  
ATOM   1790   C  CG   . PHE A 1 121 ? 10.703  16.786 60.760 1.00 9.02   ? 124 PHE A CG   1  
ATOM   1791   C  CD1  . PHE A 1 121 ? 9.898   17.487 59.855 1.00 9.73   ? 124 PHE A CD1  1  
ATOM   1792   C  CD2  . PHE A 1 121 ? 11.866  16.148 60.313 1.00 8.84   ? 124 PHE A CD2  1  
ATOM   1793   C  CE1  . PHE A 1 121 ? 10.255  17.550 58.503 1.00 9.47   ? 124 PHE A CE1  1  
ATOM   1794   C  CE2  . PHE A 1 121 ? 12.224  16.210 58.961 1.00 9.43   ? 124 PHE A CE2  1  
ATOM   1795   C  CZ   . PHE A 1 121 ? 11.418  16.911 58.056 1.00 9.11   ? 124 PHE A CZ   1  
ATOM   1796   H  H    . PHE A 1 121 ? 10.200  13.912 61.435 1.00 0.00   ? 124 PHE A H    1  
ATOM   1797   H  HA   . PHE A 1 121 ? 8.855   15.686 63.404 1.00 0.00   ? 124 PHE A HA   1  
ATOM   1798   H  HB2  . PHE A 1 121 ? 9.879   17.658 62.519 1.00 0.00   ? 124 PHE A HB2  1  
ATOM   1799   H  HB3  . PHE A 1 121 ? 11.198  16.525 62.814 1.00 0.00   ? 124 PHE A HB3  1  
ATOM   1800   H  HD1  . PHE A 1 121 ? 9.000   17.980 60.200 1.00 0.00   ? 124 PHE A HD1  1  
ATOM   1801   H  HD2  . PHE A 1 121 ? 12.488  15.607 61.011 1.00 0.00   ? 124 PHE A HD2  1  
ATOM   1802   H  HE1  . PHE A 1 121 ? 9.633   18.091 57.804 1.00 0.00   ? 124 PHE A HE1  1  
ATOM   1803   H  HE2  . PHE A 1 121 ? 13.121  15.718 58.616 1.00 0.00   ? 124 PHE A HE2  1  
ATOM   1804   H  HZ   . PHE A 1 121 ? 11.694  16.960 57.013 1.00 0.00   ? 124 PHE A HZ   1  
ATOM   1805   N  N    . LYS A 1 122 ? 7.127   16.337 61.656 1.00 9.39   ? 125 LYS A N    1  
ATOM   1806   C  CA   . LYS A 1 122 ? 6.014   16.477 60.690 1.00 10.02  ? 125 LYS A CA   1  
ATOM   1807   C  C    . LYS A 1 122 ? 6.304   17.637 59.744 1.00 9.59   ? 125 LYS A C    1  
ATOM   1808   O  O    . LYS A 1 122 ? 6.583   18.747 60.150 1.00 9.78   ? 125 LYS A O    1  
ATOM   1809   C  CB   . LYS A 1 122 ? 4.712   16.750 61.447 1.00 10.00  ? 125 LYS A CB   1  
ATOM   1810   C  CG   . LYS A 1 122 ? 3.528   16.632 60.486 1.00 11.28  ? 125 LYS A CG   1  
ATOM   1811   C  CD   . LYS A 1 122 ? 2.233   16.972 61.227 1.00 14.08  ? 125 LYS A CD   1  
ATOM   1812   C  CE   . LYS A 1 122 ? 1.048   16.843 60.269 1.00 16.28  ? 125 LYS A CE   1  
ATOM   1813   N  NZ   . LYS A 1 122 ? -0.194  17.309 60.949 1.00 20.27  ? 125 LYS A NZ   1  
ATOM   1814   H  H    . LYS A 1 122 ? 7.047   16.744 62.544 1.00 0.00   ? 125 LYS A H    1  
ATOM   1815   H  HA   . LYS A 1 122 ? 5.914   15.564 60.121 1.00 0.00   ? 125 LYS A HA   1  
ATOM   1816   H  HB2  . LYS A 1 122 ? 4.603   16.029 62.245 1.00 0.00   ? 125 LYS A HB2  1  
ATOM   1817   H  HB3  . LYS A 1 122 ? 4.739   17.746 61.862 1.00 0.00   ? 125 LYS A HB3  1  
ATOM   1818   H  HG2  . LYS A 1 122 ? 3.664   17.318 59.662 1.00 0.00   ? 125 LYS A HG2  1  
ATOM   1819   H  HG3  . LYS A 1 122 ? 3.470   15.622 60.108 1.00 0.00   ? 125 LYS A HG3  1  
ATOM   1820   H  HD2  . LYS A 1 122 ? 2.104   16.291 62.055 1.00 0.00   ? 125 LYS A HD2  1  
ATOM   1821   H  HD3  . LYS A 1 122 ? 2.285   17.984 61.597 1.00 0.00   ? 125 LYS A HD3  1  
ATOM   1822   H  HE2  . LYS A 1 122 ? 1.226   17.446 59.391 1.00 0.00   ? 125 LYS A HE2  1  
ATOM   1823   H  HE3  . LYS A 1 122 ? 0.931   15.809 59.977 1.00 0.00   ? 125 LYS A HE3  1  
ATOM   1824   H  HZ1  . LYS A 1 122 ? -0.514  18.197 60.514 1.00 0.00   ? 125 LYS A HZ1  1  
ATOM   1825   H  HZ2  . LYS A 1 122 ? 0.002   17.471 61.956 1.00 0.00   ? 125 LYS A HZ2  1  
ATOM   1826   H  HZ3  . LYS A 1 122 ? -0.935  16.586 60.850 1.00 0.00   ? 125 LYS A HZ3  1  
ATOM   1827   N  N    . ALA A 1 123 ? 6.235   17.366 58.484 1.00 9.66   ? 126 ALA A N    1  
ATOM   1828   C  CA   . ALA A 1 123 ? 6.492   18.397 57.448 1.00 9.97   ? 126 ALA A CA   1  
ATOM   1829   C  C    . ALA A 1 123 ? 5.213   19.168 57.319 1.00 10.44  ? 126 ALA A C    1  
ATOM   1830   O  O    . ALA A 1 123 ? 4.292   18.776 56.630 1.00 11.37  ? 126 ALA A O    1  
ATOM   1831   C  CB   . ALA A 1 123 ? 6.843   17.730 56.116 1.00 10.59  ? 126 ALA A CB   1  
ATOM   1832   H  H    . ALA A 1 123 ? 6.006   16.455 58.204 1.00 0.00   ? 126 ALA A H    1  
ATOM   1833   H  HA   . ALA A 1 123 ? 7.292   19.051 57.764 1.00 0.00   ? 126 ALA A HA   1  
ATOM   1834   H  HB1  . ALA A 1 123 ? 7.566   16.946 56.286 1.00 0.00   ? 126 ALA A HB1  1  
ATOM   1835   H  HB2  . ALA A 1 123 ? 7.260   18.465 55.444 1.00 0.00   ? 126 ALA A HB2  1  
ATOM   1836   H  HB3  . ALA A 1 123 ? 5.950   17.307 55.679 1.00 0.00   ? 126 ALA A HB3  1  
ATOM   1837   N  N    . THR A 1 124 ? 5.115   20.211 58.051 1.00 10.36  ? 127 THR A N    1  
ATOM   1838   C  CA   . THR A 1 124 ? 3.820   20.990 58.066 1.00 11.41  ? 127 THR A CA   1  
ATOM   1839   C  C    . THR A 1 124 ? 3.758   22.125 57.026 1.00 12.05  ? 127 THR A C    1  
ATOM   1840   O  O    . THR A 1 124 ? 2.714   22.709 56.814 1.00 12.66  ? 127 THR A O    1  
ATOM   1841   C  CB   . THR A 1 124 ? 3.628   21.592 59.460 1.00 12.11  ? 127 THR A CB   1  
ATOM   1842   O  OG1  . THR A 1 124 ? 4.719   22.454 59.755 1.00 13.43  ? 127 THR A OG1  1  
ATOM   1843   C  CG2  . THR A 1 124 ? 3.565   20.471 60.498 1.00 12.32  ? 127 THR A CG2  1  
ATOM   1844   H  H    . THR A 1 124 ? 5.849   20.464 58.649 1.00 0.00   ? 127 THR A H    1  
ATOM   1845   H  HA   . THR A 1 124 ? 3.006   20.307 57.878 1.00 0.00   ? 127 THR A HA   1  
ATOM   1846   H  HB   . THR A 1 124 ? 2.707   22.154 59.486 1.00 0.00   ? 127 THR A HB   1  
ATOM   1847   H  HG1  . THR A 1 124 ? 4.362   23.281 60.086 1.00 0.00   ? 127 THR A HG1  1  
ATOM   1848   H  HG21 . THR A 1 124 ? 3.891   20.849 61.456 1.00 0.00   ? 127 THR A HG21 1  
ATOM   1849   H  HG22 . THR A 1 124 ? 4.210   19.661 60.193 1.00 0.00   ? 127 THR A HG22 1  
ATOM   1850   H  HG23 . THR A 1 124 ? 2.550   20.113 60.580 1.00 0.00   ? 127 THR A HG23 1  
ATOM   1851   N  N    . LYS A 1 125 ? 4.837   22.459 56.396 1.00 12.03  ? 128 LYS A N    1  
ATOM   1852   C  CA   . LYS A 1 125 ? 4.811   23.564 55.403 1.00 13.08  ? 128 LYS A CA   1  
ATOM   1853   C  C    . LYS A 1 125 ? 5.422   23.070 54.100 1.00 12.03  ? 128 LYS A C    1  
ATOM   1854   O  O    . LYS A 1 125 ? 6.405   22.356 54.094 1.00 12.17  ? 128 LYS A O    1  
ATOM   1855   C  CB   . LYS A 1 125 ? 5.622   24.749 55.933 1.00 13.99  ? 128 LYS A CB   1  
ATOM   1856   C  CG   . LYS A 1 125 ? 5.043   25.205 57.273 1.00 14.80  ? 128 LYS A CG   1  
ATOM   1857   C  CD   . LYS A 1 125 ? 5.943   26.285 57.877 1.00 16.43  ? 128 LYS A CD   1  
ATOM   1858   C  CE   . LYS A 1 125 ? 5.305   26.824 59.159 1.00 14.75  ? 128 LYS A CE   1  
ATOM   1859   N  NZ   . LYS A 1 125 ? 4.104   27.635 58.812 1.00 16.74  ? 128 LYS A NZ   1  
ATOM   1860   H  H    . LYS A 1 125 ? 5.677   21.991 56.584 1.00 0.00   ? 128 LYS A H    1  
ATOM   1861   H  HA   . LYS A 1 125 ? 3.791   23.872 55.230 1.00 0.00   ? 128 LYS A HA   1  
ATOM   1862   H  HB2  . LYS A 1 125 ? 6.651   24.449 56.067 1.00 0.00   ? 128 LYS A HB2  1  
ATOM   1863   H  HB3  . LYS A 1 125 ? 5.573   25.563 55.226 1.00 0.00   ? 128 LYS A HB3  1  
ATOM   1864   H  HG2  . LYS A 1 125 ? 4.052   25.607 57.119 1.00 0.00   ? 128 LYS A HG2  1  
ATOM   1865   H  HG3  . LYS A 1 125 ? 4.990   24.364 57.948 1.00 0.00   ? 128 LYS A HG3  1  
ATOM   1866   H  HD2  . LYS A 1 125 ? 6.910   25.860 58.107 1.00 0.00   ? 128 LYS A HD2  1  
ATOM   1867   H  HD3  . LYS A 1 125 ? 6.063   27.091 57.170 1.00 0.00   ? 128 LYS A HD3  1  
ATOM   1868   H  HE2  . LYS A 1 125 ? 5.012   25.998 59.790 1.00 0.00   ? 128 LYS A HE2  1  
ATOM   1869   H  HE3  . LYS A 1 125 ? 6.018   27.443 59.683 1.00 0.00   ? 128 LYS A HE3  1  
ATOM   1870   H  HZ1  . LYS A 1 125 ? 3.351   27.009 58.463 1.00 0.00   ? 128 LYS A HZ1  1  
ATOM   1871   H  HZ2  . LYS A 1 125 ? 4.351   28.322 58.072 1.00 0.00   ? 128 LYS A HZ2  1  
ATOM   1872   H  HZ3  . LYS A 1 125 ? 3.771   28.141 59.659 1.00 0.00   ? 128 LYS A HZ3  1  
ATOM   1873   N  N    . PRO A 1 126 ? 4.830   23.435 53.005 1.00 11.24  ? 129 PRO A N    1  
ATOM   1874   C  CA   . PRO A 1 126 ? 5.301   23.014 51.656 1.00 10.94  ? 129 PRO A CA   1  
ATOM   1875   C  C    . PRO A 1 126 ? 6.396   23.925 51.093 1.00 10.32  ? 129 PRO A C    1  
ATOM   1876   O  O    . PRO A 1 126 ? 6.293   25.134 51.146 1.00 10.39  ? 129 PRO A O    1  
ATOM   1877   C  CB   . PRO A 1 126 ? 4.035   23.121 50.809 1.00 11.41  ? 129 PRO A CB   1  
ATOM   1878   C  CG   . PRO A 1 126 ? 3.224   24.209 51.442 1.00 11.72  ? 129 PRO A CG   1  
ATOM   1879   C  CD   . PRO A 1 126 ? 3.637   24.289 52.919 1.00 12.03  ? 129 PRO A CD   1  
ATOM   1880   H  HA   . PRO A 1 126 ? 5.634   21.990 51.675 1.00 0.00   ? 129 PRO A HA   1  
ATOM   1881   H  HB2  . PRO A 1 126 ? 4.289   23.383 49.791 1.00 0.00   ? 129 PRO A HB2  1  
ATOM   1882   H  HB3  . PRO A 1 126 ? 3.488   22.192 50.833 1.00 0.00   ? 129 PRO A HB3  1  
ATOM   1883   H  HG2  . PRO A 1 126 ? 3.424   25.150 50.949 1.00 0.00   ? 129 PRO A HG2  1  
ATOM   1884   H  HG3  . PRO A 1 126 ? 2.173   23.972 51.374 1.00 0.00   ? 129 PRO A HG3  1  
ATOM   1885   H  HD2  . PRO A 1 126 ? 3.878   25.308 53.188 1.00 0.00   ? 129 PRO A HD2  1  
ATOM   1886   H  HD3  . PRO A 1 126 ? 2.855   23.902 53.553 1.00 0.00   ? 129 PRO A HD3  1  
ATOM   1887   N  N    . GLY A 1 127 ? 7.440   23.360 50.539 1.00 9.15   ? 130 GLY A N    1  
ATOM   1888   C  CA   . GLY A 1 127 ? 8.513   24.219 49.967 1.00 9.12   ? 130 GLY A CA   1  
ATOM   1889   C  C    . GLY A 1 127 ? 9.888   23.599 50.215 1.00 8.71   ? 130 GLY A C    1  
ATOM   1890   O  O    . GLY A 1 127 ? 10.090  22.847 51.147 1.00 9.88   ? 130 GLY A O    1  
ATOM   1891   H  H    . GLY A 1 127 ? 7.508   22.384 50.491 1.00 0.00   ? 130 GLY A H    1  
ATOM   1892   H  HA2  . GLY A 1 127 ? 8.355   24.325 48.903 1.00 0.00   ? 130 GLY A HA2  1  
ATOM   1893   H  HA3  . GLY A 1 127 ? 8.476   25.193 50.431 1.00 0.00   ? 130 GLY A HA3  1  
ATOM   1894   N  N    . VAL A 1 128 ? 10.836  23.926 49.381 1.00 7.46   ? 131 VAL A N    1  
ATOM   1895   C  CA   . VAL A 1 128 ? 12.201  23.390 49.542 1.00 8.11   ? 131 VAL A CA   1  
ATOM   1896   C  C    . VAL A 1 128 ? 12.820  24.063 50.749 1.00 7.80   ? 131 VAL A C    1  
ATOM   1897   O  O    . VAL A 1 128 ? 12.545  25.209 51.045 1.00 8.72   ? 131 VAL A O    1  
ATOM   1898   C  CB   . VAL A 1 128 ? 13.030  23.699 48.294 1.00 8.55   ? 131 VAL A CB   1  
ATOM   1899   C  CG1  . VAL A 1 128 ? 12.527  22.852 47.123 1.00 8.56   ? 131 VAL A CG1  1  
ATOM   1900   C  CG2  . VAL A 1 128 ? 12.890  25.182 47.945 1.00 8.76   ? 131 VAL A CG2  1  
ATOM   1901   H  H    . VAL A 1 128 ? 10.641  24.542 48.644 1.00 0.00   ? 131 VAL A H    1  
ATOM   1902   H  HA   . VAL A 1 128 ? 12.159  22.322 49.699 1.00 0.00   ? 131 VAL A HA   1  
ATOM   1903   H  HB   . VAL A 1 128 ? 14.068  23.467 48.485 1.00 0.00   ? 131 VAL A HB   1  
ATOM   1904   H  HG11 . VAL A 1 128 ? 13.113  23.070 46.243 1.00 0.00   ? 131 VAL A HG11 1  
ATOM   1905   H  HG12 . VAL A 1 128 ? 11.489  23.082 46.932 1.00 0.00   ? 131 VAL A HG12 1  
ATOM   1906   H  HG13 . VAL A 1 128 ? 12.623  21.804 47.369 1.00 0.00   ? 131 VAL A HG13 1  
ATOM   1907   H  HG21 . VAL A 1 128 ? 12.545  25.282 46.926 1.00 0.00   ? 131 VAL A HG21 1  
ATOM   1908   H  HG22 . VAL A 1 128 ? 13.849  25.668 48.049 1.00 0.00   ? 131 VAL A HG22 1  
ATOM   1909   H  HG23 . VAL A 1 128 ? 12.178  25.644 48.613 1.00 0.00   ? 131 VAL A HG23 1  
ATOM   1910   N  N    . PHE A 1 129 ? 13.631  23.363 51.461 1.00 7.64   ? 132 PHE A N    1  
ATOM   1911   C  CA   . PHE A 1 129 ? 14.244  23.961 52.665 1.00 7.68   ? 132 PHE A CA   1  
ATOM   1912   C  C    . PHE A 1 129 ? 15.633  23.390 52.813 1.00 7.66   ? 132 PHE A C    1  
ATOM   1913   O  O    . PHE A 1 129 ? 15.901  22.274 52.414 1.00 8.56   ? 132 PHE A O    1  
ATOM   1914   C  CB   . PHE A 1 129 ? 13.408  23.613 53.898 1.00 7.99   ? 132 PHE A CB   1  
ATOM   1915   C  CG   . PHE A 1 129 ? 12.047  24.257 53.783 1.00 8.49   ? 132 PHE A CG   1  
ATOM   1916   C  CD1  . PHE A 1 129 ? 11.049  23.651 53.011 1.00 10.08  ? 132 PHE A CD1  1  
ATOM   1917   C  CD2  . PHE A 1 129 ? 11.785  25.461 54.447 1.00 9.03   ? 132 PHE A CD2  1  
ATOM   1918   C  CE1  . PHE A 1 129 ? 9.787   24.249 52.904 1.00 12.00  ? 132 PHE A CE1  1  
ATOM   1919   C  CE2  . PHE A 1 129 ? 10.523  26.059 54.340 1.00 11.65  ? 132 PHE A CE2  1  
ATOM   1920   C  CZ   . PHE A 1 129 ? 9.525   25.453 53.568 1.00 12.20  ? 132 PHE A CZ   1  
ATOM   1921   H  H    . PHE A 1 129 ? 13.827  22.435 51.216 1.00 0.00   ? 132 PHE A H    1  
ATOM   1922   H  HA   . PHE A 1 129 ? 14.300  25.033 52.552 1.00 0.00   ? 132 PHE A HA   1  
ATOM   1923   H  HB2  . PHE A 1 129 ? 13.294  22.541 53.965 1.00 0.00   ? 132 PHE A HB2  1  
ATOM   1924   H  HB3  . PHE A 1 129 ? 13.904  23.978 54.785 1.00 0.00   ? 132 PHE A HB3  1  
ATOM   1925   H  HD1  . PHE A 1 129 ? 11.252  22.723 52.498 1.00 0.00   ? 132 PHE A HD1  1  
ATOM   1926   H  HD2  . PHE A 1 129 ? 12.555  25.929 55.042 1.00 0.00   ? 132 PHE A HD2  1  
ATOM   1927   H  HE1  . PHE A 1 129 ? 9.017   23.782 52.308 1.00 0.00   ? 132 PHE A HE1  1  
ATOM   1928   H  HE2  . PHE A 1 129 ? 10.321  26.988 54.852 1.00 0.00   ? 132 PHE A HE2  1  
ATOM   1929   H  HZ   . PHE A 1 129 ? 8.552   25.914 53.485 1.00 0.00   ? 132 PHE A HZ   1  
ATOM   1930   N  N    . VAL A 1 130 ? 16.529  24.135 53.362 1.00 7.53   ? 133 VAL A N    1  
ATOM   1931   C  CA   . VAL A 1 130 ? 17.929  23.589 53.501 1.00 7.75   ? 133 VAL A CA   1  
ATOM   1932   C  C    . VAL A 1 130 ? 18.199  22.962 54.897 1.00 7.71   ? 133 VAL A C    1  
ATOM   1933   O  O    . VAL A 1 130 ? 17.984  23.584 55.918 1.00 7.79   ? 133 VAL A O    1  
ATOM   1934   C  CB   . VAL A 1 130 ? 18.926  24.724 53.269 1.00 7.31   ? 133 VAL A CB   1  
ATOM   1935   C  CG1  . VAL A 1 130 ? 20.159  24.509 54.148 1.00 8.83   ? 133 VAL A CG1  1  
ATOM   1936   C  CG2  . VAL A 1 130 ? 19.347  24.740 51.797 1.00 9.05   ? 133 VAL A CG2  1  
ATOM   1937   H  H    . VAL A 1 130 ? 16.310  25.039 53.670 1.00 0.00   ? 133 VAL A H    1  
ATOM   1938   H  HA   . VAL A 1 130 ? 18.084  22.834 52.745 1.00 0.00   ? 133 VAL A HA   1  
ATOM   1939   H  HB   . VAL A 1 130 ? 18.464  25.667 53.523 1.00 0.00   ? 133 VAL A HB   1  
ATOM   1940   H  HG11 . VAL A 1 130 ? 20.735  23.680 53.763 1.00 0.00   ? 133 VAL A HG11 1  
ATOM   1941   H  HG12 . VAL A 1 130 ? 19.847  24.292 55.159 1.00 0.00   ? 133 VAL A HG12 1  
ATOM   1942   H  HG13 . VAL A 1 130 ? 20.766  25.402 54.142 1.00 0.00   ? 133 VAL A HG13 1  
ATOM   1943   H  HG21 . VAL A 1 130 ? 19.413  23.726 51.431 1.00 0.00   ? 133 VAL A HG21 1  
ATOM   1944   H  HG22 . VAL A 1 130 ? 20.309  25.220 51.703 1.00 0.00   ? 133 VAL A HG22 1  
ATOM   1945   H  HG23 . VAL A 1 130 ? 18.615  25.284 51.219 1.00 0.00   ? 133 VAL A HG23 1  
ATOM   1946   N  N    . TYR A 1 131 ? 18.732  21.743 54.933 1.00 7.79   ? 134 TYR A N    1  
ATOM   1947   C  CA   . TYR A 1 131 ? 19.083  21.100 56.219 1.00 7.38   ? 134 TYR A CA   1  
ATOM   1948   C  C    . TYR A 1 131 ? 20.601  21.205 56.352 1.00 6.98   ? 134 TYR A C    1  
ATOM   1949   O  O    . TYR A 1 131 ? 21.305  21.310 55.367 1.00 7.62   ? 134 TYR A O    1  
ATOM   1950   C  CB   . TYR A 1 131 ? 18.660  19.629 56.201 1.00 6.97   ? 134 TYR A CB   1  
ATOM   1951   C  CG   . TYR A 1 131 ? 19.474  18.882 55.172 1.00 7.38   ? 134 TYR A CG   1  
ATOM   1952   C  CD1  . TYR A 1 131 ? 20.783  18.484 55.469 1.00 7.44   ? 134 TYR A CD1  1  
ATOM   1953   C  CD2  . TYR A 1 131 ? 18.920  18.588 53.920 1.00 7.56   ? 134 TYR A CD2  1  
ATOM   1954   C  CE1  . TYR A 1 131 ? 21.538  17.792 54.514 1.00 8.55   ? 134 TYR A CE1  1  
ATOM   1955   C  CE2  . TYR A 1 131 ? 19.675  17.896 52.965 1.00 7.56   ? 134 TYR A CE2  1  
ATOM   1956   C  CZ   . TYR A 1 131 ? 20.984  17.498 53.262 1.00 7.39   ? 134 TYR A CZ   1  
ATOM   1957   O  OH   . TYR A 1 131 ? 21.728  16.816 52.321 1.00 8.30   ? 134 TYR A OH   1  
ATOM   1958   H  H    . TYR A 1 131 ? 18.936  21.282 54.093 1.00 0.00   ? 134 TYR A H    1  
ATOM   1959   H  HA   . TYR A 1 131 ? 18.603  21.618 57.036 1.00 0.00   ? 134 TYR A HA   1  
ATOM   1960   H  HB2  . TYR A 1 131 ? 18.827  19.195 57.176 1.00 0.00   ? 134 TYR A HB2  1  
ATOM   1961   H  HB3  . TYR A 1 131 ? 17.612  19.559 55.950 1.00 0.00   ? 134 TYR A HB3  1  
ATOM   1962   H  HD1  . TYR A 1 131 ? 21.211  18.711 56.434 1.00 0.00   ? 134 TYR A HD1  1  
ATOM   1963   H  HD2  . TYR A 1 131 ? 17.910  18.895 53.691 1.00 0.00   ? 134 TYR A HD2  1  
ATOM   1964   H  HE1  . TYR A 1 131 ? 22.548  17.485 54.743 1.00 0.00   ? 134 TYR A HE1  1  
ATOM   1965   H  HE2  . TYR A 1 131 ? 19.247  17.670 52.000 1.00 0.00   ? 134 TYR A HE2  1  
ATOM   1966   H  HH   . TYR A 1 131 ? 21.653  17.286 51.487 1.00 0.00   ? 134 TYR A HH   1  
ATOM   1967   N  N    . HIS A 1 132 ? 21.120  21.209 57.539 1.00 7.50   ? 135 HIS A N    1  
ATOM   1968   C  CA   . HIS A 1 132 ? 22.603  21.346 57.688 1.00 7.43   ? 135 HIS A CA   1  
ATOM   1969   C  C    . HIS A 1 132 ? 23.040  21.005 59.124 1.00 7.57   ? 135 HIS A C    1  
ATOM   1970   O  O    . HIS A 1 132 ? 22.344  21.289 60.079 1.00 8.71   ? 135 HIS A O    1  
ATOM   1971   C  CB   . HIS A 1 132 ? 23.023  22.789 57.327 1.00 7.59   ? 135 HIS A CB   1  
ATOM   1972   C  CG   . HIS A 1 132 ? 22.282  23.812 58.170 1.00 8.12   ? 135 HIS A CG   1  
ATOM   1973   N  ND1  . HIS A 1 132 ? 22.149  23.684 59.546 1.00 7.89   ? 135 HIS A ND1  1  
ATOM   1974   C  CD2  . HIS A 1 132 ? 21.672  25.010 57.854 1.00 8.34   ? 135 HIS A CD2  1  
ATOM   1975   C  CE1  . HIS A 1 132 ? 21.498  24.760 60.003 1.00 7.04   ? 135 HIS A CE1  1  
ATOM   1976   N  NE2  . HIS A 1 132 ? 21.197  25.581 59.007 1.00 8.75   ? 135 HIS A NE2  1  
ATOM   1977   H  H    . HIS A 1 132 ? 20.546  21.146 58.331 1.00 0.00   ? 135 HIS A H    1  
ATOM   1978   H  HA   . HIS A 1 132 ? 23.086  20.662 57.006 1.00 0.00   ? 135 HIS A HA   1  
ATOM   1979   H  HB2  . HIS A 1 132 ? 24.084  22.900 57.493 1.00 0.00   ? 135 HIS A HB2  1  
ATOM   1980   H  HB3  . HIS A 1 132 ? 22.809  22.968 56.283 1.00 0.00   ? 135 HIS A HB3  1  
ATOM   1981   H  HD1  . HIS A 1 132 ? 22.476  22.936 60.088 1.00 0.00   ? 135 HIS A HD1  1  
ATOM   1982   H  HD2  . HIS A 1 132 ? 21.584  25.429 56.862 1.00 0.00   ? 135 HIS A HD2  1  
ATOM   1983   H  HE1  . HIS A 1 132 ? 21.251  24.934 61.040 1.00 0.00   ? 135 HIS A HE1  1  
ATOM   1984   N  N    . CYS A 1 133 ? 24.193  20.385 59.279 1.00 7.68   ? 136 CYS A N    1  
ATOM   1985   C  CA   . CYS A 1 133 ? 24.672  20.016 60.638 1.00 7.92   ? 136 CYS A CA   1  
ATOM   1986   C  C    . CYS A 1 133 ? 25.089  21.289 61.365 1.00 8.16   ? 136 CYS A C    1  
ATOM   1987   O  O    . CYS A 1 133 ? 25.559  22.228 60.754 1.00 8.28   ? 136 CYS A O    1  
ATOM   1988   C  CB   . CYS A 1 133 ? 25.860  19.063 60.498 1.00 7.60   ? 136 CYS A CB   1  
ATOM   1989   S  SG   . CYS A 1 133 ? 26.878  19.111 61.982 1.00 9.42   ? 136 CYS A SG   1  
ATOM   1990   H  H    . CYS A 1 133 ? 24.735  20.160 58.494 1.00 0.00   ? 136 CYS A H    1  
ATOM   1991   H  HA   . CYS A 1 133 ? 23.877  19.529 61.184 1.00 0.00   ? 136 CYS A HA   1  
ATOM   1992   H  HB2  . CYS A 1 133 ? 25.496  18.058 60.349 1.00 0.00   ? 136 CYS A HB2  1  
ATOM   1993   H  HB3  . CYS A 1 133 ? 26.455  19.357 59.646 1.00 0.00   ? 136 CYS A HB3  1  
ATOM   1994   N  N    . ALA A 1 134 ? 24.901  21.358 62.654 1.00 8.63   ? 137 ALA A N    1  
ATOM   1995   C  CA   . ALA A 1 134 ? 25.276  22.615 63.359 1.00 9.02   ? 137 ALA A CA   1  
ATOM   1996   C  C    . ALA A 1 134 ? 25.559  22.355 64.835 1.00 9.54   ? 137 ALA A C    1  
ATOM   1997   O  O    . ALA A 1 134 ? 24.802  22.748 65.700 1.00 9.39   ? 137 ALA A O    1  
ATOM   1998   C  CB   . ALA A 1 134 ? 24.130  23.621 63.236 1.00 9.83   ? 137 ALA A CB   1  
ATOM   1999   H  H    . ALA A 1 134 ? 24.501  20.609 63.143 1.00 0.00   ? 137 ALA A H    1  
ATOM   2000   H  HA   . ALA A 1 134 ? 26.159  23.031 62.897 1.00 0.00   ? 137 ALA A HA   1  
ATOM   2001   H  HB1  . ALA A 1 134 ? 23.648  23.503 62.277 1.00 0.00   ? 137 ALA A HB1  1  
ATOM   2002   H  HB2  . ALA A 1 134 ? 24.521  24.624 63.322 1.00 0.00   ? 137 ALA A HB2  1  
ATOM   2003   H  HB3  . ALA A 1 134 ? 23.412  23.446 64.024 1.00 0.00   ? 137 ALA A HB3  1  
ATOM   2004   N  N    . PRO A 1 135 ? 26.661  21.727 65.119 1.00 8.85   ? 138 PRO A N    1  
ATOM   2005   C  CA   . PRO A 1 135 ? 27.084  21.440 66.518 1.00 9.49   ? 138 PRO A CA   1  
ATOM   2006   C  C    . PRO A 1 135 ? 27.370  22.742 67.276 1.00 10.18  ? 138 PRO A C    1  
ATOM   2007   O  O    . PRO A 1 135 ? 28.158  23.559 66.842 1.00 9.88   ? 138 PRO A O    1  
ATOM   2008   C  CB   . PRO A 1 135 ? 28.369  20.613 66.370 1.00 9.38   ? 138 PRO A CB   1  
ATOM   2009   C  CG   . PRO A 1 135 ? 28.431  20.193 64.936 1.00 9.74   ? 138 PRO A CG   1  
ATOM   2010   C  CD   . PRO A 1 135 ? 27.626  21.218 64.141 1.00 8.80   ? 138 PRO A CD   1  
ATOM   2011   H  HA   . PRO A 1 135 ? 26.332  20.862 67.030 1.00 0.00   ? 138 PRO A HA   1  
ATOM   2012   H  HB2  . PRO A 1 135 ? 29.230  21.217 66.621 1.00 0.00   ? 138 PRO A HB2  1  
ATOM   2013   H  HB3  . PRO A 1 135 ? 28.326  19.742 67.006 1.00 0.00   ? 138 PRO A HB3  1  
ATOM   2014   H  HG2  . PRO A 1 135 ? 29.459  20.183 64.599 1.00 0.00   ? 138 PRO A HG2  1  
ATOM   2015   H  HG3  . PRO A 1 135 ? 27.992  19.215 64.816 1.00 0.00   ? 138 PRO A HG3  1  
ATOM   2016   H  HD2  . PRO A 1 135 ? 28.269  22.012 63.786 1.00 0.00   ? 138 PRO A HD2  1  
ATOM   2017   H  HD3  . PRO A 1 135 ? 27.111  20.744 63.319 1.00 0.00   ? 138 PRO A HD3  1  
ATOM   2018   N  N    . PRO A 1 136 ? 26.718  22.940 68.386 1.00 10.48  ? 139 PRO A N    1  
ATOM   2019   C  CA   . PRO A 1 136 ? 26.879  24.173 69.212 1.00 11.06  ? 139 PRO A CA   1  
ATOM   2020   C  C    . PRO A 1 136 ? 28.334  24.662 69.303 1.00 10.93  ? 139 PRO A C    1  
ATOM   2021   O  O    . PRO A 1 136 ? 29.200  23.970 69.799 1.00 11.56  ? 139 PRO A O    1  
ATOM   2022   C  CB   . PRO A 1 136 ? 26.375  23.737 70.586 1.00 12.10  ? 139 PRO A CB   1  
ATOM   2023   C  CG   . PRO A 1 136 ? 25.368  22.664 70.316 1.00 12.63  ? 139 PRO A CG   1  
ATOM   2024   C  CD   . PRO A 1 136 ? 25.751  22.007 68.985 1.00 11.25  ? 139 PRO A CD   1  
ATOM   2025   H  HA   . PRO A 1 136 ? 26.246  24.958 68.834 1.00 0.00   ? 139 PRO A HA   1  
ATOM   2026   H  HB2  . PRO A 1 136 ? 27.192  23.348 71.177 1.00 0.00   ? 139 PRO A HB2  1  
ATOM   2027   H  HB3  . PRO A 1 136 ? 25.904  24.565 71.092 1.00 0.00   ? 139 PRO A HB3  1  
ATOM   2028   H  HG2  . PRO A 1 136 ? 25.389  21.932 71.112 1.00 0.00   ? 139 PRO A HG2  1  
ATOM   2029   H  HG3  . PRO A 1 136 ? 24.382  23.095 70.236 1.00 0.00   ? 139 PRO A HG3  1  
ATOM   2030   H  HD2  . PRO A 1 136 ? 26.209  21.043 69.158 1.00 0.00   ? 139 PRO A HD2  1  
ATOM   2031   H  HD3  . PRO A 1 136 ? 24.886  21.908 68.348 1.00 0.00   ? 139 PRO A HD3  1  
ATOM   2032   N  N    . GLY A 1 137 ? 28.603  25.863 68.845 1.00 11.33  ? 140 GLY A N    1  
ATOM   2033   C  CA   . GLY A 1 137 ? 29.999  26.402 68.929 1.00 11.27  ? 140 GLY A CA   1  
ATOM   2034   C  C    . GLY A 1 137 ? 30.801  26.181 67.625 1.00 11.86  ? 140 GLY A C    1  
ATOM   2035   O  O    . GLY A 1 137 ? 31.825  26.802 67.424 1.00 13.70  ? 140 GLY A O    1  
ATOM   2036   H  H    . GLY A 1 137 ? 27.888  26.413 68.462 1.00 0.00   ? 140 GLY A H    1  
ATOM   2037   H  HA2  . GLY A 1 137 ? 29.952  27.461 69.134 1.00 0.00   ? 140 GLY A HA2  1  
ATOM   2038   H  HA3  . GLY A 1 137 ? 30.514  25.911 69.742 1.00 0.00   ? 140 GLY A HA3  1  
ATOM   2039   N  N    . MET A 1 138 ? 30.378  25.305 66.745 1.00 11.72  ? 141 MET A N    1  
ATOM   2040   C  CA   . MET A 1 138 ? 31.162  25.079 65.500 1.00 11.51  ? 141 MET A CA   1  
ATOM   2041   C  C    . MET A 1 138 ? 30.196  24.955 64.339 1.00 9.85   ? 141 MET A C    1  
ATOM   2042   O  O    . MET A 1 138 ? 30.376  24.161 63.438 1.00 9.89   ? 141 MET A O    1  
ATOM   2043   C  CB   . MET A 1 138 ? 31.976  23.789 65.632 1.00 12.74  ? 141 MET A CB   1  
ATOM   2044   C  CG   . MET A 1 138 ? 32.987  23.937 66.771 1.00 15.68  ? 141 MET A CG   1  
ATOM   2045   S  SD   . MET A 1 138 ? 33.886  22.381 66.985 1.00 20.02  ? 141 MET A SD   1  
ATOM   2046   C  CE   . MET A 1 138 ? 32.577  21.478 67.848 1.00 18.30  ? 141 MET A CE   1  
ATOM   2047   H  H    . MET A 1 138 ? 29.559  24.793 66.912 1.00 0.00   ? 141 MET A H    1  
ATOM   2048   H  HA   . MET A 1 138 ? 31.827  25.913 65.333 1.00 0.00   ? 141 MET A HA   1  
ATOM   2049   H  HB2  . MET A 1 138 ? 31.311  22.964 65.844 1.00 0.00   ? 141 MET A HB2  1  
ATOM   2050   H  HB3  . MET A 1 138 ? 32.503  23.600 64.709 1.00 0.00   ? 141 MET A HB3  1  
ATOM   2051   H  HG2  . MET A 1 138 ? 33.684  24.727 66.534 1.00 0.00   ? 141 MET A HG2  1  
ATOM   2052   H  HG3  . MET A 1 138 ? 32.465  24.180 67.685 1.00 0.00   ? 141 MET A HG3  1  
ATOM   2053   H  HE1  . MET A 1 138 ? 31.957  22.178 68.392 1.00 0.00   ? 141 MET A HE1  1  
ATOM   2054   H  HE2  . MET A 1 138 ? 33.021  20.772 68.536 1.00 0.00   ? 141 MET A HE2  1  
ATOM   2055   H  HE3  . MET A 1 138 ? 31.972  20.947 67.132 1.00 0.00   ? 141 MET A HE3  1  
ATOM   2056   N  N    . VAL A 1 139 ? 29.160  25.732 64.367 1.00 9.72   ? 142 VAL A N    1  
ATOM   2057   C  CA   . VAL A 1 139 ? 28.147  25.665 63.270 1.00 9.18   ? 142 VAL A CA   1  
ATOM   2058   C  C    . VAL A 1 139 ? 28.776  26.004 61.905 1.00 8.60   ? 142 VAL A C    1  
ATOM   2059   O  O    . VAL A 1 139 ? 28.830  25.176 61.017 1.00 8.67   ? 142 VAL A O    1  
ATOM   2060   C  CB   . VAL A 1 139 ? 27.023  26.659 63.564 1.00 9.26   ? 142 VAL A CB   1  
ATOM   2061   C  CG1  . VAL A 1 139 ? 26.151  26.829 62.319 1.00 10.19  ? 142 VAL A CG1  1  
ATOM   2062   C  CG2  . VAL A 1 139 ? 26.165  26.130 64.717 1.00 9.44   ? 142 VAL A CG2  1  
ATOM   2063   H  H    . VAL A 1 139 ? 29.035  26.356 65.112 1.00 0.00   ? 142 VAL A H    1  
ATOM   2064   H  HA   . VAL A 1 139 ? 27.734  24.668 63.231 1.00 0.00   ? 142 VAL A HA   1  
ATOM   2065   H  HB   . VAL A 1 139 ? 27.449  27.613 63.838 1.00 0.00   ? 142 VAL A HB   1  
ATOM   2066   H  HG11 . VAL A 1 139 ? 26.782  26.997 61.458 1.00 0.00   ? 142 VAL A HG11 1  
ATOM   2067   H  HG12 . VAL A 1 139 ? 25.493  27.674 62.453 1.00 0.00   ? 142 VAL A HG12 1  
ATOM   2068   H  HG13 . VAL A 1 139 ? 25.564  25.936 62.165 1.00 0.00   ? 142 VAL A HG13 1  
ATOM   2069   H  HG21 . VAL A 1 139 ? 26.605  26.426 65.658 1.00 0.00   ? 142 VAL A HG21 1  
ATOM   2070   H  HG22 . VAL A 1 139 ? 26.117  25.053 64.665 1.00 0.00   ? 142 VAL A HG22 1  
ATOM   2071   H  HG23 . VAL A 1 139 ? 25.169  26.539 64.641 1.00 0.00   ? 142 VAL A HG23 1  
ATOM   2072   N  N    . PRO A 1 140 ? 29.210  27.225 61.735 1.00 8.03   ? 143 PRO A N    1  
ATOM   2073   C  CA   . PRO A 1 140 ? 29.807  27.722 60.459 1.00 8.47   ? 143 PRO A CA   1  
ATOM   2074   C  C    . PRO A 1 140 ? 30.878  26.793 59.887 1.00 8.35   ? 143 PRO A C    1  
ATOM   2075   O  O    . PRO A 1 140 ? 31.036  26.681 58.687 1.00 8.58   ? 143 PRO A O    1  
ATOM   2076   C  CB   . PRO A 1 140 ? 30.424  29.081 60.828 1.00 9.45   ? 143 PRO A CB   1  
ATOM   2077   C  CG   . PRO A 1 140 ? 30.296  29.219 62.313 1.00 9.12   ? 143 PRO A CG   1  
ATOM   2078   C  CD   . PRO A 1 140 ? 29.182  28.275 62.754 1.00 9.74   ? 143 PRO A CD   1  
ATOM   2079   H  HA   . PRO A 1 140 ? 29.030  27.877 59.728 1.00 0.00   ? 143 PRO A HA   1  
ATOM   2080   H  HB2  . PRO A 1 140 ? 31.466  29.103 60.539 1.00 0.00   ? 143 PRO A HB2  1  
ATOM   2081   H  HB3  . PRO A 1 140 ? 29.886  29.878 60.338 1.00 0.00   ? 143 PRO A HB3  1  
ATOM   2082   H  HG2  . PRO A 1 140 ? 31.228  28.944 62.790 1.00 0.00   ? 143 PRO A HG2  1  
ATOM   2083   H  HG3  . PRO A 1 140 ? 30.034  30.233 62.569 1.00 0.00   ? 143 PRO A HG3  1  
ATOM   2084   H  HD2  . PRO A 1 140 ? 29.395  27.867 63.733 1.00 0.00   ? 143 PRO A HD2  1  
ATOM   2085   H  HD3  . PRO A 1 140 ? 28.229  28.779 62.746 1.00 0.00   ? 143 PRO A HD3  1  
ATOM   2086   N  N    . TRP A 1 141 ? 31.624  26.139 60.725 1.00 8.50   ? 144 TRP A N    1  
ATOM   2087   C  CA   . TRP A 1 141 ? 32.694  25.232 60.212 1.00 8.91   ? 144 TRP A CA   1  
ATOM   2088   C  C    . TRP A 1 141 ? 32.070  23.982 59.580 1.00 8.29   ? 144 TRP A C    1  
ATOM   2089   O  O    . TRP A 1 141 ? 32.417  23.586 58.485 1.00 8.83   ? 144 TRP A O    1  
ATOM   2090   C  CB   . TRP A 1 141 ? 33.603  24.815 61.369 1.00 9.28   ? 144 TRP A CB   1  
ATOM   2091   C  CG   . TRP A 1 141 ? 34.727  23.980 60.844 1.00 10.25  ? 144 TRP A CG   1  
ATOM   2092   C  CD1  . TRP A 1 141 ? 35.364  24.185 59.669 1.00 11.93  ? 144 TRP A CD1  1  
ATOM   2093   C  CD2  . TRP A 1 141 ? 35.357  22.815 61.453 1.00 11.33  ? 144 TRP A CD2  1  
ATOM   2094   N  NE1  . TRP A 1 141 ? 36.344  23.221 59.517 1.00 12.89  ? 144 TRP A NE1  1  
ATOM   2095   C  CE2  . TRP A 1 141 ? 36.379  22.353 60.591 1.00 12.00  ? 144 TRP A CE2  1  
ATOM   2096   C  CE3  . TRP A 1 141 ? 35.142  22.122 62.658 1.00 12.39  ? 144 TRP A CE3  1  
ATOM   2097   C  CZ2  . TRP A 1 141 ? 37.161  21.243 60.912 1.00 12.66  ? 144 TRP A CZ2  1  
ATOM   2098   C  CZ3  . TRP A 1 141 ? 35.927  21.004 62.984 1.00 13.76  ? 144 TRP A CZ3  1  
ATOM   2099   C  CH2  . TRP A 1 141 ? 36.934  20.566 62.113 1.00 14.23  ? 144 TRP A CH2  1  
ATOM   2100   H  H    . TRP A 1 141 ? 31.492  26.248 61.690 1.00 0.00   ? 144 TRP A H    1  
ATOM   2101   H  HA   . TRP A 1 141 ? 33.279  25.753 59.469 1.00 0.00   ? 144 TRP A HA   1  
ATOM   2102   H  HB2  . TRP A 1 141 ? 34.003  25.696 61.849 1.00 0.00   ? 144 TRP A HB2  1  
ATOM   2103   H  HB3  . TRP A 1 141 ? 33.034  24.242 62.086 1.00 0.00   ? 144 TRP A HB3  1  
ATOM   2104   H  HD1  . TRP A 1 141 ? 35.143  24.973 58.964 1.00 0.00   ? 144 TRP A HD1  1  
ATOM   2105   H  HE1  . TRP A 1 141 ? 36.949  23.146 58.750 1.00 0.00   ? 144 TRP A HE1  1  
ATOM   2106   H  HE3  . TRP A 1 141 ? 34.369  22.451 63.336 1.00 0.00   ? 144 TRP A HE3  1  
ATOM   2107   H  HZ2  . TRP A 1 141 ? 37.935  20.910 60.237 1.00 0.00   ? 144 TRP A HZ2  1  
ATOM   2108   H  HZ3  . TRP A 1 141 ? 35.754  20.479 63.912 1.00 0.00   ? 144 TRP A HZ3  1  
ATOM   2109   H  HH2  . TRP A 1 141 ? 37.535  19.705 62.370 1.00 0.00   ? 144 TRP A HH2  1  
ATOM   2110   N  N    . HIS A 1 142 ? 31.162  23.355 60.271 1.00 8.20   ? 145 HIS A N    1  
ATOM   2111   C  CA   . HIS A 1 142 ? 30.516  22.126 59.737 1.00 7.67   ? 145 HIS A CA   1  
ATOM   2112   C  C    . HIS A 1 142 ? 29.748  22.425 58.440 1.00 8.02   ? 145 HIS A C    1  
ATOM   2113   O  O    . HIS A 1 142 ? 29.709  21.613 57.537 1.00 8.16   ? 145 HIS A O    1  
ATOM   2114   C  CB   . HIS A 1 142 ? 29.545  21.598 60.789 1.00 7.67   ? 145 HIS A CB   1  
ATOM   2115   C  CG   . HIS A 1 142 ? 30.313  20.899 61.876 1.00 7.92   ? 145 HIS A CG   1  
ATOM   2116   N  ND1  . HIS A 1 142 ? 30.145  19.573 62.129 1.00 9.40   ? 145 HIS A ND1  1  
ATOM   2117   C  CD2  . HIS A 1 142 ? 31.235  21.331 62.767 1.00 9.70   ? 145 HIS A CD2  1  
ATOM   2118   C  CE1  . HIS A 1 142 ? 30.847  19.240 63.195 1.00 9.42   ? 145 HIS A CE1  1  
ATOM   2119   N  NE2  . HIS A 1 142 ? 31.514  20.288 63.614 1.00 9.18   ? 145 HIS A NE2  1  
ATOM   2120   H  H    . HIS A 1 142 ? 30.908  23.691 61.156 1.00 0.00   ? 145 HIS A H    1  
ATOM   2121   H  HA   . HIS A 1 142 ? 31.271  21.379 59.544 1.00 0.00   ? 145 HIS A HA   1  
ATOM   2122   H  HB2  . HIS A 1 142 ? 28.991  22.423 61.213 1.00 0.00   ? 145 HIS A HB2  1  
ATOM   2123   H  HB3  . HIS A 1 142 ? 28.860  20.902 60.329 1.00 0.00   ? 145 HIS A HB3  1  
ATOM   2124   H  HD2  . HIS A 1 142 ? 31.673  22.318 62.804 1.00 0.00   ? 145 HIS A HD2  1  
ATOM   2125   H  HE1  . HIS A 1 142 ? 30.868  18.261 63.650 1.00 0.00   ? 145 HIS A HE1  1  
ATOM   2126   H  HE2  . HIS A 1 142 ? 32.106  20.320 64.393 1.00 0.00   ? 145 HIS A HE2  1  
ATOM   2127   N  N    . VAL A 1 143 ? 29.121  23.567 58.343 1.00 8.01   ? 146 VAL A N    1  
ATOM   2128   C  CA   . VAL A 1 143 ? 28.344  23.886 57.111 1.00 7.73   ? 146 VAL A CA   1  
ATOM   2129   C  C    . VAL A 1 143 ? 29.295  24.187 55.952 1.00 7.60   ? 146 VAL A C    1  
ATOM   2130   O  O    . VAL A 1 143 ? 29.142  23.673 54.861 1.00 8.18   ? 146 VAL A O    1  
ATOM   2131   C  CB   . VAL A 1 143 ? 27.460  25.108 57.371 1.00 7.52   ? 146 VAL A CB   1  
ATOM   2132   C  CG1  . VAL A 1 143 ? 26.757  25.515 56.075 1.00 8.30   ? 146 VAL A CG1  1  
ATOM   2133   C  CG2  . VAL A 1 143 ? 26.412  24.761 58.431 1.00 8.56   ? 146 VAL A CG2  1  
ATOM   2134   H  H    . VAL A 1 143 ? 29.148  24.206 59.085 1.00 0.00   ? 146 VAL A H    1  
ATOM   2135   H  HA   . VAL A 1 143 ? 27.720  23.044 56.852 1.00 0.00   ? 146 VAL A HA   1  
ATOM   2136   H  HB   . VAL A 1 143 ? 28.073  25.927 57.720 1.00 0.00   ? 146 VAL A HB   1  
ATOM   2137   H  HG11 . VAL A 1 143 ? 27.468  25.508 55.262 1.00 0.00   ? 146 VAL A HG11 1  
ATOM   2138   H  HG12 . VAL A 1 143 ? 26.347  26.508 56.185 1.00 0.00   ? 146 VAL A HG12 1  
ATOM   2139   H  HG13 . VAL A 1 143 ? 25.960  24.818 55.863 1.00 0.00   ? 146 VAL A HG13 1  
ATOM   2140   H  HG21 . VAL A 1 143 ? 25.934  25.667 58.773 1.00 0.00   ? 146 VAL A HG21 1  
ATOM   2141   H  HG22 . VAL A 1 143 ? 26.892  24.270 59.264 1.00 0.00   ? 146 VAL A HG22 1  
ATOM   2142   H  HG23 . VAL A 1 143 ? 25.672  24.102 58.003 1.00 0.00   ? 146 VAL A HG23 1  
ATOM   2143   N  N    . VAL A 1 144 ? 30.267  25.022 56.175 1.00 7.85   ? 147 VAL A N    1  
ATOM   2144   C  CA   . VAL A 1 144 ? 31.222  25.367 55.083 1.00 7.86   ? 147 VAL A CA   1  
ATOM   2145   C  C    . VAL A 1 144 ? 31.966  24.110 54.632 1.00 7.56   ? 147 VAL A C    1  
ATOM   2146   O  O    . VAL A 1 144 ? 32.345  23.978 53.486 1.00 8.73   ? 147 VAL A O    1  
ATOM   2147   C  CB   . VAL A 1 144 ? 32.229  26.398 55.594 1.00 8.45   ? 147 VAL A CB   1  
ATOM   2148   C  CG1  . VAL A 1 144 ? 31.528  27.744 55.790 1.00 9.55   ? 147 VAL A CG1  1  
ATOM   2149   C  CG2  . VAL A 1 144 ? 32.806  25.927 56.931 1.00 9.63   ? 147 VAL A CG2  1  
ATOM   2150   H  H    . VAL A 1 144 ? 30.367  25.432 57.060 1.00 0.00   ? 147 VAL A H    1  
ATOM   2151   H  HA   . VAL A 1 144 ? 30.677  25.781 54.247 1.00 0.00   ? 147 VAL A HA   1  
ATOM   2152   H  HB   . VAL A 1 144 ? 33.027  26.510 54.874 1.00 0.00   ? 147 VAL A HB   1  
ATOM   2153   H  HG11 . VAL A 1 144 ? 32.252  28.487 56.089 1.00 0.00   ? 147 VAL A HG11 1  
ATOM   2154   H  HG12 . VAL A 1 144 ? 30.773  27.648 56.556 1.00 0.00   ? 147 VAL A HG12 1  
ATOM   2155   H  HG13 . VAL A 1 144 ? 31.064  28.046 54.863 1.00 0.00   ? 147 VAL A HG13 1  
ATOM   2156   H  HG21 . VAL A 1 144 ? 32.575  26.651 57.698 1.00 0.00   ? 147 VAL A HG21 1  
ATOM   2157   H  HG22 . VAL A 1 144 ? 33.878  25.824 56.844 1.00 0.00   ? 147 VAL A HG22 1  
ATOM   2158   H  HG23 . VAL A 1 144 ? 32.373  24.973 57.193 1.00 0.00   ? 147 VAL A HG23 1  
ATOM   2159   N  N    . SER A 1 145 ? 32.180  23.187 55.526 1.00 8.58   ? 148 SER A N    1  
ATOM   2160   C  CA   . SER A 1 145 ? 32.904  21.936 55.150 1.00 8.72   ? 148 SER A CA   1  
ATOM   2161   C  C    . SER A 1 145 ? 32.053  21.103 54.182 1.00 8.23   ? 148 SER A C    1  
ATOM   2162   O  O    . SER A 1 145 ? 32.483  20.078 53.692 1.00 8.98   ? 148 SER A O    1  
ATOM   2163   C  CB   . SER A 1 145 ? 33.188  21.117 56.409 1.00 8.41   ? 148 SER A CB   1  
ATOM   2164   O  OG   . SER A 1 145 ? 34.120  21.817 57.224 1.00 9.98   ? 148 SER A OG   1  
ATOM   2165   H  H    . SER A 1 145 ? 31.867  23.314 56.446 1.00 0.00   ? 148 SER A H    1  
ATOM   2166   H  HA   . SER A 1 145 ? 33.839  22.194 54.673 1.00 0.00   ? 148 SER A HA   1  
ATOM   2167   H  HB2  . SER A 1 145 ? 32.275  20.972 56.960 1.00 0.00   ? 148 SER A HB2  1  
ATOM   2168   H  HB3  . SER A 1 145 ? 33.593  20.154 56.127 1.00 0.00   ? 148 SER A HB3  1  
ATOM   2169   H  HG   . SER A 1 145 ? 34.612  22.419 56.662 1.00 0.00   ? 148 SER A HG   1  
ATOM   2170   N  N    . GLY A 1 146 ? 30.851  21.530 53.905 1.00 7.78   ? 149 GLY A N    1  
ATOM   2171   C  CA   . GLY A 1 146 ? 29.979  20.760 52.973 1.00 7.87   ? 149 GLY A CA   1  
ATOM   2172   C  C    . GLY A 1 146 ? 28.991  19.872 53.751 1.00 7.24   ? 149 GLY A C    1  
ATOM   2173   O  O    . GLY A 1 146 ? 28.545  18.859 53.250 1.00 7.53   ? 149 GLY A O    1  
ATOM   2174   H  H    . GLY A 1 146 ? 30.521  22.359 54.311 1.00 0.00   ? 149 GLY A H    1  
ATOM   2175   H  HA2  . GLY A 1 146 ? 29.424  21.451 52.354 1.00 0.00   ? 149 GLY A HA2  1  
ATOM   2176   H  HA3  . GLY A 1 146 ? 30.595  20.136 52.344 1.00 0.00   ? 149 GLY A HA3  1  
ATOM   2177   N  N    . MET A 1 147 ? 28.628  20.234 54.960 1.00 7.27   ? 150 MET A N    1  
ATOM   2178   C  CA   . MET A 1 147 ? 27.660  19.388 55.715 1.00 7.47   ? 150 MET A CA   1  
ATOM   2179   C  C    . MET A 1 147 ? 26.273  20.029 55.644 1.00 7.14   ? 150 MET A C    1  
ATOM   2180   O  O    . MET A 1 147 ? 25.744  20.509 56.627 1.00 7.89   ? 150 MET A O    1  
ATOM   2181   C  CB   . MET A 1 147 ? 28.094  19.258 57.176 1.00 7.57   ? 150 MET A CB   1  
ATOM   2182   C  CG   . MET A 1 147 ? 27.399  18.043 57.798 1.00 7.37   ? 150 MET A CG   1  
ATOM   2183   S  SD   . MET A 1 147 ? 28.421  17.358 59.087 1.00 8.80   ? 150 MET A SD   1  
ATOM   2184   C  CE   . MET A 1 147 ? 27.347  15.947 59.526 1.00 9.53   ? 150 MET A CE   1  
ATOM   2185   H  H    . MET A 1 147 ? 28.982  21.057 55.358 1.00 0.00   ? 150 MET A H    1  
ATOM   2186   H  HA   . MET A 1 147 ? 27.620  18.406 55.265 1.00 0.00   ? 150 MET A HA   1  
ATOM   2187   H  HB2  . MET A 1 147 ? 29.166  19.127 57.224 1.00 0.00   ? 150 MET A HB2  1  
ATOM   2188   H  HB3  . MET A 1 147 ? 27.813  20.148 57.718 1.00 0.00   ? 150 MET A HB3  1  
ATOM   2189   H  HG2  . MET A 1 147 ? 26.451  18.347 58.216 1.00 0.00   ? 150 MET A HG2  1  
ATOM   2190   H  HG3  . MET A 1 147 ? 27.232  17.296 57.036 1.00 0.00   ? 150 MET A HG3  1  
ATOM   2191   H  HE1  . MET A 1 147 ? 26.714  16.223 60.358 1.00 0.00   ? 150 MET A HE1  1  
ATOM   2192   H  HE2  . MET A 1 147 ? 27.961  15.100 59.798 1.00 0.00   ? 150 MET A HE2  1  
ATOM   2193   H  HE3  . MET A 1 147 ? 26.732  15.685 58.681 1.00 0.00   ? 150 MET A HE3  1  
ATOM   2194   N  N    . ASN A 1 148 ? 25.687  20.042 54.480 1.00 7.28   ? 151 ASN A N    1  
ATOM   2195   C  CA   . ASN A 1 148 ? 24.340  20.650 54.318 1.00 7.20   ? 151 ASN A CA   1  
ATOM   2196   C  C    . ASN A 1 148 ? 23.744  20.238 52.964 1.00 7.57   ? 151 ASN A C    1  
ATOM   2197   O  O    . ASN A 1 148 ? 24.447  20.029 51.995 1.00 8.02   ? 151 ASN A O    1  
ATOM   2198   C  CB   . ASN A 1 148 ? 24.459  22.175 54.379 1.00 7.61   ? 151 ASN A CB   1  
ATOM   2199   C  CG   . ASN A 1 148 ? 25.273  22.671 53.183 1.00 7.78   ? 151 ASN A CG   1  
ATOM   2200   O  OD1  . ASN A 1 148 ? 24.736  22.886 52.114 1.00 8.09   ? 151 ASN A OD1  1  
ATOM   2201   N  ND2  . ASN A 1 148 ? 26.557  22.864 53.318 1.00 7.90   ? 151 ASN A ND2  1  
ATOM   2202   H  H    . ASN A 1 148 ? 26.140  19.650 53.704 1.00 0.00   ? 151 ASN A H    1  
ATOM   2203   H  HA   . ASN A 1 148 ? 23.693  20.309 55.113 1.00 0.00   ? 151 ASN A HA   1  
ATOM   2204   H  HB2  . ASN A 1 148 ? 23.472  22.614 54.351 1.00 0.00   ? 151 ASN A HB2  1  
ATOM   2205   H  HB3  . ASN A 1 148 ? 24.955  22.461 55.294 1.00 0.00   ? 151 ASN A HB3  1  
ATOM   2206   H  HD21 . ASN A 1 148 ? 26.990  22.691 54.180 1.00 0.00   ? 151 ASN A HD21 1  
ATOM   2207   H  HD22 . ASN A 1 148 ? 27.087  23.183 52.558 1.00 0.00   ? 151 ASN A HD22 1  
ATOM   2208   N  N    . GLY A 1 149 ? 22.448  20.127 52.905 1.00 7.17   ? 152 GLY A N    1  
ATOM   2209   C  CA   . GLY A 1 149 ? 21.752  19.734 51.636 1.00 7.37   ? 152 GLY A CA   1  
ATOM   2210   C  C    . GLY A 1 149 ? 20.368  20.409 51.596 1.00 7.42   ? 152 GLY A C    1  
ATOM   2211   O  O    . GLY A 1 149 ? 20.240  21.576 51.909 1.00 7.52   ? 152 GLY A O    1  
ATOM   2212   H  H    . GLY A 1 149 ? 21.915  20.306 53.708 1.00 0.00   ? 152 GLY A H    1  
ATOM   2213   H  HA2  . GLY A 1 149 ? 22.339  20.056 50.787 1.00 0.00   ? 152 GLY A HA2  1  
ATOM   2214   H  HA3  . GLY A 1 149 ? 21.628  18.663 51.607 1.00 0.00   ? 152 GLY A HA3  1  
ATOM   2215   N  N    . ALA A 1 150 ? 19.324  19.696 51.225 1.00 8.04   ? 153 ALA A N    1  
ATOM   2216   C  CA   . ALA A 1 150 ? 17.974  20.344 51.194 1.00 7.92   ? 153 ALA A CA   1  
ATOM   2217   C  C    . ALA A 1 150 ? 16.868  19.303 50.957 1.00 7.91   ? 153 ALA A C    1  
ATOM   2218   O  O    . ALA A 1 150 ? 17.053  18.335 50.247 1.00 8.00   ? 153 ALA A O    1  
ATOM   2219   C  CB   . ALA A 1 150 ? 17.939  21.380 50.069 1.00 8.38   ? 153 ALA A CB   1  
ATOM   2220   H  H    . ALA A 1 150 ? 19.428  18.753 50.979 1.00 0.00   ? 153 ALA A H    1  
ATOM   2221   H  HA   . ALA A 1 150 ? 17.797  20.840 52.136 1.00 0.00   ? 153 ALA A HA   1  
ATOM   2222   H  HB1  . ALA A 1 150 ? 18.768  21.211 49.398 1.00 0.00   ? 153 ALA A HB1  1  
ATOM   2223   H  HB2  . ALA A 1 150 ? 18.013  22.371 50.490 1.00 0.00   ? 153 ALA A HB2  1  
ATOM   2224   H  HB3  . ALA A 1 150 ? 17.011  21.289 49.524 1.00 0.00   ? 153 ALA A HB3  1  
ATOM   2225   N  N    . ILE A 1 151 ? 15.708  19.514 51.537 1.00 7.70   ? 154 ILE A N    1  
ATOM   2226   C  CA   . ILE A 1 151 ? 14.579  18.561 51.337 1.00 7.91   ? 154 ILE A CA   1  
ATOM   2227   C  C    . ILE A 1 151 ? 13.405  19.305 50.685 1.00 8.06   ? 154 ILE A C    1  
ATOM   2228   O  O    . ILE A 1 151 ? 13.210  20.484 50.906 1.00 8.70   ? 154 ILE A O    1  
ATOM   2229   C  CB   . ILE A 1 151 ? 14.139  17.996 52.689 1.00 8.40   ? 154 ILE A CB   1  
ATOM   2230   C  CG1  . ILE A 1 151 ? 13.254  19.020 53.404 1.00 9.46   ? 154 ILE A CG1  1  
ATOM   2231   C  CG2  . ILE A 1 151 ? 15.372  17.704 53.546 1.00 8.86   ? 154 ILE A CG2  1  
ATOM   2232   C  CD1  . ILE A 1 151 ? 12.437  18.318 54.490 1.00 9.82   ? 154 ILE A CD1  1  
ATOM   2233   H  H    . ILE A 1 151 ? 15.580  20.310 52.093 1.00 0.00   ? 154 ILE A H    1  
ATOM   2234   H  HA   . ILE A 1 151 ? 14.897  17.754 50.693 1.00 0.00   ? 154 ILE A HA   1  
ATOM   2235   H  HB   . ILE A 1 151 ? 13.584  17.082 52.534 1.00 0.00   ? 154 ILE A HB   1  
ATOM   2236   H  HG12 . ILE A 1 151 ? 13.875  19.781 53.854 1.00 0.00   ? 154 ILE A HG12 1  
ATOM   2237   H  HG13 . ILE A 1 151 ? 12.584  19.477 52.691 1.00 0.00   ? 154 ILE A HG13 1  
ATOM   2238   H  HG21 . ILE A 1 151 ? 16.265  17.912 52.975 1.00 0.00   ? 154 ILE A HG21 1  
ATOM   2239   H  HG22 . ILE A 1 151 ? 15.368  16.666 53.841 1.00 0.00   ? 154 ILE A HG22 1  
ATOM   2240   H  HG23 . ILE A 1 151 ? 15.355  18.329 54.427 1.00 0.00   ? 154 ILE A HG23 1  
ATOM   2241   H  HD11 . ILE A 1 151 ? 12.435  18.921 55.386 1.00 0.00   ? 154 ILE A HD11 1  
ATOM   2242   H  HD12 . ILE A 1 151 ? 12.876  17.355 54.705 1.00 0.00   ? 154 ILE A HD12 1  
ATOM   2243   H  HD13 . ILE A 1 151 ? 11.422  18.182 54.146 1.00 0.00   ? 154 ILE A HD13 1  
ATOM   2244   N  N    . MET A 1 152 ? 12.626  18.631 49.881 1.00 8.16   ? 155 MET A N    1  
ATOM   2245   C  CA   . MET A 1 152 ? 11.474  19.305 49.216 1.00 8.21   ? 155 MET A CA   1  
ATOM   2246   C  C    . MET A 1 152 ? 10.150  18.691 49.690 1.00 8.75   ? 155 MET A C    1  
ATOM   2247   O  O    . MET A 1 152 ? 9.857   17.539 49.436 1.00 9.17   ? 155 MET A O    1  
ATOM   2248   C  CB   . MET A 1 152 ? 11.597  19.137 47.700 1.00 8.70   ? 155 MET A CB   1  
ATOM   2249   C  CG   . MET A 1 152 ? 10.515  19.966 47.005 1.00 9.44   ? 155 MET A CG   1  
ATOM   2250   S  SD   . MET A 1 152 ? 10.898  20.101 45.242 1.00 10.79  ? 155 MET A SD   1  
ATOM   2251   C  CE   . MET A 1 152 ? 10.862  18.332 44.865 1.00 11.06  ? 155 MET A CE   1  
ATOM   2252   H  H    . MET A 1 152 ? 12.802  17.682 49.712 1.00 0.00   ? 155 MET A H    1  
ATOM   2253   H  HA   . MET A 1 152 ? 11.487  20.357 49.459 1.00 0.00   ? 155 MET A HA   1  
ATOM   2254   H  HB2  . MET A 1 152 ? 12.572  19.473 47.378 1.00 0.00   ? 155 MET A HB2  1  
ATOM   2255   H  HB3  . MET A 1 152 ? 11.471  18.096 47.442 1.00 0.00   ? 155 MET A HB3  1  
ATOM   2256   H  HG2  . MET A 1 152 ? 9.557   19.484 47.130 1.00 0.00   ? 155 MET A HG2  1  
ATOM   2257   H  HG3  . MET A 1 152 ? 10.482  20.953 47.443 1.00 0.00   ? 155 MET A HG3  1  
ATOM   2258   H  HE1  . MET A 1 152 ? 11.417  17.792 45.620 1.00 0.00   ? 155 MET A HE1  1  
ATOM   2259   H  HE2  . MET A 1 152 ? 11.306  18.162 43.894 1.00 0.00   ? 155 MET A HE2  1  
ATOM   2260   H  HE3  . MET A 1 152 ? 9.841   17.985 44.857 1.00 0.00   ? 155 MET A HE3  1  
ATOM   2261   N  N    . VAL A 1 153 ? 9.344   19.468 50.361 1.00 8.33   ? 156 VAL A N    1  
ATOM   2262   C  CA   . VAL A 1 153 ? 8.030   18.976 50.845 1.00 8.83   ? 156 VAL A CA   1  
ATOM   2263   C  C    . VAL A 1 153 ? 7.016   19.490 49.853 1.00 9.29   ? 156 VAL A C    1  
ATOM   2264   O  O    . VAL A 1 153 ? 6.690   20.660 49.831 1.00 9.74   ? 156 VAL A O    1  
ATOM   2265   C  CB   . VAL A 1 153 ? 7.737   19.538 52.238 1.00 8.73   ? 156 VAL A CB   1  
ATOM   2266   C  CG1  . VAL A 1 153 ? 6.411   18.973 52.749 1.00 9.72   ? 156 VAL A CG1  1  
ATOM   2267   C  CG2  . VAL A 1 153 ? 8.862   19.138 53.195 1.00 9.39   ? 156 VAL A CG2  1  
ATOM   2268   H  H    . VAL A 1 153 ? 9.605   20.396 50.536 1.00 0.00   ? 156 VAL A H    1  
ATOM   2269   H  HA   . VAL A 1 153 ? 8.020   17.895 50.864 1.00 0.00   ? 156 VAL A HA   1  
ATOM   2270   H  HB   . VAL A 1 153 ? 7.673   20.616 52.185 1.00 0.00   ? 156 VAL A HB   1  
ATOM   2271   H  HG11 . VAL A 1 153 ? 6.548   17.943 53.044 1.00 0.00   ? 156 VAL A HG11 1  
ATOM   2272   H  HG12 . VAL A 1 153 ? 5.670   19.027 51.964 1.00 0.00   ? 156 VAL A HG12 1  
ATOM   2273   H  HG13 . VAL A 1 153 ? 6.077   19.550 53.599 1.00 0.00   ? 156 VAL A HG13 1  
ATOM   2274   H  HG21 . VAL A 1 153 ? 8.721   19.634 54.144 1.00 0.00   ? 156 VAL A HG21 1  
ATOM   2275   H  HG22 . VAL A 1 153 ? 9.813   19.430 52.774 1.00 0.00   ? 156 VAL A HG22 1  
ATOM   2276   H  HG23 . VAL A 1 153 ? 8.847   18.068 53.342 1.00 0.00   ? 156 VAL A HG23 1  
ATOM   2277   N  N    . LEU A 1 154 ? 6.578   18.655 48.975 1.00 9.72   ? 157 LEU A N    1  
ATOM   2278   C  CA   . LEU A 1 154 ? 5.649   19.151 47.911 1.00 10.11  ? 157 LEU A CA   1  
ATOM   2279   C  C    . LEU A 1 154 ? 4.187   19.086 48.342 1.00 10.82  ? 157 LEU A C    1  
ATOM   2280   O  O    . LEU A 1 154 ? 3.752   18.128 48.950 1.00 10.73  ? 157 LEU A O    1  
ATOM   2281   C  CB   . LEU A 1 154 ? 5.835   18.302 46.652 1.00 10.11  ? 157 LEU A CB   1  
ATOM   2282   C  CG   . LEU A 1 154 ? 7.229   18.546 46.073 1.00 10.29  ? 157 LEU A CG   1  
ATOM   2283   C  CD1  . LEU A 1 154 ? 7.793   17.232 45.528 1.00 11.59  ? 157 LEU A CD1  1  
ATOM   2284   C  CD2  . LEU A 1 154 ? 7.136   19.569 44.939 1.00 12.40  ? 157 LEU A CD2  1  
ATOM   2285   H  H    . LEU A 1 154 ? 6.900   17.729 48.964 1.00 0.00   ? 157 LEU A H    1  
ATOM   2286   H  HA   . LEU A 1 154 ? 5.899   20.175 47.677 1.00 0.00   ? 157 LEU A HA   1  
ATOM   2287   H  HB2  . LEU A 1 154 ? 5.726   17.257 46.905 1.00 0.00   ? 157 LEU A HB2  1  
ATOM   2288   H  HB3  . LEU A 1 154 ? 5.090   18.575 45.920 1.00 0.00   ? 157 LEU A HB3  1  
ATOM   2289   H  HG   . LEU A 1 154 ? 7.880   18.922 46.849 1.00 0.00   ? 157 LEU A HG   1  
ATOM   2290   H  HD11 . LEU A 1 154 ? 7.951   17.323 44.463 1.00 0.00   ? 157 LEU A HD11 1  
ATOM   2291   H  HD12 . LEU A 1 154 ? 7.093   16.432 45.721 1.00 0.00   ? 157 LEU A HD12 1  
ATOM   2292   H  HD13 . LEU A 1 154 ? 8.732   17.015 46.014 1.00 0.00   ? 157 LEU A HD13 1  
ATOM   2293   H  HD21 . LEU A 1 154 ? 6.341   19.288 44.265 1.00 0.00   ? 157 LEU A HD21 1  
ATOM   2294   H  HD22 . LEU A 1 154 ? 8.072   19.595 44.400 1.00 0.00   ? 157 LEU A HD22 1  
ATOM   2295   H  HD23 . LEU A 1 154 ? 6.931   20.546 45.351 1.00 0.00   ? 157 LEU A HD23 1  
ATOM   2296   N  N    . PRO A 1 155 ? 3.418   20.090 47.981 1.00 11.18  ? 158 PRO A N    1  
ATOM   2297   C  CA   . PRO A 1 155 ? 1.967   20.117 48.294 1.00 11.54  ? 158 PRO A CA   1  
ATOM   2298   C  C    . PRO A 1 155 ? 1.315   18.773 47.936 1.00 12.48  ? 158 PRO A C    1  
ATOM   2299   O  O    . PRO A 1 155 ? 1.671   18.143 46.960 1.00 11.96  ? 158 PRO A O    1  
ATOM   2300   C  CB   . PRO A 1 155 ? 1.423   21.238 47.408 1.00 11.71  ? 158 PRO A CB   1  
ATOM   2301   C  CG   . PRO A 1 155 ? 2.585   22.144 47.152 1.00 11.70  ? 158 PRO A CG   1  
ATOM   2302   C  CD   . PRO A 1 155 ? 3.851   21.287 47.245 1.00 10.78  ? 158 PRO A CD   1  
ATOM   2303   H  HA   . PRO A 1 155 ? 1.805   20.355 49.333 1.00 0.00   ? 158 PRO A HA   1  
ATOM   2304   H  HB2  . PRO A 1 155 ? 1.051   20.831 46.477 1.00 0.00   ? 158 PRO A HB2  1  
ATOM   2305   H  HB3  . PRO A 1 155 ? 0.642   21.777 47.921 1.00 0.00   ? 158 PRO A HB3  1  
ATOM   2306   H  HG2  . PRO A 1 155 ? 2.502   22.579 46.165 1.00 0.00   ? 158 PRO A HG2  1  
ATOM   2307   H  HG3  . PRO A 1 155 ? 2.619   22.922 47.898 1.00 0.00   ? 158 PRO A HG3  1  
ATOM   2308   H  HD2  . PRO A 1 155 ? 4.201   21.021 46.257 1.00 0.00   ? 158 PRO A HD2  1  
ATOM   2309   H  HD3  . PRO A 1 155 ? 4.620   21.804 47.796 1.00 0.00   ? 158 PRO A HD3  1  
ATOM   2310   N  N    . ARG A 1 156 ? 0.387   18.318 48.727 1.00 13.14  ? 159 ARG A N    1  
ATOM   2311   C  CA   . ARG A 1 156 ? -0.264  17.003 48.449 1.00 14.06  ? 159 ARG A CA   1  
ATOM   2312   C  C    . ARG A 1 156 ? -0.807  16.973 47.021 1.00 14.62  ? 159 ARG A C    1  
ATOM   2313   O  O    . ARG A 1 156 ? -0.849  15.938 46.384 1.00 14.84  ? 159 ARG A O    1  
ATOM   2314   C  CB   . ARG A 1 156 ? -1.415  16.789 49.433 1.00 14.36  ? 159 ARG A CB   1  
ATOM   2315   C  CG   . ARG A 1 156 ? -1.200  15.480 50.195 1.00 16.31  ? 159 ARG A CG   1  
ATOM   2316   C  CD   . ARG A 1 156 ? -2.445  15.161 51.024 1.00 18.06  ? 159 ARG A CD   1  
ATOM   2317   N  NE   . ARG A 1 156 ? -2.035  14.703 52.381 1.00 22.88  ? 159 ARG A NE   1  
ATOM   2318   C  CZ   . ARG A 1 156 ? -0.892  14.095 52.547 1.00 20.61  ? 159 ARG A CZ   1  
ATOM   2319   N  NH1  . ARG A 1 156 ? -0.109  13.889 51.524 1.00 22.68  ? 159 ARG A NH1  1  
ATOM   2320   N  NH2  . ARG A 1 156 ? -0.532  13.695 53.735 1.00 17.14  ? 159 ARG A NH2  1  
ATOM   2321   H  H    . ARG A 1 156 ? 0.127   18.832 49.520 1.00 0.00   ? 159 ARG A H    1  
ATOM   2322   H  HA   . ARG A 1 156 ? 0.462   16.212 48.572 1.00 0.00   ? 159 ARG A HA   1  
ATOM   2323   H  HB2  . ARG A 1 156 ? -1.448  17.613 50.132 1.00 0.00   ? 159 ARG A HB2  1  
ATOM   2324   H  HB3  . ARG A 1 156 ? -2.348  16.739 48.891 1.00 0.00   ? 159 ARG A HB3  1  
ATOM   2325   H  HG2  . ARG A 1 156 ? -1.020  14.680 49.491 1.00 0.00   ? 159 ARG A HG2  1  
ATOM   2326   H  HG3  . ARG A 1 156 ? -0.349  15.581 50.852 1.00 0.00   ? 159 ARG A HG3  1  
ATOM   2327   H  HD2  . ARG A 1 156 ? -3.056  16.047 51.112 1.00 0.00   ? 159 ARG A HD2  1  
ATOM   2328   H  HD3  . ARG A 1 156 ? -3.012  14.381 50.537 1.00 0.00   ? 159 ARG A HD3  1  
ATOM   2329   H  HE   . ARG A 1 156 ? -2.623  14.858 53.149 1.00 0.00   ? 159 ARG A HE   1  
ATOM   2330   H  HH11 . ARG A 1 156 ? -0.384  14.196 50.613 1.00 0.00   ? 159 ARG A HH11 1  
ATOM   2331   H  HH12 . ARG A 1 156 ? 0.767   13.423 51.650 1.00 0.00   ? 159 ARG A HH12 1  
ATOM   2332   H  HH21 . ARG A 1 156 ? -1.132  13.853 54.519 1.00 0.00   ? 159 ARG A HH21 1  
ATOM   2333   H  HH22 . ARG A 1 156 ? 0.344   13.229 53.862 1.00 0.00   ? 159 ARG A HH22 1  
ATOM   2334   N  N    . GLU A 1 157 ? -1.230  18.093 46.516 1.00 15.33  ? 160 GLU A N    1  
ATOM   2335   C  CA   . GLU A 1 157 ? -1.785  18.127 45.124 1.00 16.72  ? 160 GLU A CA   1  
ATOM   2336   C  C    . GLU A 1 157 ? -0.706  18.511 44.084 1.00 15.83  ? 160 GLU A C    1  
ATOM   2337   O  O    . GLU A 1 157 ? -1.026  18.844 42.960 1.00 16.55  ? 160 GLU A O    1  
ATOM   2338   C  CB   . GLU A 1 157 ? -2.921  19.150 45.065 1.00 18.35  ? 160 GLU A CB   1  
ATOM   2339   C  CG   . GLU A 1 157 ? -4.127  18.620 45.843 1.00 22.81  ? 160 GLU A CG   1  
ATOM   2340   C  CD   . GLU A 1 157 ? -4.431  17.188 45.400 1.00 29.20  ? 160 GLU A CD   1  
ATOM   2341   O  OE1  . GLU A 1 157 ? -4.545  16.970 44.205 1.00 32.22  ? 160 GLU A OE1  1  
ATOM   2342   O  OE2  . GLU A 1 157 ? -4.545  16.333 46.263 1.00 34.73  ? 160 GLU A OE2  1  
ATOM   2343   H  H    . GLU A 1 157 ? -1.193  18.915 47.049 1.00 0.00   ? 160 GLU A H    1  
ATOM   2344   H  HA   . GLU A 1 157 ? -2.179  17.153 44.879 1.00 0.00   ? 160 GLU A HA   1  
ATOM   2345   H  HB2  . GLU A 1 157 ? -2.589  20.081 45.503 1.00 0.00   ? 160 GLU A HB2  1  
ATOM   2346   H  HB3  . GLU A 1 157 ? -3.203  19.316 44.036 1.00 0.00   ? 160 GLU A HB3  1  
ATOM   2347   H  HG2  . GLU A 1 157 ? -3.906  18.632 46.901 1.00 0.00   ? 160 GLU A HG2  1  
ATOM   2348   H  HG3  . GLU A 1 157 ? -4.985  19.245 45.647 1.00 0.00   ? 160 GLU A HG3  1  
ATOM   2349   N  N    . GLY A 1 158 ? 0.557   18.459 44.428 1.00 14.56  ? 161 GLY A N    1  
ATOM   2350   C  CA   . GLY A 1 158 ? 1.615   18.810 43.435 1.00 14.12  ? 161 GLY A CA   1  
ATOM   2351   C  C    . GLY A 1 158 ? 1.860   20.319 43.446 1.00 13.45  ? 161 GLY A C    1  
ATOM   2352   O  O    . GLY A 1 158 ? 1.417   21.023 44.332 1.00 14.55  ? 161 GLY A O    1  
ATOM   2353   H  H    . GLY A 1 158 ? 0.808   18.180 45.333 1.00 0.00   ? 161 GLY A H    1  
ATOM   2354   H  HA2  . GLY A 1 158 ? 2.530   18.295 43.690 1.00 0.00   ? 161 GLY A HA2  1  
ATOM   2355   H  HA3  . GLY A 1 158 ? 1.295   18.509 42.449 1.00 0.00   ? 161 GLY A HA3  1  
ATOM   2356   N  N    . LEU A 1 159 ? 2.567   20.823 42.469 1.00 13.44  ? 162 LEU A N    1  
ATOM   2357   C  CA   . LEU A 1 159 ? 2.840   22.292 42.431 1.00 13.59  ? 162 LEU A CA   1  
ATOM   2358   C  C    . LEU A 1 159 ? 1.936   22.981 41.395 1.00 14.29  ? 162 LEU A C    1  
ATOM   2359   O  O    . LEU A 1 159 ? 1.612   22.423 40.366 1.00 14.65  ? 162 LEU A O    1  
ATOM   2360   C  CB   . LEU A 1 159 ? 4.305   22.524 42.056 1.00 13.19  ? 162 LEU A CB   1  
ATOM   2361   C  CG   . LEU A 1 159 ? 5.193   21.562 42.847 1.00 13.42  ? 162 LEU A CG   1  
ATOM   2362   C  CD1  . LEU A 1 159 ? 6.443   21.231 42.030 1.00 14.05  ? 162 LEU A CD1  1  
ATOM   2363   C  CD2  . LEU A 1 159 ? 5.606   22.218 44.166 1.00 13.76  ? 162 LEU A CD2  1  
ATOM   2364   H  H    . LEU A 1 159 ? 2.918   20.239 41.764 1.00 0.00   ? 162 LEU A H    1  
ATOM   2365   H  HA   . LEU A 1 159 ? 2.651   22.715 43.406 1.00 0.00   ? 162 LEU A HA   1  
ATOM   2366   H  HB2  . LEU A 1 159 ? 4.438   22.351 40.998 1.00 0.00   ? 162 LEU A HB2  1  
ATOM   2367   H  HB3  . LEU A 1 159 ? 4.581   23.541 42.292 1.00 0.00   ? 162 LEU A HB3  1  
ATOM   2368   H  HG   . LEU A 1 159 ? 4.646   20.652 43.051 1.00 0.00   ? 162 LEU A HG   1  
ATOM   2369   H  HD11 . LEU A 1 159 ? 7.110   22.081 42.032 1.00 0.00   ? 162 LEU A HD11 1  
ATOM   2370   H  HD12 . LEU A 1 159 ? 6.158   21.000 41.014 1.00 0.00   ? 162 LEU A HD12 1  
ATOM   2371   H  HD13 . LEU A 1 159 ? 6.944   20.380 42.466 1.00 0.00   ? 162 LEU A HD13 1  
ATOM   2372   H  HD21 . LEU A 1 159 ? 5.031   23.120 44.315 1.00 0.00   ? 162 LEU A HD21 1  
ATOM   2373   H  HD22 . LEU A 1 159 ? 6.658   22.463 44.132 1.00 0.00   ? 162 LEU A HD22 1  
ATOM   2374   H  HD23 . LEU A 1 159 ? 5.422   21.535 44.982 1.00 0.00   ? 162 LEU A HD23 1  
ATOM   2375   N  N    . HIS A 1 160 ? 1.541   24.201 41.665 1.00 15.20  ? 163 HIS A N    1  
ATOM   2376   C  CA   . HIS A 1 160 ? 0.679   24.950 40.719 1.00 16.66  ? 163 HIS A CA   1  
ATOM   2377   C  C    . HIS A 1 160 ? 1.192   26.388 40.634 1.00 16.84  ? 163 HIS A C    1  
ATOM   2378   O  O    . HIS A 1 160 ? 1.954   26.836 41.467 1.00 16.10  ? 163 HIS A O    1  
ATOM   2379   C  CB   . HIS A 1 160 ? -0.765  24.947 41.224 1.00 17.70  ? 163 HIS A CB   1  
ATOM   2380   C  CG   . HIS A 1 160 ? -1.299  23.541 41.209 1.00 19.89  ? 163 HIS A CG   1  
ATOM   2381   N  ND1  . HIS A 1 160 ? -0.667  22.502 41.877 1.00 24.68  ? 163 HIS A ND1  1  
ATOM   2382   C  CD2  . HIS A 1 160 ? -2.404  22.986 40.610 1.00 24.45  ? 163 HIS A CD2  1  
ATOM   2383   C  CE1  . HIS A 1 160 ? -1.389  21.385 41.667 1.00 24.31  ? 163 HIS A CE1  1  
ATOM   2384   N  NE2  . HIS A 1 160 ? -2.455  21.628 40.903 1.00 25.46  ? 163 HIS A NE2  1  
ATOM   2385   H  H    . HIS A 1 160 ? 1.827   24.628 42.500 1.00 0.00   ? 163 HIS A H    1  
ATOM   2386   H  HA   . HIS A 1 160 ? 0.725   24.489 39.743 1.00 0.00   ? 163 HIS A HA   1  
ATOM   2387   H  HB2  . HIS A 1 160 ? -0.794  25.332 42.233 1.00 0.00   ? 163 HIS A HB2  1  
ATOM   2388   H  HB3  . HIS A 1 160 ? -1.372  25.569 40.584 1.00 0.00   ? 163 HIS A HB3  1  
ATOM   2389   H  HD1  . HIS A 1 160 ? 0.156   22.568 42.406 1.00 0.00   ? 163 HIS A HD1  1  
ATOM   2390   H  HD2  . HIS A 1 160 ? -3.121  23.522 40.007 1.00 0.00   ? 163 HIS A HD2  1  
ATOM   2391   H  HE1  . HIS A 1 160 ? -1.137  20.414 42.067 1.00 0.00   ? 163 HIS A HE1  1  
ATOM   2392   H  HE2  . HIS A 1 160 ? -3.133  20.984 40.609 1.00 0.00   ? 163 HIS A HE2  1  
ATOM   2393   N  N    . ASP A 1 161 ? 0.787   27.110 39.634 1.00 17.90  ? 164 ASP A N    1  
ATOM   2394   C  CA   . ASP A 1 161 ? 1.255   28.523 39.485 1.00 19.24  ? 164 ASP A CA   1  
ATOM   2395   C  C    . ASP A 1 161 ? 0.500   29.435 40.461 1.00 20.22  ? 164 ASP A C    1  
ATOM   2396   O  O    . ASP A 1 161 ? -0.050  28.984 41.445 1.00 19.95  ? 164 ASP A O    1  
ATOM   2397   C  CB   . ASP A 1 161 ? 1.000   28.993 38.052 1.00 19.59  ? 164 ASP A CB   1  
ATOM   2398   C  CG   . ASP A 1 161 ? -0.501  28.959 37.762 1.00 21.41  ? 164 ASP A CG   1  
ATOM   2399   O  OD1  . ASP A 1 161 ? -1.263  28.812 38.704 1.00 22.32  ? 164 ASP A OD1  1  
ATOM   2400   O  OD2  . ASP A 1 161 ? -0.864  29.080 36.604 1.00 26.07  ? 164 ASP A OD2  1  
ATOM   2401   H  H    . ASP A 1 161 ? 0.176   26.726 38.971 1.00 0.00   ? 164 ASP A H    1  
ATOM   2402   H  HA   . ASP A 1 161 ? 2.313   28.573 39.695 1.00 0.00   ? 164 ASP A HA   1  
ATOM   2403   H  HB2  . ASP A 1 161 ? 1.368   30.002 37.933 1.00 0.00   ? 164 ASP A HB2  1  
ATOM   2404   H  HB3  . ASP A 1 161 ? 1.513   28.340 37.362 1.00 0.00   ? 164 ASP A HB3  1  
ATOM   2405   N  N    . GLY A 1 162 ? 0.475   30.719 40.197 1.00 21.86  ? 165 GLY A N    1  
ATOM   2406   C  CA   . GLY A 1 162 ? -0.241  31.656 41.116 1.00 23.61  ? 165 GLY A CA   1  
ATOM   2407   C  C    . GLY A 1 162 ? -1.760  31.626 40.864 1.00 25.41  ? 165 GLY A C    1  
ATOM   2408   O  O    . GLY A 1 162 ? -2.539  32.011 41.714 1.00 26.16  ? 165 GLY A O    1  
ATOM   2409   H  H    . GLY A 1 162 ? 0.928   31.065 39.400 1.00 0.00   ? 165 GLY A H    1  
ATOM   2410   H  HA2  . GLY A 1 162 ? -0.045  31.367 42.139 1.00 0.00   ? 165 GLY A HA2  1  
ATOM   2411   H  HA3  . GLY A 1 162 ? 0.124   32.659 40.955 1.00 0.00   ? 165 GLY A HA3  1  
ATOM   2412   N  N    . LYS A 1 163 ? -2.193  31.189 39.709 1.00 26.86  ? 166 LYS A N    1  
ATOM   2413   C  CA   . LYS A 1 163 ? -3.665  31.159 39.422 1.00 28.27  ? 166 LYS A CA   1  
ATOM   2414   C  C    . LYS A 1 163 ? -4.273  29.764 39.691 1.00 28.14  ? 166 LYS A C    1  
ATOM   2415   O  O    . LYS A 1 163 ? -5.430  29.529 39.407 1.00 28.83  ? 166 LYS A O    1  
ATOM   2416   C  CB   . LYS A 1 163 ? -3.895  31.529 37.956 1.00 29.16  ? 166 LYS A CB   1  
ATOM   2417   C  CG   . LYS A 1 163 ? -3.325  32.922 37.685 1.00 32.04  ? 166 LYS A CG   1  
ATOM   2418   C  CD   . LYS A 1 163 ? -2.502  32.896 36.395 1.00 34.99  ? 166 LYS A CD   1  
ATOM   2419   C  CE   . LYS A 1 163 ? -1.404  33.958 36.469 1.00 37.29  ? 166 LYS A CE   1  
ATOM   2420   N  NZ   . LYS A 1 163 ? -0.158  33.347 37.014 1.00 39.05  ? 166 LYS A NZ   1  
ATOM   2421   H  H    . LYS A 1 163 ? -1.555  30.890 39.028 1.00 0.00   ? 166 LYS A H    1  
ATOM   2422   H  HA   . LYS A 1 163 ? -4.160  31.885 40.048 1.00 0.00   ? 166 LYS A HA   1  
ATOM   2423   H  HB2  . LYS A 1 163 ? -3.402  30.807 37.321 1.00 0.00   ? 166 LYS A HB2  1  
ATOM   2424   H  HB3  . LYS A 1 163 ? -4.954  31.528 37.746 1.00 0.00   ? 166 LYS A HB3  1  
ATOM   2425   H  HG2  . LYS A 1 163 ? -4.136  33.629 37.581 1.00 0.00   ? 166 LYS A HG2  1  
ATOM   2426   H  HG3  . LYS A 1 163 ? -2.692  33.219 38.508 1.00 0.00   ? 166 LYS A HG3  1  
ATOM   2427   H  HD2  . LYS A 1 163 ? -2.054  31.920 36.275 1.00 0.00   ? 166 LYS A HD2  1  
ATOM   2428   H  HD3  . LYS A 1 163 ? -3.145  33.104 35.554 1.00 0.00   ? 166 LYS A HD3  1  
ATOM   2429   H  HE2  . LYS A 1 163 ? -1.211  34.346 35.479 1.00 0.00   ? 166 LYS A HE2  1  
ATOM   2430   H  HE3  . LYS A 1 163 ? -1.723  34.762 37.115 1.00 0.00   ? 166 LYS A HE3  1  
ATOM   2431   H  HZ1  . LYS A 1 163 ? -0.310  33.075 38.005 1.00 0.00   ? 166 LYS A HZ1  1  
ATOM   2432   H  HZ2  . LYS A 1 163 ? 0.618   34.037 36.961 1.00 0.00   ? 166 LYS A HZ2  1  
ATOM   2433   H  HZ3  . LYS A 1 163 ? 0.087   32.504 36.455 1.00 0.00   ? 166 LYS A HZ3  1  
ATOM   2434   N  N    . GLY A 1 164 ? -3.521  28.841 40.236 1.00 27.21  ? 167 GLY A N    1  
ATOM   2435   C  CA   . GLY A 1 164 ? -4.087  27.473 40.517 1.00 26.91  ? 167 GLY A CA   1  
ATOM   2436   C  C    . GLY A 1 164 ? -3.753  26.437 39.402 1.00 26.20  ? 167 GLY A C    1  
ATOM   2437   O  O    . GLY A 1 164 ? -3.968  25.255 39.582 1.00 27.11  ? 167 GLY A O    1  
ATOM   2438   H  H    . GLY A 1 164 ? -2.590  29.042 40.465 1.00 0.00   ? 167 GLY A H    1  
ATOM   2439   H  HA2  . GLY A 1 164 ? -3.685  27.117 41.453 1.00 0.00   ? 167 GLY A HA2  1  
ATOM   2440   H  HA3  . GLY A 1 164 ? -5.160  27.554 40.607 1.00 0.00   ? 167 GLY A HA3  1  
ATOM   2441   N  N    . LYS A 1 165 ? -3.252  26.852 38.262 1.00 25.47  ? 168 LYS A N    1  
ATOM   2442   C  CA   . LYS A 1 165 ? -2.940  25.889 37.177 1.00 25.04  ? 168 LYS A CA   1  
ATOM   2443   C  C    . LYS A 1 165 ? -1.865  24.923 37.651 1.00 23.44  ? 168 LYS A C    1  
ATOM   2444   O  O    . LYS A 1 165 ? -0.895  25.309 38.273 1.00 21.93  ? 168 LYS A O    1  
ATOM   2445   C  CB   . LYS A 1 165 ? -2.437  26.650 35.948 1.00 26.10  ? 168 LYS A CB   1  
ATOM   2446   C  CG   . LYS A 1 165 ? -3.484  27.681 35.521 1.00 29.60  ? 168 LYS A CG   1  
ATOM   2447   C  CD   . LYS A 1 165 ? -4.742  26.960 35.035 1.00 33.83  ? 168 LYS A CD   1  
ATOM   2448   C  CE   . LYS A 1 165 ? -5.869  27.975 34.839 1.00 35.64  ? 168 LYS A CE   1  
ATOM   2449   N  NZ   . LYS A 1 165 ? -6.937  27.735 35.851 1.00 37.57  ? 168 LYS A NZ   1  
ATOM   2450   H  H    . LYS A 1 165 ? -3.092  27.809 38.122 1.00 0.00   ? 168 LYS A H    1  
ATOM   2451   H  HA   . LYS A 1 165 ? -3.831  25.337 36.918 1.00 0.00   ? 168 LYS A HA   1  
ATOM   2452   H  HB2  . LYS A 1 165 ? -1.512  27.153 36.191 1.00 0.00   ? 168 LYS A HB2  1  
ATOM   2453   H  HB3  . LYS A 1 165 ? -2.268  25.955 35.139 1.00 0.00   ? 168 LYS A HB3  1  
ATOM   2454   H  HG2  . LYS A 1 165 ? -3.731  28.311 36.363 1.00 0.00   ? 168 LYS A HG2  1  
ATOM   2455   H  HG3  . LYS A 1 165 ? -3.087  28.287 34.721 1.00 0.00   ? 168 LYS A HG3  1  
ATOM   2456   H  HD2  . LYS A 1 165 ? -4.534  26.466 34.097 1.00 0.00   ? 168 LYS A HD2  1  
ATOM   2457   H  HD3  . LYS A 1 165 ? -5.044  26.227 35.768 1.00 0.00   ? 168 LYS A HD3  1  
ATOM   2458   H  HE2  . LYS A 1 165 ? -5.478  28.975 34.959 1.00 0.00   ? 168 LYS A HE2  1  
ATOM   2459   H  HE3  . LYS A 1 165 ? -6.283  27.867 33.847 1.00 0.00   ? 168 LYS A HE3  1  
ATOM   2460   H  HZ1  . LYS A 1 165 ? -7.591  28.542 35.864 1.00 0.00   ? 168 LYS A HZ1  1  
ATOM   2461   H  HZ2  . LYS A 1 165 ? -6.506  27.626 36.790 1.00 0.00   ? 168 LYS A HZ2  1  
ATOM   2462   H  HZ3  . LYS A 1 165 ? -7.458  26.868 35.605 1.00 0.00   ? 168 LYS A HZ3  1  
ATOM   2463   N  N    . ALA A 1 166 ? -2.031  23.670 37.363 1.00 21.68  ? 169 ALA A N    1  
ATOM   2464   C  CA   . ALA A 1 166 ? -1.013  22.665 37.799 1.00 20.47  ? 169 ALA A CA   1  
ATOM   2465   C  C    . ALA A 1 166 ? 0.277   22.763 36.954 1.00 19.23  ? 169 ALA A C    1  
ATOM   2466   O  O    . ALA A 1 166 ? 0.244   22.838 35.742 1.00 20.07  ? 169 ALA A O    1  
ATOM   2467   C  CB   . ALA A 1 166 ? -1.601  21.260 37.653 1.00 20.81  ? 169 ALA A CB   1  
ATOM   2468   H  H    . ALA A 1 166 ? -2.822  23.382 36.861 1.00 0.00   ? 169 ALA A H    1  
ATOM   2469   H  HA   . ALA A 1 166 ? -0.769  22.837 38.837 1.00 0.00   ? 169 ALA A HA   1  
ATOM   2470   H  HB1  . ALA A 1 166 ? -1.071  20.578 38.300 1.00 0.00   ? 169 ALA A HB1  1  
ATOM   2471   H  HB2  . ALA A 1 166 ? -1.503  20.934 36.628 1.00 0.00   ? 169 ALA A HB2  1  
ATOM   2472   H  HB3  . ALA A 1 166 ? -2.646  21.277 37.927 1.00 0.00   ? 169 ALA A HB3  1  
ATOM   2473   N  N    . LEU A 1 167 ? 1.412   22.728 37.613 1.00 17.05  ? 170 LEU A N    1  
ATOM   2474   C  CA   . LEU A 1 167 ? 2.731   22.777 36.929 1.00 16.71  ? 170 LEU A CA   1  
ATOM   2475   C  C    . LEU A 1 167 ? 3.433   21.459 37.248 1.00 15.56  ? 170 LEU A C    1  
ATOM   2476   O  O    . LEU A 1 167 ? 3.823   21.200 38.370 1.00 17.28  ? 170 LEU A O    1  
ATOM   2477   C  CB   . LEU A 1 167 ? 3.554   23.951 37.464 1.00 16.36  ? 170 LEU A CB   1  
ATOM   2478   C  CG   . LEU A 1 167 ? 2.877   25.267 37.078 1.00 16.59  ? 170 LEU A CG   1  
ATOM   2479   C  CD1  . LEU A 1 167 ? 3.475   26.410 37.900 1.00 17.20  ? 170 LEU A CD1  1  
ATOM   2480   C  CD2  . LEU A 1 167 ? 3.103   25.539 35.589 1.00 18.28  ? 170 LEU A CD2  1  
ATOM   2481   H  H    . LEU A 1 167 ? 1.389   22.643 38.589 1.00 0.00   ? 170 LEU A H    1  
ATOM   2482   H  HA   . LEU A 1 167 ? 2.590   22.873 35.862 1.00 0.00   ? 170 LEU A HA   1  
ATOM   2483   H  HB2  . LEU A 1 167 ? 3.622   23.882 38.540 1.00 0.00   ? 170 LEU A HB2  1  
ATOM   2484   H  HB3  . LEU A 1 167 ? 4.545   23.920 37.037 1.00 0.00   ? 170 LEU A HB3  1  
ATOM   2485   H  HG   . LEU A 1 167 ? 1.817   25.198 37.276 1.00 0.00   ? 170 LEU A HG   1  
ATOM   2486   H  HD11 . LEU A 1 167 ? 4.491   26.589 37.582 1.00 0.00   ? 170 LEU A HD11 1  
ATOM   2487   H  HD12 . LEU A 1 167 ? 3.467   26.144 38.946 1.00 0.00   ? 170 LEU A HD12 1  
ATOM   2488   H  HD13 . LEU A 1 167 ? 2.889   27.305 37.752 1.00 0.00   ? 170 LEU A HD13 1  
ATOM   2489   H  HD21 . LEU A 1 167 ? 2.574   24.802 35.004 1.00 0.00   ? 170 LEU A HD21 1  
ATOM   2490   H  HD22 . LEU A 1 167 ? 4.159   25.482 35.369 1.00 0.00   ? 170 LEU A HD22 1  
ATOM   2491   H  HD23 . LEU A 1 167 ? 2.737   26.525 35.343 1.00 0.00   ? 170 LEU A HD23 1  
ATOM   2492   N  N    . THR A 1 168 ? 3.532   20.606 36.283 1.00 13.69  ? 171 THR A N    1  
ATOM   2493   C  CA   . THR A 1 168 ? 4.123   19.281 36.502 1.00 13.45  ? 171 THR A CA   1  
ATOM   2494   C  C    . THR A 1 168 ? 5.416   19.232 35.753 1.00 13.11  ? 171 THR A C    1  
ATOM   2495   O  O    . THR A 1 168 ? 5.496   19.550 34.584 1.00 13.63  ? 171 THR A O    1  
ATOM   2496   C  CB   . THR A 1 168 ? 3.178   18.197 35.978 1.00 13.55  ? 171 THR A CB   1  
ATOM   2497   O  OG1  . THR A 1 168 ? 1.908   18.340 36.598 1.00 15.59  ? 171 THR A OG1  1  
ATOM   2498   C  CG2  . THR A 1 168 ? 3.753   16.817 36.299 1.00 15.57  ? 171 THR A CG2  1  
ATOM   2499   H  H    . THR A 1 168 ? 3.163   20.829 35.403 1.00 0.00   ? 171 THR A H    1  
ATOM   2500   H  HA   . THR A 1 168 ? 4.304   19.130 37.555 1.00 0.00   ? 171 THR A HA   1  
ATOM   2501   H  HB   . THR A 1 168 ? 3.071   18.298 34.909 1.00 0.00   ? 171 THR A HB   1  
ATOM   2502   H  HG1  . THR A 1 168 ? 2.012   18.914 37.360 1.00 0.00   ? 171 THR A HG1  1  
ATOM   2503   H  HG21 . THR A 1 168 ? 3.327   16.455 37.223 1.00 0.00   ? 171 THR A HG21 1  
ATOM   2504   H  HG22 . THR A 1 168 ? 4.826   16.889 36.401 1.00 0.00   ? 171 THR A HG22 1  
ATOM   2505   H  HG23 . THR A 1 168 ? 3.512   16.132 35.499 1.00 0.00   ? 171 THR A HG23 1  
ATOM   2506   N  N    . TYR A 1 169 ? 6.431   18.869 36.424 1.00 12.12  ? 172 TYR A N    1  
ATOM   2507   C  CA   . TYR A 1 169 ? 7.770   18.829 35.761 1.00 11.43  ? 172 TYR A CA   1  
ATOM   2508   C  C    . TYR A 1 169 ? 8.120   17.407 35.317 1.00 11.61  ? 172 TYR A C    1  
ATOM   2509   O  O    . TYR A 1 169 ? 7.829   16.442 35.997 1.00 12.29  ? 172 TYR A O    1  
ATOM   2510   C  CB   . TYR A 1 169 ? 8.833   19.325 36.744 1.00 11.46  ? 172 TYR A CB   1  
ATOM   2511   C  CG   . TYR A 1 169 ? 8.664   18.618 38.067 1.00 11.08  ? 172 TYR A CG   1  
ATOM   2512   C  CD1  . TYR A 1 169 ? 9.197   17.336 38.248 1.00 10.68  ? 172 TYR A CD1  1  
ATOM   2513   C  CD2  . TYR A 1 169 ? 7.976   19.244 39.113 1.00 10.91  ? 172 TYR A CD2  1  
ATOM   2514   C  CE1  . TYR A 1 169 ? 9.041   16.680 39.475 1.00 10.86  ? 172 TYR A CE1  1  
ATOM   2515   C  CE2  . TYR A 1 169 ? 7.819   18.588 40.340 1.00 11.27  ? 172 TYR A CE2  1  
ATOM   2516   C  CZ   . TYR A 1 169 ? 8.352   17.306 40.521 1.00 10.17  ? 172 TYR A CZ   1  
ATOM   2517   O  OH   . TYR A 1 169 ? 8.198   16.659 41.731 1.00 11.65  ? 172 TYR A OH   1  
ATOM   2518   H  H    . TYR A 1 169 ? 6.342   18.642 37.373 1.00 0.00   ? 172 TYR A H    1  
ATOM   2519   H  HA   . TYR A 1 169 ? 7.758   19.477 34.898 1.00 0.00   ? 172 TYR A HA   1  
ATOM   2520   H  HB2  . TYR A 1 169 ? 9.816   19.117 36.346 1.00 0.00   ? 172 TYR A HB2  1  
ATOM   2521   H  HB3  . TYR A 1 169 ? 8.721   20.389 36.889 1.00 0.00   ? 172 TYR A HB3  1  
ATOM   2522   H  HD1  . TYR A 1 169 ? 9.729   16.853 37.442 1.00 0.00   ? 172 TYR A HD1  1  
ATOM   2523   H  HD2  . TYR A 1 169 ? 7.565   20.233 38.973 1.00 0.00   ? 172 TYR A HD2  1  
ATOM   2524   H  HE1  . TYR A 1 169 ? 9.452   15.691 39.615 1.00 0.00   ? 172 TYR A HE1  1  
ATOM   2525   H  HE2  . TYR A 1 169 ? 7.288   19.071 41.147 1.00 0.00   ? 172 TYR A HE2  1  
ATOM   2526   H  HH   . TYR A 1 169 ? 9.045   16.671 42.183 1.00 0.00   ? 172 TYR A HH   1  
ATOM   2527   N  N    . ASP A 1 170 ? 8.764   17.273 34.184 1.00 11.59  ? 173 ASP A N    1  
ATOM   2528   C  CA   . ASP A 1 170 ? 9.156   15.917 33.704 1.00 12.04  ? 173 ASP A CA   1  
ATOM   2529   C  C    . ASP A 1 170 ? 10.438  15.453 34.422 1.00 12.53  ? 173 ASP A C    1  
ATOM   2530   O  O    . ASP A 1 170 ? 10.671  14.272 34.581 1.00 13.90  ? 173 ASP A O    1  
ATOM   2531   C  CB   . ASP A 1 170 ? 9.409   15.966 32.196 1.00 12.05  ? 173 ASP A CB   1  
ATOM   2532   C  CG   . ASP A 1 170 ? 8.140   16.434 31.480 1.00 13.01  ? 173 ASP A CG   1  
ATOM   2533   O  OD1  . ASP A 1 170 ? 7.133   15.755 31.597 1.00 15.85  ? 173 ASP A OD1  1  
ATOM   2534   O  OD2  . ASP A 1 170 ? 8.197   17.463 30.828 1.00 13.62  ? 173 ASP A OD2  1  
ATOM   2535   H  H    . ASP A 1 170 ? 9.002   18.066 33.659 1.00 0.00   ? 173 ASP A H    1  
ATOM   2536   H  HA   . ASP A 1 170 ? 8.358   15.219 33.911 1.00 0.00   ? 173 ASP A HA   1  
ATOM   2537   H  HB2  . ASP A 1 170 ? 10.215  16.654 31.988 1.00 0.00   ? 173 ASP A HB2  1  
ATOM   2538   H  HB3  . ASP A 1 170 ? 9.676   14.981 31.843 1.00 0.00   ? 173 ASP A HB3  1  
ATOM   2539   N  N    . LYS A 1 171 ? 11.275  16.369 34.852 1.00 12.65  ? 174 LYS A N    1  
ATOM   2540   C  CA   . LYS A 1 171 ? 12.526  15.967 35.544 1.00 12.89  ? 174 LYS A CA   1  
ATOM   2541   C  C    . LYS A 1 171 ? 12.905  17.041 36.559 1.00 11.76  ? 174 LYS A C    1  
ATOM   2542   O  O    . LYS A 1 171 ? 12.560  18.197 36.415 1.00 10.94  ? 174 LYS A O    1  
ATOM   2543   C  CB   . LYS A 1 171 ? 13.651  15.813 34.518 1.00 14.61  ? 174 LYS A CB   1  
ATOM   2544   C  CG   . LYS A 1 171 ? 14.061  17.192 33.998 1.00 14.13  ? 174 LYS A CG   1  
ATOM   2545   C  CD   . LYS A 1 171 ? 15.182  17.038 32.968 1.00 17.87  ? 174 LYS A CD   1  
ATOM   2546   C  CE   . LYS A 1 171 ? 15.855  15.676 33.146 1.00 16.08  ? 174 LYS A CE   1  
ATOM   2547   N  NZ   . LYS A 1 171 ? 16.877  15.484 32.079 1.00 15.55  ? 174 LYS A NZ   1  
ATOM   2548   H  H    . LYS A 1 171 ? 11.076  17.318 34.713 1.00 0.00   ? 174 LYS A H    1  
ATOM   2549   H  HA   . LYS A 1 171 ? 12.371  15.027 36.053 1.00 0.00   ? 174 LYS A HA   1  
ATOM   2550   H  HB2  . LYS A 1 171 ? 14.501  15.336 34.985 1.00 0.00   ? 174 LYS A HB2  1  
ATOM   2551   H  HB3  . LYS A 1 171 ? 13.307  15.207 33.693 1.00 0.00   ? 174 LYS A HB3  1  
ATOM   2552   H  HG2  . LYS A 1 171 ? 13.209  17.670 33.536 1.00 0.00   ? 174 LYS A HG2  1  
ATOM   2553   H  HG3  . LYS A 1 171 ? 14.411  17.798 34.820 1.00 0.00   ? 174 LYS A HG3  1  
ATOM   2554   H  HD2  . LYS A 1 171 ? 14.768  17.109 31.973 1.00 0.00   ? 174 LYS A HD2  1  
ATOM   2555   H  HD3  . LYS A 1 171 ? 15.912  17.820 33.112 1.00 0.00   ? 174 LYS A HD3  1  
ATOM   2556   H  HE2  . LYS A 1 171 ? 16.334  15.635 34.114 1.00 0.00   ? 174 LYS A HE2  1  
ATOM   2557   H  HE3  . LYS A 1 171 ? 15.112  14.895 33.079 1.00 0.00   ? 174 LYS A HE3  1  
ATOM   2558   H  HZ1  . LYS A 1 171 ? 17.548  14.745 32.369 1.00 0.00   ? 174 LYS A HZ1  1  
ATOM   2559   H  HZ2  . LYS A 1 171 ? 17.390  16.374 31.924 1.00 0.00   ? 174 LYS A HZ2  1  
ATOM   2560   H  HZ3  . LYS A 1 171 ? 16.405  15.197 31.196 1.00 0.00   ? 174 LYS A HZ3  1  
ATOM   2561   N  N    . ILE A 1 172 ? 13.608  16.668 37.586 1.00 10.77  ? 175 ILE A N    1  
ATOM   2562   C  CA   . ILE A 1 172 ? 14.009  17.666 38.617 1.00 10.47  ? 175 ILE A CA   1  
ATOM   2563   C  C    . ILE A 1 172 ? 15.448  17.400 39.073 1.00 9.92   ? 175 ILE A C    1  
ATOM   2564   O  O    . ILE A 1 172 ? 15.827  16.282 39.359 1.00 10.59  ? 175 ILE A O    1  
ATOM   2565   C  CB   . ILE A 1 172 ? 13.068  17.559 39.819 1.00 10.91  ? 175 ILE A CB   1  
ATOM   2566   C  CG1  . ILE A 1 172 ? 13.638  18.372 40.984 1.00 11.21  ? 175 ILE A CG1  1  
ATOM   2567   C  CG2  . ILE A 1 172 ? 12.938  16.093 40.237 1.00 12.08  ? 175 ILE A CG2  1  
ATOM   2568   C  CD1  . ILE A 1 172 ? 12.794  18.129 42.237 1.00 12.26  ? 175 ILE A CD1  1  
ATOM   2569   H  H    . ILE A 1 172 ? 13.873  15.730 37.683 1.00 0.00   ? 175 ILE A H    1  
ATOM   2570   H  HA   . ILE A 1 172 ? 13.943  18.659 38.199 1.00 0.00   ? 175 ILE A HA   1  
ATOM   2571   H  HB   . ILE A 1 172 ? 12.096  17.944 39.550 1.00 0.00   ? 175 ILE A HB   1  
ATOM   2572   H  HG12 . ILE A 1 172 ? 14.657  18.067 41.171 1.00 0.00   ? 175 ILE A HG12 1  
ATOM   2573   H  HG13 . ILE A 1 172 ? 13.615  19.422 40.736 1.00 0.00   ? 175 ILE A HG13 1  
ATOM   2574   H  HG21 . ILE A 1 172 ? 13.685  15.505 39.726 1.00 0.00   ? 175 ILE A HG21 1  
ATOM   2575   H  HG22 . ILE A 1 172 ? 11.954  15.731 39.976 1.00 0.00   ? 175 ILE A HG22 1  
ATOM   2576   H  HG23 . ILE A 1 172 ? 13.081  16.009 41.304 1.00 0.00   ? 175 ILE A HG23 1  
ATOM   2577   H  HD11 . ILE A 1 172 ? 12.842  18.997 42.877 1.00 0.00   ? 175 ILE A HD11 1  
ATOM   2578   H  HD12 . ILE A 1 172 ? 13.176  17.269 42.767 1.00 0.00   ? 175 ILE A HD12 1  
ATOM   2579   H  HD13 . ILE A 1 172 ? 11.768  17.948 41.951 1.00 0.00   ? 175 ILE A HD13 1  
ATOM   2580   N  N    . TYR A 1 173 ? 16.246  18.430 39.148 1.00 9.05   ? 176 TYR A N    1  
ATOM   2581   C  CA   . TYR A 1 173 ? 17.653  18.272 39.588 1.00 9.04   ? 176 TYR A CA   1  
ATOM   2582   C  C    . TYR A 1 173 ? 17.894  19.182 40.793 1.00 9.08   ? 176 TYR A C    1  
ATOM   2583   O  O    . TYR A 1 173 ? 17.292  20.228 40.927 1.00 9.56   ? 176 TYR A O    1  
ATOM   2584   C  CB   . TYR A 1 173 ? 18.595  18.666 38.449 1.00 9.09   ? 176 TYR A CB   1  
ATOM   2585   C  CG   . TYR A 1 173 ? 18.482  17.660 37.330 1.00 9.77   ? 176 TYR A CG   1  
ATOM   2586   C  CD1  . TYR A 1 173 ? 19.004  16.371 37.491 1.00 10.45  ? 176 TYR A CD1  1  
ATOM   2587   C  CD2  . TYR A 1 173 ? 17.854  18.015 36.130 1.00 10.04  ? 176 TYR A CD2  1  
ATOM   2588   C  CE1  . TYR A 1 173 ? 18.899  15.437 36.453 1.00 11.04  ? 176 TYR A CE1  1  
ATOM   2589   C  CE2  . TYR A 1 173 ? 17.748  17.081 35.092 1.00 12.54  ? 176 TYR A CE2  1  
ATOM   2590   C  CZ   . TYR A 1 173 ? 18.270  15.793 35.254 1.00 12.11  ? 176 TYR A CZ   1  
ATOM   2591   O  OH   . TYR A 1 173 ? 18.166  14.873 34.230 1.00 15.09  ? 176 TYR A OH   1  
ATOM   2592   H  H    . TYR A 1 173 ? 15.909  19.321 38.917 1.00 0.00   ? 176 TYR A H    1  
ATOM   2593   H  HA   . TYR A 1 173 ? 17.832  17.244 39.869 1.00 0.00   ? 176 TYR A HA   1  
ATOM   2594   H  HB2  . TYR A 1 173 ? 18.326  19.646 38.082 1.00 0.00   ? 176 TYR A HB2  1  
ATOM   2595   H  HB3  . TYR A 1 173 ? 19.612  18.685 38.813 1.00 0.00   ? 176 TYR A HB3  1  
ATOM   2596   H  HD1  . TYR A 1 173 ? 19.489  16.097 38.417 1.00 0.00   ? 176 TYR A HD1  1  
ATOM   2597   H  HD2  . TYR A 1 173 ? 17.450  19.009 36.005 1.00 0.00   ? 176 TYR A HD2  1  
ATOM   2598   H  HE1  . TYR A 1 173 ? 19.302  14.443 36.578 1.00 0.00   ? 176 TYR A HE1  1  
ATOM   2599   H  HE2  . TYR A 1 173 ? 17.263  17.356 34.167 1.00 0.00   ? 176 TYR A HE2  1  
ATOM   2600   H  HH   . TYR A 1 173 ? 18.551  15.262 33.441 1.00 0.00   ? 176 TYR A HH   1  
ATOM   2601   N  N    . TYR A 1 174 ? 18.763  18.783 41.669 1.00 8.69   ? 177 TYR A N    1  
ATOM   2602   C  CA   . TYR A 1 174 ? 19.052  19.600 42.876 1.00 8.48   ? 177 TYR A CA   1  
ATOM   2603   C  C    . TYR A 1 174 ? 20.513  20.037 42.841 1.00 8.01   ? 177 TYR A C    1  
ATOM   2604   O  O    . TYR A 1 174 ? 21.421  19.232 42.907 1.00 8.84   ? 177 TYR A O    1  
ATOM   2605   C  CB   . TYR A 1 174 ? 18.798  18.765 44.133 1.00 8.37   ? 177 TYR A CB   1  
ATOM   2606   C  CG   . TYR A 1 174 ? 19.496  19.402 45.310 1.00 7.71   ? 177 TYR A CG   1  
ATOM   2607   C  CD1  . TYR A 1 174 ? 19.380  20.779 45.532 1.00 7.98   ? 177 TYR A CD1  1  
ATOM   2608   C  CD2  . TYR A 1 174 ? 20.258  18.614 46.181 1.00 7.72   ? 177 TYR A CD2  1  
ATOM   2609   C  CE1  . TYR A 1 174 ? 20.028  21.369 46.624 1.00 7.68   ? 177 TYR A CE1  1  
ATOM   2610   C  CE2  . TYR A 1 174 ? 20.906  19.204 47.273 1.00 8.36   ? 177 TYR A CE2  1  
ATOM   2611   C  CZ   . TYR A 1 174 ? 20.791  20.582 47.494 1.00 7.99   ? 177 TYR A CZ   1  
ATOM   2612   O  OH   . TYR A 1 174 ? 21.429  21.164 48.571 1.00 8.38   ? 177 TYR A OH   1  
ATOM   2613   H  H    . TYR A 1 174 ? 19.229  17.931 41.537 1.00 0.00   ? 177 TYR A H    1  
ATOM   2614   H  HA   . TYR A 1 174 ? 18.414  20.471 42.885 1.00 0.00   ? 177 TYR A HA   1  
ATOM   2615   H  HB2  . TYR A 1 174 ? 17.735  18.719 44.325 1.00 0.00   ? 177 TYR A HB2  1  
ATOM   2616   H  HB3  . TYR A 1 174 ? 19.180  17.766 43.985 1.00 0.00   ? 177 TYR A HB3  1  
ATOM   2617   H  HD1  . TYR A 1 174 ? 18.792  21.387 44.860 1.00 0.00   ? 177 TYR A HD1  1  
ATOM   2618   H  HD2  . TYR A 1 174 ? 20.347  17.551 46.010 1.00 0.00   ? 177 TYR A HD2  1  
ATOM   2619   H  HE1  . TYR A 1 174 ? 19.939  22.432 46.794 1.00 0.00   ? 177 TYR A HE1  1  
ATOM   2620   H  HE2  . TYR A 1 174 ? 21.494  18.597 47.945 1.00 0.00   ? 177 TYR A HE2  1  
ATOM   2621   H  HH   . TYR A 1 174 ? 20.798  21.733 49.017 1.00 0.00   ? 177 TYR A HH   1  
ATOM   2622   N  N    . VAL A 1 175 ? 20.740  21.308 42.726 1.00 8.01   ? 178 VAL A N    1  
ATOM   2623   C  CA   . VAL A 1 175 ? 22.134  21.828 42.672 1.00 8.23   ? 178 VAL A CA   1  
ATOM   2624   C  C    . VAL A 1 175 ? 22.463  22.574 43.968 1.00 7.88   ? 178 VAL A C    1  
ATOM   2625   O  O    . VAL A 1 175 ? 22.052  23.698 44.179 1.00 8.93   ? 178 VAL A O    1  
ATOM   2626   C  CB   . VAL A 1 175 ? 22.274  22.784 41.486 1.00 8.70   ? 178 VAL A CB   1  
ATOM   2627   C  CG1  . VAL A 1 175 ? 23.642  23.466 41.538 1.00 10.06  ? 178 VAL A CG1  1  
ATOM   2628   C  CG2  . VAL A 1 175 ? 22.148  21.996 40.180 1.00 9.85   ? 178 VAL A CG2  1  
ATOM   2629   H  H    . VAL A 1 175 ? 19.987  21.932 42.667 1.00 0.00   ? 178 VAL A H    1  
ATOM   2630   H  HA   . VAL A 1 175 ? 22.820  21.003 42.549 1.00 0.00   ? 178 VAL A HA   1  
ATOM   2631   H  HB   . VAL A 1 175 ? 21.496  23.533 41.534 1.00 0.00   ? 178 VAL A HB   1  
ATOM   2632   H  HG11 . VAL A 1 175 ? 24.393  22.797 41.146 1.00 0.00   ? 178 VAL A HG11 1  
ATOM   2633   H  HG12 . VAL A 1 175 ? 23.881  23.716 42.561 1.00 0.00   ? 178 VAL A HG12 1  
ATOM   2634   H  HG13 . VAL A 1 175 ? 23.617  24.368 40.944 1.00 0.00   ? 178 VAL A HG13 1  
ATOM   2635   H  HG21 . VAL A 1 175 ? 22.842  21.169 40.190 1.00 0.00   ? 178 VAL A HG21 1  
ATOM   2636   H  HG22 . VAL A 1 175 ? 22.372  22.644 39.346 1.00 0.00   ? 178 VAL A HG22 1  
ATOM   2637   H  HG23 . VAL A 1 175 ? 21.140  21.620 40.082 1.00 0.00   ? 178 VAL A HG23 1  
ATOM   2638   N  N    . GLY A 1 176 ? 23.213  21.949 44.826 1.00 8.02   ? 179 GLY A N    1  
ATOM   2639   C  CA   . GLY A 1 176 ? 23.604  22.579 46.107 1.00 8.13   ? 179 GLY A CA   1  
ATOM   2640   C  C    . GLY A 1 176 ? 24.896  23.349 45.884 1.00 8.03   ? 179 GLY A C    1  
ATOM   2641   O  O    . GLY A 1 176 ? 25.867  22.834 45.368 1.00 8.93   ? 179 GLY A O    1  
ATOM   2642   H  H    . GLY A 1 176 ? 23.532  21.046 44.617 1.00 0.00   ? 179 GLY A H    1  
ATOM   2643   H  HA2  . GLY A 1 176 ? 22.824  23.255 46.432 1.00 0.00   ? 179 GLY A HA2  1  
ATOM   2644   H  HA3  . GLY A 1 176 ? 23.762  21.818 46.855 1.00 0.00   ? 179 GLY A HA3  1  
ATOM   2645   N  N    . GLU A 1 177 ? 24.896  24.584 46.249 1.00 7.64   ? 180 GLU A N    1  
ATOM   2646   C  CA   . GLU A 1 177 ? 26.081  25.429 46.054 1.00 7.67   ? 180 GLU A CA   1  
ATOM   2647   C  C    . GLU A 1 177 ? 26.824  25.456 47.358 1.00 7.73   ? 180 GLU A C    1  
ATOM   2648   O  O    . GLU A 1 177 ? 26.239  25.401 48.421 1.00 8.82   ? 180 GLU A O    1  
ATOM   2649   C  CB   . GLU A 1 177 ? 25.653  26.847 45.669 1.00 7.58   ? 180 GLU A CB   1  
ATOM   2650   C  CG   . GLU A 1 177 ? 26.879  27.762 45.644 1.00 7.71   ? 180 GLU A CG   1  
ATOM   2651   C  CD   . GLU A 1 177 ? 26.471  29.150 45.146 1.00 7.94   ? 180 GLU A CD   1  
ATOM   2652   O  OE1  . GLU A 1 177 ? 25.386  29.266 44.601 1.00 8.54   ? 180 GLU A OE1  1  
ATOM   2653   O  OE2  . GLU A 1 177 ? 27.251  30.072 45.318 1.00 8.59   ? 180 GLU A OE2  1  
ATOM   2654   H  H    . GLU A 1 177 ? 24.087  24.971 46.645 1.00 0.00   ? 180 GLU A H    1  
ATOM   2655   H  HA   . GLU A 1 177 ? 26.709  25.011 45.281 1.00 0.00   ? 180 GLU A HA   1  
ATOM   2656   H  HB2  . GLU A 1 177 ? 25.195  26.831 44.690 1.00 0.00   ? 180 GLU A HB2  1  
ATOM   2657   H  HB3  . GLU A 1 177 ? 24.944  27.218 46.393 1.00 0.00   ? 180 GLU A HB3  1  
ATOM   2658   H  HG2  . GLU A 1 177 ? 27.288  27.842 46.641 1.00 0.00   ? 180 GLU A HG2  1  
ATOM   2659   H  HG3  . GLU A 1 177 ? 27.624  27.348 44.981 1.00 0.00   ? 180 GLU A HG3  1  
ATOM   2660   N  N    . GLN A 1 178 ? 28.099  25.509 47.301 1.00 7.36   ? 181 GLN A N    1  
ATOM   2661   C  CA   . GLN A 1 178 ? 28.867  25.502 48.575 1.00 7.90   ? 181 GLN A CA   1  
ATOM   2662   C  C    . GLN A 1 178 ? 30.053  26.455 48.500 1.00 7.49   ? 181 GLN A C    1  
ATOM   2663   O  O    . GLN A 1 178 ? 30.929  26.315 47.670 1.00 8.63   ? 181 GLN A O    1  
ATOM   2664   C  CB   . GLN A 1 178 ? 29.375  24.085 48.850 1.00 7.68   ? 181 GLN A CB   1  
ATOM   2665   C  CG   . GLN A 1 178 ? 30.301  24.101 50.067 1.00 8.44   ? 181 GLN A CG   1  
ATOM   2666   C  CD   . GLN A 1 178 ? 29.469  24.277 51.339 1.00 8.26   ? 181 GLN A CD   1  
ATOM   2667   O  OE1  . GLN A 1 178 ? 28.610  23.470 51.634 1.00 8.59   ? 181 GLN A OE1  1  
ATOM   2668   N  NE2  . GLN A 1 178 ? 29.689  25.307 52.110 1.00 9.48   ? 181 GLN A NE2  1  
ATOM   2669   H  H    . GLN A 1 178 ? 28.562  25.531 46.437 1.00 0.00   ? 181 GLN A H    1  
ATOM   2670   H  HA   . GLN A 1 178 ? 28.218  25.806 49.382 1.00 0.00   ? 181 GLN A HA   1  
ATOM   2671   H  HB2  . GLN A 1 178 ? 28.535  23.433 49.043 1.00 0.00   ? 181 GLN A HB2  1  
ATOM   2672   H  HB3  . GLN A 1 178 ? 29.920  23.725 47.990 1.00 0.00   ? 181 GLN A HB3  1  
ATOM   2673   H  HG2  . GLN A 1 178 ? 30.844  23.169 50.118 1.00 0.00   ? 181 GLN A HG2  1  
ATOM   2674   H  HG3  . GLN A 1 178 ? 30.998  24.921 49.979 1.00 0.00   ? 181 GLN A HG3  1  
ATOM   2675   H  HE21 . GLN A 1 178 ? 30.382  25.958 51.873 1.00 0.00   ? 181 GLN A HE21 1  
ATOM   2676   H  HE22 . GLN A 1 178 ? 29.162  25.429 52.927 1.00 0.00   ? 181 GLN A HE22 1  
ATOM   2677   N  N    . ASP A 1 179 ? 30.100  27.408 49.386 1.00 7.38   ? 182 ASP A N    1  
ATOM   2678   C  CA   . ASP A 1 179 ? 31.249  28.360 49.396 1.00 7.87   ? 182 ASP A CA   1  
ATOM   2679   C  C    . ASP A 1 179 ? 32.298  27.862 50.401 1.00 7.67   ? 182 ASP A C    1  
ATOM   2680   O  O    . ASP A 1 179 ? 32.038  27.772 51.584 1.00 8.30   ? 182 ASP A O    1  
ATOM   2681   C  CB   . ASP A 1 179 ? 30.760  29.750 49.811 1.00 8.19   ? 182 ASP A CB   1  
ATOM   2682   C  CG   . ASP A 1 179 ? 29.909  29.634 51.077 1.00 8.27   ? 182 ASP A CG   1  
ATOM   2683   O  OD1  . ASP A 1 179 ? 29.092  28.731 51.138 1.00 8.52   ? 182 ASP A OD1  1  
ATOM   2684   O  OD2  . ASP A 1 179 ? 30.090  30.452 51.965 1.00 8.38   ? 182 ASP A OD2  1  
ATOM   2685   H  H    . ASP A 1 179 ? 29.392  27.487 50.059 1.00 0.00   ? 182 ASP A H    1  
ATOM   2686   H  HA   . ASP A 1 179 ? 31.688  28.409 48.409 1.00 0.00   ? 182 ASP A HA   1  
ATOM   2687   H  HB2  . ASP A 1 179 ? 31.611  30.387 50.005 1.00 0.00   ? 182 ASP A HB2  1  
ATOM   2688   H  HB3  . ASP A 1 179 ? 30.165  30.174 49.017 1.00 0.00   ? 182 ASP A HB3  1  
ATOM   2689   N  N    . PHE A 1 180 ? 33.476  27.525 49.941 1.00 7.81   ? 183 PHE A N    1  
ATOM   2690   C  CA   . PHE A 1 180 ? 34.512  27.028 50.862 1.00 7.94   ? 183 PHE A CA   1  
ATOM   2691   C  C    . PHE A 1 180 ? 35.436  28.170 51.252 1.00 7.76   ? 183 PHE A C    1  
ATOM   2692   O  O    . PHE A 1 180 ? 35.316  29.287 50.790 1.00 8.38   ? 183 PHE A O    1  
ATOM   2693   C  CB   . PHE A 1 180 ? 35.322  25.928 50.173 1.00 8.64   ? 183 PHE A CB   1  
ATOM   2694   C  CG   . PHE A 1 180 ? 34.482  24.678 50.061 1.00 8.43   ? 183 PHE A CG   1  
ATOM   2695   C  CD1  . PHE A 1 180 ? 34.028  24.034 51.218 1.00 9.45   ? 183 PHE A CD1  1  
ATOM   2696   C  CD2  . PHE A 1 180 ? 34.158  24.164 48.800 1.00 9.81   ? 183 PHE A CD2  1  
ATOM   2697   C  CE1  . PHE A 1 180 ? 33.249  22.876 51.114 1.00 9.37   ? 183 PHE A CE1  1  
ATOM   2698   C  CE2  . PHE A 1 180 ? 33.379  23.005 48.696 1.00 9.94   ? 183 PHE A CE2  1  
ATOM   2699   C  CZ   . PHE A 1 180 ? 32.925  22.361 49.854 1.00 9.53   ? 183 PHE A CZ   1  
ATOM   2700   H  H    . PHE A 1 180 ? 33.666  27.595 48.982 1.00 0.00   ? 183 PHE A H    1  
ATOM   2701   H  HA   . PHE A 1 180 ? 34.043  26.625 51.747 1.00 0.00   ? 183 PHE A HA   1  
ATOM   2702   H  HB2  . PHE A 1 180 ? 35.610  26.258 49.185 1.00 0.00   ? 183 PHE A HB2  1  
ATOM   2703   H  HB3  . PHE A 1 180 ? 36.207  25.715 50.754 1.00 0.00   ? 183 PHE A HB3  1  
ATOM   2704   H  HD1  . PHE A 1 180 ? 34.278  24.431 52.191 1.00 0.00   ? 183 PHE A HD1  1  
ATOM   2705   H  HD2  . PHE A 1 180 ? 34.508  24.660 47.907 1.00 0.00   ? 183 PHE A HD2  1  
ATOM   2706   H  HE1  . PHE A 1 180 ? 32.899  22.379 52.007 1.00 0.00   ? 183 PHE A HE1  1  
ATOM   2707   H  HE2  . PHE A 1 180 ? 33.128  22.608 47.724 1.00 0.00   ? 183 PHE A HE2  1  
ATOM   2708   H  HZ   . PHE A 1 180 ? 32.324  21.467 49.774 1.00 0.00   ? 183 PHE A HZ   1  
ATOM   2709   N  N    . TYR A 1 181 ? 36.355  27.876 52.104 1.00 8.06   ? 184 TYR A N    1  
ATOM   2710   C  CA   . TYR A 1 181 ? 37.334  28.891 52.581 1.00 8.20   ? 184 TYR A CA   1  
ATOM   2711   C  C    . TYR A 1 181 ? 38.610  28.128 52.888 1.00 9.20   ? 184 TYR A C    1  
ATOM   2712   O  O    . TYR A 1 181 ? 38.818  27.646 53.984 1.00 10.83  ? 184 TYR A O    1  
ATOM   2713   C  CB   . TYR A 1 181 ? 36.811  29.571 53.848 1.00 8.38   ? 184 TYR A CB   1  
ATOM   2714   C  CG   . TYR A 1 181 ? 35.478  30.218 53.558 1.00 8.46   ? 184 TYR A CG   1  
ATOM   2715   C  CD1  . TYR A 1 181 ? 34.315  29.440 53.522 1.00 8.13   ? 184 TYR A CD1  1  
ATOM   2716   C  CD2  . TYR A 1 181 ? 35.405  31.597 53.326 1.00 8.60   ? 184 TYR A CD2  1  
ATOM   2717   C  CE1  . TYR A 1 181 ? 33.079  30.040 53.254 1.00 7.48   ? 184 TYR A CE1  1  
ATOM   2718   C  CE2  . TYR A 1 181 ? 34.169  32.197 53.057 1.00 8.20   ? 184 TYR A CE2  1  
ATOM   2719   C  CZ   . TYR A 1 181 ? 33.006  31.419 53.021 1.00 7.63   ? 184 TYR A CZ   1  
ATOM   2720   O  OH   . TYR A 1 181 ? 31.787  32.010 52.756 1.00 8.56   ? 184 TYR A OH   1  
ATOM   2721   H  H    . TYR A 1 181 ? 36.411  26.960 52.448 1.00 0.00   ? 184 TYR A H    1  
ATOM   2722   H  HA   . TYR A 1 181 ? 37.517  29.624 51.807 1.00 0.00   ? 184 TYR A HA   1  
ATOM   2723   H  HB2  . TYR A 1 181 ? 36.692  28.834 54.629 1.00 0.00   ? 184 TYR A HB2  1  
ATOM   2724   H  HB3  . TYR A 1 181 ? 37.514  30.325 54.169 1.00 0.00   ? 184 TYR A HB3  1  
ATOM   2725   H  HD1  . TYR A 1 181 ? 34.371  28.376 53.702 1.00 0.00   ? 184 TYR A HD1  1  
ATOM   2726   H  HD2  . TYR A 1 181 ? 36.302  32.198 53.353 1.00 0.00   ? 184 TYR A HD2  1  
ATOM   2727   H  HE1  . TYR A 1 181 ? 32.181  29.439 53.226 1.00 0.00   ? 184 TYR A HE1  1  
ATOM   2728   H  HE2  . TYR A 1 181 ? 34.112  33.261 52.877 1.00 0.00   ? 184 TYR A HE2  1  
ATOM   2729   H  HH   . TYR A 1 181 ? 31.354  32.185 53.595 1.00 0.00   ? 184 TYR A HH   1  
ATOM   2730   N  N    . VAL A 1 182 ? 39.423  27.946 51.900 1.00 9.00   ? 185 VAL A N    1  
ATOM   2731   C  CA   . VAL A 1 182 ? 40.648  27.134 52.082 1.00 9.34   ? 185 VAL A CA   1  
ATOM   2732   C  C    . VAL A 1 182 ? 41.819  28.017 52.431 1.00 9.33   ? 185 VAL A C    1  
ATOM   2733   O  O    . VAL A 1 182 ? 42.118  28.979 51.751 1.00 10.08  ? 185 VAL A O    1  
ATOM   2734   C  CB   . VAL A 1 182 ? 40.951  26.378 50.788 1.00 9.76   ? 185 VAL A CB   1  
ATOM   2735   C  CG1  . VAL A 1 182 ? 42.086  25.382 51.032 1.00 11.30  ? 185 VAL A CG1  1  
ATOM   2736   C  CG2  . VAL A 1 182 ? 39.700  25.623 50.335 1.00 10.26  ? 185 VAL A CG2  1  
ATOM   2737   H  H    . VAL A 1 182 ? 39.198  28.296 51.013 1.00 0.00   ? 185 VAL A H    1  
ATOM   2738   H  HA   . VAL A 1 182 ? 40.488  26.422 52.878 1.00 0.00   ? 185 VAL A HA   1  
ATOM   2739   H  HB   . VAL A 1 182 ? 41.248  27.080 50.023 1.00 0.00   ? 185 VAL A HB   1  
ATOM   2740   H  HG11 . VAL A 1 182 ? 43.012  25.919 51.175 1.00 0.00   ? 185 VAL A HG11 1  
ATOM   2741   H  HG12 . VAL A 1 182 ? 42.179  24.726 50.180 1.00 0.00   ? 185 VAL A HG12 1  
ATOM   2742   H  HG13 . VAL A 1 182 ? 41.869  24.798 51.914 1.00 0.00   ? 185 VAL A HG13 1  
ATOM   2743   H  HG21 . VAL A 1 182 ? 38.955  25.657 51.116 1.00 0.00   ? 185 VAL A HG21 1  
ATOM   2744   H  HG22 . VAL A 1 182 ? 39.956  24.594 50.127 1.00 0.00   ? 185 VAL A HG22 1  
ATOM   2745   H  HG23 . VAL A 1 182 ? 39.306  26.083 49.441 1.00 0.00   ? 185 VAL A HG23 1  
ATOM   2746   N  N    . PRO A 1 183 ? 42.486  27.678 53.483 1.00 9.71   ? 186 PRO A N    1  
ATOM   2747   C  CA   . PRO A 1 183 ? 43.688  28.446 53.951 1.00 10.15  ? 186 PRO A CA   1  
ATOM   2748   C  C    . PRO A 1 183 ? 44.893  28.334 52.985 1.00 11.44  ? 186 PRO A C    1  
ATOM   2749   O  O    . PRO A 1 183 ? 45.216  27.265 52.506 1.00 10.98  ? 186 PRO A O    1  
ATOM   2750   C  CB   . PRO A 1 183 ? 44.039  27.805 55.303 1.00 10.57  ? 186 PRO A CB   1  
ATOM   2751   C  CG   . PRO A 1 183 ? 42.891  26.911 55.661 1.00 9.97   ? 186 PRO A CG   1  
ATOM   2752   C  CD   . PRO A 1 183 ? 42.190  26.541 54.356 1.00 10.15  ? 186 PRO A CD   1  
ATOM   2753   H  HA   . PRO A 1 183 ? 43.430  29.481 54.103 1.00 0.00   ? 186 PRO A HA   1  
ATOM   2754   H  HB2  . PRO A 1 183 ? 44.948  27.228 55.214 1.00 0.00   ? 186 PRO A HB2  1  
ATOM   2755   H  HB3  . PRO A 1 183 ? 44.156  28.569 56.056 1.00 0.00   ? 186 PRO A HB3  1  
ATOM   2756   H  HG2  . PRO A 1 183 ? 43.259  26.020 56.152 1.00 0.00   ? 186 PRO A HG2  1  
ATOM   2757   H  HG3  . PRO A 1 183 ? 42.203  27.433 56.306 1.00 0.00   ? 186 PRO A HG3  1  
ATOM   2758   H  HD2  . PRO A 1 183 ? 42.601  25.627 53.950 1.00 0.00   ? 186 PRO A HD2  1  
ATOM   2759   H  HD3  . PRO A 1 183 ? 41.126  26.451 54.506 1.00 0.00   ? 186 PRO A HD3  1  
ATOM   2760   N  N    . ARG A 1 184 ? 45.570  29.434 52.713 0.50 11.51  ? 187 ARG A N    1  
ATOM   2761   C  CA   . ARG A 1 184 ? 46.750  29.396 51.811 0.50 12.04  ? 187 ARG A CA   1  
ATOM   2762   C  C    . ARG A 1 184 ? 47.975  29.874 52.593 0.50 12.59  ? 187 ARG A C    1  
ATOM   2763   O  O    . ARG A 1 184 ? 47.869  30.669 53.506 0.50 12.54  ? 187 ARG A O    1  
ATOM   2764   C  CB   . ARG A 1 184 ? 46.512  30.320 50.614 0.50 12.05  ? 187 ARG A CB   1  
ATOM   2765   C  CG   . ARG A 1 184 ? 45.061  30.186 50.146 0.50 12.46  ? 187 ARG A CG   1  
ATOM   2766   C  CD   . ARG A 1 184 ? 44.610  31.497 49.498 0.50 13.02  ? 187 ARG A CD   1  
ATOM   2767   N  NE   . ARG A 1 184 ? 43.776  31.197 48.300 0.50 13.40  ? 187 ARG A NE   1  
ATOM   2768   C  CZ   . ARG A 1 184 ? 42.885  32.059 47.894 0.50 13.33  ? 187 ARG A CZ   1  
ATOM   2769   N  NH1  . ARG A 1 184 ? 42.724  33.183 48.536 0.50 14.89  ? 187 ARG A NH1  1  
ATOM   2770   N  NH2  . ARG A 1 184 ? 42.154  31.796 46.845 0.50 12.36  ? 187 ARG A NH2  1  
ATOM   2771   H  H    . ARG A 1 184 ? 45.299  30.283 53.121 1.00 0.00   ? 187 ARG A H    1  
ATOM   2772   H  HA   . ARG A 1 184 ? 46.911  28.386 51.465 1.00 0.00   ? 187 ARG A HA   1  
ATOM   2773   H  HB2  . ARG A 1 184 ? 46.705  31.342 50.904 1.00 0.00   ? 187 ARG A HB2  1  
ATOM   2774   H  HB3  . ARG A 1 184 ? 47.174  30.043 49.808 1.00 0.00   ? 187 ARG A HB3  1  
ATOM   2775   H  HG2  . ARG A 1 184 ? 44.987  29.383 49.427 1.00 0.00   ? 187 ARG A HG2  1  
ATOM   2776   H  HG3  . ARG A 1 184 ? 44.428  29.970 50.994 1.00 0.00   ? 187 ARG A HG3  1  
ATOM   2777   H  HD2  . ARG A 1 184 ? 44.030  32.068 50.207 1.00 0.00   ? 187 ARG A HD2  1  
ATOM   2778   H  HD3  . ARG A 1 184 ? 45.477  32.067 49.199 1.00 0.00   ? 187 ARG A HD3  1  
ATOM   2779   H  HE   . ARG A 1 184 ? 43.897  30.353 47.818 1.00 0.00   ? 187 ARG A HE   1  
ATOM   2780   H  HH11 . ARG A 1 184 ? 43.284  33.384 49.340 1.00 0.00   ? 187 ARG A HH11 1  
ATOM   2781   H  HH12 . ARG A 1 184 ? 42.040  33.844 48.225 1.00 0.00   ? 187 ARG A HH12 1  
ATOM   2782   H  HH21 . ARG A 1 184 ? 42.277  30.935 46.352 1.00 0.00   ? 187 ARG A HH21 1  
ATOM   2783   H  HH22 . ARG A 1 184 ? 41.471  32.457 46.533 1.00 0.00   ? 187 ARG A HH22 1  
ATOM   2784   N  N    . ASP A 1 185 ? 49.134  29.391 52.252 1.00 13.52  ? 188 ASP A N    1  
ATOM   2785   C  CA   . ASP A 1 185 ? 50.365  29.807 52.983 1.00 15.23  ? 188 ASP A CA   1  
ATOM   2786   C  C    . ASP A 1 185 ? 50.749  31.233 52.584 1.00 16.82  ? 188 ASP A C    1  
ATOM   2787   O  O    . ASP A 1 185 ? 49.945  31.981 52.065 1.00 16.88  ? 188 ASP A O    1  
ATOM   2788   C  CB   . ASP A 1 185 ? 51.511  28.856 52.633 1.00 15.89  ? 188 ASP A CB   1  
ATOM   2789   C  CG   . ASP A 1 185 ? 51.656  28.768 51.113 1.00 16.61  ? 188 ASP A CG   1  
ATOM   2790   O  OD1  . ASP A 1 185 ? 51.376  29.755 50.453 1.00 17.09  ? 188 ASP A OD1  1  
ATOM   2791   O  OD2  . ASP A 1 185 ? 52.045  27.715 50.634 1.00 22.27  ? 188 ASP A OD2  1  
ATOM   2792   H  H    . ASP A 1 185 ? 49.197  28.745 51.518 1.00 0.00   ? 188 ASP A H    1  
ATOM   2793   H  HA   . ASP A 1 185 ? 50.181  29.770 54.047 1.00 0.00   ? 188 ASP A HA   1  
ATOM   2794   H  HB2  . ASP A 1 185 ? 52.430  29.226 53.063 1.00 0.00   ? 188 ASP A HB2  1  
ATOM   2795   H  HB3  . ASP A 1 185 ? 51.298  27.874 53.030 1.00 0.00   ? 188 ASP A HB3  1  
ATOM   2796   N  N    . GLU A 1 186 ? 51.974  31.616 52.827 1.00 18.33  ? 189 GLU A N    1  
ATOM   2797   C  CA   . GLU A 1 186 ? 52.409  32.999 52.463 1.00 20.24  ? 189 GLU A CA   1  
ATOM   2798   C  C    . GLU A 1 186 ? 52.608  33.129 50.941 1.00 20.19  ? 189 GLU A C    1  
ATOM   2799   O  O    . GLU A 1 186 ? 52.443  34.194 50.381 1.00 21.57  ? 189 GLU A O    1  
ATOM   2800   C  CB   . GLU A 1 186 ? 53.728  33.314 53.172 1.00 21.40  ? 189 GLU A CB   1  
ATOM   2801   C  CG   . GLU A 1 186 ? 54.847  32.459 52.574 1.00 25.92  ? 189 GLU A CG   1  
ATOM   2802   C  CD   . GLU A 1 186 ? 55.892  32.159 53.650 1.00 32.20  ? 189 GLU A CD   1  
ATOM   2803   O  OE1  . GLU A 1 186 ? 56.613  33.072 54.018 1.00 32.18  ? 189 GLU A OE1  1  
ATOM   2804   O  OE2  . GLU A 1 186 ? 55.953  31.022 54.088 1.00 36.99  ? 189 GLU A OE2  1  
ATOM   2805   H  H    . GLU A 1 186 ? 52.607  30.998 53.249 1.00 0.00   ? 189 GLU A H    1  
ATOM   2806   H  HA   . GLU A 1 186 ? 51.657  33.704 52.785 1.00 0.00   ? 189 GLU A HA   1  
ATOM   2807   H  HB2  . GLU A 1 186 ? 53.965  34.360 53.042 1.00 0.00   ? 189 GLU A HB2  1  
ATOM   2808   H  HB3  . GLU A 1 186 ? 53.633  33.094 54.224 1.00 0.00   ? 189 GLU A HB3  1  
ATOM   2809   H  HG2  . GLU A 1 186 ? 54.432  31.531 52.205 1.00 0.00   ? 189 GLU A HG2  1  
ATOM   2810   H  HG3  . GLU A 1 186 ? 55.314  32.993 51.760 1.00 0.00   ? 189 GLU A HG3  1  
ATOM   2811   N  N    . ASN A 1 187 ? 52.973  32.067 50.269 1.00 20.50  ? 190 ASN A N    1  
ATOM   2812   C  CA   . ASN A 1 187 ? 53.194  32.154 48.788 1.00 21.11  ? 190 ASN A CA   1  
ATOM   2813   C  C    . ASN A 1 187 ? 51.868  32.070 47.997 1.00 20.54  ? 190 ASN A C    1  
ATOM   2814   O  O    . ASN A 1 187 ? 51.869  32.147 46.784 1.00 20.82  ? 190 ASN A O    1  
ATOM   2815   C  CB   . ASN A 1 187 ? 54.107  31.006 48.352 1.00 21.63  ? 190 ASN A CB   1  
ATOM   2816   C  CG   . ASN A 1 187 ? 55.392  31.033 49.181 1.00 24.34  ? 190 ASN A CG   1  
ATOM   2817   O  OD1  . ASN A 1 187 ? 55.907  32.090 49.492 1.00 28.49  ? 190 ASN A OD1  1  
ATOM   2818   N  ND2  . ASN A 1 187 ? 55.937  29.908 49.555 1.00 26.29  ? 190 ASN A ND2  1  
ATOM   2819   H  H    . ASN A 1 187 ? 53.113  31.217 50.736 1.00 0.00   ? 190 ASN A H    1  
ATOM   2820   H  HA   . ASN A 1 187 ? 53.680  33.091 48.560 1.00 0.00   ? 190 ASN A HA   1  
ATOM   2821   H  HB2  . ASN A 1 187 ? 53.599  30.065 48.505 1.00 0.00   ? 190 ASN A HB2  1  
ATOM   2822   H  HB3  . ASN A 1 187 ? 54.352  31.118 47.307 1.00 0.00   ? 190 ASN A HB3  1  
ATOM   2823   H  HD21 . ASN A 1 187 ? 55.523  29.056 49.304 1.00 0.00   ? 190 ASN A HD21 1  
ATOM   2824   H  HD22 . ASN A 1 187 ? 56.761  29.915 50.086 1.00 0.00   ? 190 ASN A HD22 1  
ATOM   2825   N  N    . GLY A 1 188 ? 50.744  31.914 48.650 1.00 19.28  ? 191 GLY A N    1  
ATOM   2826   C  CA   . GLY A 1 188 ? 49.447  31.829 47.899 1.00 18.92  ? 191 GLY A CA   1  
ATOM   2827   C  C    . GLY A 1 188 ? 49.090  30.369 47.516 1.00 18.11  ? 191 GLY A C    1  
ATOM   2828   O  O    . GLY A 1 188 ? 48.193  30.141 46.729 1.00 19.25  ? 191 GLY A O    1  
ATOM   2829   H  H    . GLY A 1 188 ? 50.749  31.852 49.628 1.00 0.00   ? 191 GLY A H    1  
ATOM   2830   H  HA2  . GLY A 1 188 ? 48.658  32.234 48.515 1.00 0.00   ? 191 GLY A HA2  1  
ATOM   2831   H  HA3  . GLY A 1 188 ? 49.525  32.418 46.997 1.00 0.00   ? 191 GLY A HA3  1  
ATOM   2832   N  N    . LYS A 1 189 ? 49.761  29.382 48.063 1.00 17.06  ? 192 LYS A N    1  
ATOM   2833   C  CA   . LYS A 1 189 ? 49.431  27.970 47.725 1.00 17.32  ? 192 LYS A CA   1  
ATOM   2834   C  C    . LYS A 1 189 ? 48.482  27.400 48.785 1.00 15.26  ? 192 LYS A C    1  
ATOM   2835   O  O    . LYS A 1 189 ? 48.691  27.557 49.972 1.00 14.68  ? 192 LYS A O    1  
ATOM   2836   C  CB   . LYS A 1 189 ? 50.716  27.140 47.691 1.00 18.84  ? 192 LYS A CB   1  
ATOM   2837   C  CG   . LYS A 1 189 ? 51.198  27.004 46.245 1.00 24.76  ? 192 LYS A CG   1  
ATOM   2838   C  CD   . LYS A 1 189 ? 51.609  28.377 45.712 1.00 29.42  ? 192 LYS A CD   1  
ATOM   2839   C  CE   . LYS A 1 189 ? 52.521  28.201 44.496 1.00 31.73  ? 192 LYS A CE   1  
ATOM   2840   N  NZ   . LYS A 1 189 ? 52.122  29.165 43.432 1.00 34.20  ? 192 LYS A NZ   1  
ATOM   2841   H  H    . LYS A 1 189 ? 50.477  29.575 48.704 1.00 0.00   ? 192 LYS A H    1  
ATOM   2842   H  HA   . LYS A 1 189 ? 48.953  27.934 46.757 1.00 0.00   ? 192 LYS A HA   1  
ATOM   2843   H  HB2  . LYS A 1 189 ? 51.477  27.631 48.280 1.00 0.00   ? 192 LYS A HB2  1  
ATOM   2844   H  HB3  . LYS A 1 189 ? 50.523  26.159 48.098 1.00 0.00   ? 192 LYS A HB3  1  
ATOM   2845   H  HG2  . LYS A 1 189 ? 52.046  26.334 46.211 1.00 0.00   ? 192 LYS A HG2  1  
ATOM   2846   H  HG3  . LYS A 1 189 ? 50.401  26.607 45.636 1.00 0.00   ? 192 LYS A HG3  1  
ATOM   2847   H  HD2  . LYS A 1 189 ? 50.726  28.930 45.424 1.00 0.00   ? 192 LYS A HD2  1  
ATOM   2848   H  HD3  . LYS A 1 189 ? 52.139  28.919 46.481 1.00 0.00   ? 192 LYS A HD3  1  
ATOM   2849   H  HE2  . LYS A 1 189 ? 53.545  28.387 44.784 1.00 0.00   ? 192 LYS A HE2  1  
ATOM   2850   H  HE3  . LYS A 1 189 ? 52.430  27.193 44.121 1.00 0.00   ? 192 LYS A HE3  1  
ATOM   2851   H  HZ1  . LYS A 1 189 ? 51.423  28.720 42.804 1.00 0.00   ? 192 LYS A HZ1  1  
ATOM   2852   H  HZ2  . LYS A 1 189 ? 52.958  29.437 42.878 1.00 0.00   ? 192 LYS A HZ2  1  
ATOM   2853   H  HZ3  . LYS A 1 189 ? 51.705  30.012 43.871 1.00 0.00   ? 192 LYS A HZ3  1  
ATOM   2854   N  N    . TYR A 1 190 ? 47.442  26.741 48.359 1.00 13.71  ? 193 TYR A N    1  
ATOM   2855   C  CA   . TYR A 1 190 ? 46.473  26.157 49.310 1.00 12.86  ? 193 TYR A CA   1  
ATOM   2856   C  C    . TYR A 1 190 ? 47.217  25.224 50.244 1.00 12.89  ? 193 TYR A C    1  
ATOM   2857   O  O    . TYR A 1 190 ? 48.149  24.547 49.857 1.00 14.72  ? 193 TYR A O    1  
ATOM   2858   C  CB   . TYR A 1 190 ? 45.406  25.373 48.542 1.00 12.31  ? 193 TYR A CB   1  
ATOM   2859   C  CG   . TYR A 1 190 ? 44.544  26.332 47.757 1.00 11.63  ? 193 TYR A CG   1  
ATOM   2860   C  CD1  . TYR A 1 190 ? 43.718  27.241 48.429 1.00 11.93  ? 193 TYR A CD1  1  
ATOM   2861   C  CD2  . TYR A 1 190 ? 44.570  26.312 46.357 1.00 12.05  ? 193 TYR A CD2  1  
ATOM   2862   C  CE1  . TYR A 1 190 ? 42.918  28.130 47.701 1.00 12.18  ? 193 TYR A CE1  1  
ATOM   2863   C  CE2  . TYR A 1 190 ? 43.771  27.201 45.629 1.00 14.09  ? 193 TYR A CE2  1  
ATOM   2864   C  CZ   . TYR A 1 190 ? 42.945  28.110 46.301 1.00 12.23  ? 193 TYR A CZ   1  
ATOM   2865   O  OH   . TYR A 1 190 ? 42.156  28.987 45.583 1.00 14.74  ? 193 TYR A OH   1  
ATOM   2866   H  H    . TYR A 1 190 ? 47.300  26.632 47.395 1.00 0.00   ? 193 TYR A H    1  
ATOM   2867   H  HA   . TYR A 1 190 ? 46.004  26.945 49.881 1.00 0.00   ? 193 TYR A HA   1  
ATOM   2868   H  HB2  . TYR A 1 190 ? 45.886  24.682 47.864 1.00 0.00   ? 193 TYR A HB2  1  
ATOM   2869   H  HB3  . TYR A 1 190 ? 44.791  24.825 49.239 1.00 0.00   ? 193 TYR A HB3  1  
ATOM   2870   H  HD1  . TYR A 1 190 ? 43.698  27.257 49.508 1.00 0.00   ? 193 TYR A HD1  1  
ATOM   2871   H  HD2  . TYR A 1 190 ? 45.208  25.611 45.839 1.00 0.00   ? 193 TYR A HD2  1  
ATOM   2872   H  HE1  . TYR A 1 190 ? 42.281  28.832 48.219 1.00 0.00   ? 193 TYR A HE1  1  
ATOM   2873   H  HE2  . TYR A 1 190 ? 43.791  27.186 44.550 1.00 0.00   ? 193 TYR A HE2  1  
ATOM   2874   H  HH   . TYR A 1 190 ? 41.630  28.474 44.965 1.00 0.00   ? 193 TYR A HH   1  
ATOM   2875   N  N    . LYS A 1 191 ? 46.826  25.192 51.473 1.00 12.50  ? 194 LYS A N    1  
ATOM   2876   C  CA   . LYS A 1 191 ? 47.526  24.306 52.449 1.00 12.71  ? 194 LYS A CA   1  
ATOM   2877   C  C    . LYS A 1 191 ? 46.699  23.043 52.723 1.00 13.07  ? 194 LYS A C    1  
ATOM   2878   O  O    . LYS A 1 191 ? 45.486  23.078 52.776 1.00 12.76  ? 194 LYS A O    1  
ATOM   2879   C  CB   . LYS A 1 191 ? 47.736  25.065 53.761 1.00 13.20  ? 194 LYS A CB   1  
ATOM   2880   C  CG   . LYS A 1 191 ? 48.577  26.316 53.497 1.00 14.04  ? 194 LYS A CG   1  
ATOM   2881   C  CD   . LYS A 1 191 ? 48.648  27.161 54.771 1.00 17.09  ? 194 LYS A CD   1  
ATOM   2882   C  CE   . LYS A 1 191 ? 48.972  26.261 55.964 1.00 18.59  ? 194 LYS A CE   1  
ATOM   2883   N  NZ   . LYS A 1 191 ? 48.984  27.075 57.212 1.00 22.23  ? 194 LYS A NZ   1  
ATOM   2884   H  H    . LYS A 1 191 ? 46.079  25.754 51.767 1.00 0.00   ? 194 LYS A H    1  
ATOM   2885   H  HA   . LYS A 1 191 ? 48.487  24.021 52.047 1.00 0.00   ? 194 LYS A HA   1  
ATOM   2886   H  HB2  . LYS A 1 191 ? 46.777  25.354 54.167 1.00 0.00   ? 194 LYS A HB2  1  
ATOM   2887   H  HB3  . LYS A 1 191 ? 48.250  24.431 54.466 1.00 0.00   ? 194 LYS A HB3  1  
ATOM   2888   H  HG2  . LYS A 1 191 ? 49.574  26.024 53.202 1.00 0.00   ? 194 LYS A HG2  1  
ATOM   2889   H  HG3  . LYS A 1 191 ? 48.122  26.896 52.708 1.00 0.00   ? 194 LYS A HG3  1  
ATOM   2890   H  HD2  . LYS A 1 191 ? 49.420  27.910 54.663 1.00 0.00   ? 194 LYS A HD2  1  
ATOM   2891   H  HD3  . LYS A 1 191 ? 47.698  27.645 54.936 1.00 0.00   ? 194 LYS A HD3  1  
ATOM   2892   H  HE2  . LYS A 1 191 ? 48.223  25.487 56.045 1.00 0.00   ? 194 LYS A HE2  1  
ATOM   2893   H  HE3  . LYS A 1 191 ? 49.942  25.808 55.821 1.00 0.00   ? 194 LYS A HE3  1  
ATOM   2894   H  HZ1  . LYS A 1 191 ? 49.475  27.973 57.036 1.00 0.00   ? 194 LYS A HZ1  1  
ATOM   2895   H  HZ2  . LYS A 1 191 ? 49.479  26.553 57.963 1.00 0.00   ? 194 LYS A HZ2  1  
ATOM   2896   H  HZ3  . LYS A 1 191 ? 48.005  27.266 57.509 1.00 0.00   ? 194 LYS A HZ3  1  
ATOM   2897   N  N    . LYS A 1 192 ? 47.360  21.929 52.913 1.00 13.49  ? 195 LYS A N    1  
ATOM   2898   C  CA   . LYS A 1 192 ? 46.648  20.667 53.200 1.00 14.01  ? 195 LYS A CA   1  
ATOM   2899   C  C    . LYS A 1 192 ? 46.974  20.271 54.631 1.00 13.34  ? 195 LYS A C    1  
ATOM   2900   O  O    . LYS A 1 192 ? 47.951  20.716 55.201 1.00 14.81  ? 195 LYS A O    1  
ATOM   2901   C  CB   . LYS A 1 192 ? 47.121  19.575 52.239 1.00 14.68  ? 195 LYS A CB   1  
ATOM   2902   C  CG   . LYS A 1 192 ? 47.094  20.109 50.805 1.00 17.13  ? 195 LYS A CG   1  
ATOM   2903   C  CD   . LYS A 1 192 ? 47.856  19.149 49.888 1.00 20.98  ? 195 LYS A CD   1  
ATOM   2904   C  CE   . LYS A 1 192 ? 47.384  19.339 48.445 1.00 25.05  ? 195 LYS A CE   1  
ATOM   2905   N  NZ   . LYS A 1 192 ? 47.765  18.147 47.637 1.00 29.20  ? 195 LYS A NZ   1  
ATOM   2906   H  H    . LYS A 1 192 ? 48.339  21.935 52.876 1.00 0.00   ? 195 LYS A H    1  
ATOM   2907   H  HA   . LYS A 1 192 ? 45.583  20.815 53.094 1.00 0.00   ? 195 LYS A HA   1  
ATOM   2908   H  HB2  . LYS A 1 192 ? 48.129  19.281 52.496 1.00 0.00   ? 195 LYS A HB2  1  
ATOM   2909   H  HB3  . LYS A 1 192 ? 46.466  18.720 52.314 1.00 0.00   ? 195 LYS A HB3  1  
ATOM   2910   H  HG2  . LYS A 1 192 ? 46.070  20.191 50.471 1.00 0.00   ? 195 LYS A HG2  1  
ATOM   2911   H  HG3  . LYS A 1 192 ? 47.562  21.081 50.774 1.00 0.00   ? 195 LYS A HG3  1  
ATOM   2912   H  HD2  . LYS A 1 192 ? 48.914  19.355 49.952 1.00 0.00   ? 195 LYS A HD2  1  
ATOM   2913   H  HD3  . LYS A 1 192 ? 47.667  18.132 50.195 1.00 0.00   ? 195 LYS A HD3  1  
ATOM   2914   H  HE2  . LYS A 1 192 ? 46.310  19.456 48.430 1.00 0.00   ? 195 LYS A HE2  1  
ATOM   2915   H  HE3  . LYS A 1 192 ? 47.848  20.221 48.028 1.00 0.00   ? 195 LYS A HE3  1  
ATOM   2916   H  HZ1  . LYS A 1 192 ? 48.270  17.466 48.239 1.00 0.00   ? 195 LYS A HZ1  1  
ATOM   2917   H  HZ2  . LYS A 1 192 ? 48.384  18.440 46.855 1.00 0.00   ? 195 LYS A HZ2  1  
ATOM   2918   H  HZ3  . LYS A 1 192 ? 46.907  17.701 47.253 1.00 0.00   ? 195 LYS A HZ3  1  
ATOM   2919   N  N    . TYR A 1 193 ? 46.168  19.456 55.224 1.00 13.15  ? 196 TYR A N    1  
ATOM   2920   C  CA   . TYR A 1 193 ? 46.431  19.055 56.615 1.00 13.12  ? 196 TYR A CA   1  
ATOM   2921   C  C    . TYR A 1 193 ? 46.213  17.563 56.740 1.00 14.02  ? 196 TYR A C    1  
ATOM   2922   O  O    . TYR A 1 193 ? 45.783  16.900 55.817 1.00 14.24  ? 196 TYR A O    1  
ATOM   2923   C  CB   . TYR A 1 193 ? 45.475  19.795 57.553 1.00 12.55  ? 196 TYR A CB   1  
ATOM   2924   C  CG   . TYR A 1 193 ? 45.584  21.282 57.313 1.00 12.50  ? 196 TYR A CG   1  
ATOM   2925   C  CD1  . TYR A 1 193 ? 44.978  21.855 56.188 1.00 12.18  ? 196 TYR A CD1  1  
ATOM   2926   C  CD2  . TYR A 1 193 ? 46.289  22.087 58.214 1.00 12.21  ? 196 TYR A CD2  1  
ATOM   2927   C  CE1  . TYR A 1 193 ? 45.078  23.233 55.965 1.00 11.99  ? 196 TYR A CE1  1  
ATOM   2928   C  CE2  . TYR A 1 193 ? 46.390  23.466 57.991 1.00 11.57  ? 196 TYR A CE2  1  
ATOM   2929   C  CZ   . TYR A 1 193 ? 45.784  24.039 56.866 1.00 11.54  ? 196 TYR A CZ   1  
ATOM   2930   O  OH   . TYR A 1 193 ? 45.883  25.398 56.646 1.00 12.74  ? 196 TYR A OH   1  
ATOM   2931   H  H    . TYR A 1 193 ? 45.379  19.115 54.754 1.00 0.00   ? 196 TYR A H    1  
ATOM   2932   H  HA   . TYR A 1 193 ? 47.451  19.296 56.875 1.00 0.00   ? 196 TYR A HA   1  
ATOM   2933   H  HB2  . TYR A 1 193 ? 44.462  19.472 57.363 1.00 0.00   ? 196 TYR A HB2  1  
ATOM   2934   H  HB3  . TYR A 1 193 ? 45.736  19.578 58.578 1.00 0.00   ? 196 TYR A HB3  1  
ATOM   2935   H  HD1  . TYR A 1 193 ? 44.434  21.233 55.492 1.00 0.00   ? 196 TYR A HD1  1  
ATOM   2936   H  HD2  . TYR A 1 193 ? 46.756  21.645 59.082 1.00 0.00   ? 196 TYR A HD2  1  
ATOM   2937   H  HE1  . TYR A 1 193 ? 44.611  23.675 55.097 1.00 0.00   ? 196 TYR A HE1  1  
ATOM   2938   H  HE2  . TYR A 1 193 ? 46.934  24.087 58.687 1.00 0.00   ? 196 TYR A HE2  1  
ATOM   2939   H  HH   . TYR A 1 193 ? 45.619  25.848 57.452 1.00 0.00   ? 196 TYR A HH   1  
ATOM   2940   N  N    . GLU A 1 194 ? 46.508  17.034 57.873 1.00 14.90  ? 197 GLU A N    1  
ATOM   2941   C  CA   . GLU A 1 194 ? 46.327  15.570 58.086 1.00 16.48  ? 197 GLU A CA   1  
ATOM   2942   C  C    . GLU A 1 194 ? 44.895  15.267 58.555 1.00 16.31  ? 197 GLU A C    1  
ATOM   2943   O  O    . GLU A 1 194 ? 44.256  14.361 58.057 1.00 19.11  ? 197 GLU A O    1  
ATOM   2944   C  CB   . GLU A 1 194 ? 47.319  15.087 59.147 1.00 17.90  ? 197 GLU A CB   1  
ATOM   2945   C  CG   . GLU A 1 194 ? 48.729  15.064 58.554 1.00 23.45  ? 197 GLU A CG   1  
ATOM   2946   C  CD   . GLU A 1 194 ? 49.758  15.042 59.686 1.00 29.50  ? 197 GLU A CD   1  
ATOM   2947   O  OE1  . GLU A 1 194 ? 49.384  15.348 60.806 1.00 33.63  ? 197 GLU A OE1  1  
ATOM   2948   O  OE2  . GLU A 1 194 ? 50.903  14.719 59.413 1.00 34.30  ? 197 GLU A OE2  1  
ATOM   2949   H  H    . GLU A 1 194 ? 46.854  17.594 58.599 1.00 0.00   ? 197 GLU A H    1  
ATOM   2950   H  HA   . GLU A 1 194 ? 46.516  15.049 57.160 1.00 0.00   ? 197 GLU A HA   1  
ATOM   2951   H  HB2  . GLU A 1 194 ? 47.294  15.757 59.994 1.00 0.00   ? 197 GLU A HB2  1  
ATOM   2952   H  HB3  . GLU A 1 194 ? 47.048  14.092 59.467 1.00 0.00   ? 197 GLU A HB3  1  
ATOM   2953   H  HG2  . GLU A 1 194 ? 48.847  14.181 57.942 1.00 0.00   ? 197 GLU A HG2  1  
ATOM   2954   H  HG3  . GLU A 1 194 ? 48.880  15.945 57.950 1.00 0.00   ? 197 GLU A HG3  1  
ATOM   2955   N  N    . ALA A 1 195 ? 44.387  15.998 59.516 1.00 15.25  ? 198 ALA A N    1  
ATOM   2956   C  CA   . ALA A 1 195 ? 43.017  15.718 60.002 1.00 14.83  ? 198 ALA A CA   1  
ATOM   2957   C  C    . ALA A 1 195 ? 42.158  16.960 59.830 1.00 14.00  ? 198 ALA A C    1  
ATOM   2958   O  O    . ALA A 1 195 ? 42.633  18.013 59.453 1.00 13.68  ? 198 ALA A O    1  
ATOM   2959   C  CB   . ALA A 1 195 ? 43.068  15.333 61.482 1.00 15.57  ? 198 ALA A CB   1  
ATOM   2960   H  H    . ALA A 1 195 ? 44.915  16.718 59.919 1.00 0.00   ? 198 ALA A H    1  
ATOM   2961   H  HA   . ALA A 1 195 ? 42.592  14.904 59.434 1.00 0.00   ? 198 ALA A HA   1  
ATOM   2962   H  HB1  . ALA A 1 195 ? 44.066  15.494 61.862 1.00 0.00   ? 198 ALA A HB1  1  
ATOM   2963   H  HB2  . ALA A 1 195 ? 42.805  14.292 61.593 1.00 0.00   ? 198 ALA A HB2  1  
ATOM   2964   H  HB3  . ALA A 1 195 ? 42.369  15.942 62.037 1.00 0.00   ? 198 ALA A HB3  1  
ATOM   2965   N  N    . PRO A 1 196 ? 40.900  16.829 60.108 1.00 13.61  ? 199 PRO A N    1  
ATOM   2966   C  CA   . PRO A 1 196 ? 39.923  17.956 59.991 1.00 13.22  ? 199 PRO A CA   1  
ATOM   2967   C  C    . PRO A 1 196 ? 40.135  19.071 61.037 1.00 12.39  ? 199 PRO A C    1  
ATOM   2968   O  O    . PRO A 1 196 ? 39.950  20.236 60.748 1.00 12.41  ? 199 PRO A O    1  
ATOM   2969   C  CB   . PRO A 1 196 ? 38.563  17.284 60.205 1.00 14.17  ? 199 PRO A CB   1  
ATOM   2970   C  CG   . PRO A 1 196 ? 38.849  16.030 60.963 1.00 16.80  ? 199 PRO A CG   1  
ATOM   2971   C  CD   . PRO A 1 196 ? 40.258  15.589 60.568 1.00 14.44  ? 199 PRO A CD   1  
ATOM   2972   H  HA   . PRO A 1 196 ? 39.958  18.372 58.998 1.00 0.00   ? 199 PRO A HA   1  
ATOM   2973   H  HB2  . PRO A 1 196 ? 37.915  17.931 60.780 1.00 0.00   ? 199 PRO A HB2  1  
ATOM   2974   H  HB3  . PRO A 1 196 ? 38.110  17.046 59.256 1.00 0.00   ? 199 PRO A HB3  1  
ATOM   2975   H  HG2  . PRO A 1 196 ? 38.802  16.222 62.026 1.00 0.00   ? 199 PRO A HG2  1  
ATOM   2976   H  HG3  . PRO A 1 196 ? 38.141  15.263 60.692 1.00 0.00   ? 199 PRO A HG3  1  
ATOM   2977   H  HD2  . PRO A 1 196 ? 40.781  15.183 61.424 1.00 0.00   ? 199 PRO A HD2  1  
ATOM   2978   H  HD3  . PRO A 1 196 ? 40.221  14.869 59.766 1.00 0.00   ? 199 PRO A HD3  1  
ATOM   2979   N  N    . GLY A 1 197 ? 40.502  18.732 62.250 1.00 12.02  ? 200 GLY A N    1  
ATOM   2980   C  CA   . GLY A 1 197 ? 40.696  19.786 63.293 1.00 11.82  ? 200 GLY A CA   1  
ATOM   2981   C  C    . GLY A 1 197 ? 41.986  20.582 63.041 1.00 11.41  ? 200 GLY A C    1  
ATOM   2982   O  O    . GLY A 1 197 ? 42.080  21.744 63.380 1.00 11.67  ? 200 GLY A O    1  
ATOM   2983   H  H    . GLY A 1 197 ? 40.635  17.788 62.476 1.00 0.00   ? 200 GLY A H    1  
ATOM   2984   H  HA2  . GLY A 1 197 ? 39.853  20.462 63.275 1.00 0.00   ? 200 GLY A HA2  1  
ATOM   2985   H  HA3  . GLY A 1 197 ? 40.754  19.318 64.264 1.00 0.00   ? 200 GLY A HA3  1  
ATOM   2986   N  N    . ASP A 1 198 ? 42.984  19.967 62.468 1.00 11.53  ? 201 ASP A N    1  
ATOM   2987   C  CA   . ASP A 1 198 ? 44.269  20.690 62.218 1.00 11.75  ? 201 ASP A CA   1  
ATOM   2988   C  C    . ASP A 1 198 ? 44.033  21.953 61.376 1.00 12.14  ? 201 ASP A C    1  
ATOM   2989   O  O    . ASP A 1 198 ? 44.802  22.892 61.430 1.00 12.97  ? 201 ASP A O    1  
ATOM   2990   C  CB   . ASP A 1 198 ? 45.232  19.762 61.474 1.00 11.71  ? 201 ASP A CB   1  
ATOM   2991   C  CG   . ASP A 1 198 ? 45.586  18.571 62.367 1.00 13.16  ? 201 ASP A CG   1  
ATOM   2992   O  OD1  . ASP A 1 198 ? 45.460  18.703 63.574 1.00 14.80  ? 201 ASP A OD1  1  
ATOM   2993   O  OD2  . ASP A 1 198 ? 45.977  17.548 61.830 1.00 17.35  ? 201 ASP A OD2  1  
ATOM   2994   H  H    . ASP A 1 198 ? 42.895  19.025 62.212 1.00 0.00   ? 201 ASP A H    1  
ATOM   2995   H  HA   . ASP A 1 198 ? 44.708  20.970 63.163 1.00 0.00   ? 201 ASP A HA   1  
ATOM   2996   H  HB2  . ASP A 1 198 ? 44.761  19.406 60.569 1.00 0.00   ? 201 ASP A HB2  1  
ATOM   2997   H  HB3  . ASP A 1 198 ? 46.132  20.302 61.225 1.00 0.00   ? 201 ASP A HB3  1  
ATOM   2998   N  N    . ALA A 1 199 ? 42.992  21.983 60.590 1.00 11.92  ? 202 ALA A N    1  
ATOM   2999   C  CA   . ALA A 1 199 ? 42.730  23.187 59.739 1.00 11.97  ? 202 ALA A CA   1  
ATOM   3000   C  C    . ALA A 1 199 ? 41.570  24.031 60.301 1.00 11.50  ? 202 ALA A C    1  
ATOM   3001   O  O    . ALA A 1 199 ? 40.963  24.805 59.588 1.00 11.43  ? 202 ALA A O    1  
ATOM   3002   C  CB   . ALA A 1 199 ? 42.378  22.731 58.321 1.00 12.61  ? 202 ALA A CB   1  
ATOM   3003   H  H    . ALA A 1 199 ? 42.387  21.213 60.549 1.00 0.00   ? 202 ALA A H    1  
ATOM   3004   H  HA   . ALA A 1 199 ? 43.622  23.794 59.701 1.00 0.00   ? 202 ALA A HA   1  
ATOM   3005   H  HB1  . ALA A 1 199 ? 42.122  21.682 58.334 1.00 0.00   ? 202 ALA A HB1  1  
ATOM   3006   H  HB2  . ALA A 1 199 ? 43.227  22.887 57.672 1.00 0.00   ? 202 ALA A HB2  1  
ATOM   3007   H  HB3  . ALA A 1 199 ? 41.537  23.303 57.958 1.00 0.00   ? 202 ALA A HB3  1  
ATOM   3008   N  N    . TYR A 1 200 ? 41.263  23.905 61.565 1.00 11.32  ? 203 TYR A N    1  
ATOM   3009   C  CA   . TYR A 1 200 ? 40.153  24.719 62.154 1.00 11.08  ? 203 TYR A CA   1  
ATOM   3010   C  C    . TYR A 1 200 ? 40.560  26.207 62.356 1.00 11.59  ? 203 TYR A C    1  
ATOM   3011   O  O    . TYR A 1 200 ? 39.811  27.099 62.009 1.00 11.16  ? 203 TYR A O    1  
ATOM   3012   C  CB   . TYR A 1 200 ? 39.764  24.123 63.508 1.00 11.12  ? 203 TYR A CB   1  
ATOM   3013   C  CG   . TYR A 1 200 ? 38.624  24.917 64.100 1.00 10.14  ? 203 TYR A CG   1  
ATOM   3014   C  CD1  . TYR A 1 200 ? 38.891  26.040 64.893 1.00 11.19  ? 203 TYR A CD1  1  
ATOM   3015   C  CD2  . TYR A 1 200 ? 37.301  24.531 63.855 1.00 11.29  ? 203 TYR A CD2  1  
ATOM   3016   C  CE1  . TYR A 1 200 ? 37.834  26.776 65.441 1.00 12.17  ? 203 TYR A CE1  1  
ATOM   3017   C  CE2  . TYR A 1 200 ? 36.244  25.267 64.404 1.00 11.86  ? 203 TYR A CE2  1  
ATOM   3018   C  CZ   . TYR A 1 200 ? 36.511  26.390 65.197 1.00 11.80  ? 203 TYR A CZ   1  
ATOM   3019   O  OH   . TYR A 1 200 ? 35.469  27.116 65.737 1.00 14.11  ? 203 TYR A OH   1  
ATOM   3020   H  H    . TYR A 1 200 ? 41.768  23.285 62.131 1.00 0.00   ? 203 TYR A H    1  
ATOM   3021   H  HA   . TYR A 1 200 ? 39.299  24.676 61.496 1.00 0.00   ? 203 TYR A HA   1  
ATOM   3022   H  HB2  . TYR A 1 200 ? 39.457  23.096 63.374 1.00 0.00   ? 203 TYR A HB2  1  
ATOM   3023   H  HB3  . TYR A 1 200 ? 40.612  24.161 64.176 1.00 0.00   ? 203 TYR A HB3  1  
ATOM   3024   H  HD1  . TYR A 1 200 ? 39.912  26.338 65.081 1.00 0.00   ? 203 TYR A HD1  1  
ATOM   3025   H  HD2  . TYR A 1 200 ? 37.096  23.665 63.244 1.00 0.00   ? 203 TYR A HD2  1  
ATOM   3026   H  HE1  . TYR A 1 200 ? 38.039  27.642 66.053 1.00 0.00   ? 203 TYR A HE1  1  
ATOM   3027   H  HE2  . TYR A 1 200 ? 35.223  24.969 64.215 1.00 0.00   ? 203 TYR A HE2  1  
ATOM   3028   H  HH   . TYR A 1 200 ? 34.769  26.502 65.970 1.00 0.00   ? 203 TYR A HH   1  
ATOM   3029   N  N    . GLU A 1 201 ? 41.706  26.493 62.946 1.00 11.77  ? 204 GLU A N    1  
ATOM   3030   C  CA   . GLU A 1 201 ? 42.087  27.916 63.190 1.00 12.86  ? 204 GLU A CA   1  
ATOM   3031   C  C    . GLU A 1 201 ? 42.353  28.634 61.870 1.00 11.74  ? 204 GLU A C    1  
ATOM   3032   O  O    . GLU A 1 201 ? 41.902  29.741 61.651 1.00 11.81  ? 204 GLU A O    1  
ATOM   3033   C  CB   . GLU A 1 201 ? 43.349  27.960 64.053 1.00 14.59  ? 204 GLU A CB   1  
ATOM   3034   C  CG   . GLU A 1 201 ? 43.576  29.388 64.554 1.00 21.42  ? 204 GLU A CG   1  
ATOM   3035   C  CD   . GLU A 1 201 ? 44.786  29.416 65.489 1.00 27.37  ? 204 GLU A CD   1  
ATOM   3036   O  OE1  . GLU A 1 201 ? 44.669  28.906 66.591 1.00 30.99  ? 204 GLU A OE1  1  
ATOM   3037   O  OE2  . GLU A 1 201 ? 45.809  29.946 65.087 1.00 33.11  ? 204 GLU A OE2  1  
ATOM   3038   H  H    . GLU A 1 201 ? 42.292  25.770 63.253 1.00 0.00   ? 204 GLU A H    1  
ATOM   3039   H  HA   . GLU A 1 201 ? 41.284  28.415 63.711 1.00 0.00   ? 204 GLU A HA   1  
ATOM   3040   H  HB2  . GLU A 1 201 ? 43.231  27.296 64.897 1.00 0.00   ? 204 GLU A HB2  1  
ATOM   3041   H  HB3  . GLU A 1 201 ? 44.199  27.648 63.465 1.00 0.00   ? 204 GLU A HB3  1  
ATOM   3042   H  HG2  . GLU A 1 201 ? 43.756  30.040 63.711 1.00 0.00   ? 204 GLU A HG2  1  
ATOM   3043   H  HG3  . GLU A 1 201 ? 42.701  29.725 65.090 1.00 0.00   ? 204 GLU A HG3  1  
ATOM   3044   N  N    . ASP A 1 202 ? 43.096  28.024 61.000 1.00 11.38  ? 205 ASP A N    1  
ATOM   3045   C  CA   . ASP A 1 202 ? 43.414  28.679 59.697 1.00 10.60  ? 205 ASP A CA   1  
ATOM   3046   C  C    . ASP A 1 202 ? 42.140  28.869 58.869 1.00 10.33  ? 205 ASP A C    1  
ATOM   3047   O  O    . ASP A 1 202 ? 42.001  29.832 58.142 1.00 10.37  ? 205 ASP A O    1  
ATOM   3048   C  CB   . ASP A 1 202 ? 44.397  27.803 58.917 1.00 10.96  ? 205 ASP A CB   1  
ATOM   3049   C  CG   . ASP A 1 202 ? 45.771  27.854 59.589 1.00 12.81  ? 205 ASP A CG   1  
ATOM   3050   O  OD1  . ASP A 1 202 ? 45.962  28.710 60.437 1.00 13.98  ? 205 ASP A OD1  1  
ATOM   3051   O  OD2  . ASP A 1 202 ? 46.608  27.037 59.244 1.00 14.05  ? 205 ASP A OD2  1  
ATOM   3052   H  H    . ASP A 1 202 ? 43.461  27.138 61.204 1.00 0.00   ? 205 ASP A H    1  
ATOM   3053   H  HA   . ASP A 1 202 ? 43.866  29.642 59.882 1.00 0.00   ? 205 ASP A HA   1  
ATOM   3054   H  HB2  . ASP A 1 202 ? 44.039  26.784 58.905 1.00 0.00   ? 205 ASP A HB2  1  
ATOM   3055   H  HB3  . ASP A 1 202 ? 44.480  28.168 57.905 1.00 0.00   ? 205 ASP A HB3  1  
ATOM   3056   N  N    . THR A 1 203 ? 41.214  27.957 58.962 1.00 10.16  ? 206 THR A N    1  
ATOM   3057   C  CA   . THR A 1 203 ? 39.960  28.086 58.168 1.00 10.18  ? 206 THR A CA   1  
ATOM   3058   C  C    . THR A 1 203 ? 39.118  29.223 58.737 1.00 9.77   ? 206 THR A C    1  
ATOM   3059   O  O    . THR A 1 203 ? 38.598  30.049 58.014 1.00 10.01  ? 206 THR A O    1  
ATOM   3060   C  CB   . THR A 1 203 ? 39.170  26.777 58.246 1.00 10.24  ? 206 THR A CB   1  
ATOM   3061   O  OG1  . THR A 1 203 ? 39.979  25.709 57.772 1.00 11.17  ? 206 THR A OG1  1  
ATOM   3062   C  CG2  . THR A 1 203 ? 37.911  26.887 57.384 1.00 10.47  ? 206 THR A CG2  1  
ATOM   3063   H  H    . THR A 1 203 ? 41.346  27.182 59.547 1.00 0.00   ? 206 THR A H    1  
ATOM   3064   H  HA   . THR A 1 203 ? 40.205  28.298 57.138 1.00 0.00   ? 206 THR A HA   1  
ATOM   3065   H  HB   . THR A 1 203 ? 38.885  26.587 59.269 1.00 0.00   ? 206 THR A HB   1  
ATOM   3066   H  HG1  . THR A 1 203 ? 40.731  26.088 57.313 1.00 0.00   ? 206 THR A HG1  1  
ATOM   3067   H  HG21 . THR A 1 203 ? 37.178  26.169 57.724 1.00 0.00   ? 206 THR A HG21 1  
ATOM   3068   H  HG22 . THR A 1 203 ? 38.161  26.685 56.353 1.00 0.00   ? 206 THR A HG22 1  
ATOM   3069   H  HG23 . THR A 1 203 ? 37.504  27.884 57.467 1.00 0.00   ? 206 THR A HG23 1  
ATOM   3070   N  N    . VAL A 1 204 ? 38.983  29.273 60.030 1.00 10.09  ? 207 VAL A N    1  
ATOM   3071   C  CA   . VAL A 1 204 ? 38.177  30.359 60.653 1.00 10.38  ? 207 VAL A CA   1  
ATOM   3072   C  C    . VAL A 1 204 ? 38.708  31.707 60.173 1.00 10.34  ? 207 VAL A C    1  
ATOM   3073   O  O    . VAL A 1 204 ? 37.956  32.592 59.816 1.00 10.19  ? 207 VAL A O    1  
ATOM   3074   C  CB   . VAL A 1 204 ? 38.294  30.274 62.176 1.00 11.67  ? 207 VAL A CB   1  
ATOM   3075   C  CG1  . VAL A 1 204 ? 37.685  31.528 62.805 1.00 14.24  ? 207 VAL A CG1  1  
ATOM   3076   C  CG2  . VAL A 1 204 ? 37.544  29.038 62.676 1.00 12.43  ? 207 VAL A CG2  1  
ATOM   3077   H  H    . VAL A 1 204 ? 39.414  28.597 60.594 1.00 0.00   ? 207 VAL A H    1  
ATOM   3078   H  HA   . VAL A 1 204 ? 37.142  30.253 60.362 1.00 0.00   ? 207 VAL A HA   1  
ATOM   3079   H  HB   . VAL A 1 204 ? 39.336  30.203 62.453 1.00 0.00   ? 207 VAL A HB   1  
ATOM   3080   H  HG11 . VAL A 1 204 ? 38.461  32.103 63.287 1.00 0.00   ? 207 VAL A HG11 1  
ATOM   3081   H  HG12 . VAL A 1 204 ? 36.944  31.240 63.537 1.00 0.00   ? 207 VAL A HG12 1  
ATOM   3082   H  HG13 . VAL A 1 204 ? 37.218  32.126 62.037 1.00 0.00   ? 207 VAL A HG13 1  
ATOM   3083   H  HG21 . VAL A 1 204 ? 36.984  29.291 63.564 1.00 0.00   ? 207 VAL A HG21 1  
ATOM   3084   H  HG22 . VAL A 1 204 ? 38.252  28.256 62.907 1.00 0.00   ? 207 VAL A HG22 1  
ATOM   3085   H  HG23 . VAL A 1 204 ? 36.866  28.693 61.909 1.00 0.00   ? 207 VAL A HG23 1  
ATOM   3086   N  N    . LYS A 1 205 ? 40.002  31.868 60.155 1.00 10.37  ? 208 LYS A N    1  
ATOM   3087   C  CA   . LYS A 1 205 ? 40.584  33.157 59.689 1.00 11.18  ? 208 LYS A CA   1  
ATOM   3088   C  C    . LYS A 1 205 ? 40.053  33.472 58.289 1.00 10.34  ? 208 LYS A C    1  
ATOM   3089   O  O    . LYS A 1 205 ? 39.630  34.576 58.008 1.00 11.15  ? 208 LYS A O    1  
ATOM   3090   C  CB   . LYS A 1 205 ? 42.109  33.043 59.643 1.00 12.50  ? 208 LYS A CB   1  
ATOM   3091   C  CG   . LYS A 1 205 ? 42.712  34.396 59.259 1.00 17.79  ? 208 LYS A CG   1  
ATOM   3092   C  CD   . LYS A 1 205 ? 44.209  34.396 59.575 1.00 22.64  ? 208 LYS A CD   1  
ATOM   3093   C  CE   . LYS A 1 205 ? 44.804  35.761 59.225 1.00 25.06  ? 208 LYS A CE   1  
ATOM   3094   N  NZ   . LYS A 1 205 ? 46.292  35.672 59.234 1.00 29.62  ? 208 LYS A NZ   1  
ATOM   3095   H  H    . LYS A 1 205 ? 40.591  31.139 60.442 1.00 0.00   ? 208 LYS A H    1  
ATOM   3096   H  HA   . LYS A 1 205 ? 40.301  33.948 60.368 1.00 0.00   ? 208 LYS A HA   1  
ATOM   3097   H  HB2  . LYS A 1 205 ? 42.477  32.747 60.615 1.00 0.00   ? 208 LYS A HB2  1  
ATOM   3098   H  HB3  . LYS A 1 205 ? 42.393  32.303 58.910 1.00 0.00   ? 208 LYS A HB3  1  
ATOM   3099   H  HG2  . LYS A 1 205 ? 42.566  34.567 58.202 1.00 0.00   ? 208 LYS A HG2  1  
ATOM   3100   H  HG3  . LYS A 1 205 ? 42.227  35.179 59.822 1.00 0.00   ? 208 LYS A HG3  1  
ATOM   3101   H  HD2  . LYS A 1 205 ? 44.354  34.198 60.627 1.00 0.00   ? 208 LYS A HD2  1  
ATOM   3102   H  HD3  . LYS A 1 205 ? 44.700  33.632 58.992 1.00 0.00   ? 208 LYS A HD3  1  
ATOM   3103   H  HE2  . LYS A 1 205 ? 44.467  36.060 58.243 1.00 0.00   ? 208 LYS A HE2  1  
ATOM   3104   H  HE3  . LYS A 1 205 ? 44.483  36.491 59.953 1.00 0.00   ? 208 LYS A HE3  1  
ATOM   3105   H  HZ1  . LYS A 1 205 ? 46.633  35.660 60.216 1.00 0.00   ? 208 LYS A HZ1  1  
ATOM   3106   H  HZ2  . LYS A 1 205 ? 46.692  36.494 58.740 1.00 0.00   ? 208 LYS A HZ2  1  
ATOM   3107   H  HZ3  . LYS A 1 205 ? 46.589  34.798 58.752 1.00 0.00   ? 208 LYS A HZ3  1  
ATOM   3108   N  N    . VAL A 1 206 ? 40.067  32.508 57.407 1.00 9.28   ? 209 VAL A N    1  
ATOM   3109   C  CA   . VAL A 1 206 ? 39.557  32.753 56.027 1.00 9.04   ? 209 VAL A CA   1  
ATOM   3110   C  C    . VAL A 1 206 ? 38.047  33.029 56.063 1.00 9.02   ? 209 VAL A C    1  
ATOM   3111   O  O    . VAL A 1 206 ? 37.551  33.890 55.364 1.00 9.27   ? 209 VAL A O    1  
ATOM   3112   C  CB   . VAL A 1 206 ? 39.827  31.521 55.161 1.00 8.98   ? 209 VAL A CB   1  
ATOM   3113   C  CG1  . VAL A 1 206 ? 39.466  31.829 53.707 1.00 10.05  ? 209 VAL A CG1  1  
ATOM   3114   C  CG2  . VAL A 1 206 ? 41.309  31.151 55.251 1.00 9.38   ? 209 VAL A CG2  1  
ATOM   3115   H  H    . VAL A 1 206 ? 40.409  31.623 57.654 1.00 0.00   ? 209 VAL A H    1  
ATOM   3116   H  HA   . VAL A 1 206 ? 40.067  33.605 55.603 1.00 0.00   ? 209 VAL A HA   1  
ATOM   3117   H  HB   . VAL A 1 206 ? 39.226  30.695 55.514 1.00 0.00   ? 209 VAL A HB   1  
ATOM   3118   H  HG11 . VAL A 1 206 ? 39.815  32.819 53.452 1.00 0.00   ? 209 VAL A HG11 1  
ATOM   3119   H  HG12 . VAL A 1 206 ? 38.394  31.781 53.584 1.00 0.00   ? 209 VAL A HG12 1  
ATOM   3120   H  HG13 . VAL A 1 206 ? 39.935  31.104 53.058 1.00 0.00   ? 209 VAL A HG13 1  
ATOM   3121   H  HG21 . VAL A 1 206 ? 41.513  30.711 56.216 1.00 0.00   ? 209 VAL A HG21 1  
ATOM   3122   H  HG22 . VAL A 1 206 ? 41.910  32.039 55.126 1.00 0.00   ? 209 VAL A HG22 1  
ATOM   3123   H  HG23 . VAL A 1 206 ? 41.550  30.441 54.473 1.00 0.00   ? 209 VAL A HG23 1  
ATOM   3124   N  N    . MET A 1 207 ? 37.308  32.302 56.862 1.00 9.13   ? 210 MET A N    1  
ATOM   3125   C  CA   . MET A 1 207 ? 35.832  32.526 56.925 1.00 8.97   ? 210 MET A CA   1  
ATOM   3126   C  C    . MET A 1 207 ? 35.516  33.949 57.412 1.00 9.21   ? 210 MET A C    1  
ATOM   3127   O  O    . MET A 1 207 ? 34.561  34.561 56.977 1.00 9.43   ? 210 MET A O    1  
ATOM   3128   C  CB   . MET A 1 207 ? 35.209  31.513 57.888 1.00 10.22  ? 210 MET A CB   1  
ATOM   3129   C  CG   . MET A 1 207 ? 35.297  30.111 57.283 1.00 10.25  ? 210 MET A CG   1  
ATOM   3130   S  SD   . MET A 1 207 ? 35.307  28.881 58.611 1.00 12.55  ? 210 MET A SD   1  
ATOM   3131   C  CE   . MET A 1 207 ? 33.709  29.317 59.337 1.00 12.34  ? 210 MET A CE   1  
ATOM   3132   H  H    . MET A 1 207 ? 37.722  31.606 57.414 1.00 0.00   ? 210 MET A H    1  
ATOM   3133   H  HA   . MET A 1 207 ? 35.409  32.385 55.941 1.00 0.00   ? 210 MET A HA   1  
ATOM   3134   H  HB2  . MET A 1 207 ? 35.743  31.535 58.827 1.00 0.00   ? 210 MET A HB2  1  
ATOM   3135   H  HB3  . MET A 1 207 ? 34.173  31.766 58.057 1.00 0.00   ? 210 MET A HB3  1  
ATOM   3136   H  HG2  . MET A 1 207 ? 34.444  29.942 56.642 1.00 0.00   ? 210 MET A HG2  1  
ATOM   3137   H  HG3  . MET A 1 207 ? 36.205  30.025 56.705 1.00 0.00   ? 210 MET A HG3  1  
ATOM   3138   H  HE1  . MET A 1 207 ? 32.972  29.415 58.552 1.00 0.00   ? 210 MET A HE1  1  
ATOM   3139   H  HE2  . MET A 1 207 ? 33.800  30.254 59.871 1.00 0.00   ? 210 MET A HE2  1  
ATOM   3140   H  HE3  . MET A 1 207 ? 33.400  28.545 60.022 1.00 0.00   ? 210 MET A HE3  1  
ATOM   3141   N  N    . ARG A 1 208 ? 36.294  34.476 58.320 1.00 9.81   ? 211 ARG A N    1  
ATOM   3142   C  CA   . ARG A 1 208 ? 36.019  35.846 58.839 1.00 10.39  ? 211 ARG A CA   1  
ATOM   3143   C  C    . ARG A 1 208 ? 36.072  36.846 57.690 1.00 10.10  ? 211 ARG A C    1  
ATOM   3144   O  O    . ARG A 1 208 ? 35.305  37.787 57.633 1.00 11.60  ? 211 ARG A O    1  
ATOM   3145   C  CB   . ARG A 1 208 ? 37.071  36.216 59.886 1.00 11.31  ? 211 ARG A CB   1  
ATOM   3146   C  CG   . ARG A 1 208 ? 36.675  35.623 61.240 1.00 12.73  ? 211 ARG A CG   1  
ATOM   3147   C  CD   . ARG A 1 208 ? 37.799  35.861 62.250 1.00 17.25  ? 211 ARG A CD   1  
ATOM   3148   N  NE   . ARG A 1 208 ? 37.545  37.132 62.986 1.00 18.72  ? 211 ARG A NE   1  
ATOM   3149   C  CZ   . ARG A 1 208 ? 36.629  37.176 63.914 1.00 19.42  ? 211 ARG A CZ   1  
ATOM   3150   N  NH1  . ARG A 1 208 ? 35.935  36.108 64.198 1.00 18.62  ? 211 ARG A NH1  1  
ATOM   3151   N  NH2  . ARG A 1 208 ? 36.407  38.289 64.558 1.00 22.39  ? 211 ARG A NH2  1  
ATOM   3152   H  H    . ARG A 1 208 ? 37.053  33.964 58.670 1.00 0.00   ? 211 ARG A H    1  
ATOM   3153   H  HA   . ARG A 1 208 ? 35.038  35.869 59.291 1.00 0.00   ? 211 ARG A HA   1  
ATOM   3154   H  HB2  . ARG A 1 208 ? 38.031  35.821 59.586 1.00 0.00   ? 211 ARG A HB2  1  
ATOM   3155   H  HB3  . ARG A 1 208 ? 37.134  37.290 59.970 1.00 0.00   ? 211 ARG A HB3  1  
ATOM   3156   H  HG2  . ARG A 1 208 ? 35.770  36.098 61.589 1.00 0.00   ? 211 ARG A HG2  1  
ATOM   3157   H  HG3  . ARG A 1 208 ? 36.508  34.562 61.134 1.00 0.00   ? 211 ARG A HG3  1  
ATOM   3158   H  HD2  . ARG A 1 208 ? 37.833  35.040 62.951 1.00 0.00   ? 211 ARG A HD2  1  
ATOM   3159   H  HD3  . ARG A 1 208 ? 38.743  35.929 61.729 1.00 0.00   ? 211 ARG A HD3  1  
ATOM   3160   H  HE   . ARG A 1 208 ? 38.067  37.934 62.773 1.00 0.00   ? 211 ARG A HE   1  
ATOM   3161   H  HH11 . ARG A 1 208 ? 36.106  35.256 63.704 1.00 0.00   ? 211 ARG A HH11 1  
ATOM   3162   H  HH12 . ARG A 1 208 ? 35.233  36.143 64.909 1.00 0.00   ? 211 ARG A HH12 1  
ATOM   3163   H  HH21 . ARG A 1 208 ? 36.938  39.108 64.341 1.00 0.00   ? 211 ARG A HH21 1  
ATOM   3164   H  HH22 . ARG A 1 208 ? 35.704  38.324 65.269 1.00 0.00   ? 211 ARG A HH22 1  
ATOM   3165   N  N    . THR A 1 209 ? 36.973  36.651 56.773 1.00 9.92   ? 212 THR A N    1  
ATOM   3166   C  CA   . THR A 1 209 ? 37.081  37.594 55.618 1.00 9.66   ? 212 THR A CA   1  
ATOM   3167   C  C    . THR A 1 209 ? 35.765  37.640 54.815 1.00 9.32   ? 212 THR A C    1  
ATOM   3168   O  O    . THR A 1 209 ? 35.574  38.508 53.986 1.00 9.49   ? 212 THR A O    1  
ATOM   3169   C  CB   . THR A 1 209 ? 38.215  37.136 54.698 1.00 10.31  ? 212 THR A CB   1  
ATOM   3170   O  OG1  . THR A 1 209 ? 37.833  35.934 54.043 1.00 11.32  ? 212 THR A OG1  1  
ATOM   3171   C  CG2  . THR A 1 209 ? 39.477  36.890 55.525 1.00 11.74  ? 212 THR A CG2  1  
ATOM   3172   H  H    . THR A 1 209 ? 37.582  35.886 56.839 1.00 0.00   ? 212 THR A H    1  
ATOM   3173   H  HA   . THR A 1 209 ? 37.305  38.584 55.988 1.00 0.00   ? 212 THR A HA   1  
ATOM   3174   H  HB   . THR A 1 209 ? 38.415  37.900 53.963 1.00 0.00   ? 212 THR A HB   1  
ATOM   3175   H  HG1  . THR A 1 209 ? 38.608  35.370 53.983 1.00 0.00   ? 212 THR A HG1  1  
ATOM   3176   H  HG21 . THR A 1 209 ? 40.230  37.617 55.259 1.00 0.00   ? 212 THR A HG21 1  
ATOM   3177   H  HG22 . THR A 1 209 ? 39.851  35.896 55.325 1.00 0.00   ? 212 THR A HG22 1  
ATOM   3178   H  HG23 . THR A 1 209 ? 39.243  36.981 56.576 1.00 0.00   ? 212 THR A HG23 1  
ATOM   3179   N  N    . LEU A 1 210 ? 34.859  36.720 55.040 1.00 8.58   ? 213 LEU A N    1  
ATOM   3180   C  CA   . LEU A 1 210 ? 33.582  36.732 54.275 1.00 8.64   ? 213 LEU A CA   1  
ATOM   3181   C  C    . LEU A 1 210 ? 33.882  36.624 52.776 1.00 9.32   ? 213 LEU A C    1  
ATOM   3182   O  O    . LEU A 1 210 ? 33.117  37.077 51.947 1.00 10.90  ? 213 LEU A O    1  
ATOM   3183   C  CB   . LEU A 1 210 ? 32.834  38.038 54.552 1.00 8.75   ? 213 LEU A CB   1  
ATOM   3184   C  CG   . LEU A 1 210 ? 32.492  38.126 56.040 1.00 9.18   ? 213 LEU A CG   1  
ATOM   3185   C  CD1  . LEU A 1 210 ? 31.557  39.312 56.281 1.00 10.17  ? 213 LEU A CD1  1  
ATOM   3186   C  CD2  . LEU A 1 210 ? 31.799  36.834 56.479 1.00 10.64  ? 213 LEU A CD2  1  
ATOM   3187   H  H    . LEU A 1 210 ? 35.025  36.021 55.707 1.00 0.00   ? 213 LEU A H    1  
ATOM   3188   H  HA   . LEU A 1 210 ? 32.971  35.896 54.581 1.00 0.00   ? 213 LEU A HA   1  
ATOM   3189   H  HB2  . LEU A 1 210 ? 33.458  38.876 54.275 1.00 0.00   ? 213 LEU A HB2  1  
ATOM   3190   H  HB3  . LEU A 1 210 ? 31.923  38.062 53.973 1.00 0.00   ? 213 LEU A HB3  1  
ATOM   3191   H  HG   . LEU A 1 210 ? 33.400  38.262 56.610 1.00 0.00   ? 213 LEU A HG   1  
ATOM   3192   H  HD11 . LEU A 1 210 ? 32.111  40.233 56.180 1.00 0.00   ? 213 LEU A HD11 1  
ATOM   3193   H  HD12 . LEU A 1 210 ? 31.143  39.248 57.276 1.00 0.00   ? 213 LEU A HD12 1  
ATOM   3194   H  HD13 . LEU A 1 210 ? 30.756  39.292 55.556 1.00 0.00   ? 213 LEU A HD13 1  
ATOM   3195   H  HD21 . LEU A 1 210 ? 31.569  36.889 57.533 1.00 0.00   ? 213 LEU A HD21 1  
ATOM   3196   H  HD22 . LEU A 1 210 ? 32.453  35.994 56.296 1.00 0.00   ? 213 LEU A HD22 1  
ATOM   3197   H  HD23 . LEU A 1 210 ? 30.885  36.707 55.917 1.00 0.00   ? 213 LEU A HD23 1  
ATOM   3198   N  N    . THR A 1 211 ? 34.989  36.027 52.418 1.00 9.58   ? 214 THR A N    1  
ATOM   3199   C  CA   . THR A 1 211 ? 35.328  35.895 50.974 1.00 9.76   ? 214 THR A CA   1  
ATOM   3200   C  C    . THR A 1 211 ? 35.727  34.450 50.695 1.00 9.34   ? 214 THR A C    1  
ATOM   3201   O  O    . THR A 1 211 ? 36.813  34.023 51.033 1.00 10.06  ? 214 THR A O    1  
ATOM   3202   C  CB   . THR A 1 211 ? 36.494  36.825 50.633 1.00 10.36  ? 214 THR A CB   1  
ATOM   3203   O  OG1  . THR A 1 211 ? 36.156  38.157 50.994 1.00 13.71  ? 214 THR A OG1  1  
ATOM   3204   C  CG2  . THR A 1 211 ? 36.781  36.758 49.132 1.00 13.05  ? 214 THR A CG2  1  
ATOM   3205   H  H    . THR A 1 211 ? 35.595  35.667 53.099 1.00 0.00   ? 214 THR A H    1  
ATOM   3206   H  HA   . THR A 1 211 ? 34.468  36.155 50.375 1.00 0.00   ? 214 THR A HA   1  
ATOM   3207   H  HB   . THR A 1 211 ? 37.373  36.516 51.178 1.00 0.00   ? 214 THR A HB   1  
ATOM   3208   H  HG1  . THR A 1 211 ? 35.274  38.147 51.373 1.00 0.00   ? 214 THR A HG1  1  
ATOM   3209   H  HG21 . THR A 1 211 ? 37.481  35.959 48.935 1.00 0.00   ? 214 THR A HG21 1  
ATOM   3210   H  HG22 . THR A 1 211 ? 37.205  37.696 48.805 1.00 0.00   ? 214 THR A HG22 1  
ATOM   3211   H  HG23 . THR A 1 211 ? 35.862  36.571 48.598 1.00 0.00   ? 214 THR A HG23 1  
ATOM   3212   N  N    . PRO A 1 212 ? 34.849  33.697 50.095 1.00 8.99   ? 215 PRO A N    1  
ATOM   3213   C  CA   . PRO A 1 212 ? 35.116  32.254 49.781 1.00 9.07   ? 215 PRO A CA   1  
ATOM   3214   C  C    . PRO A 1 212 ? 36.177  32.049 48.680 1.00 8.68   ? 215 PRO A C    1  
ATOM   3215   O  O    . PRO A 1 212 ? 36.100  32.638 47.620 1.00 9.37   ? 215 PRO A O    1  
ATOM   3216   C  CB   . PRO A 1 212 ? 33.757  31.730 49.310 1.00 9.40   ? 215 PRO A CB   1  
ATOM   3217   C  CG   . PRO A 1 212 ? 33.002  32.931 48.840 1.00 11.62  ? 215 PRO A CG   1  
ATOM   3218   C  CD   . PRO A 1 212 ? 33.516  34.123 49.650 1.00 9.01   ? 215 PRO A CD   1  
ATOM   3219   H  HA   . PRO A 1 212 ? 35.408  31.729 50.676 1.00 0.00   ? 215 PRO A HA   1  
ATOM   3220   H  HB2  . PRO A 1 212 ? 33.890  31.027 48.499 1.00 0.00   ? 215 PRO A HB2  1  
ATOM   3221   H  HB3  . PRO A 1 212 ? 33.233  31.263 50.129 1.00 0.00   ? 215 PRO A HB3  1  
ATOM   3222   H  HG2  . PRO A 1 212 ? 33.183  33.090 47.785 1.00 0.00   ? 215 PRO A HG2  1  
ATOM   3223   H  HG3  . PRO A 1 212 ? 31.947  32.799 49.020 1.00 0.00   ? 215 PRO A HG3  1  
ATOM   3224   H  HD2  . PRO A 1 212 ? 33.584  35.003 49.025 1.00 0.00   ? 215 PRO A HD2  1  
ATOM   3225   H  HD3  . PRO A 1 212 ? 32.879  34.307 50.501 1.00 0.00   ? 215 PRO A HD3  1  
ATOM   3226   N  N    . THR A 1 213 ? 37.157  31.198 48.915 1.00 7.95   ? 216 THR A N    1  
ATOM   3227   C  CA   . THR A 1 213 ? 38.190  30.949 47.871 1.00 8.51   ? 216 THR A CA   1  
ATOM   3228   C  C    . THR A 1 213 ? 37.564  30.177 46.697 1.00 8.43   ? 216 THR A C    1  
ATOM   3229   O  O    . THR A 1 213 ? 38.039  30.247 45.581 1.00 9.47   ? 216 THR A O    1  
ATOM   3230   C  CB   . THR A 1 213 ? 39.331  30.125 48.471 1.00 8.56   ? 216 THR A CB   1  
ATOM   3231   O  OG1  . THR A 1 213 ? 38.813  28.908 48.989 1.00 9.17   ? 216 THR A OG1  1  
ATOM   3232   C  CG2  . THR A 1 213 ? 39.999  30.917 49.596 1.00 9.85   ? 216 THR A CG2  1  
ATOM   3233   H  H    . THR A 1 213 ? 37.196  30.718 49.768 1.00 0.00   ? 216 THR A H    1  
ATOM   3234   H  HA   . THR A 1 213 ? 38.576  31.893 47.516 1.00 0.00   ? 216 THR A HA   1  
ATOM   3235   H  HB   . THR A 1 213 ? 40.061  29.909 47.706 1.00 0.00   ? 216 THR A HB   1  
ATOM   3236   H  HG1  . THR A 1 213 ? 39.536  28.279 49.050 1.00 0.00   ? 216 THR A HG1  1  
ATOM   3237   H  HG21 . THR A 1 213 ? 39.449  31.830 49.769 1.00 0.00   ? 216 THR A HG21 1  
ATOM   3238   H  HG22 . THR A 1 213 ? 41.014  31.157 49.314 1.00 0.00   ? 216 THR A HG22 1  
ATOM   3239   H  HG23 . THR A 1 213 ? 40.006  30.325 50.499 1.00 0.00   ? 216 THR A HG23 1  
ATOM   3240   N  N    . HIS A 1 214 ? 36.504  29.440 46.934 1.00 8.53   ? 217 HIS A N    1  
ATOM   3241   C  CA   . HIS A 1 214 ? 35.869  28.675 45.824 1.00 8.53   ? 217 HIS A CA   1  
ATOM   3242   C  C    . HIS A 1 214 ? 34.368  28.520 46.087 1.00 8.02   ? 217 HIS A C    1  
ATOM   3243   O  O    . HIS A 1 214 ? 33.950  28.155 47.168 1.00 8.79   ? 217 HIS A O    1  
ATOM   3244   C  CB   . HIS A 1 214 ? 36.514  27.290 45.727 1.00 8.11   ? 217 HIS A CB   1  
ATOM   3245   C  CG   . HIS A 1 214 ? 38.010  27.436 45.674 1.00 9.37   ? 217 HIS A CG   1  
ATOM   3246   N  ND1  . HIS A 1 214 ? 38.737  27.989 46.719 1.00 10.23  ? 217 HIS A ND1  1  
ATOM   3247   C  CD2  . HIS A 1 214 ? 38.930  27.106 44.710 1.00 11.55  ? 217 HIS A CD2  1  
ATOM   3248   C  CE1  . HIS A 1 214 ? 40.035  27.976 46.362 1.00 10.22  ? 217 HIS A CE1  1  
ATOM   3249   N  NE2  . HIS A 1 214 ? 40.204  27.448 45.149 1.00 11.26  ? 217 HIS A NE2  1  
ATOM   3250   H  H    . HIS A 1 214 ? 36.132  29.392 47.839 1.00 0.00   ? 217 HIS A H    1  
ATOM   3251   H  HA   . HIS A 1 214 ? 36.017  29.204 44.894 1.00 0.00   ? 217 HIS A HA   1  
ATOM   3252   H  HB2  . HIS A 1 214 ? 36.239  26.705 46.592 1.00 0.00   ? 217 HIS A HB2  1  
ATOM   3253   H  HB3  . HIS A 1 214 ? 36.169  26.794 44.832 1.00 0.00   ? 217 HIS A HB3  1  
ATOM   3254   H  HD1  . HIS A 1 214 ? 38.372  28.328 47.563 1.00 0.00   ? 217 HIS A HD1  1  
ATOM   3255   H  HD2  . HIS A 1 214 ? 38.700  26.651 43.758 1.00 0.00   ? 217 HIS A HD2  1  
ATOM   3256   H  HE1  . HIS A 1 214 ? 40.839  28.346 46.981 1.00 0.00   ? 217 HIS A HE1  1  
ATOM   3257   H  HE2  . HIS A 1 214 ? 41.049  27.327 44.667 1.00 0.00   ? 217 HIS A HE2  1  
ATOM   3258   N  N    . VAL A 1 215 ? 33.557  28.788 45.100 1.00 8.35   ? 218 VAL A N    1  
ATOM   3259   C  CA   . VAL A 1 215 ? 32.091  28.653 45.274 1.00 8.23   ? 218 VAL A CA   1  
ATOM   3260   C  C    . VAL A 1 215 ? 31.664  27.705 44.195 1.00 8.16   ? 218 VAL A C    1  
ATOM   3261   O  O    . VAL A 1 215 ? 31.873  27.968 43.027 1.00 8.84   ? 218 VAL A O    1  
ATOM   3262   C  CB   . VAL A 1 215 ? 31.408  30.010 45.090 1.00 8.00   ? 218 VAL A CB   1  
ATOM   3263   C  CG1  . VAL A 1 215 ? 29.897  29.849 45.265 1.00 9.11   ? 218 VAL A CG1  1  
ATOM   3264   C  CG2  . VAL A 1 215 ? 31.939  30.993 46.136 1.00 9.04   ? 218 VAL A CG2  1  
ATOM   3265   H  H    . VAL A 1 215 ? 33.920  29.075 44.236 1.00 0.00   ? 218 VAL A H    1  
ATOM   3266   H  HA   . VAL A 1 215 ? 31.865  28.241 46.248 1.00 0.00   ? 218 VAL A HA   1  
ATOM   3267   H  HB   . VAL A 1 215 ? 31.617  30.386 44.099 1.00 0.00   ? 218 VAL A HB   1  
ATOM   3268   H  HG11 . VAL A 1 215 ? 29.695  28.981 45.875 1.00 0.00   ? 218 VAL A HG11 1  
ATOM   3269   H  HG12 . VAL A 1 215 ? 29.434  29.723 44.297 1.00 0.00   ? 218 VAL A HG12 1  
ATOM   3270   H  HG13 . VAL A 1 215 ? 29.494  30.728 45.745 1.00 0.00   ? 218 VAL A HG13 1  
ATOM   3271   H  HG21 . VAL A 1 215 ? 32.457  31.801 45.640 1.00 0.00   ? 218 VAL A HG21 1  
ATOM   3272   H  HG22 . VAL A 1 215 ? 32.621  30.481 46.798 1.00 0.00   ? 218 VAL A HG22 1  
ATOM   3273   H  HG23 . VAL A 1 215 ? 31.113  31.392 46.707 1.00 0.00   ? 218 VAL A HG23 1  
ATOM   3274   N  N    . VAL A 1 216 ? 31.157  26.567 44.527 1.00 7.96   ? 219 VAL A N    1  
ATOM   3275   C  CA   . VAL A 1 216 ? 30.862  25.644 43.409 1.00 8.39   ? 219 VAL A CA   1  
ATOM   3276   C  C    . VAL A 1 216 ? 29.575  24.895 43.607 1.00 8.64   ? 219 VAL A C    1  
ATOM   3277   O  O    . VAL A 1 216 ? 28.858  25.071 44.572 1.00 8.95   ? 219 VAL A O    1  
ATOM   3278   C  CB   . VAL A 1 216 ? 32.007  24.640 43.277 1.00 8.67   ? 219 VAL A CB   1  
ATOM   3279   C  CG1  . VAL A 1 216 ? 33.337  25.390 43.187 1.00 9.73   ? 219 VAL A CG1  1  
ATOM   3280   C  CG2  . VAL A 1 216 ? 32.023  23.723 44.503 1.00 9.58   ? 219 VAL A CG2  1  
ATOM   3281   H  H    . VAL A 1 216 ? 31.044  26.302 45.464 1.00 0.00   ? 219 VAL A H    1  
ATOM   3282   H  HA   . VAL A 1 216 ? 30.799  26.212 42.494 1.00 0.00   ? 219 VAL A HA   1  
ATOM   3283   H  HB   . VAL A 1 216 ? 31.867  24.048 42.384 1.00 0.00   ? 219 VAL A HB   1  
ATOM   3284   H  HG11 . VAL A 1 216 ? 34.015  25.012 43.938 1.00 0.00   ? 219 VAL A HG11 1  
ATOM   3285   H  HG12 . VAL A 1 216 ? 33.168  26.444 43.352 1.00 0.00   ? 219 VAL A HG12 1  
ATOM   3286   H  HG13 . VAL A 1 216 ? 33.767  25.243 42.207 1.00 0.00   ? 219 VAL A HG13 1  
ATOM   3287   H  HG21 . VAL A 1 216 ? 32.044  24.323 45.401 1.00 0.00   ? 219 VAL A HG21 1  
ATOM   3288   H  HG22 . VAL A 1 216 ? 32.899  23.093 44.470 1.00 0.00   ? 219 VAL A HG22 1  
ATOM   3289   H  HG23 . VAL A 1 216 ? 31.136  23.107 44.502 1.00 0.00   ? 219 VAL A HG23 1  
ATOM   3290   N  N    . PHE A 1 217 ? 29.287  24.050 42.672 1.00 8.16   ? 220 PHE A N    1  
ATOM   3291   C  CA   . PHE A 1 217 ? 28.036  23.247 42.751 1.00 8.63   ? 220 PHE A CA   1  
ATOM   3292   C  C    . PHE A 1 217 ? 28.387  21.760 42.708 1.00 8.94   ? 220 PHE A C    1  
ATOM   3293   O  O    . PHE A 1 217 ? 29.217  21.330 41.932 1.00 9.93   ? 220 PHE A O    1  
ATOM   3294   C  CB   . PHE A 1 217 ? 27.131  23.593 41.567 1.00 8.41   ? 220 PHE A CB   1  
ATOM   3295   C  CG   . PHE A 1 217 ? 27.019  25.094 41.441 1.00 8.90   ? 220 PHE A CG   1  
ATOM   3296   C  CD1  . PHE A 1 217 ? 26.847  25.882 42.585 1.00 9.64   ? 220 PHE A CD1  1  
ATOM   3297   C  CD2  . PHE A 1 217 ? 27.087  25.696 40.179 1.00 9.38   ? 220 PHE A CD2  1  
ATOM   3298   C  CE1  . PHE A 1 217 ? 26.743  27.273 42.467 1.00 9.20   ? 220 PHE A CE1  1  
ATOM   3299   C  CE2  . PHE A 1 217 ? 26.983  27.088 40.061 1.00 9.81   ? 220 PHE A CE2  1  
ATOM   3300   C  CZ   . PHE A 1 217 ? 26.811  27.876 41.206 1.00 9.26   ? 220 PHE A CZ   1  
ATOM   3301   H  H    . PHE A 1 217 ? 29.892  23.939 41.909 1.00 0.00   ? 220 PHE A H    1  
ATOM   3302   H  HA   . PHE A 1 217 ? 27.523  23.470 43.675 1.00 0.00   ? 220 PHE A HA   1  
ATOM   3303   H  HB2  . PHE A 1 217 ? 27.553  23.185 40.660 1.00 0.00   ? 220 PHE A HB2  1  
ATOM   3304   H  HB3  . PHE A 1 217 ? 26.150  23.172 41.729 1.00 0.00   ? 220 PHE A HB3  1  
ATOM   3305   H  HD1  . PHE A 1 217 ? 26.795  25.417 43.558 1.00 0.00   ? 220 PHE A HD1  1  
ATOM   3306   H  HD2  . PHE A 1 217 ? 27.219  25.088 39.296 1.00 0.00   ? 220 PHE A HD2  1  
ATOM   3307   H  HE1  . PHE A 1 217 ? 26.611  27.881 43.350 1.00 0.00   ? 220 PHE A HE1  1  
ATOM   3308   H  HE2  . PHE A 1 217 ? 27.035  27.553 39.088 1.00 0.00   ? 220 PHE A HE2  1  
ATOM   3309   H  HZ   . PHE A 1 217 ? 26.731  28.949 41.115 1.00 0.00   ? 220 PHE A HZ   1  
ATOM   3310   N  N    . ASN A 1 218 ? 27.763  20.972 43.537 1.00 9.36   ? 221 ASN A N    1  
ATOM   3311   C  CA   . ASN A 1 218 ? 28.065  19.503 43.545 1.00 9.72   ? 221 ASN A CA   1  
ATOM   3312   C  C    . ASN A 1 218 ? 29.359  19.185 44.338 1.00 10.45  ? 221 ASN A C    1  
ATOM   3313   O  O    . ASN A 1 218 ? 29.790  18.050 44.380 1.00 12.26  ? 221 ASN A O    1  
ATOM   3314   C  CB   . ASN A 1 218 ? 28.233  19.021 42.103 1.00 10.62  ? 221 ASN A CB   1  
ATOM   3315   C  CG   . ASN A 1 218 ? 27.294  17.841 41.846 1.00 9.10   ? 221 ASN A CG   1  
ATOM   3316   O  OD1  . ASN A 1 218 ? 27.392  17.181 40.831 1.00 11.78  ? 221 ASN A OD1  1  
ATOM   3317   N  ND2  . ASN A 1 218 ? 26.381  17.545 42.731 1.00 7.53   ? 221 ASN A ND2  1  
ATOM   3318   H  H    . ASN A 1 218 ? 27.098  21.339 44.156 1.00 0.00   ? 221 ASN A H    1  
ATOM   3319   H  HA   . ASN A 1 218 ? 27.238  18.977 43.996 1.00 0.00   ? 221 ASN A HA   1  
ATOM   3320   H  HB2  . ASN A 1 218 ? 27.994  19.827 41.424 1.00 0.00   ? 221 ASN A HB2  1  
ATOM   3321   H  HB3  . ASN A 1 218 ? 29.254  18.707 41.944 1.00 0.00   ? 221 ASN A HB3  1  
ATOM   3322   H  HD21 . ASN A 1 218 ? 26.302  18.077 43.550 1.00 0.00   ? 221 ASN A HD21 1  
ATOM   3323   H  HD22 . ASN A 1 218 ? 25.775  16.791 42.576 1.00 0.00   ? 221 ASN A HD22 1  
ATOM   3324   N  N    . GLY A 1 219 ? 29.980  20.156 44.967 1.00 10.00  ? 222 GLY A N    1  
ATOM   3325   C  CA   . GLY A 1 219 ? 31.232  19.869 45.745 1.00 10.52  ? 222 GLY A CA   1  
ATOM   3326   C  C    . GLY A 1 219 ? 32.550  20.018 44.915 1.00 9.98   ? 222 GLY A C    1  
ATOM   3327   O  O    . GLY A 1 219 ? 33.589  19.585 45.371 1.00 12.64  ? 222 GLY A O    1  
ATOM   3328   H  H    . GLY A 1 219 ? 29.624  21.069 44.931 1.00 0.00   ? 222 GLY A H    1  
ATOM   3329   H  HA2  . GLY A 1 219 ? 31.277  20.548 46.583 1.00 0.00   ? 222 GLY A HA2  1  
ATOM   3330   H  HA3  . GLY A 1 219 ? 31.176  18.859 46.124 1.00 0.00   ? 222 GLY A HA3  1  
ATOM   3331   N  N    . ALA A 1 220 ? 32.564  20.625 43.737 1.00 9.88   ? 223 ALA A N    1  
ATOM   3332   C  CA   . ALA A 1 220 ? 33.871  20.754 43.008 1.00 9.57   ? 223 ALA A CA   1  
ATOM   3333   C  C    . ALA A 1 220 ? 33.727  21.632 41.754 1.00 9.50   ? 223 ALA A C    1  
ATOM   3334   O  O    . ALA A 1 220 ? 32.763  21.527 41.023 1.00 9.41   ? 223 ALA A O    1  
ATOM   3335   C  CB   . ALA A 1 220 ? 34.354  19.363 42.594 1.00 10.11  ? 223 ALA A CB   1  
ATOM   3336   H  H    . ALA A 1 220 ? 31.741  20.997 43.357 1.00 0.00   ? 223 ALA A H    1  
ATOM   3337   H  HA   . ALA A 1 220 ? 34.601  21.198 43.668 1.00 0.00   ? 223 ALA A HA   1  
ATOM   3338   H  HB1  . ALA A 1 220 ? 34.945  18.935 43.390 1.00 0.00   ? 223 ALA A HB1  1  
ATOM   3339   H  HB2  . ALA A 1 220 ? 34.956  19.442 41.701 1.00 0.00   ? 223 ALA A HB2  1  
ATOM   3340   H  HB3  . ALA A 1 220 ? 33.501  18.730 42.398 1.00 0.00   ? 223 ALA A HB3  1  
ATOM   3341   N  N    . VAL A 1 221 ? 34.699  22.483 41.481 1.00 9.33   ? 224 VAL A N    1  
ATOM   3342   C  CA   . VAL A 1 221 ? 34.613  23.329 40.259 1.00 9.86   ? 224 VAL A CA   1  
ATOM   3343   C  C    . VAL A 1 221 ? 34.478  22.408 39.043 1.00 10.45  ? 224 VAL A C    1  
ATOM   3344   O  O    . VAL A 1 221 ? 35.246  21.482 38.868 1.00 11.10  ? 224 VAL A O    1  
ATOM   3345   C  CB   . VAL A 1 221 ? 35.883  24.173 40.126 1.00 10.51  ? 224 VAL A CB   1  
ATOM   3346   C  CG1  . VAL A 1 221 ? 35.757  25.099 38.916 1.00 10.97  ? 224 VAL A CG1  1  
ATOM   3347   C  CG2  . VAL A 1 221 ? 36.070  25.012 41.392 1.00 10.64  ? 224 VAL A CG2  1  
ATOM   3348   H  H    . VAL A 1 221 ? 35.481  22.543 42.068 1.00 0.00   ? 224 VAL A H    1  
ATOM   3349   H  HA   . VAL A 1 221 ? 33.750  23.975 40.323 1.00 0.00   ? 224 VAL A HA   1  
ATOM   3350   H  HB   . VAL A 1 221 ? 36.735  23.522 39.994 1.00 0.00   ? 224 VAL A HB   1  
ATOM   3351   H  HG11 . VAL A 1 221 ? 36.727  25.229 38.459 1.00 0.00   ? 224 VAL A HG11 1  
ATOM   3352   H  HG12 . VAL A 1 221 ? 35.378  26.059 39.235 1.00 0.00   ? 224 VAL A HG12 1  
ATOM   3353   H  HG13 . VAL A 1 221 ? 35.077  24.664 38.199 1.00 0.00   ? 224 VAL A HG13 1  
ATOM   3354   H  HG21 . VAL A 1 221 ? 35.294  25.761 41.445 1.00 0.00   ? 224 VAL A HG21 1  
ATOM   3355   H  HG22 . VAL A 1 221 ? 37.035  25.495 41.365 1.00 0.00   ? 224 VAL A HG22 1  
ATOM   3356   H  HG23 . VAL A 1 221 ? 36.012  24.372 42.260 1.00 0.00   ? 224 VAL A HG23 1  
ATOM   3357   N  N    . GLY A 1 222 ? 33.500  22.637 38.212 1.00 10.14  ? 225 GLY A N    1  
ATOM   3358   C  CA   . GLY A 1 222 ? 33.310  21.750 37.018 1.00 10.78  ? 225 GLY A CA   1  
ATOM   3359   C  C    . GLY A 1 222 ? 32.618  20.401 37.382 1.00 10.44  ? 225 GLY A C    1  
ATOM   3360   O  O    . GLY A 1 222 ? 32.679  19.462 36.614 1.00 11.29  ? 225 GLY A O    1  
ATOM   3361   H  H    . GLY A 1 222 ? 32.881  23.379 38.376 1.00 0.00   ? 225 GLY A H    1  
ATOM   3362   H  HA2  . GLY A 1 222 ? 32.702  22.270 36.291 1.00 0.00   ? 225 GLY A HA2  1  
ATOM   3363   H  HA3  . GLY A 1 222 ? 34.275  21.541 36.581 1.00 0.00   ? 225 GLY A HA3  1  
ATOM   3364   N  N    . ALA A 1 223 ? 31.950  20.285 38.516 1.00 9.91   ? 226 ALA A N    1  
ATOM   3365   C  CA   . ALA A 1 223 ? 31.270  18.996 38.851 1.00 9.95   ? 226 ALA A CA   1  
ATOM   3366   C  C    . ALA A 1 223 ? 30.015  18.777 37.968 1.00 9.53   ? 226 ALA A C    1  
ATOM   3367   O  O    . ALA A 1 223 ? 29.613  17.653 37.738 1.00 10.66  ? 226 ALA A O    1  
ATOM   3368   C  CB   . ALA A 1 223 ? 30.850  19.019 40.322 1.00 10.56  ? 226 ALA A CB   1  
ATOM   3369   H  H    . ALA A 1 223 ? 31.889  21.047 39.130 1.00 0.00   ? 226 ALA A H    1  
ATOM   3370   H  HA   . ALA A 1 223 ? 31.960  18.181 38.694 1.00 0.00   ? 226 ALA A HA   1  
ATOM   3371   H  HB1  . ALA A 1 223 ? 31.580  19.570 40.896 1.00 0.00   ? 226 ALA A HB1  1  
ATOM   3372   H  HB2  . ALA A 1 223 ? 30.789  18.007 40.695 1.00 0.00   ? 226 ALA A HB2  1  
ATOM   3373   H  HB3  . ALA A 1 223 ? 29.885  19.496 40.414 1.00 0.00   ? 226 ALA A HB3  1  
ATOM   3374   N  N    . LEU A 1 224 ? 29.379  19.824 37.485 1.00 9.07   ? 227 LEU A N    1  
ATOM   3375   C  CA   . LEU A 1 224 ? 28.156  19.635 36.648 1.00 10.02  ? 227 LEU A CA   1  
ATOM   3376   C  C    . LEU A 1 224 ? 28.386  20.192 35.241 1.00 10.91  ? 227 LEU A C    1  
ATOM   3377   O  O    . LEU A 1 224 ? 27.476  20.674 34.596 1.00 11.05  ? 227 LEU A O    1  
ATOM   3378   C  CB   . LEU A 1 224 ? 26.979  20.367 37.297 1.00 9.99   ? 227 LEU A CB   1  
ATOM   3379   C  CG   . LEU A 1 224 ? 26.712  19.777 38.682 1.00 10.08  ? 227 LEU A CG   1  
ATOM   3380   C  CD1  . LEU A 1 224 ? 25.559  20.532 39.346 1.00 10.68  ? 227 LEU A CD1  1  
ATOM   3381   C  CD2  . LEU A 1 224 ? 26.338  18.300 38.542 1.00 11.07  ? 227 LEU A CD2  1  
ATOM   3382   H  H    . LEU A 1 224 ? 29.701  20.728 37.685 1.00 0.00   ? 227 LEU A H    1  
ATOM   3383   H  HA   . LEU A 1 224 ? 27.927  18.581 36.582 1.00 0.00   ? 227 LEU A HA   1  
ATOM   3384   H  HB2  . LEU A 1 224 ? 27.217  21.417 37.392 1.00 0.00   ? 227 LEU A HB2  1  
ATOM   3385   H  HB3  . LEU A 1 224 ? 26.099  20.251 36.682 1.00 0.00   ? 227 LEU A HB3  1  
ATOM   3386   H  HG   . LEU A 1 224 ? 27.600  19.870 39.291 1.00 0.00   ? 227 LEU A HG   1  
ATOM   3387   H  HD11 . LEU A 1 224 ? 25.610  20.399 40.416 1.00 0.00   ? 227 LEU A HD11 1  
ATOM   3388   H  HD12 . LEU A 1 224 ? 24.618  20.148 38.980 1.00 0.00   ? 227 LEU A HD12 1  
ATOM   3389   H  HD13 . LEU A 1 224 ? 25.634  21.584 39.110 1.00 0.00   ? 227 LEU A HD13 1  
ATOM   3390   H  HD21 . LEU A 1 224 ? 25.979  17.927 39.491 1.00 0.00   ? 227 LEU A HD21 1  
ATOM   3391   H  HD22 . LEU A 1 224 ? 27.207  17.735 38.239 1.00 0.00   ? 227 LEU A HD22 1  
ATOM   3392   H  HD23 . LEU A 1 224 ? 25.562  18.193 37.798 1.00 0.00   ? 227 LEU A HD23 1  
ATOM   3393   N  N    . THR A 1 225 ? 29.593  20.123 34.759 1.00 13.08  ? 228 THR A N    1  
ATOM   3394   C  CA   . THR A 1 225 ? 29.890  20.637 33.393 1.00 14.67  ? 228 THR A CA   1  
ATOM   3395   C  C    . THR A 1 225 ? 30.685  19.581 32.615 1.00 15.12  ? 228 THR A C    1  
ATOM   3396   O  O    . THR A 1 225 ? 31.338  18.733 33.190 1.00 14.81  ? 228 THR A O    1  
ATOM   3397   C  CB   . THR A 1 225 ? 30.714  21.922 33.498 1.00 14.96  ? 228 THR A CB   1  
ATOM   3398   O  OG1  . THR A 1 225 ? 31.944  21.641 34.152 1.00 19.14  ? 228 THR A OG1  1  
ATOM   3399   C  CG2  . THR A 1 225 ? 29.935  22.966 34.299 1.00 18.01  ? 228 THR A CG2  1  
ATOM   3400   H  H    . THR A 1 225 ? 30.310  19.724 35.296 1.00 0.00   ? 228 THR A H    1  
ATOM   3401   H  HA   . THR A 1 225 ? 28.964  20.843 32.876 1.00 0.00   ? 228 THR A HA   1  
ATOM   3402   H  HB   . THR A 1 225 ? 30.911  22.306 32.509 1.00 0.00   ? 228 THR A HB   1  
ATOM   3403   H  HG1  . THR A 1 225 ? 32.657  21.822 33.535 1.00 0.00   ? 228 THR A HG1  1  
ATOM   3404   H  HG21 . THR A 1 225 ? 30.427  23.925 34.215 1.00 0.00   ? 228 THR A HG21 1  
ATOM   3405   H  HG22 . THR A 1 225 ? 29.898  22.670 35.337 1.00 0.00   ? 228 THR A HG22 1  
ATOM   3406   H  HG23 . THR A 1 225 ? 28.930  23.042 33.910 1.00 0.00   ? 228 THR A HG23 1  
ATOM   3407   N  N    . GLY A 1 226 ? 30.632  19.628 31.312 1.00 16.78  ? 229 GLY A N    1  
ATOM   3408   C  CA   . GLY A 1 226 ? 31.376  18.636 30.492 1.00 17.16  ? 229 GLY A CA   1  
ATOM   3409   C  C    . GLY A 1 226 ? 30.518  17.387 30.331 1.00 16.99  ? 229 GLY A C    1  
ATOM   3410   O  O    . GLY A 1 226 ? 29.379  17.452 29.915 1.00 17.81  ? 229 GLY A O    1  
ATOM   3411   H  H    . GLY A 1 226 ? 30.097  20.321 30.871 1.00 0.00   ? 229 GLY A H    1  
ATOM   3412   H  HA2  . GLY A 1 226 ? 31.591  19.059 29.521 1.00 0.00   ? 229 GLY A HA2  1  
ATOM   3413   H  HA3  . GLY A 1 226 ? 32.299  18.375 30.987 1.00 0.00   ? 229 GLY A HA3  1  
ATOM   3414   N  N    . ASP A 1 227 ? 31.051  16.252 30.668 1.00 17.33  ? 230 ASP A N    1  
ATOM   3415   C  CA   . ASP A 1 227 ? 30.259  14.993 30.547 1.00 17.28  ? 230 ASP A CA   1  
ATOM   3416   C  C    . ASP A 1 227 ? 29.230  14.891 31.690 1.00 16.43  ? 230 ASP A C    1  
ATOM   3417   O  O    . ASP A 1 227 ? 28.304  14.106 31.625 1.00 17.71  ? 230 ASP A O    1  
ATOM   3418   C  CB   . ASP A 1 227 ? 31.206  13.792 30.611 1.00 18.94  ? 230 ASP A CB   1  
ATOM   3419   C  CG   . ASP A 1 227 ? 32.098  13.779 29.369 1.00 21.99  ? 230 ASP A CG   1  
ATOM   3420   O  OD1  . ASP A 1 227 ? 31.682  14.322 28.358 1.00 27.27  ? 230 ASP A OD1  1  
ATOM   3421   O  OD2  . ASP A 1 227 ? 33.183  13.226 29.448 1.00 27.85  ? 230 ASP A OD2  1  
ATOM   3422   H  H    . ASP A 1 227 ? 31.969  16.223 31.010 1.00 0.00   ? 230 ASP A H    1  
ATOM   3423   H  HA   . ASP A 1 227 ? 29.741  14.987 29.600 1.00 0.00   ? 230 ASP A HA   1  
ATOM   3424   H  HB2  . ASP A 1 227 ? 31.820  13.866 31.496 1.00 0.00   ? 230 ASP A HB2  1  
ATOM   3425   H  HB3  . ASP A 1 227 ? 30.629  12.880 30.647 1.00 0.00   ? 230 ASP A HB3  1  
ATOM   3426   N  N    . LYS A 1 228 ? 29.380  15.666 32.738 1.00 14.14  ? 231 LYS A N    1  
ATOM   3427   C  CA   . LYS A 1 228 ? 28.408  15.590 33.866 1.00 12.79  ? 231 LYS A CA   1  
ATOM   3428   C  C    . LYS A 1 228 ? 27.360  16.705 33.746 1.00 11.81  ? 231 LYS A C    1  
ATOM   3429   O  O    . LYS A 1 228 ? 26.637  16.983 34.682 1.00 11.75  ? 231 LYS A O    1  
ATOM   3430   C  CB   . LYS A 1 228 ? 29.158  15.741 35.191 1.00 12.85  ? 231 LYS A CB   1  
ATOM   3431   C  CG   . LYS A 1 228 ? 30.226  14.651 35.301 1.00 14.51  ? 231 LYS A CG   1  
ATOM   3432   C  CD   . LYS A 1 228 ? 30.894  14.727 36.675 1.00 15.69  ? 231 LYS A CD   1  
ATOM   3433   C  CE   . LYS A 1 228 ? 32.207  13.941 36.649 1.00 17.28  ? 231 LYS A CE   1  
ATOM   3434   N  NZ   . LYS A 1 228 ? 32.637  13.646 38.045 1.00 16.03  ? 231 LYS A NZ   1  
ATOM   3435   H  H    . LYS A 1 228 ? 30.133  16.292 32.781 1.00 0.00   ? 231 LYS A H    1  
ATOM   3436   H  HA   . LYS A 1 228 ? 27.912  14.631 33.846 1.00 0.00   ? 231 LYS A HA   1  
ATOM   3437   H  HB2  . LYS A 1 228 ? 29.628  16.713 35.230 1.00 0.00   ? 231 LYS A HB2  1  
ATOM   3438   H  HB3  . LYS A 1 228 ? 28.463  15.644 36.012 1.00 0.00   ? 231 LYS A HB3  1  
ATOM   3439   H  HG2  . LYS A 1 228 ? 29.765  13.681 35.176 1.00 0.00   ? 231 LYS A HG2  1  
ATOM   3440   H  HG3  . LYS A 1 228 ? 30.970  14.797 34.532 1.00 0.00   ? 231 LYS A HG3  1  
ATOM   3441   H  HD2  . LYS A 1 228 ? 31.097  15.759 36.920 1.00 0.00   ? 231 LYS A HD2  1  
ATOM   3442   H  HD3  . LYS A 1 228 ? 30.238  14.302 37.419 1.00 0.00   ? 231 LYS A HD3  1  
ATOM   3443   H  HE2  . LYS A 1 228 ? 32.061  13.014 36.113 1.00 0.00   ? 231 LYS A HE2  1  
ATOM   3444   H  HE3  . LYS A 1 228 ? 32.967  14.527 36.154 1.00 0.00   ? 231 LYS A HE3  1  
ATOM   3445   H  HZ1  . LYS A 1 228 ? 32.134  14.273 38.703 1.00 0.00   ? 231 LYS A HZ1  1  
ATOM   3446   H  HZ2  . LYS A 1 228 ? 33.660  13.804 38.133 1.00 0.00   ? 231 LYS A HZ2  1  
ATOM   3447   H  HZ3  . LYS A 1 228 ? 32.417  12.654 38.272 1.00 0.00   ? 231 LYS A HZ3  1  
ATOM   3448   N  N    . ALA A 1 229 ? 27.263  17.345 32.610 1.00 11.39  ? 232 ALA A N    1  
ATOM   3449   C  CA   . ALA A 1 229 ? 26.249  18.432 32.460 1.00 11.10  ? 232 ALA A CA   1  
ATOM   3450   C  C    . ALA A 1 229 ? 24.843  17.822 32.495 1.00 10.61  ? 232 ALA A C    1  
ATOM   3451   O  O    . ALA A 1 229 ? 24.590  16.798 31.892 1.00 11.00  ? 232 ALA A O    1  
ATOM   3452   C  CB   . ALA A 1 229 ? 26.462  19.148 31.125 1.00 10.93  ? 232 ALA A CB   1  
ATOM   3453   H  H    . ALA A 1 229 ? 27.849  17.110 31.860 1.00 0.00   ? 232 ALA A H    1  
ATOM   3454   H  HA   . ALA A 1 229 ? 26.356  19.138 33.270 1.00 0.00   ? 232 ALA A HA   1  
ATOM   3455   H  HB1  . ALA A 1 229 ? 26.856  18.450 30.401 1.00 0.00   ? 232 ALA A HB1  1  
ATOM   3456   H  HB2  . ALA A 1 229 ? 27.162  19.960 31.260 1.00 0.00   ? 232 ALA A HB2  1  
ATOM   3457   H  HB3  . ALA A 1 229 ? 25.520  19.540 30.772 1.00 0.00   ? 232 ALA A HB3  1  
ATOM   3458   N  N    . MET A 1 230 ? 23.922  18.437 33.195 1.00 10.97  ? 233 MET A N    1  
ATOM   3459   C  CA   . MET A 1 230 ? 22.562  17.879 33.252 1.00 11.28  ? 233 MET A CA   1  
ATOM   3460   C  C    . MET A 1 230 ? 22.086  17.641 31.831 1.00 11.94  ? 233 MET A C    1  
ATOM   3461   O  O    . MET A 1 230 ? 22.847  17.689 30.885 1.00 13.52  ? 233 MET A O    1  
ATOM   3462   C  CB   . MET A 1 230 ? 21.628  18.869 33.951 1.00 11.78  ? 233 MET A CB   1  
ATOM   3463   C  CG   . MET A 1 230 ? 21.398  18.422 35.396 1.00 11.59  ? 233 MET A CG   1  
ATOM   3464   S  SD   . MET A 1 230 ? 21.432  19.866 36.487 1.00 13.52  ? 233 MET A SD   1  
ATOM   3465   C  CE   . MET A 1 230 ? 23.126  20.386 36.121 1.00 12.81  ? 233 MET A CE   1  
ATOM   3466   H  H    . MET A 1 230 ? 24.138  19.262 33.678 1.00 0.00   ? 233 MET A H    1  
ATOM   3467   H  HA   . MET A 1 230 ? 22.575  16.945 33.794 1.00 0.00   ? 233 MET A HA   1  
ATOM   3468   H  HB2  . MET A 1 230 ? 22.075  19.852 33.944 1.00 0.00   ? 233 MET A HB2  1  
ATOM   3469   H  HB3  . MET A 1 230 ? 20.682  18.899 33.431 1.00 0.00   ? 233 MET A HB3  1  
ATOM   3470   H  HG2  . MET A 1 230 ? 20.437  17.934 35.474 1.00 0.00   ? 233 MET A HG2  1  
ATOM   3471   H  HG3  . MET A 1 230 ? 22.176  17.732 35.687 1.00 0.00   ? 233 MET A HG3  1  
ATOM   3472   H  HE1  . MET A 1 230 ? 23.665  19.564 35.671 1.00 0.00   ? 233 MET A HE1  1  
ATOM   3473   H  HE2  . MET A 1 230 ? 23.615  20.687 37.037 1.00 0.00   ? 233 MET A HE2  1  
ATOM   3474   H  HE3  . MET A 1 230 ? 23.108  21.219 35.436 1.00 0.00   ? 233 MET A HE3  1  
ATOM   3475   N  N    . THR A 1 231 ? 20.835  17.391 31.681 1.00 12.01  ? 234 THR A N    1  
ATOM   3476   C  CA   . THR A 1 231 ? 20.265  17.149 30.323 1.00 11.94  ? 234 THR A CA   1  
ATOM   3477   C  C    . THR A 1 231 ? 18.775  17.546 30.286 1.00 12.30  ? 234 THR A C    1  
ATOM   3478   O  O    . THR A 1 231 ? 18.071  17.477 31.274 1.00 13.05  ? 234 THR A O    1  
ATOM   3479   C  CB   . THR A 1 231 ? 20.401  15.664 29.975 1.00 12.51  ? 234 THR A CB   1  
ATOM   3480   O  OG1  . THR A 1 231 ? 19.816  14.883 31.007 1.00 12.88  ? 234 THR A OG1  1  
ATOM   3481   C  CG2  . THR A 1 231 ? 21.881  15.304 29.836 1.00 12.73  ? 234 THR A CG2  1  
ATOM   3482   H  H    . THR A 1 231 ? 20.248  17.364 32.465 1.00 0.00   ? 234 THR A H    1  
ATOM   3483   H  HA   . THR A 1 231 ? 20.809  17.736 29.598 1.00 0.00   ? 234 THR A HA   1  
ATOM   3484   H  HB   . THR A 1 231 ? 19.898  15.465 29.042 1.00 0.00   ? 234 THR A HB   1  
ATOM   3485   H  HG1  . THR A 1 231 ? 20.358  14.100 31.130 1.00 0.00   ? 234 THR A HG1  1  
ATOM   3486   H  HG21 . THR A 1 231 ? 22.442  15.775 30.629 1.00 0.00   ? 234 THR A HG21 1  
ATOM   3487   H  HG22 . THR A 1 231 ? 22.248  15.650 28.881 1.00 0.00   ? 234 THR A HG22 1  
ATOM   3488   H  HG23 . THR A 1 231 ? 21.998  14.232 29.900 1.00 0.00   ? 234 THR A HG23 1  
ATOM   3489   N  N    . ALA A 1 232 ? 18.305  17.952 29.134 1.00 11.80  ? 235 ALA A N    1  
ATOM   3490   C  CA   . ALA A 1 232 ? 16.879  18.356 28.955 1.00 12.10  ? 235 ALA A CA   1  
ATOM   3491   C  C    . ALA A 1 232 ? 16.600  18.481 27.446 1.00 12.16  ? 235 ALA A C    1  
ATOM   3492   O  O    . ALA A 1 232 ? 17.471  18.841 26.679 1.00 12.14  ? 235 ALA A O    1  
ATOM   3493   C  CB   . ALA A 1 232 ? 16.636  19.703 29.638 1.00 13.02  ? 235 ALA A CB   1  
ATOM   3494   H  H    . ALA A 1 232 ? 18.907  17.985 28.362 1.00 0.00   ? 235 ALA A H    1  
ATOM   3495   H  HA   . ALA A 1 232 ? 16.231  17.604 29.384 1.00 0.00   ? 235 ALA A HA   1  
ATOM   3496   H  HB1  . ALA A 1 232 ? 16.067  20.343 28.979 1.00 0.00   ? 235 ALA A HB1  1  
ATOM   3497   H  HB2  . ALA A 1 232 ? 17.584  20.170 29.862 1.00 0.00   ? 235 ALA A HB2  1  
ATOM   3498   H  HB3  . ALA A 1 232 ? 16.085  19.549 30.554 1.00 0.00   ? 235 ALA A HB3  1  
ATOM   3499   N  N    . ALA A 1 233 ? 15.404  18.176 27.007 1.00 13.28  ? 236 ALA A N    1  
ATOM   3500   C  CA   . ALA A 1 233 ? 15.098  18.266 25.558 1.00 13.04  ? 236 ALA A CA   1  
ATOM   3501   C  C    . ALA A 1 233 ? 14.009  19.310 25.324 1.00 13.45  ? 236 ALA A C    1  
ATOM   3502   O  O    . ALA A 1 233 ? 13.134  19.515 26.142 1.00 13.54  ? 236 ALA A O    1  
ATOM   3503   C  CB   . ALA A 1 233 ? 14.614  16.905 25.054 1.00 13.53  ? 236 ALA A CB   1  
ATOM   3504   H  H    . ALA A 1 233 ? 14.714  17.877 27.635 1.00 0.00   ? 236 ALA A H    1  
ATOM   3505   H  HA   . ALA A 1 233 ? 15.989  18.551 25.020 1.00 0.00   ? 236 ALA A HA   1  
ATOM   3506   H  HB1  . ALA A 1 233 ? 14.656  16.187 25.860 1.00 0.00   ? 236 ALA A HB1  1  
ATOM   3507   H  HB2  . ALA A 1 233 ? 15.247  16.575 24.244 1.00 0.00   ? 236 ALA A HB2  1  
ATOM   3508   H  HB3  . ALA A 1 233 ? 13.596  16.992 24.703 1.00 0.00   ? 236 ALA A HB3  1  
ATOM   3509   N  N    . VAL A 1 234 ? 14.064  19.965 24.205 1.00 13.68  ? 237 VAL A N    1  
ATOM   3510   C  CA   . VAL A 1 234 ? 13.053  20.997 23.878 1.00 13.50  ? 237 VAL A CA   1  
ATOM   3511   C  C    . VAL A 1 234 ? 11.673  20.447 24.191 1.00 13.15  ? 237 VAL A C    1  
ATOM   3512   O  O    . VAL A 1 234 ? 11.333  19.338 23.829 1.00 13.95  ? 237 VAL A O    1  
ATOM   3513   C  CB   . VAL A 1 234 ? 13.141  21.348 22.391 1.00 13.87  ? 237 VAL A CB   1  
ATOM   3514   C  CG1  . VAL A 1 234 ? 11.961  22.243 22.007 1.00 14.53  ? 237 VAL A CG1  1  
ATOM   3515   C  CG2  . VAL A 1 234 ? 14.452  22.089 22.120 1.00 14.53  ? 237 VAL A CG2  1  
ATOM   3516   H  H    . VAL A 1 234 ? 14.782  19.772 23.567 1.00 0.00   ? 237 VAL A H    1  
ATOM   3517   H  HA   . VAL A 1 234 ? 13.234  21.882 24.470 1.00 0.00   ? 237 VAL A HA   1  
ATOM   3518   H  HB   . VAL A 1 234 ? 13.110  20.440 21.805 1.00 0.00   ? 237 VAL A HB   1  
ATOM   3519   H  HG11 . VAL A 1 234 ? 12.332  23.190 21.644 1.00 0.00   ? 237 VAL A HG11 1  
ATOM   3520   H  HG12 . VAL A 1 234 ? 11.338  22.408 22.873 1.00 0.00   ? 237 VAL A HG12 1  
ATOM   3521   H  HG13 . VAL A 1 234 ? 11.382  21.762 21.233 1.00 0.00   ? 237 VAL A HG13 1  
ATOM   3522   H  HG21 . VAL A 1 234 ? 15.157  21.416 21.656 1.00 0.00   ? 237 VAL A HG21 1  
ATOM   3523   H  HG22 . VAL A 1 234 ? 14.860  22.452 23.052 1.00 0.00   ? 237 VAL A HG22 1  
ATOM   3524   H  HG23 . VAL A 1 234 ? 14.263  22.924 21.461 1.00 0.00   ? 237 VAL A HG23 1  
ATOM   3525   N  N    . GLY A 1 235 ? 10.881  21.209 24.870 1.00 13.37  ? 238 GLY A N    1  
ATOM   3526   C  CA   . GLY A 1 235 ? 9.506   20.732 25.230 1.00 13.29  ? 238 GLY A CA   1  
ATOM   3527   C  C    . GLY A 1 235 ? 9.499   20.032 26.611 1.00 13.61  ? 238 GLY A C    1  
ATOM   3528   O  O    . GLY A 1 235 ? 8.466   19.598 27.082 1.00 13.77  ? 238 GLY A O    1  
ATOM   3529   H  H    . GLY A 1 235 ? 11.182  22.096 25.157 1.00 0.00   ? 238 GLY A H    1  
ATOM   3530   H  HA2  . GLY A 1 235 ? 8.834   21.577 25.258 1.00 0.00   ? 238 GLY A HA2  1  
ATOM   3531   H  HA3  . GLY A 1 235 ? 9.166   20.033 24.480 1.00 0.00   ? 238 GLY A HA3  1  
ATOM   3532   N  N    . GLU A 1 236 ? 10.632  19.917 27.261 1.00 13.10  ? 239 GLU A N    1  
ATOM   3533   C  CA   . GLU A 1 236 ? 10.680  19.255 28.586 1.00 13.51  ? 239 GLU A CA   1  
ATOM   3534   C  C    . GLU A 1 236 ? 10.593  20.311 29.688 1.00 12.41  ? 239 GLU A C    1  
ATOM   3535   O  O    . GLU A 1 236 ? 11.168  21.377 29.599 1.00 12.39  ? 239 GLU A O    1  
ATOM   3536   C  CB   . GLU A 1 236 ? 11.993  18.482 28.723 1.00 13.64  ? 239 GLU A CB   1  
ATOM   3537   C  CG   . GLU A 1 236 ? 11.897  17.515 29.905 1.00 17.68  ? 239 GLU A CG   1  
ATOM   3538   C  CD   . GLU A 1 236 ? 12.981  16.444 29.779 1.00 18.74  ? 239 GLU A CD   1  
ATOM   3539   O  OE1  . GLU A 1 236 ? 13.936  16.678 29.057 1.00 16.99  ? 239 GLU A OE1  1  
ATOM   3540   O  OE2  . GLU A 1 236 ? 12.839  15.408 30.407 1.00 22.53  ? 239 GLU A OE2  1  
ATOM   3541   H  H    . GLU A 1 236 ? 11.456  20.272 26.866 1.00 0.00   ? 239 GLU A H    1  
ATOM   3542   H  HA   . GLU A 1 236 ? 9.849   18.571 28.677 1.00 0.00   ? 239 GLU A HA   1  
ATOM   3543   H  HB2  . GLU A 1 236 ? 12.179  17.925 27.816 1.00 0.00   ? 239 GLU A HB2  1  
ATOM   3544   H  HB3  . GLU A 1 236 ? 12.803  19.175 28.893 1.00 0.00   ? 239 GLU A HB3  1  
ATOM   3545   H  HG2  . GLU A 1 236 ? 12.034  18.061 30.828 1.00 0.00   ? 239 GLU A HG2  1  
ATOM   3546   H  HG3  . GLU A 1 236 ? 10.926  17.043 29.906 1.00 0.00   ? 239 GLU A HG3  1  
ATOM   3547   N  N    . LYS A 1 237 ? 9.874   20.006 30.721 1.00 11.97  ? 240 LYS A N    1  
ATOM   3548   C  CA   . LYS A 1 237 ? 9.715   20.942 31.849 1.00 11.81  ? 240 LYS A CA   1  
ATOM   3549   C  C    . LYS A 1 237 ? 10.627  20.445 32.938 1.00 11.32  ? 240 LYS A C    1  
ATOM   3550   O  O    . LYS A 1 237 ? 10.631  19.277 33.273 1.00 11.61  ? 240 LYS A O    1  
ATOM   3551   C  CB   . LYS A 1 237 ? 8.264   20.934 32.333 1.00 12.31  ? 240 LYS A CB   1  
ATOM   3552   C  CG   . LYS A 1 237 ? 7.377   20.269 31.279 1.00 14.01  ? 240 LYS A CG   1  
ATOM   3553   C  CD   . LYS A 1 237 ? 5.915   20.340 31.724 1.00 15.76  ? 240 LYS A CD   1  
ATOM   3554   C  CE   . LYS A 1 237 ? 5.250   18.978 31.514 1.00 16.07  ? 240 LYS A CE   1  
ATOM   3555   N  NZ   . LYS A 1 237 ? 3.839   19.036 31.991 1.00 17.98  ? 240 LYS A NZ   1  
ATOM   3556   H  H    . LYS A 1 237 ? 9.427   19.135 30.754 1.00 0.00   ? 240 LYS A H    1  
ATOM   3557   H  HA   . LYS A 1 237 ? 10.004  21.939 31.548 1.00 0.00   ? 240 LYS A HA   1  
ATOM   3558   H  HB2  . LYS A 1 237 ? 8.198   20.384 33.261 1.00 0.00   ? 240 LYS A HB2  1  
ATOM   3559   H  HB3  . LYS A 1 237 ? 7.932   21.949 32.491 1.00 0.00   ? 240 LYS A HB3  1  
ATOM   3560   H  HG2  . LYS A 1 237 ? 7.493   20.781 30.336 1.00 0.00   ? 240 LYS A HG2  1  
ATOM   3561   H  HG3  . LYS A 1 237 ? 7.666   19.235 31.166 1.00 0.00   ? 240 LYS A HG3  1  
ATOM   3562   H  HD2  . LYS A 1 237 ? 5.869   20.607 32.770 1.00 0.00   ? 240 LYS A HD2  1  
ATOM   3563   H  HD3  . LYS A 1 237 ? 5.396   21.085 31.139 1.00 0.00   ? 240 LYS A HD3  1  
ATOM   3564   H  HE2  . LYS A 1 237 ? 5.264   18.729 30.463 1.00 0.00   ? 240 LYS A HE2  1  
ATOM   3565   H  HE3  . LYS A 1 237 ? 5.788   18.225 32.071 1.00 0.00   ? 240 LYS A HE3  1  
ATOM   3566   H  HZ1  . LYS A 1 237 ? 3.417   19.946 31.719 1.00 0.00   ? 240 LYS A HZ1  1  
ATOM   3567   H  HZ2  . LYS A 1 237 ? 3.819   18.942 33.026 1.00 0.00   ? 240 LYS A HZ2  1  
ATOM   3568   H  HZ3  . LYS A 1 237 ? 3.297   18.258 31.561 1.00 0.00   ? 240 LYS A HZ3  1  
ATOM   3569   N  N    . VAL A 1 238 ? 11.439  21.288 33.458 1.00 10.31  ? 241 VAL A N    1  
ATOM   3570   C  CA   . VAL A 1 238 ? 12.394  20.811 34.484 1.00 10.77  ? 241 VAL A CA   1  
ATOM   3571   C  C    . VAL A 1 238 ? 12.435  21.751 35.674 1.00 10.14  ? 241 VAL A C    1  
ATOM   3572   O  O    . VAL A 1 238 ? 12.552  22.954 35.545 1.00 10.75  ? 241 VAL A O    1  
ATOM   3573   C  CB   . VAL A 1 238 ? 13.790  20.719 33.868 1.00 11.25  ? 241 VAL A CB   1  
ATOM   3574   C  CG1  . VAL A 1 238 ? 14.784  20.237 34.925 1.00 11.71  ? 241 VAL A CG1  1  
ATOM   3575   C  CG2  . VAL A 1 238 ? 13.767  19.728 32.702 1.00 12.69  ? 241 VAL A CG2  1  
ATOM   3576   H  H    . VAL A 1 238 ? 11.458  22.218 33.151 1.00 0.00   ? 241 VAL A H    1  
ATOM   3577   H  HA   . VAL A 1 238 ? 12.093  19.830 34.818 1.00 0.00   ? 241 VAL A HA   1  
ATOM   3578   H  HB   . VAL A 1 238 ? 14.090  21.693 33.509 1.00 0.00   ? 241 VAL A HB   1  
ATOM   3579   H  HG11 . VAL A 1 238 ? 15.625  19.763 34.440 1.00 0.00   ? 241 VAL A HG11 1  
ATOM   3580   H  HG12 . VAL A 1 238 ? 14.299  19.527 35.579 1.00 0.00   ? 241 VAL A HG12 1  
ATOM   3581   H  HG13 . VAL A 1 238 ? 15.132  21.080 35.504 1.00 0.00   ? 241 VAL A HG13 1  
ATOM   3582   H  HG21 . VAL A 1 238 ? 12.764  19.351 32.570 1.00 0.00   ? 241 VAL A HG21 1  
ATOM   3583   H  HG22 . VAL A 1 238 ? 14.435  18.907 32.914 1.00 0.00   ? 241 VAL A HG22 1  
ATOM   3584   H  HG23 . VAL A 1 238 ? 14.085  20.227 31.799 1.00 0.00   ? 241 VAL A HG23 1  
ATOM   3585   N  N    . LEU A 1 239 ? 12.369  21.187 36.835 1.00 9.42   ? 242 LEU A N    1  
ATOM   3586   C  CA   . LEU A 1 239 ? 12.435  21.992 38.082 1.00 9.14   ? 242 LEU A CA   1  
ATOM   3587   C  C    . LEU A 1 239 ? 13.860  21.901 38.633 1.00 9.52   ? 242 LEU A C    1  
ATOM   3588   O  O    . LEU A 1 239 ? 14.409  20.829 38.794 1.00 9.92   ? 242 LEU A O    1  
ATOM   3589   C  CB   . LEU A 1 239 ? 11.448  21.434 39.109 1.00 9.81   ? 242 LEU A CB   1  
ATOM   3590   C  CG   . LEU A 1 239 ? 11.470  22.306 40.366 1.00 10.29  ? 242 LEU A CG   1  
ATOM   3591   C  CD1  . LEU A 1 239 ? 10.517  23.488 40.185 1.00 11.72  ? 242 LEU A CD1  1  
ATOM   3592   C  CD2  . LEU A 1 239 ? 11.025  21.473 41.571 1.00 11.20  ? 242 LEU A CD2  1  
ATOM   3593   H  H    . LEU A 1 239 ? 12.298  20.211 36.894 1.00 0.00   ? 242 LEU A H    1  
ATOM   3594   H  HA   . LEU A 1 239 ? 12.193  23.022 37.864 1.00 0.00   ? 242 LEU A HA   1  
ATOM   3595   H  HB2  . LEU A 1 239 ? 10.452  21.433 38.688 1.00 0.00   ? 242 LEU A HB2  1  
ATOM   3596   H  HB3  . LEU A 1 239 ? 11.730  20.425 39.369 1.00 0.00   ? 242 LEU A HB3  1  
ATOM   3597   H  HG   . LEU A 1 239 ? 12.473  22.674 40.530 1.00 0.00   ? 242 LEU A HG   1  
ATOM   3598   H  HD11 . LEU A 1 239 ? 10.648  24.184 41.000 1.00 0.00   ? 242 LEU A HD11 1  
ATOM   3599   H  HD12 . LEU A 1 239 ? 9.498   23.131 40.177 1.00 0.00   ? 242 LEU A HD12 1  
ATOM   3600   H  HD13 . LEU A 1 239 ? 10.732  23.984 39.250 1.00 0.00   ? 242 LEU A HD13 1  
ATOM   3601   H  HD21 . LEU A 1 239 ? 11.486  21.863 42.467 1.00 0.00   ? 242 LEU A HD21 1  
ATOM   3602   H  HD22 . LEU A 1 239 ? 11.326  20.446 41.429 1.00 0.00   ? 242 LEU A HD22 1  
ATOM   3603   H  HD23 . LEU A 1 239 ? 9.951   21.524 41.666 1.00 0.00   ? 242 LEU A HD23 1  
ATOM   3604   N  N    . ILE A 1 240 ? 14.467  23.018 38.898 1.00 9.19   ? 243 ILE A N    1  
ATOM   3605   C  CA   . ILE A 1 240 ? 15.862  23.022 39.411 1.00 9.46   ? 243 ILE A CA   1  
ATOM   3606   C  C    . ILE A 1 240 ? 15.895  23.613 40.818 1.00 8.35   ? 243 ILE A C    1  
ATOM   3607   O  O    . ILE A 1 240 ? 15.809  24.810 41.013 1.00 9.13   ? 243 ILE A O    1  
ATOM   3608   C  CB   . ILE A 1 240 ? 16.742  23.863 38.485 1.00 9.72   ? 243 ILE A CB   1  
ATOM   3609   C  CG1  . ILE A 1 240 ? 16.660  23.307 37.061 1.00 12.24  ? 243 ILE A CG1  1  
ATOM   3610   C  CG2  . ILE A 1 240 ? 18.192  23.809 38.969 1.00 10.91  ? 243 ILE A CG2  1  
ATOM   3611   C  CD1  . ILE A 1 240 ? 17.215  24.339 36.077 1.00 13.45  ? 243 ILE A CD1  1  
ATOM   3612   H  H    . ILE A 1 240 ? 14.006  23.869 38.741 1.00 0.00   ? 243 ILE A H    1  
ATOM   3613   H  HA   . ILE A 1 240 ? 16.237  22.010 39.438 1.00 0.00   ? 243 ILE A HA   1  
ATOM   3614   H  HB   . ILE A 1 240 ? 16.398  24.887 38.494 1.00 0.00   ? 243 ILE A HB   1  
ATOM   3615   H  HG12 . ILE A 1 240 ? 17.240  22.398 36.996 1.00 0.00   ? 243 ILE A HG12 1  
ATOM   3616   H  HG13 . ILE A 1 240 ? 15.630  23.097 36.815 1.00 0.00   ? 243 ILE A HG13 1  
ATOM   3617   H  HG21 . ILE A 1 240 ? 18.858  23.880 38.121 1.00 0.00   ? 243 ILE A HG21 1  
ATOM   3618   H  HG22 . ILE A 1 240 ? 18.365  22.877 39.486 1.00 0.00   ? 243 ILE A HG22 1  
ATOM   3619   H  HG23 . ILE A 1 240 ? 18.378  24.633 39.642 1.00 0.00   ? 243 ILE A HG23 1  
ATOM   3620   H  HD11 . ILE A 1 240 ? 17.948  23.869 35.438 1.00 0.00   ? 243 ILE A HD11 1  
ATOM   3621   H  HD12 . ILE A 1 240 ? 17.680  25.145 36.625 1.00 0.00   ? 243 ILE A HD12 1  
ATOM   3622   H  HD13 . ILE A 1 240 ? 16.410  24.731 35.474 1.00 0.00   ? 243 ILE A HD13 1  
ATOM   3623   N  N    . VAL A 1 241 ? 16.026  22.770 41.791 1.00 8.16   ? 244 VAL A N    1  
ATOM   3624   C  CA   . VAL A 1 241 ? 16.079  23.220 43.194 1.00 8.21   ? 244 VAL A CA   1  
ATOM   3625   C  C    . VAL A 1 241 ? 17.511  23.602 43.496 1.00 7.94   ? 244 VAL A C    1  
ATOM   3626   O  O    . VAL A 1 241 ? 18.446  22.928 43.112 1.00 9.21   ? 244 VAL A O    1  
ATOM   3627   C  CB   . VAL A 1 241 ? 15.638  22.084 44.119 1.00 8.38   ? 244 VAL A CB   1  
ATOM   3628   C  CG1  . VAL A 1 241 ? 15.777  22.529 45.576 1.00 9.36   ? 244 VAL A CG1  1  
ATOM   3629   C  CG2  . VAL A 1 241 ? 14.176  21.733 43.833 1.00 9.28   ? 244 VAL A CG2  1  
ATOM   3630   H  H    . VAL A 1 241 ? 16.097  21.813 41.591 1.00 0.00   ? 244 VAL A H    1  
ATOM   3631   H  HA   . VAL A 1 241 ? 15.434  24.076 43.329 1.00 0.00   ? 244 VAL A HA   1  
ATOM   3632   H  HB   . VAL A 1 241 ? 16.259  21.217 43.947 1.00 0.00   ? 244 VAL A HB   1  
ATOM   3633   H  HG11 . VAL A 1 241 ? 16.613  22.017 46.030 1.00 0.00   ? 244 VAL A HG11 1  
ATOM   3634   H  HG12 . VAL A 1 241 ? 14.872  22.290 46.114 1.00 0.00   ? 244 VAL A HG12 1  
ATOM   3635   H  HG13 . VAL A 1 241 ? 15.946  23.596 45.612 1.00 0.00   ? 244 VAL A HG13 1  
ATOM   3636   H  HG21 . VAL A 1 241 ? 14.045  20.663 43.890 1.00 0.00   ? 244 VAL A HG21 1  
ATOM   3637   H  HG22 . VAL A 1 241 ? 13.910  22.076 42.844 1.00 0.00   ? 244 VAL A HG22 1  
ATOM   3638   H  HG23 . VAL A 1 241 ? 13.541  22.213 44.563 1.00 0.00   ? 244 VAL A HG23 1  
ATOM   3639   N  N    . HIS A 1 242 ? 17.690  24.689 44.153 1.00 7.93   ? 245 HIS A N    1  
ATOM   3640   C  CA   . HIS A 1 242 ? 19.057  25.152 44.460 1.00 7.76   ? 245 HIS A CA   1  
ATOM   3641   C  C    . HIS A 1 242 ? 19.104  25.574 45.912 1.00 7.40   ? 245 HIS A C    1  
ATOM   3642   O  O    . HIS A 1 242 ? 18.183  26.170 46.433 1.00 8.62   ? 245 HIS A O    1  
ATOM   3643   C  CB   . HIS A 1 242 ? 19.411  26.342 43.566 1.00 8.11   ? 245 HIS A CB   1  
ATOM   3644   C  CG   . HIS A 1 242 ? 20.890  26.603 43.640 1.00 8.92   ? 245 HIS A CG   1  
ATOM   3645   N  ND1  . HIS A 1 242 ? 21.694  26.634 42.508 1.00 8.78   ? 245 HIS A ND1  1  
ATOM   3646   C  CD2  . HIS A 1 242 ? 21.727  26.847 44.701 1.00 8.55   ? 245 HIS A CD2  1  
ATOM   3647   C  CE1  . HIS A 1 242 ? 22.953  26.888 42.912 1.00 9.30   ? 245 HIS A CE1  1  
ATOM   3648   N  NE2  . HIS A 1 242 ? 23.025  27.026 44.236 1.00 9.26   ? 245 HIS A NE2  1  
ATOM   3649   H  H    . HIS A 1 242 ? 16.918  25.225 44.431 1.00 0.00   ? 245 HIS A H    1  
ATOM   3650   H  HA   . HIS A 1 242 ? 19.760  24.350 44.291 1.00 0.00   ? 245 HIS A HA   1  
ATOM   3651   H  HB2  . HIS A 1 242 ? 19.134  26.121 42.546 1.00 0.00   ? 245 HIS A HB2  1  
ATOM   3652   H  HB3  . HIS A 1 242 ? 18.875  27.217 43.902 1.00 0.00   ? 245 HIS A HB3  1  
ATOM   3653   H  HD1  . HIS A 1 242 ? 21.398  26.495 41.584 1.00 0.00   ? 245 HIS A HD1  1  
ATOM   3654   H  HD2  . HIS A 1 242 ? 21.424  26.893 45.737 1.00 0.00   ? 245 HIS A HD2  1  
ATOM   3655   H  HE1  . HIS A 1 242 ? 23.799  26.970 42.246 1.00 0.00   ? 245 HIS A HE1  1  
ATOM   3656   H  HE2  . HIS A 1 242 ? 23.825  27.213 44.770 1.00 0.00   ? 245 HIS A HE2  1  
ATOM   3657   N  N    . SER A 1 243 ? 20.162  25.257 46.571 1.00 7.45   ? 246 SER A N    1  
ATOM   3658   C  CA   . SER A 1 243 ? 20.274  25.623 48.009 1.00 7.51   ? 246 SER A CA   1  
ATOM   3659   C  C    . SER A 1 243 ? 21.659  26.208 48.342 1.00 6.93   ? 246 SER A C    1  
ATOM   3660   O  O    . SER A 1 243 ? 22.665  25.884 47.743 1.00 7.83   ? 246 SER A O    1  
ATOM   3661   C  CB   . SER A 1 243 ? 20.041  24.376 48.862 1.00 8.55   ? 246 SER A CB   1  
ATOM   3662   O  OG   . SER A 1 243 ? 21.202  23.557 48.824 1.00 8.70   ? 246 SER A OG   1  
ATOM   3663   H  H    . SER A 1 243 ? 20.887  24.766 46.131 1.00 0.00   ? 246 SER A H    1  
ATOM   3664   H  HA   . SER A 1 243 ? 19.517  26.354 48.246 1.00 0.00   ? 246 SER A HA   1  
ATOM   3665   H  HB2  . SER A 1 243 ? 19.844  24.665 49.880 1.00 0.00   ? 246 SER A HB2  1  
ATOM   3666   H  HB3  . SER A 1 243 ? 19.190  23.830 48.474 1.00 0.00   ? 246 SER A HB3  1  
ATOM   3667   H  HG   . SER A 1 243 ? 21.124  22.898 49.517 1.00 0.00   ? 246 SER A HG   1  
ATOM   3668   N  N    . GLN A 1 244 ? 21.678  27.055 49.333 1.00 7.42   ? 247 GLN A N    1  
ATOM   3669   C  CA   . GLN A 1 244 ? 22.917  27.710 49.832 1.00 7.28   ? 247 GLN A CA   1  
ATOM   3670   C  C    . GLN A 1 244 ? 22.710  27.849 51.339 1.00 7.36   ? 247 GLN A C    1  
ATOM   3671   O  O    . GLN A 1 244 ? 21.901  28.634 51.794 1.00 7.99   ? 247 GLN A O    1  
ATOM   3672   C  CB   . GLN A 1 244 ? 23.081  29.091 49.190 1.00 7.64   ? 247 GLN A CB   1  
ATOM   3673   C  CG   . GLN A 1 244 ? 24.473  29.202 48.565 1.00 7.63   ? 247 GLN A CG   1  
ATOM   3674   C  CD   . GLN A 1 244 ? 25.530  29.215 49.671 1.00 7.77   ? 247 GLN A CD   1  
ATOM   3675   O  OE1  . GLN A 1 244 ? 25.202  29.226 50.841 1.00 7.96   ? 247 GLN A OE1  1  
ATOM   3676   N  NE2  . GLN A 1 244 ? 26.795  29.214 49.349 1.00 7.82   ? 247 GLN A NE2  1  
ATOM   3677   H  H    . GLN A 1 244 ? 20.833  27.257 49.786 1.00 0.00   ? 247 GLN A H    1  
ATOM   3678   H  HA   . GLN A 1 244 ? 23.779  27.089 49.627 1.00 0.00   ? 247 GLN A HA   1  
ATOM   3679   H  HB2  . GLN A 1 244 ? 22.330  29.223 48.425 1.00 0.00   ? 247 GLN A HB2  1  
ATOM   3680   H  HB3  . GLN A 1 244 ? 22.965  29.855 49.945 1.00 0.00   ? 247 GLN A HB3  1  
ATOM   3681   H  HG2  . GLN A 1 244 ? 24.643  28.358 47.913 1.00 0.00   ? 247 GLN A HG2  1  
ATOM   3682   H  HG3  . GLN A 1 244 ? 24.540  30.117 47.996 1.00 0.00   ? 247 GLN A HG3  1  
ATOM   3683   H  HE21 . GLN A 1 244 ? 27.059  29.205 48.405 1.00 0.00   ? 247 GLN A HE21 1  
ATOM   3684   H  HE22 . GLN A 1 244 ? 27.479  29.222 50.050 1.00 0.00   ? 247 GLN A HE22 1  
ATOM   3685   N  N    . ALA A 1 245 ? 23.356  27.028 52.105 1.00 7.56   ? 248 ALA A N    1  
ATOM   3686   C  CA   . ALA A 1 245 ? 23.116  27.029 53.594 1.00 7.73   ? 248 ALA A CA   1  
ATOM   3687   C  C    . ALA A 1 245 ? 23.857  28.144 54.349 1.00 7.76   ? 248 ALA A C    1  
ATOM   3688   O  O    . ALA A 1 245 ? 23.615  28.358 55.520 1.00 8.69   ? 248 ALA A O    1  
ATOM   3689   C  CB   . ALA A 1 245 ? 23.557  25.679 54.161 1.00 8.64   ? 248 ALA A CB   1  
ATOM   3690   H  H    . ALA A 1 245 ? 23.947  26.355 51.708 1.00 0.00   ? 248 ALA A H    1  
ATOM   3691   H  HA   . ALA A 1 245 ? 22.057  27.140 53.771 1.00 0.00   ? 248 ALA A HA   1  
ATOM   3692   H  HB1  . ALA A 1 245 ? 24.412  25.821 54.805 1.00 0.00   ? 248 ALA A HB1  1  
ATOM   3693   H  HB2  . ALA A 1 245 ? 23.823  25.018 53.349 1.00 0.00   ? 248 ALA A HB2  1  
ATOM   3694   H  HB3  . ALA A 1 245 ? 22.747  25.245 54.728 1.00 0.00   ? 248 ALA A HB3  1  
ATOM   3695   N  N    . ASN A 1 246 ? 24.754  28.841 53.729 1.00 7.44   ? 249 ASN A N    1  
ATOM   3696   C  CA   . ASN A 1 246 ? 25.494  29.915 54.466 1.00 7.59   ? 249 ASN A CA   1  
ATOM   3697   C  C    . ASN A 1 246 ? 26.089  30.956 53.498 1.00 7.95   ? 249 ASN A C    1  
ATOM   3698   O  O    . ASN A 1 246 ? 27.184  31.443 53.701 1.00 8.48   ? 249 ASN A O    1  
ATOM   3699   C  CB   . ASN A 1 246 ? 26.625  29.279 55.275 1.00 7.61   ? 249 ASN A CB   1  
ATOM   3700   C  CG   . ASN A 1 246 ? 27.553  30.374 55.805 1.00 7.72   ? 249 ASN A CG   1  
ATOM   3701   O  OD1  . ASN A 1 246 ? 27.286  30.969 56.830 1.00 9.07   ? 249 ASN A OD1  1  
ATOM   3702   N  ND2  . ASN A 1 246 ? 28.639  30.668 55.144 1.00 8.85   ? 249 ASN A ND2  1  
ATOM   3703   H  H    . ASN A 1 246 ? 24.957  28.658 52.788 1.00 0.00   ? 249 ASN A H    1  
ATOM   3704   H  HA   . ASN A 1 246 ? 24.814  30.411 55.143 1.00 0.00   ? 249 ASN A HA   1  
ATOM   3705   H  HB2  . ASN A 1 246 ? 26.208  28.727 56.105 1.00 0.00   ? 249 ASN A HB2  1  
ATOM   3706   H  HB3  . ASN A 1 246 ? 27.188  28.609 54.643 1.00 0.00   ? 249 ASN A HB3  1  
ATOM   3707   H  HD21 . ASN A 1 246 ? 28.855  30.188 54.317 1.00 0.00   ? 249 ASN A HD21 1  
ATOM   3708   H  HD22 . ASN A 1 246 ? 29.240  31.368 55.475 1.00 0.00   ? 249 ASN A HD22 1  
ATOM   3709   N  N    . ARG A 1 247 ? 25.372  31.320 52.471 1.00 8.49   ? 250 ARG A N    1  
ATOM   3710   C  CA   . ARG A 1 247 ? 25.883  32.354 51.510 1.00 8.39   ? 250 ARG A CA   1  
ATOM   3711   C  C    . ARG A 1 247 ? 24.771  32.715 50.507 1.00 7.77   ? 250 ARG A C    1  
ATOM   3712   O  O    . ARG A 1 247 ? 24.129  31.843 49.958 1.00 8.10   ? 250 ARG A O    1  
ATOM   3713   C  CB   . ARG A 1 247 ? 27.089  31.794 50.753 1.00 9.34   ? 250 ARG A CB   1  
ATOM   3714   C  CG   . ARG A 1 247 ? 27.468  32.748 49.618 1.00 10.68  ? 250 ARG A CG   1  
ATOM   3715   C  CD   . ARG A 1 247 ? 28.574  33.692 50.093 1.00 10.04  ? 250 ARG A CD   1  
ATOM   3716   N  NE   . ARG A 1 247 ? 29.639  33.771 49.054 1.00 10.31  ? 250 ARG A NE   1  
ATOM   3717   C  CZ   . ARG A 1 247 ? 29.605  34.717 48.155 1.00 9.83   ? 250 ARG A CZ   1  
ATOM   3718   N  NH1  . ARG A 1 247 ? 28.639  35.594 48.167 1.00 11.16  ? 250 ARG A NH1  1  
ATOM   3719   N  NH2  . ARG A 1 247 ? 30.538  34.787 47.245 1.00 10.71  ? 250 ARG A NH2  1  
ATOM   3720   H  H    . ARG A 1 247 ? 24.483  30.930 52.337 1.00 0.00   ? 250 ARG A H    1  
ATOM   3721   H  HA   . ARG A 1 247 ? 26.177  33.238 52.055 1.00 0.00   ? 250 ARG A HA   1  
ATOM   3722   H  HB2  . ARG A 1 247 ? 27.923  31.691 51.432 1.00 0.00   ? 250 ARG A HB2  1  
ATOM   3723   H  HB3  . ARG A 1 247 ? 26.839  30.828 50.340 1.00 0.00   ? 250 ARG A HB3  1  
ATOM   3724   H  HG2  . ARG A 1 247 ? 27.820  32.177 48.771 1.00 0.00   ? 250 ARG A HG2  1  
ATOM   3725   H  HG3  . ARG A 1 247 ? 26.603  33.326 49.330 1.00 0.00   ? 250 ARG A HG3  1  
ATOM   3726   H  HD2  . ARG A 1 247 ? 28.161  34.676 50.260 1.00 0.00   ? 250 ARG A HD2  1  
ATOM   3727   H  HD3  . ARG A 1 247 ? 28.997  33.318 51.014 1.00 0.00   ? 250 ARG A HD3  1  
ATOM   3728   H  HE   . ARG A 1 247 ? 30.365  33.113 49.045 1.00 0.00   ? 250 ARG A HE   1  
ATOM   3729   H  HH11 . ARG A 1 247 ? 27.924  35.541 48.865 1.00 0.00   ? 250 ARG A HH11 1  
ATOM   3730   H  HH12 . ARG A 1 247 ? 28.613  36.319 47.479 1.00 0.00   ? 250 ARG A HH12 1  
ATOM   3731   H  HH21 . ARG A 1 247 ? 31.279  34.115 47.236 1.00 0.00   ? 250 ARG A HH21 1  
ATOM   3732   H  HH22 . ARG A 1 247 ? 30.512  35.512 46.557 1.00 0.00   ? 250 ARG A HH22 1  
ATOM   3733   N  N    . ASP A 1 248 ? 24.527  33.988 50.254 1.00 7.97   ? 251 ASP A N    1  
ATOM   3734   C  CA   . ASP A 1 248 ? 23.438  34.336 49.273 1.00 7.62   ? 251 ASP A CA   1  
ATOM   3735   C  C    . ASP A 1 248 ? 23.931  34.189 47.811 1.00 7.72   ? 251 ASP A C    1  
ATOM   3736   O  O    . ASP A 1 248 ? 24.993  34.663 47.460 1.00 8.12   ? 251 ASP A O    1  
ATOM   3737   C  CB   . ASP A 1 248 ? 22.994  35.781 49.509 1.00 8.03   ? 251 ASP A CB   1  
ATOM   3738   C  CG   . ASP A 1 248 ? 22.745  36.001 51.002 1.00 7.51   ? 251 ASP A CG   1  
ATOM   3739   O  OD1  . ASP A 1 248 ? 22.217  35.101 51.634 1.00 8.72   ? 251 ASP A OD1  1  
ATOM   3740   O  OD2  . ASP A 1 248 ? 23.087  37.066 51.489 1.00 9.21   ? 251 ASP A OD2  1  
ATOM   3741   H  H    . ASP A 1 248 ? 25.044  34.693 50.697 1.00 0.00   ? 251 ASP A H    1  
ATOM   3742   H  HA   . ASP A 1 248 ? 22.597  33.678 49.430 1.00 0.00   ? 251 ASP A HA   1  
ATOM   3743   H  HB2  . ASP A 1 248 ? 23.767  36.455 49.169 1.00 0.00   ? 251 ASP A HB2  1  
ATOM   3744   H  HB3  . ASP A 1 248 ? 22.083  35.971 48.963 1.00 0.00   ? 251 ASP A HB3  1  
ATOM   3745   N  N    . THR A 1 249 ? 23.147  33.557 46.947 1.00 7.60   ? 252 THR A N    1  
ATOM   3746   C  CA   . THR A 1 249 ? 23.553  33.418 45.537 1.00 7.62   ? 252 THR A CA   1  
ATOM   3747   C  C    . THR A 1 249 ? 22.492  34.081 44.662 1.00 8.02   ? 252 THR A C    1  
ATOM   3748   O  O    . THR A 1 249 ? 21.583  34.731 45.140 1.00 8.58   ? 252 THR A O    1  
ATOM   3749   C  CB   . THR A 1 249 ? 23.664  31.934 45.177 1.00 8.22   ? 252 THR A CB   1  
ATOM   3750   O  OG1  . THR A 1 249 ? 23.767  31.798 43.766 1.00 8.60   ? 252 THR A OG1  1  
ATOM   3751   C  CG2  . THR A 1 249 ? 22.424  31.192 45.674 1.00 8.91   ? 252 THR A CG2  1  
ATOM   3752   H  H    . THR A 1 249 ? 22.284  33.199 47.243 1.00 0.00   ? 252 THR A H    1  
ATOM   3753   H  HA   . THR A 1 249 ? 24.506  33.903 45.384 1.00 0.00   ? 252 THR A HA   1  
ATOM   3754   H  HB   . THR A 1 249 ? 24.541  31.515 45.645 1.00 0.00   ? 252 THR A HB   1  
ATOM   3755   H  HG1  . THR A 1 249 ? 23.779  30.861 43.559 1.00 0.00   ? 252 THR A HG1  1  
ATOM   3756   H  HG21 . THR A 1 249 ? 22.490  31.056 46.744 1.00 0.00   ? 252 THR A HG21 1  
ATOM   3757   H  HG22 . THR A 1 249 ? 22.363  30.227 45.192 1.00 0.00   ? 252 THR A HG22 1  
ATOM   3758   H  HG23 . THR A 1 249 ? 21.541  31.768 45.439 1.00 0.00   ? 252 THR A HG23 1  
ATOM   3759   N  N    . ARG A 1 250 ? 22.609  33.912 43.390 1.00 8.09   ? 253 ARG A N    1  
ATOM   3760   C  CA   . ARG A 1 250 ? 21.632  34.507 42.429 1.00 8.55   ? 253 ARG A CA   1  
ATOM   3761   C  C    . ARG A 1 250 ? 21.659  33.669 41.145 1.00 8.44   ? 253 ARG A C    1  
ATOM   3762   O  O    . ARG A 1 250 ? 22.387  33.954 40.215 1.00 8.40   ? 253 ARG A O    1  
ATOM   3763   C  CB   . ARG A 1 250 ? 22.034  35.949 42.112 1.00 8.97   ? 253 ARG A CB   1  
ATOM   3764   C  CG   . ARG A 1 250 ? 23.513  35.995 41.722 1.00 8.54   ? 253 ARG A CG   1  
ATOM   3765   C  CD   . ARG A 1 250 ? 24.237  37.028 42.587 1.00 8.93   ? 253 ARG A CD   1  
ATOM   3766   N  NE   . ARG A 1 250 ? 24.240  36.574 44.006 1.00 8.89   ? 253 ARG A NE   1  
ATOM   3767   C  CZ   . ARG A 1 250 ? 25.331  36.662 44.717 1.00 10.15  ? 253 ARG A CZ   1  
ATOM   3768   N  NH1  . ARG A 1 250 ? 26.419  37.148 44.185 1.00 10.13  ? 253 ARG A NH1  1  
ATOM   3769   N  NH2  . ARG A 1 250 ? 25.334  36.264 45.960 1.00 10.85  ? 253 ARG A NH2  1  
ATOM   3770   H  H    . ARG A 1 250 ? 23.355  33.378 43.045 1.00 0.00   ? 253 ARG A H    1  
ATOM   3771   H  HA   . ARG A 1 250 ? 20.641  34.487 42.857 1.00 0.00   ? 253 ARG A HA   1  
ATOM   3772   H  HB2  . ARG A 1 250 ? 21.433  36.318 41.292 1.00 0.00   ? 253 ARG A HB2  1  
ATOM   3773   H  HB3  . ARG A 1 250 ? 21.874  36.567 42.982 1.00 0.00   ? 253 ARG A HB3  1  
ATOM   3774   H  HG2  . ARG A 1 250 ? 23.955  35.021 41.877 1.00 0.00   ? 253 ARG A HG2  1  
ATOM   3775   H  HG3  . ARG A 1 250 ? 23.603  36.271 40.683 1.00 0.00   ? 253 ARG A HG3  1  
ATOM   3776   H  HD2  . ARG A 1 250 ? 25.254  37.137 42.242 1.00 0.00   ? 253 ARG A HD2  1  
ATOM   3777   H  HD3  . ARG A 1 250 ? 23.729  37.978 42.514 1.00 0.00   ? 253 ARG A HD3  1  
ATOM   3778   H  HE   . ARG A 1 250 ? 23.423  36.209 44.406 1.00 0.00   ? 253 ARG A HE   1  
ATOM   3779   H  HH11 . ARG A 1 250 ? 26.417  37.453 43.233 1.00 0.00   ? 253 ARG A HH11 1  
ATOM   3780   H  HH12 . ARG A 1 250 ? 27.255  37.215 44.730 1.00 0.00   ? 253 ARG A HH12 1  
ATOM   3781   H  HH21 . ARG A 1 250 ? 24.500  35.891 46.367 1.00 0.00   ? 253 ARG A HH21 1  
ATOM   3782   H  HH22 . ARG A 1 250 ? 26.170  36.331 46.505 1.00 0.00   ? 253 ARG A HH22 1  
ATOM   3783   N  N    . PRO A 1 251 ? 20.891  32.617 41.129 1.00 8.47   ? 254 PRO A N    1  
ATOM   3784   C  CA   . PRO A 1 251 ? 20.818  31.660 39.989 1.00 9.09   ? 254 PRO A CA   1  
ATOM   3785   C  C    . PRO A 1 251 ? 20.410  32.309 38.671 1.00 9.23   ? 254 PRO A C    1  
ATOM   3786   O  O    . PRO A 1 251 ? 19.628  33.238 38.627 1.00 9.36   ? 254 PRO A O    1  
ATOM   3787   C  CB   . PRO A 1 251 ? 19.758  30.638 40.418 1.00 9.95   ? 254 PRO A CB   1  
ATOM   3788   C  CG   . PRO A 1 251 ? 19.632  30.780 41.897 1.00 9.93   ? 254 PRO A CG   1  
ATOM   3789   C  CD   . PRO A 1 251 ? 19.995  32.225 42.225 1.00 9.40   ? 254 PRO A CD   1  
ATOM   3790   H  HA   . PRO A 1 251 ? 21.762  31.156 39.871 1.00 0.00   ? 254 PRO A HA   1  
ATOM   3791   H  HB2  . PRO A 1 251 ? 18.815  30.857 39.937 1.00 0.00   ? 254 PRO A HB2  1  
ATOM   3792   H  HB3  . PRO A 1 251 ? 20.081  29.639 40.170 1.00 0.00   ? 254 PRO A HB3  1  
ATOM   3793   H  HG2  . PRO A 1 251 ? 18.616  30.570 42.203 1.00 0.00   ? 254 PRO A HG2  1  
ATOM   3794   H  HG3  . PRO A 1 251 ? 20.317  30.112 42.395 1.00 0.00   ? 254 PRO A HG3  1  
ATOM   3795   H  HD2  . PRO A 1 251 ? 19.108  32.844 42.235 1.00 0.00   ? 254 PRO A HD2  1  
ATOM   3796   H  HD3  . PRO A 1 251 ? 20.513  32.282 43.169 1.00 0.00   ? 254 PRO A HD3  1  
ATOM   3797   N  N    . HIS A 1 252 ? 20.928  31.795 37.595 1.00 9.15   ? 255 HIS A N    1  
ATOM   3798   C  CA   . HIS A 1 252 ? 20.577  32.335 36.241 1.00 9.57   ? 255 HIS A CA   1  
ATOM   3799   C  C    . HIS A 1 252 ? 20.896  31.298 35.132 1.00 9.90   ? 255 HIS A C    1  
ATOM   3800   O  O    . HIS A 1 252 ? 22.032  30.914 34.938 1.00 9.83   ? 255 HIS A O    1  
ATOM   3801   C  CB   . HIS A 1 252 ? 21.383  33.610 35.984 1.00 10.12  ? 255 HIS A CB   1  
ATOM   3802   C  CG   . HIS A 1 252 ? 21.284  33.981 34.529 1.00 10.96  ? 255 HIS A CG   1  
ATOM   3803   N  ND1  . HIS A 1 252 ? 20.297  34.830 34.047 1.00 13.67  ? 255 HIS A ND1  1  
ATOM   3804   C  CD2  . HIS A 1 252 ? 22.041  33.629 33.439 1.00 14.04  ? 255 HIS A CD2  1  
ATOM   3805   C  CE1  . HIS A 1 252 ? 20.484  34.958 32.720 1.00 15.33  ? 255 HIS A CE1  1  
ATOM   3806   N  NE2  . HIS A 1 252 ? 21.532  34.247 32.302 1.00 14.77  ? 255 HIS A NE2  1  
ATOM   3807   H  H    . HIS A 1 252 ? 21.542  31.035 37.669 1.00 0.00   ? 255 HIS A H    1  
ATOM   3808   H  HA   . HIS A 1 252 ? 19.523  32.570 36.214 1.00 0.00   ? 255 HIS A HA   1  
ATOM   3809   H  HB2  . HIS A 1 252 ? 20.988  34.414 36.588 1.00 0.00   ? 255 HIS A HB2  1  
ATOM   3810   H  HB3  . HIS A 1 252 ? 22.418  33.441 36.242 1.00 0.00   ? 255 HIS A HB3  1  
ATOM   3811   H  HD1  . HIS A 1 252 ? 19.592  35.258 34.577 1.00 0.00   ? 255 HIS A HD1  1  
ATOM   3812   H  HD2  . HIS A 1 252 ? 22.899  32.973 33.461 1.00 0.00   ? 255 HIS A HD2  1  
ATOM   3813   H  HE1  . HIS A 1 252 ? 19.863  35.561 32.075 1.00 0.00   ? 255 HIS A HE1  1  
ATOM   3814   H  HE2  . HIS A 1 252 ? 21.873  34.175 31.386 1.00 0.00   ? 255 HIS A HE2  1  
ATOM   3815   N  N    . LEU A 1 253 ? 19.893  30.870 34.388 1.00 10.31  ? 256 LEU A N    1  
ATOM   3816   C  CA   . LEU A 1 253 ? 20.106  29.900 33.282 1.00 10.52  ? 256 LEU A CA   1  
ATOM   3817   C  C    . LEU A 1 253 ? 20.443  30.681 32.010 1.00 11.02  ? 256 LEU A C    1  
ATOM   3818   O  O    . LEU A 1 253 ? 19.607  31.329 31.413 1.00 11.75  ? 256 LEU A O    1  
ATOM   3819   C  CB   . LEU A 1 253 ? 18.831  29.083 33.061 1.00 10.95  ? 256 LEU A CB   1  
ATOM   3820   C  CG   . LEU A 1 253 ? 19.035  28.124 31.888 1.00 11.42  ? 256 LEU A CG   1  
ATOM   3821   C  CD1  . LEU A 1 253 ? 20.102  27.090 32.252 1.00 12.57  ? 256 LEU A CD1  1  
ATOM   3822   C  CD2  . LEU A 1 253 ? 17.718  27.408 31.580 1.00 12.85  ? 256 LEU A CD2  1  
ATOM   3823   H  H    . LEU A 1 253 ? 18.991  31.214 34.556 1.00 0.00   ? 256 LEU A H    1  
ATOM   3824   H  HA   . LEU A 1 253 ? 20.924  29.239 33.530 1.00 0.00   ? 256 LEU A HA   1  
ATOM   3825   H  HB2  . LEU A 1 253 ? 18.607  28.518 33.955 1.00 0.00   ? 256 LEU A HB2  1  
ATOM   3826   H  HB3  . LEU A 1 253 ? 18.010  29.749 32.841 1.00 0.00   ? 256 LEU A HB3  1  
ATOM   3827   H  HG   . LEU A 1 253 ? 19.356  28.681 31.019 1.00 0.00   ? 256 LEU A HG   1  
ATOM   3828   H  HD11 . LEU A 1 253 ? 20.753  26.931 31.405 1.00 0.00   ? 256 LEU A HD11 1  
ATOM   3829   H  HD12 . LEU A 1 253 ? 19.625  26.159 32.519 1.00 0.00   ? 256 LEU A HD12 1  
ATOM   3830   H  HD13 . LEU A 1 253 ? 20.682  27.451 33.089 1.00 0.00   ? 256 LEU A HD13 1  
ATOM   3831   H  HD21 . LEU A 1 253 ? 17.642  26.518 32.186 1.00 0.00   ? 256 LEU A HD21 1  
ATOM   3832   H  HD22 . LEU A 1 253 ? 17.691  27.136 30.535 1.00 0.00   ? 256 LEU A HD22 1  
ATOM   3833   H  HD23 . LEU A 1 253 ? 16.891  28.066 31.802 1.00 0.00   ? 256 LEU A HD23 1  
ATOM   3834   N  N    . ILE A 1 254 ? 21.675  30.630 31.620 1.00 11.36  ? 257 ILE A N    1  
ATOM   3835   C  CA   . ILE A 1 254 ? 22.149  31.355 30.425 1.00 12.09  ? 257 ILE A CA   1  
ATOM   3836   C  C    . ILE A 1 254 ? 21.452  30.797 29.212 1.00 12.57  ? 257 ILE A C    1  
ATOM   3837   O  O    . ILE A 1 254 ? 21.517  29.619 28.918 1.00 13.08  ? 257 ILE A O    1  
ATOM   3838   C  CB   . ILE A 1 254 ? 23.660  31.172 30.279 1.00 13.04  ? 257 ILE A CB   1  
ATOM   3839   C  CG1  . ILE A 1 254 ? 24.355  31.638 31.561 1.00 14.27  ? 257 ILE A CG1  1  
ATOM   3840   C  CG2  . ILE A 1 254 ? 24.163  32.003 29.097 1.00 13.44  ? 257 ILE A CG2  1  
ATOM   3841   C  CD1  . ILE A 1 254 ? 25.848  31.835 31.290 1.00 17.09  ? 257 ILE A CD1  1  
ATOM   3842   H  H    . ILE A 1 254 ? 22.317  30.107 32.144 1.00 0.00   ? 257 ILE A H    1  
ATOM   3843   H  HA   . ILE A 1 254 ? 21.920  32.405 30.524 1.00 0.00   ? 257 ILE A HA   1  
ATOM   3844   H  HB   . ILE A 1 254 ? 23.881  30.129 30.105 1.00 0.00   ? 257 ILE A HB   1  
ATOM   3845   H  HG12 . ILE A 1 254 ? 23.921  32.572 31.886 1.00 0.00   ? 257 ILE A HG12 1  
ATOM   3846   H  HG13 . ILE A 1 254 ? 24.226  30.893 32.331 1.00 0.00   ? 257 ILE A HG13 1  
ATOM   3847   H  HG21 . ILE A 1 254 ? 25.169  31.699 28.846 1.00 0.00   ? 257 ILE A HG21 1  
ATOM   3848   H  HG22 . ILE A 1 254 ? 24.160  33.049 29.366 1.00 0.00   ? 257 ILE A HG22 1  
ATOM   3849   H  HG23 . ILE A 1 254 ? 23.517  31.848 28.247 1.00 0.00   ? 257 ILE A HG23 1  
ATOM   3850   H  HD11 . ILE A 1 254 ? 25.985  32.675 30.626 1.00 0.00   ? 257 ILE A HD11 1  
ATOM   3851   H  HD12 . ILE A 1 254 ? 26.251  30.944 30.832 1.00 0.00   ? 257 ILE A HD12 1  
ATOM   3852   H  HD13 . ILE A 1 254 ? 26.361  32.024 32.222 1.00 0.00   ? 257 ILE A HD13 1  
ATOM   3853   N  N    . GLY A 1 255 ? 20.775  31.633 28.516 1.00 12.26  ? 258 GLY A N    1  
ATOM   3854   C  CA   . GLY A 1 255 ? 20.038  31.170 27.306 1.00 13.06  ? 258 GLY A CA   1  
ATOM   3855   C  C    . GLY A 1 255 ? 18.570  30.860 27.654 1.00 12.40  ? 258 GLY A C    1  
ATOM   3856   O  O    . GLY A 1 255 ? 17.744  30.709 26.775 1.00 12.68  ? 258 GLY A O    1  
ATOM   3857   H  H    . GLY A 1 255 ? 20.734  32.574 28.785 1.00 0.00   ? 258 GLY A H    1  
ATOM   3858   H  HA2  . GLY A 1 255 ? 20.072  31.943 26.551 1.00 0.00   ? 258 GLY A HA2  1  
ATOM   3859   H  HA3  . GLY A 1 255 ? 20.507  30.276 26.923 1.00 0.00   ? 258 GLY A HA3  1  
ATOM   3860   N  N    . GLY A 1 256 ? 18.229  30.757 28.918 1.00 12.07  ? 259 GLY A N    1  
ATOM   3861   C  CA   . GLY A 1 256 ? 16.819  30.453 29.275 1.00 12.05  ? 259 GLY A CA   1  
ATOM   3862   C  C    . GLY A 1 256 ? 16.342  31.419 30.354 1.00 11.32  ? 259 GLY A C    1  
ATOM   3863   O  O    . GLY A 1 256 ? 16.827  32.527 30.474 1.00 11.25  ? 259 GLY A O    1  
ATOM   3864   H  H    . GLY A 1 256 ? 18.901  30.876 29.621 1.00 0.00   ? 259 GLY A H    1  
ATOM   3865   H  HA2  . GLY A 1 256 ? 16.197  30.556 28.397 1.00 0.00   ? 259 GLY A HA2  1  
ATOM   3866   H  HA3  . GLY A 1 256 ? 16.752  29.442 29.647 1.00 0.00   ? 259 GLY A HA3  1  
ATOM   3867   N  N    . HIS A 1 257 ? 15.393  31.004 31.138 1.00 10.61  ? 260 HIS A N    1  
ATOM   3868   C  CA   . HIS A 1 257 ? 14.868  31.885 32.216 1.00 11.45  ? 260 HIS A CA   1  
ATOM   3869   C  C    . HIS A 1 257 ? 13.965  31.069 33.147 1.00 11.27  ? 260 HIS A C    1  
ATOM   3870   O  O    . HIS A 1 257 ? 13.436  30.041 32.774 1.00 11.43  ? 260 HIS A O    1  
ATOM   3871   C  CB   . HIS A 1 257 ? 14.062  33.027 31.595 1.00 12.22  ? 260 HIS A CB   1  
ATOM   3872   C  CG   . HIS A 1 257 ? 14.827  33.611 30.440 1.00 14.36  ? 260 HIS A CG   1  
ATOM   3873   N  ND1  . HIS A 1 257 ? 15.220  32.846 29.350 1.00 17.81  ? 260 HIS A ND1  1  
ATOM   3874   C  CD2  . HIS A 1 257 ? 15.281  34.883 30.188 1.00 15.59  ? 260 HIS A CD2  1  
ATOM   3875   C  CE1  . HIS A 1 257 ? 15.879  33.658 28.501 1.00 16.17  ? 260 HIS A CE1  1  
ATOM   3876   N  NE2  . HIS A 1 257 ? 15.942  34.906 28.966 1.00 17.81  ? 260 HIS A NE2  1  
ATOM   3877   H  H    . HIS A 1 257 ? 15.020  30.106 31.018 1.00 0.00   ? 260 HIS A H    1  
ATOM   3878   H  HA   . HIS A 1 257 ? 15.693  32.293 32.782 1.00 0.00   ? 260 HIS A HA   1  
ATOM   3879   H  HB2  . HIS A 1 257 ? 13.113  32.648 31.244 1.00 0.00   ? 260 HIS A HB2  1  
ATOM   3880   H  HB3  . HIS A 1 257 ? 13.892  33.793 32.337 1.00 0.00   ? 260 HIS A HB3  1  
ATOM   3881   H  HD1  . HIS A 1 257 ? 15.049  31.890 29.222 1.00 0.00   ? 260 HIS A HD1  1  
ATOM   3882   H  HD2  . HIS A 1 257 ? 15.145  35.734 30.840 1.00 0.00   ? 260 HIS A HD2  1  
ATOM   3883   H  HE1  . HIS A 1 257 ? 16.303  33.337 27.561 1.00 0.00   ? 260 HIS A HE1  1  
ATOM   3884   H  HE2  . HIS A 1 257 ? 16.366  35.678 28.536 1.00 0.00   ? 260 HIS A HE2  1  
ATOM   3885   N  N    . GLY A 1 258 ? 13.788  31.525 34.355 1.00 11.23  ? 261 GLY A N    1  
ATOM   3886   C  CA   . GLY A 1 258 ? 12.927  30.794 35.322 1.00 11.14  ? 261 GLY A CA   1  
ATOM   3887   C  C    . GLY A 1 258 ? 11.481  31.157 35.034 1.00 11.12  ? 261 GLY A C    1  
ATOM   3888   O  O    . GLY A 1 258 ? 11.012  32.220 35.390 1.00 11.01  ? 261 GLY A O    1  
ATOM   3889   H  H    . GLY A 1 258 ? 14.227  32.357 34.629 1.00 0.00   ? 261 GLY A H    1  
ATOM   3890   H  HA2  . GLY A 1 258 ? 13.069  29.729 35.203 1.00 0.00   ? 261 GLY A HA2  1  
ATOM   3891   H  HA3  . GLY A 1 258 ? 13.178  31.088 36.329 1.00 0.00   ? 261 GLY A HA3  1  
ATOM   3892   N  N    . ASP A 1 259 ? 10.780  30.298 34.366 1.00 11.15  ? 262 ASP A N    1  
ATOM   3893   C  CA   . ASP A 1 259 ? 9.362   30.613 34.021 1.00 11.22  ? 262 ASP A CA   1  
ATOM   3894   C  C    . ASP A 1 259 ? 8.625   30.939 35.303 1.00 10.94  ? 262 ASP A C    1  
ATOM   3895   O  O    . ASP A 1 259 ? 8.012   31.977 35.452 1.00 11.43  ? 262 ASP A O    1  
ATOM   3896   C  CB   . ASP A 1 259 ? 8.714   29.401 33.347 1.00 11.71  ? 262 ASP A CB   1  
ATOM   3897   C  CG   . ASP A 1 259 ? 9.188   29.310 31.895 1.00 12.70  ? 262 ASP A CG   1  
ATOM   3898   O  OD1  . ASP A 1 259 ? 9.629   30.320 31.372 1.00 13.16  ? 262 ASP A OD1  1  
ATOM   3899   O  OD2  . ASP A 1 259 ? 9.102   28.231 31.332 1.00 13.51  ? 262 ASP A OD2  1  
ATOM   3900   H  H    . ASP A 1 259 ? 11.185  29.457 34.068 1.00 0.00   ? 262 ASP A H    1  
ATOM   3901   H  HA   . ASP A 1 259 ? 9.330   31.463 33.355 1.00 0.00   ? 262 ASP A HA   1  
ATOM   3902   H  HB2  . ASP A 1 259 ? 8.996   28.502 33.876 1.00 0.00   ? 262 ASP A HB2  1  
ATOM   3903   H  HB3  . ASP A 1 259 ? 7.640   29.510 33.367 1.00 0.00   ? 262 ASP A HB3  1  
ATOM   3904   N  N    . TYR A 1 260 ? 8.715   30.054 36.235 1.00 10.24  ? 263 TYR A N    1  
ATOM   3905   C  CA   . TYR A 1 260 ? 8.065   30.259 37.556 1.00 10.50  ? 263 TYR A CA   1  
ATOM   3906   C  C    . TYR A 1 260 ? 9.128   29.979 38.605 1.00 10.35  ? 263 TYR A C    1  
ATOM   3907   O  O    . TYR A 1 260 ? 9.749   28.934 38.596 1.00 11.80  ? 263 TYR A O    1  
ATOM   3908   C  CB   . TYR A 1 260 ? 6.897   29.283 37.721 1.00 11.30  ? 263 TYR A CB   1  
ATOM   3909   C  CG   . TYR A 1 260 ? 5.964   29.409 36.540 1.00 11.97  ? 263 TYR A CG   1  
ATOM   3910   C  CD1  . TYR A 1 260 ? 6.191   28.652 35.385 1.00 14.80  ? 263 TYR A CD1  1  
ATOM   3911   C  CD2  . TYR A 1 260 ? 4.873   30.284 36.601 1.00 13.21  ? 263 TYR A CD2  1  
ATOM   3912   C  CE1  . TYR A 1 260 ? 5.326   28.768 34.290 1.00 16.51  ? 263 TYR A CE1  1  
ATOM   3913   C  CE2  . TYR A 1 260 ? 4.008   30.401 35.506 1.00 16.43  ? 263 TYR A CE2  1  
ATOM   3914   C  CZ   . TYR A 1 260 ? 4.235   29.643 34.351 1.00 16.66  ? 263 TYR A CZ   1  
ATOM   3915   O  OH   . TYR A 1 260 ? 3.382   29.758 33.272 1.00 22.74  ? 263 TYR A OH   1  
ATOM   3916   H  H    . TYR A 1 260 ? 9.237   29.240 36.077 1.00 0.00   ? 263 TYR A H    1  
ATOM   3917   H  HA   . TYR A 1 260 ? 7.717   31.278 37.643 1.00 0.00   ? 263 TYR A HA   1  
ATOM   3918   H  HB2  . TYR A 1 260 ? 7.276   28.273 37.774 1.00 0.00   ? 263 TYR A HB2  1  
ATOM   3919   H  HB3  . TYR A 1 260 ? 6.360   29.515 38.629 1.00 0.00   ? 263 TYR A HB3  1  
ATOM   3920   H  HD1  . TYR A 1 260 ? 7.033   27.977 35.338 1.00 0.00   ? 263 TYR A HD1  1  
ATOM   3921   H  HD2  . TYR A 1 260 ? 4.698   30.868 37.492 1.00 0.00   ? 263 TYR A HD2  1  
ATOM   3922   H  HE1  . TYR A 1 260 ? 5.501   28.184 33.399 1.00 0.00   ? 263 TYR A HE1  1  
ATOM   3923   H  HE2  . TYR A 1 260 ? 3.166   31.075 35.553 1.00 0.00   ? 263 TYR A HE2  1  
ATOM   3924   H  HH   . TYR A 1 260 ? 2.641   30.308 33.536 1.00 0.00   ? 263 TYR A HH   1  
ATOM   3925   N  N    . VAL A 1 261 ? 9.399   30.902 39.478 1.00 10.09  ? 264 VAL A N    1  
ATOM   3926   C  CA   . VAL A 1 261 ? 10.486  30.642 40.459 1.00 9.94   ? 264 VAL A CA   1  
ATOM   3927   C  C    . VAL A 1 261 ? 10.082  31.003 41.885 1.00 9.18   ? 264 VAL A C    1  
ATOM   3928   O  O    . VAL A 1 261 ? 9.980   32.159 42.248 1.00 9.87   ? 264 VAL A O    1  
ATOM   3929   C  CB   . VAL A 1 261 ? 11.715  31.462 40.068 1.00 10.19  ? 264 VAL A CB   1  
ATOM   3930   C  CG1  . VAL A 1 261 ? 12.839  31.211 41.074 1.00 10.48  ? 264 VAL A CG1  1  
ATOM   3931   C  CG2  . VAL A 1 261 ? 12.181  31.046 38.670 1.00 10.44  ? 264 VAL A CG2  1  
ATOM   3932   H  H    . VAL A 1 261 ? 8.930   31.762 39.463 1.00 0.00   ? 264 VAL A H    1  
ATOM   3933   H  HA   . VAL A 1 261 ? 10.745  29.595 40.424 1.00 0.00   ? 264 VAL A HA   1  
ATOM   3934   H  HB   . VAL A 1 261 ? 11.461  32.513 40.067 1.00 0.00   ? 264 VAL A HB   1  
ATOM   3935   H  HG11 . VAL A 1 261 ? 13.265  30.234 40.902 1.00 0.00   ? 264 VAL A HG11 1  
ATOM   3936   H  HG12 . VAL A 1 261 ? 12.441  31.259 42.077 1.00 0.00   ? 264 VAL A HG12 1  
ATOM   3937   H  HG13 . VAL A 1 261 ? 13.604  31.963 40.954 1.00 0.00   ? 264 VAL A HG13 1  
ATOM   3938   H  HG21 . VAL A 1 261 ? 12.009  29.989 38.534 1.00 0.00   ? 264 VAL A HG21 1  
ATOM   3939   H  HG22 . VAL A 1 261 ? 13.235  31.256 38.565 1.00 0.00   ? 264 VAL A HG22 1  
ATOM   3940   H  HG23 . VAL A 1 261 ? 11.628  31.600 37.927 1.00 0.00   ? 264 VAL A HG23 1  
ATOM   3941   N  N    . TRP A 1 262 ? 9.919   30.010 42.710 1.00 9.08   ? 265 TRP A N    1  
ATOM   3942   C  CA   . TRP A 1 262 ? 9.598   30.258 44.144 1.00 9.60   ? 265 TRP A CA   1  
ATOM   3943   C  C    . TRP A 1 262 ? 10.922  30.650 44.775 1.00 9.15   ? 265 TRP A C    1  
ATOM   3944   O  O    . TRP A 1 262 ? 11.673  29.826 45.259 1.00 9.15   ? 265 TRP A O    1  
ATOM   3945   C  CB   . TRP A 1 262 ? 9.058   28.982 44.795 1.00 9.37   ? 265 TRP A CB   1  
ATOM   3946   C  CG   . TRP A 1 262 ? 7.778   28.587 44.131 1.00 9.83   ? 265 TRP A CG   1  
ATOM   3947   C  CD1  . TRP A 1 262 ? 6.546   28.996 44.512 1.00 10.01  ? 265 TRP A CD1  1  
ATOM   3948   C  CD2  . TRP A 1 262 ? 7.582   27.716 42.979 1.00 9.61   ? 265 TRP A CD2  1  
ATOM   3949   N  NE1  . TRP A 1 262 ? 5.607   28.431 43.669 1.00 10.14  ? 265 TRP A NE1  1  
ATOM   3950   C  CE2  . TRP A 1 262 ? 6.196   27.634 42.707 1.00 11.08  ? 265 TRP A CE2  1  
ATOM   3951   C  CE3  . TRP A 1 262 ? 8.463   26.996 42.153 1.00 10.40  ? 265 TRP A CE3  1  
ATOM   3952   C  CZ2  . TRP A 1 262 ? 5.701   26.865 41.653 1.00 11.71  ? 265 TRP A CZ2  1  
ATOM   3953   C  CZ3  . TRP A 1 262 ? 7.969   26.221 41.090 1.00 10.95  ? 265 TRP A CZ3  1  
ATOM   3954   C  CH2  . TRP A 1 262 ? 6.591   26.156 40.841 1.00 11.62  ? 265 TRP A CH2  1  
ATOM   3955   H  H    . TRP A 1 262 ? 10.057  29.092 42.396 1.00 0.00   ? 265 TRP A H    1  
ATOM   3956   H  HA   . TRP A 1 262 ? 8.885   31.066 44.235 1.00 0.00   ? 265 TRP A HA   1  
ATOM   3957   H  HB2  . TRP A 1 262 ? 9.781   28.187 44.684 1.00 0.00   ? 265 TRP A HB2  1  
ATOM   3958   H  HB3  . TRP A 1 262 ? 8.878   29.161 45.845 1.00 0.00   ? 265 TRP A HB3  1  
ATOM   3959   H  HD1  . TRP A 1 262 ? 6.332   29.655 45.340 1.00 0.00   ? 265 TRP A HD1  1  
ATOM   3960   H  HE1  . TRP A 1 262 ? 4.638   28.567 43.729 1.00 0.00   ? 265 TRP A HE1  1  
ATOM   3961   H  HE3  . TRP A 1 262 ? 9.527   27.039 42.336 1.00 0.00   ? 265 TRP A HE3  1  
ATOM   3962   H  HZ2  . TRP A 1 262 ? 4.639   26.819 41.465 1.00 0.00   ? 265 TRP A HZ2  1  
ATOM   3963   H  HZ3  . TRP A 1 262 ? 8.655   25.672 40.462 1.00 0.00   ? 265 TRP A HZ3  1  
ATOM   3964   H  HH2  . TRP A 1 262 ? 6.217   25.559 40.023 1.00 0.00   ? 265 TRP A HH2  1  
ATOM   3965   N  N    . ALA A 1 263 ? 11.251  31.892 44.662 1.00 10.05  ? 266 ALA A N    1  
ATOM   3966   C  CA   . ALA A 1 263 ? 12.585  32.376 45.129 1.00 10.48  ? 266 ALA A CA   1  
ATOM   3967   C  C    . ALA A 1 263 ? 12.768  32.065 46.587 1.00 10.52  ? 266 ALA A C    1  
ATOM   3968   O  O    . ALA A 1 263 ? 13.812  31.626 47.028 1.00 11.77  ? 266 ALA A O    1  
ATOM   3969   C  CB   . ALA A 1 263 ? 12.678  33.888 44.917 1.00 11.32  ? 266 ALA A CB   1  
ATOM   3970   H  H    . ALA A 1 263 ? 10.652  32.508 44.191 1.00 0.00   ? 266 ALA A H    1  
ATOM   3971   H  HA   . ALA A 1 263 ? 13.361  31.889 44.559 1.00 0.00   ? 266 ALA A HA   1  
ATOM   3972   H  HB1  . ALA A 1 263 ? 12.621  34.108 43.862 1.00 0.00   ? 266 ALA A HB1  1  
ATOM   3973   H  HB2  . ALA A 1 263 ? 13.617  34.249 45.310 1.00 0.00   ? 266 ALA A HB2  1  
ATOM   3974   H  HB3  . ALA A 1 263 ? 11.862  34.375 45.431 1.00 0.00   ? 266 ALA A HB3  1  
ATOM   3975   N  N    . THR A 1 264 ? 11.762  32.302 47.334 1.00 9.81   ? 267 THR A N    1  
ATOM   3976   C  CA   . THR A 1 264 ? 11.841  32.042 48.801 1.00 10.13  ? 267 THR A CA   1  
ATOM   3977   C  C    . THR A 1 264 ? 11.817  30.535 49.082 1.00 8.79   ? 267 THR A C    1  
ATOM   3978   O  O    . THR A 1 264 ? 12.032  30.104 50.198 1.00 8.62   ? 267 THR A O    1  
ATOM   3979   C  CB   . THR A 1 264 ? 10.650  32.705 49.497 1.00 9.97   ? 267 THR A CB   1  
ATOM   3980   O  OG1  . THR A 1 264 ? 9.463   31.990 49.184 1.00 10.77  ? 267 THR A OG1  1  
ATOM   3981   C  CG2  . THR A 1 264 ? 10.518  34.152 49.019 1.00 12.01  ? 267 THR A CG2  1  
ATOM   3982   H  H    . THR A 1 264 ? 10.939  32.665 46.945 1.00 0.00   ? 267 THR A H    1  
ATOM   3983   H  HA   . THR A 1 264 ? 12.757  32.462 49.189 1.00 0.00   ? 267 THR A HA   1  
ATOM   3984   H  HB   . THR A 1 264 ? 10.805  32.696 50.565 1.00 0.00   ? 267 THR A HB   1  
ATOM   3985   H  HG1  . THR A 1 264 ? 9.678   31.055 49.159 1.00 0.00   ? 267 THR A HG1  1  
ATOM   3986   H  HG21 . THR A 1 264 ? 9.987   34.174 48.079 1.00 0.00   ? 267 THR A HG21 1  
ATOM   3987   H  HG22 . THR A 1 264 ? 11.501  34.579 48.887 1.00 0.00   ? 267 THR A HG22 1  
ATOM   3988   H  HG23 . THR A 1 264 ? 9.972   34.726 49.754 1.00 0.00   ? 267 THR A HG23 1  
ATOM   3989   N  N    . GLY A 1 265 ? 11.555  29.726 48.091 1.00 8.63   ? 268 GLY A N    1  
ATOM   3990   C  CA   . GLY A 1 265 ? 11.519  28.240 48.332 1.00 8.96   ? 268 GLY A CA   1  
ATOM   3991   C  C    . GLY A 1 265 ? 10.237  27.805 49.096 1.00 8.59   ? 268 GLY A C    1  
ATOM   3992   O  O    . GLY A 1 265 ? 10.186  26.731 49.662 1.00 9.28   ? 268 GLY A O    1  
ATOM   3993   H  H    . GLY A 1 265 ? 11.380  30.084 47.196 1.00 0.00   ? 268 GLY A H    1  
ATOM   3994   H  HA2  . GLY A 1 265 ? 11.551  27.730 47.380 1.00 0.00   ? 268 GLY A HA2  1  
ATOM   3995   H  HA3  . GLY A 1 265 ? 12.385  27.957 48.912 1.00 0.00   ? 268 GLY A HA3  1  
ATOM   3996   N  N    . LYS A 1 266 ? 9.207   28.614 49.100 1.00 8.38   ? 269 LYS A N    1  
ATOM   3997   C  CA   . LYS A 1 266 ? 7.946   28.256 49.791 1.00 8.58   ? 269 LYS A CA   1  
ATOM   3998   C  C    . LYS A 1 266 ? 6.860   28.162 48.727 1.00 9.02   ? 269 LYS A C    1  
ATOM   3999   O  O    . LYS A 1 266 ? 6.713   29.036 47.896 1.00 9.34   ? 269 LYS A O    1  
ATOM   4000   C  CB   . LYS A 1 266 ? 7.584   29.341 50.808 1.00 8.85   ? 269 LYS A CB   1  
ATOM   4001   C  CG   . LYS A 1 266 ? 8.802   29.650 51.681 1.00 8.88   ? 269 LYS A CG   1  
ATOM   4002   C  CD   . LYS A 1 266 ? 9.423   28.341 52.173 1.00 9.37   ? 269 LYS A CD   1  
ATOM   4003   C  CE   . LYS A 1 266 ? 10.835  28.610 52.695 1.00 8.96   ? 269 LYS A CE   1  
ATOM   4004   N  NZ   . LYS A 1 266 ? 11.828  28.274 51.635 1.00 8.69   ? 269 LYS A NZ   1  
ATOM   4005   H  H    . LYS A 1 266 ? 9.267   29.469 48.625 1.00 0.00   ? 269 LYS A H    1  
ATOM   4006   H  HA   . LYS A 1 266 ? 8.057   27.304 50.289 1.00 0.00   ? 269 LYS A HA   1  
ATOM   4007   H  HB2  . LYS A 1 266 ? 7.278   30.236 50.286 1.00 0.00   ? 269 LYS A HB2  1  
ATOM   4008   H  HB3  . LYS A 1 266 ? 6.775   28.994 51.432 1.00 0.00   ? 269 LYS A HB3  1  
ATOM   4009   H  HG2  . LYS A 1 266 ? 9.530   30.199 51.101 1.00 0.00   ? 269 LYS A HG2  1  
ATOM   4010   H  HG3  . LYS A 1 266 ? 8.496   30.242 52.530 1.00 0.00   ? 269 LYS A HG3  1  
ATOM   4011   H  HD2  . LYS A 1 266 ? 8.816   27.932 52.968 1.00 0.00   ? 269 LYS A HD2  1  
ATOM   4012   H  HD3  . LYS A 1 266 ? 9.470   27.636 51.357 1.00 0.00   ? 269 LYS A HD3  1  
ATOM   4013   H  HE2  . LYS A 1 266 ? 10.929  29.653 52.959 1.00 0.00   ? 269 LYS A HE2  1  
ATOM   4014   H  HE3  . LYS A 1 266 ? 11.019  27.999 53.567 1.00 0.00   ? 269 LYS A HE3  1  
ATOM   4015   H  HZ1  . LYS A 1 266 ? 11.721  27.277 51.362 1.00 0.00   ? 269 LYS A HZ1  1  
ATOM   4016   H  HZ2  . LYS A 1 266 ? 12.790  28.430 51.999 1.00 0.00   ? 269 LYS A HZ2  1  
ATOM   4017   H  HZ3  . LYS A 1 266 ? 11.668  28.882 50.806 1.00 0.00   ? 269 LYS A HZ3  1  
ATOM   4018   N  N    . PHE A 1 267 ? 6.128   27.097 48.717 1.00 9.23   ? 270 PHE A N    1  
ATOM   4019   C  CA   . PHE A 1 267 ? 5.076   26.926 47.670 1.00 10.19  ? 270 PHE A CA   1  
ATOM   4020   C  C    . PHE A 1 267 ? 3.894   27.854 47.941 1.00 10.80  ? 270 PHE A C    1  
ATOM   4021   O  O    . PHE A 1 267 ? 3.305   28.406 47.034 1.00 12.75  ? 270 PHE A O    1  
ATOM   4022   C  CB   . PHE A 1 267 ? 4.591   25.475 47.674 1.00 10.57  ? 270 PHE A CB   1  
ATOM   4023   C  CG   . PHE A 1 267 ? 5.632   24.593 47.027 1.00 10.05  ? 270 PHE A CG   1  
ATOM   4024   C  CD1  . PHE A 1 267 ? 6.186   24.955 45.793 1.00 10.48  ? 270 PHE A CD1  1  
ATOM   4025   C  CD2  . PHE A 1 267 ? 6.043   23.414 47.660 1.00 11.39  ? 270 PHE A CD2  1  
ATOM   4026   C  CE1  . PHE A 1 267 ? 7.151   24.138 45.192 1.00 10.56  ? 270 PHE A CE1  1  
ATOM   4027   C  CE2  . PHE A 1 267 ? 7.008   22.597 47.060 1.00 11.09  ? 270 PHE A CE2  1  
ATOM   4028   C  CZ   . PHE A 1 267 ? 7.562   22.959 45.826 1.00 10.26  ? 270 PHE A CZ   1  
ATOM   4029   H  H    . PHE A 1 267 ? 6.282   26.390 49.378 1.00 0.00   ? 270 PHE A H    1  
ATOM   4030   H  HA   . PHE A 1 267 ? 5.496   27.156 46.702 1.00 0.00   ? 270 PHE A HA   1  
ATOM   4031   H  HB2  . PHE A 1 267 ? 4.429   25.153 48.693 1.00 0.00   ? 270 PHE A HB2  1  
ATOM   4032   H  HB3  . PHE A 1 267 ? 3.666   25.403 47.122 1.00 0.00   ? 270 PHE A HB3  1  
ATOM   4033   H  HD1  . PHE A 1 267 ? 5.868   25.864 45.304 1.00 0.00   ? 270 PHE A HD1  1  
ATOM   4034   H  HD2  . PHE A 1 267 ? 5.615   23.135 48.612 1.00 0.00   ? 270 PHE A HD2  1  
ATOM   4035   H  HE1  . PHE A 1 267 ? 7.578   24.417 44.241 1.00 0.00   ? 270 PHE A HE1  1  
ATOM   4036   H  HE2  . PHE A 1 267 ? 7.325   21.688 47.548 1.00 0.00   ? 270 PHE A HE2  1  
ATOM   4037   H  HZ   . PHE A 1 267 ? 8.306   22.328 45.363 1.00 0.00   ? 270 PHE A HZ   1  
ATOM   4038   N  N    . ASN A 1 268 ? 3.535   28.017 49.177 1.00 10.68  ? 271 ASN A N    1  
ATOM   4039   C  CA   . ASN A 1 268 ? 2.377   28.897 49.510 1.00 11.14  ? 271 ASN A CA   1  
ATOM   4040   C  C    . ASN A 1 268 ? 2.619   30.298 48.952 1.00 11.41  ? 271 ASN A C    1  
ATOM   4041   O  O    . ASN A 1 268 ? 1.699   30.996 48.572 1.00 13.09  ? 271 ASN A O    1  
ATOM   4042   C  CB   . ASN A 1 268 ? 2.216   28.975 51.029 1.00 11.66  ? 271 ASN A CB   1  
ATOM   4043   C  CG   . ASN A 1 268 ? 1.415   27.768 51.520 1.00 13.49  ? 271 ASN A CG   1  
ATOM   4044   O  OD1  . ASN A 1 268 ? 0.717   27.134 50.754 1.00 16.88  ? 271 ASN A OD1  1  
ATOM   4045   N  ND2  . ASN A 1 268 ? 1.485   27.420 52.776 1.00 15.90  ? 271 ASN A ND2  1  
ATOM   4046   H  H    . ASN A 1 268 ? 4.018   27.553 49.892 1.00 0.00   ? 271 ASN A H    1  
ATOM   4047   H  HA   . ASN A 1 268 ? 1.477   28.487 49.074 1.00 0.00   ? 271 ASN A HA   1  
ATOM   4048   H  HB2  . ASN A 1 268 ? 3.191   28.974 51.495 1.00 0.00   ? 271 ASN A HB2  1  
ATOM   4049   H  HB3  . ASN A 1 268 ? 1.693   29.882 51.290 1.00 0.00   ? 271 ASN A HB3  1  
ATOM   4050   H  HD21 . ASN A 1 268 ? 2.048   27.931 53.395 1.00 0.00   ? 271 ASN A HD21 1  
ATOM   4051   H  HD22 . ASN A 1 268 ? 0.976   26.649 53.101 1.00 0.00   ? 271 ASN A HD22 1  
ATOM   4052   N  N    . THR A 1 269 ? 3.850   30.714 48.903 1.00 11.21  ? 272 THR A N    1  
ATOM   4053   C  CA   . THR A 1 269 ? 4.163   32.068 48.375 1.00 12.02  ? 272 THR A CA   1  
ATOM   4054   C  C    . THR A 1 269 ? 4.177   32.006 46.855 1.00 12.68  ? 272 THR A C    1  
ATOM   4055   O  O    . THR A 1 269 ? 4.947   31.276 46.262 1.00 13.05  ? 272 THR A O    1  
ATOM   4056   C  CB   . THR A 1 269 ? 5.535   32.514 48.885 1.00 12.22  ? 272 THR A CB   1  
ATOM   4057   O  OG1  . THR A 1 269 ? 5.520   32.558 50.305 1.00 14.02  ? 272 THR A OG1  1  
ATOM   4058   C  CG2  . THR A 1 269 ? 5.861   33.902 48.332 1.00 13.15  ? 272 THR A CG2  1  
ATOM   4059   H  H    . THR A 1 269 ? 4.574   30.133 49.217 1.00 0.00   ? 272 THR A H    1  
ATOM   4060   H  HA   . THR A 1 269 ? 3.408   32.768 48.703 1.00 0.00   ? 272 THR A HA   1  
ATOM   4061   H  HB   . THR A 1 269 ? 6.287   31.814 48.554 1.00 0.00   ? 272 THR A HB   1  
ATOM   4062   H  HG1  . THR A 1 269 ? 4.606   32.494 50.593 1.00 0.00   ? 272 THR A HG1  1  
ATOM   4063   H  HG21 . THR A 1 269 ? 6.017   33.837 47.265 1.00 0.00   ? 272 THR A HG21 1  
ATOM   4064   H  HG22 . THR A 1 269 ? 6.756   34.277 48.805 1.00 0.00   ? 272 THR A HG22 1  
ATOM   4065   H  HG23 . THR A 1 269 ? 5.039   34.572 48.535 1.00 0.00   ? 272 THR A HG23 1  
ATOM   4066   N  N    . PRO A 1 270 ? 3.321   32.756 46.228 1.00 13.18  ? 273 PRO A N    1  
ATOM   4067   C  CA   . PRO A 1 270 ? 3.218   32.779 44.733 1.00 13.14  ? 273 PRO A CA   1  
ATOM   4068   C  C    . PRO A 1 270 ? 4.596   32.828 44.060 1.00 12.38  ? 273 PRO A C    1  
ATOM   4069   O  O    . PRO A 1 270 ? 5.470   33.549 44.499 1.00 12.23  ? 273 PRO A O    1  
ATOM   4070   C  CB   . PRO A 1 270 ? 2.436   34.062 44.454 1.00 14.48  ? 273 PRO A CB   1  
ATOM   4071   C  CG   . PRO A 1 270 ? 1.607   34.297 45.678 1.00 16.39  ? 273 PRO A CG   1  
ATOM   4072   C  CD   . PRO A 1 270 ? 2.356   33.668 46.859 1.00 14.48  ? 273 PRO A CD   1  
ATOM   4073   H  HA   . PRO A 1 270 ? 2.657   31.929 44.382 1.00 0.00   ? 273 PRO A HA   1  
ATOM   4074   H  HB2  . PRO A 1 270 ? 3.116   34.887 44.296 1.00 0.00   ? 273 PRO A HB2  1  
ATOM   4075   H  HB3  . PRO A 1 270 ? 1.796   33.932 43.596 1.00 0.00   ? 273 PRO A HB3  1  
ATOM   4076   H  HG2  . PRO A 1 270 ? 1.482   35.359 45.839 1.00 0.00   ? 273 PRO A HG2  1  
ATOM   4077   H  HG3  . PRO A 1 270 ? 0.644   33.823 45.568 1.00 0.00   ? 273 PRO A HG3  1  
ATOM   4078   H  HD2  . PRO A 1 270 ? 2.869   34.431 47.429 1.00 0.00   ? 273 PRO A HD2  1  
ATOM   4079   H  HD3  . PRO A 1 270 ? 1.677   33.115 47.488 1.00 0.00   ? 273 PRO A HD3  1  
ATOM   4080   N  N    . PRO A 1 271 ? 4.808   32.062 43.009 1.00 11.75  ? 274 PRO A N    1  
ATOM   4081   C  CA   . PRO A 1 271 ? 6.137   32.047 42.308 1.00 11.47  ? 274 PRO A CA   1  
ATOM   4082   C  C    . PRO A 1 271 ? 6.346   33.211 41.306 1.00 11.03  ? 274 PRO A C    1  
ATOM   4083   O  O    . PRO A 1 271 ? 5.601   33.347 40.356 1.00 12.18  ? 274 PRO A O    1  
ATOM   4084   C  CB   . PRO A 1 271 ? 6.103   30.714 41.563 1.00 11.88  ? 274 PRO A CB   1  
ATOM   4085   C  CG   . PRO A 1 271 ? 4.655   30.444 41.290 1.00 12.30  ? 274 PRO A CG   1  
ATOM   4086   C  CD   . PRO A 1 271 ? 3.844   31.147 42.386 1.00 12.14  ? 274 PRO A CD   1  
ATOM   4087   H  HA   . PRO A 1 271 ? 6.937   32.029 43.029 1.00 0.00   ? 274 PRO A HA   1  
ATOM   4088   H  HB2  . PRO A 1 271 ? 6.654   30.791 40.636 1.00 0.00   ? 274 PRO A HB2  1  
ATOM   4089   H  HB3  . PRO A 1 271 ? 6.514   29.930 42.180 1.00 0.00   ? 274 PRO A HB3  1  
ATOM   4090   H  HG2  . PRO A 1 271 ? 4.386   30.837 40.318 1.00 0.00   ? 274 PRO A HG2  1  
ATOM   4091   H  HG3  . PRO A 1 271 ? 4.465   29.383 41.325 1.00 0.00   ? 274 PRO A HG3  1  
ATOM   4092   H  HD2  . PRO A 1 271 ? 3.020   31.698 41.952 1.00 0.00   ? 274 PRO A HD2  1  
ATOM   4093   H  HD3  . PRO A 1 271 ? 3.485   30.433 43.111 1.00 0.00   ? 274 PRO A HD3  1  
ATOM   4094   N  N    . ASP A 1 272 ? 7.379   34.035 41.475 1.00 10.91  ? 275 ASP A N    1  
ATOM   4095   C  CA   . ASP A 1 272 ? 7.601   35.112 40.492 1.00 10.90  ? 275 ASP A CA   1  
ATOM   4096   C  C    . ASP A 1 272 ? 7.542   34.463 39.118 1.00 10.70  ? 275 ASP A C    1  
ATOM   4097   O  O    . ASP A 1 272 ? 7.495   33.254 39.000 1.00 11.42  ? 275 ASP A O    1  
ATOM   4098   C  CB   . ASP A 1 272 ? 8.977   35.745 40.713 1.00 11.61  ? 275 ASP A CB   1  
ATOM   4099   C  CG   . ASP A 1 272 ? 9.029   36.384 42.102 1.00 12.83  ? 275 ASP A CG   1  
ATOM   4100   O  OD1  . ASP A 1 272 ? 7.992   36.828 42.567 1.00 13.50  ? 275 ASP A OD1  1  
ATOM   4101   O  OD2  . ASP A 1 272 ? 10.104  36.417 42.677 1.00 14.21  ? 275 ASP A OD2  1  
ATOM   4102   H  H    . ASP A 1 272 ? 7.999   33.908 42.223 1.00 0.00   ? 275 ASP A H    1  
ATOM   4103   H  HA   . ASP A 1 272 ? 6.827   35.860 40.582 1.00 0.00   ? 275 ASP A HA   1  
ATOM   4104   H  HB2  . ASP A 1 272 ? 9.740   34.984 40.637 1.00 0.00   ? 275 ASP A HB2  1  
ATOM   4105   H  HB3  . ASP A 1 272 ? 9.148   36.504 39.964 1.00 0.00   ? 275 ASP A HB3  1  
ATOM   4106   N  N    . VAL A 1 273 ? 7.532   35.229 38.081 1.00 11.07  ? 276 VAL A N    1  
ATOM   4107   C  CA   . VAL A 1 273 ? 7.462   34.614 36.722 1.00 11.68  ? 276 VAL A CA   1  
ATOM   4108   C  C    . VAL A 1 273 ? 8.326   35.395 35.724 1.00 11.44  ? 276 VAL A C    1  
ATOM   4109   O  O    . VAL A 1 273 ? 8.515   36.589 35.844 1.00 11.41  ? 276 VAL A O    1  
ATOM   4110   C  CB   . VAL A 1 273 ? 6.010   34.617 36.242 1.00 13.16  ? 276 VAL A CB   1  
ATOM   4111   C  CG1  . VAL A 1 273 ? 5.145   33.825 37.224 1.00 14.41  ? 276 VAL A CG1  1  
ATOM   4112   C  CG2  . VAL A 1 273 ? 5.503   36.059 36.165 1.00 13.73  ? 276 VAL A CG2  1  
ATOM   4113   H  H    . VAL A 1 273 ? 7.562   36.203 38.184 1.00 0.00   ? 276 VAL A H    1  
ATOM   4114   H  HA   . VAL A 1 273 ? 7.815   33.595 36.775 1.00 0.00   ? 276 VAL A HA   1  
ATOM   4115   H  HB   . VAL A 1 273 ? 5.954   34.161 35.264 1.00 0.00   ? 276 VAL A HB   1  
ATOM   4116   H  HG11 . VAL A 1 273 ? 5.635   32.892 37.463 1.00 0.00   ? 276 VAL A HG11 1  
ATOM   4117   H  HG12 . VAL A 1 273 ? 4.184   33.622 36.775 1.00 0.00   ? 276 VAL A HG12 1  
ATOM   4118   H  HG13 . VAL A 1 273 ? 5.007   34.401 38.127 1.00 0.00   ? 276 VAL A HG13 1  
ATOM   4119   H  HG21 . VAL A 1 273 ? 6.107   36.616 35.465 1.00 0.00   ? 276 VAL A HG21 1  
ATOM   4120   H  HG22 . VAL A 1 273 ? 5.569   36.516 37.141 1.00 0.00   ? 276 VAL A HG22 1  
ATOM   4121   H  HG23 . VAL A 1 273 ? 4.474   36.061 35.835 1.00 0.00   ? 276 VAL A HG23 1  
ATOM   4122   N  N    . ASP A 1 274 ? 8.836   34.717 34.727 1.00 11.01  ? 277 ASP A N    1  
ATOM   4123   C  CA   . ASP A 1 274 ? 9.669   35.386 33.702 1.00 11.19  ? 277 ASP A CA   1  
ATOM   4124   C  C    . ASP A 1 274 ? 10.876  35.938 34.407 1.00 11.22  ? 277 ASP A C    1  
ATOM   4125   O  O    . ASP A 1 274 ? 11.156  37.119 34.359 1.00 11.46  ? 277 ASP A O    1  
ATOM   4126   C  CB   . ASP A 1 274 ? 8.880   36.524 33.050 1.00 11.60  ? 277 ASP A CB   1  
ATOM   4127   C  CG   . ASP A 1 274 ? 7.639   35.956 32.360 1.00 12.90  ? 277 ASP A CG   1  
ATOM   4128   O  OD1  . ASP A 1 274 ? 7.641   34.773 32.060 1.00 14.91  ? 277 ASP A OD1  1  
ATOM   4129   O  OD2  . ASP A 1 274 ? 6.707   36.712 32.143 1.00 15.79  ? 277 ASP A OD2  1  
ATOM   4130   H  H    . ASP A 1 274 ? 8.655   33.757 34.652 1.00 0.00   ? 277 ASP A H    1  
ATOM   4131   H  HA   . ASP A 1 274 ? 9.975   34.672 32.952 1.00 0.00   ? 277 ASP A HA   1  
ATOM   4132   H  HB2  . ASP A 1 274 ? 8.578   37.233 33.809 1.00 0.00   ? 277 ASP A HB2  1  
ATOM   4133   H  HB3  . ASP A 1 274 ? 9.500   37.021 32.320 1.00 0.00   ? 277 ASP A HB3  1  
ATOM   4134   N  N    . GLN A 1 275 ? 11.576  35.102 35.107 1.00 10.91  ? 278 GLN A N    1  
ATOM   4135   C  CA   . GLN A 1 275 ? 12.758  35.634 35.868 1.00 10.82  ? 278 GLN A CA   1  
ATOM   4136   C  C    . GLN A 1 275 ? 14.096  35.406 35.135 1.00 10.59  ? 278 GLN A C    1  
ATOM   4137   O  O    . GLN A 1 275 ? 14.446  34.292 34.800 1.00 11.42  ? 278 GLN A O    1  
ATOM   4138   C  CB   . GLN A 1 275 ? 12.819  34.943 37.232 1.00 10.75  ? 278 GLN A CB   1  
ATOM   4139   C  CG   . GLN A 1 275 ? 11.529  35.224 38.005 1.00 10.56  ? 278 GLN A CG   1  
ATOM   4140   C  CD   . GLN A 1 275 ? 11.535  36.670 38.502 1.00 10.79  ? 278 GLN A CD   1  
ATOM   4141   O  OE1  . GLN A 1 275 ? 12.358  37.042 39.315 1.00 11.34  ? 278 GLN A OE1  1  
ATOM   4142   N  NE2  . GLN A 1 275 ? 10.646  37.509 38.045 1.00 10.41  ? 278 GLN A NE2  1  
ATOM   4143   H  H    . GLN A 1 275 ? 11.321  34.158 35.167 1.00 0.00   ? 278 GLN A H    1  
ATOM   4144   H  HA   . GLN A 1 275 ? 12.623  36.693 36.025 1.00 0.00   ? 278 GLN A HA   1  
ATOM   4145   H  HB2  . GLN A 1 275 ? 12.931  33.878 37.091 1.00 0.00   ? 278 GLN A HB2  1  
ATOM   4146   H  HB3  . GLN A 1 275 ? 13.661  35.323 37.791 1.00 0.00   ? 278 GLN A HB3  1  
ATOM   4147   H  HG2  . GLN A 1 275 ? 10.679  35.069 37.355 1.00 0.00   ? 278 GLN A HG2  1  
ATOM   4148   H  HG3  . GLN A 1 275 ? 11.462  34.555 38.850 1.00 0.00   ? 278 GLN A HG3  1  
ATOM   4149   H  HE21 . GLN A 1 275 ? 9.982   37.210 37.389 1.00 0.00   ? 278 GLN A HE21 1  
ATOM   4150   H  HE22 . GLN A 1 275 ? 10.642  38.438 38.357 1.00 0.00   ? 278 GLN A HE22 1  
ATOM   4151   N  N    . GLU A 1 276 ? 14.879  36.457 34.940 1.00 10.48  ? 279 GLU A N    1  
ATOM   4152   C  CA   . GLU A 1 276 ? 16.218  36.279 34.298 1.00 10.58  ? 279 GLU A CA   1  
ATOM   4153   C  C    . GLU A 1 276 ? 17.251  35.809 35.359 1.00 10.10  ? 279 GLU A C    1  
ATOM   4154   O  O    . GLU A 1 276 ? 18.103  34.989 35.083 1.00 10.59  ? 279 GLU A O    1  
ATOM   4155   C  CB   . GLU A 1 276 ? 16.675  37.610 33.698 1.00 10.71  ? 279 GLU A CB   1  
ATOM   4156   C  CG   . GLU A 1 276 ? 16.953  38.609 34.823 1.00 10.86  ? 279 GLU A CG   1  
ATOM   4157   C  CD   . GLU A 1 276 ? 17.289  39.975 34.223 1.00 10.35  ? 279 GLU A CD   1  
ATOM   4158   O  OE1  . GLU A 1 276 ? 18.182  40.032 33.393 1.00 10.64  ? 279 GLU A OE1  1  
ATOM   4159   O  OE2  . GLU A 1 276 ? 16.648  40.941 34.603 1.00 11.17  ? 279 GLU A OE2  1  
ATOM   4160   H  H    . GLU A 1 276 ? 14.601  37.341 35.258 1.00 0.00   ? 279 GLU A H    1  
ATOM   4161   H  HA   . GLU A 1 276 ? 16.145  35.537 33.516 1.00 0.00   ? 279 GLU A HA   1  
ATOM   4162   H  HB2  . GLU A 1 276 ? 17.576  37.455 33.123 1.00 0.00   ? 279 GLU A HB2  1  
ATOM   4163   H  HB3  . GLU A 1 276 ? 15.900  38.001 33.056 1.00 0.00   ? 279 GLU A HB3  1  
ATOM   4164   H  HG2  . GLU A 1 276 ? 16.077  38.696 35.451 1.00 0.00   ? 279 GLU A HG2  1  
ATOM   4165   H  HG3  . GLU A 1 276 ? 17.787  38.263 35.415 1.00 0.00   ? 279 GLU A HG3  1  
ATOM   4166   N  N    . THR A 1 277 ? 17.177  36.330 36.569 1.00 9.60   ? 280 THR A N    1  
ATOM   4167   C  CA   . THR A 1 277 ? 18.128  35.938 37.639 1.00 9.69   ? 280 THR A CA   1  
ATOM   4168   C  C    . THR A 1 277 ? 17.397  36.080 38.967 1.00 9.75   ? 280 THR A C    1  
ATOM   4169   O  O    . THR A 1 277 ? 16.875  37.129 39.289 1.00 12.01  ? 280 THR A O    1  
ATOM   4170   C  CB   . THR A 1 277 ? 19.348  36.863 37.615 1.00 10.30  ? 280 THR A CB   1  
ATOM   4171   O  OG1  . THR A 1 277 ? 20.050  36.684 36.393 1.00 11.10  ? 280 THR A OG1  1  
ATOM   4172   C  CG2  . THR A 1 277 ? 20.268  36.526 38.789 1.00 11.22  ? 280 THR A CG2  1  
ATOM   4173   H  H    . THR A 1 277 ? 16.481  36.992 36.765 1.00 0.00   ? 280 THR A H    1  
ATOM   4174   H  HA   . THR A 1 277 ? 18.437  34.912 37.498 1.00 0.00   ? 280 THR A HA   1  
ATOM   4175   H  HB   . THR A 1 277 ? 19.024  37.889 37.699 1.00 0.00   ? 280 THR A HB   1  
ATOM   4176   H  HG1  . THR A 1 277 ? 20.523  37.498 36.202 1.00 0.00   ? 280 THR A HG1  1  
ATOM   4177   H  HG21 . THR A 1 277 ? 20.826  37.407 39.073 1.00 0.00   ? 280 THR A HG21 1  
ATOM   4178   H  HG22 . THR A 1 277 ? 20.954  35.745 38.497 1.00 0.00   ? 280 THR A HG22 1  
ATOM   4179   H  HG23 . THR A 1 277 ? 19.675  36.190 39.627 1.00 0.00   ? 280 THR A HG23 1  
ATOM   4180   N  N    . TRP A 1 278 ? 17.315  35.031 39.721 1.00 9.08   ? 281 TRP A N    1  
ATOM   4181   C  CA   . TRP A 1 278 ? 16.574  35.104 40.999 1.00 8.80   ? 281 TRP A CA   1  
ATOM   4182   C  C    . TRP A 1 278 ? 17.533  35.414 42.130 1.00 9.13   ? 281 TRP A C    1  
ATOM   4183   O  O    . TRP A 1 278 ? 18.656  35.828 41.922 1.00 10.77  ? 281 TRP A O    1  
ATOM   4184   C  CB   . TRP A 1 278 ? 15.887  33.764 41.267 1.00 9.17   ? 281 TRP A CB   1  
ATOM   4185   C  CG   . TRP A 1 278 ? 16.328  32.764 40.247 1.00 8.46   ? 281 TRP A CG   1  
ATOM   4186   C  CD1  . TRP A 1 278 ? 16.801  31.527 40.525 1.00 8.34   ? 281 TRP A CD1  1  
ATOM   4187   C  CD2  . TRP A 1 278 ? 16.347  32.892 38.796 1.00 9.30   ? 281 TRP A CD2  1  
ATOM   4188   N  NE1  . TRP A 1 278 ? 17.109  30.889 39.338 1.00 9.43   ? 281 TRP A NE1  1  
ATOM   4189   C  CE2  . TRP A 1 278 ? 16.846  31.689 38.243 1.00 9.02   ? 281 TRP A CE2  1  
ATOM   4190   C  CE3  . TRP A 1 278 ? 15.983  33.926 37.914 1.00 9.42   ? 281 TRP A CE3  1  
ATOM   4191   C  CZ2  . TRP A 1 278 ? 16.980  31.517 36.865 1.00 10.70  ? 281 TRP A CZ2  1  
ATOM   4192   C  CZ3  . TRP A 1 278 ? 16.116  33.756 36.526 1.00 10.24  ? 281 TRP A CZ3  1  
ATOM   4193   C  CH2  . TRP A 1 278 ? 16.613  32.554 36.003 1.00 11.19  ? 281 TRP A CH2  1  
ATOM   4194   H  H    . TRP A 1 278 ? 17.715  34.184 39.431 1.00 0.00   ? 281 TRP A H    1  
ATOM   4195   H  HA   . TRP A 1 278 ? 15.828  35.882 40.938 1.00 0.00   ? 281 TRP A HA   1  
ATOM   4196   H  HB2  . TRP A 1 278 ? 16.153  33.414 42.253 1.00 0.00   ? 281 TRP A HB2  1  
ATOM   4197   H  HB3  . TRP A 1 278 ? 14.816  33.890 41.207 1.00 0.00   ? 281 TRP A HB3  1  
ATOM   4198   H  HD1  . TRP A 1 278 ? 16.919  31.108 41.513 1.00 0.00   ? 281 TRP A HD1  1  
ATOM   4199   H  HE1  . TRP A 1 278 ? 17.469  29.980 39.261 1.00 0.00   ? 281 TRP A HE1  1  
ATOM   4200   H  HE3  . TRP A 1 278 ? 15.599  34.856 38.306 1.00 0.00   ? 281 TRP A HE3  1  
ATOM   4201   H  HZ2  . TRP A 1 278 ? 17.363  30.589 36.468 1.00 0.00   ? 281 TRP A HZ2  1  
ATOM   4202   H  HZ3  . TRP A 1 278 ? 15.834  34.556 35.857 1.00 0.00   ? 281 TRP A HZ3  1  
ATOM   4203   H  HH2  . TRP A 1 278 ? 16.713  32.429 34.935 1.00 0.00   ? 281 TRP A HH2  1  
ATOM   4204   N  N    . PHE A 1 279 ? 17.092  35.216 43.328 1.00 8.48   ? 282 PHE A N    1  
ATOM   4205   C  CA   . PHE A 1 279 ? 17.969  35.497 44.502 1.00 8.10   ? 282 PHE A CA   1  
ATOM   4206   C  C    . PHE A 1 279 ? 17.579  34.607 45.694 1.00 8.24   ? 282 PHE A C    1  
ATOM   4207   O  O    . PHE A 1 279 ? 16.480  34.679 46.208 1.00 9.42   ? 282 PHE A O    1  
ATOM   4208   C  CB   . PHE A 1 279 ? 17.822  36.967 44.901 1.00 8.53   ? 282 PHE A CB   1  
ATOM   4209   C  CG   . PHE A 1 279 ? 18.781  37.283 46.023 1.00 9.16   ? 282 PHE A CG   1  
ATOM   4210   C  CD1  . PHE A 1 279 ? 20.144  37.453 45.753 1.00 8.76   ? 282 PHE A CD1  1  
ATOM   4211   C  CD2  . PHE A 1 279 ? 18.308  37.404 47.335 1.00 9.45   ? 282 PHE A CD2  1  
ATOM   4212   C  CE1  . PHE A 1 279 ? 21.034  37.746 46.794 1.00 9.00   ? 282 PHE A CE1  1  
ATOM   4213   C  CE2  . PHE A 1 279 ? 19.197  37.697 48.376 1.00 10.41  ? 282 PHE A CE2  1  
ATOM   4214   C  CZ   . PHE A 1 279 ? 20.560  37.867 48.105 1.00 9.69   ? 282 PHE A CZ   1  
ATOM   4215   H  H    . PHE A 1 279 ? 16.181  34.883 43.466 1.00 0.00   ? 282 PHE A H    1  
ATOM   4216   H  HA   . PHE A 1 279 ? 18.996  35.303 44.234 1.00 0.00   ? 282 PHE A HA   1  
ATOM   4217   H  HB2  . PHE A 1 279 ? 18.044  37.595 44.050 1.00 0.00   ? 282 PHE A HB2  1  
ATOM   4218   H  HB3  . PHE A 1 279 ? 16.811  37.152 45.230 1.00 0.00   ? 282 PHE A HB3  1  
ATOM   4219   H  HD1  . PHE A 1 279 ? 20.510  37.359 44.741 1.00 0.00   ? 282 PHE A HD1  1  
ATOM   4220   H  HD2  . PHE A 1 279 ? 17.256  37.273 47.544 1.00 0.00   ? 282 PHE A HD2  1  
ATOM   4221   H  HE1  . PHE A 1 279 ? 22.085  37.877 46.585 1.00 0.00   ? 282 PHE A HE1  1  
ATOM   4222   H  HE2  . PHE A 1 279 ? 18.832  37.791 49.388 1.00 0.00   ? 282 PHE A HE2  1  
ATOM   4223   H  HZ   . PHE A 1 279 ? 21.246  38.093 48.908 1.00 0.00   ? 282 PHE A HZ   1  
ATOM   4224   N  N    . ILE A 1 280 ? 18.491  33.785 46.143 1.00 7.85   ? 283 ILE A N    1  
ATOM   4225   C  CA   . ILE A 1 280 ? 18.226  32.897 47.308 1.00 8.36   ? 283 ILE A CA   1  
ATOM   4226   C  C    . ILE A 1 280 ? 19.210  33.284 48.409 1.00 7.66   ? 283 ILE A C    1  
ATOM   4227   O  O    . ILE A 1 280 ? 20.410  33.196 48.238 1.00 8.38   ? 283 ILE A O    1  
ATOM   4228   C  CB   . ILE A 1 280 ? 18.443  31.437 46.907 1.00 8.35   ? 283 ILE A CB   1  
ATOM   4229   C  CG1  . ILE A 1 280 ? 17.433  31.051 45.824 1.00 10.10  ? 283 ILE A CG1  1  
ATOM   4230   C  CG2  . ILE A 1 280 ? 18.248  30.537 48.128 1.00 9.41   ? 283 ILE A CG2  1  
ATOM   4231   C  CD1  . ILE A 1 280 ? 17.879  29.753 45.148 1.00 9.96   ? 283 ILE A CD1  1  
ATOM   4232   H  H    . ILE A 1 280 ? 19.372  33.765 45.714 1.00 0.00   ? 283 ILE A H    1  
ATOM   4233   H  HA   . ILE A 1 280 ? 17.213  33.040 47.655 1.00 0.00   ? 283 ILE A HA   1  
ATOM   4234   H  HB   . ILE A 1 280 ? 19.447  31.314 46.526 1.00 0.00   ? 283 ILE A HB   1  
ATOM   4235   H  HG12 . ILE A 1 280 ? 16.461  30.908 46.274 1.00 0.00   ? 283 ILE A HG12 1  
ATOM   4236   H  HG13 . ILE A 1 280 ? 17.377  31.838 45.087 1.00 0.00   ? 283 ILE A HG13 1  
ATOM   4237   H  HG21 . ILE A 1 280 ? 18.461  29.513 47.859 1.00 0.00   ? 283 ILE A HG21 1  
ATOM   4238   H  HG22 . ILE A 1 280 ? 17.227  30.614 48.472 1.00 0.00   ? 283 ILE A HG22 1  
ATOM   4239   H  HG23 . ILE A 1 280 ? 18.918  30.849 48.916 1.00 0.00   ? 283 ILE A HG23 1  
ATOM   4240   H  HD11 . ILE A 1 280 ? 18.785  29.397 45.616 1.00 0.00   ? 283 ILE A HD11 1  
ATOM   4241   H  HD12 . ILE A 1 280 ? 18.065  29.939 44.100 1.00 0.00   ? 283 ILE A HD12 1  
ATOM   4242   H  HD13 . ILE A 1 280 ? 17.104  29.009 45.250 1.00 0.00   ? 283 ILE A HD13 1  
ATOM   4243   N  N    . PRO A 1 281 ? 18.706  33.753 49.509 1.00 8.06   ? 284 PRO A N    1  
ATOM   4244   C  CA   . PRO A 1 281 ? 19.551  34.221 50.651 1.00 8.05   ? 284 PRO A CA   1  
ATOM   4245   C  C    . PRO A 1 281 ? 20.210  33.091 51.450 1.00 8.01   ? 284 PRO A C    1  
ATOM   4246   O  O    . PRO A 1 281 ? 19.580  32.114 51.804 1.00 8.88   ? 284 PRO A O    1  
ATOM   4247   C  CB   . PRO A 1 281 ? 18.563  34.982 51.536 1.00 7.96   ? 284 PRO A CB   1  
ATOM   4248   C  CG   . PRO A 1 281 ? 17.224  34.390 51.239 1.00 9.03   ? 284 PRO A CG   1  
ATOM   4249   C  CD   . PRO A 1 281 ? 17.270  33.892 49.794 1.00 8.34   ? 284 PRO A CD   1  
ATOM   4250   H  HA   . PRO A 1 281 ? 20.302  34.906 50.296 1.00 0.00   ? 284 PRO A HA   1  
ATOM   4251   H  HB2  . PRO A 1 281 ? 18.814  34.844 52.579 1.00 0.00   ? 284 PRO A HB2  1  
ATOM   4252   H  HB3  . PRO A 1 281 ? 18.566  36.031 51.284 1.00 0.00   ? 284 PRO A HB3  1  
ATOM   4253   H  HG2  . PRO A 1 281 ? 17.028  33.566 51.912 1.00 0.00   ? 284 PRO A HG2  1  
ATOM   4254   H  HG3  . PRO A 1 281 ? 16.457  35.142 51.339 1.00 0.00   ? 284 PRO A HG3  1  
ATOM   4255   H  HD2  . PRO A 1 281 ? 16.769  32.938 49.707 1.00 0.00   ? 284 PRO A HD2  1  
ATOM   4256   H  HD3  . PRO A 1 281 ? 16.827  34.617 49.128 1.00 0.00   ? 284 PRO A HD3  1  
ATOM   4257   N  N    . GLY A 1 282 ? 21.475  33.239 51.764 1.00 7.52   ? 285 GLY A N    1  
ATOM   4258   C  CA   . GLY A 1 282 ? 22.165  32.206 52.565 1.00 7.90   ? 285 GLY A CA   1  
ATOM   4259   C  C    . GLY A 1 282 ? 21.179  31.667 53.591 1.00 7.42   ? 285 GLY A C    1  
ATOM   4260   O  O    . GLY A 1 282 ? 20.389  32.395 54.159 1.00 7.93   ? 285 GLY A O    1  
ATOM   4261   H  H    . GLY A 1 282 ? 21.956  34.047 51.488 1.00 0.00   ? 285 GLY A H    1  
ATOM   4262   H  HA2  . GLY A 1 282 ? 22.498  31.406 51.918 1.00 0.00   ? 285 GLY A HA2  1  
ATOM   4263   H  HA3  . GLY A 1 282 ? 23.010  32.642 53.074 1.00 0.00   ? 285 GLY A HA3  1  
ATOM   4264   N  N    . GLY A 1 283 ? 21.207  30.398 53.811 1.00 7.53   ? 286 GLY A N    1  
ATOM   4265   C  CA   . GLY A 1 283 ? 20.268  29.777 54.774 1.00 7.29   ? 286 GLY A CA   1  
ATOM   4266   C  C    . GLY A 1 283 ? 18.915  29.518 54.098 1.00 7.42   ? 286 GLY A C    1  
ATOM   4267   O  O    . GLY A 1 283 ? 17.889  29.554 54.748 1.00 8.06   ? 286 GLY A O    1  
ATOM   4268   H  H    . GLY A 1 283 ? 21.845  29.835 53.324 1.00 0.00   ? 286 GLY A H    1  
ATOM   4269   H  HA2  . GLY A 1 283 ? 20.681  28.841 55.123 1.00 0.00   ? 286 GLY A HA2  1  
ATOM   4270   H  HA3  . GLY A 1 283 ? 20.124  30.441 55.613 1.00 0.00   ? 286 GLY A HA3  1  
ATOM   4271   N  N    . ALA A 1 284 ? 18.874  29.251 52.806 1.00 7.70   ? 287 ALA A N    1  
ATOM   4272   C  CA   . ALA A 1 284 ? 17.530  28.998 52.185 1.00 7.92   ? 287 ALA A CA   1  
ATOM   4273   C  C    . ALA A 1 284 ? 17.650  28.311 50.818 1.00 7.50   ? 287 ALA A C    1  
ATOM   4274   O  O    . ALA A 1 284 ? 18.582  28.541 50.074 1.00 7.47   ? 287 ALA A O    1  
ATOM   4275   C  CB   . ALA A 1 284 ? 16.802  30.332 52.011 1.00 8.64   ? 287 ALA A CB   1  
ATOM   4276   H  H    . ALA A 1 284 ? 19.694  29.215 52.270 1.00 0.00   ? 287 ALA A H    1  
ATOM   4277   H  HA   . ALA A 1 284 ? 16.952  28.369 52.845 1.00 0.00   ? 287 ALA A HA   1  
ATOM   4278   H  HB1  . ALA A 1 284 ? 17.298  30.916 51.250 1.00 0.00   ? 287 ALA A HB1  1  
ATOM   4279   H  HB2  . ALA A 1 284 ? 16.816  30.874 52.945 1.00 0.00   ? 287 ALA A HB2  1  
ATOM   4280   H  HB3  . ALA A 1 284 ? 15.780  30.148 51.716 1.00 0.00   ? 287 ALA A HB3  1  
ATOM   4281   N  N    . ALA A 1 285 ? 16.682  27.486 50.471 1.00 7.62   ? 288 ALA A N    1  
ATOM   4282   C  CA   . ALA A 1 285 ? 16.717  26.809 49.135 1.00 8.07   ? 288 ALA A CA   1  
ATOM   4283   C  C    . ALA A 1 285 ? 15.485  27.233 48.312 1.00 8.03   ? 288 ALA A C    1  
ATOM   4284   O  O    . ALA A 1 285 ? 14.382  27.278 48.820 1.00 8.27   ? 288 ALA A O    1  
ATOM   4285   C  CB   . ALA A 1 285 ? 16.699  25.291 49.333 1.00 8.62   ? 288 ALA A CB   1  
ATOM   4286   H  H    . ALA A 1 285 ? 15.928  27.333 51.078 1.00 0.00   ? 288 ALA A H    1  
ATOM   4287   H  HA   . ALA A 1 285 ? 17.617  27.094 48.610 1.00 0.00   ? 288 ALA A HA   1  
ATOM   4288   H  HB1  . ALA A 1 285 ? 16.037  25.042 50.149 1.00 0.00   ? 288 ALA A HB1  1  
ATOM   4289   H  HB2  . ALA A 1 285 ? 17.697  24.946 49.561 1.00 0.00   ? 288 ALA A HB2  1  
ATOM   4290   H  HB3  . ALA A 1 285 ? 16.351  24.814 48.429 1.00 0.00   ? 288 ALA A HB3  1  
ATOM   4291   N  N    . GLY A 1 286 ? 15.659  27.547 47.046 1.00 7.94   ? 289 GLY A N    1  
ATOM   4292   C  CA   . GLY A 1 286 ? 14.495  27.962 46.220 1.00 8.14   ? 289 GLY A CA   1  
ATOM   4293   C  C    . GLY A 1 286 ? 14.240  26.917 45.136 1.00 8.16   ? 289 GLY A C    1  
ATOM   4294   O  O    . GLY A 1 286 ? 14.760  25.819 45.180 1.00 8.24   ? 289 GLY A O    1  
ATOM   4295   H  H    . GLY A 1 286 ? 16.554  27.507 46.649 1.00 0.00   ? 289 GLY A H    1  
ATOM   4296   H  HA2  . GLY A 1 286 ? 13.621  28.052 46.849 1.00 0.00   ? 289 GLY A HA2  1  
ATOM   4297   H  HA3  . GLY A 1 286 ? 14.705  28.914 45.755 1.00 0.00   ? 289 GLY A HA3  1  
ATOM   4298   N  N    . ALA A 1 287 ? 13.443  27.252 44.165 1.00 9.28   ? 290 ALA A N    1  
ATOM   4299   C  CA   . ALA A 1 287 ? 13.144  26.287 43.069 1.00 9.09   ? 290 ALA A CA   1  
ATOM   4300   C  C    . ALA A 1 287 ? 12.637  27.043 41.832 1.00 9.61   ? 290 ALA A C    1  
ATOM   4301   O  O    . ALA A 1 287 ? 11.800  27.919 41.924 1.00 10.11  ? 290 ALA A O    1  
ATOM   4302   C  CB   . ALA A 1 287 ? 12.070  25.302 43.537 1.00 9.84   ? 290 ALA A CB   1  
ATOM   4303   H  H    . ALA A 1 287 ? 13.037  28.144 44.154 1.00 0.00   ? 290 ALA A H    1  
ATOM   4304   H  HA   . ALA A 1 287 ? 14.042  25.744 42.814 1.00 0.00   ? 290 ALA A HA   1  
ATOM   4305   H  HB1  . ALA A 1 287 ? 12.456  24.711 44.355 1.00 0.00   ? 290 ALA A HB1  1  
ATOM   4306   H  HB2  . ALA A 1 287 ? 11.798  24.652 42.720 1.00 0.00   ? 290 ALA A HB2  1  
ATOM   4307   H  HB3  . ALA A 1 287 ? 11.200  25.849 43.868 1.00 0.00   ? 290 ALA A HB3  1  
ATOM   4308   N  N    . ALA A 1 288 ? 13.141  26.700 40.677 1.00 9.56   ? 291 ALA A N    1  
ATOM   4309   C  CA   . ALA A 1 288 ? 12.708  27.370 39.426 1.00 9.66   ? 291 ALA A CA   1  
ATOM   4310   C  C    . ALA A 1 288 ? 12.221  26.306 38.440 1.00 9.55   ? 291 ALA A C    1  
ATOM   4311   O  O    . ALA A 1 288 ? 12.802  25.247 38.309 1.00 10.76  ? 291 ALA A O    1  
ATOM   4312   C  CB   . ALA A 1 288 ? 13.886  28.133 38.817 1.00 9.88   ? 291 ALA A CB   1  
ATOM   4313   H  H    . ALA A 1 288 ? 13.812  25.987 40.635 1.00 0.00   ? 291 ALA A H    1  
ATOM   4314   H  HA   . ALA A 1 288 ? 11.904  28.058 39.643 1.00 0.00   ? 291 ALA A HA   1  
ATOM   4315   H  HB1  . ALA A 1 288 ? 14.445  27.474 38.169 1.00 0.00   ? 291 ALA A HB1  1  
ATOM   4316   H  HB2  . ALA A 1 288 ? 14.530  28.491 39.607 1.00 0.00   ? 291 ALA A HB2  1  
ATOM   4317   H  HB3  . ALA A 1 288 ? 13.516  28.971 38.246 1.00 0.00   ? 291 ALA A HB3  1  
ATOM   4318   N  N    . PHE A 1 289 ? 11.153  26.583 37.757 1.00 9.95   ? 292 PHE A N    1  
ATOM   4319   C  CA   . PHE A 1 289 ? 10.596  25.610 36.783 1.00 10.37  ? 292 PHE A CA   1  
ATOM   4320   C  C    . PHE A 1 289 ? 10.633  26.252 35.404 1.00 10.30  ? 292 PHE A C    1  
ATOM   4321   O  O    . PHE A 1 289 ? 10.159  27.354 35.214 1.00 10.80  ? 292 PHE A O    1  
ATOM   4322   C  CB   . PHE A 1 289 ? 9.150   25.290 37.170 1.00 10.70  ? 292 PHE A CB   1  
ATOM   4323   C  CG   . PHE A 1 289 ? 8.589   24.230 36.253 1.00 10.69  ? 292 PHE A CG   1  
ATOM   4324   C  CD1  . PHE A 1 289 ? 8.537   24.452 34.872 1.00 12.22  ? 292 PHE A CD1  1  
ATOM   4325   C  CD2  . PHE A 1 289 ? 8.110   23.028 36.788 1.00 11.51  ? 292 PHE A CD2  1  
ATOM   4326   C  CE1  . PHE A 1 289 ? 8.005   23.471 34.026 1.00 13.44  ? 292 PHE A CE1  1  
ATOM   4327   C  CE2  . PHE A 1 289 ? 7.581   22.047 35.942 1.00 12.74  ? 292 PHE A CE2  1  
ATOM   4328   C  CZ   . PHE A 1 289 ? 7.528   22.268 34.562 1.00 13.03  ? 292 PHE A CZ   1  
ATOM   4329   H  H    . PHE A 1 289 ? 10.703  27.443 37.891 1.00 0.00   ? 292 PHE A H    1  
ATOM   4330   H  HA   . PHE A 1 289 ? 11.187  24.706 36.785 1.00 0.00   ? 292 PHE A HA   1  
ATOM   4331   H  HB2  . PHE A 1 289 ? 9.123   24.932 38.189 1.00 0.00   ? 292 PHE A HB2  1  
ATOM   4332   H  HB3  . PHE A 1 289 ? 8.551   26.186 37.090 1.00 0.00   ? 292 PHE A HB3  1  
ATOM   4333   H  HD1  . PHE A 1 289 ? 8.906   25.379 34.459 1.00 0.00   ? 292 PHE A HD1  1  
ATOM   4334   H  HD2  . PHE A 1 289 ? 8.151   22.858 37.854 1.00 0.00   ? 292 PHE A HD2  1  
ATOM   4335   H  HE1  . PHE A 1 289 ? 7.965   23.641 32.960 1.00 0.00   ? 292 PHE A HE1  1  
ATOM   4336   H  HE2  . PHE A 1 289 ? 7.213   21.120 36.355 1.00 0.00   ? 292 PHE A HE2  1  
ATOM   4337   H  HZ   . PHE A 1 289 ? 7.117   21.512 33.910 1.00 0.00   ? 292 PHE A HZ   1  
ATOM   4338   N  N    . TYR A 1 290 ? 11.212  25.598 34.443 1.00 10.57  ? 293 TYR A N    1  
ATOM   4339   C  CA   . TYR A 1 290 ? 11.289  26.219 33.096 1.00 10.68  ? 293 TYR A CA   1  
ATOM   4340   C  C    . TYR A 1 290 ? 11.165  25.165 31.998 1.00 11.20  ? 293 TYR A C    1  
ATOM   4341   O  O    . TYR A 1 290 ? 11.737  24.095 32.064 1.00 11.16  ? 293 TYR A O    1  
ATOM   4342   C  CB   . TYR A 1 290 ? 12.630  26.941 32.950 1.00 10.59  ? 293 TYR A CB   1  
ATOM   4343   C  CG   . TYR A 1 290 ? 12.818  27.370 31.515 1.00 10.87  ? 293 TYR A CG   1  
ATOM   4344   C  CD1  . TYR A 1 290 ? 12.086  28.450 31.006 1.00 10.96  ? 293 TYR A CD1  1  
ATOM   4345   C  CD2  . TYR A 1 290 ? 13.723  26.689 30.693 1.00 10.69  ? 293 TYR A CD2  1  
ATOM   4346   C  CE1  . TYR A 1 290 ? 12.260  28.848 29.675 1.00 11.30  ? 293 TYR A CE1  1  
ATOM   4347   C  CE2  . TYR A 1 290 ? 13.897  27.087 29.362 1.00 10.85  ? 293 TYR A CE2  1  
ATOM   4348   C  CZ   . TYR A 1 290 ? 13.166  28.166 28.853 1.00 12.12  ? 293 TYR A CZ   1  
ATOM   4349   O  OH   . TYR A 1 290 ? 13.338  28.559 27.541 1.00 12.92  ? 293 TYR A OH   1  
ATOM   4350   H  H    . TYR A 1 290 ? 11.611  24.718 34.609 1.00 0.00   ? 293 TYR A H    1  
ATOM   4351   H  HA   . TYR A 1 290 ? 10.490  26.937 32.990 1.00 0.00   ? 293 TYR A HA   1  
ATOM   4352   H  HB2  . TYR A 1 290 ? 12.641  27.810 33.591 1.00 0.00   ? 293 TYR A HB2  1  
ATOM   4353   H  HB3  . TYR A 1 290 ? 13.430  26.274 33.233 1.00 0.00   ? 293 TYR A HB3  1  
ATOM   4354   H  HD1  . TYR A 1 290 ? 11.388  28.976 31.640 1.00 0.00   ? 293 TYR A HD1  1  
ATOM   4355   H  HD2  . TYR A 1 290 ? 14.287  25.856 31.086 1.00 0.00   ? 293 TYR A HD2  1  
ATOM   4356   H  HE1  . TYR A 1 290 ? 11.696  29.681 29.282 1.00 0.00   ? 293 TYR A HE1  1  
ATOM   4357   H  HE2  . TYR A 1 290 ? 14.596  26.561 28.728 1.00 0.00   ? 293 TYR A HE2  1  
ATOM   4358   H  HH   . TYR A 1 290 ? 14.271  28.735 27.404 1.00 0.00   ? 293 TYR A HH   1  
ATOM   4359   N  N    . THR A 1 291 ? 10.431  25.491 30.976 1.00 11.13  ? 294 THR A N    1  
ATOM   4360   C  CA   . THR A 1 291 ? 10.250  24.570 29.827 1.00 11.76  ? 294 THR A CA   1  
ATOM   4361   C  C    . THR A 1 291 ? 11.254  24.969 28.750 1.00 11.73  ? 294 THR A C    1  
ATOM   4362   O  O    . THR A 1 291 ? 11.250  26.078 28.253 1.00 12.46  ? 294 THR A O    1  
ATOM   4363   C  CB   . THR A 1 291 ? 8.826   24.697 29.281 1.00 12.42  ? 294 THR A CB   1  
ATOM   4364   O  OG1  . THR A 1 291 ? 7.897   24.389 30.311 1.00 13.10  ? 294 THR A OG1  1  
ATOM   4365   C  CG2  . THR A 1 291 ? 8.637   23.727 28.113 1.00 13.12  ? 294 THR A CG2  1  
ATOM   4366   H  H    . THR A 1 291 ? 10.003  26.372 30.956 1.00 0.00   ? 294 THR A H    1  
ATOM   4367   H  HA   . THR A 1 291 ? 10.435  23.553 30.141 1.00 0.00   ? 294 THR A HA   1  
ATOM   4368   H  HB   . THR A 1 291 ? 8.661   25.705 28.935 1.00 0.00   ? 294 THR A HB   1  
ATOM   4369   H  HG1  . THR A 1 291 ? 7.012   24.499 29.954 1.00 0.00   ? 294 THR A HG1  1  
ATOM   4370   H  HG21 . THR A 1 291 ? 8.410   22.743 28.496 1.00 0.00   ? 294 THR A HG21 1  
ATOM   4371   H  HG22 . THR A 1 291 ? 9.544   23.685 27.529 1.00 0.00   ? 294 THR A HG22 1  
ATOM   4372   H  HG23 . THR A 1 291 ? 7.823   24.067 27.491 1.00 0.00   ? 294 THR A HG23 1  
ATOM   4373   N  N    . PHE A 1 292 ? 12.132  24.081 28.418 1.00 11.92  ? 295 PHE A N    1  
ATOM   4374   C  CA   . PHE A 1 292 ? 13.177  24.381 27.410 1.00 12.03  ? 295 PHE A CA   1  
ATOM   4375   C  C    . PHE A 1 292 ? 12.551  24.538 26.035 1.00 12.55  ? 295 PHE A C    1  
ATOM   4376   O  O    . PHE A 1 292 ? 11.722  23.755 25.616 1.00 12.71  ? 295 PHE A O    1  
ATOM   4377   C  CB   . PHE A 1 292 ? 14.193  23.237 27.377 1.00 11.71  ? 295 PHE A CB   1  
ATOM   4378   C  CG   . PHE A 1 292 ? 15.190  23.417 28.496 1.00 11.17  ? 295 PHE A CG   1  
ATOM   4379   C  CD1  . PHE A 1 292 ? 16.316  24.227 28.308 1.00 11.56  ? 295 PHE A CD1  1  
ATOM   4380   C  CD2  . PHE A 1 292 ? 14.989  22.773 29.723 1.00 11.65  ? 295 PHE A CD2  1  
ATOM   4381   C  CE1  . PHE A 1 292 ? 17.241  24.393 29.346 1.00 12.36  ? 295 PHE A CE1  1  
ATOM   4382   C  CE2  . PHE A 1 292 ? 15.913  22.939 30.761 1.00 11.80  ? 295 PHE A CE2  1  
ATOM   4383   C  CZ   . PHE A 1 292 ? 17.039  23.750 30.572 1.00 11.28  ? 295 PHE A CZ   1  
ATOM   4384   H  H    . PHE A 1 292 ? 12.123  23.205 28.858 1.00 0.00   ? 295 PHE A H    1  
ATOM   4385   H  HA   . PHE A 1 292 ? 13.682  25.296 27.680 1.00 0.00   ? 295 PHE A HA   1  
ATOM   4386   H  HB2  . PHE A 1 292 ? 13.678  22.296 27.500 1.00 0.00   ? 295 PHE A HB2  1  
ATOM   4387   H  HB3  . PHE A 1 292 ? 14.711  23.244 26.430 1.00 0.00   ? 295 PHE A HB3  1  
ATOM   4388   H  HD1  . PHE A 1 292 ? 16.471  24.724 27.361 1.00 0.00   ? 295 PHE A HD1  1  
ATOM   4389   H  HD2  . PHE A 1 292 ? 14.120  22.148 29.869 1.00 0.00   ? 295 PHE A HD2  1  
ATOM   4390   H  HE1  . PHE A 1 292 ? 18.109  25.019 29.200 1.00 0.00   ? 295 PHE A HE1  1  
ATOM   4391   H  HE2  . PHE A 1 292 ? 15.758  22.443 31.707 1.00 0.00   ? 295 PHE A HE2  1  
ATOM   4392   H  HZ   . PHE A 1 292 ? 17.753  23.878 31.373 1.00 0.00   ? 295 PHE A HZ   1  
ATOM   4393   N  N    . GLN A 1 293 ? 12.958  25.544 25.328 1.00 13.12  ? 296 GLN A N    1  
ATOM   4394   C  CA   . GLN A 1 293 ? 12.409  25.773 23.953 1.00 14.13  ? 296 GLN A CA   1  
ATOM   4395   C  C    . GLN A 1 293 ? 13.524  25.733 22.872 1.00 14.00  ? 296 GLN A C    1  
ATOM   4396   O  O    . GLN A 1 293 ? 13.233  25.695 21.693 1.00 15.47  ? 296 GLN A O    1  
ATOM   4397   C  CB   . GLN A 1 293 ? 11.723  27.140 23.911 1.00 15.74  ? 296 GLN A CB   1  
ATOM   4398   C  CG   . GLN A 1 293 ? 10.745  27.257 25.082 1.00 19.73  ? 296 GLN A CG   1  
ATOM   4399   C  CD   . GLN A 1 293 ? 9.394   26.662 24.681 1.00 24.52  ? 296 GLN A CD   1  
ATOM   4400   O  OE1  . GLN A 1 293 ? 8.751   25.998 25.469 1.00 32.09  ? 296 GLN A OE1  1  
ATOM   4401   N  NE2  . GLN A 1 293 ? 8.933   26.873 23.478 1.00 28.43  ? 296 GLN A NE2  1  
ATOM   4402   H  H    . GLN A 1 293 ? 13.635  26.152 25.690 1.00 0.00   ? 296 GLN A H    1  
ATOM   4403   H  HA   . GLN A 1 293 ? 11.679  25.008 23.734 1.00 0.00   ? 296 GLN A HA   1  
ATOM   4404   H  HB2  . GLN A 1 293 ? 12.469  27.919 23.984 1.00 0.00   ? 296 GLN A HB2  1  
ATOM   4405   H  HB3  . GLN A 1 293 ? 11.183  27.244 22.982 1.00 0.00   ? 296 GLN A HB3  1  
ATOM   4406   H  HG2  . GLN A 1 293 ? 11.138  26.720 25.934 1.00 0.00   ? 296 GLN A HG2  1  
ATOM   4407   H  HG3  . GLN A 1 293 ? 10.615  28.297 25.341 1.00 0.00   ? 296 GLN A HG3  1  
ATOM   4408   H  HE21 . GLN A 1 293 ? 9.452   27.409 22.842 1.00 0.00   ? 296 GLN A HE21 1  
ATOM   4409   H  HE22 . GLN A 1 293 ? 8.069   26.497 23.211 1.00 0.00   ? 296 GLN A HE22 1  
ATOM   4410   N  N    . GLN A 1 294 ? 14.788  25.750 23.243 1.00 13.44  ? 297 GLN A N    1  
ATOM   4411   C  CA   . GLN A 1 294 ? 15.866  25.723 22.216 1.00 13.56  ? 297 GLN A CA   1  
ATOM   4412   C  C    . GLN A 1 294 ? 16.941  24.717 22.625 1.00 13.44  ? 297 GLN A C    1  
ATOM   4413   O  O    . GLN A 1 294 ? 17.313  24.623 23.778 1.00 13.52  ? 297 GLN A O    1  
ATOM   4414   C  CB   . GLN A 1 294 ? 16.490  27.115 22.096 1.00 13.50  ? 297 GLN A CB   1  
ATOM   4415   C  CG   . GLN A 1 294 ? 15.419  28.121 21.669 1.00 13.59  ? 297 GLN A CG   1  
ATOM   4416   C  CD   . GLN A 1 294 ? 15.494  28.336 20.156 1.00 13.41  ? 297 GLN A CD   1  
ATOM   4417   O  OE1  . GLN A 1 294 ? 15.422  27.393 19.393 1.00 14.53  ? 297 GLN A OE1  1  
ATOM   4418   N  NE2  . GLN A 1 294 ? 15.636  29.545 19.688 1.00 15.07  ? 297 GLN A NE2  1  
ATOM   4419   H  H    . GLN A 1 294 ? 15.019  25.788 24.195 1.00 0.00   ? 297 GLN A H    1  
ATOM   4420   H  HA   . GLN A 1 294 ? 15.447  25.434 21.263 1.00 0.00   ? 297 GLN A HA   1  
ATOM   4421   H  HB2  . GLN A 1 294 ? 16.901  27.408 23.051 1.00 0.00   ? 297 GLN A HB2  1  
ATOM   4422   H  HB3  . GLN A 1 294 ? 17.277  27.095 21.357 1.00 0.00   ? 297 GLN A HB3  1  
ATOM   4423   H  HG2  . GLN A 1 294 ? 14.443  27.739 21.932 1.00 0.00   ? 297 GLN A HG2  1  
ATOM   4424   H  HG3  . GLN A 1 294 ? 15.586  29.061 22.173 1.00 0.00   ? 297 GLN A HG3  1  
ATOM   4425   H  HE21 . GLN A 1 294 ? 15.695  30.306 20.304 1.00 0.00   ? 297 GLN A HE21 1  
ATOM   4426   H  HE22 . GLN A 1 294 ? 15.685  29.693 18.720 1.00 0.00   ? 297 GLN A HE22 1  
ATOM   4427   N  N    . PRO A 1 295 ? 17.430  23.969 21.677 1.00 13.31  ? 298 PRO A N    1  
ATOM   4428   C  CA   . PRO A 1 295 ? 18.475  22.943 21.909 1.00 13.50  ? 298 PRO A CA   1  
ATOM   4429   C  C    . PRO A 1 295 ? 19.881  23.540 21.892 1.00 14.05  ? 298 PRO A C    1  
ATOM   4430   O  O    . PRO A 1 295 ? 20.126  24.567 21.290 1.00 14.76  ? 298 PRO A O    1  
ATOM   4431   C  CB   . PRO A 1 295 ? 18.288  21.985 20.735 1.00 14.06  ? 298 PRO A CB   1  
ATOM   4432   C  CG   . PRO A 1 295 ? 17.744  22.824 19.622 1.00 14.23  ? 298 PRO A CG   1  
ATOM   4433   C  CD   . PRO A 1 295 ? 17.030  24.021 20.263 1.00 13.17  ? 298 PRO A CD   1  
ATOM   4434   H  HA   . PRO A 1 295 ? 18.296  22.422 22.834 1.00 0.00   ? 298 PRO A HA   1  
ATOM   4435   H  HB2  . PRO A 1 295 ? 19.238  21.552 20.452 1.00 0.00   ? 298 PRO A HB2  1  
ATOM   4436   H  HB3  . PRO A 1 295 ? 17.582  21.211 20.992 1.00 0.00   ? 298 PRO A HB3  1  
ATOM   4437   H  HG2  . PRO A 1 295 ? 18.553  23.167 18.992 1.00 0.00   ? 298 PRO A HG2  1  
ATOM   4438   H  HG3  . PRO A 1 295 ? 17.038  22.252 19.040 1.00 0.00   ? 298 PRO A HG3  1  
ATOM   4439   H  HD2  . PRO A 1 295 ? 17.360  24.944 19.807 1.00 0.00   ? 298 PRO A HD2  1  
ATOM   4440   H  HD3  . PRO A 1 295 ? 15.959  23.915 20.175 1.00 0.00   ? 298 PRO A HD3  1  
ATOM   4441   N  N    . GLY A 1 296 ? 20.805  22.903 22.547 1.00 14.06  ? 299 GLY A N    1  
ATOM   4442   C  CA   . GLY A 1 296 ? 22.194  23.426 22.570 1.00 14.86  ? 299 GLY A CA   1  
ATOM   4443   C  C    . GLY A 1 296 ? 22.729  23.360 23.996 1.00 14.37  ? 299 GLY A C    1  
ATOM   4444   O  O    . GLY A 1 296 ? 22.120  22.779 24.873 1.00 14.32  ? 299 GLY A O    1  
ATOM   4445   H  H    . GLY A 1 296 ? 20.585  22.076 23.024 1.00 0.00   ? 299 GLY A H    1  
ATOM   4446   H  HA2  . GLY A 1 296 ? 22.816  22.827 21.920 1.00 0.00   ? 299 GLY A HA2  1  
ATOM   4447   H  HA3  . GLY A 1 296 ? 22.200  24.451 22.234 1.00 0.00   ? 299 GLY A HA3  1  
ATOM   4448   N  N    . ILE A 1 297 ? 23.860  23.950 24.236 0.50 14.25  ? 300 ILE A N    1  
ATOM   4449   C  CA   . ILE A 1 297 ? 24.438  23.924 25.612 0.50 14.05  ? 300 ILE A CA   1  
ATOM   4450   C  C    . ILE A 1 297 ? 24.124  25.237 26.346 0.50 13.93  ? 300 ILE A C    1  
ATOM   4451   O  O    . ILE A 1 297 ? 24.366  26.317 25.844 0.50 13.54  ? 300 ILE A O    1  
ATOM   4452   C  CB   . ILE A 1 297 ? 25.954  23.744 25.521 0.50 14.58  ? 300 ILE A CB   1  
ATOM   4453   C  CG1  . ILE A 1 297 ? 26.559  23.806 26.925 0.50 14.71  ? 300 ILE A CG1  1  
ATOM   4454   C  CG2  . ILE A 1 297 ? 26.550  24.860 24.661 0.50 14.48  ? 300 ILE A CG2  1  
ATOM   4455   C  CD1  . ILE A 1 297 ? 26.985  22.403 27.361 0.50 15.36  ? 300 ILE A CD1  1  
ATOM   4456   H  H    . ILE A 1 297 ? 24.334  24.413 23.514 1.00 0.00   ? 300 ILE A H    1  
ATOM   4457   H  HA   . ILE A 1 297 ? 24.013  23.097 26.162 1.00 0.00   ? 300 ILE A HA   1  
ATOM   4458   H  HB   . ILE A 1 297 ? 26.176  22.787 25.072 1.00 0.00   ? 300 ILE A HB   1  
ATOM   4459   H  HG12 . ILE A 1 297 ? 27.420  24.459 26.918 1.00 0.00   ? 300 ILE A HG12 1  
ATOM   4460   H  HG13 . ILE A 1 297 ? 25.823  24.188 27.618 1.00 0.00   ? 300 ILE A HG13 1  
ATOM   4461   H  HG21 . ILE A 1 297 ? 27.596  24.658 24.484 1.00 0.00   ? 300 ILE A HG21 1  
ATOM   4462   H  HG22 . ILE A 1 297 ? 26.447  25.804 25.175 1.00 0.00   ? 300 ILE A HG22 1  
ATOM   4463   H  HG23 . ILE A 1 297 ? 26.027  24.905 23.717 1.00 0.00   ? 300 ILE A HG23 1  
ATOM   4464   H  HD11 . ILE A 1 297 ? 27.249  22.416 28.408 1.00 0.00   ? 300 ILE A HD11 1  
ATOM   4465   H  HD12 . ILE A 1 297 ? 27.838  22.089 26.777 1.00 0.00   ? 300 ILE A HD12 1  
ATOM   4466   H  HD13 . ILE A 1 297 ? 26.168  21.714 27.204 1.00 0.00   ? 300 ILE A HD13 1  
ATOM   4467   N  N    . TYR A 1 298 ? 23.599  25.142 27.540 1.00 13.37  ? 301 TYR A N    1  
ATOM   4468   C  CA   . TYR A 1 298 ? 23.277  26.358 28.332 1.00 12.72  ? 301 TYR A CA   1  
ATOM   4469   C  C    . TYR A 1 298 ? 23.992  26.266 29.682 1.00 12.56  ? 301 TYR A C    1  
ATOM   4470   O  O    . TYR A 1 298 ? 24.066  25.216 30.289 1.00 13.32  ? 301 TYR A O    1  
ATOM   4471   C  CB   . TYR A 1 298 ? 21.765  26.439 28.556 1.00 12.33  ? 301 TYR A CB   1  
ATOM   4472   C  CG   . TYR A 1 298 ? 21.068  26.628 27.230 1.00 11.56  ? 301 TYR A CG   1  
ATOM   4473   C  CD1  . TYR A 1 298 ? 21.222  25.675 26.216 1.00 11.84  ? 301 TYR A CD1  1  
ATOM   4474   C  CD2  . TYR A 1 298 ? 20.269  27.757 27.014 1.00 11.75  ? 301 TYR A CD2  1  
ATOM   4475   C  CE1  . TYR A 1 298 ? 20.576  25.851 24.986 1.00 12.20  ? 301 TYR A CE1  1  
ATOM   4476   C  CE2  . TYR A 1 298 ? 19.623  27.933 25.785 1.00 11.58  ? 301 TYR A CE2  1  
ATOM   4477   C  CZ   . TYR A 1 298 ? 19.777  26.980 24.771 1.00 11.74  ? 301 TYR A CZ   1  
ATOM   4478   O  OH   . TYR A 1 298 ? 19.140  27.153 23.559 1.00 12.96  ? 301 TYR A OH   1  
ATOM   4479   H  H    . TYR A 1 298 ? 23.425  24.256 27.922 1.00 0.00   ? 301 TYR A H    1  
ATOM   4480   H  HA   . TYR A 1 298 ? 23.614  27.236 27.801 1.00 0.00   ? 301 TYR A HA   1  
ATOM   4481   H  HB2  . TYR A 1 298 ? 21.420  25.525 29.017 1.00 0.00   ? 301 TYR A HB2  1  
ATOM   4482   H  HB3  . TYR A 1 298 ? 21.541  27.274 29.202 1.00 0.00   ? 301 TYR A HB3  1  
ATOM   4483   H  HD1  . TYR A 1 298 ? 21.839  24.804 26.383 1.00 0.00   ? 301 TYR A HD1  1  
ATOM   4484   H  HD2  . TYR A 1 298 ? 20.151  28.492 27.796 1.00 0.00   ? 301 TYR A HD2  1  
ATOM   4485   H  HE1  . TYR A 1 298 ? 20.694  25.115 24.204 1.00 0.00   ? 301 TYR A HE1  1  
ATOM   4486   H  HE2  . TYR A 1 298 ? 19.007  28.804 25.618 1.00 0.00   ? 301 TYR A HE2  1  
ATOM   4487   H  HH   . TYR A 1 298 ? 18.221  27.366 23.734 1.00 0.00   ? 301 TYR A HH   1  
ATOM   4488   N  N    . ALA A 1 299 ? 24.529  27.355 30.148 1.00 12.12  ? 302 ALA A N    1  
ATOM   4489   C  CA   . ALA A 1 299 ? 25.249  27.346 31.438 1.00 12.69  ? 302 ALA A CA   1  
ATOM   4490   C  C    . ALA A 1 299 ? 24.305  27.862 32.501 1.00 12.42  ? 302 ALA A C    1  
ATOM   4491   O  O    . ALA A 1 299 ? 23.483  28.720 32.251 1.00 14.99  ? 302 ALA A O    1  
ATOM   4492   C  CB   . ALA A 1 299 ? 26.477  28.254 31.351 1.00 13.06  ? 302 ALA A CB   1  
ATOM   4493   H  H    . ALA A 1 299 ? 24.463  28.187 29.635 1.00 0.00   ? 302 ALA A H    1  
ATOM   4494   H  HA   . ALA A 1 299 ? 25.555  26.339 31.679 1.00 0.00   ? 302 ALA A HA   1  
ATOM   4495   H  HB1  . ALA A 1 299 ? 26.801  28.325 30.323 1.00 0.00   ? 302 ALA A HB1  1  
ATOM   4496   H  HB2  . ALA A 1 299 ? 27.274  27.841 31.952 1.00 0.00   ? 302 ALA A HB2  1  
ATOM   4497   H  HB3  . ALA A 1 299 ? 26.224  29.238 31.718 1.00 0.00   ? 302 ALA A HB3  1  
ATOM   4498   N  N    . TYR A 1 300 ? 24.393  27.341 33.676 1.00 11.33  ? 303 TYR A N    1  
ATOM   4499   C  CA   . TYR A 1 300 ? 23.467  27.806 34.737 1.00 10.61  ? 303 TYR A CA   1  
ATOM   4500   C  C    . TYR A 1 300 ? 24.317  28.140 35.922 1.00 10.04  ? 303 TYR A C    1  
ATOM   4501   O  O    . TYR A 1 300 ? 24.991  27.282 36.458 1.00 10.49  ? 303 TYR A O    1  
ATOM   4502   C  CB   . TYR A 1 300 ? 22.480  26.693 35.096 1.00 10.70  ? 303 TYR A CB   1  
ATOM   4503   C  CG   . TYR A 1 300 ? 21.885  26.967 36.456 1.00 8.85   ? 303 TYR A CG   1  
ATOM   4504   C  CD1  . TYR A 1 300 ? 22.608  26.654 37.613 1.00 10.73  ? 303 TYR A CD1  1  
ATOM   4505   C  CD2  . TYR A 1 300 ? 20.609  27.535 36.560 1.00 10.69  ? 303 TYR A CD2  1  
ATOM   4506   C  CE1  . TYR A 1 300 ? 22.056  26.909 38.874 1.00 11.02  ? 303 TYR A CE1  1  
ATOM   4507   C  CE2  . TYR A 1 300 ? 20.057  27.789 37.822 1.00 10.14  ? 303 TYR A CE2  1  
ATOM   4508   C  CZ   . TYR A 1 300 ? 20.781  27.476 38.979 1.00 10.43  ? 303 TYR A CZ   1  
ATOM   4509   O  OH   . TYR A 1 300 ? 20.236  27.727 40.222 1.00 9.47   ? 303 TYR A OH   1  
ATOM   4510   H  H    . TYR A 1 300 ? 25.050  26.638 33.862 1.00 0.00   ? 303 TYR A H    1  
ATOM   4511   H  HA   . TYR A 1 300 ? 22.934  28.685 34.404 1.00 0.00   ? 303 TYR A HA   1  
ATOM   4512   H  HB2  . TYR A 1 300 ? 21.692  26.659 34.358 1.00 0.00   ? 303 TYR A HB2  1  
ATOM   4513   H  HB3  . TYR A 1 300 ? 22.997  25.745 35.115 1.00 0.00   ? 303 TYR A HB3  1  
ATOM   4514   H  HD1  . TYR A 1 300 ? 23.592  26.217 37.533 1.00 0.00   ? 303 TYR A HD1  1  
ATOM   4515   H  HD2  . TYR A 1 300 ? 20.051  27.776 35.668 1.00 0.00   ? 303 TYR A HD2  1  
ATOM   4516   H  HE1  . TYR A 1 300 ? 22.614  26.667 39.767 1.00 0.00   ? 303 TYR A HE1  1  
ATOM   4517   H  HE2  . TYR A 1 300 ? 19.073  28.227 37.902 1.00 0.00   ? 303 TYR A HE2  1  
ATOM   4518   H  HH   . TYR A 1 300 ? 19.410  28.199 40.094 1.00 0.00   ? 303 TYR A HH   1  
ATOM   4519   N  N    . VAL A 1 301 ? 24.371  29.365 36.328 1.00 9.61   ? 304 VAL A N    1  
ATOM   4520   C  CA   . VAL A 1 301 ? 25.289  29.616 37.455 1.00 9.85   ? 304 VAL A CA   1  
ATOM   4521   C  C    . VAL A 1 301 ? 24.960  30.876 38.217 1.00 9.03   ? 304 VAL A C    1  
ATOM   4522   O  O    . VAL A 1 301 ? 24.114  31.667 37.851 1.00 10.34  ? 304 VAL A O    1  
ATOM   4523   C  CB   . VAL A 1 301 ? 26.708  29.732 36.902 1.00 9.78   ? 304 VAL A CB   1  
ATOM   4524   C  CG1  . VAL A 1 301 ? 26.824  28.914 35.615 1.00 10.64  ? 304 VAL A CG1  1  
ATOM   4525   C  CG2  . VAL A 1 301 ? 27.014  31.201 36.600 1.00 10.46  ? 304 VAL A CG2  1  
ATOM   4526   H  H    . VAL A 1 301 ? 23.876  30.086 35.886 1.00 0.00   ? 304 VAL A H    1  
ATOM   4527   H  HA   . VAL A 1 301 ? 25.254  28.777 38.131 1.00 0.00   ? 304 VAL A HA   1  
ATOM   4528   H  HB   . VAL A 1 301 ? 27.409  29.358 37.630 1.00 0.00   ? 304 VAL A HB   1  
ATOM   4529   H  HG11 . VAL A 1 301 ? 27.853  28.903 35.287 1.00 0.00   ? 304 VAL A HG11 1  
ATOM   4530   H  HG12 . VAL A 1 301 ? 26.207  29.360 34.848 1.00 0.00   ? 304 VAL A HG12 1  
ATOM   4531   H  HG13 . VAL A 1 301 ? 26.494  27.903 35.800 1.00 0.00   ? 304 VAL A HG13 1  
ATOM   4532   H  HG21 . VAL A 1 301 ? 27.789  31.260 35.850 1.00 0.00   ? 304 VAL A HG21 1  
ATOM   4533   H  HG22 . VAL A 1 301 ? 27.347  31.692 37.502 1.00 0.00   ? 304 VAL A HG22 1  
ATOM   4534   H  HG23 . VAL A 1 301 ? 26.122  31.687 36.235 1.00 0.00   ? 304 VAL A HG23 1  
ATOM   4535   N  N    . ASN A 1 302 ? 25.670  31.047 39.282 1.00 8.99   ? 305 ASN A N    1  
ATOM   4536   C  CA   . ASN A 1 302 ? 25.500  32.231 40.140 1.00 8.56   ? 305 ASN A CA   1  
ATOM   4537   C  C    . ASN A 1 302 ? 25.885  33.403 39.291 1.00 8.99   ? 305 ASN A C    1  
ATOM   4538   O  O    . ASN A 1 302 ? 26.917  33.407 38.650 1.00 9.72   ? 305 ASN A O    1  
ATOM   4539   C  CB   . ASN A 1 302 ? 26.422  32.136 41.358 1.00 8.50   ? 305 ASN A CB   1  
ATOM   4540   C  CG   . ASN A 1 302 ? 26.271  33.396 42.212 1.00 8.40   ? 305 ASN A CG   1  
ATOM   4541   O  OD1  . ASN A 1 302 ? 25.804  34.413 41.738 1.00 9.70   ? 305 ASN A OD1  1  
ATOM   4542   N  ND2  . ASN A 1 302 ? 26.650  33.373 43.460 1.00 9.18   ? 305 ASN A ND2  1  
ATOM   4543   H  H    . ASN A 1 302 ? 26.347  30.379 39.518 1.00 0.00   ? 305 ASN A H    1  
ATOM   4544   H  HA   . ASN A 1 302 ? 24.470  32.319 40.453 1.00 0.00   ? 305 ASN A HA   1  
ATOM   4545   H  HB2  . ASN A 1 302 ? 26.154  31.269 41.944 1.00 0.00   ? 305 ASN A HB2  1  
ATOM   4546   H  HB3  . ASN A 1 302 ? 27.446  32.047 41.029 1.00 0.00   ? 305 ASN A HB3  1  
ATOM   4547   H  HD21 . ASN A 1 302 ? 27.027  32.554 43.843 1.00 0.00   ? 305 ASN A HD21 1  
ATOM   4548   H  HD22 . ASN A 1 302 ? 26.558  34.176 44.015 1.00 0.00   ? 305 ASN A HD22 1  
ATOM   4549   N  N    . HIS A 1 303 ? 25.054  34.366 39.215 1.00 8.97   ? 306 HIS A N    1  
ATOM   4550   C  CA   . HIS A 1 303 ? 25.379  35.503 38.317 1.00 9.55   ? 306 HIS A CA   1  
ATOM   4551   C  C    . HIS A 1 303 ? 26.658  36.118 38.797 1.00 9.37   ? 306 HIS A C    1  
ATOM   4552   O  O    . HIS A 1 303 ? 27.573  36.304 38.020 1.00 9.64   ? 306 HIS A O    1  
ATOM   4553   C  CB   . HIS A 1 303 ? 24.264  36.554 38.229 1.00 9.64   ? 306 HIS A CB   1  
ATOM   4554   C  CG   . HIS A 1 303 ? 24.249  37.124 36.816 1.00 10.20  ? 306 HIS A CG   1  
ATOM   4555   N  ND1  . HIS A 1 303 ? 24.547  38.459 36.537 1.00 9.24   ? 306 HIS A ND1  1  
ATOM   4556   C  CD2  . HIS A 1 303 ? 24.003  36.549 35.590 1.00 9.94   ? 306 HIS A CD2  1  
ATOM   4557   C  CE1  . HIS A 1 303 ? 24.478  38.639 35.203 1.00 9.95   ? 306 HIS A CE1  1  
ATOM   4558   N  NE2  . HIS A 1 303 ? 24.150  37.502 34.607 1.00 10.78  ? 306 HIS A NE2  1  
ATOM   4559   H  H    . HIS A 1 303 ? 24.200  34.332 39.695 1.00 0.00   ? 306 HIS A H    1  
ATOM   4560   H  HA   . HIS A 1 303 ? 25.553  35.105 37.325 1.00 0.00   ? 306 HIS A HA   1  
ATOM   4561   H  HB2  . HIS A 1 303 ? 23.311  36.091 38.447 1.00 0.00   ? 306 HIS A HB2  1  
ATOM   4562   H  HB3  . HIS A 1 303 ? 24.454  37.347 38.936 1.00 0.00   ? 306 HIS A HB3  1  
ATOM   4563   H  HD1  . HIS A 1 303 ? 24.769  39.148 37.198 1.00 0.00   ? 306 HIS A HD1  1  
ATOM   4564   H  HD2  . HIS A 1 303 ? 23.738  35.515 35.426 1.00 0.00   ? 306 HIS A HD2  1  
ATOM   4565   H  HE1  . HIS A 1 303 ? 24.662  39.573 34.695 1.00 0.00   ? 306 HIS A HE1  1  
ATOM   4566   N  N    . ASN A 1 304 ? 26.810  36.397 40.063 1.00 9.01   ? 307 ASN A N    1  
ATOM   4567   C  CA   . ASN A 1 304 ? 28.163  36.937 40.411 1.00 8.81   ? 307 ASN A CA   1  
ATOM   4568   C  C    . ASN A 1 304 ? 29.149  36.309 39.379 1.00 8.76   ? 307 ASN A C    1  
ATOM   4569   O  O    . ASN A 1 304 ? 29.666  35.230 39.591 1.00 9.03   ? 307 ASN A O    1  
ATOM   4570   C  CB   . ASN A 1 304 ? 28.548  36.512 41.831 1.00 9.36   ? 307 ASN A CB   1  
ATOM   4571   C  CG   . ASN A 1 304 ? 29.802  37.271 42.268 1.00 9.44   ? 307 ASN A CG   1  
ATOM   4572   O  OD1  . ASN A 1 304 ? 30.798  37.273 41.573 1.00 11.45  ? 307 ASN A OD1  1  
ATOM   4573   N  ND2  . ASN A 1 304 ? 29.795  37.920 43.401 1.00 11.47  ? 307 ASN A ND2  1  
ATOM   4574   H  H    . ASN A 1 304 ? 26.118  36.221 40.734 1.00 0.00   ? 307 ASN A H    1  
ATOM   4575   H  HA   . ASN A 1 304 ? 28.167  38.015 40.321 1.00 0.00   ? 307 ASN A HA   1  
ATOM   4576   H  HB2  . ASN A 1 304 ? 27.735  36.737 42.506 1.00 0.00   ? 307 ASN A HB2  1  
ATOM   4577   H  HB3  . ASN A 1 304 ? 28.747  35.451 41.848 1.00 0.00   ? 307 ASN A HB3  1  
ATOM   4578   H  HD21 . ASN A 1 304 ? 28.992  37.918 43.961 1.00 0.00   ? 307 ASN A HD21 1  
ATOM   4579   H  HD22 . ASN A 1 304 ? 30.593  38.409 43.690 1.00 0.00   ? 307 ASN A HD22 1  
ATOM   4580   N  N    . LEU A 1 305 ? 29.348  36.943 38.231 1.00 8.88   ? 308 LEU A N    1  
ATOM   4581   C  CA   . LEU A 1 305 ? 30.208  36.355 37.164 1.00 8.92   ? 308 LEU A CA   1  
ATOM   4582   C  C    . LEU A 1 305 ? 31.508  35.895 37.766 1.00 9.31   ? 308 LEU A C    1  
ATOM   4583   O  O    . LEU A 1 305 ? 32.001  34.819 37.493 1.00 9.63   ? 308 LEU A O    1  
ATOM   4584   C  CB   . LEU A 1 305 ? 30.487  37.412 36.093 1.00 9.16   ? 308 LEU A CB   1  
ATOM   4585   C  CG   . LEU A 1 305 ? 29.221  37.649 35.268 1.00 10.35  ? 308 LEU A CG   1  
ATOM   4586   C  CD1  . LEU A 1 305 ? 29.584  38.378 33.973 1.00 11.31  ? 308 LEU A CD1  1  
ATOM   4587   C  CD2  . LEU A 1 305 ? 28.575  36.304 34.930 1.00 11.71  ? 308 LEU A CD2  1  
ATOM   4588   H  H    . LEU A 1 305 ? 28.875  37.784 38.058 1.00 0.00   ? 308 LEU A H    1  
ATOM   4589   H  HA   . LEU A 1 305 ? 29.702  35.514 36.715 1.00 0.00   ? 308 LEU A HA   1  
ATOM   4590   H  HB2  . LEU A 1 305 ? 30.787  38.335 36.567 1.00 0.00   ? 308 LEU A HB2  1  
ATOM   4591   H  HB3  . LEU A 1 305 ? 31.278  37.066 35.443 1.00 0.00   ? 308 LEU A HB3  1  
ATOM   4592   H  HG   . LEU A 1 305 ? 28.528  38.251 35.838 1.00 0.00   ? 308 LEU A HG   1  
ATOM   4593   H  HD11 . LEU A 1 305 ? 30.628  38.654 33.996 1.00 0.00   ? 308 LEU A HD11 1  
ATOM   4594   H  HD12 . LEU A 1 305 ? 28.979  39.268 33.879 1.00 0.00   ? 308 LEU A HD12 1  
ATOM   4595   H  HD13 . LEU A 1 305 ? 29.401  37.728 33.130 1.00 0.00   ? 308 LEU A HD13 1  
ATOM   4596   H  HD21 . LEU A 1 305 ? 28.121  35.889 35.818 1.00 0.00   ? 308 LEU A HD21 1  
ATOM   4597   H  HD22 . LEU A 1 305 ? 29.329  35.624 34.561 1.00 0.00   ? 308 LEU A HD22 1  
ATOM   4598   H  HD23 . LEU A 1 305 ? 27.818  36.448 34.173 1.00 0.00   ? 308 LEU A HD23 1  
ATOM   4599   N  N    . ILE A 1 306 ? 32.061  36.710 38.584 1.00 9.26   ? 309 ILE A N    1  
ATOM   4600   C  CA   . ILE A 1 306 ? 33.349  36.352 39.236 1.00 9.78   ? 309 ILE A CA   1  
ATOM   4601   C  C    . ILE A 1 306 ? 33.155  35.039 39.975 1.00 9.98   ? 309 ILE A C    1  
ATOM   4602   O  O    . ILE A 1 306 ? 33.906  34.098 39.809 1.00 9.85   ? 309 ILE A O    1  
ATOM   4603   C  CB   . ILE A 1 306 ? 33.748  37.448 40.225 1.00 9.82   ? 309 ILE A CB   1  
ATOM   4604   C  CG1  . ILE A 1 306 ? 33.929  38.770 39.475 1.00 9.96   ? 309 ILE A CG1  1  
ATOM   4605   C  CG2  . ILE A 1 306 ? 35.064  37.066 40.907 1.00 10.12  ? 309 ILE A CG2  1  
ATOM   4606   C  CD1  . ILE A 1 306 ? 34.181  39.896 40.479 1.00 10.37  ? 309 ILE A CD1  1  
ATOM   4607   H  H    . ILE A 1 306 ? 31.635  37.570 38.781 1.00 0.00   ? 309 ILE A H    1  
ATOM   4608   H  HA   . ILE A 1 306 ? 34.118  36.238 38.485 1.00 0.00   ? 309 ILE A HA   1  
ATOM   4609   H  HB   . ILE A 1 306 ? 32.975  37.557 40.972 1.00 0.00   ? 309 ILE A HB   1  
ATOM   4610   H  HG12 . ILE A 1 306 ? 34.771  38.690 38.803 1.00 0.00   ? 309 ILE A HG12 1  
ATOM   4611   H  HG13 . ILE A 1 306 ? 33.036  38.988 38.909 1.00 0.00   ? 309 ILE A HG13 1  
ATOM   4612   H  HG21 . ILE A 1 306 ? 35.876  37.616 40.455 1.00 0.00   ? 309 ILE A HG21 1  
ATOM   4613   H  HG22 . ILE A 1 306 ? 35.236  36.007 40.788 1.00 0.00   ? 309 ILE A HG22 1  
ATOM   4614   H  HG23 . ILE A 1 306 ? 35.007  37.306 41.958 1.00 0.00   ? 309 ILE A HG23 1  
ATOM   4615   H  HD11 . ILE A 1 306 ? 34.340  40.823 39.948 1.00 0.00   ? 309 ILE A HD11 1  
ATOM   4616   H  HD12 . ILE A 1 306 ? 35.055  39.664 41.069 1.00 0.00   ? 309 ILE A HD12 1  
ATOM   4617   H  HD13 . ILE A 1 306 ? 33.325  39.997 41.129 1.00 0.00   ? 309 ILE A HD13 1  
ATOM   4618   N  N    . GLU A 1 307 ? 32.133  34.961 40.776 1.00 9.72   ? 310 GLU A N    1  
ATOM   4619   C  CA   . GLU A 1 307 ? 31.865  33.689 41.515 1.00 9.48   ? 310 GLU A CA   1  
ATOM   4620   C  C    . GLU A 1 307 ? 31.544  32.532 40.535 1.00 9.54   ? 310 GLU A C    1  
ATOM   4621   O  O    . GLU A 1 307 ? 31.830  31.386 40.819 1.00 10.56  ? 310 GLU A O    1  
ATOM   4622   C  CB   . GLU A 1 307 ? 30.677  33.896 42.456 1.00 9.84   ? 310 GLU A CB   1  
ATOM   4623   C  CG   . GLU A 1 307 ? 30.899  35.158 43.291 1.00 10.66  ? 310 GLU A CG   1  
ATOM   4624   C  CD   . GLU A 1 307 ? 29.572  35.602 43.909 1.00 13.08  ? 310 GLU A CD   1  
ATOM   4625   O  OE1  . GLU A 1 307 ? 28.560  35.004 43.583 1.00 17.58  ? 310 GLU A OE1  1  
ATOM   4626   O  OE2  . GLU A 1 307 ? 29.591  36.533 44.698 1.00 15.44  ? 310 GLU A OE2  1  
ATOM   4627   H  H    . GLU A 1 307 ? 31.530  35.727 40.880 1.00 0.00   ? 310 GLU A H    1  
ATOM   4628   H  HA   . GLU A 1 307 ? 32.736  33.429 42.098 1.00 0.00   ? 310 GLU A HA   1  
ATOM   4629   H  HB2  . GLU A 1 307 ? 29.772  34.002 41.874 1.00 0.00   ? 310 GLU A HB2  1  
ATOM   4630   H  HB3  . GLU A 1 307 ? 30.585  33.044 43.113 1.00 0.00   ? 310 GLU A HB3  1  
ATOM   4631   H  HG2  . GLU A 1 307 ? 31.611  34.949 44.076 1.00 0.00   ? 310 GLU A HG2  1  
ATOM   4632   H  HG3  . GLU A 1 307 ? 31.280  35.946 42.658 1.00 0.00   ? 310 GLU A HG3  1  
ATOM   4633   N  N    . ALA A 1 308 ? 30.940  32.808 39.397 1.00 9.53   ? 311 ALA A N    1  
ATOM   4634   C  CA   . ALA A 1 308 ? 30.599  31.707 38.440 1.00 10.02  ? 311 ALA A CA   1  
ATOM   4635   C  C    . ALA A 1 308 ? 31.766  31.328 37.485 1.00 10.42  ? 311 ALA A C    1  
ATOM   4636   O  O    . ALA A 1 308 ? 31.817  30.210 37.013 1.00 12.15  ? 311 ALA A O    1  
ATOM   4637   C  CB   . ALA A 1 308 ? 29.400  32.142 37.598 1.00 10.17  ? 311 ALA A CB   1  
ATOM   4638   H  H    . ALA A 1 308 ? 30.702  33.734 39.182 1.00 0.00   ? 311 ALA A H    1  
ATOM   4639   H  HA   . ALA A 1 308 ? 30.318  30.832 39.006 1.00 0.00   ? 311 ALA A HA   1  
ATOM   4640   H  HB1  . ALA A 1 308 ? 28.983  31.283 37.094 1.00 0.00   ? 311 ALA A HB1  1  
ATOM   4641   H  HB2  . ALA A 1 308 ? 29.719  32.869 36.866 1.00 0.00   ? 311 ALA A HB2  1  
ATOM   4642   H  HB3  . ALA A 1 308 ? 28.651  32.583 38.239 1.00 0.00   ? 311 ALA A HB3  1  
ATOM   4643   N  N    . PHE A 1 309 ? 32.681  32.218 37.152 1.00 10.48  ? 312 PHE A N    1  
ATOM   4644   C  CA   . PHE A 1 309 ? 33.757  31.818 36.195 1.00 10.77  ? 312 PHE A CA   1  
ATOM   4645   C  C    . PHE A 1 309 ? 35.109  31.765 36.898 1.00 11.82  ? 312 PHE A C    1  
ATOM   4646   O  O    . PHE A 1 309 ? 35.947  30.939 36.594 1.00 14.43  ? 312 PHE A O    1  
ATOM   4647   C  CB   . PHE A 1 309 ? 33.821  32.835 35.054 1.00 10.49  ? 312 PHE A CB   1  
ATOM   4648   C  CG   . PHE A 1 309 ? 32.664  32.606 34.111 1.00 10.56  ? 312 PHE A CG   1  
ATOM   4649   C  CD1  . PHE A 1 309 ? 32.642  31.470 33.293 1.00 12.95  ? 312 PHE A CD1  1  
ATOM   4650   C  CD2  . PHE A 1 309 ? 31.615  33.531 34.054 1.00 12.05  ? 312 PHE A CD2  1  
ATOM   4651   C  CE1  . PHE A 1 309 ? 31.569  31.259 32.418 1.00 14.31  ? 312 PHE A CE1  1  
ATOM   4652   C  CE2  . PHE A 1 309 ? 30.542  33.319 33.180 1.00 12.78  ? 312 PHE A CE2  1  
ATOM   4653   C  CZ   . PHE A 1 309 ? 30.519  32.183 32.362 1.00 13.65  ? 312 PHE A CZ   1  
ATOM   4654   H  H    . PHE A 1 309 ? 32.638  33.133 37.502 1.00 0.00   ? 312 PHE A H    1  
ATOM   4655   H  HA   . PHE A 1 309 ? 33.529  30.844 35.789 1.00 0.00   ? 312 PHE A HA   1  
ATOM   4656   H  HB2  . PHE A 1 309 ? 33.764  33.835 35.459 1.00 0.00   ? 312 PHE A HB2  1  
ATOM   4657   H  HB3  . PHE A 1 309 ? 34.751  32.716 34.517 1.00 0.00   ? 312 PHE A HB3  1  
ATOM   4658   H  HD1  . PHE A 1 309 ? 33.452  30.757 33.337 1.00 0.00   ? 312 PHE A HD1  1  
ATOM   4659   H  HD2  . PHE A 1 309 ? 31.632  34.407 34.685 1.00 0.00   ? 312 PHE A HD2  1  
ATOM   4660   H  HE1  . PHE A 1 309 ? 31.552  30.382 31.787 1.00 0.00   ? 312 PHE A HE1  1  
ATOM   4661   H  HE2  . PHE A 1 309 ? 29.732  34.032 33.136 1.00 0.00   ? 312 PHE A HE2  1  
ATOM   4662   H  HZ   . PHE A 1 309 ? 29.692  32.020 31.687 1.00 0.00   ? 312 PHE A HZ   1  
ATOM   4663   N  N    . GLU A 1 310 ? 35.335  32.646 37.819 1.00 10.93  ? 313 GLU A N    1  
ATOM   4664   C  CA   . GLU A 1 310 ? 36.648  32.661 38.534 1.00 11.27  ? 313 GLU A CA   1  
ATOM   4665   C  C    . GLU A 1 310 ? 36.637  31.764 39.792 1.00 10.93  ? 313 GLU A C    1  
ATOM   4666   O  O    . GLU A 1 310 ? 37.669  31.267 40.198 1.00 11.83  ? 313 GLU A O    1  
ATOM   4667   C  CB   . GLU A 1 310 ? 36.971  34.097 38.951 1.00 11.54  ? 313 GLU A CB   1  
ATOM   4668   C  CG   . GLU A 1 310 ? 37.430  34.893 37.728 1.00 13.37  ? 313 GLU A CG   1  
ATOM   4669   C  CD   . GLU A 1 310 ? 38.828  34.430 37.312 1.00 14.62  ? 313 GLU A CD   1  
ATOM   4670   O  OE1  . GLU A 1 310 ? 39.443  33.708 38.079 1.00 17.24  ? 313 GLU A OE1  1  
ATOM   4671   O  OE2  . GLU A 1 310 ? 39.259  34.806 36.234 1.00 17.46  ? 313 GLU A OE2  1  
ATOM   4672   H  H    . GLU A 1 310 ? 34.650  33.311 38.039 1.00 0.00   ? 313 GLU A H    1  
ATOM   4673   H  HA   . GLU A 1 310 ? 37.417  32.313 37.862 1.00 0.00   ? 313 GLU A HA   1  
ATOM   4674   H  HB2  . GLU A 1 310 ? 36.088  34.557 39.370 1.00 0.00   ? 313 GLU A HB2  1  
ATOM   4675   H  HB3  . GLU A 1 310 ? 37.758  34.090 39.689 1.00 0.00   ? 313 GLU A HB3  1  
ATOM   4676   H  HG2  . GLU A 1 310 ? 36.739  34.731 36.913 1.00 0.00   ? 313 GLU A HG2  1  
ATOM   4677   H  HG3  . GLU A 1 310 ? 37.460  35.944 37.972 1.00 0.00   ? 313 GLU A HG3  1  
ATOM   4678   N  N    . LEU A 1 311 ? 35.510  31.563 40.434 1.00 9.81   ? 314 LEU A N    1  
ATOM   4679   C  CA   . LEU A 1 311 ? 35.515  30.719 41.667 1.00 9.71   ? 314 LEU A CA   1  
ATOM   4680   C  C    . LEU A 1 311 ? 35.136  29.286 41.313 1.00 9.38   ? 314 LEU A C    1  
ATOM   4681   O  O    . LEU A 1 311 ? 35.762  28.337 41.743 1.00 9.49   ? 314 LEU A O    1  
ATOM   4682   C  CB   . LEU A 1 311 ? 34.505  31.279 42.670 1.00 10.03  ? 314 LEU A CB   1  
ATOM   4683   C  CG   . LEU A 1 311 ? 34.937  32.681 43.102 1.00 9.81   ? 314 LEU A CG   1  
ATOM   4684   C  CD1  . LEU A 1 311 ? 34.355  32.994 44.481 1.00 10.54  ? 314 LEU A CD1  1  
ATOM   4685   C  CD2  . LEU A 1 311 ? 36.465  32.745 43.167 1.00 10.36  ? 314 LEU A CD2  1  
ATOM   4686   H  H    . LEU A 1 311 ? 34.680  31.978 40.120 1.00 0.00   ? 314 LEU A H    1  
ATOM   4687   H  HA   . LEU A 1 311 ? 36.501  30.732 42.106 1.00 0.00   ? 314 LEU A HA   1  
ATOM   4688   H  HB2  . LEU A 1 311 ? 33.529  31.328 42.209 1.00 0.00   ? 314 LEU A HB2  1  
ATOM   4689   H  HB3  . LEU A 1 311 ? 34.462  30.636 43.536 1.00 0.00   ? 314 LEU A HB3  1  
ATOM   4690   H  HG   . LEU A 1 311 ? 34.575  33.406 42.386 1.00 0.00   ? 314 LEU A HG   1  
ATOM   4691   H  HD11 . LEU A 1 311 ? 34.991  33.705 44.988 1.00 0.00   ? 314 LEU A HD11 1  
ATOM   4692   H  HD12 . LEU A 1 311 ? 34.297  32.085 45.062 1.00 0.00   ? 314 LEU A HD12 1  
ATOM   4693   H  HD13 . LEU A 1 311 ? 33.366  33.412 44.368 1.00 0.00   ? 314 LEU A HD13 1  
ATOM   4694   H  HD21 . LEU A 1 311 ? 36.764  33.591 43.768 1.00 0.00   ? 314 LEU A HD21 1  
ATOM   4695   H  HD22 . LEU A 1 311 ? 36.864  32.853 42.170 1.00 0.00   ? 314 LEU A HD22 1  
ATOM   4696   H  HD23 . LEU A 1 311 ? 36.844  31.836 43.610 1.00 0.00   ? 314 LEU A HD23 1  
ATOM   4697   N  N    . GLY A 1 312 ? 34.112  29.129 40.537 1.00 9.13   ? 315 GLY A N    1  
ATOM   4698   C  CA   . GLY A 1 312 ? 33.659  27.762 40.140 1.00 8.62   ? 315 GLY A CA   1  
ATOM   4699   C  C    . GLY A 1 312 ? 32.133  27.571 40.351 1.00 8.83   ? 315 GLY A C    1  
ATOM   4700   O  O    . GLY A 1 312 ? 31.687  26.469 40.601 1.00 9.20   ? 315 GLY A O    1  
ATOM   4701   H  H    . GLY A 1 312 ? 33.626  29.915 40.210 1.00 0.00   ? 315 GLY A H    1  
ATOM   4702   H  HA2  . GLY A 1 312 ? 33.892  27.605 39.097 1.00 0.00   ? 315 GLY A HA2  1  
ATOM   4703   H  HA3  . GLY A 1 312 ? 34.189  27.031 40.732 1.00 0.00   ? 315 GLY A HA3  1  
ATOM   4704   N  N    . ALA A 1 313 ? 31.316  28.603 40.232 1.00 8.74   ? 316 ALA A N    1  
ATOM   4705   C  CA   . ALA A 1 313 ? 29.854  28.396 40.408 1.00 9.09   ? 316 ALA A CA   1  
ATOM   4706   C  C    . ALA A 1 313 ? 29.170  28.377 39.033 1.00 9.36   ? 316 ALA A C    1  
ATOM   4707   O  O    . ALA A 1 313 ? 28.365  29.234 38.734 1.00 9.59   ? 316 ALA A O    1  
ATOM   4708   C  CB   . ALA A 1 313 ? 29.275  29.534 41.251 1.00 9.42   ? 316 ALA A CB   1  
ATOM   4709   H  H    . ALA A 1 313 ? 31.668  29.491 40.011 1.00 0.00   ? 316 ALA A H    1  
ATOM   4710   H  HA   . ALA A 1 313 ? 29.682  27.454 40.908 1.00 0.00   ? 316 ALA A HA   1  
ATOM   4711   H  HB1  . ALA A 1 313 ? 29.905  30.407 41.158 1.00 0.00   ? 316 ALA A HB1  1  
ATOM   4712   H  HB2  . ALA A 1 313 ? 29.232  29.230 42.286 1.00 0.00   ? 316 ALA A HB2  1  
ATOM   4713   H  HB3  . ALA A 1 313 ? 28.280  29.770 40.903 1.00 0.00   ? 316 ALA A HB3  1  
ATOM   4714   N  N    . ALA A 1 314 ? 29.474  27.412 38.190 1.00 9.54   ? 317 ALA A N    1  
ATOM   4715   C  CA   . ALA A 1 314 ? 28.815  27.377 36.849 1.00 9.71   ? 317 ALA A CA   1  
ATOM   4716   C  C    . ALA A 1 314 ? 28.688  25.932 36.339 1.00 9.57   ? 317 ALA A C    1  
ATOM   4717   O  O    . ALA A 1 314 ? 29.668  25.237 36.161 1.00 10.75  ? 317 ALA A O    1  
ATOM   4718   C  CB   . ALA A 1 314 ? 29.649  28.189 35.857 1.00 10.67  ? 317 ALA A CB   1  
ATOM   4719   H  H    . ALA A 1 314 ? 30.124  26.723 38.440 1.00 0.00   ? 317 ALA A H    1  
ATOM   4720   H  HA   . ALA A 1 314 ? 27.831  27.814 36.926 1.00 0.00   ? 317 ALA A HA   1  
ATOM   4721   H  HB1  . ALA A 1 314 ? 29.332  27.962 34.850 1.00 0.00   ? 317 ALA A HB1  1  
ATOM   4722   H  HB2  . ALA A 1 314 ? 30.693  27.935 35.971 1.00 0.00   ? 317 ALA A HB2  1  
ATOM   4723   H  HB3  . ALA A 1 314 ? 29.512  29.243 36.049 1.00 0.00   ? 317 ALA A HB3  1  
ATOM   4724   N  N    . ALA A 1 315 ? 27.481  25.488 36.078 1.00 9.66   ? 318 ALA A N    1  
ATOM   4725   C  CA   . ALA A 1 315 ? 27.283  24.114 35.553 1.00 9.66   ? 318 ALA A CA   1  
ATOM   4726   C  C    . ALA A 1 315 ? 26.750  24.246 34.133 1.00 10.16  ? 318 ALA A C    1  
ATOM   4727   O  O    . ALA A 1 315 ? 26.622  25.340 33.621 1.00 10.31  ? 318 ALA A O    1  
ATOM   4728   C  CB   . ALA A 1 315 ? 26.268  23.367 36.421 1.00 10.59  ? 318 ALA A CB   1  
ATOM   4729   H  H    . ALA A 1 315 ? 26.707  26.074 36.211 1.00 0.00   ? 318 ALA A H    1  
ATOM   4730   H  HA   . ALA A 1 315 ? 28.225  23.584 35.545 1.00 0.00   ? 318 ALA A HA   1  
ATOM   4731   H  HB1  . ALA A 1 315 ? 25.372  23.960 36.519 1.00 0.00   ? 318 ALA A HB1  1  
ATOM   4732   H  HB2  . ALA A 1 315 ? 26.692  23.191 37.399 1.00 0.00   ? 318 ALA A HB2  1  
ATOM   4733   H  HB3  . ALA A 1 315 ? 26.026  22.421 35.959 1.00 0.00   ? 318 ALA A HB3  1  
ATOM   4734   N  N    . HIS A 1 316 ? 26.433  23.170 33.479 1.00 10.42  ? 319 HIS A N    1  
ATOM   4735   C  CA   . HIS A 1 316 ? 25.906  23.320 32.080 1.00 11.18  ? 319 HIS A CA   1  
ATOM   4736   C  C    . HIS A 1 316 ? 24.873  22.232 31.728 1.00 11.18  ? 319 HIS A C    1  
ATOM   4737   O  O    . HIS A 1 316 ? 25.075  21.062 31.985 1.00 11.21  ? 319 HIS A O    1  
ATOM   4738   C  CB   . HIS A 1 316 ? 27.074  23.232 31.097 1.00 11.80  ? 319 HIS A CB   1  
ATOM   4739   C  CG   . HIS A 1 316 ? 28.211  24.084 31.591 1.00 14.29  ? 319 HIS A CG   1  
ATOM   4740   N  ND1  . HIS A 1 316 ? 29.517  23.616 31.645 1.00 17.93  ? 319 HIS A ND1  1  
ATOM   4741   C  CD2  . HIS A 1 316 ? 28.255  25.375 32.059 1.00 17.30  ? 319 HIS A CD2  1  
ATOM   4742   C  CE1  . HIS A 1 316 ? 30.285  24.611 32.129 1.00 18.55  ? 319 HIS A CE1  1  
ATOM   4743   N  NE2  . HIS A 1 316 ? 29.563  25.701 32.396 1.00 17.78  ? 319 HIS A NE2  1  
ATOM   4744   H  H    . HIS A 1 316 ? 26.532  22.285 33.888 1.00 0.00   ? 319 HIS A H    1  
ATOM   4745   H  HA   . HIS A 1 316 ? 25.441  24.289 31.983 1.00 0.00   ? 319 HIS A HA   1  
ATOM   4746   H  HB2  . HIS A 1 316 ? 27.401  22.206 31.016 1.00 0.00   ? 319 HIS A HB2  1  
ATOM   4747   H  HB3  . HIS A 1 316 ? 26.756  23.586 30.127 1.00 0.00   ? 319 HIS A HB3  1  
ATOM   4748   H  HD1  . HIS A 1 316 ? 29.825  22.725 31.379 1.00 0.00   ? 319 HIS A HD1  1  
ATOM   4749   H  HD2  . HIS A 1 316 ? 27.404  26.034 32.150 1.00 0.00   ? 319 HIS A HD2  1  
ATOM   4750   H  HE1  . HIS A 1 316 ? 31.351  24.536 32.282 1.00 0.00   ? 319 HIS A HE1  1  
ATOM   4751   H  HE2  . HIS A 1 316 ? 29.888  26.554 32.754 1.00 0.00   ? 319 HIS A HE2  1  
ATOM   4752   N  N    . PHE A 1 317 ? 23.778  22.616 31.095 1.00 11.87  ? 320 PHE A N    1  
ATOM   4753   C  CA   . PHE A 1 317 ? 22.751  21.609 30.676 1.00 12.33  ? 320 PHE A CA   1  
ATOM   4754   C  C    . PHE A 1 317 ? 22.770  21.430 29.133 1.00 13.14  ? 320 PHE A C    1  
ATOM   4755   O  O    . PHE A 1 317 ? 22.670  22.382 28.385 1.00 14.45  ? 320 PHE A O    1  
ATOM   4756   C  CB   . PHE A 1 317 ? 21.365  22.089 31.112 1.00 12.29  ? 320 PHE A CB   1  
ATOM   4757   C  CG   . PHE A 1 317 ? 21.286  22.097 32.619 1.00 13.31  ? 320 PHE A CG   1  
ATOM   4758   C  CD1  . PHE A 1 317 ? 22.137  22.926 33.361 1.00 13.98  ? 320 PHE A CD1  1  
ATOM   4759   C  CD2  . PHE A 1 317 ? 20.362  21.276 33.277 1.00 15.20  ? 320 PHE A CD2  1  
ATOM   4760   C  CE1  . PHE A 1 317 ? 22.064  22.933 34.759 1.00 15.76  ? 320 PHE A CE1  1  
ATOM   4761   C  CE2  . PHE A 1 317 ? 20.289  21.284 34.675 1.00 16.22  ? 320 PHE A CE2  1  
ATOM   4762   C  CZ   . PHE A 1 317 ? 21.140  22.112 35.416 1.00 16.67  ? 320 PHE A CZ   1  
ATOM   4763   H  H    . PHE A 1 317 ? 23.652  23.562 30.870 1.00 0.00   ? 320 PHE A H    1  
ATOM   4764   H  HA   . PHE A 1 317 ? 22.966  20.662 31.148 1.00 0.00   ? 320 PHE A HA   1  
ATOM   4765   H  HB2  . PHE A 1 317 ? 21.195  23.088 30.736 1.00 0.00   ? 320 PHE A HB2  1  
ATOM   4766   H  HB3  . PHE A 1 317 ? 20.612  21.423 30.716 1.00 0.00   ? 320 PHE A HB3  1  
ATOM   4767   H  HD1  . PHE A 1 317 ? 22.850  23.559 32.854 1.00 0.00   ? 320 PHE A HD1  1  
ATOM   4768   H  HD2  . PHE A 1 317 ? 19.705  20.637 32.705 1.00 0.00   ? 320 PHE A HD2  1  
ATOM   4769   H  HE1  . PHE A 1 317 ? 22.720  23.573 35.330 1.00 0.00   ? 320 PHE A HE1  1  
ATOM   4770   H  HE2  . PHE A 1 317 ? 19.576  20.650 35.181 1.00 0.00   ? 320 PHE A HE2  1  
ATOM   4771   H  HZ   . PHE A 1 317 ? 21.083  22.118 36.494 1.00 0.00   ? 320 PHE A HZ   1  
ATOM   4772   N  N    . LYS A 1 318 ? 22.884  20.203 28.671 1.00 13.68  ? 321 LYS A N    1  
ATOM   4773   C  CA   . LYS A 1 318 ? 22.898  19.905 27.232 1.00 14.14  ? 321 LYS A CA   1  
ATOM   4774   C  C    . LYS A 1 318 ? 21.475  19.575 26.876 1.00 13.63  ? 321 LYS A C    1  
ATOM   4775   O  O    . LYS A 1 318 ? 20.811  18.812 27.549 1.00 12.99  ? 321 LYS A O    1  
ATOM   4776   C  CB   . LYS A 1 318 ? 23.805  18.705 26.950 1.00 14.99  ? 321 LYS A CB   1  
ATOM   4777   C  CG   . LYS A 1 318 ? 25.249  19.062 27.308 1.00 18.82  ? 321 LYS A CG   1  
ATOM   4778   C  CD   . LYS A 1 318 ? 26.177  17.920 26.887 1.00 22.63  ? 321 LYS A CD   1  
ATOM   4779   C  CE   . LYS A 1 318 ? 26.921  17.388 28.113 1.00 25.52  ? 321 LYS A CE   1  
ATOM   4780   N  NZ   . LYS A 1 318 ? 27.280  15.958 27.894 1.00 26.26  ? 321 LYS A NZ   1  
ATOM   4781   H  H    . LYS A 1 318 ? 22.952  19.462 29.308 1.00 0.00   ? 321 LYS A H    1  
ATOM   4782   H  HA   . LYS A 1 318 ? 23.231  20.769 26.675 1.00 0.00   ? 321 LYS A HA   1  
ATOM   4783   H  HB2  . LYS A 1 318 ? 23.483  17.863 27.545 1.00 0.00   ? 321 LYS A HB2  1  
ATOM   4784   H  HB3  . LYS A 1 318 ? 23.749  18.449 25.903 1.00 0.00   ? 321 LYS A HB3  1  
ATOM   4785   H  HG2  . LYS A 1 318 ? 25.535  19.967 26.792 1.00 0.00   ? 321 LYS A HG2  1  
ATOM   4786   H  HG3  . LYS A 1 318 ? 25.330  19.213 28.374 1.00 0.00   ? 321 LYS A HG3  1  
ATOM   4787   H  HD2  . LYS A 1 318 ? 25.592  17.126 26.446 1.00 0.00   ? 321 LYS A HD2  1  
ATOM   4788   H  HD3  . LYS A 1 318 ? 26.892  18.284 26.164 1.00 0.00   ? 321 LYS A HD3  1  
ATOM   4789   H  HE2  . LYS A 1 318 ? 27.821  17.965 28.267 1.00 0.00   ? 321 LYS A HE2  1  
ATOM   4790   H  HE3  . LYS A 1 318 ? 26.287  17.470 28.983 1.00 0.00   ? 321 LYS A HE3  1  
ATOM   4791   H  HZ1  . LYS A 1 318 ? 26.701  15.356 28.513 1.00 0.00   ? 321 LYS A HZ1  1  
ATOM   4792   H  HZ2  . LYS A 1 318 ? 28.285  15.814 28.115 1.00 0.00   ? 321 LYS A HZ2  1  
ATOM   4793   H  HZ3  . LYS A 1 318 ? 27.103  15.705 26.900 1.00 0.00   ? 321 LYS A HZ3  1  
ATOM   4794   N  N    . VAL A 1 319 ? 20.979  20.186 25.877 1.00 13.01  ? 322 VAL A N    1  
ATOM   4795   C  CA   . VAL A 1 319 ? 19.568  19.968 25.524 1.00 12.98  ? 322 VAL A CA   1  
ATOM   4796   C  C    . VAL A 1 319 ? 19.476  19.550 24.084 1.00 13.57  ? 322 VAL A C    1  
ATOM   4797   O  O    . VAL A 1 319 ? 20.127  20.091 23.213 1.00 14.03  ? 322 VAL A O    1  
ATOM   4798   C  CB   . VAL A 1 319 ? 18.781  21.262 25.733 1.00 12.78  ? 322 VAL A CB   1  
ATOM   4799   C  CG1  . VAL A 1 319 ? 17.293  21.000 25.497 1.00 12.86  ? 322 VAL A CG1  1  
ATOM   4800   C  CG2  . VAL A 1 319 ? 18.989  21.758 27.166 1.00 13.46  ? 322 VAL A CG2  1  
ATOM   4801   H  H    . VAL A 1 319 ? 21.517  20.837 25.379 1.00 0.00   ? 322 VAL A H    1  
ATOM   4802   H  HA   . VAL A 1 319 ? 19.155  19.193 26.151 1.00 0.00   ? 322 VAL A HA   1  
ATOM   4803   H  HB   . VAL A 1 319 ? 19.130  22.011 25.037 1.00 0.00   ? 322 VAL A HB   1  
ATOM   4804   H  HG11 . VAL A 1 319 ? 17.176  20.309 24.675 1.00 0.00   ? 322 VAL A HG11 1  
ATOM   4805   H  HG12 . VAL A 1 319 ? 16.797  21.930 25.258 1.00 0.00   ? 322 VAL A HG12 1  
ATOM   4806   H  HG13 . VAL A 1 319 ? 16.856  20.577 26.389 1.00 0.00   ? 322 VAL A HG13 1  
ATOM   4807   H  HG21 . VAL A 1 319 ? 18.324  22.586 27.361 1.00 0.00   ? 322 VAL A HG21 1  
ATOM   4808   H  HG22 . VAL A 1 319 ? 20.012  22.080 27.291 1.00 0.00   ? 322 VAL A HG22 1  
ATOM   4809   H  HG23 . VAL A 1 319 ? 18.778  20.956 27.858 1.00 0.00   ? 322 VAL A HG23 1  
ATOM   4810   N  N    . THR A 1 320 ? 18.670  18.589 23.832 1.00 13.67  ? 323 THR A N    1  
ATOM   4811   C  CA   . THR A 1 320 ? 18.512  18.102 22.428 1.00 14.23  ? 323 THR A CA   1  
ATOM   4812   C  C    . THR A 1 320 ? 17.155  18.549 21.872 1.00 14.45  ? 323 THR A C    1  
ATOM   4813   O  O    . THR A 1 320 ? 16.230  18.816 22.614 1.00 14.21  ? 323 THR A O    1  
ATOM   4814   C  CB   . THR A 1 320 ? 18.592  16.574 22.407 1.00 14.55  ? 323 THR A CB   1  
ATOM   4815   O  OG1  . THR A 1 320 ? 17.468  16.034 23.088 1.00 15.55  ? 323 THR A OG1  1  
ATOM   4816   C  CG2  . THR A 1 320 ? 19.877  16.118 23.100 1.00 15.56  ? 323 THR A CG2  1  
ATOM   4817   H  H    . THR A 1 320 ? 18.159  18.172 24.557 1.00 0.00   ? 323 THR A H    1  
ATOM   4818   H  HA   . THR A 1 320 ? 19.302  18.511 21.815 1.00 0.00   ? 323 THR A HA   1  
ATOM   4819   H  HB   . THR A 1 320 ? 18.596  16.226 21.386 1.00 0.00   ? 323 THR A HB   1  
ATOM   4820   H  HG1  . THR A 1 320 ? 17.747  15.229 23.530 1.00 0.00   ? 323 THR A HG1  1  
ATOM   4821   H  HG21 . THR A 1 320 ? 20.309  16.949 23.639 1.00 0.00   ? 323 THR A HG21 1  
ATOM   4822   H  HG22 . THR A 1 320 ? 20.580  15.766 22.359 1.00 0.00   ? 323 THR A HG22 1  
ATOM   4823   H  HG23 . THR A 1 320 ? 19.651  15.319 23.790 1.00 0.00   ? 323 THR A HG23 1  
ATOM   4824   N  N    . GLY A 1 321 ? 17.025  18.630 20.571 1.00 14.97  ? 324 GLY A N    1  
ATOM   4825   C  CA   . GLY A 1 321 ? 15.723  19.057 19.982 1.00 14.82  ? 324 GLY A CA   1  
ATOM   4826   C  C    . GLY A 1 321 ? 15.960  19.845 18.690 1.00 14.89  ? 324 GLY A C    1  
ATOM   4827   O  O    . GLY A 1 321 ? 17.035  19.827 18.125 1.00 14.96  ? 324 GLY A O    1  
ATOM   4828   H  H    . GLY A 1 321 ? 17.780  18.409 19.987 1.00 0.00   ? 324 GLY A H    1  
ATOM   4829   H  HA2  . GLY A 1 321 ? 15.125  18.183 19.765 1.00 0.00   ? 324 GLY A HA2  1  
ATOM   4830   H  HA3  . GLY A 1 321 ? 15.198  19.683 20.688 1.00 0.00   ? 324 GLY A HA3  1  
ATOM   4831   N  N    . GLU A 1 322 ? 14.954  20.534 18.220 1.00 15.72  ? 325 GLU A N    1  
ATOM   4832   C  CA   . GLU A 1 322 ? 15.096  21.323 16.971 1.00 16.63  ? 325 GLU A CA   1  
ATOM   4833   C  C    . GLU A 1 322 ? 15.143  22.810 17.315 1.00 16.03  ? 325 GLU A C    1  
ATOM   4834   O  O    . GLU A 1 322 ? 14.397  23.298 18.141 1.00 16.56  ? 325 GLU A O    1  
ATOM   4835   C  CB   . GLU A 1 322 ? 13.902  21.048 16.055 1.00 17.67  ? 325 GLU A CB   1  
ATOM   4836   C  CG   . GLU A 1 322 ? 14.038  21.876 14.776 1.00 20.73  ? 325 GLU A CG   1  
ATOM   4837   C  CD   . GLU A 1 322 ? 12.830  21.623 13.872 1.00 25.79  ? 325 GLU A CD   1  
ATOM   4838   O  OE1  . GLU A 1 322 ? 12.328  20.510 13.884 1.00 28.74  ? 325 GLU A OE1  1  
ATOM   4839   O  OE2  . GLU A 1 322 ? 12.426  22.545 13.184 1.00 29.74  ? 325 GLU A OE2  1  
ATOM   4840   H  H    . GLU A 1 322 ? 14.097  20.528 18.695 1.00 0.00   ? 325 GLU A H    1  
ATOM   4841   H  HA   . GLU A 1 322 ? 16.009  21.040 16.468 1.00 0.00   ? 325 GLU A HA   1  
ATOM   4842   H  HB2  . GLU A 1 322 ? 13.876  19.997 15.804 1.00 0.00   ? 325 GLU A HB2  1  
ATOM   4843   H  HB3  . GLU A 1 322 ? 12.988  21.320 16.562 1.00 0.00   ? 325 GLU A HB3  1  
ATOM   4844   H  HG2  . GLU A 1 322 ? 14.086  22.925 15.030 1.00 0.00   ? 325 GLU A HG2  1  
ATOM   4845   H  HG3  . GLU A 1 322 ? 14.940  21.589 14.256 1.00 0.00   ? 325 GLU A HG3  1  
ATOM   4846   N  N    . TRP A 1 323 ? 16.020  23.525 16.683 1.00 15.80  ? 326 TRP A N    1  
ATOM   4847   C  CA   . TRP A 1 323 ? 16.150  24.968 16.941 1.00 15.82  ? 326 TRP A CA   1  
ATOM   4848   C  C    . TRP A 1 323 ? 14.902  25.670 16.442 1.00 15.71  ? 326 TRP A C    1  
ATOM   4849   O  O    . TRP A 1 323 ? 14.225  25.218 15.540 1.00 16.24  ? 326 TRP A O    1  
ATOM   4850   C  CB   . TRP A 1 323 ? 17.375  25.512 16.204 1.00 15.55  ? 326 TRP A CB   1  
ATOM   4851   C  CG   . TRP A 1 323 ? 17.501  26.980 16.462 1.00 16.09  ? 326 TRP A CG   1  
ATOM   4852   C  CD1  . TRP A 1 323 ? 16.977  27.953 15.682 1.00 16.95  ? 326 TRP A CD1  1  
ATOM   4853   C  CD2  . TRP A 1 323 ? 18.182  27.655 17.559 1.00 16.91  ? 326 TRP A CD2  1  
ATOM   4854   N  NE1  . TRP A 1 323 ? 17.293  29.183 16.230 1.00 17.12  ? 326 TRP A NE1  1  
ATOM   4855   C  CE2  . TRP A 1 323 ? 18.035  29.052 17.388 1.00 15.66  ? 326 TRP A CE2  1  
ATOM   4856   C  CE3  . TRP A 1 323 ? 18.906  27.197 18.674 1.00 16.83  ? 326 TRP A CE3  1  
ATOM   4857   C  CZ2  . TRP A 1 323 ? 18.587  29.962 18.291 1.00 16.11  ? 326 TRP A CZ2  1  
ATOM   4858   C  CZ3  . TRP A 1 323 ? 19.462  28.109 19.585 1.00 16.86  ? 326 TRP A CZ3  1  
ATOM   4859   C  CH2  . TRP A 1 323 ? 19.303  29.489 19.394 1.00 16.32  ? 326 TRP A CH2  1  
ATOM   4860   H  H    . TRP A 1 323 ? 16.606  23.098 16.024 1.00 0.00   ? 326 TRP A H    1  
ATOM   4861   H  HA   . TRP A 1 323 ? 16.262  25.137 18.001 1.00 0.00   ? 326 TRP A HA   1  
ATOM   4862   H  HB2  . TRP A 1 323 ? 18.262  25.007 16.558 1.00 0.00   ? 326 TRP A HB2  1  
ATOM   4863   H  HB3  . TRP A 1 323 ? 17.263  25.342 15.144 1.00 0.00   ? 326 TRP A HB3  1  
ATOM   4864   H  HD1  . TRP A 1 323 ? 16.405  27.796 14.780 1.00 0.00   ? 326 TRP A HD1  1  
ATOM   4865   H  HE1  . TRP A 1 323 ? 17.033  30.052 15.858 1.00 0.00   ? 326 TRP A HE1  1  
ATOM   4866   H  HE3  . TRP A 1 323 ? 19.034  26.136 18.831 1.00 0.00   ? 326 TRP A HE3  1  
ATOM   4867   H  HZ2  . TRP A 1 323 ? 18.461  31.024 18.138 1.00 0.00   ? 326 TRP A HZ2  1  
ATOM   4868   H  HZ3  . TRP A 1 323 ? 20.016  27.746 20.438 1.00 0.00   ? 326 TRP A HZ3  1  
ATOM   4869   H  HH2  . TRP A 1 323 ? 19.733  30.186 20.098 1.00 0.00   ? 326 TRP A HH2  1  
ATOM   4870   N  N    . ASN A 1 324 ? 14.602  26.768 17.035 1.00 16.03  ? 327 ASN A N    1  
ATOM   4871   C  CA   . ASN A 1 324 ? 13.400  27.548 16.644 1.00 16.12  ? 327 ASN A CA   1  
ATOM   4872   C  C    . ASN A 1 324 ? 13.864  28.935 16.230 1.00 16.67  ? 327 ASN A C    1  
ATOM   4873   O  O    . ASN A 1 324 ? 14.262  29.743 17.044 1.00 15.71  ? 327 ASN A O    1  
ATOM   4874   C  CB   . ASN A 1 324 ? 12.443  27.656 17.834 1.00 16.19  ? 327 ASN A CB   1  
ATOM   4875   C  CG   . ASN A 1 324 ? 11.178  28.402 17.406 1.00 17.31  ? 327 ASN A CG   1  
ATOM   4876   O  OD1  . ASN A 1 324 ? 11.175  29.092 16.405 1.00 19.40  ? 327 ASN A OD1  1  
ATOM   4877   N  ND2  . ASN A 1 324 ? 10.096  28.293 18.126 1.00 17.78  ? 327 ASN A ND2  1  
ATOM   4878   H  H    . ASN A 1 324 ? 15.173  27.095 17.761 1.00 0.00   ? 327 ASN A H    1  
ATOM   4879   H  HA   . ASN A 1 324 ? 12.904  27.065 15.815 1.00 0.00   ? 327 ASN A HA   1  
ATOM   4880   H  HB2  . ASN A 1 324 ? 12.180  26.665 18.174 1.00 0.00   ? 327 ASN A HB2  1  
ATOM   4881   H  HB3  . ASN A 1 324 ? 12.924  28.196 18.635 1.00 0.00   ? 327 ASN A HB3  1  
ATOM   4882   H  HD21 . ASN A 1 324 ? 10.098  27.737 18.933 1.00 0.00   ? 327 ASN A HD21 1  
ATOM   4883   H  HD22 . ASN A 1 324 ? 9.281   28.767 17.861 1.00 0.00   ? 327 ASN A HD22 1  
ATOM   4884   N  N    . ASP A 1 325 ? 13.851  29.198 14.965 1.00 16.59  ? 328 ASP A N    1  
ATOM   4885   C  CA   . ASP A 1 325 ? 14.331  30.519 14.468 1.00 17.35  ? 328 ASP A CA   1  
ATOM   4886   C  C    . ASP A 1 325 ? 13.401  31.622 14.950 1.00 16.56  ? 328 ASP A C    1  
ATOM   4887   O  O    . ASP A 1 325 ? 13.825  32.718 15.259 1.00 18.15  ? 328 ASP A O    1  
ATOM   4888   C  CB   . ASP A 1 325 ? 14.358  30.508 12.938 1.00 17.59  ? 328 ASP A CB   1  
ATOM   4889   C  CG   . ASP A 1 325 ? 15.592  29.746 12.454 1.00 20.30  ? 328 ASP A CG   1  
ATOM   4890   O  OD1  . ASP A 1 325 ? 16.688  30.239 12.663 1.00 20.76  ? 328 ASP A OD1  1  
ATOM   4891   O  OD2  . ASP A 1 325 ? 15.421  28.682 11.883 1.00 24.78  ? 328 ASP A OD2  1  
ATOM   4892   H  H    . ASP A 1 325 ? 13.552  28.516 14.328 1.00 0.00   ? 328 ASP A H    1  
ATOM   4893   H  HA   . ASP A 1 325 ? 15.328  30.702 14.841 1.00 0.00   ? 328 ASP A HA   1  
ATOM   4894   H  HB2  . ASP A 1 325 ? 13.466  30.025 12.567 1.00 0.00   ? 328 ASP A HB2  1  
ATOM   4895   H  HB3  . ASP A 1 325 ? 14.397  31.523 12.571 1.00 0.00   ? 328 ASP A HB3  1  
ATOM   4896   N  N    . ASP A 1 326 ? 12.137  31.345 15.011 1.00 15.87  ? 329 ASP A N    1  
ATOM   4897   C  CA   . ASP A 1 326 ? 11.171  32.386 15.469 1.00 16.01  ? 329 ASP A CA   1  
ATOM   4898   C  C    . ASP A 1 326 ? 11.693  33.024 16.756 1.00 15.24  ? 329 ASP A C    1  
ATOM   4899   O  O    . ASP A 1 326 ? 11.712  34.230 16.905 1.00 15.54  ? 329 ASP A O    1  
ATOM   4900   C  CB   . ASP A 1 326 ? 9.810   31.738 15.735 1.00 16.31  ? 329 ASP A CB   1  
ATOM   4901   C  CG   . ASP A 1 326 ? 8.785   32.823 16.069 1.00 18.18  ? 329 ASP A CG   1  
ATOM   4902   O  OD1  . ASP A 1 326 ? 9.054   33.976 15.774 1.00 20.88  ? 329 ASP A OD1  1  
ATOM   4903   O  OD2  . ASP A 1 326 ? 7.748   32.483 16.615 1.00 19.34  ? 329 ASP A OD2  1  
ATOM   4904   H  H    . ASP A 1 326 ? 11.816  30.456 14.753 1.00 0.00   ? 329 ASP A H    1  
ATOM   4905   H  HA   . ASP A 1 326 ? 11.068  33.143 14.706 1.00 0.00   ? 329 ASP A HA   1  
ATOM   4906   H  HB2  . ASP A 1 326 ? 9.491   31.198 14.855 1.00 0.00   ? 329 ASP A HB2  1  
ATOM   4907   H  HB3  . ASP A 1 326 ? 9.893   31.055 16.567 1.00 0.00   ? 329 ASP A HB3  1  
ATOM   4908   N  N    . LEU A 1 327 ? 12.121  32.217 17.682 1.00 14.82  ? 330 LEU A N    1  
ATOM   4909   C  CA   . LEU A 1 327 ? 12.651  32.749 18.963 1.00 14.43  ? 330 LEU A CA   1  
ATOM   4910   C  C    . LEU A 1 327 ? 13.993  33.453 18.732 1.00 14.08  ? 330 LEU A C    1  
ATOM   4911   O  O    . LEU A 1 327 ? 14.250  34.495 19.303 1.00 14.21  ? 330 LEU A O    1  
ATOM   4912   C  CB   . LEU A 1 327 ? 12.848  31.595 19.948 1.00 14.40  ? 330 LEU A CB   1  
ATOM   4913   C  CG   . LEU A 1 327 ? 11.486  31.117 20.454 1.00 15.07  ? 330 LEU A CG   1  
ATOM   4914   C  CD1  . LEU A 1 327 ? 11.676  29.901 21.362 1.00 15.32  ? 330 LEU A CD1  1  
ATOM   4915   C  CD2  . LEU A 1 327 ? 10.813  32.242 21.243 1.00 16.88  ? 330 LEU A CD2  1  
ATOM   4916   H  H    . LEU A 1 327 ? 12.097  31.249 17.531 1.00 0.00   ? 330 LEU A H    1  
ATOM   4917   H  HA   . LEU A 1 327 ? 11.945  33.453 19.377 1.00 0.00   ? 330 LEU A HA   1  
ATOM   4918   H  HB2  . LEU A 1 327 ? 13.355  30.780 19.451 1.00 0.00   ? 330 LEU A HB2  1  
ATOM   4919   H  HB3  . LEU A 1 327 ? 13.442  31.932 20.784 1.00 0.00   ? 330 LEU A HB3  1  
ATOM   4920   H  HG   . LEU A 1 327 ? 10.866  30.843 19.612 1.00 0.00   ? 330 LEU A HG   1  
ATOM   4921   H  HD11 . LEU A 1 327 ? 12.715  29.822 21.645 1.00 0.00   ? 330 LEU A HD11 1  
ATOM   4922   H  HD12 . LEU A 1 327 ? 11.378  29.007 20.835 1.00 0.00   ? 330 LEU A HD12 1  
ATOM   4923   H  HD13 . LEU A 1 327 ? 11.069  30.016 22.249 1.00 0.00   ? 330 LEU A HD13 1  
ATOM   4924   H  HD21 . LEU A 1 327 ? 11.359  33.162 21.095 1.00 0.00   ? 330 LEU A HD21 1  
ATOM   4925   H  HD22 . LEU A 1 327 ? 10.807  31.991 22.294 1.00 0.00   ? 330 LEU A HD22 1  
ATOM   4926   H  HD23 . LEU A 1 327 ? 9.797   32.366 20.897 1.00 0.00   ? 330 LEU A HD23 1  
ATOM   4927   N  N    . MET A 1 328 ? 14.867  32.908 17.915 1.00 13.95  ? 331 MET A N    1  
ATOM   4928   C  CA   . MET A 1 328 ? 16.169  33.597 17.712 1.00 14.47  ? 331 MET A CA   1  
ATOM   4929   C  C    . MET A 1 328 ? 16.843  33.087 16.448 1.00 15.09  ? 331 MET A C    1  
ATOM   4930   O  O    . MET A 1 328 ? 16.908  31.899 16.200 1.00 15.21  ? 331 MET A O    1  
ATOM   4931   C  CB   . MET A 1 328 ? 17.077  33.330 18.914 1.00 14.50  ? 331 MET A CB   1  
ATOM   4932   C  CG   . MET A 1 328 ? 18.469  33.903 18.640 1.00 13.98  ? 331 MET A CG   1  
ATOM   4933   S  SD   . MET A 1 328 ? 19.603  33.385 19.952 1.00 14.59  ? 331 MET A SD   1  
ATOM   4934   C  CE   . MET A 1 328 ? 18.829  34.311 21.300 1.00 13.34  ? 331 MET A CE   1  
ATOM   4935   H  H    . MET A 1 328 ? 14.669  32.064 17.458 1.00 0.00   ? 331 MET A H    1  
ATOM   4936   H  HA   . MET A 1 328 ? 16.001  34.660 17.623 1.00 0.00   ? 331 MET A HA   1  
ATOM   4937   H  HB2  . MET A 1 328 ? 16.659  33.800 19.792 1.00 0.00   ? 331 MET A HB2  1  
ATOM   4938   H  HB3  . MET A 1 328 ? 17.154  32.265 19.077 1.00 0.00   ? 331 MET A HB3  1  
ATOM   4939   H  HG2  . MET A 1 328 ? 18.828  33.538 17.689 1.00 0.00   ? 331 MET A HG2  1  
ATOM   4940   H  HG3  . MET A 1 328 ? 18.416  34.981 18.615 1.00 0.00   ? 331 MET A HG3  1  
ATOM   4941   H  HE1  . MET A 1 328 ? 19.375  35.229 21.466 1.00 0.00   ? 331 MET A HE1  1  
ATOM   4942   H  HE2  . MET A 1 328 ? 18.840  33.711 22.200 1.00 0.00   ? 331 MET A HE2  1  
ATOM   4943   H  HE3  . MET A 1 328 ? 17.809  34.544 21.039 1.00 0.00   ? 331 MET A HE3  1  
ATOM   4944   N  N    . THR A 1 329 ? 17.358  33.976 15.650 1.00 15.35  ? 332 THR A N    1  
ATOM   4945   C  CA   . THR A 1 329 ? 18.048  33.529 14.396 1.00 16.80  ? 332 THR A CA   1  
ATOM   4946   C  C    . THR A 1 329 ? 19.193  34.492 14.030 1.00 16.35  ? 332 THR A C    1  
ATOM   4947   O  O    . THR A 1 329 ? 19.035  35.696 14.064 1.00 16.97  ? 332 THR A O    1  
ATOM   4948   C  CB   . THR A 1 329 ? 17.035  33.492 13.250 1.00 17.56  ? 332 THR A CB   1  
ATOM   4949   O  OG1  . THR A 1 329 ? 17.341  32.407 12.385 1.00 20.18  ? 332 THR A OG1  1  
ATOM   4950   C  CG2  . THR A 1 329 ? 17.098  34.804 12.467 1.00 18.74  ? 332 THR A CG2  1  
ATOM   4951   H  H    . THR A 1 329 ? 17.304  34.929 15.872 1.00 0.00   ? 332 THR A H    1  
ATOM   4952   H  HA   . THR A 1 329 ? 18.451  32.539 14.546 1.00 0.00   ? 332 THR A HA   1  
ATOM   4953   H  HB   . THR A 1 329 ? 16.041  33.364 13.650 1.00 0.00   ? 332 THR A HB   1  
ATOM   4954   H  HG1  . THR A 1 329 ? 16.879  32.549 11.555 1.00 0.00   ? 332 THR A HG1  1  
ATOM   4955   H  HG21 . THR A 1 329 ? 17.718  34.673 11.593 1.00 0.00   ? 332 THR A HG21 1  
ATOM   4956   H  HG22 . THR A 1 329 ? 17.518  35.577 13.094 1.00 0.00   ? 332 THR A HG22 1  
ATOM   4957   H  HG23 . THR A 1 329 ? 16.102  35.090 12.162 1.00 0.00   ? 332 THR A HG23 1  
ATOM   4958   N  N    . SER A 1 330 ? 20.342  33.966 13.659 1.00 16.67  ? 333 SER A N    1  
ATOM   4959   C  CA   . SER A 1 330 ? 21.479  34.846 13.271 1.00 17.30  ? 333 SER A CA   1  
ATOM   4960   C  C    . SER A 1 330 ? 21.260  35.301 11.830 1.00 17.68  ? 333 SER A C    1  
ATOM   4961   O  O    . SER A 1 330 ? 21.512  34.571 10.892 1.00 18.52  ? 333 SER A O    1  
ATOM   4962   C  CB   . SER A 1 330 ? 22.791  34.068 13.372 1.00 17.58  ? 333 SER A CB   1  
ATOM   4963   O  OG   . SER A 1 330 ? 23.853  34.871 12.875 1.00 19.09  ? 333 SER A OG   1  
ATOM   4964   H  H    . SER A 1 330 ? 20.444  32.992 13.624 1.00 0.00   ? 333 SER A H    1  
ATOM   4965   H  HA   . SER A 1 330 ? 21.512  35.707 13.924 1.00 0.00   ? 333 SER A HA   1  
ATOM   4966   H  HB2  . SER A 1 330 ? 22.986  33.819 14.402 1.00 0.00   ? 333 SER A HB2  1  
ATOM   4967   H  HB3  . SER A 1 330 ? 22.713  33.157 12.793 1.00 0.00   ? 333 SER A HB3  1  
ATOM   4968   H  HG   . SER A 1 330 ? 23.854  34.803 11.918 1.00 0.00   ? 333 SER A HG   1  
ATOM   4969   N  N    . VAL A 1 331 ? 20.764  36.490 11.648 1.00 17.56  ? 334 VAL A N    1  
ATOM   4970   C  CA   . VAL A 1 331 ? 20.495  36.982 10.269 1.00 18.76  ? 334 VAL A CA   1  
ATOM   4971   C  C    . VAL A 1 331 ? 21.811  37.057 9.528  1.00 19.16  ? 334 VAL A C    1  
ATOM   4972   O  O    . VAL A 1 331 ? 21.958  36.563 8.427  1.00 20.18  ? 334 VAL A O    1  
ATOM   4973   C  CB   . VAL A 1 331 ? 19.859  38.372 10.332 1.00 18.83  ? 334 VAL A CB   1  
ATOM   4974   C  CG1  . VAL A 1 331 ? 19.708  38.930 8.916  1.00 18.95  ? 334 VAL A CG1  1  
ATOM   4975   C  CG2  . VAL A 1 331 ? 18.480  38.270 10.988 1.00 19.21  ? 334 VAL A CG2  1  
ATOM   4976   H  H    . VAL A 1 331 ? 20.548  37.054 12.420 1.00 0.00   ? 334 VAL A H    1  
ATOM   4977   H  HA   . VAL A 1 331 ? 19.830  36.299 9.762  1.00 0.00   ? 334 VAL A HA   1  
ATOM   4978   H  HB   . VAL A 1 331 ? 20.489  39.030 10.913 1.00 0.00   ? 334 VAL A HB   1  
ATOM   4979   H  HG11 . VAL A 1 331 ? 20.600  38.713 8.347  1.00 0.00   ? 334 VAL A HG11 1  
ATOM   4980   H  HG12 . VAL A 1 331 ? 19.563  39.999 8.964  1.00 0.00   ? 334 VAL A HG12 1  
ATOM   4981   H  HG13 . VAL A 1 331 ? 18.855  38.472 8.437  1.00 0.00   ? 334 VAL A HG13 1  
ATOM   4982   H  HG21 . VAL A 1 331 ? 18.549  38.580 12.021 1.00 0.00   ? 334 VAL A HG21 1  
ATOM   4983   H  HG22 . VAL A 1 331 ? 18.133  37.249 10.941 1.00 0.00   ? 334 VAL A HG22 1  
ATOM   4984   H  HG23 . VAL A 1 331 ? 17.785  38.911 10.466 1.00 0.00   ? 334 VAL A HG23 1  
ATOM   4985   N  N    . LEU A 1 332 ? 22.777  37.658 10.141 1.00 19.14  ? 335 LEU A N    1  
ATOM   4986   C  CA   . LEU A 1 332 ? 24.122  37.761 9.500  1.00 19.24  ? 335 LEU A CA   1  
ATOM   4987   C  C    . LEU A 1 332 ? 25.188  37.199 10.453 1.00 19.06  ? 335 LEU A C    1  
ATOM   4988   O  O    . LEU A 1 332 ? 25.528  37.813 11.445 1.00 18.15  ? 335 LEU A O    1  
ATOM   4989   C  CB   . LEU A 1 332 ? 24.431  39.229 9.197  1.00 19.73  ? 335 LEU A CB   1  
ATOM   4990   C  CG   . LEU A 1 332 ? 25.831  39.341 8.590  1.00 21.15  ? 335 LEU A CG   1  
ATOM   4991   C  CD1  . LEU A 1 332 ? 25.840  38.696 7.204  1.00 22.86  ? 335 LEU A CD1  1  
ATOM   4992   C  CD2  . LEU A 1 332 ? 26.215  40.817 8.467  1.00 21.81  ? 335 LEU A CD2  1  
ATOM   4993   H  H    . LEU A 1 332 ? 22.631  38.032 11.035 1.00 0.00   ? 335 LEU A H    1  
ATOM   4994   H  HA   . LEU A 1 332 ? 24.126  37.194 8.580  1.00 0.00   ? 335 LEU A HA   1  
ATOM   4995   H  HB2  . LEU A 1 332 ? 23.703  39.613 8.498  1.00 0.00   ? 335 LEU A HB2  1  
ATOM   4996   H  HB3  . LEU A 1 332 ? 24.391  39.801 10.112 1.00 0.00   ? 335 LEU A HB3  1  
ATOM   4997   H  HG   . LEU A 1 332 ? 26.541  38.834 9.228  1.00 0.00   ? 335 LEU A HG   1  
ATOM   4998   H  HD11 . LEU A 1 332 ? 26.271  39.382 6.490  1.00 0.00   ? 335 LEU A HD11 1  
ATOM   4999   H  HD12 . LEU A 1 332 ? 24.828  38.460 6.910  1.00 0.00   ? 335 LEU A HD12 1  
ATOM   5000   H  HD13 . LEU A 1 332 ? 26.427  37.790 7.232  1.00 0.00   ? 335 LEU A HD13 1  
ATOM   5001   H  HD21 . LEU A 1 332 ? 26.864  40.950 7.614  1.00 0.00   ? 335 LEU A HD21 1  
ATOM   5002   H  HD22 . LEU A 1 332 ? 26.729  41.132 9.363  1.00 0.00   ? 335 LEU A HD22 1  
ATOM   5003   H  HD23 . LEU A 1 332 ? 25.322  41.412 8.337  1.00 0.00   ? 335 LEU A HD23 1  
ATOM   5004   N  N    . ALA A 1 333 ? 25.720  36.035 10.164 1.00 19.12  ? 336 ALA A N    1  
ATOM   5005   C  CA   . ALA A 1 333 ? 26.757  35.448 11.057 1.00 19.15  ? 336 ALA A CA   1  
ATOM   5006   C  C    . ALA A 1 333 ? 27.989  36.351 11.056 1.00 19.63  ? 336 ALA A C    1  
ATOM   5007   O  O    . ALA A 1 333 ? 28.236  37.077 10.113 1.00 19.82  ? 336 ALA A O    1  
ATOM   5008   C  CB   . ALA A 1 333 ? 27.142  34.057 10.548 1.00 19.67  ? 336 ALA A CB   1  
ATOM   5009   H  H    . ALA A 1 333 ? 25.435  35.552 9.361  1.00 0.00   ? 336 ALA A H    1  
ATOM   5010   H  HA   . ALA A 1 333 ? 26.367  35.371 12.061 1.00 0.00   ? 336 ALA A HA   1  
ATOM   5011   H  HB1  . ALA A 1 333 ? 27.132  33.358 11.371 1.00 0.00   ? 336 ALA A HB1  1  
ATOM   5012   H  HB2  . ALA A 1 333 ? 28.131  34.093 10.117 1.00 0.00   ? 336 ALA A HB2  1  
ATOM   5013   H  HB3  . ALA A 1 333 ? 26.433  33.740 9.798  1.00 0.00   ? 336 ALA A HB3  1  
ATOM   5014   N  N    . PRO A 1 334 ? 28.756  36.306 12.109 1.00 19.64  ? 337 PRO A N    1  
ATOM   5015   C  CA   . PRO A 1 334 ? 29.988  37.134 12.240 1.00 20.19  ? 337 PRO A CA   1  
ATOM   5016   C  C    . PRO A 1 334 ? 30.835  37.111 10.963 1.00 21.37  ? 337 PRO A C    1  
ATOM   5017   O  O    . PRO A 1 334 ? 31.256  36.066 10.509 1.00 21.94  ? 337 PRO A O    1  
ATOM   5018   C  CB   . PRO A 1 334 ? 30.741  36.477 13.397 1.00 19.77  ? 337 PRO A CB   1  
ATOM   5019   C  CG   . PRO A 1 334 ? 29.691  35.815 14.229 1.00 19.84  ? 337 PRO A CG   1  
ATOM   5020   C  CD   . PRO A 1 334 ? 28.534  35.459 13.291 1.00 19.51  ? 337 PRO A CD   1  
ATOM   5021   H  HA   . PRO A 1 334 ? 29.733  38.148 12.504 1.00 0.00   ? 337 PRO A HA   1  
ATOM   5022   H  HB2  . PRO A 1 334 ? 31.440  35.744 13.018 1.00 0.00   ? 337 PRO A HB2  1  
ATOM   5023   H  HB3  . PRO A 1 334 ? 31.258  37.223 13.980 1.00 0.00   ? 337 PRO A HB3  1  
ATOM   5024   H  HG2  . PRO A 1 334 ? 30.093  34.919 14.683 1.00 0.00   ? 337 PRO A HG2  1  
ATOM   5025   H  HG3  . PRO A 1 334 ? 29.342  36.493 14.993 1.00 0.00   ? 337 PRO A HG3  1  
ATOM   5026   H  HD2  . PRO A 1 334 ? 28.575  34.412 13.023 1.00 0.00   ? 337 PRO A HD2  1  
ATOM   5027   H  HD3  . PRO A 1 334 ? 27.587  35.699 13.748 1.00 0.00   ? 337 PRO A HD3  1  
ATOM   5028   N  N    . SER A 1 335 ? 31.086  38.252 10.376 1.00 22.30  ? 338 SER A N    1  
ATOM   5029   C  CA   . SER A 1 335 ? 31.898  38.274 9.132  1.00 23.87  ? 338 SER A CA   1  
ATOM   5030   C  C    . SER A 1 335 ? 32.430  39.684 8.897  1.00 24.96  ? 338 SER A C    1  
ATOM   5031   O  O    . SER A 1 335 ? 31.992  40.636 9.511  1.00 23.73  ? 338 SER A O    1  
ATOM   5032   C  CB   . SER A 1 335 ? 31.028  37.853 7.947  1.00 24.25  ? 338 SER A CB   1  
ATOM   5033   O  OG   . SER A 1 335 ? 29.771  38.513 8.030  1.00 26.10  ? 338 SER A OG   1  
ATOM   5034   H  H    . SER A 1 335 ? 30.737  39.087 10.752 1.00 0.00   ? 338 SER A H    1  
ATOM   5035   H  HA   . SER A 1 335 ? 32.727  37.588 9.231  1.00 0.00   ? 338 SER A HA   1  
ATOM   5036   H  HB2  . SER A 1 335 ? 31.513  38.129 7.026  1.00 0.00   ? 338 SER A HB2  1  
ATOM   5037   H  HB3  . SER A 1 335 ? 30.886  36.781 7.970  1.00 0.00   ? 338 SER A HB3  1  
ATOM   5038   H  HG   . SER A 1 335 ? 29.529  38.801 7.148  1.00 0.00   ? 338 SER A HG   1  
ATOM   5039   N  N    . GLY A 1 336 ? 33.372  39.823 8.012  1.00 26.68  ? 339 GLY A N    1  
ATOM   5040   C  CA   . GLY A 1 336 ? 33.938  41.173 7.732  1.00 28.24  ? 339 GLY A CA   1  
ATOM   5041   C  C    . GLY A 1 336 ? 32.799  42.181 7.568  1.00 29.71  ? 339 GLY A C    1  
ATOM   5042   O  O    . GLY A 1 336 ? 31.830  41.847 6.906  1.00 31.31  ? 339 GLY A O    1  
ATOM   5043   H  H    . GLY A 1 336 ? 33.710  39.040 7.529  1.00 0.00   ? 339 GLY A H    1  
ATOM   5044   H  HA2  . GLY A 1 336 ? 34.572  41.474 8.554  1.00 0.00   ? 339 GLY A HA2  1  
ATOM   5045   H  HA3  . GLY A 1 336 ? 34.518  41.139 6.823  1.00 0.00   ? 339 GLY A HA3  1  
ATOM   5046   N  N    . ALA B 1 1   ? -4.277  68.068 54.000 1.00 24.85  ? 4   ALA B N    1  
ATOM   5047   C  CA   . ALA B 1 1   ? -4.856  68.861 55.121 1.00 24.08  ? 4   ALA B CA   1  
ATOM   5048   C  C    . ALA B 1 1   ? -4.188  70.237 55.174 1.00 24.22  ? 4   ALA B C    1  
ATOM   5049   O  O    . ALA B 1 1   ? -3.015  70.381 54.891 1.00 24.21  ? 4   ALA B O    1  
ATOM   5050   C  CB   . ALA B 1 1   ? -4.615  68.127 56.442 1.00 24.23  ? 4   ALA B CB   1  
ATOM   5051   H  HA   . ALA B 1 1   ? -5.918  68.982 54.966 1.00 0.00   ? 4   ALA B HA   1  
ATOM   5052   H  HB1  . ALA B 1 1   ? -3.847  68.639 57.004 1.00 0.00   ? 4   ALA B HB1  1  
ATOM   5053   H  HB2  . ALA B 1 1   ? -4.297  67.115 56.239 1.00 0.00   ? 4   ALA B HB2  1  
ATOM   5054   H  HB3  . ALA B 1 1   ? -5.529  68.109 57.016 1.00 0.00   ? 4   ALA B HB3  1  
ATOM   5055   N  N    . THR B 1 2   ? -4.927  71.251 55.535 1.00 23.96  ? 5   THR B N    1  
ATOM   5056   C  CA   . THR B 1 2   ? -4.341  72.610 55.607 1.00 23.82  ? 5   THR B CA   1  
ATOM   5057   C  C    . THR B 1 2   ? -3.733  72.811 56.990 1.00 23.24  ? 5   THR B C    1  
ATOM   5058   O  O    . THR B 1 2   ? -3.920  72.012 57.885 1.00 22.73  ? 5   THR B O    1  
ATOM   5059   C  CB   . THR B 1 2   ? -5.435  73.654 55.371 1.00 23.80  ? 5   THR B CB   1  
ATOM   5060   O  OG1  . THR B 1 2   ? -6.294  73.701 56.503 1.00 23.80  ? 5   THR B OG1  1  
ATOM   5061   C  CG2  . THR B 1 2   ? -6.244  73.277 54.130 1.00 24.98  ? 5   THR B CG2  1  
ATOM   5062   H  H    . THR B 1 2   ? -5.871  71.113 55.760 1.00 0.00   ? 5   THR B H    1  
ATOM   5063   H  HA   . THR B 1 2   ? -3.573  72.714 54.855 1.00 0.00   ? 5   THR B HA   1  
ATOM   5064   H  HB   . THR B 1 2   ? -4.984  74.622 55.221 1.00 0.00   ? 5   THR B HB   1  
ATOM   5065   H  HG1  . THR B 1 2   ? -7.170  73.428 56.222 1.00 0.00   ? 5   THR B HG1  1  
ATOM   5066   H  HG21 . THR B 1 2   ? -7.094  72.677 54.422 1.00 0.00   ? 5   THR B HG21 1  
ATOM   5067   H  HG22 . THR B 1 2   ? -5.621  72.712 53.452 1.00 0.00   ? 5   THR B HG22 1  
ATOM   5068   H  HG23 . THR B 1 2   ? -6.589  74.175 53.638 1.00 0.00   ? 5   THR B HG23 1  
ATOM   5069   N  N    . ALA B 1 3   ? -3.005  73.869 57.170 1.00 23.07  ? 6   ALA B N    1  
ATOM   5070   C  CA   . ALA B 1 3   ? -2.377  74.125 58.501 1.00 23.07  ? 6   ALA B CA   1  
ATOM   5071   C  C    . ALA B 1 3   ? -3.449  74.188 59.603 1.00 22.80  ? 6   ALA B C    1  
ATOM   5072   O  O    . ALA B 1 3   ? -3.267  73.660 60.682 1.00 22.06  ? 6   ALA B O    1  
ATOM   5073   C  CB   . ALA B 1 3   ? -1.621  75.454 58.455 1.00 23.13  ? 6   ALA B CB   1  
ATOM   5074   H  H    . ALA B 1 3   ? -2.866  74.500 56.433 1.00 0.00   ? 6   ALA B H    1  
ATOM   5075   H  HA   . ALA B 1 3   ? -1.682  73.329 58.725 1.00 0.00   ? 6   ALA B HA   1  
ATOM   5076   H  HB1  . ALA B 1 3   ? -0.812  75.383 57.744 1.00 0.00   ? 6   ALA B HB1  1  
ATOM   5077   H  HB2  . ALA B 1 3   ? -1.222  75.675 59.434 1.00 0.00   ? 6   ALA B HB2  1  
ATOM   5078   H  HB3  . ALA B 1 3   ? -2.296  76.242 58.155 1.00 0.00   ? 6   ALA B HB3  1  
ATOM   5079   N  N    . ALA B 1 4   ? -4.554  74.841 59.351 1.00 22.91  ? 7   ALA B N    1  
ATOM   5080   C  CA   . ALA B 1 4   ? -5.615  74.948 60.394 1.00 22.71  ? 7   ALA B CA   1  
ATOM   5081   C  C    . ALA B 1 4   ? -6.104  73.554 60.791 1.00 22.29  ? 7   ALA B C    1  
ATOM   5082   O  O    . ALA B 1 4   ? -6.364  73.282 61.946 1.00 22.62  ? 7   ALA B O    1  
ATOM   5083   C  CB   . ALA B 1 4   ? -6.789  75.759 59.843 1.00 22.81  ? 7   ALA B CB   1  
ATOM   5084   H  H    . ALA B 1 4   ? -4.680  75.272 58.480 1.00 0.00   ? 7   ALA B H    1  
ATOM   5085   H  HA   . ALA B 1 4   ? -5.213  75.446 61.264 1.00 0.00   ? 7   ALA B HA   1  
ATOM   5086   H  HB1  . ALA B 1 4   ? -7.499  75.093 59.376 1.00 0.00   ? 7   ALA B HB1  1  
ATOM   5087   H  HB2  . ALA B 1 4   ? -6.425  76.467 59.113 1.00 0.00   ? 7   ALA B HB2  1  
ATOM   5088   H  HB3  . ALA B 1 4   ? -7.271  76.290 60.651 1.00 0.00   ? 7   ALA B HB3  1  
ATOM   5089   N  N    . GLU B 1 5   ? -6.241  72.671 59.843 1.00 21.82  ? 8   GLU B N    1  
ATOM   5090   C  CA   . GLU B 1 5   ? -6.724  71.299 60.167 1.00 21.40  ? 8   GLU B CA   1  
ATOM   5091   C  C    . GLU B 1 5   ? -5.661  70.564 60.981 1.00 20.84  ? 8   GLU B C    1  
ATOM   5092   O  O    . GLU B 1 5   ? -5.951  69.936 61.979 1.00 20.30  ? 8   GLU B O    1  
ATOM   5093   C  CB   . GLU B 1 5   ? -6.993  70.533 58.869 1.00 21.37  ? 8   GLU B CB   1  
ATOM   5094   C  CG   . GLU B 1 5   ? -8.357  70.939 58.310 1.00 22.33  ? 8   GLU B CG   1  
ATOM   5095   C  CD   . GLU B 1 5   ? -8.344  70.811 56.786 1.00 25.01  ? 8   GLU B CD   1  
ATOM   5096   O  OE1  . GLU B 1 5   ? -7.498  70.092 56.279 1.00 25.80  ? 8   GLU B OE1  1  
ATOM   5097   O  OE2  . GLU B 1 5   ? -9.179  71.434 56.151 1.00 28.01  ? 8   GLU B OE2  1  
ATOM   5098   H  H    . GLU B 1 5   ? -6.033  72.911 58.916 1.00 0.00   ? 8   GLU B H    1  
ATOM   5099   H  HA   . GLU B 1 5   ? -7.636  71.364 60.741 1.00 0.00   ? 8   GLU B HA   1  
ATOM   5100   H  HB2  . GLU B 1 5   ? -6.223  70.767 58.148 1.00 0.00   ? 8   GLU B HB2  1  
ATOM   5101   H  HB3  . GLU B 1 5   ? -6.989  69.473 59.070 1.00 0.00   ? 8   GLU B HB3  1  
ATOM   5102   H  HG2  . GLU B 1 5   ? -9.121  70.294 58.720 1.00 0.00   ? 8   GLU B HG2  1  
ATOM   5103   H  HG3  . GLU B 1 5   ? -8.568  71.963 58.581 1.00 0.00   ? 8   GLU B HG3  1  
ATOM   5104   N  N    . ILE B 1 6   ? -4.430  70.638 60.561 1.00 20.41  ? 9   ILE B N    1  
ATOM   5105   C  CA   . ILE B 1 6   ? -3.344  69.944 61.310 1.00 20.86  ? 9   ILE B CA   1  
ATOM   5106   C  C    . ILE B 1 6   ? -3.257  70.505 62.732 1.00 21.11  ? 9   ILE B C    1  
ATOM   5107   O  O    . ILE B 1 6   ? -3.056  69.777 63.684 1.00 20.69  ? 9   ILE B O    1  
ATOM   5108   C  CB   . ILE B 1 6   ? -2.011  70.164 60.593 1.00 20.56  ? 9   ILE B CB   1  
ATOM   5109   C  CG1  . ILE B 1 6   ? -2.074  69.539 59.198 1.00 20.76  ? 9   ILE B CG1  1  
ATOM   5110   C  CG2  . ILE B 1 6   ? -0.886  69.507 61.394 1.00 21.09  ? 9   ILE B CG2  1  
ATOM   5111   C  CD1  . ILE B 1 6   ? -0.838  69.951 58.397 1.00 20.67  ? 9   ILE B CD1  1  
ATOM   5112   H  H    . ILE B 1 6   ? -4.218  71.150 59.753 1.00 0.00   ? 9   ILE B H    1  
ATOM   5113   H  HA   . ILE B 1 6   ? -3.558  68.886 61.354 1.00 0.00   ? 9   ILE B HA   1  
ATOM   5114   H  HB   . ILE B 1 6   ? -1.820  71.224 60.507 1.00 0.00   ? 9   ILE B HB   1  
ATOM   5115   H  HG12 . ILE B 1 6   ? -2.104  68.462 59.287 1.00 0.00   ? 9   ILE B HG12 1  
ATOM   5116   H  HG13 . ILE B 1 6   ? -2.962  69.883 58.689 1.00 0.00   ? 9   ILE B HG13 1  
ATOM   5117   H  HG21 . ILE B 1 6   ? 0.069   69.843 61.017 1.00 0.00   ? 9   ILE B HG21 1  
ATOM   5118   H  HG22 . ILE B 1 6   ? -0.954  68.433 61.297 1.00 0.00   ? 9   ILE B HG22 1  
ATOM   5119   H  HG23 . ILE B 1 6   ? -0.978  69.780 62.435 1.00 0.00   ? 9   ILE B HG23 1  
ATOM   5120   H  HD11 . ILE B 1 6   ? -0.358  69.070 57.997 1.00 0.00   ? 9   ILE B HD11 1  
ATOM   5121   H  HD12 . ILE B 1 6   ? -0.149  70.475 59.043 1.00 0.00   ? 9   ILE B HD12 1  
ATOM   5122   H  HD13 . ILE B 1 6   ? -1.134  70.599 57.585 1.00 0.00   ? 9   ILE B HD13 1  
ATOM   5123   N  N    . ALA B 1 7   ? -3.402  71.794 62.886 1.00 21.48  ? 10  ALA B N    1  
ATOM   5124   C  CA   . ALA B 1 7   ? -3.322  72.397 64.252 1.00 22.12  ? 10  ALA B CA   1  
ATOM   5125   C  C    . ALA B 1 7   ? -4.483  71.911 65.142 1.00 22.05  ? 10  ALA B C    1  
ATOM   5126   O  O    . ALA B 1 7   ? -4.354  71.842 66.348 1.00 23.11  ? 10  ALA B O    1  
ATOM   5127   C  CB   . ALA B 1 7   ? -3.385  73.921 64.133 1.00 22.78  ? 10  ALA B CB   1  
ATOM   5128   H  H    . ALA B 1 7   ? -3.561  72.366 62.106 1.00 0.00   ? 10  ALA B H    1  
ATOM   5129   H  HA   . ALA B 1 7   ? -2.384  72.117 64.708 1.00 0.00   ? 10  ALA B HA   1  
ATOM   5130   H  HB1  . ALA B 1 7   ? -3.314  74.204 63.093 1.00 0.00   ? 10  ALA B HB1  1  
ATOM   5131   H  HB2  . ALA B 1 7   ? -2.564  74.359 64.681 1.00 0.00   ? 10  ALA B HB2  1  
ATOM   5132   H  HB3  . ALA B 1 7   ? -4.320  74.276 64.539 1.00 0.00   ? 10  ALA B HB3  1  
ATOM   5133   N  N    . ALA B 1 8   ? -5.617  71.590 64.571 1.00 22.19  ? 11  ALA B N    1  
ATOM   5134   C  CA   . ALA B 1 8   ? -6.775  71.132 65.406 1.00 22.09  ? 11  ALA B CA   1  
ATOM   5135   C  C    . ALA B 1 8   ? -6.721  69.615 65.709 1.00 21.35  ? 11  ALA B C    1  
ATOM   5136   O  O    . ALA B 1 8   ? -7.599  69.091 66.365 1.00 21.65  ? 11  ALA B O    1  
ATOM   5137   C  CB   . ALA B 1 8   ? -8.076  71.443 64.663 1.00 22.26  ? 11  ALA B CB   1  
ATOM   5138   H  H    . ALA B 1 8   ? -5.713  71.662 63.598 1.00 0.00   ? 11  ALA B H    1  
ATOM   5139   H  HA   . ALA B 1 8   ? -6.770  71.675 66.338 1.00 0.00   ? 11  ALA B HA   1  
ATOM   5140   H  HB1  . ALA B 1 8   ? -8.242  70.696 63.900 1.00 0.00   ? 11  ALA B HB1  1  
ATOM   5141   H  HB2  . ALA B 1 8   ? -8.003  72.417 64.203 1.00 0.00   ? 11  ALA B HB2  1  
ATOM   5142   H  HB3  . ALA B 1 8   ? -8.900  71.434 65.361 1.00 0.00   ? 11  ALA B HB3  1  
ATOM   5143   N  N    . LEU B 1 9   ? -5.721  68.898 65.254 1.00 20.64  ? 12  LEU B N    1  
ATOM   5144   C  CA   . LEU B 1 9   ? -5.671  67.428 65.551 1.00 20.36  ? 12  LEU B CA   1  
ATOM   5145   C  C    . LEU B 1 9   ? -5.090  67.192 66.956 1.00 19.82  ? 12  LEU B C    1  
ATOM   5146   O  O    . LEU B 1 9   ? -4.214  67.908 67.396 1.00 20.06  ? 12  LEU B O    1  
ATOM   5147   C  CB   . LEU B 1 9   ? -4.788  66.731 64.513 1.00 19.78  ? 12  LEU B CB   1  
ATOM   5148   C  CG   . LEU B 1 9   ? -5.424  66.865 63.129 1.00 20.42  ? 12  LEU B CG   1  
ATOM   5149   C  CD1  . LEU B 1 9   ? -4.463  66.321 62.070 1.00 20.90  ? 12  LEU B CD1  1  
ATOM   5150   C  CD2  . LEU B 1 9   ? -6.729  66.067 63.089 1.00 20.95  ? 12  LEU B CD2  1  
ATOM   5151   H  H    . LEU B 1 9   ? -5.012  69.319 64.725 1.00 0.00   ? 12  LEU B H    1  
ATOM   5152   H  HA   . LEU B 1 9   ? -6.670  67.019 65.503 1.00 0.00   ? 12  LEU B HA   1  
ATOM   5153   H  HB2  . LEU B 1 9   ? -3.810  67.191 64.507 1.00 0.00   ? 12  LEU B HB2  1  
ATOM   5154   H  HB3  . LEU B 1 9   ? -4.694  65.686 64.765 1.00 0.00   ? 12  LEU B HB3  1  
ATOM   5155   H  HG   . LEU B 1 9   ? -5.629  67.906 62.927 1.00 0.00   ? 12  LEU B HG   1  
ATOM   5156   H  HD11 . LEU B 1 9   ? -3.938  67.142 61.605 1.00 0.00   ? 12  LEU B HD11 1  
ATOM   5157   H  HD12 . LEU B 1 9   ? -5.021  65.779 61.321 1.00 0.00   ? 12  LEU B HD12 1  
ATOM   5158   H  HD13 . LEU B 1 9   ? -3.750  65.657 62.538 1.00 0.00   ? 12  LEU B HD13 1  
ATOM   5159   H  HD21 . LEU B 1 9   ? -6.551  65.067 63.457 1.00 0.00   ? 12  LEU B HD21 1  
ATOM   5160   H  HD22 . LEU B 1 9   ? -7.090  66.017 62.073 1.00 0.00   ? 12  LEU B HD22 1  
ATOM   5161   H  HD23 . LEU B 1 9   ? -7.467  66.553 63.710 1.00 0.00   ? 12  LEU B HD23 1  
ATOM   5162   N  N    . PRO B 1 10  ? -5.576  66.186 67.653 1.00 19.94  ? 13  PRO B N    1  
ATOM   5163   C  CA   . PRO B 1 10  ? -5.091  65.850 69.029 1.00 20.27  ? 13  PRO B CA   1  
ATOM   5164   C  C    . PRO B 1 10  ? -3.598  65.470 69.062 1.00 20.25  ? 13  PRO B C    1  
ATOM   5165   O  O    . PRO B 1 10  ? -3.112  64.749 68.213 1.00 19.92  ? 13  PRO B O    1  
ATOM   5166   C  CB   . PRO B 1 10  ? -5.949  64.649 69.448 1.00 20.69  ? 13  PRO B CB   1  
ATOM   5167   C  CG   . PRO B 1 10  ? -7.105  64.615 68.499 1.00 21.90  ? 13  PRO B CG   1  
ATOM   5168   C  CD   . PRO B 1 10  ? -6.632  65.273 67.206 1.00 20.20  ? 13  PRO B CD   1  
ATOM   5169   H  HA   . PRO B 1 10  ? -5.278  66.673 69.699 1.00 0.00   ? 13  PRO B HA   1  
ATOM   5170   H  HB2  . PRO B 1 10  ? -5.374  63.737 69.370 1.00 0.00   ? 13  PRO B HB2  1  
ATOM   5171   H  HB3  . PRO B 1 10  ? -6.306  64.780 70.457 1.00 0.00   ? 13  PRO B HB3  1  
ATOM   5172   H  HG2  . PRO B 1 10  ? -7.399  63.591 68.312 1.00 0.00   ? 13  PRO B HG2  1  
ATOM   5173   H  HG3  . PRO B 1 10  ? -7.935  65.171 68.906 1.00 0.00   ? 13  PRO B HG3  1  
ATOM   5174   H  HD2  . PRO B 1 10  ? -6.236  64.531 66.526 1.00 0.00   ? 13  PRO B HD2  1  
ATOM   5175   H  HD3  . PRO B 1 10  ? -7.434  65.827 66.744 1.00 0.00   ? 13  PRO B HD3  1  
ATOM   5176   N  N    . ARG B 1 11  ? -2.875  65.942 70.050 1.00 20.56  ? 14  ARG B N    1  
ATOM   5177   C  CA   . ARG B 1 11  ? -1.432  65.609 70.162 1.00 20.82  ? 14  ARG B CA   1  
ATOM   5178   C  C    . ARG B 1 11  ? -1.247  64.584 71.283 1.00 21.38  ? 14  ARG B C    1  
ATOM   5179   O  O    . ARG B 1 11  ? -1.866  64.666 72.325 1.00 22.15  ? 14  ARG B O    1  
ATOM   5180   C  CB   . ARG B 1 11  ? -0.637  66.875 70.487 1.00 21.16  ? 14  ARG B CB   1  
ATOM   5181   C  CG   . ARG B 1 11  ? 0.200   67.279 69.272 1.00 21.85  ? 14  ARG B CG   1  
ATOM   5182   C  CD   . ARG B 1 11  ? -0.325  68.600 68.707 1.00 21.40  ? 14  ARG B CD   1  
ATOM   5183   N  NE   . ARG B 1 11  ? -1.255  68.323 67.577 1.00 21.66  ? 14  ARG B NE   1  
ATOM   5184   C  CZ   . ARG B 1 11  ? -1.276  69.116 66.540 1.00 21.56  ? 14  ARG B CZ   1  
ATOM   5185   N  NH1  . ARG B 1 11  ? -0.483  70.151 66.494 1.00 21.80  ? 14  ARG B NH1  1  
ATOM   5186   N  NH2  . ARG B 1 11  ? -2.091  68.873 65.550 1.00 21.14  ? 14  ARG B NH2  1  
ATOM   5187   H  H    . ARG B 1 11  ? -3.294  66.513 70.727 1.00 0.00   ? 14  ARG B H    1  
ATOM   5188   H  HA   . ARG B 1 11  ? -1.084  65.191 69.228 1.00 0.00   ? 14  ARG B HA   1  
ATOM   5189   H  HB2  . ARG B 1 11  ? -1.320  67.674 70.738 1.00 0.00   ? 14  ARG B HB2  1  
ATOM   5190   H  HB3  . ARG B 1 11  ? 0.017   66.684 71.325 1.00 0.00   ? 14  ARG B HB3  1  
ATOM   5191   H  HG2  . ARG B 1 11  ? 1.232   67.397 69.569 1.00 0.00   ? 14  ARG B HG2  1  
ATOM   5192   H  HG3  . ARG B 1 11  ? 0.129   66.513 68.514 1.00 0.00   ? 14  ARG B HG3  1  
ATOM   5193   H  HD2  . ARG B 1 11  ? -0.850  69.140 69.482 1.00 0.00   ? 14  ARG B HD2  1  
ATOM   5194   H  HD3  . ARG B 1 11  ? 0.505   69.195 68.354 1.00 0.00   ? 14  ARG B HD3  1  
ATOM   5195   H  HE   . ARG B 1 11  ? -1.850  67.546 67.612 1.00 0.00   ? 14  ARG B HE   1  
ATOM   5196   H  HH11 . ARG B 1 11  ? 0.141   70.337 67.253 1.00 0.00   ? 14  ARG B HH11 1  
ATOM   5197   H  HH12 . ARG B 1 11  ? -0.500  70.759 65.700 1.00 0.00   ? 14  ARG B HH12 1  
ATOM   5198   H  HH21 . ARG B 1 11  ? -2.699  68.080 65.586 1.00 0.00   ? 14  ARG B HH21 1  
ATOM   5199   H  HH22 . ARG B 1 11  ? -2.107  69.480 64.756 1.00 0.00   ? 14  ARG B HH22 1  
ATOM   5200   N  N    . GLN B 1 12  ? -0.407  63.618 71.067 1.00 20.58  ? 15  GLN B N    1  
ATOM   5201   C  CA   . GLN B 1 12  ? -0.171  62.571 72.095 1.00 21.14  ? 15  GLN B CA   1  
ATOM   5202   C  C    . GLN B 1 12  ? 1.335   62.364 72.262 1.00 20.02  ? 15  GLN B C    1  
ATOM   5203   O  O    . GLN B 1 12  ? 2.022   61.922 71.362 1.00 18.71  ? 15  GLN B O    1  
ATOM   5204   C  CB   . GLN B 1 12  ? -0.820  61.259 71.648 1.00 21.91  ? 15  GLN B CB   1  
ATOM   5205   C  CG   . GLN B 1 12  ? -0.490  60.156 72.656 1.00 24.65  ? 15  GLN B CG   1  
ATOM   5206   C  CD   . GLN B 1 12  ? -1.011  58.816 72.135 1.00 29.30  ? 15  GLN B CD   1  
ATOM   5207   O  OE1  . GLN B 1 12  ? -1.325  58.685 70.968 1.00 32.53  ? 15  GLN B OE1  1  
ATOM   5208   N  NE2  . GLN B 1 12  ? -1.117  57.807 72.956 1.00 33.32  ? 15  GLN B NE2  1  
ATOM   5209   H  H    . GLN B 1 12  ? 0.072   63.575 70.213 1.00 0.00   ? 15  GLN B H    1  
ATOM   5210   H  HA   . GLN B 1 12  ? -0.599  62.884 73.036 1.00 0.00   ? 15  GLN B HA   1  
ATOM   5211   H  HB2  . GLN B 1 12  ? -1.892  61.389 71.593 1.00 0.00   ? 15  GLN B HB2  1  
ATOM   5212   H  HB3  . GLN B 1 12  ? -0.441  60.982 70.677 1.00 0.00   ? 15  GLN B HB3  1  
ATOM   5213   H  HG2  . GLN B 1 12  ? 0.581   60.100 72.790 1.00 0.00   ? 15  GLN B HG2  1  
ATOM   5214   H  HG3  . GLN B 1 12  ? -0.960  60.380 73.602 1.00 0.00   ? 15  GLN B HG3  1  
ATOM   5215   H  HE21 . GLN B 1 12  ? -0.864  57.912 73.897 1.00 0.00   ? 15  GLN B HE21 1  
ATOM   5216   H  HE22 . GLN B 1 12  ? -1.450  56.944 72.632 1.00 0.00   ? 15  GLN B HE22 1  
ATOM   5217   N  N    . LYS B 1 13  ? 1.844   62.692 73.409 1.00 19.74  ? 16  LYS B N    1  
ATOM   5218   C  CA   . LYS B 1 13  ? 3.288   62.541 73.672 1.00 20.00  ? 16  LYS B CA   1  
ATOM   5219   C  C    . LYS B 1 13  ? 3.545   61.097 74.033 1.00 18.65  ? 16  LYS B C    1  
ATOM   5220   O  O    . LYS B 1 13  ? 2.784   60.475 74.747 1.00 19.43  ? 16  LYS B O    1  
ATOM   5221   C  CB   . LYS B 1 13  ? 3.699   63.446 74.836 1.00 21.18  ? 16  LYS B CB   1  
ATOM   5222   C  CG   . LYS B 1 13  ? 5.108   63.072 75.301 1.00 25.33  ? 16  LYS B CG   1  
ATOM   5223   C  CD   . LYS B 1 13  ? 6.139   63.684 74.350 1.00 29.82  ? 16  LYS B CD   1  
ATOM   5224   C  CE   . LYS B 1 13  ? 7.538   63.197 74.733 1.00 31.71  ? 16  LYS B CE   1  
ATOM   5225   N  NZ   . LYS B 1 13  ? 8.480   63.459 73.607 1.00 34.15  ? 16  LYS B NZ   1  
ATOM   5226   H  H    . LYS B 1 13  ? 1.261   63.051 74.110 1.00 0.00   ? 16  LYS B H    1  
ATOM   5227   H  HA   . LYS B 1 13  ? 3.850   62.803 72.788 1.00 0.00   ? 16  LYS B HA   1  
ATOM   5228   H  HB2  . LYS B 1 13  ? 3.688   64.477 74.511 1.00 0.00   ? 16  LYS B HB2  1  
ATOM   5229   H  HB3  . LYS B 1 13  ? 3.007   63.318 75.654 1.00 0.00   ? 16  LYS B HB3  1  
ATOM   5230   H  HG2  . LYS B 1 13  ? 5.269   63.449 76.300 1.00 0.00   ? 16  LYS B HG2  1  
ATOM   5231   H  HG3  . LYS B 1 13  ? 5.214   61.997 75.300 1.00 0.00   ? 16  LYS B HG3  1  
ATOM   5232   H  HD2  . LYS B 1 13  ? 5.917   63.384 73.337 1.00 0.00   ? 16  LYS B HD2  1  
ATOM   5233   H  HD3  . LYS B 1 13  ? 6.102   64.760 74.424 1.00 0.00   ? 16  LYS B HD3  1  
ATOM   5234   H  HE2  . LYS B 1 13  ? 7.875   63.725 75.613 1.00 0.00   ? 16  LYS B HE2  1  
ATOM   5235   H  HE3  . LYS B 1 13  ? 7.507   62.137 74.937 1.00 0.00   ? 16  LYS B HE3  1  
ATOM   5236   H  HZ1  . LYS B 1 13  ? 9.031   62.600 73.409 1.00 0.00   ? 16  LYS B HZ1  1  
ATOM   5237   H  HZ2  . LYS B 1 13  ? 9.126   64.230 73.868 1.00 0.00   ? 16  LYS B HZ2  1  
ATOM   5238   H  HZ3  . LYS B 1 13  ? 7.939   63.729 72.760 1.00 0.00   ? 16  LYS B HZ3  1  
ATOM   5239   N  N    . VAL B 1 14  ? 4.592   60.548 73.529 1.00 16.97  ? 17  VAL B N    1  
ATOM   5240   C  CA   . VAL B 1 14  ? 4.883   59.118 73.826 1.00 17.05  ? 17  VAL B CA   1  
ATOM   5241   C  C    . VAL B 1 14  ? 6.296   58.949 74.393 1.00 15.95  ? 17  VAL B C    1  
ATOM   5242   O  O    . VAL B 1 14  ? 7.271   59.402 73.827 1.00 17.52  ? 17  VAL B O    1  
ATOM   5243   C  CB   . VAL B 1 14  ? 4.757   58.302 72.538 1.00 16.94  ? 17  VAL B CB   1  
ATOM   5244   C  CG1  . VAL B 1 14  ? 5.369   56.916 72.750 1.00 18.92  ? 17  VAL B CG1  1  
ATOM   5245   C  CG2  . VAL B 1 14  ? 3.279   58.155 72.171 1.00 19.53  ? 17  VAL B CG2  1  
ATOM   5246   H  H    . VAL B 1 14  ? 5.184   61.061 72.940 1.00 0.00   ? 17  VAL B H    1  
ATOM   5247   H  HA   . VAL B 1 14  ? 4.166   58.752 74.545 1.00 0.00   ? 17  VAL B HA   1  
ATOM   5248   H  HB   . VAL B 1 14  ? 5.281   58.807 71.740 1.00 0.00   ? 17  VAL B HB   1  
ATOM   5249   H  HG11 . VAL B 1 14  ? 5.056   56.258 71.953 1.00 0.00   ? 17  VAL B HG11 1  
ATOM   5250   H  HG12 . VAL B 1 14  ? 5.037   56.516 73.697 1.00 0.00   ? 17  VAL B HG12 1  
ATOM   5251   H  HG13 . VAL B 1 14  ? 6.446   56.994 72.750 1.00 0.00   ? 17  VAL B HG13 1  
ATOM   5252   H  HG21 . VAL B 1 14  ? 3.097   57.156 71.802 1.00 0.00   ? 17  VAL B HG21 1  
ATOM   5253   H  HG22 . VAL B 1 14  ? 3.025   58.874 71.407 1.00 0.00   ? 17  VAL B HG22 1  
ATOM   5254   H  HG23 . VAL B 1 14  ? 2.671   58.330 73.047 1.00 0.00   ? 17  VAL B HG23 1  
ATOM   5255   N  N    . GLU B 1 15  ? 6.400   58.266 75.500 1.00 16.04  ? 18  GLU B N    1  
ATOM   5256   C  CA   . GLU B 1 15  ? 7.718   58.010 76.122 1.00 16.43  ? 18  GLU B CA   1  
ATOM   5257   C  C    . GLU B 1 15  ? 8.303   56.790 75.433 1.00 15.58  ? 18  GLU B C    1  
ATOM   5258   O  O    . GLU B 1 15  ? 7.679   55.752 75.345 1.00 15.99  ? 18  GLU B O    1  
ATOM   5259   C  CB   . GLU B 1 15  ? 7.544   57.732 77.617 1.00 17.45  ? 18  GLU B CB   1  
ATOM   5260   C  CG   . GLU B 1 15  ? 7.570   59.053 78.389 1.00 22.60  ? 18  GLU B CG   1  
ATOM   5261   C  CD   . GLU B 1 15  ? 6.266   59.814 78.142 1.00 28.23  ? 18  GLU B CD   1  
ATOM   5262   O  OE1  . GLU B 1 15  ? 5.216   59.201 78.248 1.00 33.49  ? 18  GLU B OE1  1  
ATOM   5263   O  OE2  . GLU B 1 15  ? 6.339   60.996 77.851 1.00 32.25  ? 18  GLU B OE2  1  
ATOM   5264   H  H    . GLU B 1 15  ? 5.593   57.897 75.915 1.00 0.00   ? 18  GLU B H    1  
ATOM   5265   H  HA   . GLU B 1 15  ? 8.366   58.863 75.976 1.00 0.00   ? 18  GLU B HA   1  
ATOM   5266   H  HB2  . GLU B 1 15  ? 6.600   57.235 77.783 1.00 0.00   ? 18  GLU B HB2  1  
ATOM   5267   H  HB3  . GLU B 1 15  ? 8.349   57.101 77.962 1.00 0.00   ? 18  GLU B HB3  1  
ATOM   5268   H  HG2  . GLU B 1 15  ? 7.675   58.850 79.445 1.00 0.00   ? 18  GLU B HG2  1  
ATOM   5269   H  HG3  . GLU B 1 15  ? 8.403   59.651 78.052 1.00 0.00   ? 18  GLU B HG3  1  
ATOM   5270   N  N    . LEU B 1 16  ? 9.471   56.919 74.905 1.00 14.63  ? 19  LEU B N    1  
ATOM   5271   C  CA   . LEU B 1 16  ? 10.083  55.780 74.167 1.00 14.18  ? 19  LEU B CA   1  
ATOM   5272   C  C    . LEU B 1 16  ? 10.839  54.863 75.120 1.00 13.81  ? 19  LEU B C    1  
ATOM   5273   O  O    . LEU B 1 16  ? 11.345  55.283 76.142 1.00 15.39  ? 19  LEU B O    1  
ATOM   5274   C  CB   . LEU B 1 16  ? 11.052  56.323 73.114 1.00 13.80  ? 19  LEU B CB   1  
ATOM   5275   C  CG   . LEU B 1 16  ? 10.264  57.045 72.020 1.00 14.27  ? 19  LEU B CG   1  
ATOM   5276   C  CD1  . LEU B 1 16  ? 11.138  58.133 71.394 1.00 15.81  ? 19  LEU B CD1  1  
ATOM   5277   C  CD2  . LEU B 1 16  ? 9.854   56.039 70.942 1.00 15.44  ? 19  LEU B CD2  1  
ATOM   5278   H  H    . LEU B 1 16  ? 9.941   57.777 74.959 1.00 0.00   ? 19  LEU B H    1  
ATOM   5279   H  HA   . LEU B 1 16  ? 9.306   55.217 73.674 1.00 0.00   ? 19  LEU B HA   1  
ATOM   5280   H  HB2  . LEU B 1 16  ? 11.739  57.015 73.581 1.00 0.00   ? 19  LEU B HB2  1  
ATOM   5281   H  HB3  . LEU B 1 16  ? 11.605  55.505 72.678 1.00 0.00   ? 19  LEU B HB3  1  
ATOM   5282   H  HG   . LEU B 1 16  ? 9.381   57.496 72.450 1.00 0.00   ? 19  LEU B HG   1  
ATOM   5283   H  HD11 . LEU B 1 16  ? 11.750  58.587 72.159 1.00 0.00   ? 19  LEU B HD11 1  
ATOM   5284   H  HD12 . LEU B 1 16  ? 10.509  58.885 70.942 1.00 0.00   ? 19  LEU B HD12 1  
ATOM   5285   H  HD13 . LEU B 1 16  ? 11.774  57.694 70.639 1.00 0.00   ? 19  LEU B HD13 1  
ATOM   5286   H  HD21 . LEU B 1 16  ? 10.083  55.039 71.276 1.00 0.00   ? 19  LEU B HD21 1  
ATOM   5287   H  HD22 . LEU B 1 16  ? 10.395  56.247 70.030 1.00 0.00   ? 19  LEU B HD22 1  
ATOM   5288   H  HD23 . LEU B 1 16  ? 8.793   56.122 70.757 1.00 0.00   ? 19  LEU B HD23 1  
ATOM   5289   N  N    . VAL B 1 17  ? 10.930  53.609 74.777 1.00 12.96  ? 20  VAL B N    1  
ATOM   5290   C  CA   . VAL B 1 17  ? 11.661  52.657 75.637 1.00 13.24  ? 20  VAL B CA   1  
ATOM   5291   C  C    . VAL B 1 17  ? 12.947  52.294 74.921 1.00 12.33  ? 20  VAL B C    1  
ATOM   5292   O  O    . VAL B 1 17  ? 13.241  52.814 73.863 1.00 13.09  ? 20  VAL B O    1  
ATOM   5293   C  CB   . VAL B 1 17  ? 10.816  51.400 75.856 1.00 13.99  ? 20  VAL B CB   1  
ATOM   5294   C  CG1  . VAL B 1 17  ? 9.544   51.766 76.623 1.00 15.38  ? 20  VAL B CG1  1  
ATOM   5295   C  CG2  . VAL B 1 17  ? 10.437  50.800 74.500 1.00 15.19  ? 20  VAL B CG2  1  
ATOM   5296   H  H    . VAL B 1 17  ? 10.522  53.300 73.941 1.00 0.00   ? 20  VAL B H    1  
ATOM   5297   H  HA   . VAL B 1 17  ? 11.887  53.119 76.587 1.00 0.00   ? 20  VAL B HA   1  
ATOM   5298   H  HB   . VAL B 1 17  ? 11.384  50.679 76.425 1.00 0.00   ? 20  VAL B HB   1  
ATOM   5299   H  HG11 . VAL B 1 17  ? 9.808   52.296 77.526 1.00 0.00   ? 20  VAL B HG11 1  
ATOM   5300   H  HG12 . VAL B 1 17  ? 9.006   50.865 76.879 1.00 0.00   ? 20  VAL B HG12 1  
ATOM   5301   H  HG13 . VAL B 1 17  ? 8.920   52.395 76.005 1.00 0.00   ? 20  VAL B HG13 1  
ATOM   5302   H  HG21 . VAL B 1 17  ? 10.860  49.810 74.414 1.00 0.00   ? 20  VAL B HG21 1  
ATOM   5303   H  HG22 . VAL B 1 17  ? 10.822  51.426 73.709 1.00 0.00   ? 20  VAL B HG22 1  
ATOM   5304   H  HG23 . VAL B 1 17  ? 9.362   50.740 74.420 1.00 0.00   ? 20  VAL B HG23 1  
ATOM   5305   N  N    . ASP B 1 18  ? 13.720  51.416 75.466 1.00 11.63  ? 21  ASP B N    1  
ATOM   5306   C  CA   . ASP B 1 18  ? 14.994  51.045 74.767 1.00 11.45  ? 21  ASP B CA   1  
ATOM   5307   C  C    . ASP B 1 18  ? 14.877  49.642 74.153 1.00 11.00  ? 21  ASP B C    1  
ATOM   5308   O  O    . ASP B 1 18  ? 14.456  48.711 74.811 1.00 11.24  ? 21  ASP B O    1  
ATOM   5309   C  CB   . ASP B 1 18  ? 16.146  51.062 75.774 1.00 11.49  ? 21  ASP B CB   1  
ATOM   5310   C  CG   . ASP B 1 18  ? 16.321  52.477 76.328 1.00 12.77  ? 21  ASP B CG   1  
ATOM   5311   O  OD1  . ASP B 1 18  ? 15.952  53.412 75.636 1.00 12.68  ? 21  ASP B OD1  1  
ATOM   5312   O  OD2  . ASP B 1 18  ? 16.821  52.602 77.433 1.00 17.86  ? 21  ASP B OD2  1  
ATOM   5313   H  H    . ASP B 1 18  ? 13.478  50.998 76.319 1.00 0.00   ? 21  ASP B H    1  
ATOM   5314   H  HA   . ASP B 1 18  ? 15.194  51.762 73.985 1.00 0.00   ? 21  ASP B HA   1  
ATOM   5315   H  HB2  . ASP B 1 18  ? 15.926  50.382 76.584 1.00 0.00   ? 21  ASP B HB2  1  
ATOM   5316   H  HB3  . ASP B 1 18  ? 17.058  50.754 75.284 1.00 0.00   ? 21  ASP B HB3  1  
ATOM   5317   N  N    . PRO B 1 19  ? 15.263  49.480 72.901 1.00 10.18  ? 22  PRO B N    1  
ATOM   5318   C  CA   . PRO B 1 19  ? 15.206  48.155 72.228 1.00 9.73   ? 22  PRO B CA   1  
ATOM   5319   C  C    . PRO B 1 19  ? 15.715  47.036 73.150 1.00 9.58   ? 22  PRO B C    1  
ATOM   5320   O  O    . PRO B 1 19  ? 16.469  47.281 74.071 1.00 9.96   ? 22  PRO B O    1  
ATOM   5321   C  CB   . PRO B 1 19  ? 16.129  48.329 71.023 1.00 9.88   ? 22  PRO B CB   1  
ATOM   5322   C  CG   . PRO B 1 19  ? 16.105  49.792 70.709 1.00 11.34  ? 22  PRO B CG   1  
ATOM   5323   C  CD   . PRO B 1 19  ? 15.788  50.529 72.016 1.00 9.93   ? 22  PRO B CD   1  
ATOM   5324   H  HA   . PRO B 1 19  ? 14.203  47.944 71.893 1.00 0.00   ? 22  PRO B HA   1  
ATOM   5325   H  HB2  . PRO B 1 19  ? 17.133  48.013 71.274 1.00 0.00   ? 22  PRO B HB2  1  
ATOM   5326   H  HB3  . PRO B 1 19  ? 15.758  47.765 70.181 1.00 0.00   ? 22  PRO B HB3  1  
ATOM   5327   H  HG2  . PRO B 1 19  ? 17.069  50.102 70.331 1.00 0.00   ? 22  PRO B HG2  1  
ATOM   5328   H  HG3  . PRO B 1 19  ? 15.337  50.000 69.981 1.00 0.00   ? 22  PRO B HG3  1  
ATOM   5329   H  HD2  . PRO B 1 19  ? 16.687  50.964 72.431 1.00 0.00   ? 22  PRO B HD2  1  
ATOM   5330   H  HD3  . PRO B 1 19  ? 15.039  51.287 71.851 1.00 0.00   ? 22  PRO B HD3  1  
ATOM   5331   N  N    . PRO B 1 20  ? 15.302  45.821 72.907 1.00 9.21   ? 23  PRO B N    1  
ATOM   5332   C  CA   . PRO B 1 20  ? 14.375  45.485 71.784 1.00 9.69   ? 23  PRO B CA   1  
ATOM   5333   C  C    . PRO B 1 20  ? 12.894  45.747 72.115 1.00 9.67   ? 23  PRO B C    1  
ATOM   5334   O  O    . PRO B 1 20  ? 12.019  45.484 71.315 1.00 9.93   ? 23  PRO B O    1  
ATOM   5335   C  CB   . PRO B 1 20  ? 14.614  43.991 71.577 1.00 10.12  ? 23  PRO B CB   1  
ATOM   5336   C  CG   . PRO B 1 20  ? 15.023  43.465 72.916 1.00 10.37  ? 23  PRO B CG   1  
ATOM   5337   C  CD   . PRO B 1 20  ? 15.677  44.625 73.677 1.00 10.30  ? 23  PRO B CD   1  
ATOM   5338   H  HA   . PRO B 1 20  ? 14.659  46.018 70.893 1.00 0.00   ? 23  PRO B HA   1  
ATOM   5339   H  HB2  . PRO B 1 20  ? 13.704  43.510 71.245 1.00 0.00   ? 23  PRO B HB2  1  
ATOM   5340   H  HB3  . PRO B 1 20  ? 15.406  43.833 70.862 1.00 0.00   ? 23  PRO B HB3  1  
ATOM   5341   H  HG2  . PRO B 1 20  ? 14.153  43.112 73.453 1.00 0.00   ? 23  PRO B HG2  1  
ATOM   5342   H  HG3  . PRO B 1 20  ? 15.735  42.664 72.797 1.00 0.00   ? 23  PRO B HG3  1  
ATOM   5343   H  HD2  . PRO B 1 20  ? 15.288  44.683 74.684 1.00 0.00   ? 23  PRO B HD2  1  
ATOM   5344   H  HD3  . PRO B 1 20  ? 16.750  44.513 73.690 1.00 0.00   ? 23  PRO B HD3  1  
ATOM   5345   N  N    . PHE B 1 21  ? 12.607  46.258 73.282 1.00 9.73   ? 24  PHE B N    1  
ATOM   5346   C  CA   . PHE B 1 21  ? 11.201  46.528 73.654 1.00 10.73  ? 24  PHE B CA   1  
ATOM   5347   C  C    . PHE B 1 21  ? 10.646  47.660 72.791 1.00 10.46  ? 24  PHE B C    1  
ATOM   5348   O  O    . PHE B 1 21  ? 11.368  48.377 72.128 1.00 10.32  ? 24  PHE B O    1  
ATOM   5349   C  CB   . PHE B 1 21  ? 11.133  46.932 75.128 1.00 11.30  ? 24  PHE B CB   1  
ATOM   5350   C  CG   . PHE B 1 21  ? 11.651  45.802 75.984 1.00 13.92  ? 24  PHE B CG   1  
ATOM   5351   C  CD1  . PHE B 1 21  ? 10.864  44.661 76.189 1.00 17.02  ? 24  PHE B CD1  1  
ATOM   5352   C  CD2  . PHE B 1 21  ? 12.917  45.893 76.574 1.00 15.99  ? 24  PHE B CD2  1  
ATOM   5353   C  CE1  . PHE B 1 21  ? 11.344  43.613 76.983 1.00 18.38  ? 24  PHE B CE1  1  
ATOM   5354   C  CE2  . PHE B 1 21  ? 13.397  44.845 77.368 1.00 17.75  ? 24  PHE B CE2  1  
ATOM   5355   C  CZ   . PHE B 1 21  ? 12.611  43.705 77.573 1.00 19.22  ? 24  PHE B CZ   1  
ATOM   5356   H  H    . PHE B 1 21  ? 13.327  46.462 73.915 1.00 0.00   ? 24  PHE B H    1  
ATOM   5357   H  HA   . PHE B 1 21  ? 10.611  45.637 73.500 1.00 0.00   ? 24  PHE B HA   1  
ATOM   5358   H  HB2  . PHE B 1 21  ? 11.739  47.812 75.288 1.00 0.00   ? 24  PHE B HB2  1  
ATOM   5359   H  HB3  . PHE B 1 21  ? 10.109  47.146 75.396 1.00 0.00   ? 24  PHE B HB3  1  
ATOM   5360   H  HD1  . PHE B 1 21  ? 9.887   44.591 75.734 1.00 0.00   ? 24  PHE B HD1  1  
ATOM   5361   H  HD2  . PHE B 1 21  ? 13.524  46.773 76.417 1.00 0.00   ? 24  PHE B HD2  1  
ATOM   5362   H  HE1  . PHE B 1 21  ? 10.738  42.734 77.140 1.00 0.00   ? 24  PHE B HE1  1  
ATOM   5363   H  HE2  . PHE B 1 21  ? 14.374  44.916 77.823 1.00 0.00   ? 24  PHE B HE2  1  
ATOM   5364   H  HZ   . PHE B 1 21  ? 12.981  42.896 78.185 1.00 0.00   ? 24  PHE B HZ   1  
ATOM   5365   N  N    . VAL B 1 22  ? 9.361   47.810 72.811 1.00 11.03  ? 25  VAL B N    1  
ATOM   5366   C  CA   . VAL B 1 22  ? 8.692   48.865 72.027 1.00 11.71  ? 25  VAL B CA   1  
ATOM   5367   C  C    . VAL B 1 22  ? 7.701   49.564 72.947 1.00 11.68  ? 25  VAL B C    1  
ATOM   5368   O  O    . VAL B 1 22  ? 7.093   48.959 73.807 1.00 12.51  ? 25  VAL B O    1  
ATOM   5369   C  CB   . VAL B 1 22  ? 7.949   48.239 70.845 1.00 11.48  ? 25  VAL B CB   1  
ATOM   5370   C  CG1  . VAL B 1 22  ? 7.234   49.335 70.052 1.00 13.14  ? 25  VAL B CG1  1  
ATOM   5371   C  CG2  . VAL B 1 22  ? 8.950   47.524 69.935 1.00 11.71  ? 25  VAL B CG2  1  
ATOM   5372   H  H    . VAL B 1 22  ? 8.819   47.208 73.363 1.00 0.00   ? 25  VAL B H    1  
ATOM   5373   H  HA   . VAL B 1 22  ? 9.423   49.574 71.668 1.00 0.00   ? 25  VAL B HA   1  
ATOM   5374   H  HB   . VAL B 1 22  ? 7.222   47.529 71.212 1.00 0.00   ? 25  VAL B HB   1  
ATOM   5375   H  HG11 . VAL B 1 22  ? 7.907   49.739 69.310 1.00 0.00   ? 25  VAL B HG11 1  
ATOM   5376   H  HG12 . VAL B 1 22  ? 6.925   50.122 70.724 1.00 0.00   ? 25  VAL B HG12 1  
ATOM   5377   H  HG13 . VAL B 1 22  ? 6.367   48.918 69.563 1.00 0.00   ? 25  VAL B HG13 1  
ATOM   5378   H  HG21 . VAL B 1 22  ? 9.132   46.528 70.311 1.00 0.00   ? 25  VAL B HG21 1  
ATOM   5379   H  HG22 . VAL B 1 22  ? 9.878   48.077 69.917 1.00 0.00   ? 25  VAL B HG22 1  
ATOM   5380   H  HG23 . VAL B 1 22  ? 8.548   47.463 68.934 1.00 0.00   ? 25  VAL B HG23 1  
ATOM   5381   N  N    . HIS B 1 23  ? 7.559   50.833 72.787 1.00 11.85  ? 26  HIS B N    1  
ATOM   5382   C  CA   . HIS B 1 23  ? 6.642   51.610 73.650 1.00 12.23  ? 26  HIS B CA   1  
ATOM   5383   C  C    . HIS B 1 23  ? 5.218   51.104 73.488 1.00 13.22  ? 26  HIS B C    1  
ATOM   5384   O  O    . HIS B 1 23  ? 4.869   50.464 72.516 1.00 12.69  ? 26  HIS B O    1  
ATOM   5385   C  CB   . HIS B 1 23  ? 6.704   53.087 73.257 1.00 12.57  ? 26  HIS B CB   1  
ATOM   5386   C  CG   . HIS B 1 23  ? 6.068   53.274 71.908 1.00 12.45  ? 26  HIS B CG   1  
ATOM   5387   N  ND1  . HIS B 1 23  ? 6.787   53.147 70.727 1.00 14.66  ? 26  HIS B ND1  1  
ATOM   5388   C  CD2  . HIS B 1 23  ? 4.782   53.580 71.534 1.00 9.67   ? 26  HIS B CD2  1  
ATOM   5389   C  CE1  . HIS B 1 23  ? 5.936   53.373 69.708 1.00 9.66   ? 26  HIS B CE1  1  
ATOM   5390   N  NE2  . HIS B 1 23  ? 4.705   53.641 70.147 1.00 14.54  ? 26  HIS B NE2  1  
ATOM   5391   H  H    . HIS B 1 23  ? 8.079   51.294 72.096 1.00 0.00   ? 26  HIS B H    1  
ATOM   5392   H  HA   . HIS B 1 23  ? 6.945   51.503 74.681 1.00 0.00   ? 26  HIS B HA   1  
ATOM   5393   H  HB2  . HIS B 1 23  ? 6.174   53.677 73.991 1.00 0.00   ? 26  HIS B HB2  1  
ATOM   5394   H  HB3  . HIS B 1 23  ? 7.735   53.405 73.216 1.00 0.00   ? 26  HIS B HB3  1  
ATOM   5395   H  HD1  . HIS B 1 23  ? 7.739   52.931 70.649 1.00 0.00   ? 26  HIS B HD1  1  
ATOM   5396   H  HD2  . HIS B 1 23  ? 3.959   53.747 72.212 1.00 0.00   ? 26  HIS B HD2  1  
ATOM   5397   H  HE1  . HIS B 1 23  ? 6.215   53.341 68.665 1.00 0.00   ? 26  HIS B HE1  1  
ATOM   5398   H  HE2  . HIS B 1 23  ? 3.913   53.839 69.606 1.00 0.00   ? 26  HIS B HE2  1  
ATOM   5399   N  N    . ALA B 1 24  ? 4.398   51.400 74.443 1.00 14.84  ? 27  ALA B N    1  
ATOM   5400   C  CA   . ALA B 1 24  ? 2.984   50.967 74.392 1.00 14.77  ? 27  ALA B CA   1  
ATOM   5401   C  C    . ALA B 1 24  ? 2.294   51.618 73.198 1.00 13.93  ? 27  ALA B C    1  
ATOM   5402   O  O    . ALA B 1 24  ? 2.504   52.774 72.885 1.00 14.32  ? 27  ALA B O    1  
ATOM   5403   C  CB   . ALA B 1 24  ? 2.276   51.386 75.682 1.00 16.49  ? 27  ALA B CB   1  
ATOM   5404   H  H    . ALA B 1 24  ? 4.717   51.922 75.209 1.00 0.00   ? 27  ALA B H    1  
ATOM   5405   H  HA   . ALA B 1 24  ? 2.940   49.893 74.292 1.00 0.00   ? 27  ALA B HA   1  
ATOM   5406   H  HB1  . ALA B 1 24  ? 1.600   52.202 75.473 1.00 0.00   ? 27  ALA B HB1  1  
ATOM   5407   H  HB2  . ALA B 1 24  ? 3.009   51.703 76.409 1.00 0.00   ? 27  ALA B HB2  1  
ATOM   5408   H  HB3  . ALA B 1 24  ? 1.718   50.549 76.075 1.00 0.00   ? 27  ALA B HB3  1  
ATOM   5409   N  N    . HIS B 1 25  ? 1.473   50.869 72.541 1.00 13.27  ? 28  HIS B N    1  
ATOM   5410   C  CA   . HIS B 1 25  ? 0.734   51.376 71.359 1.00 13.39  ? 28  HIS B CA   1  
ATOM   5411   C  C    . HIS B 1 25  ? -0.377  50.375 71.024 1.00 13.79  ? 28  HIS B C    1  
ATOM   5412   O  O    . HIS B 1 25  ? -0.330  49.227 71.418 1.00 15.28  ? 28  HIS B O    1  
ATOM   5413   C  CB   . HIS B 1 25  ? 1.688   51.505 70.170 1.00 12.89  ? 28  HIS B CB   1  
ATOM   5414   C  CG   . HIS B 1 25  ? 2.193   50.142 69.782 1.00 13.27  ? 28  HIS B CG   1  
ATOM   5415   N  ND1  . HIS B 1 25  ? 3.327   49.582 70.355 1.00 13.18  ? 28  HIS B ND1  1  
ATOM   5416   C  CD2  . HIS B 1 25  ? 1.730   49.214 68.881 1.00 13.08  ? 28  HIS B CD2  1  
ATOM   5417   C  CE1  . HIS B 1 25  ? 3.506   48.370 69.798 1.00 14.63  ? 28  HIS B CE1  1  
ATOM   5418   N  NE2  . HIS B 1 25  ? 2.562   48.100 68.896 1.00 14.12  ? 28  HIS B NE2  1  
ATOM   5419   H  H    . HIS B 1 25  ? 1.334   49.943 72.830 1.00 0.00   ? 28  HIS B H    1  
ATOM   5420   H  HA   . HIS B 1 25  ? 0.300   52.339 71.586 1.00 0.00   ? 28  HIS B HA   1  
ATOM   5421   H  HB2  . HIS B 1 25  ? 1.164   51.946 69.334 1.00 0.00   ? 28  HIS B HB2  1  
ATOM   5422   H  HB3  . HIS B 1 25  ? 2.523   52.132 70.444 1.00 0.00   ? 28  HIS B HB3  1  
ATOM   5423   H  HD1  . HIS B 1 25  ? 3.893   49.994 71.041 1.00 0.00   ? 28  HIS B HD1  1  
ATOM   5424   H  HD2  . HIS B 1 25  ? 0.856   49.331 68.258 1.00 0.00   ? 28  HIS B HD2  1  
ATOM   5425   H  HE1  . HIS B 1 25  ? 4.315   47.700 70.050 1.00 0.00   ? 28  HIS B HE1  1  
ATOM   5426   H  HE2  . HIS B 1 25  ? 2.473   47.287 68.356 1.00 0.00   ? 28  HIS B HE2  1  
ATOM   5427   N  N    . SER B 1 26  ? -1.377  50.802 70.312 1.00 14.78  ? 29  SER B N    1  
ATOM   5428   C  CA   . SER B 1 26  ? -2.492  49.892 69.961 1.00 15.19  ? 29  SER B CA   1  
ATOM   5429   C  C    . SER B 1 26  ? -2.356  49.504 68.498 1.00 14.07  ? 29  SER B C    1  
ATOM   5430   O  O    . SER B 1 26  ? -2.027  50.316 67.656 1.00 14.31  ? 29  SER B O    1  
ATOM   5431   C  CB   . SER B 1 26  ? -3.826  50.604 70.183 1.00 16.52  ? 29  SER B CB   1  
ATOM   5432   O  OG   . SER B 1 26  ? -3.889  51.754 69.349 1.00 22.58  ? 29  SER B OG   1  
ATOM   5433   H  H    . SER B 1 26  ? -1.397  51.735 70.012 1.00 0.00   ? 29  SER B H    1  
ATOM   5434   H  HA   . SER B 1 26  ? -2.446  49.006 70.577 1.00 0.00   ? 29  SER B HA   1  
ATOM   5435   H  HB2  . SER B 1 26  ? -4.637  49.940 69.933 1.00 0.00   ? 29  SER B HB2  1  
ATOM   5436   H  HB3  . SER B 1 26  ? -3.910  50.895 71.222 1.00 0.00   ? 29  SER B HB3  1  
ATOM   5437   H  HG   . SER B 1 26  ? -4.814  51.984 69.230 1.00 0.00   ? 29  SER B HG   1  
ATOM   5438   N  N    . GLN B 1 27  ? -2.593  48.271 68.189 1.00 12.52  ? 30  GLN B N    1  
ATOM   5439   C  CA   . GLN B 1 27  ? -2.461  47.829 66.774 1.00 12.11  ? 30  GLN B CA   1  
ATOM   5440   C  C    . GLN B 1 27  ? -3.468  48.615 65.967 1.00 13.15  ? 30  GLN B C    1  
ATOM   5441   O  O    . GLN B 1 27  ? -3.132  49.386 65.090 1.00 13.23  ? 30  GLN B O    1  
ATOM   5442   C  CB   . GLN B 1 27  ? -2.761  46.332 66.666 1.00 11.96  ? 30  GLN B CB   1  
ATOM   5443   C  CG   . GLN B 1 27  ? -1.557  45.532 67.165 1.00 11.80  ? 30  GLN B CG   1  
ATOM   5444   C  CD   . GLN B 1 27  ? -1.948  44.061 67.316 1.00 11.97  ? 30  GLN B CD   1  
ATOM   5445   O  OE1  . GLN B 1 27  ? -2.501  43.471 66.409 1.00 12.83  ? 30  GLN B OE1  1  
ATOM   5446   N  NE2  . GLN B 1 27  ? -1.682  43.438 68.431 1.00 12.08  ? 30  GLN B NE2  1  
ATOM   5447   H  H    . GLN B 1 27  ? -2.848  47.629 68.884 1.00 0.00   ? 30  GLN B H    1  
ATOM   5448   H  HA   . GLN B 1 27  ? -1.462  48.033 66.416 1.00 0.00   ? 30  GLN B HA   1  
ATOM   5449   H  HB2  . GLN B 1 27  ? -3.627  46.095 67.267 1.00 0.00   ? 30  GLN B HB2  1  
ATOM   5450   H  HB3  . GLN B 1 27  ? -2.958  46.077 65.635 1.00 0.00   ? 30  GLN B HB3  1  
ATOM   5451   H  HG2  . GLN B 1 27  ? -0.747  45.620 66.455 1.00 0.00   ? 30  GLN B HG2  1  
ATOM   5452   H  HG3  . GLN B 1 27  ? -1.240  45.918 68.122 1.00 0.00   ? 30  GLN B HG3  1  
ATOM   5453   H  HE21 . GLN B 1 27  ? -1.235  43.913 69.163 1.00 0.00   ? 30  GLN B HE21 1  
ATOM   5454   H  HE22 . GLN B 1 27  ? -1.928  42.496 68.537 1.00 0.00   ? 30  GLN B HE22 1  
ATOM   5455   N  N    . VAL B 1 28  ? -4.704  48.454 66.302 1.00 14.35  ? 31  VAL B N    1  
ATOM   5456   C  CA   . VAL B 1 28  ? -5.772  49.221 65.612 1.00 16.12  ? 31  VAL B CA   1  
ATOM   5457   C  C    . VAL B 1 28  ? -5.731  50.658 66.140 1.00 16.96  ? 31  VAL B C    1  
ATOM   5458   O  O    . VAL B 1 28  ? -5.630  50.891 67.328 1.00 18.52  ? 31  VAL B O    1  
ATOM   5459   C  CB   . VAL B 1 28  ? -7.136  48.597 65.916 1.00 16.13  ? 31  VAL B CB   1  
ATOM   5460   C  CG1  . VAL B 1 28  ? -8.236  49.422 65.246 1.00 17.74  ? 31  VAL B CG1  1  
ATOM   5461   C  CG2  . VAL B 1 28  ? -7.172  47.166 65.374 1.00 15.96  ? 31  VAL B CG2  1  
ATOM   5462   H  H    . VAL B 1 28  ? -4.935  47.851 67.039 1.00 0.00   ? 31  VAL B H    1  
ATOM   5463   H  HA   . VAL B 1 28  ? -5.595  49.218 64.546 1.00 0.00   ? 31  VAL B HA   1  
ATOM   5464   H  HB   . VAL B 1 28  ? -7.295  48.584 66.984 1.00 0.00   ? 31  VAL B HB   1  
ATOM   5465   H  HG11 . VAL B 1 28  ? -8.146  50.455 65.549 1.00 0.00   ? 31  VAL B HG11 1  
ATOM   5466   H  HG12 . VAL B 1 28  ? -9.202  49.042 65.544 1.00 0.00   ? 31  VAL B HG12 1  
ATOM   5467   H  HG13 . VAL B 1 28  ? -8.136  49.351 64.173 1.00 0.00   ? 31  VAL B HG13 1  
ATOM   5468   H  HG21 . VAL B 1 28  ? -7.959  46.615 65.867 1.00 0.00   ? 31  VAL B HG21 1  
ATOM   5469   H  HG22 . VAL B 1 28  ? -6.224  46.685 65.563 1.00 0.00   ? 31  VAL B HG22 1  
ATOM   5470   H  HG23 . VAL B 1 28  ? -7.359  47.188 64.311 1.00 0.00   ? 31  VAL B HG23 1  
ATOM   5471   N  N    . ALA B 1 29  ? -5.780  51.618 65.267 1.00 18.23  ? 32  ALA B N    1  
ATOM   5472   C  CA   . ALA B 1 29  ? -5.713  53.040 65.700 1.00 20.20  ? 32  ALA B CA   1  
ATOM   5473   C  C    . ALA B 1 29  ? -6.941  53.404 66.530 1.00 22.69  ? 32  ALA B C    1  
ATOM   5474   O  O    . ALA B 1 29  ? -8.059  53.065 66.198 1.00 22.80  ? 32  ALA B O    1  
ATOM   5475   C  CB   . ALA B 1 29  ? -5.652  53.941 64.466 1.00 19.88  ? 32  ALA B CB   1  
ATOM   5476   H  H    . ALA B 1 29  ? -5.841  51.404 64.313 1.00 0.00   ? 32  ALA B H    1  
ATOM   5477   H  HA   . ALA B 1 29  ? -4.824  53.190 66.293 1.00 0.00   ? 32  ALA B HA   1  
ATOM   5478   H  HB1  . ALA B 1 29  ? -5.633  53.332 63.575 1.00 0.00   ? 32  ALA B HB1  1  
ATOM   5479   H  HB2  . ALA B 1 29  ? -4.758  54.547 64.507 1.00 0.00   ? 32  ALA B HB2  1  
ATOM   5480   H  HB3  . ALA B 1 29  ? -6.521  54.583 64.445 1.00 0.00   ? 32  ALA B HB3  1  
ATOM   5481   N  N    . GLU B 1 30  ? -6.732  54.111 67.603 1.00 25.26  ? 33  GLU B N    1  
ATOM   5482   C  CA   . GLU B 1 30  ? -7.871  54.531 68.466 1.00 27.29  ? 33  GLU B CA   1  
ATOM   5483   C  C    . GLU B 1 30  ? -8.168  56.004 68.187 1.00 27.51  ? 33  GLU B C    1  
ATOM   5484   O  O    . GLU B 1 30  ? -7.438  56.884 68.599 1.00 28.71  ? 33  GLU B O    1  
ATOM   5485   C  CB   . GLU B 1 30  ? -7.495  54.350 69.938 1.00 28.43  ? 33  GLU B CB   1  
ATOM   5486   C  CG   . GLU B 1 30  ? -6.604  53.116 70.091 1.00 32.19  ? 33  GLU B CG   1  
ATOM   5487   C  CD   . GLU B 1 30  ? -6.535  52.715 71.566 1.00 36.40  ? 33  GLU B CD   1  
ATOM   5488   O  OE1  . GLU B 1 30  ? -5.726  53.288 72.277 1.00 39.39  ? 33  GLU B OE1  1  
ATOM   5489   O  OE2  . GLU B 1 30  ? -7.291  51.843 71.959 1.00 41.08  ? 33  GLU B OE2  1  
ATOM   5490   H  H    . GLU B 1 30  ? -5.819  54.380 67.838 1.00 0.00   ? 33  GLU B H    1  
ATOM   5491   H  HA   . GLU B 1 30  ? -8.741  53.934 68.235 1.00 0.00   ? 33  GLU B HA   1  
ATOM   5492   H  HB2  . GLU B 1 30  ? -6.963  55.225 70.283 1.00 0.00   ? 33  GLU B HB2  1  
ATOM   5493   H  HB3  . GLU B 1 30  ? -8.392  54.219 70.525 1.00 0.00   ? 33  GLU B HB3  1  
ATOM   5494   H  HG2  . GLU B 1 30  ? -7.018  52.301 69.514 1.00 0.00   ? 33  GLU B HG2  1  
ATOM   5495   H  HG3  . GLU B 1 30  ? -5.611  53.342 69.734 1.00 0.00   ? 33  GLU B HG3  1  
ATOM   5496   N  N    . GLY B 1 31  ? -9.219  56.277 67.470 1.00 27.32  ? 34  GLY B N    1  
ATOM   5497   C  CA   . GLY B 1 31  ? -9.550  57.693 67.137 1.00 26.80  ? 34  GLY B CA   1  
ATOM   5498   C  C    . GLY B 1 31  ? -9.007  58.023 65.739 1.00 26.04  ? 34  GLY B C    1  
ATOM   5499   O  O    . GLY B 1 31  ? -8.432  57.184 65.075 1.00 26.67  ? 34  GLY B O    1  
ATOM   5500   H  H    . GLY B 1 31  ? -9.783  55.550 67.133 1.00 0.00   ? 34  GLY B H    1  
ATOM   5501   H  HA2  . GLY B 1 31  ? -10.623 57.825 67.151 1.00 0.00   ? 34  GLY B HA2  1  
ATOM   5502   H  HA3  . GLY B 1 31  ? -9.096  58.351 67.861 1.00 0.00   ? 34  GLY B HA3  1  
ATOM   5503   N  N    . GLY B 1 32  ? -9.184  59.238 65.288 1.00 24.45  ? 35  GLY B N    1  
ATOM   5504   C  CA   . GLY B 1 32  ? -8.677  59.622 63.933 1.00 22.88  ? 35  GLY B CA   1  
ATOM   5505   C  C    . GLY B 1 32  ? -7.186  59.981 64.008 1.00 21.33  ? 35  GLY B C    1  
ATOM   5506   O  O    . GLY B 1 32  ? -6.501  59.630 64.947 1.00 20.75  ? 35  GLY B O    1  
ATOM   5507   H  H    . GLY B 1 32  ? -9.651  59.900 65.840 1.00 0.00   ? 35  GLY B H    1  
ATOM   5508   H  HA2  . GLY B 1 32  ? -8.813  58.793 63.253 1.00 0.00   ? 35  GLY B HA2  1  
ATOM   5509   H  HA3  . GLY B 1 32  ? -9.231  60.475 63.573 1.00 0.00   ? 35  GLY B HA3  1  
ATOM   5510   N  N    . PRO B 1 33  ? -6.692  60.674 63.009 1.00 20.48  ? 36  PRO B N    1  
ATOM   5511   C  CA   . PRO B 1 33  ? -5.260  61.090 62.936 1.00 19.50  ? 36  PRO B CA   1  
ATOM   5512   C  C    . PRO B 1 33  ? -4.831  61.950 64.129 1.00 18.79  ? 36  PRO B C    1  
ATOM   5513   O  O    . PRO B 1 33  ? -5.563  62.803 64.591 1.00 18.25  ? 36  PRO B O    1  
ATOM   5514   C  CB   . PRO B 1 33  ? -5.169  61.903 61.639 1.00 20.00  ? 36  PRO B CB   1  
ATOM   5515   C  CG   . PRO B 1 33  ? -6.376  61.535 60.840 1.00 21.59  ? 36  PRO B CG   1  
ATOM   5516   C  CD   . PRO B 1 33  ? -7.455  61.131 61.841 1.00 20.95  ? 36  PRO B CD   1  
ATOM   5517   H  HA   . PRO B 1 33  ? -4.626  60.223 62.857 1.00 0.00   ? 36  PRO B HA   1  
ATOM   5518   H  HB2  . PRO B 1 33  ? -5.175  62.961 61.863 1.00 0.00   ? 36  PRO B HB2  1  
ATOM   5519   H  HB3  . PRO B 1 33  ? -4.274  61.641 61.096 1.00 0.00   ? 36  PRO B HB3  1  
ATOM   5520   H  HG2  . PRO B 1 33  ? -6.705  62.385 60.257 1.00 0.00   ? 36  PRO B HG2  1  
ATOM   5521   H  HG3  . PRO B 1 33  ? -6.152  60.703 60.192 1.00 0.00   ? 36  PRO B HG3  1  
ATOM   5522   H  HD2  . PRO B 1 33  ? -8.073  61.982 62.095 1.00 0.00   ? 36  PRO B HD2  1  
ATOM   5523   H  HD3  . PRO B 1 33  ? -8.056  60.326 61.449 1.00 0.00   ? 36  PRO B HD3  1  
ATOM   5524   N  N    . LYS B 1 34  ? -3.641  61.735 64.619 1.00 18.10  ? 37  LYS B N    1  
ATOM   5525   C  CA   . LYS B 1 34  ? -3.140  62.541 65.776 1.00 18.19  ? 37  LYS B CA   1  
ATOM   5526   C  C    . LYS B 1 34  ? -1.619  62.800 65.652 1.00 16.60  ? 37  LYS B C    1  
ATOM   5527   O  O    . LYS B 1 34  ? -0.853  61.933 65.283 1.00 15.43  ? 37  LYS B O    1  
ATOM   5528   C  CB   . LYS B 1 34  ? -3.416  61.781 67.075 1.00 19.79  ? 37  LYS B CB   1  
ATOM   5529   C  CG   . LYS B 1 34  ? -4.882  61.344 67.110 1.00 24.19  ? 37  LYS B CG   1  
ATOM   5530   C  CD   . LYS B 1 34  ? -5.220  60.799 68.498 1.00 29.17  ? 37  LYS B CD   1  
ATOM   5531   C  CE   . LYS B 1 34  ? -4.338  59.586 68.799 1.00 31.56  ? 37  LYS B CE   1  
ATOM   5532   N  NZ   . LYS B 1 34  ? -5.157  58.343 68.718 1.00 34.46  ? 37  LYS B NZ   1  
ATOM   5533   H  H    . LYS B 1 34  ? -3.068  61.046 64.221 1.00 0.00   ? 37  LYS B H    1  
ATOM   5534   H  HA   . LYS B 1 34  ? -3.660  63.487 65.801 1.00 0.00   ? 37  LYS B HA   1  
ATOM   5535   H  HB2  . LYS B 1 34  ? -2.778  60.910 67.125 1.00 0.00   ? 37  LYS B HB2  1  
ATOM   5536   H  HB3  . LYS B 1 34  ? -3.215  62.425 67.918 1.00 0.00   ? 37  LYS B HB3  1  
ATOM   5537   H  HG2  . LYS B 1 34  ? -5.515  62.192 66.891 1.00 0.00   ? 37  LYS B HG2  1  
ATOM   5538   H  HG3  . LYS B 1 34  ? -5.045  60.573 66.372 1.00 0.00   ? 37  LYS B HG3  1  
ATOM   5539   H  HD2  . LYS B 1 34  ? -5.044  61.566 69.239 1.00 0.00   ? 37  LYS B HD2  1  
ATOM   5540   H  HD3  . LYS B 1 34  ? -6.258  60.502 68.526 1.00 0.00   ? 37  LYS B HD3  1  
ATOM   5541   H  HE2  . LYS B 1 34  ? -3.536  59.536 68.078 1.00 0.00   ? 37  LYS B HE2  1  
ATOM   5542   H  HE3  . LYS B 1 34  ? -3.923  59.680 69.792 1.00 0.00   ? 37  LYS B HE3  1  
ATOM   5543   H  HZ1  . LYS B 1 34  ? -4.631  57.553 69.141 1.00 0.00   ? 37  LYS B HZ1  1  
ATOM   5544   H  HZ2  . LYS B 1 34  ? -5.362  58.127 67.723 1.00 0.00   ? 37  LYS B HZ2  1  
ATOM   5545   H  HZ3  . LYS B 1 34  ? -6.049  58.483 69.235 1.00 0.00   ? 37  LYS B HZ3  1  
ATOM   5546   N  N    . VAL B 1 35  ? -1.196  63.997 65.987 1.00 14.86  ? 38  VAL B N    1  
ATOM   5547   C  CA   . VAL B 1 35  ? 0.236   64.373 65.939 1.00 14.93  ? 38  VAL B CA   1  
ATOM   5548   C  C    . VAL B 1 35  ? 0.942   63.718 67.117 1.00 14.57  ? 38  VAL B C    1  
ATOM   5549   O  O    . VAL B 1 35  ? 0.773   64.084 68.263 1.00 15.70  ? 38  VAL B O    1  
ATOM   5550   C  CB   . VAL B 1 35  ? 0.373   65.894 66.038 1.00 14.81  ? 38  VAL B CB   1  
ATOM   5551   C  CG1  . VAL B 1 35  ? 1.808   66.254 66.425 1.00 15.54  ? 38  VAL B CG1  1  
ATOM   5552   C  CG2  . VAL B 1 35  ? 0.039   66.523 64.684 1.00 15.91  ? 38  VAL B CG2  1  
ATOM   5553   H  H    . VAL B 1 35  ? -1.849  64.660 66.294 1.00 0.00   ? 38  VAL B H    1  
ATOM   5554   H  HA   . VAL B 1 35  ? 0.673   64.027 65.014 1.00 0.00   ? 38  VAL B HA   1  
ATOM   5555   H  HB   . VAL B 1 35  ? -0.307  66.268 66.789 1.00 0.00   ? 38  VAL B HB   1  
ATOM   5556   H  HG11 . VAL B 1 35  ? 2.169   65.552 67.162 1.00 0.00   ? 38  VAL B HG11 1  
ATOM   5557   H  HG12 . VAL B 1 35  ? 1.831   67.252 66.837 1.00 0.00   ? 38  VAL B HG12 1  
ATOM   5558   H  HG13 . VAL B 1 35  ? 2.439   66.212 65.549 1.00 0.00   ? 38  VAL B HG13 1  
ATOM   5559   H  HG21 . VAL B 1 35  ? 0.679   66.102 63.923 1.00 0.00   ? 38  VAL B HG21 1  
ATOM   5560   H  HG22 . VAL B 1 35  ? 0.194   67.591 64.735 1.00 0.00   ? 38  VAL B HG22 1  
ATOM   5561   H  HG23 . VAL B 1 35  ? -0.994  66.322 64.438 1.00 0.00   ? 38  VAL B HG23 1  
ATOM   5562   N  N    . VAL B 1 36  ? 1.704   62.734 66.815 1.00 14.15  ? 39  VAL B N    1  
ATOM   5563   C  CA   . VAL B 1 36  ? 2.434   61.970 67.821 1.00 13.39  ? 39  VAL B CA   1  
ATOM   5564   C  C    . VAL B 1 36  ? 3.690   62.723 68.094 1.00 13.36  ? 39  VAL B C    1  
ATOM   5565   O  O    . VAL B 1 36  ? 4.337   63.241 67.206 1.00 13.81  ? 39  VAL B O    1  
ATOM   5566   C  CB   . VAL B 1 36  ? 2.765   60.577 67.285 1.00 13.80  ? 39  VAL B CB   1  
ATOM   5567   C  CG1  . VAL B 1 36  ? 2.819   59.582 68.446 1.00 14.24  ? 39  VAL B CG1  1  
ATOM   5568   C  CG2  . VAL B 1 36  ? 1.682   60.143 66.294 1.00 14.28  ? 39  VAL B CG2  1  
ATOM   5569   H  H    . VAL B 1 36  ? 1.785   62.472 65.874 1.00 0.00   ? 39  VAL B H    1  
ATOM   5570   H  HA   . VAL B 1 36  ? 1.847   61.891 68.724 1.00 0.00   ? 39  VAL B HA   1  
ATOM   5571   H  HB   . VAL B 1 36  ? 3.723   60.601 66.787 1.00 0.00   ? 39  VAL B HB   1  
ATOM   5572   H  HG11 . VAL B 1 36  ? 3.113   58.611 68.075 1.00 0.00   ? 39  VAL B HG11 1  
ATOM   5573   H  HG12 . VAL B 1 36  ? 1.844   59.511 68.905 1.00 0.00   ? 39  VAL B HG12 1  
ATOM   5574   H  HG13 . VAL B 1 36  ? 3.537   59.921 69.177 1.00 0.00   ? 39  VAL B HG13 1  
ATOM   5575   H  HG21 . VAL B 1 36  ? 1.786   59.089 66.085 1.00 0.00   ? 39  VAL B HG21 1  
ATOM   5576   H  HG22 . VAL B 1 36  ? 1.788   60.704 65.377 1.00 0.00   ? 39  VAL B HG22 1  
ATOM   5577   H  HG23 . VAL B 1 36  ? 0.708   60.332 66.720 1.00 0.00   ? 39  VAL B HG23 1  
ATOM   5578   N  N    . GLU B 1 37  ? 4.013   62.833 69.308 1.00 13.38  ? 40  GLU B N    1  
ATOM   5579   C  CA   . GLU B 1 37  ? 5.222   63.617 69.670 1.00 14.28  ? 40  GLU B CA   1  
ATOM   5580   C  C    . GLU B 1 37  ? 6.265   62.734 70.342 1.00 13.85  ? 40  GLU B C    1  
ATOM   5581   O  O    . GLU B 1 37  ? 6.002   62.060 71.318 1.00 13.55  ? 40  GLU B O    1  
ATOM   5582   C  CB   . GLU B 1 37  ? 4.823   64.743 70.627 1.00 14.87  ? 40  GLU B CB   1  
ATOM   5583   C  CG   . GLU B 1 37  ? 3.902   65.726 69.903 1.00 17.92  ? 40  GLU B CG   1  
ATOM   5584   C  CD   . GLU B 1 37  ? 3.385   66.768 70.897 1.00 21.46  ? 40  GLU B CD   1  
ATOM   5585   O  OE1  . GLU B 1 37  ? 2.885   66.369 71.936 1.00 27.11  ? 40  GLU B OE1  1  
ATOM   5586   O  OE2  . GLU B 1 37  ? 3.497   67.946 70.602 1.00 26.93  ? 40  GLU B OE2  1  
ATOM   5587   H  H    . GLU B 1 37  ? 3.452   62.437 70.007 1.00 0.00   ? 40  GLU B H    1  
ATOM   5588   H  HA   . GLU B 1 37  ? 5.645   64.049 68.776 1.00 0.00   ? 40  GLU B HA   1  
ATOM   5589   H  HB2  . GLU B 1 37  ? 4.307   64.324 71.479 1.00 0.00   ? 40  GLU B HB2  1  
ATOM   5590   H  HB3  . GLU B 1 37  ? 5.709   65.262 70.961 1.00 0.00   ? 40  GLU B HB3  1  
ATOM   5591   H  HG2  . GLU B 1 37  ? 4.452   66.221 69.115 1.00 0.00   ? 40  GLU B HG2  1  
ATOM   5592   H  HG3  . GLU B 1 37  ? 3.066   65.191 69.478 1.00 0.00   ? 40  GLU B HG3  1  
ATOM   5593   N  N    . PHE B 1 38  ? 7.460   62.766 69.833 1.00 13.19  ? 41  PHE B N    1  
ATOM   5594   C  CA   . PHE B 1 38  ? 8.569   61.963 70.439 1.00 12.67  ? 41  PHE B CA   1  
ATOM   5595   C  C    . PHE B 1 38  ? 9.839   62.833 70.528 1.00 12.22  ? 41  PHE B C    1  
ATOM   5596   O  O    . PHE B 1 38  ? 10.135  63.597 69.630 1.00 12.78  ? 41  PHE B O    1  
ATOM   5597   C  CB   . PHE B 1 38  ? 8.850   60.739 69.564 1.00 12.93  ? 41  PHE B CB   1  
ATOM   5598   C  CG   . PHE B 1 38  ? 7.620   59.865 69.510 1.00 12.27  ? 41  PHE B CG   1  
ATOM   5599   C  CD1  . PHE B 1 38  ? 6.604   60.143 68.588 1.00 12.81  ? 41  PHE B CD1  1  
ATOM   5600   C  CD2  . PHE B 1 38  ? 7.496   58.777 70.381 1.00 13.88  ? 41  PHE B CD2  1  
ATOM   5601   C  CE1  . PHE B 1 38  ? 5.463   59.333 68.538 1.00 13.41  ? 41  PHE B CE1  1  
ATOM   5602   C  CE2  . PHE B 1 38  ? 6.355   57.967 70.331 1.00 13.52  ? 41  PHE B CE2  1  
ATOM   5603   C  CZ   . PHE B 1 38  ? 5.339   58.245 69.410 1.00 12.93  ? 41  PHE B CZ   1  
ATOM   5604   H  H    . PHE B 1 38  ? 7.642   63.339 69.059 1.00 0.00   ? 41  PHE B H    1  
ATOM   5605   H  HA   . PHE B 1 38  ? 8.282   61.641 71.430 1.00 0.00   ? 41  PHE B HA   1  
ATOM   5606   H  HB2  . PHE B 1 38  ? 9.107   61.062 68.565 1.00 0.00   ? 41  PHE B HB2  1  
ATOM   5607   H  HB3  . PHE B 1 38  ? 9.672   60.177 69.983 1.00 0.00   ? 41  PHE B HB3  1  
ATOM   5608   H  HD1  . PHE B 1 38  ? 6.700   60.983 67.916 1.00 0.00   ? 41  PHE B HD1  1  
ATOM   5609   H  HD2  . PHE B 1 38  ? 8.280   58.562 71.092 1.00 0.00   ? 41  PHE B HD2  1  
ATOM   5610   H  HE1  . PHE B 1 38  ? 4.679   59.548 67.827 1.00 0.00   ? 41  PHE B HE1  1  
ATOM   5611   H  HE2  . PHE B 1 38  ? 6.259   57.127 71.004 1.00 0.00   ? 41  PHE B HE2  1  
ATOM   5612   H  HZ   . PHE B 1 38  ? 4.459   57.620 69.371 1.00 0.00   ? 41  PHE B HZ   1  
ATOM   5613   N  N    . THR B 1 39  ? 10.591  62.731 71.602 1.00 12.16  ? 42  THR B N    1  
ATOM   5614   C  CA   . THR B 1 39  ? 11.824  63.557 71.729 1.00 12.56  ? 42  THR B CA   1  
ATOM   5615   C  C    . THR B 1 39  ? 13.019  62.646 72.009 1.00 12.53  ? 42  THR B C    1  
ATOM   5616   O  O    . THR B 1 39  ? 12.982  61.811 72.891 1.00 13.23  ? 42  THR B O    1  
ATOM   5617   C  CB   . THR B 1 39  ? 11.657  64.549 72.882 1.00 13.45  ? 42  THR B CB   1  
ATOM   5618   O  OG1  . THR B 1 39  ? 10.827  65.624 72.463 1.00 16.04  ? 42  THR B OG1  1  
ATOM   5619   C  CG2  . THR B 1 39  ? 13.026  65.090 73.295 1.00 14.94  ? 42  THR B CG2  1  
ATOM   5620   H  H    . THR B 1 39  ? 10.339  62.113 72.320 1.00 0.00   ? 42  THR B H    1  
ATOM   5621   H  HA   . THR B 1 39  ? 11.991  64.098 70.809 1.00 0.00   ? 42  THR B HA   1  
ATOM   5622   H  HB   . THR B 1 39  ? 11.202  64.050 73.724 1.00 0.00   ? 42  THR B HB   1  
ATOM   5623   H  HG1  . THR B 1 39  ? 10.789  66.265 73.177 1.00 0.00   ? 42  THR B HG1  1  
ATOM   5624   H  HG21 . THR B 1 39  ? 13.756  64.836 72.541 1.00 0.00   ? 42  THR B HG21 1  
ATOM   5625   H  HG22 . THR B 1 39  ? 13.317  64.651 74.239 1.00 0.00   ? 42  THR B HG22 1  
ATOM   5626   H  HG23 . THR B 1 39  ? 12.973  66.163 73.399 1.00 0.00   ? 42  THR B HG23 1  
ATOM   5627   N  N    . MET B 1 40  ? 14.078  62.799 71.265 1.00 12.11  ? 43  MET B N    1  
ATOM   5628   C  CA   . MET B 1 40  ? 15.277  61.938 71.489 1.00 12.20  ? 43  MET B CA   1  
ATOM   5629   C  C    . MET B 1 40  ? 16.566  62.782 71.503 1.00 11.77  ? 43  MET B C    1  
ATOM   5630   O  O    . MET B 1 40  ? 16.843  63.536 70.591 1.00 11.94  ? 43  MET B O    1  
ATOM   5631   C  CB   . MET B 1 40  ? 15.367  60.899 70.370 1.00 11.90  ? 43  MET B CB   1  
ATOM   5632   C  CG   . MET B 1 40  ? 14.158  59.965 70.441 1.00 12.52  ? 43  MET B CG   1  
ATOM   5633   S  SD   . MET B 1 40  ? 14.384  58.595 69.280 1.00 12.87  ? 43  MET B SD   1  
ATOM   5634   C  CE   . MET B 1 40  ? 14.996  59.576 67.888 1.00 13.51  ? 43  MET B CE   1  
ATOM   5635   H  H    . MET B 1 40  ? 14.087  63.478 70.558 1.00 0.00   ? 43  MET B H    1  
ATOM   5636   H  HA   . MET B 1 40  ? 15.177  61.429 72.436 1.00 0.00   ? 43  MET B HA   1  
ATOM   5637   H  HB2  . MET B 1 40  ? 15.380  61.401 69.413 1.00 0.00   ? 43  MET B HB2  1  
ATOM   5638   H  HB3  . MET B 1 40  ? 16.272  60.322 70.486 1.00 0.00   ? 43  MET B HB3  1  
ATOM   5639   H  HG2  . MET B 1 40  ? 14.062  59.576 71.443 1.00 0.00   ? 43  MET B HG2  1  
ATOM   5640   H  HG3  . MET B 1 40  ? 13.264  60.513 70.181 1.00 0.00   ? 43  MET B HG3  1  
ATOM   5641   H  HE1  . MET B 1 40  ? 14.816  59.041 66.965 1.00 0.00   ? 43  MET B HE1  1  
ATOM   5642   H  HE2  . MET B 1 40  ? 16.056  59.751 68.009 1.00 0.00   ? 43  MET B HE2  1  
ATOM   5643   H  HE3  . MET B 1 40  ? 14.479  60.522 67.858 1.00 0.00   ? 43  MET B HE3  1  
ATOM   5644   N  N    . VAL B 1 41  ? 17.361  62.626 72.531 1.00 12.45  ? 44  VAL B N    1  
ATOM   5645   C  CA   . VAL B 1 41  ? 18.636  63.356 72.642 1.00 11.91  ? 44  VAL B CA   1  
ATOM   5646   C  C    . VAL B 1 41  ? 19.716  62.426 72.123 1.00 11.62  ? 44  VAL B C    1  
ATOM   5647   O  O    . VAL B 1 41  ? 19.719  61.241 72.396 1.00 12.27  ? 44  VAL B O    1  
ATOM   5648   C  CB   . VAL B 1 41  ? 18.910  63.711 74.104 1.00 12.60  ? 44  VAL B CB   1  
ATOM   5649   C  CG1  . VAL B 1 41  ? 20.262  64.418 74.214 1.00 14.16  ? 44  VAL B CG1  1  
ATOM   5650   C  CG2  . VAL B 1 41  ? 17.807  64.639 74.617 1.00 14.73  ? 44  VAL B CG2  1  
ATOM   5651   H  H    . VAL B 1 41  ? 17.111  61.993 73.236 1.00 0.00   ? 44  VAL B H    1  
ATOM   5652   H  HA   . VAL B 1 41  ? 18.602  64.253 72.041 1.00 0.00   ? 44  VAL B HA   1  
ATOM   5653   H  HB   . VAL B 1 41  ? 18.927  62.807 74.697 1.00 0.00   ? 44  VAL B HB   1  
ATOM   5654   H  HG11 . VAL B 1 41  ? 21.056  63.693 74.116 1.00 0.00   ? 44  VAL B HG11 1  
ATOM   5655   H  HG12 . VAL B 1 41  ? 20.336  64.906 75.175 1.00 0.00   ? 44  VAL B HG12 1  
ATOM   5656   H  HG13 . VAL B 1 41  ? 20.347  65.155 73.429 1.00 0.00   ? 44  VAL B HG13 1  
ATOM   5657   H  HG21 . VAL B 1 41  ? 17.952  65.629 74.211 1.00 0.00   ? 44  VAL B HG21 1  
ATOM   5658   H  HG22 . VAL B 1 41  ? 17.846  64.683 75.696 1.00 0.00   ? 44  VAL B HG22 1  
ATOM   5659   H  HG23 . VAL B 1 41  ? 16.844  64.260 74.307 1.00 0.00   ? 44  VAL B HG23 1  
ATOM   5660   N  N    . ILE B 1 42  ? 20.599  62.938 71.349 1.00 10.59  ? 45  ILE B N    1  
ATOM   5661   C  CA   . ILE B 1 42  ? 21.658  62.088 70.760 1.00 10.79  ? 45  ILE B CA   1  
ATOM   5662   C  C    . ILE B 1 42  ? 22.857  62.112 71.673 1.00 11.23  ? 45  ILE B C    1  
ATOM   5663   O  O    . ILE B 1 42  ? 23.254  63.150 72.164 1.00 11.62  ? 45  ILE B O    1  
ATOM   5664   C  CB   . ILE B 1 42  ? 22.049  62.631 69.385 1.00 10.60  ? 45  ILE B CB   1  
ATOM   5665   C  CG1  . ILE B 1 42  ? 20.830  62.594 68.459 1.00 11.14  ? 45  ILE B CG1  1  
ATOM   5666   C  CG2  . ILE B 1 42  ? 23.164  61.768 68.792 1.00 11.96  ? 45  ILE B CG2  1  
ATOM   5667   C  CD1  . ILE B 1 42  ? 20.795  63.866 67.610 1.00 12.23  ? 45  ILE B CD1  1  
ATOM   5668   H  H    . ILE B 1 42  ? 20.554  63.890 71.120 1.00 0.00   ? 45  ILE B H    1  
ATOM   5669   H  HA   . ILE B 1 42  ? 21.298  61.075 70.661 1.00 0.00   ? 45  ILE B HA   1  
ATOM   5670   H  HB   . ILE B 1 42  ? 22.396  63.649 69.485 1.00 0.00   ? 45  ILE B HB   1  
ATOM   5671   H  HG12 . ILE B 1 42  ? 20.896  61.730 67.813 1.00 0.00   ? 45  ILE B HG12 1  
ATOM   5672   H  HG13 . ILE B 1 42  ? 19.930  62.534 69.051 1.00 0.00   ? 45  ILE B HG13 1  
ATOM   5673   H  HG21 . ILE B 1 42  ? 23.849  62.394 68.240 1.00 0.00   ? 45  ILE B HG21 1  
ATOM   5674   H  HG22 . ILE B 1 42  ? 22.735  61.031 68.129 1.00 0.00   ? 45  ILE B HG22 1  
ATOM   5675   H  HG23 . ILE B 1 42  ? 23.695  61.269 69.589 1.00 0.00   ? 45  ILE B HG23 1  
ATOM   5676   H  HD11 . ILE B 1 42  ? 21.252  63.672 66.651 1.00 0.00   ? 45  ILE B HD11 1  
ATOM   5677   H  HD12 . ILE B 1 42  ? 21.338  64.651 68.115 1.00 0.00   ? 45  ILE B HD12 1  
ATOM   5678   H  HD13 . ILE B 1 42  ? 19.770  64.173 67.464 1.00 0.00   ? 45  ILE B HD13 1  
ATOM   5679   N  N    . GLU B 1 43  ? 23.438  60.987 71.925 1.00 11.31  ? 46  GLU B N    1  
ATOM   5680   C  CA   . GLU B 1 43  ? 24.618  60.994 72.841 1.00 11.64  ? 46  GLU B CA   1  
ATOM   5681   C  C    . GLU B 1 43  ? 25.802  60.246 72.223 1.00 11.30  ? 46  GLU B C    1  
ATOM   5682   O  O    . GLU B 1 43  ? 25.786  59.036 72.112 1.00 11.61  ? 46  GLU B O    1  
ATOM   5683   C  CB   . GLU B 1 43  ? 24.233  60.323 74.160 1.00 12.71  ? 46  GLU B CB   1  
ATOM   5684   C  CG   . GLU B 1 43  ? 23.249  61.215 74.920 1.00 15.20  ? 46  GLU B CG   1  
ATOM   5685   C  CD   . GLU B 1 43  ? 24.006  62.381 75.558 1.00 16.00  ? 46  GLU B CD   1  
ATOM   5686   O  OE1  . GLU B 1 43  ? 25.225  62.362 75.521 1.00 17.82  ? 46  GLU B OE1  1  
ATOM   5687   O  OE2  . GLU B 1 43  ? 23.353  63.274 76.074 1.00 18.09  ? 46  GLU B OE2  1  
ATOM   5688   H  H    . GLU B 1 43  ? 23.108  60.151 71.534 1.00 0.00   ? 46  GLU B H    1  
ATOM   5689   H  HA   . GLU B 1 43  ? 24.907  62.015 73.037 1.00 0.00   ? 46  GLU B HA   1  
ATOM   5690   H  HB2  . GLU B 1 43  ? 23.770  59.367 73.957 1.00 0.00   ? 46  GLU B HB2  1  
ATOM   5691   H  HB3  . GLU B 1 43  ? 25.118  60.174 74.760 1.00 0.00   ? 46  GLU B HB3  1  
ATOM   5692   H  HG2  . GLU B 1 43  ? 22.508  61.598 74.233 1.00 0.00   ? 46  GLU B HG2  1  
ATOM   5693   H  HG3  . GLU B 1 43  ? 22.762  60.639 75.692 1.00 0.00   ? 46  GLU B HG3  1  
ATOM   5694   N  N    . GLU B 1 44  ? 26.851  60.944 71.852 1.00 12.04  ? 47  GLU B N    1  
ATOM   5695   C  CA   . GLU B 1 44  ? 28.031  60.222 71.287 1.00 11.72  ? 47  GLU B CA   1  
ATOM   5696   C  C    . GLU B 1 44  ? 28.891  59.725 72.457 1.00 11.88  ? 47  GLU B C    1  
ATOM   5697   O  O    . GLU B 1 44  ? 29.528  60.510 73.131 1.00 12.46  ? 47  GLU B O    1  
ATOM   5698   C  CB   . GLU B 1 44  ? 28.850  61.176 70.414 1.00 12.54  ? 47  GLU B CB   1  
ATOM   5699   C  CG   . GLU B 1 44  ? 27.942  61.809 69.358 1.00 12.14  ? 47  GLU B CG   1  
ATOM   5700   C  CD   . GLU B 1 44  ? 28.586  63.094 68.834 1.00 12.34  ? 47  GLU B CD   1  
ATOM   5701   O  OE1  . GLU B 1 44  ? 29.656  63.434 69.312 1.00 14.09  ? 47  GLU B OE1  1  
ATOM   5702   O  OE2  . GLU B 1 44  ? 27.998  63.716 67.965 1.00 11.76  ? 47  GLU B OE2  1  
ATOM   5703   H  H    . GLU B 1 44  ? 26.870  61.917 71.969 1.00 0.00   ? 47  GLU B H    1  
ATOM   5704   H  HA   . GLU B 1 44  ? 27.696  59.381 70.698 1.00 0.00   ? 47  GLU B HA   1  
ATOM   5705   H  HB2  . GLU B 1 44  ? 29.278  61.951 71.033 1.00 0.00   ? 47  GLU B HB2  1  
ATOM   5706   H  HB3  . GLU B 1 44  ? 29.640  60.628 69.925 1.00 0.00   ? 47  GLU B HB3  1  
ATOM   5707   H  HG2  . GLU B 1 44  ? 27.804  61.115 68.541 1.00 0.00   ? 47  GLU B HG2  1  
ATOM   5708   H  HG3  . GLU B 1 44  ? 26.985  62.042 69.799 1.00 0.00   ? 47  GLU B HG3  1  
ATOM   5709   N  N    . LYS B 1 45  ? 28.905  58.439 72.737 1.00 11.75  ? 48  LYS B N    1  
ATOM   5710   C  CA   . LYS B 1 45  ? 29.706  57.982 73.878 1.00 12.33  ? 48  LYS B CA   1  
ATOM   5711   C  C    . LYS B 1 45  ? 30.450  56.732 73.492 1.00 12.77  ? 48  LYS B C    1  
ATOM   5712   O  O    . LYS B 1 45  ? 30.474  56.320 72.350 1.00 12.54  ? 48  LYS B O    1  
ATOM   5713   C  CB   . LYS B 1 45  ? 28.785  57.685 75.063 1.00 12.82  ? 48  LYS B CB   1  
ATOM   5714   C  CG   . LYS B 1 45  ? 27.678  56.726 74.624 1.00 13.32  ? 48  LYS B CG   1  
ATOM   5715   C  CD   . LYS B 1 45  ? 26.454  56.911 75.523 1.00 14.24  ? 48  LYS B CD   1  
ATOM   5716   C  CE   . LYS B 1 45  ? 26.098  55.577 76.182 1.00 14.60  ? 48  LYS B CE   1  
ATOM   5717   N  NZ   . LYS B 1 45  ? 24.633  55.531 76.449 1.00 15.31  ? 48  LYS B NZ   1  
ATOM   5718   H  H    . LYS B 1 45  ? 28.376  57.805 72.209 1.00 0.00   ? 48  LYS B H    1  
ATOM   5719   H  HA   . LYS B 1 45  ? 30.411  58.751 74.155 1.00 0.00   ? 48  LYS B HA   1  
ATOM   5720   H  HB2  . LYS B 1 45  ? 29.359  57.234 75.860 1.00 0.00   ? 48  LYS B HB2  1  
ATOM   5721   H  HB3  . LYS B 1 45  ? 28.343  58.605 75.415 1.00 0.00   ? 48  LYS B HB3  1  
ATOM   5722   H  HG2  . LYS B 1 45  ? 27.408  56.934 73.598 1.00 0.00   ? 48  LYS B HG2  1  
ATOM   5723   H  HG3  . LYS B 1 45  ? 28.031  55.708 74.704 1.00 0.00   ? 48  LYS B HG3  1  
ATOM   5724   H  HD2  . LYS B 1 45  ? 26.676  57.643 76.286 1.00 0.00   ? 48  LYS B HD2  1  
ATOM   5725   H  HD3  . LYS B 1 45  ? 25.619  57.251 74.929 1.00 0.00   ? 48  LYS B HD3  1  
ATOM   5726   H  HE2  . LYS B 1 45  ? 26.370  54.766 75.523 1.00 0.00   ? 48  LYS B HE2  1  
ATOM   5727   H  HE3  . LYS B 1 45  ? 26.637  55.481 77.113 1.00 0.00   ? 48  LYS B HE3  1  
ATOM   5728   H  HZ1  . LYS B 1 45  ? 24.376  56.291 77.110 1.00 0.00   ? 48  LYS B HZ1  1  
ATOM   5729   H  HZ2  . LYS B 1 45  ? 24.385  54.612 76.867 1.00 0.00   ? 48  LYS B HZ2  1  
ATOM   5730   H  HZ3  . LYS B 1 45  ? 24.114  55.658 75.555 1.00 0.00   ? 48  LYS B HZ3  1  
ATOM   5731   N  N    . LYS B 1 46  ? 31.056  56.130 74.445 1.00 13.38  ? 49  LYS B N    1  
ATOM   5732   C  CA   . LYS B 1 46  ? 31.824  54.882 74.177 1.00 14.27  ? 49  LYS B CA   1  
ATOM   5733   C  C    . LYS B 1 46  ? 31.059  53.666 74.719 1.00 13.76  ? 49  LYS B C    1  
ATOM   5734   O  O    . LYS B 1 46  ? 30.693  53.610 75.876 1.00 16.09  ? 49  LYS B O    1  
ATOM   5735   C  CB   . LYS B 1 46  ? 33.189  54.969 74.862 1.00 15.68  ? 49  LYS B CB   1  
ATOM   5736   C  CG   . LYS B 1 46  ? 33.781  56.363 74.646 1.00 19.74  ? 49  LYS B CG   1  
ATOM   5737   C  CD   . LYS B 1 46  ? 34.767  56.680 75.772 1.00 23.16  ? 49  LYS B CD   1  
ATOM   5738   C  CE   . LYS B 1 46  ? 36.122  57.062 75.173 1.00 26.43  ? 49  LYS B CE   1  
ATOM   5739   N  NZ   . LYS B 1 46  ? 37.181  56.927 76.212 1.00 28.08  ? 49  LYS B NZ   1  
ATOM   5740   H  H    . LYS B 1 46  ? 31.015  56.491 75.355 1.00 0.00   ? 49  LYS B H    1  
ATOM   5741   H  HA   . LYS B 1 46  ? 31.965  54.770 73.112 1.00 0.00   ? 49  LYS B HA   1  
ATOM   5742   H  HB2  . LYS B 1 46  ? 33.073  54.786 75.920 1.00 0.00   ? 49  LYS B HB2  1  
ATOM   5743   H  HB3  . LYS B 1 46  ? 33.852  54.229 74.439 1.00 0.00   ? 49  LYS B HB3  1  
ATOM   5744   H  HG2  . LYS B 1 46  ? 34.296  56.392 73.696 1.00 0.00   ? 49  LYS B HG2  1  
ATOM   5745   H  HG3  . LYS B 1 46  ? 32.988  57.095 74.648 1.00 0.00   ? 49  LYS B HG3  1  
ATOM   5746   H  HD2  . LYS B 1 46  ? 34.388  57.502 76.361 1.00 0.00   ? 49  LYS B HD2  1  
ATOM   5747   H  HD3  . LYS B 1 46  ? 34.886  55.811 76.401 1.00 0.00   ? 49  LYS B HD3  1  
ATOM   5748   H  HE2  . LYS B 1 46  ? 36.346  56.407 74.343 1.00 0.00   ? 49  LYS B HE2  1  
ATOM   5749   H  HE3  . LYS B 1 46  ? 36.086  58.084 74.826 1.00 0.00   ? 49  LYS B HE3  1  
ATOM   5750   H  HZ1  . LYS B 1 46  ? 37.583  57.862 76.422 1.00 0.00   ? 49  LYS B HZ1  1  
ATOM   5751   H  HZ2  . LYS B 1 46  ? 37.932  56.299 75.863 1.00 0.00   ? 49  LYS B HZ2  1  
ATOM   5752   H  HZ3  . LYS B 1 46  ? 36.766  56.524 77.078 1.00 0.00   ? 49  LYS B HZ3  1  
ATOM   5753   N  N    . ILE B 1 47  ? 30.831  52.692 73.882 1.00 12.50  ? 50  ILE B N    1  
ATOM   5754   C  CA   . ILE B 1 47  ? 30.112  51.468 74.307 1.00 12.24  ? 50  ILE B CA   1  
ATOM   5755   C  C    . ILE B 1 47  ? 30.951  50.241 73.932 1.00 11.82  ? 50  ILE B C    1  
ATOM   5756   O  O    . ILE B 1 47  ? 31.682  50.238 72.962 1.00 12.00  ? 50  ILE B O    1  
ATOM   5757   C  CB   . ILE B 1 47  ? 28.758  51.398 73.599 1.00 11.95  ? 50  ILE B CB   1  
ATOM   5758   C  CG1  . ILE B 1 47  ? 28.978  51.263 72.091 1.00 11.94  ? 50  ILE B CG1  1  
ATOM   5759   C  CG2  . ILE B 1 47  ? 27.965  52.675 73.885 1.00 13.76  ? 50  ILE B CG2  1  
ATOM   5760   C  CD1  . ILE B 1 47  ? 27.691  50.770 71.428 1.00 13.62  ? 50  ILE B CD1  1  
ATOM   5761   H  H    . ILE B 1 47  ? 31.148  52.768 72.958 1.00 0.00   ? 50  ILE B H    1  
ATOM   5762   H  HA   . ILE B 1 47  ? 29.961  51.490 75.376 1.00 0.00   ? 50  ILE B HA   1  
ATOM   5763   H  HB   . ILE B 1 47  ? 28.206  50.543 73.963 1.00 0.00   ? 50  ILE B HB   1  
ATOM   5764   H  HG12 . ILE B 1 47  ? 29.250  52.224 71.680 1.00 0.00   ? 50  ILE B HG12 1  
ATOM   5765   H  HG13 . ILE B 1 47  ? 29.771  50.554 71.905 1.00 0.00   ? 50  ILE B HG13 1  
ATOM   5766   H  HG21 . ILE B 1 47  ? 27.854  52.798 74.952 1.00 0.00   ? 50  ILE B HG21 1  
ATOM   5767   H  HG22 . ILE B 1 47  ? 26.989  52.603 73.427 1.00 0.00   ? 50  ILE B HG22 1  
ATOM   5768   H  HG23 . ILE B 1 47  ? 28.492  53.524 73.477 1.00 0.00   ? 50  ILE B HG23 1  
ATOM   5769   H  HD11 . ILE B 1 47  ? 27.859  49.794 70.996 1.00 0.00   ? 50  ILE B HD11 1  
ATOM   5770   H  HD12 . ILE B 1 47  ? 27.397  51.461 70.652 1.00 0.00   ? 50  ILE B HD12 1  
ATOM   5771   H  HD13 . ILE B 1 47  ? 26.907  50.705 72.168 1.00 0.00   ? 50  ILE B HD13 1  
ATOM   5772   N  N    . VAL B 1 48  ? 30.844  49.208 74.708 1.00 11.13  ? 51  VAL B N    1  
ATOM   5773   C  CA   . VAL B 1 48  ? 31.594  47.982 74.462 1.00 11.76  ? 51  VAL B CA   1  
ATOM   5774   C  C    . VAL B 1 48  ? 30.747  47.162 73.546 1.00 11.19  ? 51  VAL B C    1  
ATOM   5775   O  O    . VAL B 1 48  ? 29.535  47.237 73.560 1.00 13.36  ? 51  VAL B O    1  
ATOM   5776   C  CB   . VAL B 1 48  ? 31.827  47.234 75.776 1.00 12.41  ? 51  VAL B CB   1  
ATOM   5777   C  CG1  . VAL B 1 48  ? 32.352  45.829 75.479 1.00 13.13  ? 51  VAL B CG1  1  
ATOM   5778   C  CG2  . VAL B 1 48  ? 32.854  47.994 76.619 1.00 14.10  ? 51  VAL B CG2  1  
ATOM   5779   H  H    . VAL B 1 48  ? 30.246  49.254 75.483 1.00 0.00   ? 51  VAL B H    1  
ATOM   5780   H  HA   . VAL B 1 48  ? 32.539  48.212 73.991 1.00 0.00   ? 51  VAL B HA   1  
ATOM   5781   H  HB   . VAL B 1 48  ? 30.895  47.162 76.319 1.00 0.00   ? 51  VAL B HB   1  
ATOM   5782   H  HG11 . VAL B 1 48  ? 33.183  45.894 74.791 1.00 0.00   ? 51  VAL B HG11 1  
ATOM   5783   H  HG12 . VAL B 1 48  ? 31.565  45.236 75.037 1.00 0.00   ? 51  VAL B HG12 1  
ATOM   5784   H  HG13 . VAL B 1 48  ? 32.681  45.365 76.397 1.00 0.00   ? 51  VAL B HG13 1  
ATOM   5785   H  HG21 . VAL B 1 48  ? 32.608  49.046 76.624 1.00 0.00   ? 51  VAL B HG21 1  
ATOM   5786   H  HG22 . VAL B 1 48  ? 33.838  47.856 76.198 1.00 0.00   ? 51  VAL B HG22 1  
ATOM   5787   H  HG23 . VAL B 1 48  ? 32.839  47.616 77.631 1.00 0.00   ? 51  VAL B HG23 1  
ATOM   5788   N  N    . ILE B 1 49  ? 31.355  46.418 72.724 1.00 9.85   ? 52  ILE B N    1  
ATOM   5789   C  CA   . ILE B 1 49  ? 30.553  45.612 71.748 1.00 9.97   ? 52  ILE B CA   1  
ATOM   5790   C  C    . ILE B 1 49  ? 30.773  44.098 71.908 1.00 9.83   ? 52  ILE B C    1  
ATOM   5791   O  O    . ILE B 1 49  ? 30.021  43.309 71.371 1.00 10.17  ? 52  ILE B O    1  
ATOM   5792   C  CB   . ILE B 1 49  ? 30.944  46.022 70.327 1.00 9.68   ? 52  ILE B CB   1  
ATOM   5793   C  CG1  . ILE B 1 49  ? 32.448  45.813 70.134 1.00 10.56  ? 52  ILE B CG1  1  
ATOM   5794   C  CG2  . ILE B 1 49  ? 30.604  47.498 70.109 1.00 10.70  ? 52  ILE B CG2  1  
ATOM   5795   C  CD1  . ILE B 1 49  ? 32.817  46.078 68.673 1.00 11.67  ? 52  ILE B CD1  1  
ATOM   5796   H  H    . ILE B 1 49  ? 32.334  46.394 72.704 1.00 0.00   ? 52  ILE B H    1  
ATOM   5797   H  HA   . ILE B 1 49  ? 29.506  45.830 71.893 1.00 0.00   ? 52  ILE B HA   1  
ATOM   5798   H  HB   . ILE B 1 49  ? 30.400  45.418 69.616 1.00 0.00   ? 52  ILE B HB   1  
ATOM   5799   H  HG12 . ILE B 1 49  ? 32.991  46.494 70.773 1.00 0.00   ? 52  ILE B HG12 1  
ATOM   5800   H  HG13 . ILE B 1 49  ? 32.706  44.796 70.389 1.00 0.00   ? 52  ILE B HG13 1  
ATOM   5801   H  HG21 . ILE B 1 49  ? 31.489  48.027 69.787 1.00 0.00   ? 52  ILE B HG21 1  
ATOM   5802   H  HG22 . ILE B 1 49  ? 30.246  47.925 71.034 1.00 0.00   ? 52  ILE B HG22 1  
ATOM   5803   H  HG23 . ILE B 1 49  ? 29.838  47.582 69.353 1.00 0.00   ? 52  ILE B HG23 1  
ATOM   5804   H  HD11 . ILE B 1 49  ? 32.813  45.146 68.126 1.00 0.00   ? 52  ILE B HD11 1  
ATOM   5805   H  HD12 . ILE B 1 49  ? 33.801  46.520 68.625 1.00 0.00   ? 52  ILE B HD12 1  
ATOM   5806   H  HD13 . ILE B 1 49  ? 32.096  46.754 68.237 1.00 0.00   ? 52  ILE B HD13 1  
ATOM   5807   N  N    . ASP B 1 50  ? 31.784  43.671 72.611 1.00 9.85   ? 53  ASP B N    1  
ATOM   5808   C  CA   . ASP B 1 50  ? 32.003  42.210 72.746 1.00 10.43  ? 53  ASP B CA   1  
ATOM   5809   C  C    . ASP B 1 50  ? 32.450  41.888 74.164 1.00 10.16  ? 53  ASP B C    1  
ATOM   5810   O  O    . ASP B 1 50  ? 32.490  42.741 75.028 1.00 11.14  ? 53  ASP B O    1  
ATOM   5811   C  CB   . ASP B 1 50  ? 33.083  41.763 71.758 1.00 10.40  ? 53  ASP B CB   1  
ATOM   5812   C  CG   . ASP B 1 50  ? 34.352  42.587 71.982 1.00 10.84  ? 53  ASP B CG   1  
ATOM   5813   O  OD1  . ASP B 1 50  ? 34.601  42.958 73.117 1.00 10.54  ? 53  ASP B OD1  1  
ATOM   5814   O  OD2  . ASP B 1 50  ? 35.054  42.831 71.015 1.00 10.74  ? 53  ASP B OD2  1  
ATOM   5815   H  H    . ASP B 1 50  ? 32.399  44.307 73.034 1.00 0.00   ? 53  ASP B H    1  
ATOM   5816   H  HA   . ASP B 1 50  ? 31.083  41.687 72.532 1.00 0.00   ? 53  ASP B HA   1  
ATOM   5817   H  HB2  . ASP B 1 50  ? 33.300  40.716 71.912 1.00 0.00   ? 53  ASP B HB2  1  
ATOM   5818   H  HB3  . ASP B 1 50  ? 32.732  41.914 70.749 1.00 0.00   ? 53  ASP B HB3  1  
ATOM   5819   N  N    . ASP B 1 51  ? 32.784  40.658 74.407 1.00 10.99  ? 54  ASP B N    1  
ATOM   5820   C  CA   . ASP B 1 51  ? 33.232  40.264 75.774 1.00 12.56  ? 54  ASP B CA   1  
ATOM   5821   C  C    . ASP B 1 51  ? 34.689  40.689 75.986 1.00 12.41  ? 54  ASP B C    1  
ATOM   5822   O  O    . ASP B 1 51  ? 35.115  40.938 77.097 1.00 15.11  ? 54  ASP B O    1  
ATOM   5823   C  CB   . ASP B 1 51  ? 33.118  38.746 75.928 1.00 12.74  ? 54  ASP B CB   1  
ATOM   5824   C  CG   . ASP B 1 51  ? 31.645  38.356 76.068 1.00 15.53  ? 54  ASP B CG   1  
ATOM   5825   O  OD1  . ASP B 1 51  ? 30.803  39.218 75.875 1.00 16.80  ? 54  ASP B OD1  1  
ATOM   5826   O  OD2  . ASP B 1 51  ? 31.384  37.202 76.365 1.00 17.89  ? 54  ASP B OD2  1  
ATOM   5827   H  H    . ASP B 1 51  ? 32.742  39.988 73.693 1.00 0.00   ? 54  ASP B H    1  
ATOM   5828   H  HA   . ASP B 1 51  ? 32.606  40.747 76.509 1.00 0.00   ? 54  ASP B HA   1  
ATOM   5829   H  HB2  . ASP B 1 51  ? 33.538  38.263 75.057 1.00 0.00   ? 54  ASP B HB2  1  
ATOM   5830   H  HB3  . ASP B 1 51  ? 33.656  38.432 76.809 1.00 0.00   ? 54  ASP B HB3  1  
ATOM   5831   N  N    . ALA B 1 52  ? 35.458  40.771 74.934 1.00 11.95  ? 55  ALA B N    1  
ATOM   5832   C  CA   . ALA B 1 52  ? 36.891  41.177 75.084 1.00 12.88  ? 55  ALA B CA   1  
ATOM   5833   C  C    . ALA B 1 52  ? 37.014  42.648 75.539 1.00 13.57  ? 55  ALA B C    1  
ATOM   5834   O  O    . ALA B 1 52  ? 38.069  43.079 75.958 1.00 16.47  ? 55  ALA B O    1  
ATOM   5835   C  CB   . ALA B 1 52  ? 37.603  41.007 73.741 1.00 13.20  ? 55  ALA B CB   1  
ATOM   5836   H  H    . ALA B 1 52  ? 35.098  40.564 74.046 1.00 0.00   ? 55  ALA B H    1  
ATOM   5837   H  HA   . ALA B 1 52  ? 37.364  40.540 75.816 1.00 0.00   ? 55  ALA B HA   1  
ATOM   5838   H  HB1  . ALA B 1 52  ? 38.084  40.041 73.709 1.00 0.00   ? 55  ALA B HB1  1  
ATOM   5839   H  HB2  . ALA B 1 52  ? 38.345  41.783 73.626 1.00 0.00   ? 55  ALA B HB2  1  
ATOM   5840   H  HB3  . ALA B 1 52  ? 36.882  41.077 72.940 1.00 0.00   ? 55  ALA B HB3  1  
ATOM   5841   N  N    . GLY B 1 53  ? 35.962  43.425 75.455 1.00 12.67  ? 56  GLY B N    1  
ATOM   5842   C  CA   . GLY B 1 53  ? 36.056  44.861 75.879 1.00 12.83  ? 56  GLY B CA   1  
ATOM   5843   C  C    . GLY B 1 53  ? 36.289  45.804 74.668 1.00 12.49  ? 56  GLY B C    1  
ATOM   5844   O  O    . GLY B 1 53  ? 36.649  46.951 74.839 1.00 13.24  ? 56  GLY B O    1  
ATOM   5845   H  H    . GLY B 1 53  ? 35.117  43.070 75.109 1.00 0.00   ? 56  GLY B H    1  
ATOM   5846   H  HA2  . GLY B 1 53  ? 35.138  45.143 76.373 1.00 0.00   ? 56  GLY B HA2  1  
ATOM   5847   H  HA3  . GLY B 1 53  ? 36.877  44.971 76.571 1.00 0.00   ? 56  GLY B HA3  1  
ATOM   5848   N  N    . THR B 1 54  ? 36.079  45.344 73.456 1.00 10.99  ? 57  THR B N    1  
ATOM   5849   C  CA   . THR B 1 54  ? 36.276  46.214 72.276 1.00 11.44  ? 57  THR B CA   1  
ATOM   5850   C  C    . THR B 1 54  ? 35.381  47.421 72.452 1.00 11.54  ? 57  THR B C    1  
ATOM   5851   O  O    . THR B 1 54  ? 34.245  47.306 72.868 1.00 11.51  ? 57  THR B O    1  
ATOM   5852   C  CB   . THR B 1 54  ? 35.888  45.459 71.003 1.00 11.39  ? 57  THR B CB   1  
ATOM   5853   O  OG1  . THR B 1 54  ? 36.714  44.311 70.864 1.00 11.54  ? 57  THR B OG1  1  
ATOM   5854   C  CG2  . THR B 1 54  ? 36.072  46.372 69.790 1.00 12.55  ? 57  THR B CG2  1  
ATOM   5855   H  H    . THR B 1 54  ? 35.780  44.419 73.333 1.00 0.00   ? 57  THR B H    1  
ATOM   5856   H  HA   . THR B 1 54  ? 37.308  46.527 72.219 1.00 0.00   ? 57  THR B HA   1  
ATOM   5857   H  HB   . THR B 1 54  ? 34.854  45.154 71.065 1.00 0.00   ? 57  THR B HB   1  
ATOM   5858   H  HG1  . THR B 1 54  ? 36.147  43.536 70.866 1.00 0.00   ? 57  THR B HG1  1  
ATOM   5859   H  HG21 . THR B 1 54  ? 35.693  45.878 68.907 1.00 0.00   ? 57  THR B HG21 1  
ATOM   5860   H  HG22 . THR B 1 54  ? 37.122  46.589 69.658 1.00 0.00   ? 57  THR B HG22 1  
ATOM   5861   H  HG23 . THR B 1 54  ? 35.531  47.293 69.947 1.00 0.00   ? 57  THR B HG23 1  
ATOM   5862   N  N    . GLU B 1 55  ? 35.876  48.578 72.176 1.00 13.49  ? 58  GLU B N    1  
ATOM   5863   C  CA   . GLU B 1 55  ? 35.025  49.790 72.377 1.00 15.46  ? 58  GLU B CA   1  
ATOM   5864   C  C    . GLU B 1 55  ? 34.846  50.585 71.078 1.00 15.90  ? 58  GLU B C    1  
ATOM   5865   O  O    . GLU B 1 55  ? 35.774  50.791 70.321 1.00 17.87  ? 58  GLU B O    1  
ATOM   5866   C  CB   . GLU B 1 55  ? 35.679  50.690 73.427 1.00 18.05  ? 58  GLU B CB   1  
ATOM   5867   C  CG   . GLU B 1 55  ? 36.311  49.825 74.520 1.00 21.83  ? 58  GLU B CG   1  
ATOM   5868   C  CD   . GLU B 1 55  ? 37.082  50.716 75.495 1.00 27.39  ? 58  GLU B CD   1  
ATOM   5869   O  OE1  . GLU B 1 55  ? 37.896  51.499 75.034 1.00 32.17  ? 58  GLU B OE1  1  
ATOM   5870   O  OE2  . GLU B 1 55  ? 36.845  50.600 76.686 1.00 31.16  ? 58  GLU B OE2  1  
ATOM   5871   H  H    . GLU B 1 55  ? 36.801  48.664 71.864 1.00 0.00   ? 58  GLU B H    1  
ATOM   5872   H  HA   . GLU B 1 55  ? 34.055  49.482 72.738 1.00 0.00   ? 58  GLU B HA   1  
ATOM   5873   H  HB2  . GLU B 1 55  ? 36.442  51.294 72.958 1.00 0.00   ? 58  GLU B HB2  1  
ATOM   5874   H  HB3  . GLU B 1 55  ? 34.931  51.332 73.867 1.00 0.00   ? 58  GLU B HB3  1  
ATOM   5875   H  HG2  . GLU B 1 55  ? 35.534  49.294 75.052 1.00 0.00   ? 58  GLU B HG2  1  
ATOM   5876   H  HG3  . GLU B 1 55  ? 36.989  49.115 74.070 1.00 0.00   ? 58  GLU B HG3  1  
ATOM   5877   N  N    . VAL B 1 56  ? 33.648  51.065 70.847 1.00 14.28  ? 59  VAL B N    1  
ATOM   5878   C  CA   . VAL B 1 56  ? 33.368  51.893 69.631 1.00 14.75  ? 59  VAL B CA   1  
ATOM   5879   C  C    . VAL B 1 56  ? 32.635  53.201 70.033 1.00 13.52  ? 59  VAL B C    1  
ATOM   5880   O  O    . VAL B 1 56  ? 31.616  53.175 70.695 1.00 12.98  ? 59  VAL B O    1  
ATOM   5881   C  CB   . VAL B 1 56  ? 32.489  51.096 68.666 1.00 15.01  ? 59  VAL B CB   1  
ATOM   5882   C  CG1  . VAL B 1 56  ? 31.754  52.057 67.730 1.00 18.40  ? 59  VAL B CG1  1  
ATOM   5883   C  CG2  . VAL B 1 56  ? 33.366  50.152 67.840 1.00 17.23  ? 59  VAL B CG2  1  
ATOM   5884   H  H    . VAL B 1 56  ? 32.931  50.902 71.494 1.00 0.00   ? 59  VAL B H    1  
ATOM   5885   H  HA   . VAL B 1 56  ? 34.300  52.141 69.145 1.00 0.00   ? 59  VAL B HA   1  
ATOM   5886   H  HB   . VAL B 1 56  ? 31.768  50.520 69.229 1.00 0.00   ? 59  VAL B HB   1  
ATOM   5887   H  HG11 . VAL B 1 56  ? 31.576  52.991 68.242 1.00 0.00   ? 59  VAL B HG11 1  
ATOM   5888   H  HG12 . VAL B 1 56  ? 30.810  51.622 67.436 1.00 0.00   ? 59  VAL B HG12 1  
ATOM   5889   H  HG13 . VAL B 1 56  ? 32.357  52.236 66.853 1.00 0.00   ? 59  VAL B HG13 1  
ATOM   5890   H  HG21 . VAL B 1 56  ? 34.240  49.879 68.413 1.00 0.00   ? 59  VAL B HG21 1  
ATOM   5891   H  HG22 . VAL B 1 56  ? 33.672  50.649 66.931 1.00 0.00   ? 59  VAL B HG22 1  
ATOM   5892   H  HG23 . VAL B 1 56  ? 32.805  49.263 67.593 1.00 0.00   ? 59  VAL B HG23 1  
ATOM   5893   N  N    . HIS B 1 57  ? 33.154  54.337 69.619 1.00 13.53  ? 60  HIS B N    1  
ATOM   5894   C  CA   . HIS B 1 57  ? 32.532  55.648 69.933 1.00 13.67  ? 60  HIS B CA   1  
ATOM   5895   C  C    . HIS B 1 57  ? 31.229  55.702 69.178 1.00 12.42  ? 60  HIS B C    1  
ATOM   5896   O  O    . HIS B 1 57  ? 31.164  56.068 68.022 1.00 13.95  ? 60  HIS B O    1  
ATOM   5897   C  CB   . HIS B 1 57  ? 33.449  56.784 69.474 1.00 15.16  ? 60  HIS B CB   1  
ATOM   5898   C  CG   . HIS B 1 57  ? 34.666  56.835 70.356 1.00 18.44  ? 60  HIS B CG   1  
ATOM   5899   N  ND1  . HIS B 1 57  ? 34.689  57.553 71.544 1.00 23.72  ? 60  HIS B ND1  1  
ATOM   5900   C  CD2  . HIS B 1 57  ? 35.909  56.262 70.239 1.00 21.79  ? 60  HIS B CD2  1  
ATOM   5901   C  CE1  . HIS B 1 57  ? 35.910  57.395 72.090 1.00 23.37  ? 60  HIS B CE1  1  
ATOM   5902   N  NE2  . HIS B 1 57  ? 36.688  56.619 71.334 1.00 22.65  ? 60  HIS B NE2  1  
ATOM   5903   H  H    . HIS B 1 57  ? 33.972  54.317 69.080 1.00 0.00   ? 60  HIS B H    1  
ATOM   5904   H  HA   . HIS B 1 57  ? 32.348  55.725 70.994 1.00 0.00   ? 60  HIS B HA   1  
ATOM   5905   H  HB2  . HIS B 1 57  ? 33.752  56.611 68.451 1.00 0.00   ? 60  HIS B HB2  1  
ATOM   5906   H  HB3  . HIS B 1 57  ? 32.919  57.723 69.538 1.00 0.00   ? 60  HIS B HB3  1  
ATOM   5907   H  HD1  . HIS B 1 57  ? 33.951  58.079 71.918 1.00 0.00   ? 60  HIS B HD1  1  
ATOM   5908   H  HD2  . HIS B 1 57  ? 36.231  55.633 69.423 1.00 0.00   ? 60  HIS B HD2  1  
ATOM   5909   H  HE1  . HIS B 1 57  ? 36.220  57.842 73.023 1.00 0.00   ? 60  HIS B HE1  1  
ATOM   5910   H  HE2  . HIS B 1 57  ? 37.615  56.355 71.513 1.00 0.00   ? 60  HIS B HE2  1  
ATOM   5911   N  N    . ALA B 1 58  ? 30.208  55.272 69.816 1.00 11.94  ? 61  ALA B N    1  
ATOM   5912   C  CA   . ALA B 1 58  ? 28.882  55.202 69.160 1.00 11.41  ? 61  ALA B CA   1  
ATOM   5913   C  C    . ALA B 1 58  ? 28.156  56.542 69.184 1.00 11.06  ? 61  ALA B C    1  
ATOM   5914   O  O    . ALA B 1 58  ? 28.256  57.328 70.105 1.00 11.73  ? 61  ALA B O    1  
ATOM   5915   C  CB   . ALA B 1 58  ? 28.025  54.159 69.879 1.00 11.98  ? 61  ALA B CB   1  
ATOM   5916   H  H    . ALA B 1 58  ? 30.314  54.939 70.732 1.00 0.00   ? 61  ALA B H    1  
ATOM   5917   H  HA   . ALA B 1 58  ? 29.014  54.894 68.135 1.00 0.00   ? 61  ALA B HA   1  
ATOM   5918   H  HB1  . ALA B 1 58  ? 27.222  54.653 70.405 1.00 0.00   ? 61  ALA B HB1  1  
ATOM   5919   H  HB2  . ALA B 1 58  ? 28.636  53.615 70.583 1.00 0.00   ? 61  ALA B HB2  1  
ATOM   5920   H  HB3  . ALA B 1 58  ? 27.612  53.472 69.155 1.00 0.00   ? 61  ALA B HB3  1  
ATOM   5921   N  N    . MET B 1 59  ? 27.392  56.758 68.161 1.00 10.25  ? 62  MET B N    1  
ATOM   5922   C  CA   . MET B 1 59  ? 26.573  57.979 68.020 1.00 10.26  ? 62  MET B CA   1  
ATOM   5923   C  C    . MET B 1 59  ? 25.207  57.416 68.179 1.00 10.06  ? 62  MET B C    1  
ATOM   5924   O  O    . MET B 1 59  ? 24.806  56.543 67.434 1.00 11.19  ? 62  MET B O    1  
ATOM   5925   C  CB   . MET B 1 59  ? 26.752  58.600 66.632 1.00 10.55  ? 62  MET B CB   1  
ATOM   5926   C  CG   . MET B 1 59  ? 28.237  58.856 66.373 1.00 10.95  ? 62  MET B CG   1  
ATOM   5927   S  SD   . MET B 1 59  ? 28.457  59.488 64.691 1.00 12.44  ? 62  MET B SD   1  
ATOM   5928   C  CE   . MET B 1 59  ? 30.264  59.392 64.648 1.00 13.12  ? 62  MET B CE   1  
ATOM   5929   H  H    . MET B 1 59  ? 27.334  56.071 67.465 1.00 0.00   ? 62  MET B H    1  
ATOM   5930   H  HA   . MET B 1 59  ? 26.795  58.688 68.807 1.00 0.00   ? 62  MET B HA   1  
ATOM   5931   H  HB2  . MET B 1 59  ? 26.366  57.923 65.883 1.00 0.00   ? 62  MET B HB2  1  
ATOM   5932   H  HB3  . MET B 1 59  ? 26.213  59.535 66.583 1.00 0.00   ? 62  MET B HB3  1  
ATOM   5933   H  HG2  . MET B 1 59  ? 28.606  59.583 67.082 1.00 0.00   ? 62  MET B HG2  1  
ATOM   5934   H  HG3  . MET B 1 59  ? 28.787  57.933 66.486 1.00 0.00   ? 62  MET B HG3  1  
ATOM   5935   H  HE1  . MET B 1 59  ? 30.605  58.692 65.398 1.00 0.00   ? 62  MET B HE1  1  
ATOM   5936   H  HE2  . MET B 1 59  ? 30.680  60.371 64.845 1.00 0.00   ? 62  MET B HE2  1  
ATOM   5937   H  HE3  . MET B 1 59  ? 30.584  59.057 63.674 1.00 0.00   ? 62  MET B HE3  1  
ATOM   5938   N  N    . ALA B 1 60  ? 24.544  57.742 69.211 1.00 9.92   ? 63  ALA B N    1  
ATOM   5939   C  CA   . ALA B 1 60  ? 23.303  57.008 69.425 1.00 9.88   ? 63  ALA B CA   1  
ATOM   5940   C  C    . ALA B 1 60  ? 22.161  57.900 69.709 1.00 9.93   ? 63  ALA B C    1  
ATOM   5941   O  O    . ALA B 1 60  ? 22.170  58.726 70.599 1.00 10.68  ? 63  ALA B O    1  
ATOM   5942   C  CB   . ALA B 1 60  ? 23.489  56.047 70.600 1.00 10.09  ? 63  ALA B CB   1  
ATOM   5943   H  H    . ALA B 1 60  ? 24.912  58.343 69.892 1.00 0.00   ? 63  ALA B H    1  
ATOM   5944   H  HA   . ALA B 1 60  ? 23.083  56.427 68.544 1.00 0.00   ? 63  ALA B HA   1  
ATOM   5945   H  HB1  . ALA B 1 60  ? 22.772  56.280 71.373 1.00 0.00   ? 63  ALA B HB1  1  
ATOM   5946   H  HB2  . ALA B 1 60  ? 24.489  56.149 70.994 1.00 0.00   ? 63  ALA B HB2  1  
ATOM   5947   H  HB3  . ALA B 1 60  ? 23.337  55.032 70.262 1.00 0.00   ? 63  ALA B HB3  1  
ATOM   5948   N  N    . PHE B 1 61  ? 21.147  57.676 68.984 1.00 9.73   ? 64  PHE B N    1  
ATOM   5949   C  CA   . PHE B 1 61  ? 19.894  58.453 69.214 1.00 9.97   ? 64  PHE B CA   1  
ATOM   5950   C  C    . PHE B 1 61  ? 19.202  57.853 70.448 1.00 10.62  ? 64  PHE B C    1  
ATOM   5951   O  O    . PHE B 1 61  ? 18.969  56.662 70.511 1.00 11.00  ? 64  PHE B O    1  
ATOM   5952   C  CB   . PHE B 1 61  ? 18.977  58.332 67.994 1.00 9.71   ? 64  PHE B CB   1  
ATOM   5953   C  CG   . PHE B 1 61  ? 19.397  59.335 66.947 1.00 9.89   ? 64  PHE B CG   1  
ATOM   5954   C  CD1  . PHE B 1 61  ? 19.319  60.706 67.220 1.00 10.72  ? 64  PHE B CD1  1  
ATOM   5955   C  CD2  . PHE B 1 61  ? 19.864  58.894 65.703 1.00 10.19  ? 64  PHE B CD2  1  
ATOM   5956   C  CE1  . PHE B 1 61  ? 19.708  61.636 66.248 1.00 10.64  ? 64  PHE B CE1  1  
ATOM   5957   C  CE2  . PHE B 1 61  ? 20.253  59.825 64.732 1.00 11.14  ? 64  PHE B CE2  1  
ATOM   5958   C  CZ   . PHE B 1 61  ? 20.175  61.196 65.004 1.00 10.46  ? 64  PHE B CZ   1  
ATOM   5959   H  H    . PHE B 1 61  ? 21.169  56.964 68.311 1.00 0.00   ? 64  PHE B H    1  
ATOM   5960   H  HA   . PHE B 1 61  ? 20.134  59.491 69.396 1.00 0.00   ? 64  PHE B HA   1  
ATOM   5961   H  HB2  . PHE B 1 61  ? 19.050  57.334 67.587 1.00 0.00   ? 64  PHE B HB2  1  
ATOM   5962   H  HB3  . PHE B 1 61  ? 17.957  58.527 68.290 1.00 0.00   ? 64  PHE B HB3  1  
ATOM   5963   H  HD1  . PHE B 1 61  ? 18.959  61.046 68.179 1.00 0.00   ? 64  PHE B HD1  1  
ATOM   5964   H  HD2  . PHE B 1 61  ? 19.924  57.837 65.492 1.00 0.00   ? 64  PHE B HD2  1  
ATOM   5965   H  HE1  . PHE B 1 61  ? 19.648  62.694 66.459 1.00 0.00   ? 64  PHE B HE1  1  
ATOM   5966   H  HE2  . PHE B 1 61  ? 20.613  59.485 63.772 1.00 0.00   ? 64  PHE B HE2  1  
ATOM   5967   H  HZ   . PHE B 1 61  ? 20.475  61.913 64.255 1.00 0.00   ? 64  PHE B HZ   1  
ATOM   5968   N  N    . ASN B 1 62  ? 18.905  58.647 71.444 1.00 11.19  ? 65  ASN B N    1  
ATOM   5969   C  CA   . ASN B 1 62  ? 18.271  58.084 72.675 1.00 12.09  ? 65  ASN B CA   1  
ATOM   5970   C  C    . ASN B 1 62  ? 19.310  57.298 73.520 1.00 11.80  ? 65  ASN B C    1  
ATOM   5971   O  O    . ASN B 1 62  ? 18.948  56.565 74.419 1.00 12.83  ? 65  ASN B O    1  
ATOM   5972   C  CB   . ASN B 1 62  ? 17.135  57.142 72.271 1.00 12.98  ? 65  ASN B CB   1  
ATOM   5973   C  CG   . ASN B 1 62  ? 15.962  57.312 73.238 1.00 16.43  ? 65  ASN B CG   1  
ATOM   5974   O  OD1  . ASN B 1 62  ? 15.520  58.416 73.488 1.00 18.65  ? 65  ASN B OD1  1  
ATOM   5975   N  ND2  . ASN B 1 62  ? 15.434  56.257 73.796 1.00 16.29  ? 65  ASN B ND2  1  
ATOM   5976   H  H    . ASN B 1 62  ? 19.123  59.601 71.395 1.00 0.00   ? 65  ASN B H    1  
ATOM   5977   H  HA   . ASN B 1 62  ? 17.868  58.891 73.269 1.00 0.00   ? 65  ASN B HA   1  
ATOM   5978   H  HB2  . ASN B 1 62  ? 16.813  57.377 71.267 1.00 0.00   ? 65  ASN B HB2  1  
ATOM   5979   H  HB3  . ASN B 1 62  ? 17.483  56.121 72.307 1.00 0.00   ? 65  ASN B HB3  1  
ATOM   5980   H  HD21 . ASN B 1 62  ? 15.789  55.366 73.594 1.00 0.00   ? 65  ASN B HD21 1  
ATOM   5981   H  HD22 . ASN B 1 62  ? 14.682  56.356 74.416 1.00 0.00   ? 65  ASN B HD22 1  
ATOM   5982   N  N    . GLY B 1 63  ? 20.593  57.444 73.250 1.00 11.28  ? 66  GLY B N    1  
ATOM   5983   C  CA   . GLY B 1 63  ? 21.618  56.714 74.042 1.00 11.45  ? 66  GLY B CA   1  
ATOM   5984   C  C    . GLY B 1 63  ? 21.554  55.194 73.799 1.00 11.56  ? 66  GLY B C    1  
ATOM   5985   O  O    . GLY B 1 63  ? 22.045  54.430 74.605 1.00 12.55  ? 66  GLY B O    1  
ATOM   5986   H  H    . GLY B 1 63  ? 20.873  58.042 72.526 1.00 0.00   ? 66  GLY B H    1  
ATOM   5987   H  HA2  . GLY B 1 63  ? 22.598  57.073 73.765 1.00 0.00   ? 66  GLY B HA2  1  
ATOM   5988   H  HA3  . GLY B 1 63  ? 21.456  56.908 75.092 1.00 0.00   ? 66  GLY B HA3  1  
ATOM   5989   N  N    . THR B 1 64  ? 20.982  54.721 72.710 1.00 10.85  ? 67  THR B N    1  
ATOM   5990   C  CA   . THR B 1 64  ? 20.966  53.223 72.515 1.00 10.44  ? 67  THR B CA   1  
ATOM   5991   C  C    . THR B 1 64  ? 21.100  52.795 71.029 1.00 9.47   ? 67  THR B C    1  
ATOM   5992   O  O    . THR B 1 64  ? 20.393  53.283 70.169 1.00 9.82   ? 67  THR B O    1  
ATOM   5993   C  CB   . THR B 1 64  ? 19.652  52.669 73.070 1.00 10.39  ? 67  THR B CB   1  
ATOM   5994   O  OG1  . THR B 1 64  ? 18.561  53.267 72.384 1.00 10.26  ? 67  THR B OG1  1  
ATOM   5995   C  CG2  . THR B 1 64  ? 19.553  52.983 74.563 1.00 11.40  ? 67  THR B CG2  1  
ATOM   5996   H  H    . THR B 1 64  ? 20.591  55.322 72.042 1.00 0.00   ? 67  THR B H    1  
ATOM   5997   H  HA   . THR B 1 64  ? 21.783  52.792 73.074 1.00 0.00   ? 67  THR B HA   1  
ATOM   5998   H  HB   . THR B 1 64  ? 19.623  51.599 72.929 1.00 0.00   ? 67  THR B HB   1  
ATOM   5999   H  HG1  . THR B 1 64  ? 18.283  52.668 71.687 1.00 0.00   ? 67  THR B HG1  1  
ATOM   6000   H  HG21 . THR B 1 64  ? 18.883  53.817 74.712 1.00 0.00   ? 67  THR B HG21 1  
ATOM   6001   H  HG22 . THR B 1 64  ? 20.532  53.235 74.944 1.00 0.00   ? 67  THR B HG22 1  
ATOM   6002   H  HG23 . THR B 1 64  ? 19.174  52.118 75.088 1.00 0.00   ? 67  THR B HG23 1  
ATOM   6003   N  N    . VAL B 1 65  ? 21.971  51.829 70.738 1.00 9.51   ? 68  VAL B N    1  
ATOM   6004   C  CA   . VAL B 1 65  ? 22.102  51.322 69.357 1.00 9.00   ? 68  VAL B CA   1  
ATOM   6005   C  C    . VAL B 1 65  ? 21.415  49.956 69.323 1.00 9.30   ? 68  VAL B C    1  
ATOM   6006   O  O    . VAL B 1 65  ? 21.781  49.052 70.047 1.00 9.72   ? 68  VAL B O    1  
ATOM   6007   C  CB   . VAL B 1 65  ? 23.581  51.170 68.995 1.00 9.20   ? 68  VAL B CB   1  
ATOM   6008   C  CG1  . VAL B 1 65  ? 23.706  50.582 67.588 1.00 9.60   ? 68  VAL B CG1  1  
ATOM   6009   C  CG2  . VAL B 1 65  ? 24.257  52.543 69.033 1.00 10.66  ? 68  VAL B CG2  1  
ATOM   6010   H  H    . VAL B 1 65  ? 22.497  51.419 71.456 1.00 0.00   ? 68  VAL B H    1  
ATOM   6011   H  HA   . VAL B 1 65  ? 21.617  51.997 68.668 1.00 0.00   ? 68  VAL B HA   1  
ATOM   6012   H  HB   . VAL B 1 65  ? 24.060  50.511 69.704 1.00 0.00   ? 68  VAL B HB   1  
ATOM   6013   H  HG11 . VAL B 1 65  ? 23.729  51.382 66.864 1.00 0.00   ? 68  VAL B HG11 1  
ATOM   6014   H  HG12 . VAL B 1 65  ? 22.859  49.941 67.390 1.00 0.00   ? 68  VAL B HG12 1  
ATOM   6015   H  HG13 . VAL B 1 65  ? 24.617  50.006 67.518 1.00 0.00   ? 68  VAL B HG13 1  
ATOM   6016   H  HG21 . VAL B 1 65  ? 24.995  52.603 68.247 1.00 0.00   ? 68  VAL B HG21 1  
ATOM   6017   H  HG22 . VAL B 1 65  ? 24.739  52.680 69.990 1.00 0.00   ? 68  VAL B HG22 1  
ATOM   6018   H  HG23 . VAL B 1 65  ? 23.515  53.314 68.890 1.00 0.00   ? 68  VAL B HG23 1  
ATOM   6019   N  N    . PRO B 1 66  ? 20.411  49.818 68.510 1.00 8.55   ? 69  PRO B N    1  
ATOM   6020   C  CA   . PRO B 1 66  ? 19.934  50.898 67.611 1.00 8.52   ? 69  PRO B CA   1  
ATOM   6021   C  C    . PRO B 1 66  ? 18.911  51.819 68.279 1.00 8.69   ? 69  PRO B C    1  
ATOM   6022   O  O    . PRO B 1 66  ? 18.233  51.439 69.213 1.00 9.04   ? 69  PRO B O    1  
ATOM   6023   C  CB   . PRO B 1 66  ? 19.282  50.137 66.448 1.00 8.33   ? 69  PRO B CB   1  
ATOM   6024   C  CG   . PRO B 1 66  ? 19.128  48.707 66.892 1.00 8.92   ? 69  PRO B CG   1  
ATOM   6025   C  CD   . PRO B 1 66  ? 19.611  48.610 68.342 1.00 8.73   ? 69  PRO B CD   1  
ATOM   6026   H  HA   . PRO B 1 66  ? 20.766  51.471 67.239 1.00 0.00   ? 69  PRO B HA   1  
ATOM   6027   H  HB2  . PRO B 1 66  ? 18.314  50.563 66.226 1.00 0.00   ? 69  PRO B HB2  1  
ATOM   6028   H  HB3  . PRO B 1 66  ? 19.915  50.182 65.576 1.00 0.00   ? 69  PRO B HB3  1  
ATOM   6029   H  HG2  . PRO B 1 66  ? 18.089  48.414 66.829 1.00 0.00   ? 69  PRO B HG2  1  
ATOM   6030   H  HG3  . PRO B 1 66  ? 19.730  48.064 66.269 1.00 0.00   ? 69  PRO B HG3  1  
ATOM   6031   H  HD2  . PRO B 1 66  ? 18.771  48.607 69.023 1.00 0.00   ? 69  PRO B HD2  1  
ATOM   6032   H  HD3  . PRO B 1 66  ? 20.223  47.733 68.483 1.00 0.00   ? 69  PRO B HD3  1  
ATOM   6033   N  N    . GLY B 1 67  ? 18.787  53.027 67.797 1.00 8.68   ? 70  GLY B N    1  
ATOM   6034   C  CA   . GLY B 1 67  ? 17.804  53.963 68.394 1.00 8.87   ? 70  GLY B CA   1  
ATOM   6035   C  C    . GLY B 1 67  ? 16.532  53.190 68.725 1.00 8.92   ? 70  GLY B C    1  
ATOM   6036   O  O    . GLY B 1 67  ? 16.405  52.023 68.411 1.00 9.37   ? 70  GLY B O    1  
ATOM   6037   H  H    . GLY B 1 67  ? 19.337  53.312 67.038 1.00 0.00   ? 70  GLY B H    1  
ATOM   6038   H  HA2  . GLY B 1 67  ? 18.215  54.393 69.296 1.00 0.00   ? 70  GLY B HA2  1  
ATOM   6039   H  HA3  . GLY B 1 67  ? 17.573  54.746 67.689 1.00 0.00   ? 70  GLY B HA3  1  
ATOM   6040   N  N    . PRO B 1 68  ? 15.604  53.836 69.359 1.00 9.29   ? 71  PRO B N    1  
ATOM   6041   C  CA   . PRO B 1 68  ? 14.310  53.211 69.756 1.00 9.31   ? 71  PRO B CA   1  
ATOM   6042   C  C    . PRO B 1 68  ? 13.303  53.156 68.601 1.00 9.05   ? 71  PRO B C    1  
ATOM   6043   O  O    . PRO B 1 68  ? 13.333  53.973 67.702 1.00 9.79   ? 71  PRO B O    1  
ATOM   6044   C  CB   . PRO B 1 68  ? 13.801  54.133 70.862 1.00 9.84   ? 71  PRO B CB   1  
ATOM   6045   C  CG   . PRO B 1 68  ? 14.378  55.478 70.553 1.00 10.43  ? 71  PRO B CG   1  
ATOM   6046   C  CD   . PRO B 1 68  ? 15.679  55.244 69.777 1.00 9.82   ? 71  PRO B CD   1  
ATOM   6047   H  HA   . PRO B 1 68  ? 14.476  52.225 70.157 1.00 0.00   ? 71  PRO B HA   1  
ATOM   6048   H  HB2  . PRO B 1 68  ? 12.721  54.173 70.847 1.00 0.00   ? 71  PRO B HB2  1  
ATOM   6049   H  HB3  . PRO B 1 68  ? 14.153  53.794 71.824 1.00 0.00   ? 71  PRO B HB3  1  
ATOM   6050   H  HG2  . PRO B 1 68  ? 13.682  56.045 69.949 1.00 0.00   ? 71  PRO B HG2  1  
ATOM   6051   H  HG3  . PRO B 1 68  ? 14.592  56.007 71.467 1.00 0.00   ? 71  PRO B HG3  1  
ATOM   6052   H  HD2  . PRO B 1 68  ? 15.727  55.895 68.915 1.00 0.00   ? 71  PRO B HD2  1  
ATOM   6053   H  HD3  . PRO B 1 68  ? 16.534  55.397 70.417 1.00 0.00   ? 71  PRO B HD3  1  
ATOM   6054   N  N    . LEU B 1 69  ? 12.407  52.203 68.620 1.00 9.74   ? 72  LEU B N    1  
ATOM   6055   C  CA   . LEU B 1 69  ? 11.399  52.111 67.520 1.00 9.75   ? 72  LEU B CA   1  
ATOM   6056   C  C    . LEU B 1 69  ? 10.151  52.954 67.853 1.00 9.72   ? 72  LEU B C    1  
ATOM   6057   O  O    . LEU B 1 69  ? 9.442   52.684 68.801 1.00 12.12  ? 72  LEU B O    1  
ATOM   6058   C  CB   . LEU B 1 69  ? 10.986  50.650 67.335 1.00 9.55   ? 72  LEU B CB   1  
ATOM   6059   C  CG   . LEU B 1 69  ? 9.978   50.545 66.189 1.00 10.22  ? 72  LEU B CG   1  
ATOM   6060   C  CD1  . LEU B 1 69  ? 10.713  50.206 64.892 1.00 11.27  ? 72  LEU B CD1  1  
ATOM   6061   C  CD2  . LEU B 1 69  ? 8.965   49.442 66.503 1.00 11.42  ? 72  LEU B CD2  1  
ATOM   6062   H  H    . LEU B 1 69  ? 12.394  51.554 69.355 1.00 0.00   ? 72  LEU B H    1  
ATOM   6063   H  HA   . LEU B 1 69  ? 11.839  52.474 66.603 1.00 0.00   ? 72  LEU B HA   1  
ATOM   6064   H  HB2  . LEU B 1 69  ? 11.858  50.056 67.104 1.00 0.00   ? 72  LEU B HB2  1  
ATOM   6065   H  HB3  . LEU B 1 69  ? 10.533  50.286 68.245 1.00 0.00   ? 72  LEU B HB3  1  
ATOM   6066   H  HG   . LEU B 1 69  ? 9.463   51.488 66.076 1.00 0.00   ? 72  LEU B HG   1  
ATOM   6067   H  HD11 . LEU B 1 69  ? 11.779  50.227 65.065 1.00 0.00   ? 72  LEU B HD11 1  
ATOM   6068   H  HD12 . LEU B 1 69  ? 10.458  50.931 64.133 1.00 0.00   ? 72  LEU B HD12 1  
ATOM   6069   H  HD13 . LEU B 1 69  ? 10.422  49.221 64.560 1.00 0.00   ? 72  LEU B HD13 1  
ATOM   6070   H  HD21 . LEU B 1 69  ? 8.686   49.494 67.545 1.00 0.00   ? 72  LEU B HD21 1  
ATOM   6071   H  HD22 . LEU B 1 69  ? 9.406   48.478 66.296 1.00 0.00   ? 72  LEU B HD22 1  
ATOM   6072   H  HD23 . LEU B 1 69  ? 8.086   49.575 65.889 1.00 0.00   ? 72  LEU B HD23 1  
ATOM   6073   N  N    . MET B 1 70  ? 9.873   53.959 67.056 1.00 10.24  ? 73  MET B N    1  
ATOM   6074   C  CA   . MET B 1 70  ? 8.687   54.801 67.280 1.00 10.56  ? 73  MET B CA   1  
ATOM   6075   C  C    . MET B 1 70  ? 7.546   54.145 66.535 1.00 10.56  ? 73  MET B C    1  
ATOM   6076   O  O    . MET B 1 70  ? 7.739   53.528 65.506 1.00 10.96  ? 73  MET B O    1  
ATOM   6077   C  CB   . MET B 1 70  ? 8.932   56.208 66.730 1.00 10.84  ? 73  MET B CB   1  
ATOM   6078   C  CG   . MET B 1 70  ? 10.069  56.871 67.510 1.00 13.48  ? 73  MET B CG   1  
ATOM   6079   S  SD   . MET B 1 70  ? 10.501  58.444 66.725 1.00 14.11  ? 73  MET B SD   1  
ATOM   6080   C  CE   . MET B 1 70  ? 12.101  57.932 66.055 1.00 14.24  ? 73  MET B CE   1  
ATOM   6081   H  H    . MET B 1 70  ? 10.455  54.141 66.288 1.00 0.00   ? 73  MET B H    1  
ATOM   6082   H  HA   . MET B 1 70  ? 8.461   54.848 68.336 1.00 0.00   ? 73  MET B HA   1  
ATOM   6083   H  HB2  . MET B 1 70  ? 9.200   56.144 65.685 1.00 0.00   ? 73  MET B HB2  1  
ATOM   6084   H  HB3  . MET B 1 70  ? 8.034   56.798 66.835 1.00 0.00   ? 73  MET B HB3  1  
ATOM   6085   H  HG2  . MET B 1 70  ? 9.751   57.051 68.526 1.00 0.00   ? 73  MET B HG2  1  
ATOM   6086   H  HG3  . MET B 1 70  ? 10.931  56.221 67.512 1.00 0.00   ? 73  MET B HG3  1  
ATOM   6087   H  HE1  . MET B 1 70  ? 12.633  57.353 66.798 1.00 0.00   ? 73  MET B HE1  1  
ATOM   6088   H  HE2  . MET B 1 70  ? 12.678  58.808 65.793 1.00 0.00   ? 73  MET B HE2  1  
ATOM   6089   H  HE3  . MET B 1 70  ? 11.948  57.328 65.175 1.00 0.00   ? 73  MET B HE3  1  
ATOM   6090   N  N    . VAL B 1 71  ? 6.375   54.232 67.049 1.00 10.76  ? 74  VAL B N    1  
ATOM   6091   C  CA   . VAL B 1 71  ? 5.233   53.564 66.369 1.00 10.63  ? 74  VAL B CA   1  
ATOM   6092   C  C    . VAL B 1 71  ? 4.001   54.472 66.301 1.00 10.87  ? 74  VAL B C    1  
ATOM   6093   O  O    . VAL B 1 71  ? 3.440   54.875 67.301 1.00 11.65  ? 74  VAL B O    1  
ATOM   6094   C  CB   . VAL B 1 71  ? 4.873   52.290 67.134 1.00 11.03  ? 74  VAL B CB   1  
ATOM   6095   C  CG1  . VAL B 1 71  ? 3.689   51.601 66.452 1.00 11.90  ? 74  VAL B CG1  1  
ATOM   6096   C  CG2  . VAL B 1 71  ? 6.076   51.344 67.142 1.00 11.80  ? 74  VAL B CG2  1  
ATOM   6097   H  H    . VAL B 1 71  ? 6.239   54.709 67.894 1.00 0.00   ? 74  VAL B H    1  
ATOM   6098   H  HA   . VAL B 1 71  ? 5.529   53.296 65.366 1.00 0.00   ? 74  VAL B HA   1  
ATOM   6099   H  HB   . VAL B 1 71  ? 4.604   52.544 68.150 1.00 0.00   ? 74  VAL B HB   1  
ATOM   6100   H  HG11 . VAL B 1 71  ? 4.026   51.124 65.543 1.00 0.00   ? 74  VAL B HG11 1  
ATOM   6101   H  HG12 . VAL B 1 71  ? 2.934   52.336 66.214 1.00 0.00   ? 74  VAL B HG12 1  
ATOM   6102   H  HG13 . VAL B 1 71  ? 3.273   50.859 67.116 1.00 0.00   ? 74  VAL B HG13 1  
ATOM   6103   H  HG21 . VAL B 1 71  ? 6.901   51.816 67.655 1.00 0.00   ? 74  VAL B HG21 1  
ATOM   6104   H  HG22 . VAL B 1 71  ? 6.364   51.119 66.126 1.00 0.00   ? 74  VAL B HG22 1  
ATOM   6105   H  HG23 . VAL B 1 71  ? 5.811   50.429 67.652 1.00 0.00   ? 74  VAL B HG23 1  
ATOM   6106   N  N    . VAL B 1 72  ? 3.562   54.744 65.107 1.00 11.12  ? 75  VAL B N    1  
ATOM   6107   C  CA   . VAL B 1 72  ? 2.348   55.565 64.885 1.00 11.29  ? 75  VAL B CA   1  
ATOM   6108   C  C    . VAL B 1 72  ? 1.509   54.856 63.811 1.00 11.46  ? 75  VAL B C    1  
ATOM   6109   O  O    . VAL B 1 72  ? 1.895   53.826 63.296 1.00 11.94  ? 75  VAL B O    1  
ATOM   6110   C  CB   . VAL B 1 72  ? 2.745   56.959 64.398 1.00 11.58  ? 75  VAL B CB   1  
ATOM   6111   C  CG1  . VAL B 1 72  ? 3.762   57.568 65.365 1.00 12.03  ? 75  VAL B CG1  1  
ATOM   6112   C  CG2  . VAL B 1 72  ? 3.369   56.853 63.004 1.00 12.24  ? 75  VAL B CG2  1  
ATOM   6113   H  H    . VAL B 1 72  ? 4.028   54.366 64.332 1.00 0.00   ? 75  VAL B H    1  
ATOM   6114   H  HA   . VAL B 1 72  ? 1.782   55.639 65.803 1.00 0.00   ? 75  VAL B HA   1  
ATOM   6115   H  HB   . VAL B 1 72  ? 1.868   57.589 64.355 1.00 0.00   ? 75  VAL B HB   1  
ATOM   6116   H  HG11 . VAL B 1 72  ? 4.720   57.654 64.873 1.00 0.00   ? 75  VAL B HG11 1  
ATOM   6117   H  HG12 . VAL B 1 72  ? 3.859   56.932 66.232 1.00 0.00   ? 75  VAL B HG12 1  
ATOM   6118   H  HG13 . VAL B 1 72  ? 3.425   58.547 65.672 1.00 0.00   ? 75  VAL B HG13 1  
ATOM   6119   H  HG21 . VAL B 1 72  ? 4.207   56.173 63.036 1.00 0.00   ? 75  VAL B HG21 1  
ATOM   6120   H  HG22 . VAL B 1 72  ? 3.708   57.827 62.686 1.00 0.00   ? 75  VAL B HG22 1  
ATOM   6121   H  HG23 . VAL B 1 72  ? 2.632   56.483 62.307 1.00 0.00   ? 75  VAL B HG23 1  
ATOM   6122   N  N    . HIS B 1 73  ? 0.374   55.389 63.468 1.00 12.07  ? 76  HIS B N    1  
ATOM   6123   C  CA   . HIS B 1 73  ? -0.470  54.747 62.441 1.00 12.28  ? 76  HIS B CA   1  
ATOM   6124   C  C    . HIS B 1 73  ? -0.357  55.534 61.143 1.00 12.24  ? 76  HIS B C    1  
ATOM   6125   O  O    . HIS B 1 73  ? 0.160   56.633 61.104 1.00 13.05  ? 76  HIS B O    1  
ATOM   6126   C  CB   . HIS B 1 73  ? -1.927  54.736 62.908 1.00 12.59  ? 76  HIS B CB   1  
ATOM   6127   C  CG   . HIS B 1 73  ? -2.108  53.678 63.962 1.00 12.34  ? 76  HIS B CG   1  
ATOM   6128   N  ND1  . HIS B 1 73  ? -1.783  53.896 65.294 1.00 13.89  ? 76  HIS B ND1  1  
ATOM   6129   C  CD2  . HIS B 1 73  ? -2.579  52.389 63.897 1.00 12.18  ? 76  HIS B CD2  1  
ATOM   6130   C  CE1  . HIS B 1 73  ? -2.060  52.765 65.970 1.00 14.37  ? 76  HIS B CE1  1  
ATOM   6131   N  NE2  . HIS B 1 73  ? -2.546  51.820 65.164 1.00 13.29  ? 76  HIS B NE2  1  
ATOM   6132   H  H    . HIS B 1 73  ? 0.077   56.220 63.894 1.00 0.00   ? 76  HIS B H    1  
ATOM   6133   H  HA   . HIS B 1 73  ? -0.135  53.733 62.280 1.00 0.00   ? 76  HIS B HA   1  
ATOM   6134   H  HB2  . HIS B 1 73  ? -2.180  55.702 63.320 1.00 0.00   ? 76  HIS B HB2  1  
ATOM   6135   H  HB3  . HIS B 1 73  ? -2.573  54.522 62.070 1.00 0.00   ? 76  HIS B HB3  1  
ATOM   6136   H  HD1  . HIS B 1 73  ? -1.418  54.723 65.673 1.00 0.00   ? 76  HIS B HD1  1  
ATOM   6137   H  HD2  . HIS B 1 73  ? -2.922  51.895 63.000 1.00 0.00   ? 76  HIS B HD2  1  
ATOM   6138   H  HE1  . HIS B 1 73  ? -1.907  52.640 67.031 1.00 0.00   ? 76  HIS B HE1  1  
ATOM   6139   H  HE2  . HIS B 1 73  ? -2.823  50.913 65.414 1.00 0.00   ? 76  HIS B HE2  1  
ATOM   6140   N  N    . GLN B 1 74  ? -0.837  54.971 60.085 1.00 12.15  ? 77  GLN B N    1  
ATOM   6141   C  CA   . GLN B 1 74  ? -0.778  55.646 58.770 1.00 12.88  ? 77  GLN B CA   1  
ATOM   6142   C  C    . GLN B 1 74  ? -1.695  56.854 58.804 1.00 14.00  ? 77  GLN B C    1  
ATOM   6143   O  O    . GLN B 1 74  ? -2.821  56.785 59.255 1.00 13.86  ? 77  GLN B O    1  
ATOM   6144   C  CB   . GLN B 1 74  ? -1.239  54.681 57.675 1.00 13.21  ? 77  GLN B CB   1  
ATOM   6145   C  CG   . GLN B 1 74  ? -1.177  55.382 56.317 1.00 14.39  ? 77  GLN B CG   1  
ATOM   6146   C  CD   . GLN B 1 74  ? -1.686  54.434 55.229 1.00 17.51  ? 77  GLN B CD   1  
ATOM   6147   O  OE1  . GLN B 1 74  ? -1.650  54.759 54.059 1.00 23.87  ? 77  GLN B OE1  1  
ATOM   6148   N  NE2  . GLN B 1 74  ? -2.162  53.267 55.568 1.00 19.03  ? 77  GLN B NE2  1  
ATOM   6149   H  H    . GLN B 1 74  ? -1.245  54.083 60.154 1.00 0.00   ? 77  GLN B H    1  
ATOM   6150   H  HA   . GLN B 1 74  ? 0.235   55.964 58.570 1.00 0.00   ? 77  GLN B HA   1  
ATOM   6151   H  HB2  . GLN B 1 74  ? -0.593  53.815 57.664 1.00 0.00   ? 77  GLN B HB2  1  
ATOM   6152   H  HB3  . GLN B 1 74  ? -2.254  54.371 57.872 1.00 0.00   ? 77  GLN B HB3  1  
ATOM   6153   H  HG2  . GLN B 1 74  ? -1.794  56.268 56.341 1.00 0.00   ? 77  GLN B HG2  1  
ATOM   6154   H  HG3  . GLN B 1 74  ? -0.156  55.659 56.101 1.00 0.00   ? 77  GLN B HG3  1  
ATOM   6155   H  HE21 . GLN B 1 74  ? -2.191  53.005 56.512 1.00 0.00   ? 77  GLN B HE21 1  
ATOM   6156   H  HE22 . GLN B 1 74  ? -2.490  52.653 54.879 1.00 0.00   ? 77  GLN B HE22 1  
ATOM   6157   N  N    . ASP B 1 75  ? -1.216  57.961 58.346 1.00 14.71  ? 78  ASP B N    1  
ATOM   6158   C  CA   . ASP B 1 75  ? -2.050  59.195 58.362 1.00 15.86  ? 78  ASP B CA   1  
ATOM   6159   C  C    . ASP B 1 75  ? -1.606  60.089 59.525 1.00 15.68  ? 78  ASP B C    1  
ATOM   6160   O  O    . ASP B 1 75  ? -1.573  61.298 59.414 1.00 16.41  ? 78  ASP B O    1  
ATOM   6161   C  CB   . ASP B 1 75  ? -3.521  58.816 58.541 1.00 17.09  ? 78  ASP B CB   1  
ATOM   6162   C  CG   . ASP B 1 75  ? -3.831  57.566 57.715 1.00 19.31  ? 78  ASP B CG   1  
ATOM   6163   O  OD1  . ASP B 1 75  ? -3.427  57.525 56.565 1.00 23.14  ? 78  ASP B OD1  1  
ATOM   6164   O  OD2  . ASP B 1 75  ? -4.467  56.671 58.248 1.00 24.71  ? 78  ASP B OD2  1  
ATOM   6165   H  H    . ASP B 1 75  ? -0.300  57.992 57.998 1.00 0.00   ? 78  ASP B H    1  
ATOM   6166   H  HA   . ASP B 1 75  ? -1.924  59.727 57.430 1.00 0.00   ? 78  ASP B HA   1  
ATOM   6167   H  HB2  . ASP B 1 75  ? -3.717  58.617 59.585 1.00 0.00   ? 78  ASP B HB2  1  
ATOM   6168   H  HB3  . ASP B 1 75  ? -4.146  59.630 58.206 1.00 0.00   ? 78  ASP B HB3  1  
ATOM   6169   N  N    . ASP B 1 76  ? -1.260  59.501 60.641 1.00 14.56  ? 79  ASP B N    1  
ATOM   6170   C  CA   . ASP B 1 76  ? -0.816  60.314 61.806 1.00 14.34  ? 79  ASP B CA   1  
ATOM   6171   C  C    . ASP B 1 76  ? 0.519   60.995 61.486 1.00 14.07  ? 79  ASP B C    1  
ATOM   6172   O  O    . ASP B 1 76  ? 1.338   60.475 60.754 1.00 13.82  ? 79  ASP B O    1  
ATOM   6173   C  CB   . ASP B 1 76  ? -0.642  59.404 63.024 1.00 13.96  ? 79  ASP B CB   1  
ATOM   6174   C  CG   . ASP B 1 76  ? -2.002  58.838 63.437 1.00 13.95  ? 79  ASP B CG   1  
ATOM   6175   O  OD1  . ASP B 1 76  ? -3.003  59.451 63.103 1.00 14.79  ? 79  ASP B OD1  1  
ATOM   6176   O  OD2  . ASP B 1 76  ? -2.020  57.802 64.081 1.00 14.31  ? 79  ASP B OD2  1  
ATOM   6177   H  H    . ASP B 1 76  ? -1.291  58.524 60.709 1.00 0.00   ? 79  ASP B H    1  
ATOM   6178   H  HA   . ASP B 1 76  ? -1.559  61.066 62.024 1.00 0.00   ? 79  ASP B HA   1  
ATOM   6179   H  HB2  . ASP B 1 76  ? 0.026   58.592 62.775 1.00 0.00   ? 79  ASP B HB2  1  
ATOM   6180   H  HB3  . ASP B 1 76  ? -0.228  59.972 63.843 1.00 0.00   ? 79  ASP B HB3  1  
ATOM   6181   N  N    . TYR B 1 77  ? 0.737   62.156 62.037 1.00 13.74  ? 80  TYR B N    1  
ATOM   6182   C  CA   . TYR B 1 77  ? 2.001   62.892 61.791 1.00 13.94  ? 80  TYR B CA   1  
ATOM   6183   C  C    . TYR B 1 77  ? 2.965   62.657 62.957 1.00 14.40  ? 80  TYR B C    1  
ATOM   6184   O  O    . TYR B 1 77  ? 2.606   62.749 64.114 1.00 15.55  ? 80  TYR B O    1  
ATOM   6185   C  CB   . TYR B 1 77  ? 1.705   64.388 61.667 1.00 14.02  ? 80  TYR B CB   1  
ATOM   6186   C  CG   . TYR B 1 77  ? 0.715   64.614 60.550 1.00 14.38  ? 80  TYR B CG   1  
ATOM   6187   C  CD1  . TYR B 1 77  ? -0.628  64.261 60.722 1.00 15.18  ? 80  TYR B CD1  1  
ATOM   6188   C  CD2  . TYR B 1 77  ? 1.141   65.178 59.341 1.00 14.28  ? 80  TYR B CD2  1  
ATOM   6189   C  CE1  . TYR B 1 77  ? -1.546  64.471 59.686 1.00 15.93  ? 80  TYR B CE1  1  
ATOM   6190   C  CE2  . TYR B 1 77  ? 0.223   65.388 58.305 1.00 14.88  ? 80  TYR B CE2  1  
ATOM   6191   C  CZ   . TYR B 1 77  ? -1.120  65.035 58.478 1.00 15.02  ? 80  TYR B CZ   1  
ATOM   6192   O  OH   . TYR B 1 77  ? -2.025  65.242 57.457 1.00 16.89  ? 80  TYR B OH   1  
ATOM   6193   H  H    . TYR B 1 77  ? 0.057   62.547 62.625 1.00 0.00   ? 80  TYR B H    1  
ATOM   6194   H  HA   . TYR B 1 77  ? 2.451   62.537 60.875 1.00 0.00   ? 80  TYR B HA   1  
ATOM   6195   H  HB2  . TYR B 1 77  ? 1.290   64.750 62.596 1.00 0.00   ? 80  TYR B HB2  1  
ATOM   6196   H  HB3  . TYR B 1 77  ? 2.620   64.919 61.450 1.00 0.00   ? 80  TYR B HB3  1  
ATOM   6197   H  HD1  . TYR B 1 77  ? -0.957  63.826 61.655 1.00 0.00   ? 80  TYR B HD1  1  
ATOM   6198   H  HD2  . TYR B 1 77  ? 2.178   65.451 59.208 1.00 0.00   ? 80  TYR B HD2  1  
ATOM   6199   H  HE1  . TYR B 1 77  ? -2.583  64.199 59.820 1.00 0.00   ? 80  TYR B HE1  1  
ATOM   6200   H  HE2  . TYR B 1 77  ? 0.552   65.823 57.373 1.00 0.00   ? 80  TYR B HE2  1  
ATOM   6201   H  HH   . TYR B 1 77  ? -1.771  66.044 56.993 1.00 0.00   ? 80  TYR B HH   1  
ATOM   6202   N  N    . LEU B 1 78  ? 4.184   62.355 62.640 1.00 13.19  ? 81  LEU B N    1  
ATOM   6203   C  CA   . LEU B 1 78  ? 5.217   62.104 63.667 1.00 12.70  ? 81  LEU B CA   1  
ATOM   6204   C  C    . LEU B 1 78  ? 6.013   63.382 63.844 1.00 12.27  ? 81  LEU B C    1  
ATOM   6205   O  O    . LEU B 1 78  ? 6.593   63.911 62.916 1.00 12.66  ? 81  LEU B O    1  
ATOM   6206   C  CB   . LEU B 1 78  ? 6.142   60.976 63.207 1.00 12.08  ? 81  LEU B CB   1  
ATOM   6207   C  CG   . LEU B 1 78  ? 6.997   60.504 64.384 1.00 12.26  ? 81  LEU B CG   1  
ATOM   6208   C  CD1  . LEU B 1 78  ? 7.520   59.094 64.103 1.00 12.74  ? 81  LEU B CD1  1  
ATOM   6209   C  CD2  . LEU B 1 78  ? 8.180   61.458 64.569 1.00 12.96  ? 81  LEU B CD2  1  
ATOM   6210   H  H    . LEU B 1 78  ? 4.429   62.292 61.693 1.00 0.00   ? 81  LEU B H    1  
ATOM   6211   H  HA   . LEU B 1 78  ? 4.746   61.834 64.601 1.00 0.00   ? 81  LEU B HA   1  
ATOM   6212   H  HB2  . LEU B 1 78  ? 5.549   60.151 62.838 1.00 0.00   ? 81  LEU B HB2  1  
ATOM   6213   H  HB3  . LEU B 1 78  ? 6.786   61.337 62.419 1.00 0.00   ? 81  LEU B HB3  1  
ATOM   6214   H  HG   . LEU B 1 78  ? 6.397   60.492 65.282 1.00 0.00   ? 81  LEU B HG   1  
ATOM   6215   H  HD11 . LEU B 1 78  ? 7.775   59.006 63.057 1.00 0.00   ? 81  LEU B HD11 1  
ATOM   6216   H  HD12 . LEU B 1 78  ? 6.757   58.371 64.350 1.00 0.00   ? 81  LEU B HD12 1  
ATOM   6217   H  HD13 . LEU B 1 78  ? 8.399   58.910 64.704 1.00 0.00   ? 81  LEU B HD13 1  
ATOM   6218   H  HD21 . LEU B 1 78  ? 8.636   61.655 63.610 1.00 0.00   ? 81  LEU B HD21 1  
ATOM   6219   H  HD22 . LEU B 1 78  ? 8.907   61.006 65.228 1.00 0.00   ? 81  LEU B HD22 1  
ATOM   6220   H  HD23 . LEU B 1 78  ? 7.830   62.385 64.999 1.00 0.00   ? 81  LEU B HD23 1  
ATOM   6221   N  N    . GLU B 1 79  ? 6.010   63.893 65.021 1.00 12.80  ? 82  GLU B N    1  
ATOM   6222   C  CA   . GLU B 1 79  ? 6.719   65.158 65.302 1.00 12.91  ? 82  GLU B CA   1  
ATOM   6223   C  C    . GLU B 1 79  ? 7.828   64.821 66.250 1.00 12.94  ? 82  GLU B C    1  
ATOM   6224   O  O    . GLU B 1 79  ? 7.602   64.388 67.362 1.00 14.81  ? 82  GLU B O    1  
ATOM   6225   C  CB   . GLU B 1 79  ? 5.762   66.162 65.950 1.00 14.04  ? 82  GLU B CB   1  
ATOM   6226   C  CG   . GLU B 1 79  ? 6.445   67.527 66.050 1.00 14.82  ? 82  GLU B CG   1  
ATOM   6227   C  CD   . GLU B 1 79  ? 5.388   68.613 66.260 1.00 17.42  ? 82  GLU B CD   1  
ATOM   6228   O  OE1  . GLU B 1 79  ? 4.879   69.115 65.272 1.00 20.58  ? 82  GLU B OE1  1  
ATOM   6229   O  OE2  . GLU B 1 79  ? 5.107   68.924 67.405 1.00 23.22  ? 82  GLU B OE2  1  
ATOM   6230   H  H    . GLU B 1 79  ? 5.509   63.451 65.738 1.00 0.00   ? 82  GLU B H    1  
ATOM   6231   H  HA   . GLU B 1 79  ? 7.124   65.567 64.388 1.00 0.00   ? 82  GLU B HA   1  
ATOM   6232   H  HB2  . GLU B 1 79  ? 4.869   66.248 65.348 1.00 0.00   ? 82  GLU B HB2  1  
ATOM   6233   H  HB3  . GLU B 1 79  ? 5.498   65.821 66.940 1.00 0.00   ? 82  GLU B HB3  1  
ATOM   6234   H  HG2  . GLU B 1 79  ? 7.132   67.526 66.885 1.00 0.00   ? 82  GLU B HG2  1  
ATOM   6235   H  HG3  . GLU B 1 79  ? 6.987   67.727 65.138 1.00 0.00   ? 82  GLU B HG3  1  
ATOM   6236   N  N    . LEU B 1 80  ? 9.023   64.947 65.812 1.00 12.42  ? 83  LEU B N    1  
ATOM   6237   C  CA   . LEU B 1 80  ? 10.147  64.547 66.705 1.00 12.40  ? 83  LEU B CA   1  
ATOM   6238   C  C    . LEU B 1 80  ? 11.080  65.711 67.053 1.00 12.14  ? 83  LEU B C    1  
ATOM   6239   O  O    . LEU B 1 80  ? 11.735  66.282 66.205 1.00 12.47  ? 83  LEU B O    1  
ATOM   6240   C  CB   . LEU B 1 80  ? 10.961  63.452 66.014 1.00 12.68  ? 83  LEU B CB   1  
ATOM   6241   C  CG   . LEU B 1 80  ? 12.365  63.401 66.618 1.00 12.26  ? 83  LEU B CG   1  
ATOM   6242   C  CD1  . LEU B 1 80  ? 12.359  62.495 67.851 1.00 12.44  ? 83  LEU B CD1  1  
ATOM   6243   C  CD2  . LEU B 1 80  ? 13.345  62.845 65.583 1.00 12.26  ? 83  LEU B CD2  1  
ATOM   6244   H  H    . LEU B 1 80  ? 9.193   65.251 64.896 1.00 0.00   ? 83  LEU B H    1  
ATOM   6245   H  HA   . LEU B 1 80  ? 9.739   64.145 67.619 1.00 0.00   ? 83  LEU B HA   1  
ATOM   6246   H  HB2  . LEU B 1 80  ? 10.473  62.499 66.155 1.00 0.00   ? 83  LEU B HB2  1  
ATOM   6247   H  HB3  . LEU B 1 80  ? 11.033  63.668 64.959 1.00 0.00   ? 83  LEU B HB3  1  
ATOM   6248   H  HG   . LEU B 1 80  ? 12.669  64.397 66.906 1.00 0.00   ? 83  LEU B HG   1  
ATOM   6249   H  HD11 . LEU B 1 80  ? 12.874  61.574 67.623 1.00 0.00   ? 83  LEU B HD11 1  
ATOM   6250   H  HD12 . LEU B 1 80  ? 11.339  62.277 68.132 1.00 0.00   ? 83  LEU B HD12 1  
ATOM   6251   H  HD13 . LEU B 1 80  ? 12.859  62.995 68.668 1.00 0.00   ? 83  LEU B HD13 1  
ATOM   6252   H  HD21 . LEU B 1 80  ? 13.337  61.765 65.624 1.00 0.00   ? 83  LEU B HD21 1  
ATOM   6253   H  HD22 . LEU B 1 80  ? 14.340  63.206 65.797 1.00 0.00   ? 83  LEU B HD22 1  
ATOM   6254   H  HD23 . LEU B 1 80  ? 13.049  63.169 64.596 1.00 0.00   ? 83  LEU B HD23 1  
ATOM   6255   N  N    . THR B 1 81  ? 11.191  66.002 68.323 1.00 11.83  ? 84  THR B N    1  
ATOM   6256   C  CA   . THR B 1 81  ? 12.134  67.058 68.788 1.00 12.28  ? 84  THR B CA   1  
ATOM   6257   C  C    . THR B 1 81  ? 13.492  66.380 69.050 1.00 11.68  ? 84  THR B C    1  
ATOM   6258   O  O    . THR B 1 81  ? 13.632  65.564 69.939 1.00 12.47  ? 84  THR B O    1  
ATOM   6259   C  CB   . THR B 1 81  ? 11.611  67.689 70.081 1.00 12.95  ? 84  THR B CB   1  
ATOM   6260   O  OG1  . THR B 1 81  ? 10.407  68.393 69.809 1.00 13.51  ? 84  THR B OG1  1  
ATOM   6261   C  CG2  . THR B 1 81  ? 12.655  68.656 70.638 1.00 13.39  ? 84  THR B CG2  1  
ATOM   6262   H  H    . THR B 1 81  ? 10.688  65.481 68.983 1.00 0.00   ? 84  THR B H    1  
ATOM   6263   H  HA   . THR B 1 81  ? 12.243  67.815 68.023 1.00 0.00   ? 84  THR B HA   1  
ATOM   6264   H  HB   . THR B 1 81  ? 11.419  66.914 70.808 1.00 0.00   ? 84  THR B HB   1  
ATOM   6265   H  HG1  . THR B 1 81  ? 9.673   67.787 69.940 1.00 0.00   ? 84  THR B HG1  1  
ATOM   6266   H  HG21 . THR B 1 81  ? 12.584  69.601 70.119 1.00 0.00   ? 84  THR B HG21 1  
ATOM   6267   H  HG22 . THR B 1 81  ? 13.642  68.241 70.497 1.00 0.00   ? 84  THR B HG22 1  
ATOM   6268   H  HG23 . THR B 1 81  ? 12.477  68.811 71.692 1.00 0.00   ? 84  THR B HG23 1  
ATOM   6269   N  N    . LEU B 1 82  ? 14.470  66.687 68.248 1.00 11.93  ? 85  LEU B N    1  
ATOM   6270   C  CA   . LEU B 1 82  ? 15.783  66.073 68.370 1.00 12.11  ? 85  LEU B CA   1  
ATOM   6271   C  C    . LEU B 1 82  ? 16.664  67.074 69.033 1.00 11.85  ? 85  LEU B C    1  
ATOM   6272   O  O    . LEU B 1 82  ? 16.544  68.268 68.841 1.00 11.96  ? 85  LEU B O    1  
ATOM   6273   C  CB   . LEU B 1 82  ? 16.332  65.730 66.983 1.00 11.83  ? 85  LEU B CB   1  
ATOM   6274   C  CG   . LEU B 1 82  ? 17.626  64.929 67.130 1.00 11.29  ? 85  LEU B CG   1  
ATOM   6275   C  CD1  . LEU B 1 82  ? 17.305  63.531 67.663 1.00 12.39  ? 85  LEU B CD1  1  
ATOM   6276   C  CD2  . LEU B 1 82  ? 18.307  64.808 65.764 1.00 12.62  ? 85  LEU B CD2  1  
ATOM   6277   H  H    . LEU B 1 82  ? 14.308  67.326 67.523 1.00 0.00   ? 85  LEU B H    1  
ATOM   6278   H  HA   . LEU B 1 82  ? 15.720  65.179 68.973 1.00 0.00   ? 85  LEU B HA   1  
ATOM   6279   H  HB2  . LEU B 1 82  ? 15.603  65.143 66.443 1.00 0.00   ? 85  LEU B HB2  1  
ATOM   6280   H  HB3  . LEU B 1 82  ? 16.534  66.641 66.440 1.00 0.00   ? 85  LEU B HB3  1  
ATOM   6281   H  HG   . LEU B 1 82  ? 18.286  65.434 67.820 1.00 0.00   ? 85  LEU B HG   1  
ATOM   6282   H  HD11 . LEU B 1 82  ? 18.189  63.106 68.115 1.00 0.00   ? 85  LEU B HD11 1  
ATOM   6283   H  HD12 . LEU B 1 82  ? 16.978  62.902 66.849 1.00 0.00   ? 85  LEU B HD12 1  
ATOM   6284   H  HD13 . LEU B 1 82  ? 16.521  63.600 68.402 1.00 0.00   ? 85  LEU B HD13 1  
ATOM   6285   H  HD21 . LEU B 1 82  ? 18.558  63.774 65.577 1.00 0.00   ? 85  LEU B HD21 1  
ATOM   6286   H  HD22 . LEU B 1 82  ? 19.208  65.404 65.757 1.00 0.00   ? 85  LEU B HD22 1  
ATOM   6287   H  HD23 . LEU B 1 82  ? 17.636  65.160 64.995 1.00 0.00   ? 85  LEU B HD23 1  
ATOM   6288   N  N    . ILE B 1 83  ? 17.514  66.607 69.836 1.00 11.78  ? 86  ILE B N    1  
ATOM   6289   C  CA   . ILE B 1 83  ? 18.405  67.532 70.578 1.00 12.24  ? 86  ILE B CA   1  
ATOM   6290   C  C    . ILE B 1 83  ? 19.837  67.008 70.587 1.00 11.84  ? 86  ILE B C    1  
ATOM   6291   O  O    . ILE B 1 83  ? 20.115  65.895 70.987 1.00 11.91  ? 86  ILE B O    1  
ATOM   6292   C  CB   . ILE B 1 83  ? 17.907  67.666 72.018 1.00 12.81  ? 86  ILE B CB   1  
ATOM   6293   C  CG1  . ILE B 1 83  ? 16.500  68.269 72.016 1.00 13.35  ? 86  ILE B CG1  1  
ATOM   6294   C  CG2  . ILE B 1 83  ? 18.851  68.579 72.802 1.00 14.25  ? 86  ILE B CG2  1  
ATOM   6295   C  CD1  . ILE B 1 83  ? 15.793  67.920 73.327 1.00 15.52  ? 86  ILE B CD1  1  
ATOM   6296   H  H    . ILE B 1 83  ? 17.566  65.641 69.992 1.00 0.00   ? 86  ILE B H    1  
ATOM   6297   H  HA   . ILE B 1 83  ? 18.383  68.502 70.105 1.00 0.00   ? 86  ILE B HA   1  
ATOM   6298   H  HB   . ILE B 1 83  ? 17.882  66.690 72.482 1.00 0.00   ? 86  ILE B HB   1  
ATOM   6299   H  HG12 . ILE B 1 83  ? 16.569  69.342 71.917 1.00 0.00   ? 86  ILE B HG12 1  
ATOM   6300   H  HG13 . ILE B 1 83  ? 15.937  67.866 71.187 1.00 0.00   ? 86  ILE B HG13 1  
ATOM   6301   H  HG21 . ILE B 1 83  ? 19.331  68.013 73.586 1.00 0.00   ? 86  ILE B HG21 1  
ATOM   6302   H  HG22 . ILE B 1 83  ? 18.287  69.390 73.237 1.00 0.00   ? 86  ILE B HG22 1  
ATOM   6303   H  HG23 . ILE B 1 83  ? 19.601  68.979 72.135 1.00 0.00   ? 86  ILE B HG23 1  
ATOM   6304   H  HD11 . ILE B 1 83  ? 14.979  68.611 73.491 1.00 0.00   ? 86  ILE B HD11 1  
ATOM   6305   H  HD12 . ILE B 1 83  ? 16.496  67.990 74.144 1.00 0.00   ? 86  ILE B HD12 1  
ATOM   6306   H  HD13 . ILE B 1 83  ? 15.406  66.914 73.270 1.00 0.00   ? 86  ILE B HD13 1  
ATOM   6307   N  N    . ASN B 1 84  ? 20.741  67.833 70.165 1.00 12.07  ? 87  ASN B N    1  
ATOM   6308   C  CA   . ASN B 1 84  ? 22.186  67.464 70.145 1.00 12.27  ? 87  ASN B CA   1  
ATOM   6309   C  C    . ASN B 1 84  ? 22.892  68.280 71.230 1.00 12.65  ? 87  ASN B C    1  
ATOM   6310   O  O    . ASN B 1 84  ? 23.207  69.440 71.052 1.00 13.14  ? 87  ASN B O    1  
ATOM   6311   C  CB   . ASN B 1 84  ? 22.785  67.795 68.776 1.00 12.08  ? 87  ASN B CB   1  
ATOM   6312   C  CG   . ASN B 1 84  ? 24.167  67.151 68.653 1.00 11.07  ? 87  ASN B CG   1  
ATOM   6313   O  OD1  . ASN B 1 84  ? 24.519  66.289 69.433 1.00 13.11  ? 87  ASN B OD1  1  
ATOM   6314   N  ND2  . ASN B 1 84  ? 24.970  67.535 67.699 1.00 11.59  ? 87  ASN B ND2  1  
ATOM   6315   H  H    . ASN B 1 84  ? 20.472  68.727 69.868 1.00 0.00   ? 87  ASN B H    1  
ATOM   6316   H  HA   . ASN B 1 84  ? 22.297  66.409 70.350 1.00 0.00   ? 87  ASN B HA   1  
ATOM   6317   H  HB2  . ASN B 1 84  ? 22.138  67.414 67.998 1.00 0.00   ? 87  ASN B HB2  1  
ATOM   6318   H  HB3  . ASN B 1 84  ? 22.879  68.866 68.673 1.00 0.00   ? 87  ASN B HB3  1  
ATOM   6319   H  HD21 . ASN B 1 84  ? 24.686  68.230 67.070 1.00 0.00   ? 87  ASN B HD21 1  
ATOM   6320   H  HD22 . ASN B 1 84  ? 25.857  67.128 67.612 1.00 0.00   ? 87  ASN B HD22 1  
ATOM   6321   N  N    . PRO B 1 85  ? 23.090  67.671 72.357 1.00 13.27  ? 88  PRO B N    1  
ATOM   6322   C  CA   . PRO B 1 85  ? 23.715  68.306 73.551 1.00 14.19  ? 88  PRO B CA   1  
ATOM   6323   C  C    . PRO B 1 85  ? 25.043  68.981 73.250 1.00 14.21  ? 88  PRO B C    1  
ATOM   6324   O  O    . PRO B 1 85  ? 25.787  68.567 72.384 1.00 13.72  ? 88  PRO B O    1  
ATOM   6325   C  CB   . PRO B 1 85  ? 23.925  67.145 74.525 1.00 14.74  ? 88  PRO B CB   1  
ATOM   6326   C  CG   . PRO B 1 85  ? 22.940  66.102 74.120 1.00 18.21  ? 88  PRO B CG   1  
ATOM   6327   C  CD   . PRO B 1 85  ? 22.725  66.269 72.618 1.00 14.38  ? 88  PRO B CD   1  
ATOM   6328   H  HA   . PRO B 1 85  ? 23.033  69.015 73.990 1.00 0.00   ? 88  PRO B HA   1  
ATOM   6329   H  HB2  . PRO B 1 85  ? 24.934  66.765 74.440 1.00 0.00   ? 88  PRO B HB2  1  
ATOM   6330   H  HB3  . PRO B 1 85  ? 23.728  67.464 75.537 1.00 0.00   ? 88  PRO B HB3  1  
ATOM   6331   H  HG2  . PRO B 1 85  ? 23.335  65.118 74.335 1.00 0.00   ? 88  PRO B HG2  1  
ATOM   6332   H  HG3  . PRO B 1 85  ? 22.007  66.251 74.639 1.00 0.00   ? 88  PRO B HG3  1  
ATOM   6333   H  HD2  . PRO B 1 85  ? 23.370  65.598 72.067 1.00 0.00   ? 88  PRO B HD2  1  
ATOM   6334   H  HD3  . PRO B 1 85  ? 21.691  66.100 72.361 1.00 0.00   ? 88  PRO B HD3  1  
ATOM   6335   N  N    . GLU B 1 86  ? 25.349  70.013 73.978 1.00 15.16  ? 89  GLU B N    1  
ATOM   6336   C  CA   . GLU B 1 86  ? 26.644  70.718 73.757 1.00 16.40  ? 89  GLU B CA   1  
ATOM   6337   C  C    . GLU B 1 86  ? 27.821  69.775 74.072 1.00 15.78  ? 89  GLU B C    1  
ATOM   6338   O  O    . GLU B 1 86  ? 28.910  69.947 73.563 1.00 17.16  ? 89  GLU B O    1  
ATOM   6339   C  CB   . GLU B 1 86  ? 26.717  71.943 74.671 1.00 16.77  ? 89  GLU B CB   1  
ATOM   6340   C  CG   . GLU B 1 86  ? 26.380  71.530 76.105 1.00 19.72  ? 89  GLU B CG   1  
ATOM   6341   C  CD   . GLU B 1 86  ? 26.191  72.781 76.966 1.00 25.57  ? 89  GLU B CD   1  
ATOM   6342   O  OE1  . GLU B 1 86  ? 26.334  73.870 76.433 1.00 29.05  ? 89  GLU B OE1  1  
ATOM   6343   O  OE2  . GLU B 1 86  ? 25.908  72.630 78.143 1.00 29.16  ? 89  GLU B OE2  1  
ATOM   6344   H  H    . GLU B 1 86  ? 24.736  70.319 74.679 1.00 0.00   ? 89  GLU B H    1  
ATOM   6345   H  HA   . GLU B 1 86  ? 26.707  71.037 72.727 1.00 0.00   ? 89  GLU B HA   1  
ATOM   6346   H  HB2  . GLU B 1 86  ? 27.715  72.356 74.640 1.00 0.00   ? 89  GLU B HB2  1  
ATOM   6347   H  HB3  . GLU B 1 86  ? 26.009  72.685 74.336 1.00 0.00   ? 89  GLU B HB3  1  
ATOM   6348   H  HG2  . GLU B 1 86  ? 25.469  70.950 76.108 1.00 0.00   ? 89  GLU B HG2  1  
ATOM   6349   H  HG3  . GLU B 1 86  ? 27.186  70.937 76.509 1.00 0.00   ? 89  GLU B HG3  1  
ATOM   6350   N  N    . THR B 1 87  ? 27.617  68.785 74.908 1.00 15.95  ? 90  THR B N    1  
ATOM   6351   C  CA   . THR B 1 87  ? 28.733  67.851 75.246 1.00 16.50  ? 90  THR B CA   1  
ATOM   6352   C  C    . THR B 1 87  ? 29.220  67.119 73.986 1.00 15.90  ? 90  THR B C    1  
ATOM   6353   O  O    . THR B 1 87  ? 30.362  66.714 73.899 1.00 16.74  ? 90  THR B O    1  
ATOM   6354   C  CB   . THR B 1 87  ? 28.241  66.824 76.269 1.00 16.99  ? 90  THR B CB   1  
ATOM   6355   O  OG1  . THR B 1 87  ? 26.997  66.290 75.840 1.00 18.42  ? 90  THR B OG1  1  
ATOM   6356   C  CG2  . THR B 1 87  ? 28.067  67.500 77.630 1.00 18.40  ? 90  THR B CG2  1  
ATOM   6357   H  H    . THR B 1 87  ? 26.734  68.661 75.315 1.00 0.00   ? 90  THR B H    1  
ATOM   6358   H  HA   . THR B 1 87  ? 29.552  68.413 75.671 1.00 0.00   ? 90  THR B HA   1  
ATOM   6359   H  HB   . THR B 1 87  ? 28.965  66.028 76.357 1.00 0.00   ? 90  THR B HB   1  
ATOM   6360   H  HG1  . THR B 1 87  ? 27.151  65.785 75.038 1.00 0.00   ? 90  THR B HG1  1  
ATOM   6361   H  HG21 . THR B 1 87  ? 27.597  68.463 77.496 1.00 0.00   ? 90  THR B HG21 1  
ATOM   6362   H  HG22 . THR B 1 87  ? 29.034  67.633 78.092 1.00 0.00   ? 90  THR B HG22 1  
ATOM   6363   H  HG23 . THR B 1 87  ? 27.448  66.881 78.262 1.00 0.00   ? 90  THR B HG23 1  
ATOM   6364   N  N    . ASN B 1 88  ? 28.366  66.938 73.014 1.00 13.94  ? 91  ASN B N    1  
ATOM   6365   C  CA   . ASN B 1 88  ? 28.783  66.225 71.776 1.00 13.82  ? 91  ASN B CA   1  
ATOM   6366   C  C    . ASN B 1 88  ? 29.751  67.099 70.982 1.00 13.84  ? 91  ASN B C    1  
ATOM   6367   O  O    . ASN B 1 88  ? 29.892  68.279 71.236 1.00 14.77  ? 91  ASN B O    1  
ATOM   6368   C  CB   . ASN B 1 88  ? 27.549  65.925 70.921 1.00 13.05  ? 91  ASN B CB   1  
ATOM   6369   C  CG   . ASN B 1 88  ? 26.757  64.779 71.552 1.00 13.92  ? 91  ASN B CG   1  
ATOM   6370   O  OD1  . ASN B 1 88  ? 27.269  64.056 72.382 1.00 13.31  ? 91  ASN B OD1  1  
ATOM   6371   N  ND2  . ASN B 1 88  ? 25.519  64.582 71.190 1.00 14.26  ? 91  ASN B ND2  1  
ATOM   6372   H  H    . ASN B 1 88  ? 27.447  67.266 73.104 1.00 0.00   ? 91  ASN B H    1  
ATOM   6373   H  HA   . ASN B 1 88  ? 29.269  65.298 72.041 1.00 0.00   ? 91  ASN B HA   1  
ATOM   6374   H  HB2  . ASN B 1 88  ? 26.927  66.807 70.866 1.00 0.00   ? 91  ASN B HB2  1  
ATOM   6375   H  HB3  . ASN B 1 88  ? 27.861  65.641 69.927 1.00 0.00   ? 91  ASN B HB3  1  
ATOM   6376   H  HD21 . ASN B 1 88  ? 25.105  65.165 70.520 1.00 0.00   ? 91  ASN B HD21 1  
ATOM   6377   H  HD22 . ASN B 1 88  ? 25.002  63.850 71.588 1.00 0.00   ? 91  ASN B HD22 1  
ATOM   6378   N  N    . THR B 1 89  ? 30.420  66.528 70.020 1.00 13.79  ? 92  THR B N    1  
ATOM   6379   C  CA   . THR B 1 89  ? 31.386  67.328 69.202 1.00 15.04  ? 92  THR B CA   1  
ATOM   6380   C  C    . THR B 1 89  ? 31.090  67.257 67.677 1.00 14.17  ? 92  THR B C    1  
ATOM   6381   O  O    . THR B 1 89  ? 31.842  67.801 66.893 1.00 16.20  ? 92  THR B O    1  
ATOM   6382   C  CB   . THR B 1 89  ? 32.801  66.805 69.456 1.00 15.36  ? 92  THR B CB   1  
ATOM   6383   O  OG1  . THR B 1 89  ? 32.986  65.586 68.750 1.00 19.91  ? 92  THR B OG1  1  
ATOM   6384   C  CG2  . THR B 1 89  ? 32.997  66.564 70.954 1.00 17.89  ? 92  THR B CG2  1  
ATOM   6385   H  H    . THR B 1 89  ? 30.290  65.575 69.831 1.00 0.00   ? 92  THR B H    1  
ATOM   6386   H  HA   . THR B 1 89  ? 31.338  68.359 69.518 1.00 0.00   ? 92  THR B HA   1  
ATOM   6387   H  HB   . THR B 1 89  ? 33.521  67.532 69.116 1.00 0.00   ? 92  THR B HB   1  
ATOM   6388   H  HG1  . THR B 1 89  ? 33.611  65.049 69.243 1.00 0.00   ? 92  THR B HG1  1  
ATOM   6389   H  HG21 . THR B 1 89  ? 33.547  67.389 71.382 1.00 0.00   ? 92  THR B HG21 1  
ATOM   6390   H  HG22 . THR B 1 89  ? 33.550  65.648 71.102 1.00 0.00   ? 92  THR B HG22 1  
ATOM   6391   H  HG23 . THR B 1 89  ? 32.034  66.485 71.435 1.00 0.00   ? 92  THR B HG23 1  
ATOM   6392   N  N    . LEU B 1 90  ? 30.027  66.616 67.225 1.00 12.70  ? 93  LEU B N    1  
ATOM   6393   C  CA   . LEU B 1 90  ? 29.779  66.579 65.742 1.00 12.38  ? 93  LEU B CA   1  
ATOM   6394   C  C    . LEU B 1 90  ? 28.313  66.925 65.415 1.00 11.92  ? 93  LEU B C    1  
ATOM   6395   O  O    . LEU B 1 90  ? 27.403  66.504 66.100 1.00 12.42  ? 93  LEU B O    1  
ATOM   6396   C  CB   . LEU B 1 90  ? 30.093  65.177 65.216 1.00 12.74  ? 93  LEU B CB   1  
ATOM   6397   C  CG   . LEU B 1 90  ? 31.468  64.738 65.723 1.00 14.42  ? 93  LEU B CG   1  
ATOM   6398   C  CD1  . LEU B 1 90  ? 31.595  63.218 65.601 1.00 15.19  ? 93  LEU B CD1  1  
ATOM   6399   C  CD2  . LEU B 1 90  ? 32.558  65.409 64.884 1.00 17.48  ? 93  LEU B CD2  1  
ATOM   6400   H  H    . LEU B 1 90  ? 29.409  66.176 67.845 1.00 0.00   ? 93  LEU B H    1  
ATOM   6401   H  HA   . LEU B 1 90  ? 30.428  67.292 65.257 1.00 0.00   ? 93  LEU B HA   1  
ATOM   6402   H  HB2  . LEU B 1 90  ? 29.341  64.485 65.565 1.00 0.00   ? 93  LEU B HB2  1  
ATOM   6403   H  HB3  . LEU B 1 90  ? 30.097  65.191 64.136 1.00 0.00   ? 93  LEU B HB3  1  
ATOM   6404   H  HG   . LEU B 1 90  ? 31.578  65.026 66.758 1.00 0.00   ? 93  LEU B HG   1  
ATOM   6405   H  HD11 . LEU B 1 90  ? 32.142  62.974 64.702 1.00 0.00   ? 93  LEU B HD11 1  
ATOM   6406   H  HD12 . LEU B 1 90  ? 30.611  62.777 65.554 1.00 0.00   ? 93  LEU B HD12 1  
ATOM   6407   H  HD13 . LEU B 1 90  ? 32.123  62.831 66.460 1.00 0.00   ? 93  LEU B HD13 1  
ATOM   6408   H  HD21 . LEU B 1 90  ? 32.291  65.357 63.839 1.00 0.00   ? 93  LEU B HD21 1  
ATOM   6409   H  HD22 . LEU B 1 90  ? 33.497  64.900 65.041 1.00 0.00   ? 93  LEU B HD22 1  
ATOM   6410   H  HD23 . LEU B 1 90  ? 32.655  66.443 65.180 1.00 0.00   ? 93  LEU B HD23 1  
ATOM   6411   N  N    . MET B 1 91  ? 28.075  67.673 64.351 1.00 11.75  ? 94  MET B N    1  
ATOM   6412   C  CA   . MET B 1 91  ? 26.671  68.009 63.982 1.00 11.31  ? 94  MET B CA   1  
ATOM   6413   C  C    . MET B 1 91  ? 25.999  66.758 63.405 1.00 10.86  ? 94  MET B C    1  
ATOM   6414   O  O    . MET B 1 91  ? 26.606  65.998 62.677 1.00 11.86  ? 94  MET B O    1  
ATOM   6415   C  CB   . MET B 1 91  ? 26.669  69.122 62.931 1.00 12.10  ? 94  MET B CB   1  
ATOM   6416   C  CG   . MET B 1 91  ? 25.294  69.195 62.266 1.00 12.94  ? 94  MET B CG   1  
ATOM   6417   S  SD   . MET B 1 91  ? 25.079  67.771 61.169 1.00 14.83  ? 94  MET B SD   1  
ATOM   6418   C  CE   . MET B 1 91  ? 25.726  68.542 59.666 1.00 15.72  ? 94  MET B CE   1  
ATOM   6419   H  H    . MET B 1 91  ? 28.818  67.991 63.797 1.00 0.00   ? 94  MET B H    1  
ATOM   6420   H  HA   . MET B 1 91  ? 26.134  68.337 64.860 1.00 0.00   ? 94  MET B HA   1  
ATOM   6421   H  HB2  . MET B 1 91  ? 26.890  70.067 63.407 1.00 0.00   ? 94  MET B HB2  1  
ATOM   6422   H  HB3  . MET B 1 91  ? 27.419  68.912 62.183 1.00 0.00   ? 94  MET B HB3  1  
ATOM   6423   H  HG2  . MET B 1 91  ? 24.526  69.184 63.025 1.00 0.00   ? 94  MET B HG2  1  
ATOM   6424   H  HG3  . MET B 1 91  ? 25.220  70.106 61.691 1.00 0.00   ? 94  MET B HG3  1  
ATOM   6425   H  HE1  . MET B 1 91  ? 25.155  68.201 58.813 1.00 0.00   ? 94  MET B HE1  1  
ATOM   6426   H  HE2  . MET B 1 91  ? 26.765  68.270 59.542 1.00 0.00   ? 94  MET B HE2  1  
ATOM   6427   H  HE3  . MET B 1 91  ? 25.644  69.614 59.745 1.00 0.00   ? 94  MET B HE3  1  
ATOM   6428   N  N    . HIS B 1 92  ? 24.755  66.529 63.731 1.00 10.72  ? 95  HIS B N    1  
ATOM   6429   C  CA   . HIS B 1 92  ? 24.061  65.327 63.210 1.00 10.51  ? 95  HIS B CA   1  
ATOM   6430   C  C    . HIS B 1 92  ? 22.870  65.731 62.334 1.00 10.77  ? 95  HIS B C    1  
ATOM   6431   O  O    . HIS B 1 92  ? 22.846  66.781 61.723 1.00 11.57  ? 95  HIS B O    1  
ATOM   6432   C  CB   . HIS B 1 92  ? 23.559  64.496 64.392 1.00 10.43  ? 95  HIS B CB   1  
ATOM   6433   C  CG   . HIS B 1 92  ? 24.736  63.984 65.175 1.00 10.28  ? 95  HIS B CG   1  
ATOM   6434   N  ND1  . HIS B 1 92  ? 25.538  62.973 64.699 1.00 9.70   ? 95  HIS B ND1  1  
ATOM   6435   C  CD2  . HIS B 1 92  ? 25.243  64.333 66.379 1.00 10.65  ? 95  HIS B CD2  1  
ATOM   6436   C  CE1  . HIS B 1 92  ? 26.507  62.752 65.573 1.00 10.18  ? 95  HIS B CE1  1  
ATOM   6437   N  NE2  . HIS B 1 92  ? 26.345  63.554 66.612 1.00 10.80  ? 95  HIS B NE2  1  
ATOM   6438   H  H    . HIS B 1 92  ? 24.283  67.148 64.326 1.00 0.00   ? 95  HIS B H    1  
ATOM   6439   H  HA   . HIS B 1 92  ? 24.752  64.737 62.628 1.00 0.00   ? 95  HIS B HA   1  
ATOM   6440   H  HB2  . HIS B 1 92  ? 22.941  65.111 65.029 1.00 0.00   ? 95  HIS B HB2  1  
ATOM   6441   H  HB3  . HIS B 1 92  ? 22.980  63.661 64.026 1.00 0.00   ? 95  HIS B HB3  1  
ATOM   6442   H  HD2  . HIS B 1 92  ? 24.849  65.091 67.040 1.00 0.00   ? 95  HIS B HD2  1  
ATOM   6443   H  HE1  . HIS B 1 92  ? 27.303  62.032 65.457 1.00 0.00   ? 95  HIS B HE1  1  
ATOM   6444   H  HE2  . HIS B 1 92  ? 26.914  63.585 67.409 1.00 0.00   ? 95  HIS B HE2  1  
ATOM   6445   N  N    . ASN B 1 93  ? 21.891  64.877 62.277 1.00 10.64  ? 96  ASN B N    1  
ATOM   6446   C  CA   . ASN B 1 93  ? 20.666  65.126 61.456 1.00 10.44  ? 96  ASN B CA   1  
ATOM   6447   C  C    . ASN B 1 93  ? 19.889  63.802 61.352 1.00 10.33  ? 96  ASN B C    1  
ATOM   6448   O  O    . ASN B 1 93  ? 20.461  62.739 61.493 1.00 10.68  ? 96  ASN B O    1  
ATOM   6449   C  CB   . ASN B 1 93  ? 21.069  65.600 60.058 1.00 10.74  ? 96  ASN B CB   1  
ATOM   6450   C  CG   . ASN B 1 93  ? 21.412  64.390 59.187 1.00 11.43  ? 96  ASN B CG   1  
ATOM   6451   O  OD1  . ASN B 1 93  ? 21.578  63.295 59.687 1.00 12.52  ? 96  ASN B OD1  1  
ATOM   6452   N  ND2  . ASN B 1 93  ? 21.525  64.542 57.896 1.00 12.19  ? 96  ASN B ND2  1  
ATOM   6453   H  H    . ASN B 1 93  ? 21.961  64.041 62.783 1.00 0.00   ? 96  ASN B H    1  
ATOM   6454   H  HA   . ASN B 1 93  ? 20.051  65.874 61.936 1.00 0.00   ? 96  ASN B HA   1  
ATOM   6455   H  HB2  . ASN B 1 93  ? 20.249  66.145 59.613 1.00 0.00   ? 96  ASN B HB2  1  
ATOM   6456   H  HB3  . ASN B 1 93  ? 21.932  66.244 60.131 1.00 0.00   ? 96  ASN B HB3  1  
ATOM   6457   H  HD21 . ASN B 1 93  ? 21.391  65.425 57.493 1.00 0.00   ? 96  ASN B HD21 1  
ATOM   6458   H  HD22 . ASN B 1 93  ? 21.744  63.773 57.330 1.00 0.00   ? 96  ASN B HD22 1  
ATOM   6459   N  N    . ILE B 1 94  ? 18.598  63.838 61.122 1.00 10.79  ? 97  ILE B N    1  
ATOM   6460   C  CA   . ILE B 1 94  ? 17.840  62.552 61.036 1.00 11.22  ? 97  ILE B CA   1  
ATOM   6461   C  C    . ILE B 1 94  ? 17.067  62.446 59.712 1.00 10.98  ? 97  ILE B C    1  
ATOM   6462   O  O    . ILE B 1 94  ? 16.331  63.336 59.334 1.00 12.08  ? 97  ILE B O    1  
ATOM   6463   C  CB   . ILE B 1 94  ? 16.852  62.474 62.201 1.00 11.16  ? 97  ILE B CB   1  
ATOM   6464   C  CG1  . ILE B 1 94  ? 16.157  61.111 62.188 1.00 11.42  ? 97  ILE B CG1  1  
ATOM   6465   C  CG2  . ILE B 1 94  ? 15.804  63.580 62.057 1.00 12.64  ? 97  ILE B CG2  1  
ATOM   6466   C  CD1  . ILE B 1 94  ? 15.793  60.710 63.619 1.00 11.81  ? 97  ILE B CD1  1  
ATOM   6467   H  H    . ILE B 1 94  ? 18.135  64.696 61.019 1.00 0.00   ? 97  ILE B H    1  
ATOM   6468   H  HA   . ILE B 1 94  ? 18.533  61.728 61.108 1.00 0.00   ? 97  ILE B HA   1  
ATOM   6469   H  HB   . ILE B 1 94  ? 17.384  62.602 63.133 1.00 0.00   ? 97  ILE B HB   1  
ATOM   6470   H  HG12 . ILE B 1 94  ? 15.259  61.170 61.590 1.00 0.00   ? 97  ILE B HG12 1  
ATOM   6471   H  HG13 . ILE B 1 94  ? 16.823  60.372 61.768 1.00 0.00   ? 97  ILE B HG13 1  
ATOM   6472   H  HG21 . ILE B 1 94  ? 15.382  63.804 63.026 1.00 0.00   ? 97  ILE B HG21 1  
ATOM   6473   H  HG22 . ILE B 1 94  ? 15.021  63.249 61.391 1.00 0.00   ? 97  ILE B HG22 1  
ATOM   6474   H  HG23 . ILE B 1 94  ? 16.270  64.467 61.654 1.00 0.00   ? 97  ILE B HG23 1  
ATOM   6475   H  HD11 . ILE B 1 94  ? 15.009  61.356 63.986 1.00 0.00   ? 97  ILE B HD11 1  
ATOM   6476   H  HD12 . ILE B 1 94  ? 16.663  60.804 64.252 1.00 0.00   ? 97  ILE B HD12 1  
ATOM   6477   H  HD13 . ILE B 1 94  ? 15.450  59.686 63.630 1.00 0.00   ? 97  ILE B HD13 1  
ATOM   6478   N  N    . ASP B 1 95  ? 17.211  61.338 59.025 1.00 11.17  ? 98  ASP B N    1  
ATOM   6479   C  CA   . ASP B 1 95  ? 16.470  61.131 57.746 1.00 12.32  ? 98  ASP B CA   1  
ATOM   6480   C  C    . ASP B 1 95  ? 15.568  59.896 57.897 1.00 11.28  ? 98  ASP B C    1  
ATOM   6481   O  O    . ASP B 1 95  ? 16.037  58.776 57.934 1.00 12.16  ? 98  ASP B O    1  
ATOM   6482   C  CB   . ASP B 1 95  ? 17.466  60.904 56.607 1.00 12.26  ? 98  ASP B CB   1  
ATOM   6483   C  CG   . ASP B 1 95  ? 16.794  60.096 55.495 1.00 15.60  ? 98  ASP B CG   1  
ATOM   6484   O  OD1  . ASP B 1 95  ? 15.602  59.857 55.601 1.00 17.76  ? 98  ASP B OD1  1  
ATOM   6485   O  OD2  . ASP B 1 95  ? 17.482  59.730 54.556 1.00 20.67  ? 98  ASP B OD2  1  
ATOM   6486   H  H    . ASP B 1 95  ? 17.793  60.628 59.368 1.00 0.00   ? 98  ASP B H    1  
ATOM   6487   H  HA   . ASP B 1 95  ? 15.864  62.000 57.533 1.00 0.00   ? 98  ASP B HA   1  
ATOM   6488   H  HB2  . ASP B 1 95  ? 17.789  61.858 56.215 1.00 0.00   ? 98  ASP B HB2  1  
ATOM   6489   H  HB3  . ASP B 1 95  ? 18.320  60.359 56.978 1.00 0.00   ? 98  ASP B HB3  1  
ATOM   6490   N  N    . PHE B 1 96  ? 14.279  60.094 58.005 1.00 10.49  ? 99  PHE B N    1  
ATOM   6491   C  CA   . PHE B 1 96  ? 13.351  58.944 58.176 1.00 10.12  ? 99  PHE B CA   1  
ATOM   6492   C  C    . PHE B 1 96  ? 12.870  58.443 56.814 1.00 9.90   ? 99  PHE B C    1  
ATOM   6493   O  O    . PHE B 1 96  ? 12.180  59.131 56.088 1.00 10.12  ? 99  PHE B O    1  
ATOM   6494   C  CB   . PHE B 1 96  ? 12.146  59.385 59.008 1.00 10.40  ? 99  PHE B CB   1  
ATOM   6495   C  CG   . PHE B 1 96  ? 12.566  59.566 60.447 1.00 10.28  ? 99  PHE B CG   1  
ATOM   6496   C  CD1  . PHE B 1 96  ? 12.518  58.481 61.331 1.00 10.03  ? 99  PHE B CD1  1  
ATOM   6497   C  CD2  . PHE B 1 96  ? 13.004  60.817 60.897 1.00 10.74  ? 99  PHE B CD2  1  
ATOM   6498   C  CE1  . PHE B 1 96  ? 12.908  58.649 62.666 1.00 11.32  ? 99  PHE B CE1  1  
ATOM   6499   C  CE2  . PHE B 1 96  ? 13.393  60.984 62.231 1.00 11.79  ? 99  PHE B CE2  1  
ATOM   6500   C  CZ   . PHE B 1 96  ? 13.345  59.900 63.116 1.00 11.99  ? 99  PHE B CZ   1  
ATOM   6501   H  H    . PHE B 1 96  ? 13.924  61.007 57.987 1.00 0.00   ? 99  PHE B H    1  
ATOM   6502   H  HA   . PHE B 1 96  ? 13.864  58.145 58.689 1.00 0.00   ? 99  PHE B HA   1  
ATOM   6503   H  HB2  . PHE B 1 96  ? 11.766  60.320 58.623 1.00 0.00   ? 99  PHE B HB2  1  
ATOM   6504   H  HB3  . PHE B 1 96  ? 11.374  58.632 58.951 1.00 0.00   ? 99  PHE B HB3  1  
ATOM   6505   H  HD1  . PHE B 1 96  ? 12.181  57.516 60.985 1.00 0.00   ? 99  PHE B HD1  1  
ATOM   6506   H  HD2  . PHE B 1 96  ? 13.040  61.653 60.215 1.00 0.00   ? 99  PHE B HD2  1  
ATOM   6507   H  HE1  . PHE B 1 96  ? 12.871  57.812 63.348 1.00 0.00   ? 99  PHE B HE1  1  
ATOM   6508   H  HE2  . PHE B 1 96  ? 13.731  61.950 62.578 1.00 0.00   ? 99  PHE B HE2  1  
ATOM   6509   H  HZ   . PHE B 1 96  ? 13.646  60.029 64.145 1.00 0.00   ? 99  PHE B HZ   1  
ATOM   6510   N  N    . HIS B 1 97  ? 13.220  57.236 56.480 1.00 9.77   ? 100 HIS B N    1  
ATOM   6511   C  CA   . HIS B 1 97  ? 12.786  56.642 55.181 1.00 9.88   ? 100 HIS B CA   1  
ATOM   6512   C  C    . HIS B 1 97  ? 11.254  56.749 55.026 1.00 10.15  ? 100 HIS B C    1  
ATOM   6513   O  O    . HIS B 1 97  ? 10.738  56.768 53.926 1.00 10.75  ? 100 HIS B O    1  
ATOM   6514   C  CB   . HIS B 1 97  ? 13.163  55.154 55.169 1.00 9.66   ? 100 HIS B CB   1  
ATOM   6515   C  CG   . HIS B 1 97  ? 14.576  54.951 54.678 1.00 8.95   ? 100 HIS B CG   1  
ATOM   6516   N  ND1  . HIS B 1 97  ? 14.870  54.092 53.627 1.00 8.97   ? 100 HIS B ND1  1  
ATOM   6517   C  CD2  . HIS B 1 97  ? 15.786  55.438 55.099 1.00 8.17   ? 100 HIS B CD2  1  
ATOM   6518   C  CE1  . HIS B 1 97  ? 16.195  54.080 53.456 1.00 9.65   ? 100 HIS B CE1  1  
ATOM   6519   N  NE2  . HIS B 1 97  ? 16.778  54.885 54.327 1.00 9.02   ? 100 HIS B NE2  1  
ATOM   6520   H  H    . HIS B 1 97  ? 13.766  56.704 57.096 1.00 0.00   ? 100 HIS B H    1  
ATOM   6521   H  HA   . HIS B 1 97  ? 13.275  57.147 54.363 1.00 0.00   ? 100 HIS B HA   1  
ATOM   6522   H  HB2  . HIS B 1 97  ? 13.078  54.759 56.170 1.00 0.00   ? 100 HIS B HB2  1  
ATOM   6523   H  HB3  . HIS B 1 97  ? 12.482  54.622 54.520 1.00 0.00   ? 100 HIS B HB3  1  
ATOM   6524   H  HD1  . HIS B 1 97  ? 14.218  53.583 53.102 1.00 0.00   ? 100 HIS B HD1  1  
ATOM   6525   H  HD2  . HIS B 1 97  ? 15.935  56.140 55.906 1.00 0.00   ? 100 HIS B HD2  1  
ATOM   6526   H  HE1  . HIS B 1 97  ? 16.716  53.496 52.712 1.00 0.00   ? 100 HIS B HE1  1  
ATOM   6527   N  N    . ALA B 1 98  ? 10.521  56.780 56.115 1.00 10.35  ? 101 ALA B N    1  
ATOM   6528   C  CA   . ALA B 1 98  ? 9.021   56.839 56.021 1.00 10.79  ? 101 ALA B CA   1  
ATOM   6529   C  C    . ALA B 1 98  ? 8.502   58.272 55.785 1.00 11.12  ? 101 ALA B C    1  
ATOM   6530   O  O    . ALA B 1 98  ? 7.311   58.512 55.823 1.00 12.92  ? 101 ALA B O    1  
ATOM   6531   C  CB   . ALA B 1 98  ? 8.422   56.302 57.322 1.00 10.86  ? 101 ALA B CB   1  
ATOM   6532   H  H    . ALA B 1 98  ? 10.953  56.735 56.994 1.00 0.00   ? 101 ALA B H    1  
ATOM   6533   H  HA   . ALA B 1 98  ? 8.697   56.211 55.205 1.00 0.00   ? 101 ALA B HA   1  
ATOM   6534   H  HB1  . ALA B 1 98  ? 9.003   56.657 58.160 1.00 0.00   ? 101 ALA B HB1  1  
ATOM   6535   H  HB2  . ALA B 1 98  ? 8.435   55.222 57.305 1.00 0.00   ? 101 ALA B HB2  1  
ATOM   6536   H  HB3  . ALA B 1 98  ? 7.403   56.648 57.418 1.00 0.00   ? 101 ALA B HB3  1  
ATOM   6537   N  N    . ALA B 1 99  ? 9.361   59.219 55.536 1.00 11.01  ? 102 ALA B N    1  
ATOM   6538   C  CA   . ALA B 1 99  ? 8.892   60.610 55.294 1.00 11.20  ? 102 ALA B CA   1  
ATOM   6539   C  C    . ALA B 1 99  ? 9.136   60.965 53.827 1.00 11.48  ? 102 ALA B C    1  
ATOM   6540   O  O    . ALA B 1 99  ? 9.832   60.264 53.120 1.00 12.74  ? 102 ALA B O    1  
ATOM   6541   C  CB   . ALA B 1 99  ? 9.668   61.577 56.191 1.00 11.01  ? 102 ALA B CB   1  
ATOM   6542   H  H    . ALA B 1 99  ? 10.318  59.013 55.501 1.00 0.00   ? 102 ALA B H    1  
ATOM   6543   H  HA   . ALA B 1 99  ? 7.836   60.680 55.512 1.00 0.00   ? 102 ALA B HA   1  
ATOM   6544   H  HB1  . ALA B 1 99  ? 9.400   62.593 55.942 1.00 0.00   ? 102 ALA B HB1  1  
ATOM   6545   H  HB2  . ALA B 1 99  ? 10.728  61.436 56.040 1.00 0.00   ? 102 ALA B HB2  1  
ATOM   6546   H  HB3  . ALA B 1 99  ? 9.423   61.383 57.225 1.00 0.00   ? 102 ALA B HB3  1  
ATOM   6547   N  N    . THR B 1 100 ? 8.571   62.042 53.359 1.00 11.83  ? 103 THR B N    1  
ATOM   6548   C  CA   . THR B 1 100 ? 8.781   62.423 51.930 1.00 12.36  ? 103 THR B CA   1  
ATOM   6549   C  C    . THR B 1 100 ? 9.146   63.914 51.795 1.00 12.47  ? 103 THR B C    1  
ATOM   6550   O  O    . THR B 1 100 ? 8.333   64.788 52.020 1.00 12.67  ? 103 THR B O    1  
ATOM   6551   C  CB   . THR B 1 100 ? 7.497   62.148 51.143 1.00 12.62  ? 103 THR B CB   1  
ATOM   6552   O  OG1  . THR B 1 100 ? 7.271   60.747 51.085 1.00 13.03  ? 103 THR B OG1  1  
ATOM   6553   C  CG2  . THR B 1 100 ? 7.636   62.705 49.726 1.00 12.82  ? 103 THR B CG2  1  
ATOM   6554   H  H    . THR B 1 100 ? 8.010   62.597 53.940 1.00 0.00   ? 103 THR B H    1  
ATOM   6555   H  HA   . THR B 1 100 ? 9.580   61.825 51.518 1.00 0.00   ? 103 THR B HA   1  
ATOM   6556   H  HB   . THR B 1 100 ? 6.664   62.628 51.634 1.00 0.00   ? 103 THR B HB   1  
ATOM   6557   H  HG1  . THR B 1 100 ? 8.081   60.304 51.350 1.00 0.00   ? 103 THR B HG1  1  
ATOM   6558   H  HG21 . THR B 1 100 ? 8.324   62.091 49.163 1.00 0.00   ? 103 THR B HG21 1  
ATOM   6559   H  HG22 . THR B 1 100 ? 8.011   63.717 49.771 1.00 0.00   ? 103 THR B HG22 1  
ATOM   6560   H  HG23 . THR B 1 100 ? 6.671   62.700 49.241 1.00 0.00   ? 103 THR B HG23 1  
ATOM   6561   N  N    . GLY B 1 101 ? 10.361  64.198 51.390 1.00 12.34  ? 104 GLY B N    1  
ATOM   6562   C  CA   . GLY B 1 101 ? 10.802  65.629 51.184 1.00 12.68  ? 104 GLY B CA   1  
ATOM   6563   C  C    . GLY B 1 101 ? 12.007  66.006 52.083 1.00 12.98  ? 104 GLY B C    1  
ATOM   6564   O  O    . GLY B 1 101 ? 12.008  65.735 53.267 1.00 12.42  ? 104 GLY B O    1  
ATOM   6565   H  H    . GLY B 1 101 ? 10.984  63.469 51.190 1.00 0.00   ? 104 GLY B H    1  
ATOM   6566   H  HA2  . GLY B 1 101 ? 11.082  65.763 50.150 1.00 0.00   ? 104 GLY B HA2  1  
ATOM   6567   H  HA3  . GLY B 1 101 ? 9.976   66.286 51.412 1.00 0.00   ? 104 GLY B HA3  1  
ATOM   6568   N  N    . ALA B 1 102 ? 13.023  66.674 51.536 1.00 13.21  ? 105 ALA B N    1  
ATOM   6569   C  CA   . ALA B 1 102 ? 14.177  67.095 52.387 1.00 12.79  ? 105 ALA B CA   1  
ATOM   6570   C  C    . ALA B 1 102 ? 15.043  65.893 52.765 1.00 12.57  ? 105 ALA B C    1  
ATOM   6571   O  O    . ALA B 1 102 ? 15.421  65.722 53.907 1.00 12.63  ? 105 ALA B O    1  
ATOM   6572   C  CB   . ALA B 1 102 ? 13.649  67.756 53.661 1.00 13.37  ? 105 ALA B CB   1  
ATOM   6573   H  H    . ALA B 1 102 ? 12.998  66.915 50.587 1.00 0.00   ? 105 ALA B H    1  
ATOM   6574   H  HA   . ALA B 1 102 ? 14.778  67.808 51.843 1.00 0.00   ? 105 ALA B HA   1  
ATOM   6575   H  HB1  . ALA B 1 102 ? 12.770  68.339 53.427 1.00 0.00   ? 105 ALA B HB1  1  
ATOM   6576   H  HB2  . ALA B 1 102 ? 14.409  68.403 54.074 1.00 0.00   ? 105 ALA B HB2  1  
ATOM   6577   H  HB3  . ALA B 1 102 ? 13.394  66.994 54.383 1.00 0.00   ? 105 ALA B HB3  1  
ATOM   6578   N  N    . LEU B 1 103 ? 15.379  65.078 51.814 1.00 12.38  ? 106 LEU B N    1  
ATOM   6579   C  CA   . LEU B 1 103 ? 16.246  63.897 52.102 1.00 12.08  ? 106 LEU B CA   1  
ATOM   6580   C  C    . LEU B 1 103 ? 15.735  63.138 53.329 1.00 12.39  ? 106 LEU B C    1  
ATOM   6581   O  O    . LEU B 1 103 ? 16.504  62.682 54.151 1.00 14.88  ? 106 LEU B O    1  
ATOM   6582   C  CB   . LEU B 1 103 ? 17.677  64.372 52.362 1.00 12.60  ? 106 LEU B CB   1  
ATOM   6583   C  CG   . LEU B 1 103 ? 18.153  65.228 51.187 1.00 13.61  ? 106 LEU B CG   1  
ATOM   6584   C  CD1  . LEU B 1 103 ? 19.470  65.913 51.554 1.00 14.05  ? 106 LEU B CD1  1  
ATOM   6585   C  CD2  . LEU B 1 103 ? 18.368  64.335 49.963 1.00 12.52  ? 106 LEU B CD2  1  
ATOM   6586   H  H    . LEU B 1 103 ? 15.076  65.248 50.898 1.00 0.00   ? 106 LEU B H    1  
ATOM   6587   H  HA   . LEU B 1 103 ? 16.242  63.236 51.248 1.00 0.00   ? 106 LEU B HA   1  
ATOM   6588   H  HB2  . LEU B 1 103 ? 17.701  64.959 53.269 1.00 0.00   ? 106 LEU B HB2  1  
ATOM   6589   H  HB3  . LEU B 1 103 ? 18.327  63.517 52.469 1.00 0.00   ? 106 LEU B HB3  1  
ATOM   6590   H  HG   . LEU B 1 103 ? 17.408  65.977 50.962 1.00 0.00   ? 106 LEU B HG   1  
ATOM   6591   H  HD11 . LEU B 1 103 ? 20.289  65.227 51.398 1.00 0.00   ? 106 LEU B HD11 1  
ATOM   6592   H  HD12 . LEU B 1 103 ? 19.444  66.211 52.592 1.00 0.00   ? 106 LEU B HD12 1  
ATOM   6593   H  HD13 . LEU B 1 103 ? 19.607  66.785 50.932 1.00 0.00   ? 106 LEU B HD13 1  
ATOM   6594   H  HD21 . LEU B 1 103 ? 19.106  63.581 50.192 1.00 0.00   ? 106 LEU B HD21 1  
ATOM   6595   H  HD22 . LEU B 1 103 ? 18.714  64.936 49.135 1.00 0.00   ? 106 LEU B HD22 1  
ATOM   6596   H  HD23 . LEU B 1 103 ? 17.436  63.858 49.697 1.00 0.00   ? 106 LEU B HD23 1  
ATOM   6597   N  N    . GLY B 1 104 ? 14.448  62.984 53.453 1.00 11.44  ? 107 GLY B N    1  
ATOM   6598   C  CA   . GLY B 1 104 ? 13.894  62.235 54.621 1.00 11.35  ? 107 GLY B CA   1  
ATOM   6599   C  C    . GLY B 1 104 ? 14.000  63.075 55.899 1.00 11.72  ? 107 GLY B C    1  
ATOM   6600   O  O    . GLY B 1 104 ? 14.033  62.549 56.993 1.00 11.74  ? 107 GLY B O    1  
ATOM   6601   H  H    . GLY B 1 104 ? 13.843  63.348 52.773 1.00 0.00   ? 107 GLY B H    1  
ATOM   6602   H  HA2  . GLY B 1 104 ? 12.856  62.000 54.433 1.00 0.00   ? 107 GLY B HA2  1  
ATOM   6603   H  HA3  . GLY B 1 104 ? 14.449  61.319 54.753 1.00 0.00   ? 107 GLY B HA3  1  
ATOM   6604   N  N    . GLY B 1 105 ? 14.044  64.372 55.774 1.00 12.05  ? 108 GLY B N    1  
ATOM   6605   C  CA   . GLY B 1 105 ? 14.136  65.239 56.992 1.00 12.39  ? 108 GLY B CA   1  
ATOM   6606   C  C    . GLY B 1 105 ? 15.602  65.570 57.349 1.00 11.99  ? 108 GLY B C    1  
ATOM   6607   O  O    . GLY B 1 105 ? 15.859  66.329 58.263 1.00 12.07  ? 108 GLY B O    1  
ATOM   6608   H  H    . GLY B 1 105 ? 14.009  64.780 54.884 1.00 0.00   ? 108 GLY B H    1  
ATOM   6609   H  HA2  . GLY B 1 105 ? 13.602  66.160 56.810 1.00 0.00   ? 108 GLY B HA2  1  
ATOM   6610   H  HA3  . GLY B 1 105 ? 13.679  64.726 57.825 1.00 0.00   ? 108 GLY B HA3  1  
ATOM   6611   N  N    . GLY B 1 106 ? 16.564  65.017 56.654 1.00 12.53  ? 109 GLY B N    1  
ATOM   6612   C  CA   . GLY B 1 106 ? 17.990  65.317 56.982 1.00 12.27  ? 109 GLY B CA   1  
ATOM   6613   C  C    . GLY B 1 106 ? 18.363  66.742 56.538 1.00 12.91  ? 109 GLY B C    1  
ATOM   6614   O  O    . GLY B 1 106 ? 19.260  67.351 57.088 1.00 13.03  ? 109 GLY B O    1  
ATOM   6615   H  H    . GLY B 1 106 ? 16.349  64.404 55.920 1.00 0.00   ? 109 GLY B H    1  
ATOM   6616   H  HA2  . GLY B 1 106 ? 18.136  65.227 58.049 1.00 0.00   ? 109 GLY B HA2  1  
ATOM   6617   H  HA3  . GLY B 1 106 ? 18.629  64.610 56.474 1.00 0.00   ? 109 GLY B HA3  1  
ATOM   6618   N  N    . GLY B 1 107 ? 17.699  67.276 55.546 1.00 12.97  ? 110 GLY B N    1  
ATOM   6619   C  CA   . GLY B 1 107 ? 18.040  68.654 55.074 1.00 13.11  ? 110 GLY B CA   1  
ATOM   6620   C  C    . GLY B 1 107 ? 17.437  69.725 56.002 1.00 13.11  ? 110 GLY B C    1  
ATOM   6621   O  O    . GLY B 1 107 ? 17.805  70.881 55.939 1.00 15.54  ? 110 GLY B O    1  
ATOM   6622   H  H    . GLY B 1 107 ? 16.984  66.770 55.106 1.00 0.00   ? 110 GLY B H    1  
ATOM   6623   H  HA2  . GLY B 1 107 ? 19.114  68.766 55.054 1.00 0.00   ? 110 GLY B HA2  1  
ATOM   6624   H  HA3  . GLY B 1 107 ? 17.651  68.793 54.076 1.00 0.00   ? 110 GLY B HA3  1  
ATOM   6625   N  N    . LEU B 1 108 ? 16.514  69.362 56.853 1.00 12.79  ? 111 LEU B N    1  
ATOM   6626   C  CA   . LEU B 1 108 ? 15.895  70.377 57.766 1.00 12.58  ? 111 LEU B CA   1  
ATOM   6627   C  C    . LEU B 1 108 ? 16.128  70.013 59.248 1.00 12.47  ? 111 LEU B C    1  
ATOM   6628   O  O    . LEU B 1 108 ? 15.435  70.493 60.123 1.00 13.23  ? 111 LEU B O    1  
ATOM   6629   C  CB   . LEU B 1 108 ? 14.391  70.443 57.497 1.00 12.48  ? 111 LEU B CB   1  
ATOM   6630   C  CG   . LEU B 1 108 ? 14.149  70.640 56.000 1.00 14.73  ? 111 LEU B CG   1  
ATOM   6631   C  CD1  . LEU B 1 108 ? 12.727  70.198 55.649 1.00 14.69  ? 111 LEU B CD1  1  
ATOM   6632   C  CD2  . LEU B 1 108 ? 14.323  72.119 55.646 1.00 16.61  ? 111 LEU B CD2  1  
ATOM   6633   H  H    . LEU B 1 108 ? 16.221  68.427 56.890 1.00 0.00   ? 111 LEU B H    1  
ATOM   6634   H  HA   . LEU B 1 108 ? 16.332  71.344 57.567 1.00 0.00   ? 111 LEU B HA   1  
ATOM   6635   H  HB2  . LEU B 1 108 ? 13.927  69.522 57.819 1.00 0.00   ? 111 LEU B HB2  1  
ATOM   6636   H  HB3  . LEU B 1 108 ? 13.964  71.272 58.041 1.00 0.00   ? 111 LEU B HB3  1  
ATOM   6637   H  HG   . LEU B 1 108 ? 14.858  70.048 55.439 1.00 0.00   ? 111 LEU B HG   1  
ATOM   6638   H  HD11 . LEU B 1 108 ? 12.736  69.670 54.707 1.00 0.00   ? 111 LEU B HD11 1  
ATOM   6639   H  HD12 . LEU B 1 108 ? 12.089  71.066 55.569 1.00 0.00   ? 111 LEU B HD12 1  
ATOM   6640   H  HD13 . LEU B 1 108 ? 12.352  69.546 56.424 1.00 0.00   ? 111 LEU B HD13 1  
ATOM   6641   H  HD21 . LEU B 1 108 ? 15.018  72.214 54.826 1.00 0.00   ? 111 LEU B HD21 1  
ATOM   6642   H  HD22 . LEU B 1 108 ? 14.705  72.652 56.505 1.00 0.00   ? 111 LEU B HD22 1  
ATOM   6643   H  HD23 . LEU B 1 108 ? 13.368  72.536 55.360 1.00 0.00   ? 111 LEU B HD23 1  
ATOM   6644   N  N    . THR B 1 109 ? 17.098  69.187 59.539 1.00 12.10  ? 112 THR B N    1  
ATOM   6645   C  CA   . THR B 1 109 ? 17.377  68.812 60.963 1.00 11.91  ? 112 THR B CA   1  
ATOM   6646   C  C    . THR B 1 109 ? 18.899  68.839 61.279 1.00 12.21  ? 112 THR B C    1  
ATOM   6647   O  O    . THR B 1 109 ? 19.337  68.236 62.238 1.00 12.05  ? 112 THR B O    1  
ATOM   6648   C  CB   . THR B 1 109 ? 16.838  67.404 61.223 1.00 11.37  ? 112 THR B CB   1  
ATOM   6649   O  OG1  . THR B 1 109 ? 17.346  66.515 60.238 1.00 10.92  ? 112 THR B OG1  1  
ATOM   6650   C  CG2  . THR B 1 109 ? 15.310  67.420 61.159 1.00 12.90  ? 112 THR B CG2  1  
ATOM   6651   H  H    . THR B 1 109 ? 17.654  68.817 58.821 1.00 0.00   ? 112 THR B H    1  
ATOM   6652   H  HA   . THR B 1 109 ? 16.870  69.507 61.615 1.00 0.00   ? 112 THR B HA   1  
ATOM   6653   H  HB   . THR B 1 109 ? 17.149  67.074 62.202 1.00 0.00   ? 112 THR B HB   1  
ATOM   6654   H  HG1  . THR B 1 109 ? 16.715  66.482 59.515 1.00 0.00   ? 112 THR B HG1  1  
ATOM   6655   H  HG21 . THR B 1 109 ? 14.908  66.875 62.001 1.00 0.00   ? 112 THR B HG21 1  
ATOM   6656   H  HG22 . THR B 1 109 ? 14.983  66.956 60.241 1.00 0.00   ? 112 THR B HG22 1  
ATOM   6657   H  HG23 . THR B 1 109 ? 14.959  68.441 61.192 1.00 0.00   ? 112 THR B HG23 1  
ATOM   6658   N  N    . GLU B 1 110 ? 19.707  69.535 60.505 1.00 12.00  ? 113 GLU B N    1  
ATOM   6659   C  CA   . GLU B 1 110 ? 21.163  69.590 60.800 1.00 12.43  ? 113 GLU B CA   1  
ATOM   6660   C  C    . GLU B 1 110 ? 21.353  70.440 62.048 1.00 12.44  ? 113 GLU B C    1  
ATOM   6661   O  O    . GLU B 1 110 ? 21.115  71.631 62.041 1.00 13.49  ? 113 GLU B O    1  
ATOM   6662   C  CB   . GLU B 1 110 ? 21.906  70.225 59.623 1.00 12.66  ? 113 GLU B CB   1  
ATOM   6663   C  CG   . GLU B 1 110 ? 21.885  69.269 58.429 1.00 13.53  ? 113 GLU B CG   1  
ATOM   6664   C  CD   . GLU B 1 110 ? 22.746  69.841 57.301 1.00 16.61  ? 113 GLU B CD   1  
ATOM   6665   O  OE1  . GLU B 1 110 ? 23.376  70.862 57.523 1.00 20.12  ? 113 GLU B OE1  1  
ATOM   6666   O  OE2  . GLU B 1 110 ? 22.761  69.248 56.235 1.00 18.16  ? 113 GLU B OE2  1  
ATOM   6667   H  H    . GLU B 1 110 ? 19.345  70.029 59.740 1.00 0.00   ? 113 GLU B H    1  
ATOM   6668   H  HA   . GLU B 1 110 ? 21.538  68.592 60.976 1.00 0.00   ? 113 GLU B HA   1  
ATOM   6669   H  HB2  . GLU B 1 110 ? 21.423  71.153 59.351 1.00 0.00   ? 113 GLU B HB2  1  
ATOM   6670   H  HB3  . GLU B 1 110 ? 22.929  70.421 59.906 1.00 0.00   ? 113 GLU B HB3  1  
ATOM   6671   H  HG2  . GLU B 1 110 ? 22.277  68.308 58.730 1.00 0.00   ? 113 GLU B HG2  1  
ATOM   6672   H  HG3  . GLU B 1 110 ? 20.870  69.151 58.080 1.00 0.00   ? 113 GLU B HG3  1  
ATOM   6673   N  N    . ILE B 1 111 ? 21.743  69.838 63.130 1.00 11.85  ? 114 ILE B N    1  
ATOM   6674   C  CA   . ILE B 1 111 ? 21.902  70.619 64.381 1.00 12.37  ? 114 ILE B CA   1  
ATOM   6675   C  C    . ILE B 1 111 ? 23.287  70.388 64.957 1.00 12.32  ? 114 ILE B C    1  
ATOM   6676   O  O    . ILE B 1 111 ? 23.714  69.268 65.158 1.00 12.00  ? 114 ILE B O    1  
ATOM   6677   C  CB   . ILE B 1 111 ? 20.847  70.175 65.396 1.00 12.04  ? 114 ILE B CB   1  
ATOM   6678   C  CG1  . ILE B 1 111 ? 20.765  68.646 65.409 1.00 12.41  ? 114 ILE B CG1  1  
ATOM   6679   C  CG2  . ILE B 1 111 ? 19.486  70.754 65.006 1.00 13.31  ? 114 ILE B CG2  1  
ATOM   6680   C  CD1  . ILE B 1 111 ? 19.856  68.193 66.552 1.00 11.87  ? 114 ILE B CD1  1  
ATOM   6681   H  H    . ILE B 1 111 ? 21.905  68.872 63.127 1.00 0.00   ? 114 ILE B H    1  
ATOM   6682   H  HA   . ILE B 1 111 ? 21.772  71.669 64.168 1.00 0.00   ? 114 ILE B HA   1  
ATOM   6683   H  HB   . ILE B 1 111 ? 21.121  70.531 66.379 1.00 0.00   ? 114 ILE B HB   1  
ATOM   6684   H  HG12 . ILE B 1 111 ? 20.363  68.300 64.468 1.00 0.00   ? 114 ILE B HG12 1  
ATOM   6685   H  HG13 . ILE B 1 111 ? 21.753  68.234 65.551 1.00 0.00   ? 114 ILE B HG13 1  
ATOM   6686   H  HG21 . ILE B 1 111 ? 19.232  71.560 65.678 1.00 0.00   ? 114 ILE B HG21 1  
ATOM   6687   H  HG22 . ILE B 1 111 ? 18.735  69.981 65.070 1.00 0.00   ? 114 ILE B HG22 1  
ATOM   6688   H  HG23 . ILE B 1 111 ? 19.531  71.129 63.994 1.00 0.00   ? 114 ILE B HG23 1  
ATOM   6689   H  HD11 . ILE B 1 111 ? 18.979  68.822 66.586 1.00 0.00   ? 114 ILE B HD11 1  
ATOM   6690   H  HD12 . ILE B 1 111 ? 20.390  68.268 67.488 1.00 0.00   ? 114 ILE B HD12 1  
ATOM   6691   H  HD13 . ILE B 1 111 ? 19.557  67.168 66.389 1.00 0.00   ? 114 ILE B HD13 1  
ATOM   6692   N  N    . ASN B 1 112 ? 23.990  71.441 65.230 1.00 12.61  ? 115 ASN B N    1  
ATOM   6693   C  CA   . ASN B 1 112 ? 25.352  71.290 65.802 1.00 13.10  ? 115 ASN B CA   1  
ATOM   6694   C  C    . ASN B 1 112 ? 25.247  71.302 67.324 1.00 12.87  ? 115 ASN B C    1  
ATOM   6695   O  O    . ASN B 1 112 ? 24.283  71.787 67.881 1.00 13.26  ? 115 ASN B O    1  
ATOM   6696   C  CB   . ASN B 1 112 ? 26.236  72.451 65.339 1.00 13.16  ? 115 ASN B CB   1  
ATOM   6697   C  CG   . ASN B 1 112 ? 26.086  72.635 63.828 1.00 15.56  ? 115 ASN B CG   1  
ATOM   6698   O  OD1  . ASN B 1 112 ? 25.179  73.301 63.372 1.00 23.52  ? 115 ASN B OD1  1  
ATOM   6699   N  ND2  . ASN B 1 112 ? 26.945  72.067 63.025 1.00 15.38  ? 115 ASN B ND2  1  
ATOM   6700   H  H    . ASN B 1 112 ? 23.623  72.334 65.063 1.00 0.00   ? 115 ASN B H    1  
ATOM   6701   H  HA   . ASN B 1 112 ? 25.781  70.354 65.476 1.00 0.00   ? 115 ASN B HA   1  
ATOM   6702   H  HB2  . ASN B 1 112 ? 25.934  73.357 65.845 1.00 0.00   ? 115 ASN B HB2  1  
ATOM   6703   H  HB3  . ASN B 1 112 ? 27.267  72.234 65.573 1.00 0.00   ? 115 ASN B HB3  1  
ATOM   6704   H  HD21 . ASN B 1 112 ? 27.677  71.529 63.393 1.00 0.00   ? 115 ASN B HD21 1  
ATOM   6705   H  HD22 . ASN B 1 112 ? 26.858  72.179 62.056 1.00 0.00   ? 115 ASN B HD22 1  
ATOM   6706   N  N    . PRO B 1 113 ? 26.232  70.777 67.992 1.00 13.38  ? 116 PRO B N    1  
ATOM   6707   C  CA   . PRO B 1 113 ? 26.253  70.730 69.477 1.00 13.66  ? 116 PRO B CA   1  
ATOM   6708   C  C    . PRO B 1 113 ? 25.609  71.976 70.100 1.00 14.03  ? 116 PRO B C    1  
ATOM   6709   O  O    . PRO B 1 113 ? 25.943  73.093 69.759 1.00 15.17  ? 116 PRO B O    1  
ATOM   6710   C  CB   . PRO B 1 113 ? 27.745  70.667 69.794 1.00 14.21  ? 116 PRO B CB   1  
ATOM   6711   C  CG   . PRO B 1 113 ? 28.373  69.976 68.621 1.00 13.96  ? 116 PRO B CG   1  
ATOM   6712   C  CD   . PRO B 1 113 ? 27.441  70.174 67.416 1.00 14.02  ? 116 PRO B CD   1  
ATOM   6713   H  HA   . PRO B 1 113 ? 25.768  69.836 69.833 1.00 0.00   ? 116 PRO B HA   1  
ATOM   6714   H  HB2  . PRO B 1 113 ? 28.145  71.665 69.903 1.00 0.00   ? 116 PRO B HB2  1  
ATOM   6715   H  HB3  . PRO B 1 113 ? 27.913  70.093 70.692 1.00 0.00   ? 116 PRO B HB3  1  
ATOM   6716   H  HG2  . PRO B 1 113 ? 29.342  70.411 68.416 1.00 0.00   ? 116 PRO B HG2  1  
ATOM   6717   H  HG3  . PRO B 1 113 ? 28.478  68.923 68.827 1.00 0.00   ? 116 PRO B HG3  1  
ATOM   6718   H  HD2  . PRO B 1 113 ? 27.893  70.841 66.695 1.00 0.00   ? 116 PRO B HD2  1  
ATOM   6719   H  HD3  . PRO B 1 113 ? 27.203  69.225 66.961 1.00 0.00   ? 116 PRO B HD3  1  
ATOM   6720   N  N    . GLY B 1 114 ? 24.678  71.793 71.000 1.00 13.73  ? 117 GLY B N    1  
ATOM   6721   C  CA   . GLY B 1 114 ? 24.005  72.966 71.630 1.00 14.59  ? 117 GLY B CA   1  
ATOM   6722   C  C    . GLY B 1 114 ? 22.794  73.426 70.788 1.00 14.78  ? 117 GLY B C    1  
ATOM   6723   O  O    . GLY B 1 114 ? 22.311  74.528 70.954 1.00 17.28  ? 117 GLY B O    1  
ATOM   6724   H  H    . GLY B 1 114 ? 24.415  70.884 71.254 1.00 0.00   ? 117 GLY B H    1  
ATOM   6725   H  HA2  . GLY B 1 114 ? 23.668  72.693 72.619 1.00 0.00   ? 117 GLY B HA2  1  
ATOM   6726   H  HA3  . GLY B 1 114 ? 24.710  73.781 71.707 1.00 0.00   ? 117 GLY B HA3  1  
ATOM   6727   N  N    . GLU B 1 115 ? 22.288  72.603 69.896 1.00 14.20  ? 118 GLU B N    1  
ATOM   6728   C  CA   . GLU B 1 115 ? 21.105  73.033 69.080 1.00 13.79  ? 118 GLU B CA   1  
ATOM   6729   C  C    . GLU B 1 115 ? 20.074  71.893 68.965 1.00 13.49  ? 118 GLU B C    1  
ATOM   6730   O  O    . GLU B 1 115 ? 20.425  70.735 68.852 1.00 13.98  ? 118 GLU B O    1  
ATOM   6731   C  CB   . GLU B 1 115 ? 21.577  73.428 67.679 1.00 14.09  ? 118 GLU B CB   1  
ATOM   6732   C  CG   . GLU B 1 115 ? 22.373  74.733 67.757 1.00 14.68  ? 118 GLU B CG   1  
ATOM   6733   C  CD   . GLU B 1 115 ? 22.556  75.304 66.350 1.00 15.38  ? 118 GLU B CD   1  
ATOM   6734   O  OE1  . GLU B 1 115 ? 22.960  74.556 65.475 1.00 16.45  ? 118 GLU B OE1  1  
ATOM   6735   O  OE2  . GLU B 1 115 ? 22.288  76.481 66.171 1.00 20.22  ? 118 GLU B OE2  1  
ATOM   6736   H  H    . GLU B 1 115 ? 22.677  71.712 69.770 1.00 0.00   ? 118 GLU B H    1  
ATOM   6737   H  HA   . GLU B 1 115 ? 20.640  73.887 69.551 1.00 0.00   ? 118 GLU B HA   1  
ATOM   6738   H  HB2  . GLU B 1 115 ? 22.204  72.646 67.277 1.00 0.00   ? 118 GLU B HB2  1  
ATOM   6739   H  HB3  . GLU B 1 115 ? 20.721  73.570 67.037 1.00 0.00   ? 118 GLU B HB3  1  
ATOM   6740   H  HG2  . GLU B 1 115 ? 21.839  75.444 68.369 1.00 0.00   ? 118 GLU B HG2  1  
ATOM   6741   H  HG3  . GLU B 1 115 ? 23.342  74.538 68.192 1.00 0.00   ? 118 GLU B HG3  1  
ATOM   6742   N  N    . LYS B 1 116 ? 18.798  72.222 68.975 1.00 13.47  ? 119 LYS B N    1  
ATOM   6743   C  CA   . LYS B 1 116 ? 17.741  71.175 68.847 1.00 13.68  ? 119 LYS B CA   1  
ATOM   6744   C  C    . LYS B 1 116 ? 16.646  71.691 67.904 1.00 13.55  ? 119 LYS B C    1  
ATOM   6745   O  O    . LYS B 1 116 ? 16.415  72.879 67.806 1.00 13.83  ? 119 LYS B O    1  
ATOM   6746   C  CB   . LYS B 1 116 ? 17.138  70.885 70.223 1.00 14.75  ? 119 LYS B CB   1  
ATOM   6747   C  CG   . LYS B 1 116 ? 16.491  72.157 70.776 1.00 16.84  ? 119 LYS B CG   1  
ATOM   6748   C  CD   . LYS B 1 116 ? 15.498  71.786 71.879 1.00 20.99  ? 119 LYS B CD   1  
ATOM   6749   C  CE   . LYS B 1 116 ? 14.625  72.999 72.209 1.00 23.78  ? 119 LYS B CE   1  
ATOM   6750   N  NZ   . LYS B 1 116 ? 13.745  72.677 73.367 1.00 25.55  ? 119 LYS B NZ   1  
ATOM   6751   H  H    . LYS B 1 116 ? 18.541  73.164 69.054 1.00 0.00   ? 119 LYS B H    1  
ATOM   6752   H  HA   . LYS B 1 116 ? 18.173  70.272 68.441 1.00 0.00   ? 119 LYS B HA   1  
ATOM   6753   H  HB2  . LYS B 1 116 ? 16.390  70.110 70.132 1.00 0.00   ? 119 LYS B HB2  1  
ATOM   6754   H  HB3  . LYS B 1 116 ? 17.916  70.558 70.896 1.00 0.00   ? 119 LYS B HB3  1  
ATOM   6755   H  HG2  . LYS B 1 116 ? 17.257  72.802 71.182 1.00 0.00   ? 119 LYS B HG2  1  
ATOM   6756   H  HG3  . LYS B 1 116 ? 15.970  72.670 69.983 1.00 0.00   ? 119 LYS B HG3  1  
ATOM   6757   H  HD2  . LYS B 1 116 ? 14.872  70.973 71.542 1.00 0.00   ? 119 LYS B HD2  1  
ATOM   6758   H  HD3  . LYS B 1 116 ? 16.038  71.483 72.764 1.00 0.00   ? 119 LYS B HD3  1  
ATOM   6759   H  HE2  . LYS B 1 116 ? 15.256  73.839 72.459 1.00 0.00   ? 119 LYS B HE2  1  
ATOM   6760   H  HE3  . LYS B 1 116 ? 14.017  73.248 71.352 1.00 0.00   ? 119 LYS B HE3  1  
ATOM   6761   H  HZ1  . LYS B 1 116 ? 13.657  73.513 73.980 1.00 0.00   ? 119 LYS B HZ1  1  
ATOM   6762   H  HZ2  . LYS B 1 116 ? 14.159  71.894 73.911 1.00 0.00   ? 119 LYS B HZ2  1  
ATOM   6763   H  HZ3  . LYS B 1 116 ? 12.803  72.400 73.020 1.00 0.00   ? 119 LYS B HZ3  1  
ATOM   6764   N  N    . THR B 1 117 ? 15.971  70.815 67.203 1.00 12.74  ? 120 THR B N    1  
ATOM   6765   C  CA   . THR B 1 117 ? 14.915  71.277 66.279 1.00 12.87  ? 120 THR B CA   1  
ATOM   6766   C  C    . THR B 1 117 ? 13.693  70.386 66.432 1.00 12.64  ? 120 THR B C    1  
ATOM   6767   O  O    . THR B 1 117 ? 13.649  69.497 67.259 1.00 13.00  ? 120 THR B O    1  
ATOM   6768   C  CB   . THR B 1 117 ? 15.426  71.203 64.839 1.00 12.64  ? 120 THR B CB   1  
ATOM   6769   O  OG1  . THR B 1 117 ? 14.372  71.537 63.947 1.00 14.07  ? 120 THR B OG1  1  
ATOM   6770   C  CG2  . THR B 1 117 ? 15.920  69.786 64.542 1.00 13.27  ? 120 THR B CG2  1  
ATOM   6771   H  H    . THR B 1 117 ? 16.169  69.859 67.286 1.00 0.00   ? 120 THR B H    1  
ATOM   6772   H  HA   . THR B 1 117 ? 14.650  72.297 66.515 1.00 0.00   ? 120 THR B HA   1  
ATOM   6773   H  HB   . THR B 1 117 ? 16.242  71.898 64.709 1.00 0.00   ? 120 THR B HB   1  
ATOM   6774   H  HG1  . THR B 1 117 ? 13.743  70.811 63.946 1.00 0.00   ? 120 THR B HG1  1  
ATOM   6775   H  HG21 . THR B 1 117 ? 15.743  69.157 65.402 1.00 0.00   ? 120 THR B HG21 1  
ATOM   6776   H  HG22 . THR B 1 117 ? 16.977  69.811 64.326 1.00 0.00   ? 120 THR B HG22 1  
ATOM   6777   H  HG23 . THR B 1 117 ? 15.387  69.390 63.691 1.00 0.00   ? 120 THR B HG23 1  
ATOM   6778   N  N    . ILE B 1 118 ? 12.704  70.623 65.636 1.00 12.88  ? 121 ILE B N    1  
ATOM   6779   C  CA   . ILE B 1 118 ? 11.463  69.805 65.707 1.00 13.33  ? 121 ILE B CA   1  
ATOM   6780   C  C    . ILE B 1 118 ? 10.935  69.604 64.289 1.00 12.63  ? 121 ILE B C    1  
ATOM   6781   O  O    . ILE B 1 118 ? 10.552  70.543 63.620 1.00 13.35  ? 121 ILE B O    1  
ATOM   6782   C  CB   . ILE B 1 118 ? 10.414  70.534 66.549 1.00 13.54  ? 121 ILE B CB   1  
ATOM   6783   C  CG1  . ILE B 1 118 ? 10.942  70.716 67.974 1.00 14.38  ? 121 ILE B CG1  1  
ATOM   6784   C  CG2  . ILE B 1 118 ? 9.126   69.710 66.585 1.00 14.53  ? 121 ILE B CG2  1  
ATOM   6785   C  CD1  . ILE B 1 118 ? 9.947   71.548 68.784 1.00 15.90  ? 121 ILE B CD1  1  
ATOM   6786   H  H    . ILE B 1 118 ? 12.771  71.347 64.979 1.00 0.00   ? 121 ILE B H    1  
ATOM   6787   H  HA   . ILE B 1 118 ? 11.685  68.846 66.152 1.00 0.00   ? 121 ILE B HA   1  
ATOM   6788   H  HB   . ILE B 1 118 ? 10.211  71.501 66.111 1.00 0.00   ? 121 ILE B HB   1  
ATOM   6789   H  HG12 . ILE B 1 118 ? 11.065  69.748 68.438 1.00 0.00   ? 121 ILE B HG12 1  
ATOM   6790   H  HG13 . ILE B 1 118 ? 11.893  71.225 67.943 1.00 0.00   ? 121 ILE B HG13 1  
ATOM   6791   H  HG21 . ILE B 1 118 ? 8.945   69.282 65.610 1.00 0.00   ? 121 ILE B HG21 1  
ATOM   6792   H  HG22 . ILE B 1 118 ? 8.298   70.349 66.856 1.00 0.00   ? 121 ILE B HG22 1  
ATOM   6793   H  HG23 . ILE B 1 118 ? 9.224   68.919 67.313 1.00 0.00   ? 121 ILE B HG23 1  
ATOM   6794   H  HD11 . ILE B 1 118 ? 9.588   72.369 68.181 1.00 0.00   ? 121 ILE B HD11 1  
ATOM   6795   H  HD12 . ILE B 1 118 ? 10.436  71.936 69.666 1.00 0.00   ? 121 ILE B HD12 1  
ATOM   6796   H  HD13 . ILE B 1 118 ? 9.114   70.927 69.079 1.00 0.00   ? 121 ILE B HD13 1  
ATOM   6797   N  N    . LEU B 1 119 ? 10.929  68.392 63.817 1.00 12.29  ? 122 LEU B N    1  
ATOM   6798   C  CA   . LEU B 1 119 ? 10.447  68.140 62.433 1.00 12.54  ? 122 LEU B CA   1  
ATOM   6799   C  C    . LEU B 1 119 ? 9.179   67.293 62.470 1.00 13.11  ? 122 LEU B C    1  
ATOM   6800   O  O    . LEU B 1 119 ? 9.100   66.297 63.162 1.00 13.13  ? 122 LEU B O    1  
ATOM   6801   C  CB   . LEU B 1 119 ? 11.529  67.401 61.644 1.00 12.70  ? 122 LEU B CB   1  
ATOM   6802   C  CG   . LEU B 1 119 ? 10.928  66.838 60.356 1.00 13.20  ? 122 LEU B CG   1  
ATOM   6803   C  CD1  . LEU B 1 119 ? 11.141  67.833 59.214 1.00 15.38  ? 122 LEU B CD1  1  
ATOM   6804   C  CD2  . LEU B 1 119 ? 11.613  65.514 60.011 1.00 14.45  ? 122 LEU B CD2  1  
ATOM   6805   H  H    . LEU B 1 119 ? 11.256  67.649 64.366 1.00 0.00   ? 122 LEU B H    1  
ATOM   6806   H  HA   . LEU B 1 119 ? 10.234  69.083 61.951 1.00 0.00   ? 122 LEU B HA   1  
ATOM   6807   H  HB2  . LEU B 1 119 ? 12.328  68.086 61.400 1.00 0.00   ? 122 LEU B HB2  1  
ATOM   6808   H  HB3  . LEU B 1 119 ? 11.920  66.590 62.241 1.00 0.00   ? 122 LEU B HB3  1  
ATOM   6809   H  HG   . LEU B 1 119 ? 9.869   66.672 60.496 1.00 0.00   ? 122 LEU B HG   1  
ATOM   6810   H  HD11 . LEU B 1 119 ? 11.217  68.832 59.617 1.00 0.00   ? 122 LEU B HD11 1  
ATOM   6811   H  HD12 . LEU B 1 119 ? 10.305  67.783 58.532 1.00 0.00   ? 122 LEU B HD12 1  
ATOM   6812   H  HD13 . LEU B 1 119 ? 12.051  67.587 58.687 1.00 0.00   ? 122 LEU B HD13 1  
ATOM   6813   H  HD21 . LEU B 1 119 ? 11.384  64.781 60.771 1.00 0.00   ? 122 LEU B HD21 1  
ATOM   6814   H  HD22 . LEU B 1 119 ? 12.682  65.663 59.964 1.00 0.00   ? 122 LEU B HD22 1  
ATOM   6815   H  HD23 . LEU B 1 119 ? 11.257  65.162 59.054 1.00 0.00   ? 122 LEU B HD23 1  
ATOM   6816   N  N    . ARG B 1 120 ? 8.188   67.680 61.721 1.00 13.29  ? 123 ARG B N    1  
ATOM   6817   C  CA   . ARG B 1 120 ? 6.917   66.900 61.695 1.00 13.38  ? 123 ARG B CA   1  
ATOM   6818   C  C    . ARG B 1 120 ? 6.622   66.432 60.261 1.00 13.26  ? 123 ARG B C    1  
ATOM   6819   O  O    . ARG B 1 120 ? 6.615   67.213 59.330 1.00 14.30  ? 123 ARG B O    1  
ATOM   6820   C  CB   . ARG B 1 120 ? 5.768   67.783 62.187 1.00 13.64  ? 123 ARG B CB   1  
ATOM   6821   C  CG   . ARG B 1 120 ? 4.434   67.084 61.917 1.00 14.57  ? 123 ARG B CG   1  
ATOM   6822   C  CD   . ARG B 1 120 ? 3.283   68.029 62.265 1.00 15.69  ? 123 ARG B CD   1  
ATOM   6823   N  NE   . ARG B 1 120 ? 2.724   68.613 61.013 1.00 18.23  ? 123 ARG B NE   1  
ATOM   6824   C  CZ   . ARG B 1 120 ? 2.916   69.875 60.739 1.00 20.75  ? 123 ARG B CZ   1  
ATOM   6825   N  NH1  . ARG B 1 120 ? 3.597   70.624 61.562 1.00 22.08  ? 123 ARG B NH1  1  
ATOM   6826   N  NH2  . ARG B 1 120 ? 2.426   70.386 59.643 1.00 21.27  ? 123 ARG B NH2  1  
ATOM   6827   H  H    . ARG B 1 120 ? 8.279   68.484 61.168 1.00 0.00   ? 123 ARG B H    1  
ATOM   6828   H  HA   . ARG B 1 120 ? 7.010   66.039 62.341 1.00 0.00   ? 123 ARG B HA   1  
ATOM   6829   H  HB2  . ARG B 1 120 ? 5.877   67.955 63.249 1.00 0.00   ? 123 ARG B HB2  1  
ATOM   6830   H  HB3  . ARG B 1 120 ? 5.790   68.727 61.665 1.00 0.00   ? 123 ARG B HB3  1  
ATOM   6831   H  HG2  . ARG B 1 120 ? 4.376   66.813 60.872 1.00 0.00   ? 123 ARG B HG2  1  
ATOM   6832   H  HG3  . ARG B 1 120 ? 4.364   66.195 62.524 1.00 0.00   ? 123 ARG B HG3  1  
ATOM   6833   H  HD2  . ARG B 1 120 ? 2.510   67.480 62.782 1.00 0.00   ? 123 ARG B HD2  1  
ATOM   6834   H  HD3  . ARG B 1 120 ? 3.648   68.822 62.901 1.00 0.00   ? 123 ARG B HD3  1  
ATOM   6835   H  HE   . ARG B 1 120 ? 2.212   68.050 60.396 1.00 0.00   ? 123 ARG B HE   1  
ATOM   6836   H  HH11 . ARG B 1 120 ? 3.972   70.232 62.402 1.00 0.00   ? 123 ARG B HH11 1  
ATOM   6837   H  HH12 . ARG B 1 120 ? 3.744   71.591 61.352 1.00 0.00   ? 123 ARG B HH12 1  
ATOM   6838   H  HH21 . ARG B 1 120 ? 1.904   69.812 59.013 1.00 0.00   ? 123 ARG B HH21 1  
ATOM   6839   H  HH22 . ARG B 1 120 ? 2.573   71.353 59.433 1.00 0.00   ? 123 ARG B HH22 1  
ATOM   6840   N  N    . PHE B 1 121 ? 6.374   65.161 60.085 1.00 12.69  ? 124 PHE B N    1  
ATOM   6841   C  CA   . PHE B 1 121 ? 6.072   64.625 58.732 1.00 11.76  ? 124 PHE B CA   1  
ATOM   6842   C  C    . PHE B 1 121 ? 4.847   63.702 58.805 1.00 12.48  ? 124 PHE B C    1  
ATOM   6843   O  O    . PHE B 1 121 ? 4.593   63.056 59.802 1.00 12.32  ? 124 PHE B O    1  
ATOM   6844   C  CB   . PHE B 1 121 ? 7.277   63.834 58.217 1.00 11.78  ? 124 PHE B CB   1  
ATOM   6845   C  CG   . PHE B 1 121 ? 7.376   62.525 58.963 1.00 12.28  ? 124 PHE B CG   1  
ATOM   6846   C  CD1  . PHE B 1 121 ? 6.621   61.422 58.545 1.00 11.86  ? 124 PHE B CD1  1  
ATOM   6847   C  CD2  . PHE B 1 121 ? 8.222   62.414 60.073 1.00 11.88  ? 124 PHE B CD2  1  
ATOM   6848   C  CE1  . PHE B 1 121 ? 6.713   60.209 59.237 1.00 12.13  ? 124 PHE B CE1  1  
ATOM   6849   C  CE2  . PHE B 1 121 ? 8.314   61.201 60.765 1.00 12.25  ? 124 PHE B CE2  1  
ATOM   6850   C  CZ   . PHE B 1 121 ? 7.559   60.098 60.347 1.00 12.13  ? 124 PHE B CZ   1  
ATOM   6851   H  H    . PHE B 1 121 ? 6.382   64.555 60.855 1.00 0.00   ? 124 PHE B H    1  
ATOM   6852   H  HA   . PHE B 1 121 ? 5.866   65.444 58.059 1.00 0.00   ? 124 PHE B HA   1  
ATOM   6853   H  HB2  . PHE B 1 121 ? 7.155   63.639 57.162 1.00 0.00   ? 124 PHE B HB2  1  
ATOM   6854   H  HB3  . PHE B 1 121 ? 8.178   64.407 58.376 1.00 0.00   ? 124 PHE B HB3  1  
ATOM   6855   H  HD1  . PHE B 1 121 ? 5.969   61.508 57.689 1.00 0.00   ? 124 PHE B HD1  1  
ATOM   6856   H  HD2  . PHE B 1 121 ? 8.804   63.265 60.396 1.00 0.00   ? 124 PHE B HD2  1  
ATOM   6857   H  HE1  . PHE B 1 121 ? 6.131   59.358 58.915 1.00 0.00   ? 124 PHE B HE1  1  
ATOM   6858   H  HE2  . PHE B 1 121 ? 8.966   61.115 61.621 1.00 0.00   ? 124 PHE B HE2  1  
ATOM   6859   H  HZ   . PHE B 1 121 ? 7.630   59.162 60.881 1.00 0.00   ? 124 PHE B HZ   1  
ATOM   6860   N  N    . LYS B 1 122 ? 4.097   63.646 57.743 1.00 12.77  ? 125 LYS B N    1  
ATOM   6861   C  CA   . LYS B 1 122 ? 2.892   62.794 57.688 1.00 13.32  ? 125 LYS B CA   1  
ATOM   6862   C  C    . LYS B 1 122 ? 3.296   61.386 57.271 1.00 13.00  ? 125 LYS B C    1  
ATOM   6863   O  O    . LYS B 1 122 ? 3.971   61.171 56.285 1.00 12.23  ? 125 LYS B O    1  
ATOM   6864   C  CB   . LYS B 1 122 ? 1.906   63.367 56.669 1.00 13.93  ? 125 LYS B CB   1  
ATOM   6865   C  CG   . LYS B 1 122 ? 0.553   62.668 56.819 1.00 15.43  ? 125 LYS B CG   1  
ATOM   6866   C  CD   . LYS B 1 122 ? -0.337  63.015 55.623 1.00 19.41  ? 125 LYS B CD   1  
ATOM   6867   C  CE   . LYS B 1 122 ? -1.807  62.876 56.022 1.00 22.47  ? 125 LYS B CE   1  
ATOM   6868   N  NZ   . LYS B 1 122 ? -2.652  63.679 55.094 1.00 25.22  ? 125 LYS B NZ   1  
ATOM   6869   H  H    . LYS B 1 122 ? 4.338   64.182 56.959 1.00 0.00   ? 125 LYS B H    1  
ATOM   6870   H  HA   . LYS B 1 122 ? 2.427   62.763 58.662 1.00 0.00   ? 125 LYS B HA   1  
ATOM   6871   H  HB2  . LYS B 1 122 ? 1.786   64.427 56.840 1.00 0.00   ? 125 LYS B HB2  1  
ATOM   6872   H  HB3  . LYS B 1 122 ? 2.284   63.204 55.671 1.00 0.00   ? 125 LYS B HB3  1  
ATOM   6873   H  HG2  . LYS B 1 122 ? 0.702   61.599 56.859 1.00 0.00   ? 125 LYS B HG2  1  
ATOM   6874   H  HG3  . LYS B 1 122 ? 0.075   63.000 57.728 1.00 0.00   ? 125 LYS B HG3  1  
ATOM   6875   H  HD2  . LYS B 1 122 ? -0.142  64.031 55.312 1.00 0.00   ? 125 LYS B HD2  1  
ATOM   6876   H  HD3  . LYS B 1 122 ? -0.122  62.341 54.807 1.00 0.00   ? 125 LYS B HD3  1  
ATOM   6877   H  HE2  . LYS B 1 122 ? -2.098  61.837 55.967 1.00 0.00   ? 125 LYS B HE2  1  
ATOM   6878   H  HE3  . LYS B 1 122 ? -1.941  63.234 57.032 1.00 0.00   ? 125 LYS B HE3  1  
ATOM   6879   H  HZ1  . LYS B 1 122 ? -2.189  63.737 54.165 1.00 0.00   ? 125 LYS B HZ1  1  
ATOM   6880   H  HZ2  . LYS B 1 122 ? -2.775  64.637 55.477 1.00 0.00   ? 125 LYS B HZ2  1  
ATOM   6881   H  HZ3  . LYS B 1 122 ? -3.582  63.223 54.991 1.00 0.00   ? 125 LYS B HZ3  1  
ATOM   6882   N  N    . ALA B 1 123 ? 2.881   60.443 58.038 1.00 12.76  ? 126 ALA B N    1  
ATOM   6883   C  CA   . ALA B 1 123 ? 3.194   59.018 57.777 1.00 12.76  ? 126 ALA B CA   1  
ATOM   6884   C  C    . ALA B 1 123 ? 2.180   58.569 56.775 1.00 13.04  ? 126 ALA B C    1  
ATOM   6885   O  O    . ALA B 1 123 ? 1.056   58.238 57.097 1.00 14.71  ? 126 ALA B O    1  
ATOM   6886   C  CB   . ALA B 1 123 ? 3.061   58.202 59.066 1.00 13.23  ? 126 ALA B CB   1  
ATOM   6887   H  H    . ALA B 1 123 ? 2.344   60.674 58.824 1.00 0.00   ? 126 ALA B H    1  
ATOM   6888   H  HA   . ALA B 1 123 ? 4.190   58.922 57.369 1.00 0.00   ? 126 ALA B HA   1  
ATOM   6889   H  HB1  . ALA B 1 123 ? 2.628   58.820 59.839 1.00 0.00   ? 126 ALA B HB1  1  
ATOM   6890   H  HB2  . ALA B 1 123 ? 4.037   57.864 59.380 1.00 0.00   ? 126 ALA B HB2  1  
ATOM   6891   H  HB3  . ALA B 1 123 ? 2.424   57.349 58.887 1.00 0.00   ? 126 ALA B HB3  1  
ATOM   6892   N  N    . THR B 1 124 ? 2.538   58.656 55.557 1.00 12.45  ? 127 THR B N    1  
ATOM   6893   C  CA   . THR B 1 124 ? 1.543   58.339 54.467 1.00 13.53  ? 127 THR B CA   1  
ATOM   6894   C  C    . THR B 1 124 ? 1.589   56.879 53.990 1.00 13.71  ? 127 THR B C    1  
ATOM   6895   O  O    . THR B 1 124 ? 0.752   56.457 53.216 1.00 14.89  ? 127 THR B O    1  
ATOM   6896   C  CB   . THR B 1 124 ? 1.817   59.254 53.272 1.00 13.86  ? 127 THR B CB   1  
ATOM   6897   O  OG1  . THR B 1 124 ? 3.154   59.063 52.829 1.00 15.80  ? 127 THR B OG1  1  
ATOM   6898   C  CG2  . THR B 1 124 ? 1.618   60.712 53.688 1.00 14.93  ? 127 THR B CG2  1  
ATOM   6899   H  H    . THR B 1 124 ? 3.427   58.999 55.328 1.00 0.00   ? 127 THR B H    1  
ATOM   6900   H  HA   . THR B 1 124 ? 0.551   58.549 54.835 1.00 0.00   ? 127 THR B HA   1  
ATOM   6901   H  HB   . THR B 1 124 ? 1.134   59.016 52.472 1.00 0.00   ? 127 THR B HB   1  
ATOM   6902   H  HG1  . THR B 1 124 ? 3.238   59.463 51.961 1.00 0.00   ? 127 THR B HG1  1  
ATOM   6903   H  HG21 . THR B 1 124 ? 2.389   61.322 53.241 1.00 0.00   ? 127 THR B HG21 1  
ATOM   6904   H  HG22 . THR B 1 124 ? 1.675   60.791 54.763 1.00 0.00   ? 127 THR B HG22 1  
ATOM   6905   H  HG23 . THR B 1 124 ? 0.650   61.053 53.352 1.00 0.00   ? 127 THR B HG23 1  
ATOM   6906   N  N    . LYS B 1 125 ? 2.538   56.112 54.412 1.00 14.26  ? 128 LYS B N    1  
ATOM   6907   C  CA   . LYS B 1 125 ? 2.610   54.698 53.949 1.00 15.39  ? 128 LYS B CA   1  
ATOM   6908   C  C    . LYS B 1 125 ? 2.796   53.779 55.152 1.00 14.16  ? 128 LYS B C    1  
ATOM   6909   O  O    . LYS B 1 125 ? 3.533   54.084 56.069 1.00 14.06  ? 128 LYS B O    1  
ATOM   6910   C  CB   . LYS B 1 125 ? 3.793   54.533 52.993 1.00 16.23  ? 128 LYS B CB   1  
ATOM   6911   C  CG   . LYS B 1 125 ? 3.649   55.514 51.828 1.00 18.03  ? 128 LYS B CG   1  
ATOM   6912   C  CD   . LYS B 1 125 ? 4.918   55.482 50.973 1.00 19.20  ? 128 LYS B CD   1  
ATOM   6913   C  CE   . LYS B 1 125 ? 4.725   56.364 49.739 1.00 17.57  ? 128 LYS B CE   1  
ATOM   6914   N  NZ   . LYS B 1 125 ? 3.756   55.715 48.811 1.00 19.17  ? 128 LYS B NZ   1  
ATOM   6915   H  H    . LYS B 1 125 ? 3.215   56.462 55.028 1.00 0.00   ? 128 LYS B H    1  
ATOM   6916   H  HA   . LYS B 1 125 ? 1.695   54.440 53.437 1.00 0.00   ? 128 LYS B HA   1  
ATOM   6917   H  HB2  . LYS B 1 125 ? 4.714   54.734 53.523 1.00 0.00   ? 128 LYS B HB2  1  
ATOM   6918   H  HB3  . LYS B 1 125 ? 3.810   53.523 52.611 1.00 0.00   ? 128 LYS B HB3  1  
ATOM   6919   H  HG2  . LYS B 1 125 ? 2.800   55.232 51.223 1.00 0.00   ? 128 LYS B HG2  1  
ATOM   6920   H  HG3  . LYS B 1 125 ? 3.502   56.512 52.213 1.00 0.00   ? 128 LYS B HG3  1  
ATOM   6921   H  HD2  . LYS B 1 125 ? 5.752   55.850 51.553 1.00 0.00   ? 128 LYS B HD2  1  
ATOM   6922   H  HD3  . LYS B 1 125 ? 5.116   54.468 50.661 1.00 0.00   ? 128 LYS B HD3  1  
ATOM   6923   H  HE2  . LYS B 1 125 ? 4.343   57.328 50.041 1.00 0.00   ? 128 LYS B HE2  1  
ATOM   6924   H  HE3  . LYS B 1 125 ? 5.673   56.494 49.237 1.00 0.00   ? 128 LYS B HE3  1  
ATOM   6925   H  HZ1  . LYS B 1 125 ? 3.282   54.929 49.298 1.00 0.00   ? 128 LYS B HZ1  1  
ATOM   6926   H  HZ2  . LYS B 1 125 ? 4.263   55.349 47.980 1.00 0.00   ? 128 LYS B HZ2  1  
ATOM   6927   H  HZ3  . LYS B 1 125 ? 3.048   56.413 48.506 1.00 0.00   ? 128 LYS B HZ3  1  
ATOM   6928   N  N    . PRO B 1 126 ? 2.122   52.664 55.151 1.00 13.26  ? 129 PRO B N    1  
ATOM   6929   C  CA   . PRO B 1 126 ? 2.198   51.676 56.264 1.00 12.88  ? 129 PRO B CA   1  
ATOM   6930   C  C    . PRO B 1 126 ? 3.379   50.708 56.122 1.00 12.09  ? 129 PRO B C    1  
ATOM   6931   O  O    . PRO B 1 126 ? 3.605   50.146 55.069 1.00 12.68  ? 129 PRO B O    1  
ATOM   6932   C  CB   . PRO B 1 126 ? 0.877   50.923 56.139 1.00 13.44  ? 129 PRO B CB   1  
ATOM   6933   C  CG   . PRO B 1 126 ? 0.526   50.974 54.684 1.00 13.86  ? 129 PRO B CG   1  
ATOM   6934   C  CD   . PRO B 1 126 ? 1.206   52.217 54.093 1.00 14.63  ? 129 PRO B CD   1  
ATOM   6935   H  HA   . PRO B 1 126 ? 2.236   52.181 57.215 1.00 0.00   ? 129 PRO B HA   1  
ATOM   6936   H  HB2  . PRO B 1 126 ? 0.999   49.898 56.462 1.00 0.00   ? 129 PRO B HB2  1  
ATOM   6937   H  HB3  . PRO B 1 126 ? 0.110   51.411 56.720 1.00 0.00   ? 129 PRO B HB3  1  
ATOM   6938   H  HG2  . PRO B 1 126 ? 0.887   50.082 54.189 1.00 0.00   ? 129 PRO B HG2  1  
ATOM   6939   H  HG3  . PRO B 1 126 ? -0.543  51.056 54.564 1.00 0.00   ? 129 PRO B HG3  1  
ATOM   6940   H  HD2  . PRO B 1 126 ? 1.755   51.956 53.198 1.00 0.00   ? 129 PRO B HD2  1  
ATOM   6941   H  HD3  . PRO B 1 126 ? 0.477   52.984 53.882 1.00 0.00   ? 129 PRO B HD3  1  
ATOM   6942   N  N    . GLY B 1 127 ? 4.130   50.493 57.176 1.00 10.85  ? 130 GLY B N    1  
ATOM   6943   C  CA   . GLY B 1 127 ? 5.277   49.545 57.076 1.00 10.20  ? 130 GLY B CA   1  
ATOM   6944   C  C    . GLY B 1 127 ? 6.448   50.019 57.942 1.00 9.91   ? 130 GLY B C    1  
ATOM   6945   O  O    . GLY B 1 127 ? 6.574   51.184 58.261 1.00 11.48  ? 130 GLY B O    1  
ATOM   6946   H  H    . GLY B 1 127 ? 3.933   50.944 58.024 1.00 0.00   ? 130 GLY B H    1  
ATOM   6947   H  HA2  . GLY B 1 127 ? 4.960   48.567 57.409 1.00 0.00   ? 130 GLY B HA2  1  
ATOM   6948   H  HA3  . GLY B 1 127 ? 5.600   49.484 56.048 1.00 0.00   ? 130 GLY B HA3  1  
ATOM   6949   N  N    . VAL B 1 128 ? 7.311   49.110 58.311 1.00 9.01   ? 131 VAL B N    1  
ATOM   6950   C  CA   . VAL B 1 128 ? 8.480   49.466 59.136 1.00 9.10   ? 131 VAL B CA   1  
ATOM   6951   C  C    . VAL B 1 128 ? 9.502   50.113 58.226 1.00 8.68   ? 131 VAL B C    1  
ATOM   6952   O  O    . VAL B 1 128 ? 9.642   49.754 57.073 1.00 9.58   ? 131 VAL B O    1  
ATOM   6953   C  CB   . VAL B 1 128 ? 9.073   48.205 59.768 1.00 9.36   ? 131 VAL B CB   1  
ATOM   6954   C  CG1  . VAL B 1 128 ? 8.129   47.685 60.853 1.00 9.27   ? 131 VAL B CG1  1  
ATOM   6955   C  CG2  . VAL B 1 128 ? 9.251   47.132 58.691 1.00 9.26   ? 131 VAL B CG2  1  
ATOM   6956   H  H    . VAL B 1 128 ? 7.184   48.180 58.029 1.00 0.00   ? 131 VAL B H    1  
ATOM   6957   H  HA   . VAL B 1 128 ? 8.186   50.161 59.909 1.00 0.00   ? 131 VAL B HA   1  
ATOM   6958   H  HB   . VAL B 1 128 ? 10.032  48.440 60.208 1.00 0.00   ? 131 VAL B HB   1  
ATOM   6959   H  HG11 . VAL B 1 128 ? 8.201   46.609 60.907 1.00 0.00   ? 131 VAL B HG11 1  
ATOM   6960   H  HG12 . VAL B 1 128 ? 7.114   47.965 60.612 1.00 0.00   ? 131 VAL B HG12 1  
ATOM   6961   H  HG13 . VAL B 1 128 ? 8.404   48.113 61.805 1.00 0.00   ? 131 VAL B HG13 1  
ATOM   6962   H  HG21 . VAL B 1 128 ? 8.795   46.211 59.022 1.00 0.00   ? 131 VAL B HG21 1  
ATOM   6963   H  HG22 . VAL B 1 128 ? 10.304  46.970 58.515 1.00 0.00   ? 131 VAL B HG22 1  
ATOM   6964   H  HG23 . VAL B 1 128 ? 8.780   47.459 57.776 1.00 0.00   ? 131 VAL B HG23 1  
ATOM   6965   N  N    . PHE B 1 129 ? 10.197  51.077 58.716 1.00 8.85   ? 132 PHE B N    1  
ATOM   6966   C  CA   . PHE B 1 129 ? 11.186  51.765 57.869 1.00 9.03   ? 132 PHE B CA   1  
ATOM   6967   C  C    . PHE B 1 129 ? 12.373  52.100 58.732 1.00 8.99   ? 132 PHE B C    1  
ATOM   6968   O  O    . PHE B 1 129 ? 12.270  52.193 59.939 1.00 10.35  ? 132 PHE B O    1  
ATOM   6969   C  CB   . PHE B 1 129 ? 10.579  53.049 57.300 1.00 9.76   ? 132 PHE B CB   1  
ATOM   6970   C  CG   . PHE B 1 129 ? 9.418   52.701 56.399 1.00 11.02  ? 132 PHE B CG   1  
ATOM   6971   C  CD1  . PHE B 1 129 ? 8.188   52.330 56.954 1.00 11.86  ? 132 PHE B CD1  1  
ATOM   6972   C  CD2  . PHE B 1 129 ? 9.573   52.750 55.009 1.00 12.11  ? 132 PHE B CD2  1  
ATOM   6973   C  CE1  . PHE B 1 129 ? 7.112   52.007 56.118 1.00 13.25  ? 132 PHE B CE1  1  
ATOM   6974   C  CE2  . PHE B 1 129 ? 8.497   52.427 54.173 1.00 12.96  ? 132 PHE B CE2  1  
ATOM   6975   C  CZ   . PHE B 1 129 ? 7.267   52.056 54.728 1.00 12.35  ? 132 PHE B CZ   1  
ATOM   6976   H  H    . PHE B 1 129 ? 10.056  51.365 59.642 1.00 0.00   ? 132 PHE B H    1  
ATOM   6977   H  HA   . PHE B 1 129 ? 11.492  51.115 57.062 1.00 0.00   ? 132 PHE B HA   1  
ATOM   6978   H  HB2  . PHE B 1 129 ? 10.231  53.672 58.111 1.00 0.00   ? 132 PHE B HB2  1  
ATOM   6979   H  HB3  . PHE B 1 129 ? 11.328  53.580 56.733 1.00 0.00   ? 132 PHE B HB3  1  
ATOM   6980   H  HD1  . PHE B 1 129 ? 8.069   52.292 58.027 1.00 0.00   ? 132 PHE B HD1  1  
ATOM   6981   H  HD2  . PHE B 1 129 ? 10.522  53.036 54.581 1.00 0.00   ? 132 PHE B HD2  1  
ATOM   6982   H  HE1  . PHE B 1 129 ? 6.163   51.721 56.546 1.00 0.00   ? 132 PHE B HE1  1  
ATOM   6983   H  HE2  . PHE B 1 129 ? 8.617   52.465 53.100 1.00 0.00   ? 132 PHE B HE2  1  
ATOM   6984   H  HZ   . PHE B 1 129 ? 6.437   51.807 54.083 1.00 0.00   ? 132 PHE B HZ   1  
ATOM   6985   N  N    . VAL B 1 130 ? 13.502  52.268 58.145 1.00 8.90   ? 133 VAL B N    1  
ATOM   6986   C  CA   . VAL B 1 130 ? 14.708  52.586 58.990 1.00 8.43   ? 133 VAL B CA   1  
ATOM   6987   C  C    . VAL B 1 130 ? 15.098  54.087 58.941 1.00 8.90   ? 133 VAL B C    1  
ATOM   6988   O  O    . VAL B 1 130 ? 15.282  54.655 57.882 1.00 8.92   ? 133 VAL B O    1  
ATOM   6989   C  CB   . VAL B 1 130 ? 15.891  51.752 58.496 1.00 8.97   ? 133 VAL B CB   1  
ATOM   6990   C  CG1  . VAL B 1 130 ? 17.166  52.596 58.542 1.00 9.96   ? 133 VAL B CG1  1  
ATOM   6991   C  CG2  . VAL B 1 130 ? 16.060  50.526 59.397 1.00 9.50   ? 133 VAL B CG2  1  
ATOM   6992   H  H    . VAL B 1 130 ? 13.580  52.179 57.172 1.00 0.00   ? 133 VAL B H    1  
ATOM   6993   H  HA   . VAL B 1 130 ? 14.498  52.315 60.013 1.00 0.00   ? 133 VAL B HA   1  
ATOM   6994   H  HB   . VAL B 1 130 ? 15.707  51.433 57.480 1.00 0.00   ? 133 VAL B HB   1  
ATOM   6995   H  HG11 . VAL B 1 130 ? 17.625  52.503 59.515 1.00 0.00   ? 133 VAL B HG11 1  
ATOM   6996   H  HG12 . VAL B 1 130 ? 16.919  53.631 58.357 1.00 0.00   ? 133 VAL B HG12 1  
ATOM   6997   H  HG13 . VAL B 1 130 ? 17.854  52.250 57.785 1.00 0.00   ? 133 VAL B HG13 1  
ATOM   6998   H  HG21 . VAL B 1 130 ? 16.920  50.664 60.035 1.00 0.00   ? 133 VAL B HG21 1  
ATOM   6999   H  HG22 . VAL B 1 130 ? 16.203  49.648 58.785 1.00 0.00   ? 133 VAL B HG22 1  
ATOM   7000   H  HG23 . VAL B 1 130 ? 15.176  50.402 60.005 1.00 0.00   ? 133 VAL B HG23 1  
ATOM   7001   N  N    . TYR B 1 131 ? 15.282  54.712 60.098 1.00 8.88   ? 134 TYR B N    1  
ATOM   7002   C  CA   . TYR B 1 131 ? 15.718  56.125 60.140 1.00 8.48   ? 134 TYR B CA   1  
ATOM   7003   C  C    . TYR B 1 131 ? 17.212  56.109 60.457 1.00 8.81   ? 134 TYR B C    1  
ATOM   7004   O  O    . TYR B 1 131 ? 17.723  55.150 61.001 1.00 9.02   ? 134 TYR B O    1  
ATOM   7005   C  CB   . TYR B 1 131 ? 14.959  56.874 61.237 1.00 9.26   ? 134 TYR B CB   1  
ATOM   7006   C  CG   . TYR B 1 131 ? 15.350  56.323 62.587 1.00 8.83   ? 134 TYR B CG   1  
ATOM   7007   C  CD1  . TYR B 1 131 ? 16.563  56.704 63.174 1.00 9.36   ? 134 TYR B CD1  1  
ATOM   7008   C  CD2  . TYR B 1 131 ? 14.500  55.431 63.253 1.00 8.92   ? 134 TYR B CD2  1  
ATOM   7009   C  CE1  . TYR B 1 131 ? 16.925  56.193 64.426 1.00 8.95   ? 134 TYR B CE1  1  
ATOM   7010   C  CE2  . TYR B 1 131 ? 14.863  54.921 64.504 1.00 9.29   ? 134 TYR B CE2  1  
ATOM   7011   C  CZ   . TYR B 1 131 ? 16.075  55.301 65.091 1.00 9.85   ? 134 TYR B CZ   1  
ATOM   7012   O  OH   . TYR B 1 131 ? 16.433  54.798 66.325 1.00 9.78   ? 134 TYR B OH   1  
ATOM   7013   H  H    . TYR B 1 131 ? 15.168  54.218 60.936 1.00 0.00   ? 134 TYR B H    1  
ATOM   7014   H  HA   . TYR B 1 131 ? 15.549  56.593 59.181 1.00 0.00   ? 134 TYR B HA   1  
ATOM   7015   H  HB2  . TYR B 1 131 ? 15.205  57.925 61.192 1.00 0.00   ? 134 TYR B HB2  1  
ATOM   7016   H  HB3  . TYR B 1 131 ? 13.896  56.746 61.091 1.00 0.00   ? 134 TYR B HB3  1  
ATOM   7017   H  HD1  . TYR B 1 131 ? 17.218  57.392 62.661 1.00 0.00   ? 134 TYR B HD1  1  
ATOM   7018   H  HD2  . TYR B 1 131 ? 13.564  55.138 62.800 1.00 0.00   ? 134 TYR B HD2  1  
ATOM   7019   H  HE1  . TYR B 1 131 ? 17.861  56.487 64.879 1.00 0.00   ? 134 TYR B HE1  1  
ATOM   7020   H  HE2  . TYR B 1 131 ? 14.207  54.233 65.018 1.00 0.00   ? 134 TYR B HE2  1  
ATOM   7021   H  HH   . TYR B 1 131 ? 16.146  55.422 66.995 1.00 0.00   ? 134 TYR B HH   1  
ATOM   7022   N  N    . HIS B 1 132 ? 17.925  57.132 60.110 1.00 8.34   ? 135 HIS B N    1  
ATOM   7023   C  CA   . HIS B 1 132 ? 19.397  57.131 60.382 1.00 8.52   ? 135 HIS B CA   1  
ATOM   7024   C  C    . HIS B 1 132 ? 19.993  58.523 60.109 1.00 9.19   ? 135 HIS B C    1  
ATOM   7025   O  O    . HIS B 1 132 ? 19.583  59.215 59.198 1.00 9.71   ? 135 HIS B O    1  
ATOM   7026   C  CB   . HIS B 1 132 ? 20.083  56.064 59.500 1.00 9.09   ? 135 HIS B CB   1  
ATOM   7027   C  CG   . HIS B 1 132 ? 19.847  56.323 58.024 1.00 9.17   ? 135 HIS B CG   1  
ATOM   7028   N  ND1  . HIS B 1 132 ? 20.067  57.565 57.443 1.00 9.10   ? 135 HIS B ND1  1  
ATOM   7029   C  CD2  . HIS B 1 132 ? 19.463  55.497 56.985 1.00 9.52   ? 135 HIS B CD2  1  
ATOM   7030   C  CE1  . HIS B 1 132 ? 19.830  57.461 56.129 1.00 9.64   ? 135 HIS B CE1  1  
ATOM   7031   N  NE2  . HIS B 1 132 ? 19.461  56.224 55.819 1.00 9.75   ? 135 HIS B NE2  1  
ATOM   7032   H  H    . HIS B 1 132 ? 17.508  57.893 59.655 1.00 0.00   ? 135 HIS B H    1  
ATOM   7033   H  HA   . HIS B 1 132 ? 19.558  56.882 61.421 1.00 0.00   ? 135 HIS B HA   1  
ATOM   7034   H  HB2  . HIS B 1 132 ? 21.145  56.077 59.693 1.00 0.00   ? 135 HIS B HB2  1  
ATOM   7035   H  HB3  . HIS B 1 132 ? 19.691  55.090 59.756 1.00 0.00   ? 135 HIS B HB3  1  
ATOM   7036   H  HD1  . HIS B 1 132 ? 20.348  58.378 57.914 1.00 0.00   ? 135 HIS B HD1  1  
ATOM   7037   H  HD2  . HIS B 1 132 ? 19.207  54.451 57.075 1.00 0.00   ? 135 HIS B HD2  1  
ATOM   7038   H  HE1  . HIS B 1 132 ? 19.925  58.270 55.420 1.00 0.00   ? 135 HIS B HE1  1  
ATOM   7039   N  N    . CYS B 1 133 ? 20.951  58.946 60.908 1.00 9.14   ? 136 CYS B N    1  
ATOM   7040   C  CA   . CYS B 1 133 ? 21.556  60.293 60.707 1.00 9.80   ? 136 CYS B CA   1  
ATOM   7041   C  C    . CYS B 1 133 ? 22.427  60.265 59.456 1.00 9.57   ? 136 CYS B C    1  
ATOM   7042   O  O    . CYS B 1 133 ? 23.017  59.254 59.129 1.00 9.53   ? 136 CYS B O    1  
ATOM   7043   C  CB   . CYS B 1 133 ? 22.402  60.642 61.933 1.00 10.18  ? 136 CYS B CB   1  
ATOM   7044   S  SG   . CYS B 1 133 ? 23.644  61.879 61.499 1.00 10.99  ? 136 CYS B SG   1  
ATOM   7045   H  H    . CYS B 1 133 ? 21.259  58.377 61.645 1.00 0.00   ? 136 CYS B H    1  
ATOM   7046   H  HA   . CYS B 1 133 ? 20.773  61.027 60.587 1.00 0.00   ? 136 CYS B HA   1  
ATOM   7047   H  HB2  . CYS B 1 133 ? 21.762  61.035 62.709 1.00 0.00   ? 136 CYS B HB2  1  
ATOM   7048   H  HB3  . CYS B 1 133 ? 22.894  59.751 62.293 1.00 0.00   ? 136 CYS B HB3  1  
ATOM   7049   N  N    . ALA B 1 134 ? 22.507  61.351 58.734 1.00 9.97   ? 137 ALA B N    1  
ATOM   7050   C  CA   . ALA B 1 134 ? 23.338  61.327 57.499 1.00 10.39  ? 137 ALA B CA   1  
ATOM   7051   C  C    . ALA B 1 134 ? 23.838  62.728 57.151 1.00 10.97  ? 137 ALA B C    1  
ATOM   7052   O  O    . ALA B 1 134 ? 23.382  63.338 56.205 1.00 11.86  ? 137 ALA B O    1  
ATOM   7053   C  CB   . ALA B 1 134 ? 22.500  60.789 56.338 1.00 11.03  ? 137 ALA B CB   1  
ATOM   7054   H  H    . ALA B 1 134 ? 22.019  62.160 58.993 1.00 0.00   ? 137 ALA B H    1  
ATOM   7055   H  HA   . ALA B 1 134 ? 24.186  60.676 57.653 1.00 0.00   ? 137 ALA B HA   1  
ATOM   7056   H  HB1  . ALA B 1 134 ? 22.996  59.934 55.902 1.00 0.00   ? 137 ALA B HB1  1  
ATOM   7057   H  HB2  . ALA B 1 134 ? 22.386  61.559 55.589 1.00 0.00   ? 137 ALA B HB2  1  
ATOM   7058   H  HB3  . ALA B 1 134 ? 21.527  60.494 56.702 1.00 0.00   ? 137 ALA B HB3  1  
ATOM   7059   N  N    . PRO B 1 135 ? 24.788  63.221 57.894 1.00 10.92  ? 138 PRO B N    1  
ATOM   7060   C  CA   . PRO B 1 135 ? 25.385  64.564 57.640 1.00 11.17  ? 138 PRO B CA   1  
ATOM   7061   C  C    . PRO B 1 135 ? 26.166  64.576 56.319 1.00 12.17  ? 138 PRO B C    1  
ATOM   7062   O  O    . PRO B 1 135 ? 27.051  63.770 56.112 1.00 12.43  ? 138 PRO B O    1  
ATOM   7063   C  CB   . PRO B 1 135 ? 26.335  64.792 58.825 1.00 11.44  ? 138 PRO B CB   1  
ATOM   7064   C  CG   . PRO B 1 135 ? 26.027  63.720 59.824 1.00 12.33  ? 138 PRO B CG   1  
ATOM   7065   C  CD   . PRO B 1 135 ? 25.395  62.563 59.053 1.00 10.16  ? 138 PRO B CD   1  
ATOM   7066   H  HA   . PRO B 1 135 ? 24.619  65.323 57.633 1.00 0.00   ? 138 PRO B HA   1  
ATOM   7067   H  HB2  . PRO B 1 135 ? 27.362  64.714 58.497 1.00 0.00   ? 138 PRO B HB2  1  
ATOM   7068   H  HB3  . PRO B 1 135 ? 26.157  65.763 59.262 1.00 0.00   ? 138 PRO B HB3  1  
ATOM   7069   H  HG2  . PRO B 1 135 ? 26.939  63.393 60.305 1.00 0.00   ? 138 PRO B HG2  1  
ATOM   7070   H  HG3  . PRO B 1 135 ? 25.330  64.088 60.560 1.00 0.00   ? 138 PRO B HG3  1  
ATOM   7071   H  HD2  . PRO B 1 135 ? 26.153  61.857 58.741 1.00 0.00   ? 138 PRO B HD2  1  
ATOM   7072   H  HD3  . PRO B 1 135 ? 24.638  62.077 59.647 1.00 0.00   ? 138 PRO B HD3  1  
ATOM   7073   N  N    . PRO B 1 136 ? 25.833  65.471 55.425 1.00 12.82  ? 139 PRO B N    1  
ATOM   7074   C  CA   . PRO B 1 136 ? 26.510  65.565 54.096 1.00 13.55  ? 139 PRO B CA   1  
ATOM   7075   C  C    . PRO B 1 136 ? 28.039  65.386 54.177 1.00 13.41  ? 139 PRO B C    1  
ATOM   7076   O  O    . PRO B 1 136 ? 28.727  66.160 54.813 1.00 14.06  ? 139 PRO B O    1  
ATOM   7077   C  CB   . PRO B 1 136 ? 26.161  66.977 53.628 1.00 14.32  ? 139 PRO B CB   1  
ATOM   7078   C  CG   . PRO B 1 136 ? 24.854  67.300 54.280 1.00 14.79  ? 139 PRO B CG   1  
ATOM   7079   C  CD   . PRO B 1 136 ? 24.783  66.488 55.579 1.00 13.42  ? 139 PRO B CD   1  
ATOM   7080   H  HA   . PRO B 1 136 ? 26.088  64.849 53.411 1.00 0.00   ? 139 PRO B HA   1  
ATOM   7081   H  HB2  . PRO B 1 136 ? 26.924  67.675 53.947 1.00 0.00   ? 139 PRO B HB2  1  
ATOM   7082   H  HB3  . PRO B 1 136 ? 26.054  67.001 52.555 1.00 0.00   ? 139 PRO B HB3  1  
ATOM   7083   H  HG2  . PRO B 1 136 ? 24.804  68.358 54.499 1.00 0.00   ? 139 PRO B HG2  1  
ATOM   7084   H  HG3  . PRO B 1 136 ? 24.039  67.017 53.632 1.00 0.00   ? 139 PRO B HG3  1  
ATOM   7085   H  HD2  . PRO B 1 136 ? 24.988  67.122 56.431 1.00 0.00   ? 139 PRO B HD2  1  
ATOM   7086   H  HD3  . PRO B 1 136 ? 23.818  66.016 55.679 1.00 0.00   ? 139 PRO B HD3  1  
ATOM   7087   N  N    . GLY B 1 137 ? 28.579  64.380 53.521 1.00 13.37  ? 140 GLY B N    1  
ATOM   7088   C  CA   . GLY B 1 137 ? 30.062  64.176 53.552 1.00 13.57  ? 140 GLY B CA   1  
ATOM   7089   C  C    . GLY B 1 137 ? 30.488  63.121 54.599 1.00 13.54  ? 140 GLY B C    1  
ATOM   7090   O  O    . GLY B 1 137 ? 31.595  62.623 54.551 1.00 14.86  ? 140 GLY B O    1  
ATOM   7091   H  H    . GLY B 1 137 ? 28.012  63.773 53.002 1.00 0.00   ? 140 GLY B H    1  
ATOM   7092   H  HA2  . GLY B 1 137 ? 30.391  63.852 52.576 1.00 0.00   ? 140 GLY B HA2  1  
ATOM   7093   H  HA3  . GLY B 1 137 ? 30.540  65.116 53.789 1.00 0.00   ? 140 GLY B HA3  1  
ATOM   7094   N  N    . MET B 1 138 ? 29.651  62.782 55.550 1.00 13.30  ? 141 MET B N    1  
ATOM   7095   C  CA   . MET B 1 138 ? 30.067  61.782 56.570 1.00 13.27  ? 141 MET B CA   1  
ATOM   7096   C  C    . MET B 1 138 ? 28.880  60.892 56.886 1.00 11.93  ? 141 MET B C    1  
ATOM   7097   O  O    . MET B 1 138 ? 28.605  60.575 58.026 1.00 11.48  ? 141 MET B O    1  
ATOM   7098   C  CB   . MET B 1 138 ? 30.523  62.502 57.841 1.00 15.34  ? 141 MET B CB   1  
ATOM   7099   C  CG   . MET B 1 138 ? 31.628  63.501 57.494 1.00 19.67  ? 141 MET B CG   1  
ATOM   7100   S  SD   . MET B 1 138 ? 33.237  62.680 57.592 1.00 28.50  ? 141 MET B SD   1  
ATOM   7101   C  CE   . MET B 1 138 ? 34.257  64.139 57.269 1.00 29.08  ? 141 MET B CE   1  
ATOM   7102   H  H    . MET B 1 138 ? 28.763  63.194 55.596 1.00 0.00   ? 141 MET B H    1  
ATOM   7103   H  HA   . MET B 1 138 ? 30.877  61.182 56.182 1.00 0.00   ? 141 MET B HA   1  
ATOM   7104   H  HB2  . MET B 1 138 ? 29.685  63.027 58.277 1.00 0.00   ? 141 MET B HB2  1  
ATOM   7105   H  HB3  . MET B 1 138 ? 30.903  61.780 58.548 1.00 0.00   ? 141 MET B HB3  1  
ATOM   7106   H  HG2  . MET B 1 138 ? 31.474  63.874 56.492 1.00 0.00   ? 141 MET B HG2  1  
ATOM   7107   H  HG3  . MET B 1 138 ? 31.601  64.325 58.192 1.00 0.00   ? 141 MET B HG3  1  
ATOM   7108   H  HE1  . MET B 1 138 ? 34.338  64.291 56.201 1.00 0.00   ? 141 MET B HE1  1  
ATOM   7109   H  HE2  . MET B 1 138 ? 35.241  63.991 57.693 1.00 0.00   ? 141 MET B HE2  1  
ATOM   7110   H  HE3  . MET B 1 138 ? 33.801  65.006 57.719 1.00 0.00   ? 141 MET B HE3  1  
ATOM   7111   N  N    . VAL B 1 139 ? 28.166  60.501 55.878 1.00 10.99  ? 142 VAL B N    1  
ATOM   7112   C  CA   . VAL B 1 139 ? 26.968  59.635 56.105 1.00 10.72  ? 142 VAL B CA   1  
ATOM   7113   C  C    . VAL B 1 139 ? 27.365  58.255 56.666 1.00 10.16  ? 142 VAL B C    1  
ATOM   7114   O  O    . VAL B 1 139 ? 27.047  57.921 57.790 1.00 9.73   ? 142 VAL B O    1  
ATOM   7115   C  CB   . VAL B 1 139 ? 26.231  59.443 54.779 1.00 10.43  ? 142 VAL B CB   1  
ATOM   7116   C  CG1  . VAL B 1 139 ? 25.210  58.314 54.920 1.00 12.24  ? 142 VAL B CG1  1  
ATOM   7117   C  CG2  . VAL B 1 139 ? 25.508  60.739 54.406 1.00 11.79  ? 142 VAL B CG2  1  
ATOM   7118   H  H    . VAL B 1 139 ? 28.404  60.781 54.970 1.00 0.00   ? 142 VAL B H    1  
ATOM   7119   H  HA   . VAL B 1 139 ? 26.308  60.124 56.805 1.00 0.00   ? 142 VAL B HA   1  
ATOM   7120   H  HB   . VAL B 1 139 ? 26.943  59.190 54.006 1.00 0.00   ? 142 VAL B HB   1  
ATOM   7121   H  HG11 . VAL B 1 139 ? 25.725  57.366 54.966 1.00 0.00   ? 142 VAL B HG11 1  
ATOM   7122   H  HG12 . VAL B 1 139 ? 24.544  58.321 54.070 1.00 0.00   ? 142 VAL B HG12 1  
ATOM   7123   H  HG13 . VAL B 1 139 ? 24.639  58.456 55.826 1.00 0.00   ? 142 VAL B HG13 1  
ATOM   7124   H  HG21 . VAL B 1 139 ? 25.052  60.630 53.433 1.00 0.00   ? 142 VAL B HG21 1  
ATOM   7125   H  HG22 . VAL B 1 139 ? 26.218  61.553 54.382 1.00 0.00   ? 142 VAL B HG22 1  
ATOM   7126   H  HG23 . VAL B 1 139 ? 24.745  60.949 55.140 1.00 0.00   ? 142 VAL B HG23 1  
ATOM   7127   N  N    . PRO B 1 140 ? 28.015  57.450 55.866 1.00 10.46  ? 143 PRO B N    1  
ATOM   7128   C  CA   . PRO B 1 140 ? 28.429  56.065 56.236 1.00 10.53  ? 143 PRO B CA   1  
ATOM   7129   C  C    . PRO B 1 140 ? 29.082  55.983 57.611 1.00 9.89   ? 143 PRO B C    1  
ATOM   7130   O  O    . PRO B 1 140 ? 28.921  55.016 58.330 1.00 10.44  ? 143 PRO B O    1  
ATOM   7131   C  CB   . PRO B 1 140 ? 29.434  55.659 55.145 1.00 11.20  ? 143 PRO B CB   1  
ATOM   7132   C  CG   . PRO B 1 140 ? 29.629  56.862 54.273 1.00 10.61  ? 143 PRO B CG   1  
ATOM   7133   C  CD   . PRO B 1 140 ? 28.434  57.781 54.504 1.00 11.41  ? 143 PRO B CD   1  
ATOM   7134   H  HA   . PRO B 1 140 ? 27.579  55.404 56.195 1.00 0.00   ? 143 PRO B HA   1  
ATOM   7135   H  HB2  . PRO B 1 140 ? 30.372  55.370 55.597 1.00 0.00   ? 143 PRO B HB2  1  
ATOM   7136   H  HB3  . PRO B 1 140 ? 29.036  54.844 54.561 1.00 0.00   ? 143 PRO B HB3  1  
ATOM   7137   H  HG2  . PRO B 1 140 ? 30.546  57.367 54.544 1.00 0.00   ? 143 PRO B HG2  1  
ATOM   7138   H  HG3  . PRO B 1 140 ? 29.663  56.565 53.236 1.00 0.00   ? 143 PRO B HG3  1  
ATOM   7139   H  HD2  . PRO B 1 140 ? 28.733  58.818 54.435 1.00 0.00   ? 143 PRO B HD2  1  
ATOM   7140   H  HD3  . PRO B 1 140 ? 27.642  57.561 53.805 1.00 0.00   ? 143 PRO B HD3  1  
ATOM   7141   N  N    . TRP B 1 141 ? 29.824  56.979 57.980 1.00 10.45  ? 144 TRP B N    1  
ATOM   7142   C  CA   . TRP B 1 141 ? 30.498  56.948 59.312 1.00 10.86  ? 144 TRP B CA   1  
ATOM   7143   C  C    . TRP B 1 141 ? 29.456  57.043 60.431 1.00 10.52  ? 144 TRP B C    1  
ATOM   7144   O  O    . TRP B 1 141 ? 29.461  56.269 61.368 1.00 10.85  ? 144 TRP B O    1  
ATOM   7145   C  CB   . TRP B 1 141 ? 31.466  58.128 59.418 1.00 12.30  ? 144 TRP B CB   1  
ATOM   7146   C  CG   . TRP B 1 141 ? 32.284  57.991 60.662 1.00 13.95  ? 144 TRP B CG   1  
ATOM   7147   C  CD1  . TRP B 1 141 ? 32.779  56.827 61.142 1.00 14.24  ? 144 TRP B CD1  1  
ATOM   7148   C  CD2  . TRP B 1 141 ? 32.711  59.031 61.590 1.00 15.73  ? 144 TRP B CD2  1  
ATOM   7149   N  NE1  . TRP B 1 141 ? 33.482  57.086 62.305 1.00 16.33  ? 144 TRP B NE1  1  
ATOM   7150   C  CE2  . TRP B 1 141 ? 33.469  58.430 62.622 1.00 15.41  ? 144 TRP B CE2  1  
ATOM   7151   C  CE3  . TRP B 1 141 ? 32.516  60.423 61.634 1.00 13.69  ? 144 TRP B CE3  1  
ATOM   7152   C  CZ2  . TRP B 1 141 ? 34.014  59.183 63.663 1.00 16.72  ? 144 TRP B CZ2  1  
ATOM   7153   C  CZ3  . TRP B 1 141 ? 33.063  61.185 62.680 1.00 15.26  ? 144 TRP B CZ3  1  
ATOM   7154   C  CH2  . TRP B 1 141 ? 33.810  60.566 63.692 1.00 16.98  ? 144 TRP B CH2  1  
ATOM   7155   H  H    . TRP B 1 141 ? 29.948  57.747 57.384 1.00 0.00   ? 144 TRP B H    1  
ATOM   7156   H  HA   . TRP B 1 141 ? 31.049  56.024 59.413 1.00 0.00   ? 144 TRP B HA   1  
ATOM   7157   H  HB2  . TRP B 1 141 ? 32.118  58.138 58.558 1.00 0.00   ? 144 TRP B HB2  1  
ATOM   7158   H  HB3  . TRP B 1 141 ? 30.906  59.051 59.456 1.00 0.00   ? 144 TRP B HB3  1  
ATOM   7159   H  HD1  . TRP B 1 141 ? 32.647  55.855 60.691 1.00 0.00   ? 144 TRP B HD1  1  
ATOM   7160   H  HE1  . TRP B 1 141 ? 33.940  56.413 62.851 1.00 0.00   ? 144 TRP B HE1  1  
ATOM   7161   H  HE3  . TRP B 1 141 ? 31.942  60.910 60.860 1.00 0.00   ? 144 TRP B HE3  1  
ATOM   7162   H  HZ2  . TRP B 1 141 ? 34.589  58.702 64.440 1.00 0.00   ? 144 TRP B HZ2  1  
ATOM   7163   H  HZ3  . TRP B 1 141 ? 32.907  62.253 62.705 1.00 0.00   ? 144 TRP B HZ3  1  
ATOM   7164   H  HH2  . TRP B 1 141 ? 34.228  61.156 64.494 1.00 0.00   ? 144 TRP B HH2  1  
ATOM   7165   N  N    . HIS B 1 142 ? 28.570  57.994 60.344 1.00 9.74   ? 145 HIS B N    1  
ATOM   7166   C  CA   . HIS B 1 142 ? 27.531  58.161 61.396 1.00 9.52   ? 145 HIS B CA   1  
ATOM   7167   C  C    . HIS B 1 142 ? 26.619  56.923 61.485 1.00 9.34   ? 145 HIS B C    1  
ATOM   7168   O  O    . HIS B 1 142 ? 26.204  56.532 62.558 1.00 9.31   ? 145 HIS B O    1  
ATOM   7169   C  CB   . HIS B 1 142 ? 26.686  59.383 61.048 1.00 9.80   ? 145 HIS B CB   1  
ATOM   7170   C  CG   . HIS B 1 142 ? 27.455  60.634 61.369 1.00 10.00  ? 145 HIS B CG   1  
ATOM   7171   N  ND1  . HIS B 1 142 ? 26.960  61.578 62.229 1.00 10.63  ? 145 HIS B ND1  1  
ATOM   7172   C  CD2  . HIS B 1 142 ? 28.661  61.099 60.954 1.00 11.26  ? 145 HIS B CD2  1  
ATOM   7173   C  CE1  . HIS B 1 142 ? 27.786  62.609 62.257 1.00 11.90  ? 145 HIS B CE1  1  
ATOM   7174   N  NE2  . HIS B 1 142 ? 28.845  62.337 61.522 1.00 11.76  ? 145 HIS B NE2  1  
ATOM   7175   H  H    . HIS B 1 142 ? 28.593  58.610 59.582 1.00 0.00   ? 145 HIS B H    1  
ATOM   7176   H  HA   . HIS B 1 142 ? 28.010  58.322 62.350 1.00 0.00   ? 145 HIS B HA   1  
ATOM   7177   H  HB2  . HIS B 1 142 ? 26.448  59.367 59.995 1.00 0.00   ? 145 HIS B HB2  1  
ATOM   7178   H  HB3  . HIS B 1 142 ? 25.773  59.365 61.624 1.00 0.00   ? 145 HIS B HB3  1  
ATOM   7179   H  HD2  . HIS B 1 142 ? 29.350  60.588 60.298 1.00 0.00   ? 145 HIS B HD2  1  
ATOM   7180   H  HE1  . HIS B 1 142 ? 27.619  63.529 62.798 1.00 0.00   ? 145 HIS B HE1  1  
ATOM   7181   H  HE2  . HIS B 1 142 ? 29.627  62.915 61.400 1.00 0.00   ? 145 HIS B HE2  1  
ATOM   7182   N  N    . VAL B 1 143 ? 26.280  56.319 60.375 1.00 9.00   ? 146 VAL B N    1  
ATOM   7183   C  CA   . VAL B 1 143 ? 25.372  55.135 60.420 1.00 8.98   ? 146 VAL B CA   1  
ATOM   7184   C  C    . VAL B 1 143 ? 26.103  53.925 61.005 1.00 8.66   ? 146 VAL B C    1  
ATOM   7185   O  O    . VAL B 1 143 ? 25.579  53.215 61.839 1.00 8.97   ? 146 VAL B O    1  
ATOM   7186   C  CB   . VAL B 1 143 ? 24.902  54.804 59.003 1.00 9.20   ? 146 VAL B CB   1  
ATOM   7187   C  CG1  . VAL B 1 143 ? 23.776  53.771 59.066 1.00 9.52   ? 146 VAL B CG1  1  
ATOM   7188   C  CG2  . VAL B 1 143 ? 24.387  56.077 58.328 1.00 9.48   ? 146 VAL B CG2  1  
ATOM   7189   H  H    . VAL B 1 143 ? 26.605  56.656 59.514 1.00 0.00   ? 146 VAL B H    1  
ATOM   7190   H  HA   . VAL B 1 143 ? 24.515  55.365 61.034 1.00 0.00   ? 146 VAL B HA   1  
ATOM   7191   H  HB   . VAL B 1 143 ? 25.728  54.402 58.434 1.00 0.00   ? 146 VAL B HB   1  
ATOM   7192   H  HG11 . VAL B 1 143 ? 23.939  53.014 58.312 1.00 0.00   ? 146 VAL B HG11 1  
ATOM   7193   H  HG12 . VAL B 1 143 ? 22.829  54.258 58.887 1.00 0.00   ? 146 VAL B HG12 1  
ATOM   7194   H  HG13 . VAL B 1 143 ? 23.765  53.309 60.042 1.00 0.00   ? 146 VAL B HG13 1  
ATOM   7195   H  HG21 . VAL B 1 143 ? 24.936  56.248 57.414 1.00 0.00   ? 146 VAL B HG21 1  
ATOM   7196   H  HG22 . VAL B 1 143 ? 24.523  56.917 58.993 1.00 0.00   ? 146 VAL B HG22 1  
ATOM   7197   H  HG23 . VAL B 1 143 ? 23.337  55.965 58.101 1.00 0.00   ? 146 VAL B HG23 1  
ATOM   7198   N  N    . VAL B 1 144 ? 27.301  53.677 60.564 1.00 9.19   ? 147 VAL B N    1  
ATOM   7199   C  CA   . VAL B 1 144 ? 28.060  52.505 61.080 1.00 9.33   ? 147 VAL B CA   1  
ATOM   7200   C  C    . VAL B 1 144 ? 28.332  52.706 62.562 1.00 9.40   ? 147 VAL B C    1  
ATOM   7201   O  O    . VAL B 1 144 ? 28.376  51.769 63.334 1.00 10.38  ? 147 VAL B O    1  
ATOM   7202   C  CB   . VAL B 1 144 ? 29.386  52.382 60.327 1.00 9.49   ? 147 VAL B CB   1  
ATOM   7203   C  CG1  . VAL B 1 144 ? 29.111  52.132 58.843 1.00 11.06  ? 147 VAL B CG1  1  
ATOM   7204   C  CG2  . VAL B 1 144 ? 30.183  53.679 60.485 1.00 10.84  ? 147 VAL B CG2  1  
ATOM   7205   H  H    . VAL B 1 144 ? 27.701  54.257 59.882 1.00 0.00   ? 147 VAL B H    1  
ATOM   7206   H  HA   . VAL B 1 144 ? 27.478  51.606 60.937 1.00 0.00   ? 147 VAL B HA   1  
ATOM   7207   H  HB   . VAL B 1 144 ? 29.954  51.556 60.732 1.00 0.00   ? 147 VAL B HB   1  
ATOM   7208   H  HG11 . VAL B 1 144 ? 30.012  51.779 58.364 1.00 0.00   ? 147 VAL B HG11 1  
ATOM   7209   H  HG12 . VAL B 1 144 ? 28.791  53.052 58.376 1.00 0.00   ? 147 VAL B HG12 1  
ATOM   7210   H  HG13 . VAL B 1 144 ? 28.334  51.388 58.742 1.00 0.00   ? 147 VAL B HG13 1  
ATOM   7211   H  HG21 . VAL B 1 144 ? 29.672  54.480 59.972 1.00 0.00   ? 147 VAL B HG21 1  
ATOM   7212   H  HG22 . VAL B 1 144 ? 31.168  53.550 60.061 1.00 0.00   ? 147 VAL B HG22 1  
ATOM   7213   H  HG23 . VAL B 1 144 ? 30.271  53.922 61.534 1.00 0.00   ? 147 VAL B HG23 1  
ATOM   7214   N  N    . SER B 1 145 ? 28.510  53.928 62.967 1.00 9.44   ? 148 SER B N    1  
ATOM   7215   C  CA   . SER B 1 145 ? 28.775  54.202 64.412 1.00 9.72   ? 148 SER B CA   1  
ATOM   7216   C  C    . SER B 1 145 ? 27.549  53.825 65.265 1.00 9.36   ? 148 SER B C    1  
ATOM   7217   O  O    . SER B 1 145 ? 27.590  53.889 66.478 1.00 10.20  ? 148 SER B O    1  
ATOM   7218   C  CB   . SER B 1 145 ? 29.079  55.689 64.596 1.00 10.17  ? 148 SER B CB   1  
ATOM   7219   O  OG   . SER B 1 145 ? 30.314  55.998 63.963 1.00 11.30  ? 148 SER B OG   1  
ATOM   7220   H  H    . SER B 1 145 ? 28.466  54.669 62.327 1.00 0.00   ? 148 SER B H    1  
ATOM   7221   H  HA   . SER B 1 145 ? 29.626  53.622 64.735 1.00 0.00   ? 148 SER B HA   1  
ATOM   7222   H  HB2  . SER B 1 145 ? 28.295  56.278 64.149 1.00 0.00   ? 148 SER B HB2  1  
ATOM   7223   H  HB3  . SER B 1 145 ? 29.137  55.916 65.653 1.00 0.00   ? 148 SER B HB3  1  
ATOM   7224   H  HG   . SER B 1 145 ? 30.645  55.196 63.552 1.00 0.00   ? 148 SER B HG   1  
ATOM   7225   N  N    . GLY B 1 146 ? 26.462  53.434 64.649 1.00 9.28   ? 149 GLY B N    1  
ATOM   7226   C  CA   . GLY B 1 146 ? 25.250  53.060 65.430 1.00 9.00   ? 149 GLY B CA   1  
ATOM   7227   C  C    . GLY B 1 146 ? 24.238  54.220 65.463 1.00 8.49   ? 149 GLY B C    1  
ATOM   7228   O  O    . GLY B 1 146 ? 23.435  54.312 66.370 1.00 9.05   ? 149 GLY B O    1  
ATOM   7229   H  H    . GLY B 1 146 ? 26.445  53.389 63.670 1.00 0.00   ? 149 GLY B H    1  
ATOM   7230   H  HA2  . GLY B 1 146 ? 24.787  52.196 64.975 1.00 0.00   ? 149 GLY B HA2  1  
ATOM   7231   H  HA3  . GLY B 1 146 ? 25.540  52.816 66.441 1.00 0.00   ? 149 GLY B HA3  1  
ATOM   7232   N  N    . MET B 1 147 ? 24.247  55.102 64.489 1.00 8.55   ? 150 MET B N    1  
ATOM   7233   C  CA   . MET B 1 147 ? 23.258  56.217 64.513 1.00 8.83   ? 150 MET B CA   1  
ATOM   7234   C  C    . MET B 1 147 ? 22.096  55.873 63.582 1.00 8.80   ? 150 MET B C    1  
ATOM   7235   O  O    . MET B 1 147 ? 21.912  56.480 62.546 1.00 8.81   ? 150 MET B O    1  
ATOM   7236   C  CB   . MET B 1 147 ? 23.915  57.521 64.056 1.00 9.29   ? 150 MET B CB   1  
ATOM   7237   C  CG   . MET B 1 147 ? 23.037  58.699 64.489 1.00 9.73   ? 150 MET B CG   1  
ATOM   7238   S  SD   . MET B 1 147 ? 24.061  60.131 64.805 1.00 10.24  ? 150 MET B SD   1  
ATOM   7239   C  CE   . MET B 1 147 ? 22.774  61.227 65.345 1.00 11.27  ? 150 MET B CE   1  
ATOM   7240   H  H    . MET B 1 147 ? 24.889  55.022 63.752 1.00 0.00   ? 150 MET B H    1  
ATOM   7241   H  HA   . MET B 1 147 ? 22.883  56.338 65.519 1.00 0.00   ? 150 MET B HA   1  
ATOM   7242   H  HB2  . MET B 1 147 ? 24.892  57.611 64.508 1.00 0.00   ? 150 MET B HB2  1  
ATOM   7243   H  HB3  . MET B 1 147 ? 24.011  57.521 62.981 1.00 0.00   ? 150 MET B HB3  1  
ATOM   7244   H  HG2  . MET B 1 147 ? 22.331  58.928 63.705 1.00 0.00   ? 150 MET B HG2  1  
ATOM   7245   H  HG3  . MET B 1 147 ? 22.500  58.434 65.388 1.00 0.00   ? 150 MET B HG3  1  
ATOM   7246   H  HE1  . MET B 1 147 ? 23.155  61.874 66.123 1.00 0.00   ? 150 MET B HE1  1  
ATOM   7247   H  HE2  . MET B 1 147 ? 21.945  60.648 65.726 1.00 0.00   ? 150 MET B HE2  1  
ATOM   7248   H  HE3  . MET B 1 147 ? 22.439  61.828 64.514 1.00 0.00   ? 150 MET B HE3  1  
ATOM   7249   N  N    . ASN B 1 148 ? 21.313  54.895 63.946 1.00 8.30   ? 151 ASN B N    1  
ATOM   7250   C  CA   . ASN B 1 148 ? 20.163  54.497 63.089 1.00 8.82   ? 151 ASN B CA   1  
ATOM   7251   C  C    . ASN B 1 148 ? 19.235  53.548 63.860 1.00 8.62   ? 151 ASN B C    1  
ATOM   7252   O  O    . ASN B 1 148 ? 19.660  52.778 64.698 1.00 9.33   ? 151 ASN B O    1  
ATOM   7253   C  CB   . ASN B 1 148 ? 20.685  53.789 61.837 1.00 8.85   ? 151 ASN B CB   1  
ATOM   7254   C  CG   . ASN B 1 148 ? 21.362  52.477 62.236 1.00 9.09   ? 151 ASN B CG   1  
ATOM   7255   O  OD1  . ASN B 1 148 ? 20.699  51.491 62.493 1.00 9.42   ? 151 ASN B OD1  1  
ATOM   7256   N  ND2  . ASN B 1 148 ? 22.664  52.422 62.300 1.00 8.81   ? 151 ASN B ND2  1  
ATOM   7257   H  H    . ASN B 1 148 ? 21.485  54.418 64.785 1.00 0.00   ? 151 ASN B H    1  
ATOM   7258   H  HA   . ASN B 1 148 ? 19.612  55.379 62.798 1.00 0.00   ? 151 ASN B HA   1  
ATOM   7259   H  HB2  . ASN B 1 148 ? 19.860  53.582 61.171 1.00 0.00   ? 151 ASN B HB2  1  
ATOM   7260   H  HB3  . ASN B 1 148 ? 21.401  54.423 61.337 1.00 0.00   ? 151 ASN B HB3  1  
ATOM   7261   H  HD21 . ASN B 1 148 ? 23.199  53.216 62.093 1.00 0.00   ? 151 ASN B HD21 1  
ATOM   7262   H  HD22 . ASN B 1 148 ? 23.107  51.585 62.555 1.00 0.00   ? 151 ASN B HD22 1  
ATOM   7263   N  N    . GLY B 1 149 ? 17.967  53.607 63.564 1.00 8.42   ? 152 GLY B N    1  
ATOM   7264   C  CA   . GLY B 1 149 ? 16.960  52.726 64.241 1.00 8.95   ? 152 GLY B CA   1  
ATOM   7265   C  C    . GLY B 1 149 ? 15.825  52.412 63.247 1.00 8.53   ? 152 GLY B C    1  
ATOM   7266   O  O    . GLY B 1 149 ? 16.076  52.114 62.096 1.00 8.69   ? 152 GLY B O    1  
ATOM   7267   H  H    . GLY B 1 149 ? 17.665  54.239 62.878 1.00 0.00   ? 152 GLY B H    1  
ATOM   7268   H  HA2  . GLY B 1 149 ? 17.435  51.807 64.554 1.00 0.00   ? 152 GLY B HA2  1  
ATOM   7269   H  HA3  . GLY B 1 149 ? 16.552  53.235 65.100 1.00 0.00   ? 152 GLY B HA3  1  
ATOM   7270   N  N    . ALA B 1 150 ? 14.578  52.482 63.665 1.00 9.36   ? 153 ALA B N    1  
ATOM   7271   C  CA   . ALA B 1 150 ? 13.466  52.190 62.706 1.00 9.39   ? 153 ALA B CA   1  
ATOM   7272   C  C    . ALA B 1 150 ? 12.101  52.517 63.333 1.00 9.67   ? 153 ALA B C    1  
ATOM   7273   O  O    . ALA B 1 150 ? 11.887  52.325 64.514 1.00 9.71   ? 153 ALA B O    1  
ATOM   7274   C  CB   . ALA B 1 150 ? 13.503  50.709 62.326 1.00 10.02  ? 153 ALA B CB   1  
ATOM   7275   H  H    . ALA B 1 150 ? 14.380  52.730 64.592 1.00 0.00   ? 153 ALA B H    1  
ATOM   7276   H  HA   . ALA B 1 150 ? 13.599  52.787 61.816 1.00 0.00   ? 153 ALA B HA   1  
ATOM   7277   H  HB1  . ALA B 1 150 ? 14.398  50.257 62.730 1.00 0.00   ? 153 ALA B HB1  1  
ATOM   7278   H  HB2  . ALA B 1 150 ? 13.505  50.612 61.251 1.00 0.00   ? 153 ALA B HB2  1  
ATOM   7279   H  HB3  . ALA B 1 150 ? 12.635  50.211 62.731 1.00 0.00   ? 153 ALA B HB3  1  
ATOM   7280   N  N    . ILE B 1 151 ? 11.169  52.994 62.539 1.00 9.38   ? 154 ILE B N    1  
ATOM   7281   C  CA   . ILE B 1 151 ? 9.814   53.315 63.072 1.00 9.68   ? 154 ILE B CA   1  
ATOM   7282   C  C    . ILE B 1 151 ? 8.780   52.421 62.376 1.00 10.15  ? 154 ILE B C    1  
ATOM   7283   O  O    . ILE B 1 151 ? 8.968   52.003 61.251 1.00 9.95   ? 154 ILE B O    1  
ATOM   7284   C  CB   . ILE B 1 151 ? 9.490   54.784 62.796 1.00 9.87   ? 154 ILE B CB   1  
ATOM   7285   C  CG1  . ILE B 1 151 ? 9.049   54.943 61.339 1.00 10.62  ? 154 ILE B CG1  1  
ATOM   7286   C  CG2  . ILE B 1 151 ? 10.734  55.638 63.047 1.00 10.24  ? 154 ILE B CG2  1  
ATOM   7287   C  CD1  . ILE B 1 151 ? 8.332   56.282 61.165 1.00 11.32  ? 154 ILE B CD1  1  
ATOM   7288   H  H    . ILE B 1 151 ? 11.362  53.127 61.587 1.00 0.00   ? 154 ILE B H    1  
ATOM   7289   H  HA   . ILE B 1 151 ? 9.792   53.132 64.136 1.00 0.00   ? 154 ILE B HA   1  
ATOM   7290   H  HB   . ILE B 1 151 ? 8.695   55.106 63.452 1.00 0.00   ? 154 ILE B HB   1  
ATOM   7291   H  HG12 . ILE B 1 151 ? 9.917   54.911 60.695 1.00 0.00   ? 154 ILE B HG12 1  
ATOM   7292   H  HG13 . ILE B 1 151 ? 8.377   54.140 61.077 1.00 0.00   ? 154 ILE B HG13 1  
ATOM   7293   H  HG21 . ILE B 1 151 ? 11.581  54.994 63.233 1.00 0.00   ? 154 ILE B HG21 1  
ATOM   7294   H  HG22 . ILE B 1 151 ? 10.569  56.272 63.905 1.00 0.00   ? 154 ILE B HG22 1  
ATOM   7295   H  HG23 . ILE B 1 151 ? 10.932  56.250 62.179 1.00 0.00   ? 154 ILE B HG23 1  
ATOM   7296   H  HD11 . ILE B 1 151 ? 8.781   56.828 60.349 1.00 0.00   ? 154 ILE B HD11 1  
ATOM   7297   H  HD12 . ILE B 1 151 ? 8.419   56.858 62.075 1.00 0.00   ? 154 ILE B HD12 1  
ATOM   7298   H  HD13 . ILE B 1 151 ? 7.288   56.107 60.950 1.00 0.00   ? 154 ILE B HD13 1  
ATOM   7299   N  N    . MET B 1 152 ? 7.693   52.121 63.035 1.00 9.75   ? 155 MET B N    1  
ATOM   7300   C  CA   . MET B 1 152 ? 6.656   51.251 62.410 1.00 9.86   ? 155 MET B CA   1  
ATOM   7301   C  C    . MET B 1 152 ? 5.325   52.008 62.287 1.00 9.81   ? 155 MET B C    1  
ATOM   7302   O  O    . MET B 1 152 ? 4.692   52.344 63.268 1.00 10.83  ? 155 MET B O    1  
ATOM   7303   C  CB   . MET B 1 152 ? 6.451   50.006 63.275 1.00 10.15  ? 155 MET B CB   1  
ATOM   7304   C  CG   . MET B 1 152 ? 5.381   49.115 62.643 1.00 10.08  ? 155 MET B CG   1  
ATOM   7305   S  SD   . MET B 1 152 ? 5.297   47.544 63.539 1.00 11.58  ? 155 MET B SD   1  
ATOM   7306   C  CE   . MET B 1 152 ? 4.654   48.206 65.096 1.00 10.91  ? 155 MET B CE   1  
ATOM   7307   H  H    . MET B 1 152 ? 7.561   52.465 63.943 1.00 0.00   ? 155 MET B H    1  
ATOM   7308   H  HA   . MET B 1 152 ? 6.987   50.951 61.427 1.00 0.00   ? 155 MET B HA   1  
ATOM   7309   H  HB2  . MET B 1 152 ? 7.381   49.460 63.345 1.00 0.00   ? 155 MET B HB2  1  
ATOM   7310   H  HB3  . MET B 1 152 ? 6.132   50.303 64.263 1.00 0.00   ? 155 MET B HB3  1  
ATOM   7311   H  HG2  . MET B 1 152 ? 4.423   49.610 62.695 1.00 0.00   ? 155 MET B HG2  1  
ATOM   7312   H  HG3  . MET B 1 152 ? 5.633   48.927 61.610 1.00 0.00   ? 155 MET B HG3  1  
ATOM   7313   H  HE1  . MET B 1 152 ? 4.137   49.135 64.905 1.00 0.00   ? 155 MET B HE1  1  
ATOM   7314   H  HE2  . MET B 1 152 ? 5.475   48.378 65.779 1.00 0.00   ? 155 MET B HE2  1  
ATOM   7315   H  HE3  . MET B 1 152 ? 3.968   47.498 65.533 1.00 0.00   ? 155 MET B HE3  1  
ATOM   7316   N  N    . VAL B 1 153 ? 4.895   52.256 61.079 1.00 10.00  ? 156 VAL B N    1  
ATOM   7317   C  CA   . VAL B 1 153 ? 3.609   52.962 60.852 1.00 10.21  ? 156 VAL B CA   1  
ATOM   7318   C  C    . VAL B 1 153 ? 2.598   51.880 60.558 1.00 10.30  ? 156 VAL B C    1  
ATOM   7319   O  O    . VAL B 1 153 ? 2.601   51.282 59.501 1.00 10.56  ? 156 VAL B O    1  
ATOM   7320   C  CB   . VAL B 1 153 ? 3.732   53.908 59.656 1.00 10.87  ? 156 VAL B CB   1  
ATOM   7321   C  CG1  . VAL B 1 153 ? 2.387   54.594 59.407 1.00 11.17  ? 156 VAL B CG1  1  
ATOM   7322   C  CG2  . VAL B 1 153 ? 4.796   54.967 59.952 1.00 11.37  ? 156 VAL B CG2  1  
ATOM   7323   H  H    . VAL B 1 153 ? 5.423   51.958 60.309 1.00 0.00   ? 156 VAL B H    1  
ATOM   7324   H  HA   . VAL B 1 153 ? 3.323   53.509 61.739 1.00 0.00   ? 156 VAL B HA   1  
ATOM   7325   H  HB   . VAL B 1 153 ? 4.016   53.344 58.779 1.00 0.00   ? 156 VAL B HB   1  
ATOM   7326   H  HG11 . VAL B 1 153 ? 2.546   55.506 58.851 1.00 0.00   ? 156 VAL B HG11 1  
ATOM   7327   H  HG12 . VAL B 1 153 ? 1.921   54.825 60.353 1.00 0.00   ? 156 VAL B HG12 1  
ATOM   7328   H  HG13 . VAL B 1 153 ? 1.746   53.935 58.841 1.00 0.00   ? 156 VAL B HG13 1  
ATOM   7329   H  HG21 . VAL B 1 153 ? 5.612   54.863 59.252 1.00 0.00   ? 156 VAL B HG21 1  
ATOM   7330   H  HG22 . VAL B 1 153 ? 5.165   54.835 60.958 1.00 0.00   ? 156 VAL B HG22 1  
ATOM   7331   H  HG23 . VAL B 1 153 ? 4.362   55.951 59.854 1.00 0.00   ? 156 VAL B HG23 1  
ATOM   7332   N  N    . LEU B 1 154 ? 1.787   51.560 61.507 1.00 10.66  ? 157 LEU B N    1  
ATOM   7333   C  CA   . LEU B 1 154 ? 0.834   50.425 61.290 1.00 11.16  ? 157 LEU B CA   1  
ATOM   7334   C  C    . LEU B 1 154 ? -0.481  50.884 60.667 1.00 11.66  ? 157 LEU B C    1  
ATOM   7335   O  O    . LEU B 1 154 ? -1.021  51.914 61.019 1.00 12.46  ? 157 LEU B O    1  
ATOM   7336   C  CB   . LEU B 1 154 ? 0.542   49.757 62.634 1.00 11.39  ? 157 LEU B CB   1  
ATOM   7337   C  CG   . LEU B 1 154 ? 1.791   49.020 63.121 1.00 11.67  ? 157 LEU B CG   1  
ATOM   7338   C  CD1  . LEU B 1 154 ? 1.937   49.206 64.632 1.00 12.74  ? 157 LEU B CD1  1  
ATOM   7339   C  CD2  . LEU B 1 154 ? 1.658   47.529 62.802 1.00 13.56  ? 157 LEU B CD2  1  
ATOM   7340   H  H    . LEU B 1 154 ? 1.838   52.008 62.377 1.00 0.00   ? 157 LEU B H    1  
ATOM   7341   H  HA   . LEU B 1 154 ? 1.296   49.701 60.637 1.00 0.00   ? 157 LEU B HA   1  
ATOM   7342   H  HB2  . LEU B 1 154 ? 0.263   50.510 63.357 1.00 0.00   ? 157 LEU B HB2  1  
ATOM   7343   H  HB3  . LEU B 1 154 ? -0.267  49.052 62.518 1.00 0.00   ? 157 LEU B HB3  1  
ATOM   7344   H  HG   . LEU B 1 154 ? 2.662   49.421 62.623 1.00 0.00   ? 157 LEU B HG   1  
ATOM   7345   H  HD11 . LEU B 1 154 ? 2.517   48.391 65.040 1.00 0.00   ? 157 LEU B HD11 1  
ATOM   7346   H  HD12 . LEU B 1 154 ? 0.960   49.216 65.090 1.00 0.00   ? 157 LEU B HD12 1  
ATOM   7347   H  HD13 . LEU B 1 154 ? 2.439   50.141 64.833 1.00 0.00   ? 157 LEU B HD13 1  
ATOM   7348   H  HD21 . LEU B 1 154 ? 1.808   46.953 63.703 1.00 0.00   ? 157 LEU B HD21 1  
ATOM   7349   H  HD22 . LEU B 1 154 ? 2.400   47.250 62.068 1.00 0.00   ? 157 LEU B HD22 1  
ATOM   7350   H  HD23 . LEU B 1 154 ? 0.672   47.331 62.409 1.00 0.00   ? 157 LEU B HD23 1  
ATOM   7351   N  N    . PRO B 1 155 ? -1.019  50.085 59.771 1.00 12.16  ? 158 PRO B N    1  
ATOM   7352   C  CA   . PRO B 1 155 ? -2.323  50.387 59.127 1.00 12.85  ? 158 PRO B CA   1  
ATOM   7353   C  C    . PRO B 1 155 ? -3.373  50.753 60.184 1.00 13.58  ? 158 PRO B C    1  
ATOM   7354   O  O    . PRO B 1 155 ? -3.438  50.155 61.239 1.00 13.18  ? 158 PRO B O    1  
ATOM   7355   C  CB   . PRO B 1 155 ? -2.696  49.082 58.421 1.00 12.76  ? 158 PRO B CB   1  
ATOM   7356   C  CG   . PRO B 1 155 ? -1.402  48.370 58.188 1.00 13.26  ? 158 PRO B CG   1  
ATOM   7357   C  CD   . PRO B 1 155 ? -0.440  48.823 59.288 1.00 12.87  ? 158 PRO B CD   1  
ATOM   7358   H  HA   . PRO B 1 155 ? -2.216  51.180 58.404 1.00 0.00   ? 158 PRO B HA   1  
ATOM   7359   H  HB2  . PRO B 1 155 ? -3.344  48.489 59.051 1.00 0.00   ? 158 PRO B HB2  1  
ATOM   7360   H  HB3  . PRO B 1 155 ? -3.176  49.290 57.477 1.00 0.00   ? 158 PRO B HB3  1  
ATOM   7361   H  HG2  . PRO B 1 155 ? -1.556  47.300 58.244 1.00 0.00   ? 158 PRO B HG2  1  
ATOM   7362   H  HG3  . PRO B 1 155 ? -1.001  48.636 57.223 1.00 0.00   ? 158 PRO B HG3  1  
ATOM   7363   H  HD2  . PRO B 1 155 ? -0.402  48.091 60.083 1.00 0.00   ? 158 PRO B HD2  1  
ATOM   7364   H  HD3  . PRO B 1 155 ? 0.545   48.997 58.883 1.00 0.00   ? 158 PRO B HD3  1  
ATOM   7365   N  N    . ARG B 1 156 ? -4.173  51.744 59.922 1.00 14.42  ? 159 ARG B N    1  
ATOM   7366   C  CA   . ARG B 1 156 ? -5.198  52.172 60.920 1.00 15.33  ? 159 ARG B CA   1  
ATOM   7367   C  C    . ARG B 1 156 ? -6.000  50.966 61.407 1.00 15.28  ? 159 ARG B C    1  
ATOM   7368   O  O    . ARG B 1 156 ? -6.434  50.913 62.540 1.00 15.56  ? 159 ARG B O    1  
ATOM   7369   C  CB   . ARG B 1 156 ? -6.147  53.182 60.271 1.00 15.73  ? 159 ARG B CB   1  
ATOM   7370   C  CG   . ARG B 1 156 ? -5.480  54.558 60.234 1.00 17.55  ? 159 ARG B CG   1  
ATOM   7371   C  CD   . ARG B 1 156 ? -6.487  55.600 59.744 1.00 19.64  ? 159 ARG B CD   1  
ATOM   7372   N  NE   . ARG B 1 156 ? -6.690  56.631 60.801 1.00 22.69  ? 159 ARG B NE   1  
ATOM   7373   C  CZ   . ARG B 1 156 ? -5.660  57.157 61.405 1.00 22.58  ? 159 ARG B CZ   1  
ATOM   7374   N  NH1  . ARG B 1 156 ? -4.452  56.782 61.083 1.00 24.62  ? 159 ARG B NH1  1  
ATOM   7375   N  NH2  . ARG B 1 156 ? -5.837  58.059 62.331 1.00 20.10  ? 159 ARG B NH2  1  
ATOM   7376   H  H    . ARG B 1 156 ? -4.090  52.225 59.072 1.00 0.00   ? 159 ARG B H    1  
ATOM   7377   H  HA   . ARG B 1 156 ? -4.706  52.636 61.761 1.00 0.00   ? 159 ARG B HA   1  
ATOM   7378   H  HB2  . ARG B 1 156 ? -6.375  52.864 59.263 1.00 0.00   ? 159 ARG B HB2  1  
ATOM   7379   H  HB3  . ARG B 1 156 ? -7.059  53.241 60.846 1.00 0.00   ? 159 ARG B HB3  1  
ATOM   7380   H  HG2  . ARG B 1 156 ? -5.142  54.821 61.226 1.00 0.00   ? 159 ARG B HG2  1  
ATOM   7381   H  HG3  . ARG B 1 156 ? -4.636  54.532 59.561 1.00 0.00   ? 159 ARG B HG3  1  
ATOM   7382   H  HD2  . ARG B 1 156 ? -6.110  56.073 58.849 1.00 0.00   ? 159 ARG B HD2  1  
ATOM   7383   H  HD3  . ARG B 1 156 ? -7.428  55.117 59.527 1.00 0.00   ? 159 ARG B HD3  1  
ATOM   7384   H  HE   . ARG B 1 156 ? -7.597  56.913 61.043 1.00 0.00   ? 159 ARG B HE   1  
ATOM   7385   H  HH11 . ARG B 1 156 ? -4.316  56.090 60.373 1.00 0.00   ? 159 ARG B HH11 1  
ATOM   7386   H  HH12 . ARG B 1 156 ? -3.663  57.185 61.545 1.00 0.00   ? 159 ARG B HH12 1  
ATOM   7387   H  HH21 . ARG B 1 156 ? -6.763  58.347 62.578 1.00 0.00   ? 159 ARG B HH21 1  
ATOM   7388   H  HH22 . ARG B 1 156 ? -5.048  58.463 62.794 1.00 0.00   ? 159 ARG B HH22 1  
ATOM   7389   N  N    . GLU B 1 157 ? -6.208  50.003 60.559 1.00 15.78  ? 160 GLU B N    1  
ATOM   7390   C  CA   . GLU B 1 157 ? -6.997  48.796 60.970 1.00 16.74  ? 160 GLU B CA   1  
ATOM   7391   C  C    . GLU B 1 157 ? -6.086  47.660 61.491 1.00 15.66  ? 160 GLU B C    1  
ATOM   7392   O  O    . GLU B 1 157 ? -6.514  46.527 61.596 1.00 15.90  ? 160 GLU B O    1  
ATOM   7393   C  CB   . GLU B 1 157 ? -7.792  48.287 59.767 1.00 17.85  ? 160 GLU B CB   1  
ATOM   7394   C  CG   . GLU B 1 157 ? -8.810  49.346 59.341 1.00 23.27  ? 160 GLU B CG   1  
ATOM   7395   C  CD   . GLU B 1 157 ? -10.007 49.316 60.293 1.00 30.02  ? 160 GLU B CD   1  
ATOM   7396   O  OE1  . GLU B 1 157 ? -9.787  49.360 61.492 1.00 35.31  ? 160 GLU B OE1  1  
ATOM   7397   O  OE2  . GLU B 1 157 ? -11.124 49.249 59.806 1.00 36.03  ? 160 GLU B OE2  1  
ATOM   7398   H  H    . GLU B 1 157 ? -5.855  50.069 59.647 1.00 0.00   ? 160 GLU B H    1  
ATOM   7399   H  HA   . GLU B 1 157 ? -7.688  49.078 61.751 1.00 0.00   ? 160 GLU B HA   1  
ATOM   7400   H  HB2  . GLU B 1 157 ? -7.116  48.086 58.948 1.00 0.00   ? 160 GLU B HB2  1  
ATOM   7401   H  HB3  . GLU B 1 157 ? -8.311  47.379 60.036 1.00 0.00   ? 160 GLU B HB3  1  
ATOM   7402   H  HG2  . GLU B 1 157 ? -8.348  50.322 59.372 1.00 0.00   ? 160 GLU B HG2  1  
ATOM   7403   H  HG3  . GLU B 1 157 ? -9.147  49.139 58.336 1.00 0.00   ? 160 GLU B HG3  1  
ATOM   7404   N  N    . GLY B 1 158 ? -4.852  47.938 61.831 1.00 14.47  ? 161 GLY B N    1  
ATOM   7405   C  CA   . GLY B 1 158 ? -3.962  46.863 62.351 1.00 14.18  ? 161 GLY B CA   1  
ATOM   7406   C  C    . GLY B 1 158 ? -3.303  46.131 61.186 1.00 13.89  ? 161 GLY B C    1  
ATOM   7407   O  O    . GLY B 1 158 ? -3.354  46.571 60.054 1.00 14.50  ? 161 GLY B O    1  
ATOM   7408   H  H    . GLY B 1 158 ? -4.518  48.856 61.754 1.00 0.00   ? 161 GLY B H    1  
ATOM   7409   H  HA2  . GLY B 1 158 ? -3.199  47.301 62.980 1.00 0.00   ? 161 GLY B HA2  1  
ATOM   7410   H  HA3  . GLY B 1 158 ? -4.544  46.161 62.928 1.00 0.00   ? 161 GLY B HA3  1  
ATOM   7411   N  N    . LEU B 1 159 ? -2.681  45.016 61.451 1.00 13.66  ? 162 LEU B N    1  
ATOM   7412   C  CA   . LEU B 1 159 ? -2.016  44.257 60.346 1.00 13.46  ? 162 LEU B CA   1  
ATOM   7413   C  C    . LEU B 1 159 ? -2.884  43.065 59.899 1.00 13.34  ? 162 LEU B C    1  
ATOM   7414   O  O    . LEU B 1 159 ? -3.496  42.389 60.701 1.00 13.87  ? 162 LEU B O    1  
ATOM   7415   C  CB   . LEU B 1 159 ? -0.662  43.738 60.836 1.00 13.48  ? 162 LEU B CB   1  
ATOM   7416   C  CG   . LEU B 1 159 ? 0.174   44.906 61.360 1.00 14.06  ? 162 LEU B CG   1  
ATOM   7417   C  CD1  . LEU B 1 159 ? 1.343   44.368 62.186 1.00 15.04  ? 162 LEU B CD1  1  
ATOM   7418   C  CD2  . LEU B 1 159 ? 0.715   45.714 60.178 1.00 14.30  ? 162 LEU B CD2  1  
ATOM   7419   H  H    . LEU B 1 159 ? -2.649  44.677 62.370 1.00 0.00   ? 162 LEU B H    1  
ATOM   7420   H  HA   . LEU B 1 159 ? -1.858  44.917 59.507 1.00 0.00   ? 162 LEU B HA   1  
ATOM   7421   H  HB2  . LEU B 1 159 ? -0.818  43.021 61.630 1.00 0.00   ? 162 LEU B HB2  1  
ATOM   7422   H  HB3  . LEU B 1 159 ? -0.141  43.263 60.019 1.00 0.00   ? 162 LEU B HB3  1  
ATOM   7423   H  HG   . LEU B 1 159 ? -0.443  45.541 61.980 1.00 0.00   ? 162 LEU B HG   1  
ATOM   7424   H  HD11 . LEU B 1 159 ? 1.804   43.543 61.663 1.00 0.00   ? 162 LEU B HD11 1  
ATOM   7425   H  HD12 . LEU B 1 159 ? 0.981   44.029 63.145 1.00 0.00   ? 162 LEU B HD12 1  
ATOM   7426   H  HD13 . LEU B 1 159 ? 2.071   45.153 62.334 1.00 0.00   ? 162 LEU B HD13 1  
ATOM   7427   H  HD21 . LEU B 1 159 ? 1.203   45.049 59.481 1.00 0.00   ? 162 LEU B HD21 1  
ATOM   7428   H  HD22 . LEU B 1 159 ? 1.426   46.444 60.537 1.00 0.00   ? 162 LEU B HD22 1  
ATOM   7429   H  HD23 . LEU B 1 159 ? -0.101  46.219 59.683 1.00 0.00   ? 162 LEU B HD23 1  
ATOM   7430   N  N    . HIS B 1 160 ? -2.916  42.801 58.613 1.00 13.85  ? 163 HIS B N    1  
ATOM   7431   C  CA   . HIS B 1 160 ? -3.702  41.664 58.081 1.00 14.55  ? 163 HIS B CA   1  
ATOM   7432   C  C    . HIS B 1 160 ? -2.818  40.900 57.093 1.00 14.77  ? 163 HIS B C    1  
ATOM   7433   O  O    . HIS B 1 160 ? -1.849  41.424 56.581 1.00 14.17  ? 163 HIS B O    1  
ATOM   7434   C  CB   . HIS B 1 160 ? -4.947  42.187 57.362 1.00 15.67  ? 163 HIS B CB   1  
ATOM   7435   C  CG   . HIS B 1 160 ? -5.904  42.763 58.370 1.00 18.05  ? 163 HIS B CG   1  
ATOM   7436   N  ND1  . HIS B 1 160 ? -5.585  43.870 59.145 1.00 22.68  ? 163 HIS B ND1  1  
ATOM   7437   C  CD2  . HIS B 1 160 ? -7.174  42.397 58.742 1.00 20.78  ? 163 HIS B CD2  1  
ATOM   7438   C  CE1  . HIS B 1 160 ? -6.642  44.129 59.937 1.00 21.20  ? 163 HIS B CE1  1  
ATOM   7439   N  NE2  . HIS B 1 160 ? -7.634  43.261 59.729 1.00 22.25  ? 163 HIS B NE2  1  
ATOM   7440   H  H    . HIS B 1 160 ? -2.398  43.358 57.995 1.00 0.00   ? 163 HIS B H    1  
ATOM   7441   H  HA   . HIS B 1 160 ? -3.993  41.010 58.890 1.00 0.00   ? 163 HIS B HA   1  
ATOM   7442   H  HB2  . HIS B 1 160 ? -4.660  42.955 56.658 1.00 0.00   ? 163 HIS B HB2  1  
ATOM   7443   H  HB3  . HIS B 1 160 ? -5.427  41.376 56.834 1.00 0.00   ? 163 HIS B HB3  1  
ATOM   7444   H  HD1  . HIS B 1 160 ? -4.743  44.371 59.120 1.00 0.00   ? 163 HIS B HD1  1  
ATOM   7445   H  HD2  . HIS B 1 160 ? -7.730  41.567 58.332 1.00 0.00   ? 163 HIS B HD2  1  
ATOM   7446   H  HE1  . HIS B 1 160 ? -6.682  44.938 60.651 1.00 0.00   ? 163 HIS B HE1  1  
ATOM   7447   H  HE2  . HIS B 1 160 ? -8.505  43.238 60.179 1.00 0.00   ? 163 HIS B HE2  1  
ATOM   7448   N  N    . ASP B 1 161 ? -3.134  39.670 56.832 1.00 15.39  ? 164 ASP B N    1  
ATOM   7449   C  CA   . ASP B 1 161 ? -2.305  38.864 55.887 1.00 15.93  ? 164 ASP B CA   1  
ATOM   7450   C  C    . ASP B 1 161 ? -2.497  39.370 54.455 1.00 16.62  ? 164 ASP B C    1  
ATOM   7451   O  O    . ASP B 1 161 ? -2.996  40.456 54.231 1.00 17.36  ? 164 ASP B O    1  
ATOM   7452   C  CB   . ASP B 1 161 ? -2.727  37.396 55.967 1.00 16.20  ? 164 ASP B CB   1  
ATOM   7453   C  CG   . ASP B 1 161 ? -4.174  37.254 55.491 1.00 17.37  ? 164 ASP B CG   1  
ATOM   7454   O  OD1  . ASP B 1 161 ? -4.699  38.218 54.957 1.00 16.74  ? 164 ASP B OD1  1  
ATOM   7455   O  OD2  . ASP B 1 161 ? -4.733  36.184 55.668 1.00 20.82  ? 164 ASP B OD2  1  
ATOM   7456   H  H    . ASP B 1 161 ? -3.915  39.264 57.263 1.00 0.00   ? 164 ASP B H    1  
ATOM   7457   H  HA   . ASP B 1 161 ? -1.264  38.951 56.161 1.00 0.00   ? 164 ASP B HA   1  
ATOM   7458   H  HB2  . ASP B 1 161 ? -2.081  36.801 55.338 1.00 0.00   ? 164 ASP B HB2  1  
ATOM   7459   H  HB3  . ASP B 1 161 ? -2.651  37.054 56.988 1.00 0.00   ? 164 ASP B HB3  1  
ATOM   7460   N  N    . GLY B 1 162 ? -2.100  38.591 53.482 1.00 17.91  ? 165 GLY B N    1  
ATOM   7461   C  CA   . GLY B 1 162 ? -2.257  39.032 52.055 1.00 19.25  ? 165 GLY B CA   1  
ATOM   7462   C  C    . GLY B 1 162 ? -3.698  38.815 51.515 1.00 20.43  ? 165 GLY B C    1  
ATOM   7463   O  O    . GLY B 1 162 ? -3.989  39.179 50.393 1.00 21.32  ? 165 GLY B O    1  
ATOM   7464   H  H    . GLY B 1 162 ? -1.698  37.721 53.685 1.00 0.00   ? 165 GLY B H    1  
ATOM   7465   H  HA2  . GLY B 1 162 ? -2.014  40.082 51.986 1.00 0.00   ? 165 GLY B HA2  1  
ATOM   7466   H  HA3  . GLY B 1 162 ? -1.566  38.473 51.440 1.00 0.00   ? 165 GLY B HA3  1  
ATOM   7467   N  N    . LYS B 1 163 ? -4.600  38.232 52.274 1.00 21.32  ? 166 LYS B N    1  
ATOM   7468   C  CA   . LYS B 1 163 ? -5.986  38.018 51.754 1.00 22.64  ? 166 LYS B CA   1  
ATOM   7469   C  C    . LYS B 1 163 ? -6.999  38.885 52.525 1.00 23.32  ? 166 LYS B C    1  
ATOM   7470   O  O    . LYS B 1 163 ? -8.173  38.901 52.210 1.00 24.33  ? 166 LYS B O    1  
ATOM   7471   C  CB   . LYS B 1 163 ? -6.362  36.543 51.913 1.00 23.39  ? 166 LYS B CB   1  
ATOM   7472   C  CG   . LYS B 1 163 ? -5.537  35.698 50.941 1.00 26.09  ? 166 LYS B CG   1  
ATOM   7473   C  CD   . LYS B 1 163 ? -5.840  36.131 49.505 1.00 29.44  ? 166 LYS B CD   1  
ATOM   7474   C  CE   . LYS B 1 163 ? -5.004  35.296 48.533 1.00 31.29  ? 166 LYS B CE   1  
ATOM   7475   N  NZ   . LYS B 1 163 ? -5.639  35.320 47.185 1.00 32.54  ? 166 LYS B NZ   1  
ATOM   7476   H  H    . LYS B 1 163 ? -4.363  37.936 53.178 1.00 0.00   ? 166 LYS B H    1  
ATOM   7477   H  HA   . LYS B 1 163 ? -6.018  38.281 50.708 1.00 0.00   ? 166 LYS B HA   1  
ATOM   7478   H  HB2  . LYS B 1 163 ? -6.160  36.228 52.927 1.00 0.00   ? 166 LYS B HB2  1  
ATOM   7479   H  HB3  . LYS B 1 163 ? -7.412  36.414 51.698 1.00 0.00   ? 166 LYS B HB3  1  
ATOM   7480   H  HG2  . LYS B 1 163 ? -4.485  35.838 51.145 1.00 0.00   ? 166 LYS B HG2  1  
ATOM   7481   H  HG3  . LYS B 1 163 ? -5.793  34.657 51.062 1.00 0.00   ? 166 LYS B HG3  1  
ATOM   7482   H  HD2  . LYS B 1 163 ? -6.890  35.982 49.298 1.00 0.00   ? 166 LYS B HD2  1  
ATOM   7483   H  HD3  . LYS B 1 163 ? -5.593  37.175 49.383 1.00 0.00   ? 166 LYS B HD3  1  
ATOM   7484   H  HE2  . LYS B 1 163 ? -4.008  35.708 48.469 1.00 0.00   ? 166 LYS B HE2  1  
ATOM   7485   H  HE3  . LYS B 1 163 ? -4.951  34.277 48.887 1.00 0.00   ? 166 LYS B HE3  1  
ATOM   7486   H  HZ1  . LYS B 1 163 ? -6.372  34.584 47.133 1.00 0.00   ? 166 LYS B HZ1  1  
ATOM   7487   H  HZ2  . LYS B 1 163 ? -4.918  35.138 46.458 1.00 0.00   ? 166 LYS B HZ2  1  
ATOM   7488   H  HZ3  . LYS B 1 163 ? -6.070  36.253 47.021 1.00 0.00   ? 166 LYS B HZ3  1  
ATOM   7489   N  N    . GLY B 1 164 ? -6.565  39.602 53.528 1.00 23.62  ? 167 GLY B N    1  
ATOM   7490   C  CA   . GLY B 1 164 ? -7.521  40.464 54.313 1.00 23.96  ? 167 GLY B CA   1  
ATOM   7491   C  C    . GLY B 1 164 ? -7.743  39.962 55.775 1.00 23.89  ? 167 GLY B C    1  
ATOM   7492   O  O    . GLY B 1 164 ? -8.337  40.658 56.574 1.00 25.25  ? 167 GLY B O    1  
ATOM   7493   H  H    . GLY B 1 164 ? -5.616  39.578 53.771 1.00 0.00   ? 167 GLY B H    1  
ATOM   7494   H  HA2  . GLY B 1 164 ? -7.131  41.470 54.348 1.00 0.00   ? 167 GLY B HA2  1  
ATOM   7495   H  HA3  . GLY B 1 164 ? -8.473  40.479 53.802 1.00 0.00   ? 167 GLY B HA3  1  
ATOM   7496   N  N    . LYS B 1 165 ? -7.298  38.777 56.135 1.00 22.93  ? 168 LYS B N    1  
ATOM   7497   C  CA   . LYS B 1 165 ? -7.512  38.274 57.512 1.00 22.65  ? 168 LYS B CA   1  
ATOM   7498   C  C    . LYS B 1 165 ? -6.709  39.122 58.483 1.00 20.90  ? 168 LYS B C    1  
ATOM   7499   O  O    . LYS B 1 165 ? -5.620  39.570 58.186 1.00 18.92  ? 168 LYS B O    1  
ATOM   7500   C  CB   . LYS B 1 165 ? -7.052  36.818 57.602 1.00 23.55  ? 168 LYS B CB   1  
ATOM   7501   C  CG   . LYS B 1 165 ? -7.609  36.184 58.878 1.00 27.52  ? 168 LYS B CG   1  
ATOM   7502   C  CD   . LYS B 1 165 ? -6.610  35.159 59.418 1.00 31.39  ? 168 LYS B CD   1  
ATOM   7503   C  CE   . LYS B 1 165 ? -7.206  33.755 59.302 1.00 33.96  ? 168 LYS B CE   1  
ATOM   7504   N  NZ   . LYS B 1 165 ? -6.708  33.105 58.056 1.00 35.51  ? 168 LYS B NZ   1  
ATOM   7505   H  H    . LYS B 1 165 ? -6.829  38.217 55.482 1.00 0.00   ? 168 LYS B H    1  
ATOM   7506   H  HA   . LYS B 1 165 ? -8.561  38.336 57.760 1.00 0.00   ? 168 LYS B HA   1  
ATOM   7507   H  HB2  . LYS B 1 165 ? -7.412  36.273 56.741 1.00 0.00   ? 168 LYS B HB2  1  
ATOM   7508   H  HB3  . LYS B 1 165 ? -5.973  36.782 57.626 1.00 0.00   ? 168 LYS B HB3  1  
ATOM   7509   H  HG2  . LYS B 1 165 ? -7.773  36.953 59.620 1.00 0.00   ? 168 LYS B HG2  1  
ATOM   7510   H  HG3  . LYS B 1 165 ? -8.543  35.691 58.657 1.00 0.00   ? 168 LYS B HG3  1  
ATOM   7511   H  HD2  . LYS B 1 165 ? -5.695  35.211 58.844 1.00 0.00   ? 168 LYS B HD2  1  
ATOM   7512   H  HD3  . LYS B 1 165 ? -6.398  35.373 60.454 1.00 0.00   ? 168 LYS B HD3  1  
ATOM   7513   H  HE2  . LYS B 1 165 ? -6.910  33.166 60.158 1.00 0.00   ? 168 LYS B HE2  1  
ATOM   7514   H  HE3  . LYS B 1 165 ? -8.283  33.823 59.267 1.00 0.00   ? 168 LYS B HE3  1  
ATOM   7515   H  HZ1  . LYS B 1 165 ? -5.884  32.513 58.279 1.00 0.00   ? 168 LYS B HZ1  1  
ATOM   7516   H  HZ2  . LYS B 1 165 ? -6.432  33.836 57.370 1.00 0.00   ? 168 LYS B HZ2  1  
ATOM   7517   H  HZ3  . LYS B 1 165 ? -7.462  32.514 57.650 1.00 0.00   ? 168 LYS B HZ3  1  
ATOM   7518   N  N    . ALA B 1 166 ? -7.241  39.347 59.641 1.00 19.87  ? 169 ALA B N    1  
ATOM   7519   C  CA   . ALA B 1 166 ? -6.510  40.177 60.648 1.00 18.75  ? 169 ALA B CA   1  
ATOM   7520   C  C    . ALA B 1 166 ? -5.433  39.352 61.386 1.00 18.10  ? 169 ALA B C    1  
ATOM   7521   O  O    . ALA B 1 166 ? -5.677  38.261 61.862 1.00 18.32  ? 169 ALA B O    1  
ATOM   7522   C  CB   . ALA B 1 166 ? -7.511  40.721 61.669 1.00 19.39  ? 169 ALA B CB   1  
ATOM   7523   H  H    . ALA B 1 166 ? -8.122  38.977 59.857 1.00 0.00   ? 169 ALA B H    1  
ATOM   7524   H  HA   . ALA B 1 166 ? -6.037  41.006 60.145 1.00 0.00   ? 169 ALA B HA   1  
ATOM   7525   H  HB1  . ALA B 1 166 ? -7.263  41.745 61.906 1.00 0.00   ? 169 ALA B HB1  1  
ATOM   7526   H  HB2  . ALA B 1 166 ? -7.470  40.123 62.567 1.00 0.00   ? 169 ALA B HB2  1  
ATOM   7527   H  HB3  . ALA B 1 166 ? -8.507  40.679 61.254 1.00 0.00   ? 169 ALA B HB3  1  
ATOM   7528   N  N    . LEU B 1 167 ? -4.250  39.908 61.503 1.00 16.31  ? 170 LEU B N    1  
ATOM   7529   C  CA   . LEU B 1 167 ? -3.131  39.247 62.221 1.00 15.84  ? 170 LEU B CA   1  
ATOM   7530   C  C    . LEU B 1 167 ? -2.788  40.140 63.413 1.00 15.19  ? 170 LEU B C    1  
ATOM   7531   O  O    . LEU B 1 167 ? -2.394  41.279 63.260 1.00 17.67  ? 170 LEU B O    1  
ATOM   7532   C  CB   . LEU B 1 167 ? -1.918  39.123 61.296 1.00 15.35  ? 170 LEU B CB   1  
ATOM   7533   C  CG   . LEU B 1 167 ? -2.223  38.116 60.186 1.00 15.52  ? 170 LEU B CG   1  
ATOM   7534   C  CD1  . LEU B 1 167 ? -1.127  38.181 59.121 1.00 14.54  ? 170 LEU B CD1  1  
ATOM   7535   C  CD2  . LEU B 1 167 ? -2.273  36.706 60.778 1.00 16.70  ? 170 LEU B CD2  1  
ATOM   7536   H  H    . LEU B 1 167 ? -4.108  40.801 61.124 1.00 0.00   ? 170 LEU B H    1  
ATOM   7537   H  HA   . LEU B 1 167 ? -3.439  38.271 62.567 1.00 0.00   ? 170 LEU B HA   1  
ATOM   7538   H  HB2  . LEU B 1 167 ? -1.699  40.087 60.858 1.00 0.00   ? 170 LEU B HB2  1  
ATOM   7539   H  HB3  . LEU B 1 167 ? -1.065  38.783 61.863 1.00 0.00   ? 170 LEU B HB3  1  
ATOM   7540   H  HG   . LEU B 1 167 ? -3.176  38.354 59.736 1.00 0.00   ? 170 LEU B HG   1  
ATOM   7541   H  HD11 . LEU B 1 167 ? -0.810  39.206 58.992 1.00 0.00   ? 170 LEU B HD11 1  
ATOM   7542   H  HD12 . LEU B 1 167 ? -1.511  37.803 58.185 1.00 0.00   ? 170 LEU B HD12 1  
ATOM   7543   H  HD13 . LEU B 1 167 ? -0.285  37.581 59.433 1.00 0.00   ? 170 LEU B HD13 1  
ATOM   7544   H  HD21 . LEU B 1 167 ? -2.883  36.711 61.669 1.00 0.00   ? 170 LEU B HD21 1  
ATOM   7545   H  HD22 . LEU B 1 167 ? -1.273  36.385 61.029 1.00 0.00   ? 170 LEU B HD22 1  
ATOM   7546   H  HD23 . LEU B 1 167 ? -2.699  36.026 60.055 1.00 0.00   ? 170 LEU B HD23 1  
ATOM   7547   N  N    . THR B 1 168 ? -2.994  39.648 64.590 1.00 12.76  ? 171 THR B N    1  
ATOM   7548   C  CA   . THR B 1 168 ? -2.757  40.453 65.797 1.00 12.40  ? 171 THR B CA   1  
ATOM   7549   C  C    . THR B 1 168 ? -1.679  39.777 66.585 1.00 11.22  ? 171 THR B C    1  
ATOM   7550   O  O    . THR B 1 168 ? -1.744  38.602 66.887 1.00 11.48  ? 171 THR B O    1  
ATOM   7551   C  CB   . THR B 1 168 ? -4.039  40.531 66.630 1.00 12.61  ? 171 THR B CB   1  
ATOM   7552   O  OG1  . THR B 1 168 ? -5.072  41.118 65.851 1.00 15.55  ? 171 THR B OG1  1  
ATOM   7553   C  CG2  . THR B 1 168 ? -3.790  41.381 67.876 1.00 13.19  ? 171 THR B CG2  1  
ATOM   7554   H  H    . THR B 1 168 ? -3.354  38.741 64.678 1.00 0.00   ? 171 THR B H    1  
ATOM   7555   H  HA   . THR B 1 168 ? -2.440  41.447 65.519 1.00 0.00   ? 171 THR B HA   1  
ATOM   7556   H  HB   . THR B 1 168 ? -4.334  39.537 66.931 1.00 0.00   ? 171 THR B HB   1  
ATOM   7557   H  HG1  . THR B 1 168 ? -5.855  40.567 65.933 1.00 0.00   ? 171 THR B HG1  1  
ATOM   7558   H  HG21 . THR B 1 168 ? -3.505  42.380 67.579 1.00 0.00   ? 171 THR B HG21 1  
ATOM   7559   H  HG22 . THR B 1 168 ? -2.996  40.939 68.460 1.00 0.00   ? 171 THR B HG22 1  
ATOM   7560   H  HG23 . THR B 1 168 ? -4.692  41.425 68.468 1.00 0.00   ? 171 THR B HG23 1  
ATOM   7561   N  N    . TYR B 1 169 ? -0.673  40.495 66.886 1.00 10.26  ? 172 TYR B N    1  
ATOM   7562   C  CA   . TYR B 1 169 ? 0.466   39.883 67.634 1.00 10.22  ? 172 TYR B CA   1  
ATOM   7563   C  C    . TYR B 1 169 ? 0.336   40.140 69.137 1.00 10.02  ? 172 TYR B C    1  
ATOM   7564   O  O    . TYR B 1 169 ? -0.040  41.212 69.565 1.00 11.12  ? 172 TYR B O    1  
ATOM   7565   C  CB   . TYR B 1 169 ? 1.780   40.486 67.133 1.00 9.71   ? 172 TYR B CB   1  
ATOM   7566   C  CG   . TYR B 1 169 ? 1.651   41.989 67.067 1.00 9.88   ? 172 TYR B CG   1  
ATOM   7567   C  CD1  . TYR B 1 169 ? 1.818   42.758 68.225 1.00 9.97   ? 172 TYR B CD1  1  
ATOM   7568   C  CD2  . TYR B 1 169 ? 1.364   42.614 65.847 1.00 10.18  ? 172 TYR B CD2  1  
ATOM   7569   C  CE1  . TYR B 1 169 ? 1.698   44.151 68.163 1.00 10.82  ? 172 TYR B CE1  1  
ATOM   7570   C  CE2  . TYR B 1 169 ? 1.244   44.007 65.785 1.00 10.66  ? 172 TYR B CE2  1  
ATOM   7571   C  CZ   . TYR B 1 169 ? 1.412   44.776 66.943 1.00 10.27  ? 172 TYR B CZ   1  
ATOM   7572   O  OH   . TYR B 1 169 ? 1.294   46.150 66.883 1.00 11.97  ? 172 TYR B OH   1  
ATOM   7573   H  H    . TYR B 1 169 ? -0.633  41.433 66.605 1.00 0.00   ? 172 TYR B H    1  
ATOM   7574   H  HA   . TYR B 1 169 ? 0.477   38.818 67.456 1.00 0.00   ? 172 TYR B HA   1  
ATOM   7575   H  HB2  . TYR B 1 169 ? 2.579   40.223 67.811 1.00 0.00   ? 172 TYR B HB2  1  
ATOM   7576   H  HB3  . TYR B 1 169 ? 2.000   40.101 66.149 1.00 0.00   ? 172 TYR B HB3  1  
ATOM   7577   H  HD1  . TYR B 1 169 ? 2.039   42.276 69.165 1.00 0.00   ? 172 TYR B HD1  1  
ATOM   7578   H  HD2  . TYR B 1 169 ? 1.235   42.021 64.954 1.00 0.00   ? 172 TYR B HD2  1  
ATOM   7579   H  HE1  . TYR B 1 169 ? 1.827   44.744 69.056 1.00 0.00   ? 172 TYR B HE1  1  
ATOM   7580   H  HE2  . TYR B 1 169 ? 1.023   44.489 64.845 1.00 0.00   ? 172 TYR B HE2  1  
ATOM   7581   H  HH   . TYR B 1 169 ? 2.165   46.515 66.715 1.00 0.00   ? 172 TYR B HH   1  
ATOM   7582   N  N    . ASP B 1 170 ? 0.670   39.162 69.943 1.00 9.66   ? 173 ASP B N    1  
ATOM   7583   C  CA   . ASP B 1 170 ? 0.591   39.355 71.420 1.00 9.95   ? 173 ASP B CA   1  
ATOM   7584   C  C    . ASP B 1 170 ? 1.774   40.218 71.896 1.00 10.62  ? 173 ASP B C    1  
ATOM   7585   O  O    . ASP B 1 170 ? 1.649   40.996 72.821 1.00 11.76  ? 173 ASP B O    1  
ATOM   7586   C  CB   . ASP B 1 170 ? 0.643   37.993 72.114 1.00 10.46  ? 173 ASP B CB   1  
ATOM   7587   C  CG   . ASP B 1 170 ? -0.568  37.159 71.693 1.00 10.60  ? 173 ASP B CG   1  
ATOM   7588   O  OD1  . ASP B 1 170 ? -1.662  37.699 71.690 1.00 11.68  ? 173 ASP B OD1  1  
ATOM   7589   O  OD2  . ASP B 1 170 ? -0.381  35.994 71.382 1.00 11.13  ? 173 ASP B OD2  1  
ATOM   7590   H  H    . ASP B 1 170 ? 0.987   38.310 69.576 1.00 0.00   ? 173 ASP B H    1  
ATOM   7591   H  HA   . ASP B 1 170 ? -0.336  39.850 71.668 1.00 0.00   ? 173 ASP B HA   1  
ATOM   7592   H  HB2  . ASP B 1 170 ? 1.551   37.479 71.832 1.00 0.00   ? 173 ASP B HB2  1  
ATOM   7593   H  HB3  . ASP B 1 170 ? 0.627   38.133 73.184 1.00 0.00   ? 173 ASP B HB3  1  
ATOM   7594   N  N    . LYS B 1 171 ? 2.923   40.084 71.277 1.00 10.52  ? 174 LYS B N    1  
ATOM   7595   C  CA   . LYS B 1 171 ? 4.096   40.887 71.698 1.00 10.59  ? 174 LYS B CA   1  
ATOM   7596   C  C    . LYS B 1 171 ? 4.921   41.241 70.466 1.00 9.88   ? 174 LYS B C    1  
ATOM   7597   O  O    . LYS B 1 171 ? 4.805   40.623 69.426 1.00 9.48   ? 174 LYS B O    1  
ATOM   7598   C  CB   . LYS B 1 171 ? 4.951   40.073 72.672 1.00 12.44  ? 174 LYS B CB   1  
ATOM   7599   C  CG   . LYS B 1 171 ? 5.575   38.886 71.935 1.00 13.23  ? 174 LYS B CG   1  
ATOM   7600   C  CD   . LYS B 1 171 ? 6.520   38.139 72.878 1.00 14.81  ? 174 LYS B CD   1  
ATOM   7601   C  CE   . LYS B 1 171 ? 6.811   39.007 74.103 1.00 13.89  ? 174 LYS B CE   1  
ATOM   7602   N  NZ   . LYS B 1 171 ? 7.478   38.181 75.149 1.00 14.01  ? 174 LYS B NZ   1  
ATOM   7603   H  H    . LYS B 1 171 ? 3.007   39.449 70.535 1.00 0.00   ? 174 LYS B H    1  
ATOM   7604   H  HA   . LYS B 1 171 ? 3.760   41.792 72.181 1.00 0.00   ? 174 LYS B HA   1  
ATOM   7605   H  HB2  . LYS B 1 171 ? 5.734   40.700 73.074 1.00 0.00   ? 174 LYS B HB2  1  
ATOM   7606   H  HB3  . LYS B 1 171 ? 4.332   39.708 73.477 1.00 0.00   ? 174 LYS B HB3  1  
ATOM   7607   H  HG2  . LYS B 1 171 ? 4.794   38.218 71.602 1.00 0.00   ? 174 LYS B HG2  1  
ATOM   7608   H  HG3  . LYS B 1 171 ? 6.131   39.244 71.081 1.00 0.00   ? 174 LYS B HG3  1  
ATOM   7609   H  HD2  . LYS B 1 171 ? 6.057   37.214 73.192 1.00 0.00   ? 174 LYS B HD2  1  
ATOM   7610   H  HD3  . LYS B 1 171 ? 7.445   37.922 72.364 1.00 0.00   ? 174 LYS B HD3  1  
ATOM   7611   H  HE2  . LYS B 1 171 ? 7.461   39.822 73.820 1.00 0.00   ? 174 LYS B HE2  1  
ATOM   7612   H  HE3  . LYS B 1 171 ? 5.885   39.403 74.492 1.00 0.00   ? 174 LYS B HE3  1  
ATOM   7613   H  HZ1  . LYS B 1 171 ? 8.312   38.686 75.511 1.00 0.00   ? 174 LYS B HZ1  1  
ATOM   7614   H  HZ2  . LYS B 1 171 ? 7.775   37.274 74.739 1.00 0.00   ? 174 LYS B HZ2  1  
ATOM   7615   H  HZ3  . LYS B 1 171 ? 6.811   38.008 75.930 1.00 0.00   ? 174 LYS B HZ3  1  
ATOM   7616   N  N    . ILE B 1 172 ? 5.749   42.233 70.574 1.00 10.23  ? 175 ILE B N    1  
ATOM   7617   C  CA   . ILE B 1 172 ? 6.586   42.641 69.411 1.00 9.36   ? 175 ILE B CA   1  
ATOM   7618   C  C    . ILE B 1 172 ? 7.961   43.125 69.893 1.00 9.59   ? 175 ILE B C    1  
ATOM   7619   O  O    . ILE B 1 172 ? 8.072   43.925 70.802 1.00 10.61  ? 175 ILE B O    1  
ATOM   7620   C  CB   . ILE B 1 172 ? 5.887   43.772 68.655 1.00 9.78   ? 175 ILE B CB   1  
ATOM   7621   C  CG1  . ILE B 1 172 ? 6.835   44.338 67.596 1.00 9.75   ? 175 ILE B CG1  1  
ATOM   7622   C  CG2  . ILE B 1 172 ? 5.500   44.880 69.636 1.00 11.30  ? 175 ILE B CG2  1  
ATOM   7623   C  CD1  . ILE B 1 172 ? 6.226   45.604 66.989 1.00 11.13  ? 175 ILE B CD1  1  
ATOM   7624   H  H    . ILE B 1 172 ? 5.822   42.718 71.422 1.00 0.00   ? 175 ILE B H    1  
ATOM   7625   H  HA   . ILE B 1 172 ? 6.716   41.797 68.750 1.00 0.00   ? 175 ILE B HA   1  
ATOM   7626   H  HB   . ILE B 1 172 ? 4.997   43.388 68.177 1.00 0.00   ? 175 ILE B HB   1  
ATOM   7627   H  HG12 . ILE B 1 172 ? 7.784   44.577 68.054 1.00 0.00   ? 175 ILE B HG12 1  
ATOM   7628   H  HG13 . ILE B 1 172 ? 6.985   43.605 66.818 1.00 0.00   ? 175 ILE B HG13 1  
ATOM   7629   H  HG21 . ILE B 1 172 ? 6.390   45.269 70.108 1.00 0.00   ? 175 ILE B HG21 1  
ATOM   7630   H  HG22 . ILE B 1 172 ? 4.839   44.479 70.390 1.00 0.00   ? 175 ILE B HG22 1  
ATOM   7631   H  HG23 . ILE B 1 172 ? 4.999   45.674 69.103 1.00 0.00   ? 175 ILE B HG23 1  
ATOM   7632   H  HD11 . ILE B 1 172 ? 6.042   45.446 65.937 1.00 0.00   ? 175 ILE B HD11 1  
ATOM   7633   H  HD12 . ILE B 1 172 ? 6.912   46.429 67.115 1.00 0.00   ? 175 ILE B HD12 1  
ATOM   7634   H  HD13 . ILE B 1 172 ? 5.295   45.830 67.488 1.00 0.00   ? 175 ILE B HD13 1  
ATOM   7635   N  N    . TYR B 1 173 ? 9.003   42.646 69.273 1.00 8.60   ? 176 TYR B N    1  
ATOM   7636   C  CA   . TYR B 1 173 ? 10.373  43.053 69.646 1.00 8.31   ? 176 TYR B CA   1  
ATOM   7637   C  C    . TYR B 1 173 ? 11.042  43.643 68.409 1.00 8.25   ? 176 TYR B C    1  
ATOM   7638   O  O    . TYR B 1 173 ? 10.759  43.263 67.290 1.00 9.35   ? 176 TYR B O    1  
ATOM   7639   C  CB   . TYR B 1 173 ? 11.162  41.833 70.127 1.00 8.93   ? 176 TYR B CB   1  
ATOM   7640   C  CG   . TYR B 1 173 ? 10.689  41.440 71.506 1.00 8.97   ? 176 TYR B CG   1  
ATOM   7641   C  CD1  . TYR B 1 173 ? 10.931  42.284 72.597 1.00 9.64   ? 176 TYR B CD1  1  
ATOM   7642   C  CD2  . TYR B 1 173 ? 10.008  40.231 71.694 1.00 9.48   ? 176 TYR B CD2  1  
ATOM   7643   C  CE1  . TYR B 1 173 ? 10.492  41.919 73.875 1.00 10.01  ? 176 TYR B CE1  1  
ATOM   7644   C  CE2  . TYR B 1 173 ? 9.569   39.867 72.973 1.00 10.30  ? 176 TYR B CE2  1  
ATOM   7645   C  CZ   . TYR B 1 173 ? 9.811   40.711 74.063 1.00 9.91   ? 176 TYR B CZ   1  
ATOM   7646   O  OH   . TYR B 1 173 ? 9.379   40.351 75.324 1.00 11.68  ? 176 TYR B OH   1  
ATOM   7647   H  H    . TYR B 1 173 ? 8.874   42.009 68.539 1.00 0.00   ? 176 TYR B H    1  
ATOM   7648   H  HA   . TYR B 1 173 ? 10.333  43.796 70.429 1.00 0.00   ? 176 TYR B HA   1  
ATOM   7649   H  HB2  . TYR B 1 173 ? 11.005  41.011 69.444 1.00 0.00   ? 176 TYR B HB2  1  
ATOM   7650   H  HB3  . TYR B 1 173 ? 12.213  42.076 70.164 1.00 0.00   ? 176 TYR B HB3  1  
ATOM   7651   H  HD1  . TYR B 1 173 ? 11.456  43.217 72.452 1.00 0.00   ? 176 TYR B HD1  1  
ATOM   7652   H  HD2  . TYR B 1 173 ? 9.821   39.580 70.853 1.00 0.00   ? 176 TYR B HD2  1  
ATOM   7653   H  HE1  . TYR B 1 173 ? 10.679  42.571 74.716 1.00 0.00   ? 176 TYR B HE1  1  
ATOM   7654   H  HE2  . TYR B 1 173 ? 9.044   38.934 73.118 1.00 0.00   ? 176 TYR B HE2  1  
ATOM   7655   H  HH   . TYR B 1 173 ? 10.006  39.719 75.683 1.00 0.00   ? 176 TYR B HH   1  
ATOM   7656   N  N    . TYR B 1 174 ? 11.909  44.578 68.605 1.00 8.14   ? 177 TYR B N    1  
ATOM   7657   C  CA   . TYR B 1 174 ? 12.598  45.228 67.463 1.00 8.66   ? 177 TYR B CA   1  
ATOM   7658   C  C    . TYR B 1 174 ? 14.092  44.970 67.585 1.00 8.14   ? 177 TYR B C    1  
ATOM   7659   O  O    . TYR B 1 174 ? 14.753  45.460 68.478 1.00 8.46   ? 177 TYR B O    1  
ATOM   7660   C  CB   . TYR B 1 174 ? 12.333  46.735 67.493 1.00 8.81   ? 177 TYR B CB   1  
ATOM   7661   C  CG   . TYR B 1 174 ? 13.388  47.448 66.681 1.00 9.11   ? 177 TYR B CG   1  
ATOM   7662   C  CD1  . TYR B 1 174 ? 13.697  47.004 65.390 1.00 9.33   ? 177 TYR B CD1  1  
ATOM   7663   C  CD2  . TYR B 1 174 ? 14.056  48.554 67.220 1.00 8.91   ? 177 TYR B CD2  1  
ATOM   7664   C  CE1  . TYR B 1 174 ? 14.675  47.665 64.638 1.00 8.73   ? 177 TYR B CE1  1  
ATOM   7665   C  CE2  . TYR B 1 174 ? 15.034  49.215 66.467 1.00 8.96   ? 177 TYR B CE2  1  
ATOM   7666   C  CZ   . TYR B 1 174 ? 15.344  48.771 65.176 1.00 8.13   ? 177 TYR B CZ   1  
ATOM   7667   O  OH   . TYR B 1 174 ? 16.308  49.423 64.435 1.00 9.66   ? 177 TYR B OH   1  
ATOM   7668   H  H    . TYR B 1 174 ? 12.106  44.871 69.519 1.00 0.00   ? 177 TYR B H    1  
ATOM   7669   H  HA   . TYR B 1 174 ? 12.233  44.814 66.535 1.00 0.00   ? 177 TYR B HA   1  
ATOM   7670   H  HB2  . TYR B 1 174 ? 11.358  46.937 67.074 1.00 0.00   ? 177 TYR B HB2  1  
ATOM   7671   H  HB3  . TYR B 1 174 ? 12.367  47.086 68.513 1.00 0.00   ? 177 TYR B HB3  1  
ATOM   7672   H  HD1  . TYR B 1 174 ? 13.181  46.150 64.975 1.00 0.00   ? 177 TYR B HD1  1  
ATOM   7673   H  HD2  . TYR B 1 174 ? 13.818  48.897 68.216 1.00 0.00   ? 177 TYR B HD2  1  
ATOM   7674   H  HE1  . TYR B 1 174 ? 14.914  47.322 63.642 1.00 0.00   ? 177 TYR B HE1  1  
ATOM   7675   H  HE2  . TYR B 1 174 ? 15.550  50.068 66.883 1.00 0.00   ? 177 TYR B HE2  1  
ATOM   7676   H  HH   . TYR B 1 174 ? 15.865  50.047 63.856 1.00 0.00   ? 177 TYR B HH   1  
ATOM   7677   N  N    . VAL B 1 175 ? 14.617  44.187 66.702 1.00 7.88   ? 178 VAL B N    1  
ATOM   7678   C  CA   . VAL B 1 175 ? 16.067  43.858 66.751 1.00 8.13   ? 178 VAL B CA   1  
ATOM   7679   C  C    . VAL B 1 175 ? 16.818  44.608 65.649 1.00 8.11   ? 178 VAL B C    1  
ATOM   7680   O  O    . VAL B 1 175 ? 16.737  44.278 64.482 1.00 8.79   ? 178 VAL B O    1  
ATOM   7681   C  CB   . VAL B 1 175 ? 16.252  42.352 66.555 1.00 8.26   ? 178 VAL B CB   1  
ATOM   7682   C  CG1  . VAL B 1 175 ? 17.741  42.035 66.404 1.00 9.46   ? 178 VAL B CG1  1  
ATOM   7683   C  CG2  . VAL B 1 175 ? 15.695  41.609 67.771 1.00 9.28   ? 178 VAL B CG2  1  
ATOM   7684   H  H    . VAL B 1 175 ? 14.053  43.796 66.002 1.00 0.00   ? 178 VAL B H    1  
ATOM   7685   H  HA   . VAL B 1 175 ? 16.466  44.143 67.713 1.00 0.00   ? 178 VAL B HA   1  
ATOM   7686   H  HB   . VAL B 1 175 ? 15.725  42.038 65.666 1.00 0.00   ? 178 VAL B HB   1  
ATOM   7687   H  HG11 . VAL B 1 175 ? 18.294  42.520 67.195 1.00 0.00   ? 178 VAL B HG11 1  
ATOM   7688   H  HG12 . VAL B 1 175 ? 18.090  42.395 65.448 1.00 0.00   ? 178 VAL B HG12 1  
ATOM   7689   H  HG13 . VAL B 1 175 ? 17.889  40.967 66.463 1.00 0.00   ? 178 VAL B HG13 1  
ATOM   7690   H  HG21 . VAL B 1 175 ? 15.380  42.324 68.517 1.00 0.00   ? 178 VAL B HG21 1  
ATOM   7691   H  HG22 . VAL B 1 175 ? 16.461  40.971 68.186 1.00 0.00   ? 178 VAL B HG22 1  
ATOM   7692   H  HG23 . VAL B 1 175 ? 14.850  41.008 67.470 1.00 0.00   ? 178 VAL B HG23 1  
ATOM   7693   N  N    . GLY B 1 176 ? 17.561  45.605 66.027 1.00 8.37   ? 179 GLY B N    1  
ATOM   7694   C  CA   . GLY B 1 176 ? 18.348  46.390 65.049 1.00 8.19   ? 179 GLY B CA   1  
ATOM   7695   C  C    . GLY B 1 176 ? 19.727  45.754 64.925 1.00 8.13   ? 179 GLY B C    1  
ATOM   7696   O  O    . GLY B 1 176 ? 20.402  45.495 65.901 1.00 9.27   ? 179 GLY B O    1  
ATOM   7697   H  H    . GLY B 1 176 ? 17.611  45.833 66.979 1.00 0.00   ? 179 GLY B H    1  
ATOM   7698   H  HA2  . GLY B 1 176 ? 17.850  46.378 64.089 1.00 0.00   ? 179 GLY B HA2  1  
ATOM   7699   H  HA3  . GLY B 1 176 ? 18.450  47.407 65.395 1.00 0.00   ? 179 GLY B HA3  1  
ATOM   7700   N  N    . GLU B 1 177 ? 20.127  45.481 63.730 1.00 7.77   ? 180 GLU B N    1  
ATOM   7701   C  CA   . GLU B 1 177 ? 21.424  44.842 63.491 1.00 7.63   ? 180 GLU B CA   1  
ATOM   7702   C  C    . GLU B 1 177 ? 22.382  45.931 63.118 1.00 7.56   ? 180 GLU B C    1  
ATOM   7703   O  O    . GLU B 1 177 ? 22.018  46.913 62.502 1.00 8.82   ? 180 GLU B O    1  
ATOM   7704   C  CB   . GLU B 1 177 ? 21.307  43.833 62.347 1.00 7.68   ? 180 GLU B CB   1  
ATOM   7705   C  CG   . GLU B 1 177 ? 22.699  43.315 61.978 1.00 7.35   ? 180 GLU B CG   1  
ATOM   7706   C  CD   . GLU B 1 177 ? 22.565  42.134 61.015 1.00 8.09   ? 180 GLU B CD   1  
ATOM   7707   O  OE1  . GLU B 1 177 ? 21.463  41.630 60.875 1.00 8.32   ? 180 GLU B OE1  1  
ATOM   7708   O  OE2  . GLU B 1 177 ? 23.568  41.754 60.433 1.00 8.65   ? 180 GLU B OE2  1  
ATOM   7709   H  H    . GLU B 1 177 ? 19.545  45.688 62.969 1.00 0.00   ? 180 GLU B H    1  
ATOM   7710   H  HA   . GLU B 1 177 ? 21.761  44.345 64.389 1.00 0.00   ? 180 GLU B HA   1  
ATOM   7711   H  HB2  . GLU B 1 177 ? 20.685  43.006 62.658 1.00 0.00   ? 180 GLU B HB2  1  
ATOM   7712   H  HB3  . GLU B 1 177 ? 20.865  44.313 61.487 1.00 0.00   ? 180 GLU B HB3  1  
ATOM   7713   H  HG2  . GLU B 1 177 ? 23.263  44.105 61.505 1.00 0.00   ? 180 GLU B HG2  1  
ATOM   7714   H  HG3  . GLU B 1 177 ? 23.211  42.991 62.872 1.00 0.00   ? 180 GLU B HG3  1  
ATOM   7715   N  N    . GLN B 1 178 ? 23.587  45.797 63.505 1.00 7.63   ? 181 GLN B N    1  
ATOM   7716   C  CA   . GLN B 1 178 ? 24.560  46.874 63.189 1.00 8.01   ? 181 GLN B CA   1  
ATOM   7717   C  C    . GLN B 1 178 ? 25.916  46.284 62.830 1.00 7.85   ? 181 GLN B C    1  
ATOM   7718   O  O    . GLN B 1 178 ? 26.536  45.591 63.612 1.00 8.75   ? 181 GLN B O    1  
ATOM   7719   C  CB   . GLN B 1 178 ? 24.713  47.789 64.406 1.00 8.08   ? 181 GLN B CB   1  
ATOM   7720   C  CG   . GLN B 1 178 ? 25.829  48.803 64.145 1.00 8.73   ? 181 GLN B CG   1  
ATOM   7721   C  CD   . GLN B 1 178 ? 25.338  49.860 63.154 1.00 8.05   ? 181 GLN B CD   1  
ATOM   7722   O  OE1  . GLN B 1 178 ? 24.362  50.538 63.406 1.00 9.37   ? 181 GLN B OE1  1  
ATOM   7723   N  NE2  . GLN B 1 178 ? 25.978  50.030 62.030 1.00 9.54   ? 181 GLN B NE2  1  
ATOM   7724   H  H    . GLN B 1 178 ? 23.861  45.012 64.024 1.00 0.00   ? 181 GLN B H    1  
ATOM   7725   H  HA   . GLN B 1 178 ? 24.192  47.453 62.356 1.00 0.00   ? 181 GLN B HA   1  
ATOM   7726   H  HB2  . GLN B 1 178 ? 23.784  48.312 64.581 1.00 0.00   ? 181 GLN B HB2  1  
ATOM   7727   H  HB3  . GLN B 1 178 ? 24.963  47.197 65.273 1.00 0.00   ? 181 GLN B HB3  1  
ATOM   7728   H  HG2  . GLN B 1 178 ? 26.106  49.280 65.074 1.00 0.00   ? 181 GLN B HG2  1  
ATOM   7729   H  HG3  . GLN B 1 178 ? 26.687  48.295 63.731 1.00 0.00   ? 181 GLN B HG3  1  
ATOM   7730   H  HE21 . GLN B 1 178 ? 26.766  49.483 61.827 1.00 0.00   ? 181 GLN B HE21 1  
ATOM   7731   H  HE22 . GLN B 1 178 ? 25.672  50.705 61.389 1.00 0.00   ? 181 GLN B HE22 1  
ATOM   7732   N  N    . ASP B 1 179 ? 26.389  46.579 61.657 1.00 7.75   ? 182 ASP B N    1  
ATOM   7733   C  CA   . ASP B 1 179 ? 27.725  46.064 61.239 1.00 8.05   ? 182 ASP B CA   1  
ATOM   7734   C  C    . ASP B 1 179 ? 28.784  47.133 61.536 1.00 7.94   ? 182 ASP B C    1  
ATOM   7735   O  O    . ASP B 1 179 ? 28.747  48.221 60.995 1.00 8.31   ? 182 ASP B O    1  
ATOM   7736   C  CB   . ASP B 1 179 ? 27.710  45.760 59.739 1.00 7.75   ? 182 ASP B CB   1  
ATOM   7737   C  CG   . ASP B 1 179 ? 27.135  46.957 58.980 1.00 8.40   ? 182 ASP B CG   1  
ATOM   7738   O  OD1  . ASP B 1 179 ? 26.138  47.496 59.432 1.00 8.89   ? 182 ASP B OD1  1  
ATOM   7739   O  OD2  . ASP B 1 179 ? 27.702  47.315 57.961 1.00 8.69   ? 182 ASP B OD2  1  
ATOM   7740   H  H    . ASP B 1 179 ? 25.876  47.155 61.053 1.00 0.00   ? 182 ASP B H    1  
ATOM   7741   H  HA   . ASP B 1 179 ? 27.954  45.164 61.790 1.00 0.00   ? 182 ASP B HA   1  
ATOM   7742   H  HB2  . ASP B 1 179 ? 28.718  45.568 59.401 1.00 0.00   ? 182 ASP B HB2  1  
ATOM   7743   H  HB3  . ASP B 1 179 ? 27.096  44.891 59.554 1.00 0.00   ? 182 ASP B HB3  1  
ATOM   7744   N  N    . PHE B 1 180 ? 29.720  46.839 62.399 1.00 8.35   ? 183 PHE B N    1  
ATOM   7745   C  CA   . PHE B 1 180 ? 30.750  47.827 62.732 1.00 8.80   ? 183 PHE B CA   1  
ATOM   7746   C  C    . PHE B 1 180 ? 31.995  47.534 61.920 1.00 9.15   ? 183 PHE B C    1  
ATOM   7747   O  O    . PHE B 1 180 ? 32.083  46.566 61.191 1.00 9.22   ? 183 PHE B O    1  
ATOM   7748   C  CB   . PHE B 1 180 ? 31.078  47.744 64.223 1.00 9.10   ? 183 PHE B CB   1  
ATOM   7749   C  CG   . PHE B 1 180 ? 29.935  48.319 65.024 1.00 8.57   ? 183 PHE B CG   1  
ATOM   7750   C  CD1  . PHE B 1 180 ? 29.622  49.680 64.919 1.00 10.03  ? 183 PHE B CD1  1  
ATOM   7751   C  CD2  . PHE B 1 180 ? 29.187  47.493 65.871 1.00 9.64   ? 183 PHE B CD2  1  
ATOM   7752   C  CE1  . PHE B 1 180 ? 28.562  50.214 65.661 1.00 10.24  ? 183 PHE B CE1  1  
ATOM   7753   C  CE2  . PHE B 1 180 ? 28.127  48.026 66.613 1.00 9.84   ? 183 PHE B CE2  1  
ATOM   7754   C  CZ   . PHE B 1 180 ? 27.814  49.387 66.508 1.00 9.87   ? 183 PHE B CZ   1  
ATOM   7755   H  H    . PHE B 1 180 ? 29.728  45.960 62.832 1.00 0.00   ? 183 PHE B H    1  
ATOM   7756   H  HA   . PHE B 1 180 ? 30.390  48.818 62.497 1.00 0.00   ? 183 PHE B HA   1  
ATOM   7757   H  HB2  . PHE B 1 180 ? 31.229  46.711 64.502 1.00 0.00   ? 183 PHE B HB2  1  
ATOM   7758   H  HB3  . PHE B 1 180 ? 31.977  48.306 64.426 1.00 0.00   ? 183 PHE B HB3  1  
ATOM   7759   H  HD1  . PHE B 1 180 ? 30.198  50.318 64.266 1.00 0.00   ? 183 PHE B HD1  1  
ATOM   7760   H  HD2  . PHE B 1 180 ? 29.428  46.443 65.952 1.00 0.00   ? 183 PHE B HD2  1  
ATOM   7761   H  HE1  . PHE B 1 180 ? 28.320  51.263 65.580 1.00 0.00   ? 183 PHE B HE1  1  
ATOM   7762   H  HE2  . PHE B 1 180 ? 27.550  47.389 67.267 1.00 0.00   ? 183 PHE B HE2  1  
ATOM   7763   H  HZ   . PHE B 1 180 ? 26.996  49.799 67.081 1.00 0.00   ? 183 PHE B HZ   1  
ATOM   7764   N  N    . TYR B 1 181 ? 32.948  48.377 62.055 1.00 9.33   ? 184 TYR B N    1  
ATOM   7765   C  CA   . TYR B 1 181 ? 34.234  48.227 61.323 1.00 9.61   ? 184 TYR B CA   1  
ATOM   7766   C  C    . TYR B 1 181 ? 35.292  48.789 62.248 1.00 10.47  ? 184 TYR B C    1  
ATOM   7767   O  O    . TYR B 1 181 ? 35.569  49.972 62.258 1.00 12.45  ? 184 TYR B O    1  
ATOM   7768   C  CB   . TYR B 1 181 ? 34.196  49.026 60.018 1.00 9.06   ? 184 TYR B CB   1  
ATOM   7769   C  CG   . TYR B 1 181 ? 33.052  48.537 59.162 1.00 8.50   ? 184 TYR B CG   1  
ATOM   7770   C  CD1  . TYR B 1 181 ? 31.745  48.961 59.432 1.00 9.58   ? 184 TYR B CD1  1  
ATOM   7771   C  CD2  . TYR B 1 181 ? 33.298  47.661 58.099 1.00 8.67   ? 184 TYR B CD2  1  
ATOM   7772   C  CE1  . TYR B 1 181 ? 30.684  48.508 58.638 1.00 8.71   ? 184 TYR B CE1  1  
ATOM   7773   C  CE2  . TYR B 1 181 ? 32.237  47.208 57.305 1.00 8.35   ? 184 TYR B CE2  1  
ATOM   7774   C  CZ   . TYR B 1 181 ? 30.930  47.632 57.575 1.00 8.53   ? 184 TYR B CZ   1  
ATOM   7775   O  OH   . TYR B 1 181 ? 29.885  47.186 56.792 1.00 8.83   ? 184 TYR B OH   1  
ATOM   7776   H  H    . TYR B 1 181 ? 32.827  49.142 62.656 1.00 0.00   ? 184 TYR B H    1  
ATOM   7777   H  HA   . TYR B 1 181 ? 34.430  47.182 61.123 1.00 0.00   ? 184 TYR B HA   1  
ATOM   7778   H  HB2  . TYR B 1 181 ? 34.057  50.073 60.242 1.00 0.00   ? 184 TYR B HB2  1  
ATOM   7779   H  HB3  . TYR B 1 181 ? 35.125  48.891 59.486 1.00 0.00   ? 184 TYR B HB3  1  
ATOM   7780   H  HD1  . TYR B 1 181 ? 31.555  49.637 60.253 1.00 0.00   ? 184 TYR B HD1  1  
ATOM   7781   H  HD2  . TYR B 1 181 ? 34.306  47.334 57.890 1.00 0.00   ? 184 TYR B HD2  1  
ATOM   7782   H  HE1  . TYR B 1 181 ? 29.676  48.835 58.847 1.00 0.00   ? 184 TYR B HE1  1  
ATOM   7783   H  HE2  . TYR B 1 181 ? 32.427  46.532 56.484 1.00 0.00   ? 184 TYR B HE2  1  
ATOM   7784   H  HH   . TYR B 1 181 ? 29.068  47.346 57.270 1.00 0.00   ? 184 TYR B HH   1  
ATOM   7785   N  N    . VAL B 1 182 ? 35.814  47.963 63.091 1.00 10.13  ? 185 VAL B N    1  
ATOM   7786   C  CA   . VAL B 1 182 ? 36.777  48.454 64.102 1.00 11.11  ? 185 VAL B CA   1  
ATOM   7787   C  C    . VAL B 1 182 ? 38.196  48.235 63.645 1.00 11.81  ? 185 VAL B C    1  
ATOM   7788   O  O    . VAL B 1 182 ? 38.587  47.147 63.270 1.00 11.43  ? 185 VAL B O    1  
ATOM   7789   C  CB   . VAL B 1 182 ? 36.550  47.710 65.418 1.00 11.33  ? 185 VAL B CB   1  
ATOM   7790   C  CG1  . VAL B 1 182 ? 37.434  48.318 66.508 1.00 12.13  ? 185 VAL B CG1  1  
ATOM   7791   C  CG2  . VAL B 1 182 ? 35.080  47.835 65.826 1.00 10.88  ? 185 VAL B CG2  1  
ATOM   7792   H  H    . VAL B 1 182 ? 35.520  47.028 63.107 1.00 0.00   ? 185 VAL B H    1  
ATOM   7793   H  HA   . VAL B 1 182 ? 36.615  49.509 64.263 1.00 0.00   ? 185 VAL B HA   1  
ATOM   7794   H  HB   . VAL B 1 182 ? 36.803  46.667 65.290 1.00 0.00   ? 185 VAL B HB   1  
ATOM   7795   H  HG11 . VAL B 1 182 ? 38.473  48.194 66.240 1.00 0.00   ? 185 VAL B HG11 1  
ATOM   7796   H  HG12 . VAL B 1 182 ? 37.243  47.819 67.447 1.00 0.00   ? 185 VAL B HG12 1  
ATOM   7797   H  HG13 . VAL B 1 182 ? 37.211  49.370 66.608 1.00 0.00   ? 185 VAL B HG13 1  
ATOM   7798   H  HG21 . VAL B 1 182 ? 34.743  48.846 65.651 1.00 0.00   ? 185 VAL B HG21 1  
ATOM   7799   H  HG22 . VAL B 1 182 ? 34.977  47.597 66.875 1.00 0.00   ? 185 VAL B HG22 1  
ATOM   7800   H  HG23 . VAL B 1 182 ? 34.485  47.150 65.241 1.00 0.00   ? 185 VAL B HG23 1  
ATOM   7801   N  N    . PRO B 1 183 ? 38.969  49.268 63.706 1.00 12.62  ? 186 PRO B N    1  
ATOM   7802   C  CA   . PRO B 1 183 ? 40.416  49.209 63.317 1.00 13.65  ? 186 PRO B CA   1  
ATOM   7803   C  C    . PRO B 1 183 ? 41.242  48.291 64.249 1.00 13.78  ? 186 PRO B C    1  
ATOM   7804   O  O    . PRO B 1 183 ? 41.037  48.266 65.446 1.00 13.76  ? 186 PRO B O    1  
ATOM   7805   C  CB   . PRO B 1 183 ? 40.898  50.661 63.443 1.00 14.20  ? 186 PRO B CB   1  
ATOM   7806   C  CG   . PRO B 1 183 ? 39.667  51.504 63.567 1.00 13.87  ? 186 PRO B CG   1  
ATOM   7807   C  CD   . PRO B 1 183 ? 38.573  50.609 64.143 1.00 12.99  ? 186 PRO B CD   1  
ATOM   7808   H  HA   . PRO B 1 183 ? 40.513  48.885 62.293 1.00 0.00   ? 186 PRO B HA   1  
ATOM   7809   H  HB2  . PRO B 1 183 ? 41.517  50.771 64.322 1.00 0.00   ? 186 PRO B HB2  1  
ATOM   7810   H  HB3  . PRO B 1 183 ? 41.451  50.947 62.561 1.00 0.00   ? 186 PRO B HB3  1  
ATOM   7811   H  HG2  . PRO B 1 183 ? 39.857  52.336 64.232 1.00 0.00   ? 186 PRO B HG2  1  
ATOM   7812   H  HG3  . PRO B 1 183 ? 39.366  51.866 62.597 1.00 0.00   ? 186 PRO B HG3  1  
ATOM   7813   H  HD2  . PRO B 1 183 ? 38.559  50.673 65.223 1.00 0.00   ? 186 PRO B HD2  1  
ATOM   7814   H  HD3  . PRO B 1 183 ? 37.611  50.868 63.730 1.00 0.00   ? 186 PRO B HD3  1  
ATOM   7815   N  N    . ARG B 1 184 ? 42.179  47.545 63.704 1.00 14.72  ? 187 ARG B N    1  
ATOM   7816   C  CA   . ARG B 1 184 ? 43.014  46.650 64.536 1.00 15.74  ? 187 ARG B CA   1  
ATOM   7817   C  C    . ARG B 1 184 ? 44.470  47.066 64.368 1.00 16.92  ? 187 ARG B C    1  
ATOM   7818   O  O    . ARG B 1 184 ? 44.857  47.618 63.357 1.00 17.38  ? 187 ARG B O    1  
ATOM   7819   C  CB   . ARG B 1 184 ? 42.834  45.202 64.076 1.00 15.74  ? 187 ARG B CB   1  
ATOM   7820   C  CG   . ARG B 1 184 ? 41.391  44.761 64.327 1.00 16.62  ? 187 ARG B CG   1  
ATOM   7821   C  CD   . ARG B 1 184 ? 40.773  44.268 63.017 1.00 20.15  ? 187 ARG B CD   1  
ATOM   7822   N  NE   . ARG B 1 184 ? 40.949  42.793 62.909 1.00 22.99  ? 187 ARG B NE   1  
ATOM   7823   C  CZ   . ARG B 1 184 ? 39.971  42.049 62.469 1.00 22.97  ? 187 ARG B CZ   1  
ATOM   7824   N  NH1  . ARG B 1 184 ? 38.838  42.598 62.124 1.00 22.96  ? 187 ARG B NH1  1  
ATOM   7825   N  NH2  . ARG B 1 184 ? 40.126  40.757 62.374 1.00 23.85  ? 187 ARG B NH2  1  
ATOM   7826   H  H    . ARG B 1 184 ? 42.330  47.587 62.737 1.00 0.00   ? 187 ARG B H    1  
ATOM   7827   H  HA   . ARG B 1 184 ? 42.725  46.742 65.573 1.00 0.00   ? 187 ARG B HA   1  
ATOM   7828   H  HB2  . ARG B 1 184 ? 43.056  45.129 63.021 1.00 0.00   ? 187 ARG B HB2  1  
ATOM   7829   H  HB3  . ARG B 1 184 ? 43.505  44.562 64.630 1.00 0.00   ? 187 ARG B HB3  1  
ATOM   7830   H  HG2  . ARG B 1 184 ? 41.380  43.962 65.054 1.00 0.00   ? 187 ARG B HG2  1  
ATOM   7831   H  HG3  . ARG B 1 184 ? 40.819  45.596 64.700 1.00 0.00   ? 187 ARG B HG3  1  
ATOM   7832   H  HD2  . ARG B 1 184 ? 39.719  44.507 63.004 1.00 0.00   ? 187 ARG B HD2  1  
ATOM   7833   H  HD3  . ARG B 1 184 ? 41.261  44.751 62.184 1.00 0.00   ? 187 ARG B HD3  1  
ATOM   7834   H  HE   . ARG B 1 184 ? 41.800  42.381 63.168 1.00 0.00   ? 187 ARG B HE   1  
ATOM   7835   H  HH11 . ARG B 1 184 ? 38.720  43.588 62.196 1.00 0.00   ? 187 ARG B HH11 1  
ATOM   7836   H  HH12 . ARG B 1 184 ? 38.089  42.028 61.786 1.00 0.00   ? 187 ARG B HH12 1  
ATOM   7837   H  HH21 . ARG B 1 184 ? 40.994  40.336 62.638 1.00 0.00   ? 187 ARG B HH21 1  
ATOM   7838   H  HH22 . ARG B 1 184 ? 39.376  40.187 62.036 1.00 0.00   ? 187 ARG B HH22 1  
ATOM   7839   N  N    . ASP B 1 185 ? 45.274  46.821 65.351 1.00 17.44  ? 188 ASP B N    1  
ATOM   7840   C  CA   . ASP B 1 185 ? 46.707  47.216 65.259 1.00 19.31  ? 188 ASP B CA   1  
ATOM   7841   C  C    . ASP B 1 185 ? 47.488  46.148 64.495 1.00 20.94  ? 188 ASP B C    1  
ATOM   7842   O  O    . ASP B 1 185 ? 46.929  45.366 63.752 1.00 21.15  ? 188 ASP B O    1  
ATOM   7843   C  CB   . ASP B 1 185 ? 47.287  47.360 66.667 1.00 18.58  ? 188 ASP B CB   1  
ATOM   7844   C  CG   . ASP B 1 185 ? 47.016  46.083 67.465 1.00 20.39  ? 188 ASP B CG   1  
ATOM   7845   O  OD1  . ASP B 1 185 ? 46.929  45.032 66.851 1.00 19.52  ? 188 ASP B OD1  1  
ATOM   7846   O  OD2  . ASP B 1 185 ? 46.900  46.178 68.675 1.00 21.47  ? 188 ASP B OD2  1  
ATOM   7847   H  H    . ASP B 1 185 ? 44.938  46.384 66.161 1.00 0.00   ? 188 ASP B H    1  
ATOM   7848   H  HA   . ASP B 1 185 ? 46.787  48.159 64.740 1.00 0.00   ? 188 ASP B HA   1  
ATOM   7849   H  HB2  . ASP B 1 185 ? 48.353  47.526 66.602 1.00 0.00   ? 188 ASP B HB2  1  
ATOM   7850   H  HB3  . ASP B 1 185 ? 46.822  48.198 67.164 1.00 0.00   ? 188 ASP B HB3  1  
ATOM   7851   N  N    . GLU B 1 186 ? 48.779  46.113 64.670 1.00 23.04  ? 189 GLU B N    1  
ATOM   7852   C  CA   . GLU B 1 186 ? 49.601  45.097 63.952 1.00 25.15  ? 189 GLU B CA   1  
ATOM   7853   C  C    . GLU B 1 186 ? 49.354  43.712 64.556 1.00 25.29  ? 189 GLU B C    1  
ATOM   7854   O  O    . GLU B 1 186 ? 49.335  42.716 63.860 1.00 26.93  ? 189 GLU B O    1  
ATOM   7855   C  CB   . GLU B 1 186 ? 51.083  45.454 64.086 1.00 25.97  ? 189 GLU B CB   1  
ATOM   7856   C  CG   . GLU B 1 186 ? 51.447  46.519 63.050 1.00 29.19  ? 189 GLU B CG   1  
ATOM   7857   C  CD   . GLU B 1 186 ? 51.198  45.970 61.644 1.00 32.37  ? 189 GLU B CD   1  
ATOM   7858   O  OE1  . GLU B 1 186 ? 51.885  45.037 61.263 1.00 34.60  ? 189 GLU B OE1  1  
ATOM   7859   O  OE2  . GLU B 1 186 ? 50.324  46.493 60.971 1.00 36.52  ? 189 GLU B OE2  1  
ATOM   7860   H  H    . GLU B 1 186 ? 49.210  46.755 65.272 1.00 0.00   ? 189 GLU B H    1  
ATOM   7861   H  HA   . GLU B 1 186 ? 49.327  45.087 62.907 1.00 0.00   ? 189 GLU B HA   1  
ATOM   7862   H  HB2  . GLU B 1 186 ? 51.272  45.836 65.079 1.00 0.00   ? 189 GLU B HB2  1  
ATOM   7863   H  HB3  . GLU B 1 186 ? 51.682  44.572 63.919 1.00 0.00   ? 189 GLU B HB3  1  
ATOM   7864   H  HG2  . GLU B 1 186 ? 50.839  47.398 63.208 1.00 0.00   ? 189 GLU B HG2  1  
ATOM   7865   H  HG3  . GLU B 1 186 ? 52.490  46.780 63.152 1.00 0.00   ? 189 GLU B HG3  1  
ATOM   7866   N  N    . ASN B 1 187 ? 49.169  43.639 65.846 1.00 25.55  ? 190 ASN B N    1  
ATOM   7867   C  CA   . ASN B 1 187 ? 48.927  42.312 66.495 1.00 25.48  ? 190 ASN B CA   1  
ATOM   7868   C  C    . ASN B 1 187 ? 47.502  41.791 66.204 1.00 24.54  ? 190 ASN B C    1  
ATOM   7869   O  O    . ASN B 1 187 ? 47.100  40.770 66.725 1.00 25.42  ? 190 ASN B O    1  
ATOM   7870   C  CB   . ASN B 1 187 ? 49.108  42.454 68.008 1.00 25.60  ? 190 ASN B CB   1  
ATOM   7871   C  CG   . ASN B 1 187 ? 50.504  43.005 68.306 1.00 27.42  ? 190 ASN B CG   1  
ATOM   7872   O  OD1  . ASN B 1 187 ? 51.373  42.980 67.457 1.00 29.79  ? 190 ASN B OD1  1  
ATOM   7873   N  ND2  . ASN B 1 187 ? 50.757  43.504 69.484 1.00 28.04  ? 190 ASN B ND2  1  
ATOM   7874   H  H    . ASN B 1 187 ? 49.191  44.454 66.390 1.00 0.00   ? 190 ASN B H    1  
ATOM   7875   H  HA   . ASN B 1 187 ? 49.647  41.599 66.121 1.00 0.00   ? 190 ASN B HA   1  
ATOM   7876   H  HB2  . ASN B 1 187 ? 48.362  43.132 68.397 1.00 0.00   ? 190 ASN B HB2  1  
ATOM   7877   H  HB3  . ASN B 1 187 ? 48.997  41.488 68.476 1.00 0.00   ? 190 ASN B HB3  1  
ATOM   7878   H  HD21 . ASN B 1 187 ? 50.056  43.524 70.169 1.00 0.00   ? 190 ASN B HD21 1  
ATOM   7879   H  HD22 . ASN B 1 187 ? 51.648  43.860 69.685 1.00 0.00   ? 190 ASN B HD22 1  
ATOM   7880   N  N    . GLY B 1 188 ? 46.736  42.466 65.382 1.00 23.31  ? 191 GLY B N    1  
ATOM   7881   C  CA   . GLY B 1 188 ? 45.349  41.978 65.080 1.00 22.22  ? 191 GLY B CA   1  
ATOM   7882   C  C    . GLY B 1 188 ? 44.369  42.280 66.238 1.00 20.97  ? 191 GLY B C    1  
ATOM   7883   O  O    . GLY B 1 188 ? 43.257  41.790 66.252 1.00 21.44  ? 191 GLY B O    1  
ATOM   7884   H  H    . GLY B 1 188 ? 47.069  43.287 64.963 1.00 0.00   ? 191 GLY B H    1  
ATOM   7885   H  HA2  . GLY B 1 188 ? 44.994  42.462 64.182 1.00 0.00   ? 191 GLY B HA2  1  
ATOM   7886   H  HA3  . GLY B 1 188 ? 45.380  40.911 64.915 1.00 0.00   ? 191 GLY B HA3  1  
ATOM   7887   N  N    . LYS B 1 189 ? 44.756  43.081 67.199 1.00 19.29  ? 192 LYS B N    1  
ATOM   7888   C  CA   . LYS B 1 189 ? 43.845  43.405 68.322 1.00 18.62  ? 192 LYS B CA   1  
ATOM   7889   C  C    . LYS B 1 189 ? 43.114  44.706 68.001 1.00 17.16  ? 192 LYS B C    1  
ATOM   7890   O  O    . LYS B 1 189 ? 43.633  45.576 67.330 1.00 16.82  ? 192 LYS B O    1  
ATOM   7891   C  CB   . LYS B 1 189 ? 44.655  43.576 69.609 1.00 19.27  ? 192 LYS B CB   1  
ATOM   7892   C  CG   . LYS B 1 189 ? 45.459  42.303 69.879 1.00 22.04  ? 192 LYS B CG   1  
ATOM   7893   C  CD   . LYS B 1 189 ? 44.502  41.151 70.192 1.00 25.71  ? 192 LYS B CD   1  
ATOM   7894   C  CE   . LYS B 1 189 ? 45.297  39.852 70.340 1.00 29.31  ? 192 LYS B CE   1  
ATOM   7895   N  NZ   . LYS B 1 189 ? 45.648  39.329 68.989 1.00 32.41  ? 192 LYS B NZ   1  
ATOM   7896   H  H    . LYS B 1 189 ? 45.653  43.475 67.172 1.00 0.00   ? 192 LYS B H    1  
ATOM   7897   H  HA   . LYS B 1 189 ? 43.127  42.608 68.449 1.00 0.00   ? 192 LYS B HA   1  
ATOM   7898   H  HB2  . LYS B 1 189 ? 45.330  44.413 69.500 1.00 0.00   ? 192 LYS B HB2  1  
ATOM   7899   H  HB3  . LYS B 1 189 ? 43.985  43.758 70.435 1.00 0.00   ? 192 LYS B HB3  1  
ATOM   7900   H  HG2  . LYS B 1 189 ? 46.047  42.057 69.006 1.00 0.00   ? 192 LYS B HG2  1  
ATOM   7901   H  HG3  . LYS B 1 189 ? 46.115  42.463 70.721 1.00 0.00   ? 192 LYS B HG3  1  
ATOM   7902   H  HD2  . LYS B 1 189 ? 43.978  41.360 71.113 1.00 0.00   ? 192 LYS B HD2  1  
ATOM   7903   H  HD3  . LYS B 1 189 ? 43.790  41.046 69.388 1.00 0.00   ? 192 LYS B HD3  1  
ATOM   7904   H  HE2  . LYS B 1 189 ? 46.201  40.045 70.897 1.00 0.00   ? 192 LYS B HE2  1  
ATOM   7905   H  HE3  . LYS B 1 189 ? 44.699  39.122 70.865 1.00 0.00   ? 192 LYS B HE3  1  
ATOM   7906   H  HZ1  . LYS B 1 189 ? 45.894  38.321 69.061 1.00 0.00   ? 192 LYS B HZ1  1  
ATOM   7907   H  HZ2  . LYS B 1 189 ? 46.461  39.856 68.613 1.00 0.00   ? 192 LYS B HZ2  1  
ATOM   7908   H  HZ3  . LYS B 1 189 ? 44.834  39.443 68.351 1.00 0.00   ? 192 LYS B HZ3  1  
ATOM   7909   N  N    . TYR B 1 190 ? 41.912  44.838 68.468 1.00 16.37  ? 193 TYR B N    1  
ATOM   7910   C  CA   . TYR B 1 190 ? 41.129  46.068 68.193 1.00 15.70  ? 193 TYR B CA   1  
ATOM   7911   C  C    . TYR B 1 190 ? 41.831  47.261 68.827 1.00 16.36  ? 193 TYR B C    1  
ATOM   7912   O  O    . TYR B 1 190 ? 42.458  47.151 69.862 1.00 17.22  ? 193 TYR B O    1  
ATOM   7913   C  CB   . TYR B 1 190 ? 39.726  45.925 68.787 1.00 14.82  ? 193 TYR B CB   1  
ATOM   7914   C  CG   . TYR B 1 190 ? 39.003  44.790 68.104 1.00 13.84  ? 193 TYR B CG   1  
ATOM   7915   C  CD1  . TYR B 1 190 ? 38.772  44.836 66.724 1.00 14.24  ? 193 TYR B CD1  1  
ATOM   7916   C  CD2  . TYR B 1 190 ? 38.564  43.690 68.851 1.00 13.53  ? 193 TYR B CD2  1  
ATOM   7917   C  CE1  . TYR B 1 190 ? 38.101  43.783 66.091 1.00 13.67  ? 193 TYR B CE1  1  
ATOM   7918   C  CE2  . TYR B 1 190 ? 37.893  42.636 68.217 1.00 14.00  ? 193 TYR B CE2  1  
ATOM   7919   C  CZ   . TYR B 1 190 ? 37.662  42.683 66.837 1.00 13.38  ? 193 TYR B CZ   1  
ATOM   7920   O  OH   . TYR B 1 190 ? 37.001  41.645 66.212 1.00 15.76  ? 193 TYR B OH   1  
ATOM   7921   H  H    . TYR B 1 190 ? 41.515  44.118 69.001 1.00 0.00   ? 193 TYR B H    1  
ATOM   7922   H  HA   . TYR B 1 190 ? 41.055  46.218 67.126 1.00 0.00   ? 193 TYR B HA   1  
ATOM   7923   H  HB2  . TYR B 1 190 ? 39.803  45.719 69.845 1.00 0.00   ? 193 TYR B HB2  1  
ATOM   7924   H  HB3  . TYR B 1 190 ? 39.176  46.843 68.638 1.00 0.00   ? 193 TYR B HB3  1  
ATOM   7925   H  HD1  . TYR B 1 190 ? 39.110  45.685 66.148 1.00 0.00   ? 193 TYR B HD1  1  
ATOM   7926   H  HD2  . TYR B 1 190 ? 38.742  43.653 69.915 1.00 0.00   ? 193 TYR B HD2  1  
ATOM   7927   H  HE1  . TYR B 1 190 ? 37.923  43.820 65.026 1.00 0.00   ? 193 TYR B HE1  1  
ATOM   7928   H  HE2  . TYR B 1 190 ? 37.555  41.788 68.793 1.00 0.00   ? 193 TYR B HE2  1  
ATOM   7929   H  HH   . TYR B 1 190 ? 36.844  40.959 66.865 1.00 0.00   ? 193 TYR B HH   1  
ATOM   7930   N  N    . LYS B 1 191 ? 41.733  48.401 68.214 1.00 16.83  ? 194 LYS B N    1  
ATOM   7931   C  CA   . LYS B 1 191 ? 42.402  49.610 68.782 1.00 17.71  ? 194 LYS B CA   1  
ATOM   7932   C  C    . LYS B 1 191 ? 41.367  50.532 69.443 1.00 18.76  ? 194 LYS B C    1  
ATOM   7933   O  O    . LYS B 1 191 ? 40.242  50.646 68.997 1.00 18.01  ? 194 LYS B O    1  
ATOM   7934   C  CB   . LYS B 1 191 ? 43.112  50.369 67.660 1.00 18.20  ? 194 LYS B CB   1  
ATOM   7935   C  CG   . LYS B 1 191 ? 44.194  49.479 67.045 1.00 19.75  ? 194 LYS B CG   1  
ATOM   7936   C  CD   . LYS B 1 191 ? 44.795  50.175 65.823 1.00 23.07  ? 194 LYS B CD   1  
ATOM   7937   C  CE   . LYS B 1 191 ? 45.159  51.616 66.183 1.00 26.07  ? 194 LYS B CE   1  
ATOM   7938   N  NZ   . LYS B 1 191 ? 45.733  52.297 64.988 1.00 29.75  ? 194 LYS B NZ   1  
ATOM   7939   H  H    . LYS B 1 191 ? 41.224  48.468 67.379 1.00 0.00   ? 194 LYS B H    1  
ATOM   7940   H  HA   . LYS B 1 191 ? 43.128  49.302 69.519 1.00 0.00   ? 194 LYS B HA   1  
ATOM   7941   H  HB2  . LYS B 1 191 ? 42.394  50.642 66.899 1.00 0.00   ? 194 LYS B HB2  1  
ATOM   7942   H  HB3  . LYS B 1 191 ? 43.568  51.261 68.061 1.00 0.00   ? 194 LYS B HB3  1  
ATOM   7943   H  HG2  . LYS B 1 191 ? 44.969  49.299 67.776 1.00 0.00   ? 194 LYS B HG2  1  
ATOM   7944   H  HG3  . LYS B 1 191 ? 43.758  48.538 66.744 1.00 0.00   ? 194 LYS B HG3  1  
ATOM   7945   H  HD2  . LYS B 1 191 ? 45.683  49.646 65.508 1.00 0.00   ? 194 LYS B HD2  1  
ATOM   7946   H  HD3  . LYS B 1 191 ? 44.074  50.178 65.019 1.00 0.00   ? 194 LYS B HD3  1  
ATOM   7947   H  HE2  . LYS B 1 191 ? 44.272  52.142 66.505 1.00 0.00   ? 194 LYS B HE2  1  
ATOM   7948   H  HE3  . LYS B 1 191 ? 45.886  51.615 66.981 1.00 0.00   ? 194 LYS B HE3  1  
ATOM   7949   H  HZ1  . LYS B 1 191 ? 45.136  52.106 64.159 1.00 0.00   ? 194 LYS B HZ1  1  
ATOM   7950   H  HZ2  . LYS B 1 191 ? 46.693  51.938 64.812 1.00 0.00   ? 194 LYS B HZ2  1  
ATOM   7951   H  HZ3  . LYS B 1 191 ? 45.772  53.323 65.159 1.00 0.00   ? 194 LYS B HZ3  1  
ATOM   7952   N  N    . LYS B 1 192 ? 41.752  51.199 70.502 1.00 20.35  ? 195 LYS B N    1  
ATOM   7953   C  CA   . LYS B 1 192 ? 40.827  52.120 71.195 1.00 22.02  ? 195 LYS B CA   1  
ATOM   7954   C  C    . LYS B 1 192 ? 41.353  53.532 71.003 1.00 22.45  ? 195 LYS B C    1  
ATOM   7955   O  O    . LYS B 1 192 ? 42.535  53.743 70.815 1.00 23.35  ? 195 LYS B O    1  
ATOM   7956   C  CB   . LYS B 1 192 ? 40.781  51.782 72.688 1.00 23.03  ? 195 LYS B CB   1  
ATOM   7957   C  CG   . LYS B 1 192 ? 40.395  50.313 72.868 1.00 26.12  ? 195 LYS B CG   1  
ATOM   7958   C  CD   . LYS B 1 192 ? 40.785  49.851 74.273 1.00 30.27  ? 195 LYS B CD   1  
ATOM   7959   C  CE   . LYS B 1 192 ? 39.924  50.579 75.307 1.00 32.40  ? 195 LYS B CE   1  
ATOM   7960   N  NZ   . LYS B 1 192 ? 40.650  50.634 76.607 1.00 34.73  ? 195 LYS B NZ   1  
ATOM   7961   H  H    . LYS B 1 192 ? 42.668  51.093 70.834 1.00 0.00   ? 195 LYS B H    1  
ATOM   7962   H  HA   . LYS B 1 192 ? 39.838  52.036 70.769 1.00 0.00   ? 195 LYS B HA   1  
ATOM   7963   H  HB2  . LYS B 1 192 ? 41.753  51.957 73.126 1.00 0.00   ? 195 LYS B HB2  1  
ATOM   7964   H  HB3  . LYS B 1 192 ? 40.048  52.407 73.176 1.00 0.00   ? 195 LYS B HB3  1  
ATOM   7965   H  HG2  . LYS B 1 192 ? 39.329  50.202 72.734 1.00 0.00   ? 195 LYS B HG2  1  
ATOM   7966   H  HG3  . LYS B 1 192 ? 40.915  49.712 72.137 1.00 0.00   ? 195 LYS B HG3  1  
ATOM   7967   H  HD2  . LYS B 1 192 ? 40.627  48.785 74.358 1.00 0.00   ? 195 LYS B HD2  1  
ATOM   7968   H  HD3  . LYS B 1 192 ? 41.825  50.076 74.451 1.00 0.00   ? 195 LYS B HD3  1  
ATOM   7969   H  HE2  . LYS B 1 192 ? 39.723  51.584 74.965 1.00 0.00   ? 195 LYS B HE2  1  
ATOM   7970   H  HE3  . LYS B 1 192 ? 38.992  50.050 75.437 1.00 0.00   ? 195 LYS B HE3  1  
ATOM   7971   H  HZ1  . LYS B 1 192 ? 40.123  51.232 77.274 1.00 0.00   ? 195 LYS B HZ1  1  
ATOM   7972   H  HZ2  . LYS B 1 192 ? 41.597  51.037 76.460 1.00 0.00   ? 195 LYS B HZ2  1  
ATOM   7973   H  HZ3  . LYS B 1 192 ? 40.738  49.673 76.996 1.00 0.00   ? 195 LYS B HZ3  1  
ATOM   7974   N  N    . TYR B 1 193 ? 40.497  54.498 71.026 1.00 22.93  ? 196 TYR B N    1  
ATOM   7975   C  CA   . TYR B 1 193 ? 40.959  55.885 70.821 1.00 23.72  ? 196 TYR B CA   1  
ATOM   7976   C  C    . TYR B 1 193 ? 40.422  56.757 71.939 1.00 25.62  ? 196 TYR B C    1  
ATOM   7977   O  O    . TYR B 1 193 ? 39.658  56.321 72.777 1.00 25.15  ? 196 TYR B O    1  
ATOM   7978   C  CB   . TYR B 1 193 ? 40.446  56.403 69.476 1.00 23.35  ? 196 TYR B CB   1  
ATOM   7979   C  CG   . TYR B 1 193 ? 40.903  55.479 68.373 1.00 21.07  ? 196 TYR B CG   1  
ATOM   7980   C  CD1  . TYR B 1 193 ? 40.197  54.298 68.112 1.00 19.72  ? 196 TYR B CD1  1  
ATOM   7981   C  CD2  . TYR B 1 193 ? 42.032  55.802 67.611 1.00 19.78  ? 196 TYR B CD2  1  
ATOM   7982   C  CE1  . TYR B 1 193 ? 40.620  53.441 67.090 1.00 18.91  ? 196 TYR B CE1  1  
ATOM   7983   C  CE2  . TYR B 1 193 ? 42.455  54.945 66.589 1.00 19.75  ? 196 TYR B CE2  1  
ATOM   7984   C  CZ   . TYR B 1 193 ? 41.749  53.764 66.328 1.00 18.82  ? 196 TYR B CZ   1  
ATOM   7985   O  OH   . TYR B 1 193 ? 42.166  52.919 65.320 1.00 18.74  ? 196 TYR B OH   1  
ATOM   7986   H  H    . TYR B 1 193 ? 39.545  54.310 71.164 1.00 0.00   ? 196 TYR B H    1  
ATOM   7987   H  HA   . TYR B 1 193 ? 42.039  55.911 70.829 1.00 0.00   ? 196 TYR B HA   1  
ATOM   7988   H  HB2  . TYR B 1 193 ? 39.367  56.440 69.493 1.00 0.00   ? 196 TYR B HB2  1  
ATOM   7989   H  HB3  . TYR B 1 193 ? 40.837  57.394 69.299 1.00 0.00   ? 196 TYR B HB3  1  
ATOM   7990   H  HD1  . TYR B 1 193 ? 39.326  54.049 68.700 1.00 0.00   ? 196 TYR B HD1  1  
ATOM   7991   H  HD2  . TYR B 1 193 ? 42.577  56.713 67.813 1.00 0.00   ? 196 TYR B HD2  1  
ATOM   7992   H  HE1  . TYR B 1 193 ? 40.075  52.530 66.888 1.00 0.00   ? 196 TYR B HE1  1  
ATOM   7993   H  HE2  . TYR B 1 193 ? 43.326  55.194 66.001 1.00 0.00   ? 196 TYR B HE2  1  
ATOM   7994   H  HH   . TYR B 1 193 ? 41.836  53.265 64.487 1.00 0.00   ? 196 TYR B HH   1  
ATOM   7995   N  N    . GLU B 1 194 ? 40.818  57.985 71.957 1.00 27.99  ? 197 GLU B N    1  
ATOM   7996   C  CA   . GLU B 1 194 ? 40.337  58.908 73.024 1.00 29.64  ? 197 GLU B CA   1  
ATOM   7997   C  C    . GLU B 1 194 ? 39.054  59.607 72.564 1.00 29.82  ? 197 GLU B C    1  
ATOM   7998   O  O    . GLU B 1 194 ? 38.062  59.627 73.266 1.00 30.77  ? 197 GLU B O    1  
ATOM   7999   C  CB   . GLU B 1 194 ? 41.413  59.957 73.312 1.00 30.71  ? 197 GLU B CB   1  
ATOM   8000   C  CG   . GLU B 1 194 ? 42.700  59.260 73.758 1.00 33.65  ? 197 GLU B CG   1  
ATOM   8001   C  CD   . GLU B 1 194 ? 43.801  60.302 73.961 1.00 37.30  ? 197 GLU B CD   1  
ATOM   8002   O  OE1  . GLU B 1 194 ? 43.474  61.475 74.028 1.00 40.33  ? 197 GLU B OE1  1  
ATOM   8003   O  OE2  . GLU B 1 194 ? 44.953  59.909 74.045 1.00 40.29  ? 197 GLU B OE2  1  
ATOM   8004   H  H    . GLU B 1 194 ? 41.435  58.311 71.269 1.00 0.00   ? 197 GLU B H    1  
ATOM   8005   H  HA   . GLU B 1 194 ? 40.136  58.344 73.923 1.00 0.00   ? 197 GLU B HA   1  
ATOM   8006   H  HB2  . GLU B 1 194 ? 41.604  60.531 72.417 1.00 0.00   ? 197 GLU B HB2  1  
ATOM   8007   H  HB3  . GLU B 1 194 ? 41.072  60.616 74.097 1.00 0.00   ? 197 GLU B HB3  1  
ATOM   8008   H  HG2  . GLU B 1 194 ? 42.522  58.737 74.687 1.00 0.00   ? 197 GLU B HG2  1  
ATOM   8009   H  HG3  . GLU B 1 194 ? 43.009  58.555 73.001 1.00 0.00   ? 197 GLU B HG3  1  
ATOM   8010   N  N    . ALA B 1 195 ? 39.065  60.186 71.393 1.00 29.91  ? 198 ALA B N    1  
ATOM   8011   C  CA   . ALA B 1 195 ? 37.847  60.886 70.897 1.00 29.65  ? 198 ALA B CA   1  
ATOM   8012   C  C    . ALA B 1 195 ? 37.390  60.249 69.584 1.00 28.99  ? 198 ALA B C    1  
ATOM   8013   O  O    . ALA B 1 195 ? 38.162  59.627 68.882 1.00 29.57  ? 198 ALA B O    1  
ATOM   8014   C  CB   . ALA B 1 195 ? 38.169  62.363 70.661 1.00 30.03  ? 198 ALA B CB   1  
ATOM   8015   H  H    . ALA B 1 195 ? 39.875  60.163 70.843 1.00 0.00   ? 198 ALA B H    1  
ATOM   8016   H  HA   . ALA B 1 195 ? 37.060  60.802 71.631 1.00 0.00   ? 198 ALA B HA   1  
ATOM   8017   H  HB1  . ALA B 1 195 ? 38.244  62.551 69.600 1.00 0.00   ? 198 ALA B HB1  1  
ATOM   8018   H  HB2  . ALA B 1 195 ? 39.108  62.607 71.137 1.00 0.00   ? 198 ALA B HB2  1  
ATOM   8019   H  HB3  . ALA B 1 195 ? 37.383  62.974 71.081 1.00 0.00   ? 198 ALA B HB3  1  
ATOM   8020   N  N    . PRO B 1 196 ? 36.136  60.407 69.262 1.00 28.51  ? 199 PRO B N    1  
ATOM   8021   C  CA   . PRO B 1 196 ? 35.542  59.842 68.012 1.00 27.88  ? 199 PRO B CA   1  
ATOM   8022   C  C    . PRO B 1 196 ? 36.302  60.260 66.742 1.00 27.09  ? 199 PRO B C    1  
ATOM   8023   O  O    . PRO B 1 196 ? 36.397  59.507 65.793 1.00 26.39  ? 199 PRO B O    1  
ATOM   8024   C  CB   . PRO B 1 196 ? 34.120  60.411 67.987 1.00 28.03  ? 199 PRO B CB   1  
ATOM   8025   C  CG   . PRO B 1 196 ? 33.812  60.791 69.398 1.00 28.74  ? 199 PRO B CG   1  
ATOM   8026   C  CD   . PRO B 1 196 ? 35.144  61.143 70.058 1.00 28.69  ? 199 PRO B CD   1  
ATOM   8027   H  HA   . PRO B 1 196 ? 35.494  58.768 68.077 1.00 0.00   ? 199 PRO B HA   1  
ATOM   8028   H  HB2  . PRO B 1 196 ? 34.079  61.281 67.346 1.00 0.00   ? 199 PRO B HB2  1  
ATOM   8029   H  HB3  . PRO B 1 196 ? 33.423  59.661 67.647 1.00 0.00   ? 199 PRO B HB3  1  
ATOM   8030   H  HG2  . PRO B 1 196 ? 33.149  61.645 69.413 1.00 0.00   ? 199 PRO B HG2  1  
ATOM   8031   H  HG3  . PRO B 1 196 ? 33.360  59.960 69.915 1.00 0.00   ? 199 PRO B HG3  1  
ATOM   8032   H  HD2  . PRO B 1 196 ? 35.323  62.208 70.002 1.00 0.00   ? 199 PRO B HD2  1  
ATOM   8033   H  HD3  . PRO B 1 196 ? 35.162  60.805 71.082 1.00 0.00   ? 199 PRO B HD3  1  
ATOM   8034   N  N    . GLY B 1 197 ? 36.833  61.455 66.707 1.00 25.88  ? 200 GLY B N    1  
ATOM   8035   C  CA   . GLY B 1 197 ? 37.570  61.911 65.484 1.00 25.05  ? 200 GLY B CA   1  
ATOM   8036   C  C    . GLY B 1 197 ? 38.903  61.150 65.292 1.00 24.09  ? 200 GLY B C    1  
ATOM   8037   O  O    . GLY B 1 197 ? 39.352  60.963 64.179 1.00 23.94  ? 200 GLY B O    1  
ATOM   8038   H  H    . GLY B 1 197 ? 36.741  62.055 67.476 1.00 0.00   ? 200 GLY B H    1  
ATOM   8039   H  HA2  . GLY B 1 197 ? 36.946  61.749 64.618 1.00 0.00   ? 200 GLY B HA2  1  
ATOM   8040   H  HA3  . GLY B 1 197 ? 37.780  62.966 65.574 1.00 0.00   ? 200 GLY B HA3  1  
ATOM   8041   N  N    . ASP B 1 198 ? 39.552  60.735 66.351 1.00 22.83  ? 201 ASP B N    1  
ATOM   8042   C  CA   . ASP B 1 198 ? 40.859  60.024 66.203 1.00 22.98  ? 201 ASP B CA   1  
ATOM   8043   C  C    . ASP B 1 198 ? 40.663  58.664 65.528 1.00 21.39  ? 201 ASP B C    1  
ATOM   8044   O  O    . ASP B 1 198 ? 41.600  58.064 65.040 1.00 22.11  ? 201 ASP B O    1  
ATOM   8045   C  CB   . ASP B 1 198 ? 41.480  59.816 67.586 1.00 23.55  ? 201 ASP B CB   1  
ATOM   8046   C  CG   . ASP B 1 198 ? 41.661  61.170 68.274 1.00 26.15  ? 201 ASP B CG   1  
ATOM   8047   O  OD1  . ASP B 1 198 ? 41.737  62.164 67.571 1.00 29.54  ? 201 ASP B OD1  1  
ATOM   8048   O  OD2  . ASP B 1 198 ? 41.720  61.190 69.492 1.00 30.73  ? 201 ASP B OD2  1  
ATOM   8049   H  H    . ASP B 1 198 ? 39.190  60.910 67.245 1.00 0.00   ? 201 ASP B H    1  
ATOM   8050   H  HA   . ASP B 1 198 ? 41.525  60.626 65.603 1.00 0.00   ? 201 ASP B HA   1  
ATOM   8051   H  HB2  . ASP B 1 198 ? 40.829  59.192 68.182 1.00 0.00   ? 201 ASP B HB2  1  
ATOM   8052   H  HB3  . ASP B 1 198 ? 42.442  59.337 67.481 1.00 0.00   ? 201 ASP B HB3  1  
ATOM   8053   N  N    . ALA B 1 199 ? 39.461  58.168 65.501 1.00 20.27  ? 202 ALA B N    1  
ATOM   8054   C  CA   . ALA B 1 199 ? 39.214  56.837 64.862 1.00 19.16  ? 202 ALA B CA   1  
ATOM   8055   C  C    . ALA B 1 199 ? 38.500  56.993 63.504 1.00 18.17  ? 202 ALA B C    1  
ATOM   8056   O  O    . ALA B 1 199 ? 37.966  56.042 62.969 1.00 17.47  ? 202 ALA B O    1  
ATOM   8057   C  CB   . ALA B 1 199 ? 38.344  55.988 65.791 1.00 19.12  ? 202 ALA B CB   1  
ATOM   8058   H  H    . ALA B 1 199 ? 38.718  58.663 65.905 1.00 0.00   ? 202 ALA B H    1  
ATOM   8059   H  HA   . ALA B 1 199 ? 40.158  56.336 64.709 1.00 0.00   ? 202 ALA B HA   1  
ATOM   8060   H  HB1  . ALA B 1 199 ? 38.507  56.292 66.814 1.00 0.00   ? 202 ALA B HB1  1  
ATOM   8061   H  HB2  . ALA B 1 199 ? 38.607  54.946 65.678 1.00 0.00   ? 202 ALA B HB2  1  
ATOM   8062   H  HB3  . ALA B 1 199 ? 37.304  56.126 65.536 1.00 0.00   ? 202 ALA B HB3  1  
ATOM   8063   N  N    . TYR B 1 200 ? 38.492  58.171 62.936 1.00 17.56  ? 203 TYR B N    1  
ATOM   8064   C  CA   . TYR B 1 200 ? 37.820  58.365 61.609 1.00 17.41  ? 203 TYR B CA   1  
ATOM   8065   C  C    . TYR B 1 200 ? 38.650  57.798 60.416 1.00 17.53  ? 203 TYR B C    1  
ATOM   8066   O  O    . TYR B 1 200 ? 38.116  57.097 59.580 1.00 17.25  ? 203 TYR B O    1  
ATOM   8067   C  CB   . TYR B 1 200 ? 37.593  59.861 61.385 1.00 17.97  ? 203 TYR B CB   1  
ATOM   8068   C  CG   . TYR B 1 200 ? 36.984  60.080 60.021 1.00 18.61  ? 203 TYR B CG   1  
ATOM   8069   C  CD1  . TYR B 1 200 ? 35.615  59.864 59.823 1.00 17.16  ? 203 TYR B CD1  1  
ATOM   8070   C  CD2  . TYR B 1 200 ? 37.788  60.497 58.954 1.00 20.43  ? 203 TYR B CD2  1  
ATOM   8071   C  CE1  . TYR B 1 200 ? 35.050  60.067 58.559 1.00 19.44  ? 203 TYR B CE1  1  
ATOM   8072   C  CE2  . TYR B 1 200 ? 37.223  60.700 57.689 1.00 22.03  ? 203 TYR B CE2  1  
ATOM   8073   C  CZ   . TYR B 1 200 ? 35.854  60.485 57.492 1.00 21.76  ? 203 TYR B CZ   1  
ATOM   8074   O  OH   . TYR B 1 200 ? 35.297  60.685 56.245 1.00 24.66  ? 203 TYR B OH   1  
ATOM   8075   H  H    . TYR B 1 200 ? 38.934  58.928 63.375 1.00 0.00   ? 203 TYR B H    1  
ATOM   8076   H  HA   . TYR B 1 200 ? 36.861  57.870 61.630 1.00 0.00   ? 203 TYR B HA   1  
ATOM   8077   H  HB2  . TYR B 1 200 ? 36.924  60.241 62.144 1.00 0.00   ? 203 TYR B HB2  1  
ATOM   8078   H  HB3  . TYR B 1 200 ? 38.537  60.381 61.444 1.00 0.00   ? 203 TYR B HB3  1  
ATOM   8079   H  HD1  . TYR B 1 200 ? 34.994  59.542 60.647 1.00 0.00   ? 203 TYR B HD1  1  
ATOM   8080   H  HD2  . TYR B 1 200 ? 38.844  60.663 59.107 1.00 0.00   ? 203 TYR B HD2  1  
ATOM   8081   H  HE1  . TYR B 1 200 ? 33.994  59.901 58.406 1.00 0.00   ? 203 TYR B HE1  1  
ATOM   8082   H  HE2  . TYR B 1 200 ? 37.844  61.022 56.866 1.00 0.00   ? 203 TYR B HE2  1  
ATOM   8083   H  HH   . TYR B 1 200 ? 35.980  61.036 55.668 1.00 0.00   ? 203 TYR B HH   1  
ATOM   8084   N  N    . GLU B 1 201 ? 39.925  58.129 60.288 1.00 17.77  ? 204 GLU B N    1  
ATOM   8085   C  CA   . GLU B 1 201 ? 40.710  57.643 59.114 1.00 18.20  ? 204 GLU B CA   1  
ATOM   8086   C  C    . GLU B 1 201 ? 40.897  56.133 59.180 1.00 16.71  ? 204 GLU B C    1  
ATOM   8087   O  O    . GLU B 1 201 ? 40.777  55.436 58.193 1.00 16.63  ? 204 GLU B O    1  
ATOM   8088   C  CB   . GLU B 1 201 ? 42.081  58.322 59.107 1.00 19.65  ? 204 GLU B CB   1  
ATOM   8089   C  CG   . GLU B 1 201 ? 41.906  59.823 58.871 1.00 23.21  ? 204 GLU B CG   1  
ATOM   8090   C  CD   . GLU B 1 201 ? 41.212  60.052 57.528 1.00 28.09  ? 204 GLU B CD   1  
ATOM   8091   O  OE1  . GLU B 1 201 ? 41.125  59.108 56.760 1.00 33.56  ? 204 GLU B OE1  1  
ATOM   8092   O  OE2  . GLU B 1 201 ? 40.778  61.167 57.290 1.00 32.59  ? 204 GLU B OE2  1  
ATOM   8093   H  H    . GLU B 1 201 ? 40.343  58.728 60.941 1.00 0.00   ? 204 GLU B H    1  
ATOM   8094   H  HA   . GLU B 1 201 ? 40.185  57.896 58.205 1.00 0.00   ? 204 GLU B HA   1  
ATOM   8095   H  HB2  . GLU B 1 201 ? 42.567  58.159 60.058 1.00 0.00   ? 204 GLU B HB2  1  
ATOM   8096   H  HB3  . GLU B 1 201 ? 42.686  57.903 58.317 1.00 0.00   ? 204 GLU B HB3  1  
ATOM   8097   H  HG2  . GLU B 1 201 ? 41.306  60.244 59.665 1.00 0.00   ? 204 GLU B HG2  1  
ATOM   8098   H  HG3  . GLU B 1 201 ? 42.874  60.301 58.860 1.00 0.00   ? 204 GLU B HG3  1  
ATOM   8099   N  N    . ASP B 1 202 ? 41.209  55.628 60.329 1.00 15.66  ? 205 ASP B N    1  
ATOM   8100   C  CA   . ASP B 1 202 ? 41.430  54.158 60.465 1.00 15.07  ? 205 ASP B CA   1  
ATOM   8101   C  C    . ASP B 1 202 ? 40.120  53.405 60.226 1.00 14.52  ? 205 ASP B C    1  
ATOM   8102   O  O    . ASP B 1 202 ? 40.112  52.303 59.715 1.00 14.72  ? 205 ASP B O    1  
ATOM   8103   C  CB   . ASP B 1 202 ? 41.943  53.850 61.873 1.00 15.33  ? 205 ASP B CB   1  
ATOM   8104   C  CG   . ASP B 1 202 ? 43.406  54.281 61.989 1.00 17.27  ? 205 ASP B CG   1  
ATOM   8105   O  OD1  . ASP B 1 202 ? 43.982  54.634 60.973 1.00 20.81  ? 205 ASP B OD1  1  
ATOM   8106   O  OD2  . ASP B 1 202 ? 43.926  54.250 63.092 1.00 19.39  ? 205 ASP B OD2  1  
ATOM   8107   H  H    . ASP B 1 202 ? 41.315  56.213 61.108 1.00 0.00   ? 205 ASP B H    1  
ATOM   8108   H  HA   . ASP B 1 202 ? 42.164  53.838 59.740 1.00 0.00   ? 205 ASP B HA   1  
ATOM   8109   H  HB2  . ASP B 1 202 ? 41.349  54.389 62.597 1.00 0.00   ? 205 ASP B HB2  1  
ATOM   8110   H  HB3  . ASP B 1 202 ? 41.866  52.790 62.060 1.00 0.00   ? 205 ASP B HB3  1  
ATOM   8111   N  N    . THR B 1 203 ? 39.016  53.985 60.598 1.00 13.96  ? 206 THR B N    1  
ATOM   8112   C  CA   . THR B 1 203 ? 37.711  53.297 60.400 1.00 13.30  ? 206 THR B CA   1  
ATOM   8113   C  C    . THR B 1 203 ? 37.378  53.293 58.915 1.00 13.38  ? 206 THR B C    1  
ATOM   8114   O  O    . THR B 1 203 ? 37.054  52.272 58.341 1.00 12.46  ? 206 THR B O    1  
ATOM   8115   C  CB   . THR B 1 203 ? 36.617  54.043 61.169 1.00 12.90  ? 206 THR B CB   1  
ATOM   8116   O  OG1  . THR B 1 203 ? 36.959  54.093 62.547 1.00 14.68  ? 206 THR B OG1  1  
ATOM   8117   C  CG2  . THR B 1 203 ? 35.283  53.313 60.998 1.00 13.33  ? 206 THR B CG2  1  
ATOM   8118   H  H    . THR B 1 203 ? 39.044  54.872 61.014 1.00 0.00   ? 206 THR B H    1  
ATOM   8119   H  HA   . THR B 1 203 ? 37.779  52.281 60.760 1.00 0.00   ? 206 THR B HA   1  
ATOM   8120   H  HB   . THR B 1 203 ? 36.525  55.046 60.783 1.00 0.00   ? 206 THR B HB   1  
ATOM   8121   H  HG1  . THR B 1 203 ? 36.236  53.705 63.046 1.00 0.00   ? 206 THR B HG1  1  
ATOM   8122   H  HG21 . THR B 1 203 ? 34.726  53.361 61.922 1.00 0.00   ? 206 THR B HG21 1  
ATOM   8123   H  HG22 . THR B 1 203 ? 35.468  52.280 60.742 1.00 0.00   ? 206 THR B HG22 1  
ATOM   8124   H  HG23 . THR B 1 203 ? 34.714  53.783 60.210 1.00 0.00   ? 206 THR B HG23 1  
ATOM   8125   N  N    . VAL B 1 204 ? 37.468  54.427 58.285 1.00 13.48  ? 207 VAL B N    1  
ATOM   8126   C  CA   . VAL B 1 204 ? 37.169  54.492 56.828 1.00 14.56  ? 207 VAL B CA   1  
ATOM   8127   C  C    . VAL B 1 204 ? 37.915  53.361 56.116 1.00 14.02  ? 207 VAL B C    1  
ATOM   8128   O  O    . VAL B 1 204 ? 37.352  52.640 55.317 1.00 13.32  ? 207 VAL B O    1  
ATOM   8129   C  CB   . VAL B 1 204 ? 37.630  55.839 56.270 1.00 15.57  ? 207 VAL B CB   1  
ATOM   8130   C  CG1  . VAL B 1 204 ? 37.536  55.820 54.744 1.00 17.27  ? 207 VAL B CG1  1  
ATOM   8131   C  CG2  . VAL B 1 204 ? 36.734  56.951 56.821 1.00 16.43  ? 207 VAL B CG2  1  
ATOM   8132   H  H    . VAL B 1 204 ? 37.740  55.236 58.767 1.00 0.00   ? 207 VAL B H    1  
ATOM   8133   H  HA   . VAL B 1 204 ? 36.107  54.379 56.671 1.00 0.00   ? 207 VAL B HA   1  
ATOM   8134   H  HB   . VAL B 1 204 ? 38.654  56.020 56.565 1.00 0.00   ? 207 VAL B HB   1  
ATOM   8135   H  HG11 . VAL B 1 204 ? 38.165  56.596 54.334 1.00 0.00   ? 207 VAL B HG11 1  
ATOM   8136   H  HG12 . VAL B 1 204 ? 36.513  55.991 54.444 1.00 0.00   ? 207 VAL B HG12 1  
ATOM   8137   H  HG13 . VAL B 1 204 ? 37.864  54.859 54.375 1.00 0.00   ? 207 VAL B HG13 1  
ATOM   8138   H  HG21 . VAL B 1 204 ? 36.096  57.323 56.033 1.00 0.00   ? 207 VAL B HG21 1  
ATOM   8139   H  HG22 . VAL B 1 204 ? 37.349  57.756 57.196 1.00 0.00   ? 207 VAL B HG22 1  
ATOM   8140   H  HG23 . VAL B 1 204 ? 36.125  56.559 57.622 1.00 0.00   ? 207 VAL B HG23 1  
ATOM   8141   N  N    . LYS B 1 205 ? 39.178  53.195 56.407 1.00 13.60  ? 208 LYS B N    1  
ATOM   8142   C  CA   . LYS B 1 205 ? 39.954  52.104 55.752 1.00 14.35  ? 208 LYS B CA   1  
ATOM   8143   C  C    . LYS B 1 205 ? 39.217  50.772 55.929 1.00 13.01  ? 208 LYS B C    1  
ATOM   8144   O  O    . LYS B 1 205 ? 39.039  50.022 54.990 1.00 13.09  ? 208 LYS B O    1  
ATOM   8145   C  CB   . LYS B 1 205 ? 41.340  52.009 56.393 1.00 15.61  ? 208 LYS B CB   1  
ATOM   8146   C  CG   . LYS B 1 205 ? 42.189  50.993 55.627 1.00 20.37  ? 208 LYS B CG   1  
ATOM   8147   C  CD   . LYS B 1 205 ? 43.666  51.202 55.966 1.00 24.74  ? 208 LYS B CD   1  
ATOM   8148   C  CE   . LYS B 1 205 ? 44.505  50.123 55.279 1.00 27.29  ? 208 LYS B CE   1  
ATOM   8149   N  NZ   . LYS B 1 205 ? 45.944  50.328 55.609 1.00 29.67  ? 208 LYS B NZ   1  
ATOM   8150   H  H    . LYS B 1 205 ? 39.613  53.783 57.059 1.00 0.00   ? 208 LYS B H    1  
ATOM   8151   H  HA   . LYS B 1 205 ? 40.059  52.320 54.699 1.00 0.00   ? 208 LYS B HA   1  
ATOM   8152   H  HB2  . LYS B 1 205 ? 41.818  52.977 56.361 1.00 0.00   ? 208 LYS B HB2  1  
ATOM   8153   H  HB3  . LYS B 1 205 ? 41.241  51.690 57.420 1.00 0.00   ? 208 LYS B HB3  1  
ATOM   8154   H  HG2  . LYS B 1 205 ? 41.892  49.992 55.907 1.00 0.00   ? 208 LYS B HG2  1  
ATOM   8155   H  HG3  . LYS B 1 205 ? 42.043  51.129 54.566 1.00 0.00   ? 208 LYS B HG3  1  
ATOM   8156   H  HD2  . LYS B 1 205 ? 43.980  52.177 55.621 1.00 0.00   ? 208 LYS B HD2  1  
ATOM   8157   H  HD3  . LYS B 1 205 ? 43.803  51.136 57.035 1.00 0.00   ? 208 LYS B HD3  1  
ATOM   8158   H  HE2  . LYS B 1 205 ? 44.192  49.149 55.625 1.00 0.00   ? 208 LYS B HE2  1  
ATOM   8159   H  HE3  . LYS B 1 205 ? 44.369  50.187 54.210 1.00 0.00   ? 208 LYS B HE3  1  
ATOM   8160   H  HZ1  . LYS B 1 205 ? 46.338  51.072 54.999 1.00 0.00   ? 208 LYS B HZ1  1  
ATOM   8161   H  HZ2  . LYS B 1 205 ? 46.466  49.443 55.453 1.00 0.00   ? 208 LYS B HZ2  1  
ATOM   8162   H  HZ3  . LYS B 1 205 ? 46.033  50.613 56.606 1.00 0.00   ? 208 LYS B HZ3  1  
ATOM   8163   N  N    . VAL B 1 206 ? 38.787  50.469 57.127 1.00 11.90  ? 209 VAL B N    1  
ATOM   8164   C  CA   . VAL B 1 206 ? 38.065  49.185 57.358 1.00 11.25  ? 209 VAL B CA   1  
ATOM   8165   C  C    . VAL B 1 206 ? 36.724  49.202 56.616 1.00 10.65  ? 209 VAL B C    1  
ATOM   8166   O  O    . VAL B 1 206 ? 36.320  48.219 56.027 1.00 10.71  ? 209 VAL B O    1  
ATOM   8167   C  CB   . VAL B 1 206 ? 37.815  49.005 58.856 1.00 10.64  ? 209 VAL B CB   1  
ATOM   8168   C  CG1  . VAL B 1 206 ? 37.145  47.652 59.103 1.00 11.76  ? 209 VAL B CG1  1  
ATOM   8169   C  CG2  . VAL B 1 206 ? 39.149  49.056 59.604 1.00 12.08  ? 209 VAL B CG2  1  
ATOM   8170   H  H    . VAL B 1 206 ? 38.941  51.086 57.873 1.00 0.00   ? 209 VAL B H    1  
ATOM   8171   H  HA   . VAL B 1 206 ? 38.666  48.365 56.994 1.00 0.00   ? 209 VAL B HA   1  
ATOM   8172   H  HB   . VAL B 1 206 ? 37.170  49.796 59.211 1.00 0.00   ? 209 VAL B HB   1  
ATOM   8173   H  HG11 . VAL B 1 206 ? 37.843  46.859 58.880 1.00 0.00   ? 209 VAL B HG11 1  
ATOM   8174   H  HG12 . VAL B 1 206 ? 36.278  47.558 58.467 1.00 0.00   ? 209 VAL B HG12 1  
ATOM   8175   H  HG13 . VAL B 1 206 ? 36.842  47.584 60.138 1.00 0.00   ? 209 VAL B HG13 1  
ATOM   8176   H  HG21 . VAL B 1 206 ? 39.284  50.038 60.032 1.00 0.00   ? 209 VAL B HG21 1  
ATOM   8177   H  HG22 . VAL B 1 206 ? 39.956  48.849 58.916 1.00 0.00   ? 209 VAL B HG22 1  
ATOM   8178   H  HG23 . VAL B 1 206 ? 39.149  48.317 60.392 1.00 0.00   ? 209 VAL B HG23 1  
ATOM   8179   N  N    . MET B 1 207 ? 36.029  50.307 56.644 1.00 10.54  ? 210 MET B N    1  
ATOM   8180   C  CA   . MET B 1 207 ? 34.711  50.378 55.943 1.00 10.51  ? 210 MET B CA   1  
ATOM   8181   C  C    . MET B 1 207 ? 34.875  50.122 54.433 1.00 10.91  ? 210 MET B C    1  
ATOM   8182   O  O    . MET B 1 207 ? 34.000  49.568 53.797 1.00 11.07  ? 210 MET B O    1  
ATOM   8183   C  CB   . MET B 1 207 ? 34.103  51.766 56.154 1.00 11.42  ? 210 MET B CB   1  
ATOM   8184   C  CG   . MET B 1 207 ? 33.645  51.908 57.607 1.00 12.04  ? 210 MET B CG   1  
ATOM   8185   S  SD   . MET B 1 207 ? 33.516  53.663 58.031 1.00 14.32  ? 210 MET B SD   1  
ATOM   8186   C  CE   . MET B 1 207 ? 32.255  54.099 56.808 1.00 13.21  ? 210 MET B CE   1  
ATOM   8187   H  H    . MET B 1 207 ? 36.370  51.088 57.128 1.00 0.00   ? 210 MET B H    1  
ATOM   8188   H  HA   . MET B 1 207 ? 34.047  49.635 56.359 1.00 0.00   ? 210 MET B HA   1  
ATOM   8189   H  HB2  . MET B 1 207 ? 34.844  52.521 55.934 1.00 0.00   ? 210 MET B HB2  1  
ATOM   8190   H  HB3  . MET B 1 207 ? 33.255  51.892 55.498 1.00 0.00   ? 210 MET B HB3  1  
ATOM   8191   H  HG2  . MET B 1 207 ? 32.681  51.436 57.729 1.00 0.00   ? 210 MET B HG2  1  
ATOM   8192   H  HG3  . MET B 1 207 ? 34.364  51.432 58.259 1.00 0.00   ? 210 MET B HG3  1  
ATOM   8193   H  HE1  . MET B 1 207 ? 31.480  53.345 56.807 1.00 0.00   ? 210 MET B HE1  1  
ATOM   8194   H  HE2  . MET B 1 207 ? 32.710  54.158 55.829 1.00 0.00   ? 210 MET B HE2  1  
ATOM   8195   H  HE3  . MET B 1 207 ? 31.823  55.054 57.059 1.00 0.00   ? 210 MET B HE3  1  
ATOM   8196   N  N    . ARG B 1 208 ? 35.972  50.531 53.849 1.00 11.44  ? 211 ARG B N    1  
ATOM   8197   C  CA   . ARG B 1 208 ? 36.162  50.321 52.385 1.00 12.48  ? 211 ARG B CA   1  
ATOM   8198   C  C    . ARG B 1 208 ? 36.241  48.826 52.082 1.00 11.69  ? 211 ARG B C    1  
ATOM   8199   O  O    . ARG B 1 208 ? 35.779  48.364 51.058 1.00 12.97  ? 211 ARG B O    1  
ATOM   8200   C  CB   . ARG B 1 208 ? 37.459  50.999 51.938 1.00 13.83  ? 211 ARG B CB   1  
ATOM   8201   C  CG   . ARG B 1 208 ? 37.129  52.295 51.195 1.00 16.22  ? 211 ARG B CG   1  
ATOM   8202   C  CD   . ARG B 1 208 ? 38.076  53.404 51.656 1.00 20.28  ? 211 ARG B CD   1  
ATOM   8203   N  NE   . ARG B 1 208 ? 38.670  54.076 50.466 1.00 21.27  ? 211 ARG B NE   1  
ATOM   8204   C  CZ   . ARG B 1 208 ? 37.893  54.558 49.534 1.00 22.18  ? 211 ARG B CZ   1  
ATOM   8205   N  NH1  . ARG B 1 208 ? 36.598  54.450 49.644 1.00 25.46  ? 211 ARG B NH1  1  
ATOM   8206   N  NH2  . ARG B 1 208 ? 38.413  55.147 48.492 1.00 23.68  ? 211 ARG B NH2  1  
ATOM   8207   H  H    . ARG B 1 208 ? 36.664  50.988 54.372 1.00 0.00   ? 211 ARG B H    1  
ATOM   8208   H  HA   . ARG B 1 208 ? 35.330  50.752 51.849 1.00 0.00   ? 211 ARG B HA   1  
ATOM   8209   H  HB2  . ARG B 1 208 ? 38.064  51.224 52.804 1.00 0.00   ? 211 ARG B HB2  1  
ATOM   8210   H  HB3  . ARG B 1 208 ? 38.003  50.338 51.280 1.00 0.00   ? 211 ARG B HB3  1  
ATOM   8211   H  HG2  . ARG B 1 208 ? 37.245  52.139 50.132 1.00 0.00   ? 211 ARG B HG2  1  
ATOM   8212   H  HG3  . ARG B 1 208 ? 36.110  52.583 51.408 1.00 0.00   ? 211 ARG B HG3  1  
ATOM   8213   H  HD2  . ARG B 1 208 ? 37.527  54.126 52.241 1.00 0.00   ? 211 ARG B HD2  1  
ATOM   8214   H  HD3  . ARG B 1 208 ? 38.864  52.977 52.258 1.00 0.00   ? 211 ARG B HD3  1  
ATOM   8215   H  HE   . ARG B 1 208 ? 39.643  54.157 50.383 1.00 0.00   ? 211 ARG B HE   1  
ATOM   8216   H  HH11 . ARG B 1 208 ? 36.199  53.999 50.442 1.00 0.00   ? 211 ARG B HH11 1  
ATOM   8217   H  HH12 . ARG B 1 208 ? 36.003  54.819 48.930 1.00 0.00   ? 211 ARG B HH12 1  
ATOM   8218   H  HH21 . ARG B 1 208 ? 39.406  55.229 48.407 1.00 0.00   ? 211 ARG B HH21 1  
ATOM   8219   H  HH22 . ARG B 1 208 ? 37.818  55.516 47.778 1.00 0.00   ? 211 ARG B HH22 1  
ATOM   8220   N  N    . THR B 1 209 ? 36.825  48.068 52.963 1.00 11.33  ? 212 THR B N    1  
ATOM   8221   C  CA   . THR B 1 209 ? 36.940  46.595 52.726 1.00 11.33  ? 212 THR B CA   1  
ATOM   8222   C  C    . THR B 1 209 ? 35.550  45.929 52.650 1.00 10.51  ? 212 THR B C    1  
ATOM   8223   O  O    . THR B 1 209 ? 35.439  44.761 52.337 1.00 10.68  ? 212 THR B O    1  
ATOM   8224   C  CB   . THR B 1 209 ? 37.737  45.963 53.869 1.00 11.59  ? 212 THR B CB   1  
ATOM   8225   O  OG1  . THR B 1 209 ? 36.931  45.922 55.039 1.00 13.27  ? 212 THR B OG1  1  
ATOM   8226   C  CG2  . THR B 1 209 ? 38.991  46.795 54.140 1.00 13.94  ? 212 THR B CG2  1  
ATOM   8227   H  H    . THR B 1 209 ? 37.193  48.462 53.781 1.00 0.00   ? 212 THR B H    1  
ATOM   8228   H  HA   . THR B 1 209 ? 37.464  46.426 51.797 1.00 0.00   ? 212 THR B HA   1  
ATOM   8229   H  HB   . THR B 1 209 ? 38.027  44.960 53.596 1.00 0.00   ? 212 THR B HB   1  
ATOM   8230   H  HG1  . THR B 1 209 ? 37.208  46.638 55.615 1.00 0.00   ? 212 THR B HG1  1  
ATOM   8231   H  HG21 . THR B 1 209 ? 38.808  47.823 53.864 1.00 0.00   ? 212 THR B HG21 1  
ATOM   8232   H  HG22 . THR B 1 209 ? 39.813  46.406 53.557 1.00 0.00   ? 212 THR B HG22 1  
ATOM   8233   H  HG23 . THR B 1 209 ? 39.238  46.742 55.190 1.00 0.00   ? 212 THR B HG23 1  
ATOM   8234   N  N    . LEU B 1 210 ? 34.492  46.647 52.935 1.00 9.58   ? 213 LEU B N    1  
ATOM   8235   C  CA   . LEU B 1 210 ? 33.138  46.033 52.877 1.00 10.29  ? 213 LEU B CA   1  
ATOM   8236   C  C    . LEU B 1 210 ? 33.130  44.761 53.723 1.00 10.15  ? 213 LEU B C    1  
ATOM   8237   O  O    . LEU B 1 210 ? 32.456  43.799 53.410 1.00 11.65  ? 213 LEU B O    1  
ATOM   8238   C  CB   . LEU B 1 210 ? 32.796  45.685 51.426 1.00 9.71   ? 213 LEU B CB   1  
ATOM   8239   C  CG   . LEU B 1 210 ? 32.827  46.956 50.576 1.00 10.72  ? 213 LEU B CG   1  
ATOM   8240   C  CD1  . LEU B 1 210 ? 32.394  46.625 49.147 1.00 12.27  ? 213 LEU B CD1  1  
ATOM   8241   C  CD2  . LEU B 1 210 ? 31.870  47.991 51.171 1.00 11.62  ? 213 LEU B CD2  1  
ATOM   8242   H  H    . LEU B 1 210 ? 34.593  47.588 53.190 1.00 0.00   ? 213 LEU B H    1  
ATOM   8243   H  HA   . LEU B 1 210 ? 32.409  46.729 53.264 1.00 0.00   ? 213 LEU B HA   1  
ATOM   8244   H  HB2  . LEU B 1 210 ? 33.518  44.978 51.046 1.00 0.00   ? 213 LEU B HB2  1  
ATOM   8245   H  HB3  . LEU B 1 210 ? 31.808  45.251 51.384 1.00 0.00   ? 213 LEU B HB3  1  
ATOM   8246   H  HG   . LEU B 1 210 ? 33.831  47.356 50.564 1.00 0.00   ? 213 LEU B HG   1  
ATOM   8247   H  HD11 . LEU B 1 210 ? 32.561  47.483 48.512 1.00 0.00   ? 213 LEU B HD11 1  
ATOM   8248   H  HD12 . LEU B 1 210 ? 31.344  46.371 49.139 1.00 0.00   ? 213 LEU B HD12 1  
ATOM   8249   H  HD13 . LEU B 1 210 ? 32.970  45.789 48.780 1.00 0.00   ? 213 LEU B HD13 1  
ATOM   8250   H  HD21 . LEU B 1 210 ? 31.968  48.923 50.634 1.00 0.00   ? 213 LEU B HD21 1  
ATOM   8251   H  HD22 . LEU B 1 210 ? 32.112  48.148 52.212 1.00 0.00   ? 213 LEU B HD22 1  
ATOM   8252   H  HD23 . LEU B 1 210 ? 30.855  47.632 51.088 1.00 0.00   ? 213 LEU B HD23 1  
ATOM   8253   N  N    . THR B 1 211 ? 33.879  44.744 54.792 1.00 10.51  ? 214 THR B N    1  
ATOM   8254   C  CA   . THR B 1 211 ? 33.915  43.529 55.650 1.00 10.57  ? 214 THR B CA   1  
ATOM   8255   C  C    . THR B 1 211 ? 33.853  43.958 57.110 1.00 9.76   ? 214 THR B C    1  
ATOM   8256   O  O    . THR B 1 211 ? 34.839  44.375 57.684 1.00 10.15  ? 214 THR B O    1  
ATOM   8257   C  CB   . THR B 1 211 ? 35.213  42.759 55.396 1.00 10.49  ? 214 THR B CB   1  
ATOM   8258   O  OG1  . THR B 1 211 ? 35.347  42.508 54.004 1.00 13.32  ? 214 THR B OG1  1  
ATOM   8259   C  CG2  . THR B 1 211 ? 35.178  41.432 56.155 1.00 12.25  ? 214 THR B CG2  1  
ATOM   8260   H  H    . THR B 1 211 ? 34.419  45.528 55.026 1.00 0.00   ? 214 THR B H    1  
ATOM   8261   H  HA   . THR B 1 211 ? 33.068  42.899 55.422 1.00 0.00   ? 214 THR B HA   1  
ATOM   8262   H  HB   . THR B 1 211 ? 36.052  43.343 55.740 1.00 0.00   ? 214 THR B HB   1  
ATOM   8263   H  HG1  . THR B 1 211 ? 34.579  42.010 53.717 1.00 0.00   ? 214 THR B HG1  1  
ATOM   8264   H  HG21 . THR B 1 211 ? 34.335  41.425 56.831 1.00 0.00   ? 214 THR B HG21 1  
ATOM   8265   H  HG22 . THR B 1 211 ? 36.092  41.315 56.719 1.00 0.00   ? 214 THR B HG22 1  
ATOM   8266   H  HG23 . THR B 1 211 ? 35.082  40.617 55.452 1.00 0.00   ? 214 THR B HG23 1  
ATOM   8267   N  N    . PRO B 1 212 ? 32.697  43.871 57.702 1.00 9.09   ? 215 PRO B N    1  
ATOM   8268   C  CA   . PRO B 1 212 ? 32.501  44.279 59.133 1.00 8.88   ? 215 PRO B CA   1  
ATOM   8269   C  C    . PRO B 1 212 ? 33.204  43.346 60.141 1.00 8.63   ? 215 PRO B C    1  
ATOM   8270   O  O    . PRO B 1 212 ? 33.070  42.141 60.076 1.00 8.74   ? 215 PRO B O    1  
ATOM   8271   C  CB   . PRO B 1 212 ? 30.983  44.214 59.322 1.00 9.62   ? 215 PRO B CB   1  
ATOM   8272   C  CG   . PRO B 1 212 ? 30.483  43.280 58.267 1.00 11.25  ? 215 PRO B CG   1  
ATOM   8273   C  CD   . PRO B 1 212 ? 31.455  43.381 57.091 1.00 9.31   ? 215 PRO B CD   1  
ATOM   8274   H  HA   . PRO B 1 212 ? 32.833  45.294 59.277 1.00 0.00   ? 215 PRO B HA   1  
ATOM   8275   H  HB2  . PRO B 1 212 ? 30.747  43.831 60.306 1.00 0.00   ? 215 PRO B HB2  1  
ATOM   8276   H  HB3  . PRO B 1 212 ? 30.547  45.191 59.185 1.00 0.00   ? 215 PRO B HB3  1  
ATOM   8277   H  HG2  . PRO B 1 212 ? 30.464  42.269 58.650 1.00 0.00   ? 215 PRO B HG2  1  
ATOM   8278   H  HG3  . PRO B 1 212 ? 29.496  43.576 57.948 1.00 0.00   ? 215 PRO B HG3  1  
ATOM   8279   H  HD2  . PRO B 1 212 ? 31.607  42.408 56.642 1.00 0.00   ? 215 PRO B HD2  1  
ATOM   8280   H  HD3  . PRO B 1 212 ? 31.095  44.087 56.359 1.00 0.00   ? 215 PRO B HD3  1  
ATOM   8281   N  N    . THR B 1 213 ? 33.938  43.898 61.089 1.00 8.39   ? 216 THR B N    1  
ATOM   8282   C  CA   . THR B 1 213 ? 34.616  43.037 62.099 1.00 8.74   ? 216 THR B CA   1  
ATOM   8283   C  C    . THR B 1 213 ? 33.575  42.456 63.074 1.00 8.15   ? 216 THR B C    1  
ATOM   8284   O  O    . THR B 1 213 ? 33.800  41.432 63.688 1.00 9.35   ? 216 THR B O    1  
ATOM   8285   C  CB   . THR B 1 213 ? 35.632  43.874 62.880 1.00 9.19   ? 216 THR B CB   1  
ATOM   8286   O  OG1  . THR B 1 213 ? 34.968  44.969 63.495 1.00 8.94   ? 216 THR B OG1  1  
ATOM   8287   C  CG2  . THR B 1 213 ? 36.707  44.397 61.926 1.00 10.25  ? 216 THR B CG2  1  
ATOM   8288   H  H    . THR B 1 213 ? 34.024  44.873 61.138 1.00 0.00   ? 216 THR B H    1  
ATOM   8289   H  HA   . THR B 1 213 ? 35.127  42.229 61.597 1.00 0.00   ? 216 THR B HA   1  
ATOM   8290   H  HB   . THR B 1 213 ? 36.096  43.262 63.638 1.00 0.00   ? 216 THR B HB   1  
ATOM   8291   H  HG1  . THR B 1 213 ? 34.188  45.173 62.974 1.00 0.00   ? 216 THR B HG1  1  
ATOM   8292   H  HG21 . THR B 1 213 ? 37.237  43.563 61.489 1.00 0.00   ? 216 THR B HG21 1  
ATOM   8293   H  HG22 . THR B 1 213 ? 37.401  45.018 62.472 1.00 0.00   ? 216 THR B HG22 1  
ATOM   8294   H  HG23 . THR B 1 213 ? 36.241  44.977 61.143 1.00 0.00   ? 216 THR B HG23 1  
ATOM   8295   N  N    . HIS B 1 214 ? 32.441  43.098 63.226 1.00 7.86   ? 217 HIS B N    1  
ATOM   8296   C  CA   . HIS B 1 214 ? 31.408  42.573 64.162 1.00 8.24   ? 217 HIS B CA   1  
ATOM   8297   C  C    . HIS B 1 214 ? 30.014  42.959 63.661 1.00 7.92   ? 217 HIS B C    1  
ATOM   8298   O  O    . HIS B 1 214 ? 29.749  44.102 63.344 1.00 8.10   ? 217 HIS B O    1  
ATOM   8299   C  CB   . HIS B 1 214 ? 31.632  43.169 65.553 1.00 8.57   ? 217 HIS B CB   1  
ATOM   8300   C  CG   . HIS B 1 214 ? 33.052  42.921 65.983 1.00 9.15   ? 217 HIS B CG   1  
ATOM   8301   N  ND1  . HIS B 1 214 ? 34.137  43.312 65.211 1.00 11.70  ? 217 HIS B ND1  1  
ATOM   8302   C  CD2  . HIS B 1 214 ? 33.581  42.322 67.100 1.00 10.92  ? 217 HIS B CD2  1  
ATOM   8303   C  CE1  . HIS B 1 214 ? 35.254  42.948 65.869 1.00 11.89  ? 217 HIS B CE1  1  
ATOM   8304   N  NE2  . HIS B 1 214 ? 34.969  42.342 67.022 1.00 10.87  ? 217 HIS B NE2  1  
ATOM   8305   H  H    . HIS B 1 214 ? 32.275  43.924 62.726 1.00 0.00   ? 217 HIS B H    1  
ATOM   8306   H  HA   . HIS B 1 214 ? 31.485  41.498 64.215 1.00 0.00   ? 217 HIS B HA   1  
ATOM   8307   H  HB2  . HIS B 1 214 ? 31.445  44.233 65.523 1.00 0.00   ? 217 HIS B HB2  1  
ATOM   8308   H  HB3  . HIS B 1 214 ? 30.957  42.704 66.257 1.00 0.00   ? 217 HIS B HB3  1  
ATOM   8309   H  HD1  . HIS B 1 214 ? 34.098  43.771 64.346 1.00 0.00   ? 217 HIS B HD1  1  
ATOM   8310   H  HD2  . HIS B 1 214 ? 33.008  41.901 67.912 1.00 0.00   ? 217 HIS B HD2  1  
ATOM   8311   H  HE1  . HIS B 1 214 ? 36.257  43.124 65.507 1.00 0.00   ? 217 HIS B HE1  1  
ATOM   8312   H  HE2  . HIS B 1 214 ? 35.604  41.986 67.678 1.00 0.00   ? 217 HIS B HE2  1  
ATOM   8313   N  N    . VAL B 1 215 ? 29.121  42.011 63.593 1.00 7.42   ? 218 VAL B N    1  
ATOM   8314   C  CA   . VAL B 1 215 ? 27.748  42.306 63.123 1.00 7.88   ? 218 VAL B CA   1  
ATOM   8315   C  C    . VAL B 1 215 ? 26.867  41.843 64.239 1.00 7.40   ? 218 VAL B C    1  
ATOM   8316   O  O    . VAL B 1 215 ? 26.886  40.683 64.598 1.00 8.35   ? 218 VAL B O    1  
ATOM   8317   C  CB   . VAL B 1 215 ? 27.443  41.522 61.845 1.00 8.28   ? 218 VAL B CB   1  
ATOM   8318   C  CG1  . VAL B 1 215 ? 26.035  41.867 61.357 1.00 9.05   ? 218 VAL B CG1  1  
ATOM   8319   C  CG2  . VAL B 1 215 ? 28.461  41.894 60.764 1.00 8.99   ? 218 VAL B CG2  1  
ATOM   8320   H  H    . VAL B 1 215 ? 29.360  41.098 63.858 1.00 0.00   ? 218 VAL B H    1  
ATOM   8321   H  HA   . VAL B 1 215 ? 27.624  43.367 62.960 1.00 0.00   ? 218 VAL B HA   1  
ATOM   8322   H  HB   . VAL B 1 215 ? 27.503  40.462 62.049 1.00 0.00   ? 218 VAL B HB   1  
ATOM   8323   H  HG11 . VAL B 1 215 ? 25.882  42.934 61.423 1.00 0.00   ? 218 VAL B HG11 1  
ATOM   8324   H  HG12 . VAL B 1 215 ? 25.306  41.361 61.973 1.00 0.00   ? 218 VAL B HG12 1  
ATOM   8325   H  HG13 . VAL B 1 215 ? 25.921  41.550 60.331 1.00 0.00   ? 218 VAL B HG13 1  
ATOM   8326   H  HG21 . VAL B 1 215 ? 28.482  41.123 60.008 1.00 0.00   ? 218 VAL B HG21 1  
ATOM   8327   H  HG22 . VAL B 1 215 ? 29.440  41.989 61.210 1.00 0.00   ? 218 VAL B HG22 1  
ATOM   8328   H  HG23 . VAL B 1 215 ? 28.179  42.834 60.312 1.00 0.00   ? 218 VAL B HG23 1  
ATOM   8329   N  N    . VAL B 1 216 ? 26.164  42.711 64.879 1.00 8.07   ? 219 VAL B N    1  
ATOM   8330   C  CA   . VAL B 1 216 ? 25.415  42.187 66.043 1.00 7.74   ? 219 VAL B CA   1  
ATOM   8331   C  C    . VAL B 1 216 ? 24.044  42.786 66.168 1.00 7.83   ? 219 VAL B C    1  
ATOM   8332   O  O    . VAL B 1 216 ? 23.592  43.564 65.351 1.00 8.80   ? 219 VAL B O    1  
ATOM   8333   C  CB   . VAL B 1 216 ? 26.205  42.487 67.317 1.00 8.10   ? 219 VAL B CB   1  
ATOM   8334   C  CG1  . VAL B 1 216 ? 27.634  41.963 67.168 1.00 9.53   ? 219 VAL B CG1  1  
ATOM   8335   C  CG2  . VAL B 1 216 ? 26.239  43.999 67.550 1.00 10.18  ? 219 VAL B CG2  1  
ATOM   8336   H  H    . VAL B 1 216 ? 26.189  43.666 64.660 1.00 0.00   ? 219 VAL B H    1  
ATOM   8337   H  HA   . VAL B 1 216 ? 25.320  41.118 65.944 1.00 0.00   ? 219 VAL B HA   1  
ATOM   8338   H  HB   . VAL B 1 216 ? 25.729  42.002 68.157 1.00 0.00   ? 219 VAL B HB   1  
ATOM   8339   H  HG11 . VAL B 1 216 ? 27.856  41.817 66.121 1.00 0.00   ? 219 VAL B HG11 1  
ATOM   8340   H  HG12 . VAL B 1 216 ? 27.729  41.023 67.691 1.00 0.00   ? 219 VAL B HG12 1  
ATOM   8341   H  HG13 . VAL B 1 216 ? 28.326  42.679 67.586 1.00 0.00   ? 219 VAL B HG13 1  
ATOM   8342   H  HG21 . VAL B 1 216 ? 27.100  44.421 67.053 1.00 0.00   ? 219 VAL B HG21 1  
ATOM   8343   H  HG22 . VAL B 1 216 ? 26.303  44.199 68.610 1.00 0.00   ? 219 VAL B HG22 1  
ATOM   8344   H  HG23 . VAL B 1 216 ? 25.339  44.445 67.154 1.00 0.00   ? 219 VAL B HG23 1  
ATOM   8345   N  N    . PHE B 1 217 ? 23.378  42.406 67.209 1.00 7.90   ? 220 PHE B N    1  
ATOM   8346   C  CA   . PHE B 1 217 ? 22.003  42.924 67.443 1.00 8.04   ? 220 PHE B CA   1  
ATOM   8347   C  C    . PHE B 1 217 ? 21.950  43.629 68.798 1.00 8.41   ? 220 PHE B C    1  
ATOM   8348   O  O    . PHE B 1 217 ? 22.523  43.175 69.769 1.00 9.29   ? 220 PHE B O    1  
ATOM   8349   C  CB   . PHE B 1 217 ? 21.010  41.760 67.435 1.00 8.23   ? 220 PHE B CB   1  
ATOM   8350   C  CG   . PHE B 1 217 ? 21.184  40.959 66.167 1.00 8.12   ? 220 PHE B CG   1  
ATOM   8351   C  CD1  . PHE B 1 217 ? 21.362  41.616 64.943 1.00 8.61   ? 220 PHE B CD1  1  
ATOM   8352   C  CD2  . PHE B 1 217 ? 21.167  39.560 66.215 1.00 9.53   ? 220 PHE B CD2  1  
ATOM   8353   C  CE1  . PHE B 1 217 ? 21.523  40.873 63.767 1.00 8.46   ? 220 PHE B CE1  1  
ATOM   8354   C  CE2  . PHE B 1 217 ? 21.328  38.817 65.039 1.00 9.03   ? 220 PHE B CE2  1  
ATOM   8355   C  CZ   . PHE B 1 217 ? 21.506  39.474 63.815 1.00 8.89   ? 220 PHE B CZ   1  
ATOM   8356   H  H    . PHE B 1 217 ? 23.778  41.774 67.842 1.00 0.00   ? 220 PHE B H    1  
ATOM   8357   H  HA   . PHE B 1 217 ? 21.744  43.624 66.663 1.00 0.00   ? 220 PHE B HA   1  
ATOM   8358   H  HB2  . PHE B 1 217 ? 21.192  41.126 68.290 1.00 0.00   ? 220 PHE B HB2  1  
ATOM   8359   H  HB3  . PHE B 1 217 ? 20.002  42.146 67.481 1.00 0.00   ? 220 PHE B HB3  1  
ATOM   8360   H  HD1  . PHE B 1 217 ? 21.375  42.695 64.906 1.00 0.00   ? 220 PHE B HD1  1  
ATOM   8361   H  HD2  . PHE B 1 217 ? 21.029  39.054 67.159 1.00 0.00   ? 220 PHE B HD2  1  
ATOM   8362   H  HE1  . PHE B 1 217 ? 21.660  41.379 62.823 1.00 0.00   ? 220 PHE B HE1  1  
ATOM   8363   H  HE2  . PHE B 1 217 ? 21.315  37.738 65.076 1.00 0.00   ? 220 PHE B HE2  1  
ATOM   8364   H  HZ   . PHE B 1 217 ? 21.630  38.901 62.908 1.00 0.00   ? 220 PHE B HZ   1  
ATOM   8365   N  N    . ASN B 1 218 ? 21.269  44.737 68.871 1.00 8.81   ? 221 ASN B N    1  
ATOM   8366   C  CA   . ASN B 1 218 ? 21.180  45.478 70.174 1.00 9.78   ? 221 ASN B CA   1  
ATOM   8367   C  C    . ASN B 1 218 ? 22.483  46.259 70.500 1.00 10.43  ? 221 ASN B C    1  
ATOM   8368   O  O    . ASN B 1 218 ? 22.608  46.819 71.571 1.00 11.92  ? 221 ASN B O    1  
ATOM   8369   C  CB   . ASN B 1 218 ? 20.909  44.475 71.297 1.00 10.27  ? 221 ASN B CB   1  
ATOM   8370   C  CG   . ASN B 1 218 ? 19.771  44.993 72.179 1.00 10.40  ? 221 ASN B CG   1  
ATOM   8371   O  OD1  . ASN B 1 218 ? 19.586  44.528 73.286 1.00 13.71  ? 221 ASN B OD1  1  
ATOM   8372   N  ND2  . ASN B 1 218 ? 18.996  45.943 71.733 1.00 8.88   ? 221 ASN B ND2  1  
ATOM   8373   H  H    . ASN B 1 218 ? 20.815  45.087 68.076 1.00 0.00   ? 221 ASN B H    1  
ATOM   8374   H  HA   . ASN B 1 218 ? 20.357  46.175 70.124 1.00 0.00   ? 221 ASN B HA   1  
ATOM   8375   H  HB2  . ASN B 1 218 ? 20.630  43.523 70.869 1.00 0.00   ? 221 ASN B HB2  1  
ATOM   8376   H  HB3  . ASN B 1 218 ? 21.799  44.355 71.895 1.00 0.00   ? 221 ASN B HB3  1  
ATOM   8377   H  HD21 . ASN B 1 218 ? 19.145  46.318 70.840 1.00 0.00   ? 221 ASN B HD21 1  
ATOM   8378   H  HD22 . ASN B 1 218 ? 18.264  46.281 72.291 1.00 0.00   ? 221 ASN B HD22 1  
ATOM   8379   N  N    . GLY B 1 219 ? 23.447  46.318 69.607 1.00 10.44  ? 222 GLY B N    1  
ATOM   8380   C  CA   . GLY B 1 219 ? 24.703  47.075 69.909 1.00 10.10  ? 222 GLY B CA   1  
ATOM   8381   C  C    . GLY B 1 219 ? 25.865  46.191 70.464 1.00 9.96   ? 222 GLY B C    1  
ATOM   8382   O  O    . GLY B 1 219 ? 26.904  46.726 70.799 1.00 11.71  ? 222 GLY B O    1  
ATOM   8383   H  H    . GLY B 1 219 ? 23.341  45.870 68.742 1.00 0.00   ? 222 GLY B H    1  
ATOM   8384   H  HA2  . GLY B 1 219 ? 25.041  47.554 69.002 1.00 0.00   ? 222 GLY B HA2  1  
ATOM   8385   H  HA3  . GLY B 1 219 ? 24.475  47.841 70.637 1.00 0.00   ? 222 GLY B HA3  1  
ATOM   8386   N  N    . ALA B 1 220 ? 25.755  44.874 70.576 1.00 9.63   ? 223 ALA B N    1  
ATOM   8387   C  CA   . ALA B 1 220 ? 26.928  44.116 71.113 1.00 9.87   ? 223 ALA B CA   1  
ATOM   8388   C  C    . ALA B 1 220 ? 26.745  42.607 70.943 1.00 9.65   ? 223 ALA B C    1  
ATOM   8389   O  O    . ALA B 1 220 ? 25.652  42.087 71.044 1.00 9.71   ? 223 ALA B O    1  
ATOM   8390   C  CB   . ALA B 1 220 ? 27.093  44.436 72.600 1.00 10.50  ? 223 ALA B CB   1  
ATOM   8391   H  H    . ALA B 1 220 ? 24.933  44.411 70.311 1.00 0.00   ? 223 ALA B H    1  
ATOM   8392   H  HA   . ALA B 1 220 ? 27.819  44.425 70.587 1.00 0.00   ? 223 ALA B HA   1  
ATOM   8393   H  HB1  . ALA B 1 220 ? 27.666  45.346 72.711 1.00 0.00   ? 223 ALA B HB1  1  
ATOM   8394   H  HB2  . ALA B 1 220 ? 27.611  43.624 73.088 1.00 0.00   ? 223 ALA B HB2  1  
ATOM   8395   H  HB3  . ALA B 1 220 ? 26.120  44.566 73.050 1.00 0.00   ? 223 ALA B HB3  1  
ATOM   8396   N  N    . VAL B 1 221 ? 27.823  41.896 70.709 1.00 9.90   ? 224 VAL B N    1  
ATOM   8397   C  CA   . VAL B 1 221 ? 27.718  40.420 70.563 1.00 10.17  ? 224 VAL B CA   1  
ATOM   8398   C  C    . VAL B 1 221 ? 27.139  39.848 71.858 1.00 10.19  ? 224 VAL B C    1  
ATOM   8399   O  O    . VAL B 1 221 ? 27.604  40.148 72.940 1.00 11.46  ? 224 VAL B O    1  
ATOM   8400   C  CB   . VAL B 1 221 ? 29.106  39.827 70.313 1.00 10.44  ? 224 VAL B CB   1  
ATOM   8401   C  CG1  . VAL B 1 221 ? 28.967  38.366 69.880 1.00 10.64  ? 224 VAL B CG1  1  
ATOM   8402   C  CG2  . VAL B 1 221 ? 29.807  40.621 69.208 1.00 10.92  ? 224 VAL B CG2  1  
ATOM   8403   H  H    . VAL B 1 221 ? 28.698  42.334 70.650 1.00 0.00   ? 224 VAL B H    1  
ATOM   8404   H  HA   . VAL B 1 221 ? 27.064  40.181 69.736 1.00 0.00   ? 224 VAL B HA   1  
ATOM   8405   H  HB   . VAL B 1 221 ? 29.688  39.879 71.222 1.00 0.00   ? 224 VAL B HB   1  
ATOM   8406   H  HG11 . VAL B 1 221 ? 29.944  37.907 69.846 1.00 0.00   ? 224 VAL B HG11 1  
ATOM   8407   H  HG12 . VAL B 1 221 ? 28.515  38.323 68.900 1.00 0.00   ? 224 VAL B HG12 1  
ATOM   8408   H  HG13 . VAL B 1 221 ? 28.345  37.838 70.587 1.00 0.00   ? 224 VAL B HG13 1  
ATOM   8409   H  HG21 . VAL B 1 221 ? 29.576  40.183 68.249 1.00 0.00   ? 224 VAL B HG21 1  
ATOM   8410   H  HG22 . VAL B 1 221 ? 30.875  40.595 69.369 1.00 0.00   ? 224 VAL B HG22 1  
ATOM   8411   H  HG23 . VAL B 1 221 ? 29.465  41.645 69.229 1.00 0.00   ? 224 VAL B HG23 1  
ATOM   8412   N  N    . GLY B 1 222 ? 26.119  39.047 71.761 1.00 10.56  ? 225 GLY B N    1  
ATOM   8413   C  CA   . GLY B 1 222 ? 25.498  38.477 72.995 1.00 10.89  ? 225 GLY B CA   1  
ATOM   8414   C  C    . GLY B 1 222 ? 24.629  39.531 73.729 1.00 10.46  ? 225 GLY B C    1  
ATOM   8415   O  O    . GLY B 1 222 ? 24.399  39.417 74.917 1.00 10.62  ? 225 GLY B O    1  
ATOM   8416   H  H    . GLY B 1 222 ? 25.748  38.829 70.880 1.00 0.00   ? 225 GLY B H    1  
ATOM   8417   H  HA2  . GLY B 1 222 ? 24.878  37.635 72.722 1.00 0.00   ? 225 GLY B HA2  1  
ATOM   8418   H  HA3  . GLY B 1 222 ? 26.279  38.141 73.661 1.00 0.00   ? 225 GLY B HA3  1  
ATOM   8419   N  N    . ALA B 1 223 ? 24.128  40.542 73.048 1.00 9.61   ? 226 ALA B N    1  
ATOM   8420   C  CA   . ALA B 1 223 ? 23.272  41.556 73.743 1.00 9.28   ? 226 ALA B CA   1  
ATOM   8421   C  C    . ALA B 1 223 ? 21.858  40.992 74.040 1.00 9.81   ? 226 ALA B C    1  
ATOM   8422   O  O    . ALA B 1 223 ? 21.222  41.389 74.996 1.00 11.58  ? 226 ALA B O    1  
ATOM   8423   C  CB   . ALA B 1 223 ? 23.141  42.794 72.854 1.00 10.01  ? 226 ALA B CB   1  
ATOM   8424   H  H    . ALA B 1 223 ? 24.305  40.624 72.088 1.00 0.00   ? 226 ALA B H    1  
ATOM   8425   H  HA   . ALA B 1 223 ? 23.742  41.838 74.673 1.00 0.00   ? 226 ALA B HA   1  
ATOM   8426   H  HB1  . ALA B 1 223 ? 22.771  42.503 71.882 1.00 0.00   ? 226 ALA B HB1  1  
ATOM   8427   H  HB2  . ALA B 1 223 ? 24.108  43.263 72.746 1.00 0.00   ? 226 ALA B HB2  1  
ATOM   8428   H  HB3  . ALA B 1 223 ? 22.451  43.491 73.308 1.00 0.00   ? 226 ALA B HB3  1  
ATOM   8429   N  N    . LEU B 1 224 ? 21.351  40.092 73.226 1.00 9.12   ? 227 LEU B N    1  
ATOM   8430   C  CA   . LEU B 1 224 ? 19.979  39.538 73.463 1.00 9.72   ? 227 LEU B CA   1  
ATOM   8431   C  C    . LEU B 1 224 ? 20.046  38.066 73.910 1.00 9.93   ? 227 LEU B C    1  
ATOM   8432   O  O    . LEU B 1 224 ? 19.317  37.225 73.422 1.00 10.10  ? 227 LEU B O    1  
ATOM   8433   C  CB   . LEU B 1 224 ? 19.168  39.634 72.169 1.00 9.44   ? 227 LEU B CB   1  
ATOM   8434   C  CG   . LEU B 1 224 ? 19.108  41.091 71.710 1.00 10.56  ? 227 LEU B CG   1  
ATOM   8435   C  CD1  . LEU B 1 224 ? 18.260  41.194 70.441 1.00 11.12  ? 227 LEU B CD1  1  
ATOM   8436   C  CD2  . LEU B 1 224 ? 18.480  41.946 72.813 1.00 12.34  ? 227 LEU B CD2  1  
ATOM   8437   H  H    . LEU B 1 224 ? 21.869  39.792 72.450 1.00 0.00   ? 227 LEU B H    1  
ATOM   8438   H  HA   . LEU B 1 224 ? 19.489  40.119 74.230 1.00 0.00   ? 227 LEU B HA   1  
ATOM   8439   H  HB2  . LEU B 1 224 ? 19.640  39.033 71.404 1.00 0.00   ? 227 LEU B HB2  1  
ATOM   8440   H  HB3  . LEU B 1 224 ? 18.166  39.272 72.344 1.00 0.00   ? 227 LEU B HB3  1  
ATOM   8441   H  HG   . LEU B 1 224 ? 20.108  41.445 71.503 1.00 0.00   ? 227 LEU B HG   1  
ATOM   8442   H  HD11 . LEU B 1 224 ? 18.547  42.075 69.887 1.00 0.00   ? 227 LEU B HD11 1  
ATOM   8443   H  HD12 . LEU B 1 224 ? 17.216  41.261 70.711 1.00 0.00   ? 227 LEU B HD12 1  
ATOM   8444   H  HD13 . LEU B 1 224 ? 18.418  40.317 69.831 1.00 0.00   ? 227 LEU B HD13 1  
ATOM   8445   H  HD21 . LEU B 1 224 ? 17.804  42.664 72.371 1.00 0.00   ? 227 LEU B HD21 1  
ATOM   8446   H  HD22 . LEU B 1 224 ? 19.257  42.468 73.351 1.00 0.00   ? 227 LEU B HD22 1  
ATOM   8447   H  HD23 . LEU B 1 224 ? 17.934  41.310 73.494 1.00 0.00   ? 227 LEU B HD23 1  
ATOM   8448   N  N    . THR B 1 225 ? 20.894  37.765 74.849 1.00 10.19  ? 228 THR B N    1  
ATOM   8449   C  CA   . THR B 1 225 ? 21.011  36.383 75.367 1.00 11.25  ? 228 THR B CA   1  
ATOM   8450   C  C    . THR B 1 225 ? 21.112  36.455 76.893 1.00 11.65  ? 228 THR B C    1  
ATOM   8451   O  O    . THR B 1 225 ? 21.215  37.521 77.468 1.00 11.79  ? 228 THR B O    1  
ATOM   8452   C  CB   . THR B 1 225 ? 22.268  35.722 74.796 1.00 11.42  ? 228 THR B CB   1  
ATOM   8453   O  OG1  . THR B 1 225 ? 23.419  36.314 75.382 1.00 12.73  ? 228 THR B OG1  1  
ATOM   8454   C  CG2  . THR B 1 225 ? 22.306  35.916 73.280 1.00 12.39  ? 228 THR B CG2  1  
ATOM   8455   H  H    . THR B 1 225 ? 21.453  38.471 75.235 1.00 0.00   ? 228 THR B H    1  
ATOM   8456   H  HA   . THR B 1 225 ? 20.137  35.813 75.086 1.00 0.00   ? 228 THR B HA   1  
ATOM   8457   H  HB   . THR B 1 225 ? 22.253  34.666 75.019 1.00 0.00   ? 228 THR B HB   1  
ATOM   8458   H  HG1  . THR B 1 225 ? 23.139  36.800 76.161 1.00 0.00   ? 228 THR B HG1  1  
ATOM   8459   H  HG21 . THR B 1 225 ? 22.971  35.188 72.840 1.00 0.00   ? 228 THR B HG21 1  
ATOM   8460   H  HG22 . THR B 1 225 ? 22.661  36.911 73.053 1.00 0.00   ? 228 THR B HG22 1  
ATOM   8461   H  HG23 . THR B 1 225 ? 21.313  35.788 72.875 1.00 0.00   ? 228 THR B HG23 1  
ATOM   8462   N  N    . GLY B 1 226 ? 21.080  35.337 77.549 1.00 11.79  ? 229 GLY B N    1  
ATOM   8463   C  CA   . GLY B 1 226 ? 21.168  35.326 79.028 1.00 12.56  ? 229 GLY B CA   1  
ATOM   8464   C  C    . GLY B 1 226 ? 19.905  35.953 79.593 1.00 12.78  ? 229 GLY B C    1  
ATOM   8465   O  O    . GLY B 1 226 ? 18.810  35.692 79.138 1.00 12.87  ? 229 GLY B O    1  
ATOM   8466   H  H    . GLY B 1 226 ? 20.993  34.491 77.062 1.00 0.00   ? 229 GLY B H    1  
ATOM   8467   H  HA2  . GLY B 1 226 ? 21.259  34.307 79.378 1.00 0.00   ? 229 GLY B HA2  1  
ATOM   8468   H  HA3  . GLY B 1 226 ? 22.026  35.898 79.346 1.00 0.00   ? 229 GLY B HA3  1  
ATOM   8469   N  N    . ASP B 1 227 ? 20.048  36.790 80.569 1.00 13.40  ? 230 ASP B N    1  
ATOM   8470   C  CA   . ASP B 1 227 ? 18.850  37.454 81.157 1.00 13.96  ? 230 ASP B CA   1  
ATOM   8471   C  C    . ASP B 1 227 ? 18.196  38.373 80.111 1.00 13.45  ? 230 ASP B C    1  
ATOM   8472   O  O    . ASP B 1 227 ? 17.041  38.732 80.229 1.00 15.21  ? 230 ASP B O    1  
ATOM   8473   C  CB   . ASP B 1 227 ? 19.274  38.286 82.369 1.00 14.89  ? 230 ASP B CB   1  
ATOM   8474   C  CG   . ASP B 1 227 ? 20.394  39.246 81.964 1.00 17.44  ? 230 ASP B CG   1  
ATOM   8475   O  OD1  . ASP B 1 227 ? 20.704  39.300 80.786 1.00 17.34  ? 230 ASP B OD1  1  
ATOM   8476   O  OD2  . ASP B 1 227 ? 20.923  39.911 82.840 1.00 24.68  ? 230 ASP B OD2  1  
ATOM   8477   H  H    . ASP B 1 227 ? 20.942  36.995 80.913 1.00 0.00   ? 230 ASP B H    1  
ATOM   8478   H  HA   . ASP B 1 227 ? 18.140  36.703 81.468 1.00 0.00   ? 230 ASP B HA   1  
ATOM   8479   H  HB2  . ASP B 1 227 ? 18.427  38.851 82.732 1.00 0.00   ? 230 ASP B HB2  1  
ATOM   8480   H  HB3  . ASP B 1 227 ? 19.630  37.630 83.149 1.00 0.00   ? 230 ASP B HB3  1  
ATOM   8481   N  N    . LYS B 1 228 ? 18.921  38.761 79.090 1.00 13.12  ? 231 LYS B N    1  
ATOM   8482   C  CA   . LYS B 1 228 ? 18.329  39.657 78.050 1.00 12.64  ? 231 LYS B CA   1  
ATOM   8483   C  C    . LYS B 1 228 ? 17.720  38.846 76.886 1.00 11.46  ? 231 LYS B C    1  
ATOM   8484   O  O    . LYS B 1 228 ? 17.196  39.414 75.949 1.00 11.22  ? 231 LYS B O    1  
ATOM   8485   C  CB   . LYS B 1 228 ? 19.421  40.578 77.502 1.00 13.29  ? 231 LYS B CB   1  
ATOM   8486   C  CG   . LYS B 1 228 ? 20.062  41.353 78.655 1.00 16.45  ? 231 LYS B CG   1  
ATOM   8487   C  CD   . LYS B 1 228 ? 18.996  42.195 79.359 1.00 20.55  ? 231 LYS B CD   1  
ATOM   8488   C  CE   . LYS B 1 228 ? 19.575  42.777 80.650 1.00 24.29  ? 231 LYS B CE   1  
ATOM   8489   N  NZ   . LYS B 1 228 ? 20.720  43.673 80.321 1.00 27.61  ? 231 LYS B NZ   1  
ATOM   8490   H  H    . LYS B 1 228 ? 19.852  38.465 79.009 1.00 0.00   ? 231 LYS B H    1  
ATOM   8491   H  HA   . LYS B 1 228 ? 17.556  40.260 78.503 1.00 0.00   ? 231 LYS B HA   1  
ATOM   8492   H  HB2  . LYS B 1 228 ? 20.174  39.985 77.003 1.00 0.00   ? 231 LYS B HB2  1  
ATOM   8493   H  HB3  . LYS B 1 228 ? 18.986  41.274 76.800 1.00 0.00   ? 231 LYS B HB3  1  
ATOM   8494   H  HG2  . LYS B 1 228 ? 20.496  40.658 79.358 1.00 0.00   ? 231 LYS B HG2  1  
ATOM   8495   H  HG3  . LYS B 1 228 ? 20.832  42.003 78.267 1.00 0.00   ? 231 LYS B HG3  1  
ATOM   8496   H  HD2  . LYS B 1 228 ? 18.684  42.999 78.708 1.00 0.00   ? 231 LYS B HD2  1  
ATOM   8497   H  HD3  . LYS B 1 228 ? 18.145  41.574 79.597 1.00 0.00   ? 231 LYS B HD3  1  
ATOM   8498   H  HE2  . LYS B 1 228 ? 18.812  43.342 81.164 1.00 0.00   ? 231 LYS B HE2  1  
ATOM   8499   H  HE3  . LYS B 1 228 ? 19.917  41.973 81.285 1.00 0.00   ? 231 LYS B HE3  1  
ATOM   8500   H  HZ1  . LYS B 1 228 ? 20.634  43.999 79.338 1.00 0.00   ? 231 LYS B HZ1  1  
ATOM   8501   H  HZ2  . LYS B 1 228 ? 21.612  43.151 80.434 1.00 0.00   ? 231 LYS B HZ2  1  
ATOM   8502   H  HZ3  . LYS B 1 228 ? 20.712  44.493 80.962 1.00 0.00   ? 231 LYS B HZ3  1  
ATOM   8503   N  N    . ALA B 1 229 ? 17.776  37.535 76.922 1.00 10.68  ? 232 ALA B N    1  
ATOM   8504   C  CA   . ALA B 1 229 ? 17.189  36.742 75.798 1.00 10.60  ? 232 ALA B CA   1  
ATOM   8505   C  C    . ALA B 1 229 ? 15.679  37.011 75.702 1.00 10.58  ? 232 ALA B C    1  
ATOM   8506   O  O    . ALA B 1 229 ? 14.973  36.985 76.690 1.00 11.81  ? 232 ALA B O    1  
ATOM   8507   C  CB   . ALA B 1 229 ? 17.424  35.252 76.050 1.00 11.11  ? 232 ALA B CB   1  
ATOM   8508   H  H    . ALA B 1 229 ? 18.199  37.079 77.679 1.00 0.00   ? 232 ALA B H    1  
ATOM   8509   H  HA   . ALA B 1 229 ? 17.663  37.028 74.871 1.00 0.00   ? 232 ALA B HA   1  
ATOM   8510   H  HB1  . ALA B 1 229 ? 18.140  35.131 76.849 1.00 0.00   ? 232 ALA B HB1  1  
ATOM   8511   H  HB2  . ALA B 1 229 ? 17.806  34.790 75.152 1.00 0.00   ? 232 ALA B HB2  1  
ATOM   8512   H  HB3  . ALA B 1 229 ? 16.492  34.782 76.328 1.00 0.00   ? 232 ALA B HB3  1  
ATOM   8513   N  N    . MET B 1 230 ? 15.174  37.263 74.516 1.00 9.94   ? 233 MET B N    1  
ATOM   8514   C  CA   . MET B 1 230 ? 13.729  37.520 74.370 1.00 10.02  ? 233 MET B CA   1  
ATOM   8515   C  C    . MET B 1 230 ? 12.969  36.380 75.028 1.00 9.90   ? 233 MET B C    1  
ATOM   8516   O  O    . MET B 1 230 ? 13.544  35.411 75.484 1.00 10.49  ? 233 MET B O    1  
ATOM   8517   C  CB   . MET B 1 230 ? 13.366  37.591 72.885 1.00 10.76  ? 233 MET B CB   1  
ATOM   8518   C  CG   . MET B 1 230 ? 13.635  39.003 72.361 1.00 11.80  ? 233 MET B CG   1  
ATOM   8519   S  SD   . MET B 1 230 ? 15.033  38.964 71.212 1.00 12.35  ? 233 MET B SD   1  
ATOM   8520   C  CE   . MET B 1 230 ? 16.153  37.995 72.252 1.00 12.89  ? 233 MET B CE   1  
ATOM   8521   H  H    . MET B 1 230 ? 15.756  37.275 73.728 1.00 0.00   ? 233 MET B H    1  
ATOM   8522   H  HA   . MET B 1 230 ? 13.475  38.452 74.852 1.00 0.00   ? 233 MET B HA   1  
ATOM   8523   H  HB2  . MET B 1 230 ? 13.966  36.881 72.334 1.00 0.00   ? 233 MET B HB2  1  
ATOM   8524   H  HB3  . MET B 1 230 ? 12.320  37.355 72.758 1.00 0.00   ? 233 MET B HB3  1  
ATOM   8525   H  HG2  . MET B 1 230 ? 12.758  39.370 71.848 1.00 0.00   ? 233 MET B HG2  1  
ATOM   8526   H  HG3  . MET B 1 230 ? 13.867  39.656 73.189 1.00 0.00   ? 233 MET B HG3  1  
ATOM   8527   H  HE1  . MET B 1 230 ? 15.753  36.999 72.379 1.00 0.00   ? 233 MET B HE1  1  
ATOM   8528   H  HE2  . MET B 1 230 ? 16.254  38.475 73.215 1.00 0.00   ? 233 MET B HE2  1  
ATOM   8529   H  HE3  . MET B 1 230 ? 17.121  37.934 71.780 1.00 0.00   ? 233 MET B HE3  1  
ATOM   8530   N  N    . THR B 1 231 ? 11.686  36.490 75.082 1.00 9.91   ? 234 THR B N    1  
ATOM   8531   C  CA   . THR B 1 231 ? 10.864  35.421 75.712 1.00 9.82   ? 234 THR B CA   1  
ATOM   8532   C  C    . THR B 1 231 ? 9.538   35.253 74.953 1.00 10.15  ? 234 THR B C    1  
ATOM   8533   O  O    . THR B 1 231 ? 8.978   36.193 74.425 1.00 10.51  ? 234 THR B O    1  
ATOM   8534   C  CB   . THR B 1 231 ? 10.572  35.797 77.166 1.00 10.22  ? 234 THR B CB   1  
ATOM   8535   O  OG1  . THR B 1 231 ? 9.980   37.088 77.210 1.00 12.40  ? 234 THR B OG1  1  
ATOM   8536   C  CG2  . THR B 1 231 ? 11.876  35.803 77.965 1.00 11.66  ? 234 THR B CG2  1  
ATOM   8537   H  H    . THR B 1 231 ? 11.249  37.283 74.708 1.00 0.00   ? 234 THR B H    1  
ATOM   8538   H  HA   . THR B 1 231 ? 11.410  34.489 75.687 1.00 0.00   ? 234 THR B HA   1  
ATOM   8539   H  HB   . THR B 1 231 ? 9.895   35.075 77.596 1.00 0.00   ? 234 THR B HB   1  
ATOM   8540   H  HG1  . THR B 1 231 ? 10.686  37.735 77.275 1.00 0.00   ? 234 THR B HG1  1  
ATOM   8541   H  HG21 . THR B 1 231 ? 12.158  36.822 78.185 1.00 0.00   ? 234 THR B HG21 1  
ATOM   8542   H  HG22 . THR B 1 231 ? 12.655  35.330 77.387 1.00 0.00   ? 234 THR B HG22 1  
ATOM   8543   H  HG23 . THR B 1 231 ? 11.735  35.261 78.889 1.00 0.00   ? 234 THR B HG23 1  
ATOM   8544   N  N    . ALA B 1 232 ? 9.041   34.048 74.917 1.00 9.83   ? 235 ALA B N    1  
ATOM   8545   C  CA   . ALA B 1 232 ? 7.757   33.744 74.227 1.00 10.28  ? 235 ALA B CA   1  
ATOM   8546   C  C    . ALA B 1 232 ? 7.276   32.363 74.700 1.00 10.22  ? 235 ALA B C    1  
ATOM   8547   O  O    . ALA B 1 232 ? 8.059   31.549 75.147 1.00 10.11  ? 235 ALA B O    1  
ATOM   8548   C  CB   . ALA B 1 232 ? 7.977   33.723 72.713 1.00 10.73  ? 235 ALA B CB   1  
ATOM   8549   H  H    . ALA B 1 232 ? 9.524   33.321 75.364 1.00 0.00   ? 235 ALA B H    1  
ATOM   8550   H  HA   . ALA B 1 232 ? 7.020   34.493 74.481 1.00 0.00   ? 235 ALA B HA   1  
ATOM   8551   H  HB1  . ALA B 1 232 ? 8.907   33.221 72.491 1.00 0.00   ? 235 ALA B HB1  1  
ATOM   8552   H  HB2  . ALA B 1 232 ? 8.018   34.737 72.341 1.00 0.00   ? 235 ALA B HB2  1  
ATOM   8553   H  HB3  . ALA B 1 232 ? 7.162   33.198 72.237 1.00 0.00   ? 235 ALA B HB3  1  
ATOM   8554   N  N    . ALA B 1 233 ? 6.002   32.093 74.619 1.00 10.03  ? 236 ALA B N    1  
ATOM   8555   C  CA   . ALA B 1 233 ? 5.490   30.780 75.075 1.00 10.21  ? 236 ALA B CA   1  
ATOM   8556   C  C    . ALA B 1 233 ? 4.696   30.121 73.950 1.00 9.71   ? 236 ALA B C    1  
ATOM   8557   O  O    . ALA B 1 233 ? 4.184   30.772 73.061 1.00 10.07  ? 236 ALA B O    1  
ATOM   8558   C  CB   . ALA B 1 233 ? 4.581   30.981 76.289 1.00 10.42  ? 236 ALA B CB   1  
ATOM   8559   H  H    . ALA B 1 233 ? 5.382   32.764 74.264 1.00 0.00   ? 236 ALA B H    1  
ATOM   8560   H  HA   . ALA B 1 233 ? 6.319   30.146 75.349 1.00 0.00   ? 236 ALA B HA   1  
ATOM   8561   H  HB1  . ALA B 1 233 ? 5.000   31.743 76.930 1.00 0.00   ? 236 ALA B HB1  1  
ATOM   8562   H  HB2  . ALA B 1 233 ? 4.501   30.054 76.837 1.00 0.00   ? 236 ALA B HB2  1  
ATOM   8563   H  HB3  . ALA B 1 233 ? 3.600   31.289 75.958 1.00 0.00   ? 236 ALA B HB3  1  
ATOM   8564   N  N    . VAL B 1 234 ? 4.598   28.830 73.995 1.00 9.77   ? 237 VAL B N    1  
ATOM   8565   C  CA   . VAL B 1 234 ? 3.851   28.084 72.959 1.00 10.14  ? 237 VAL B CA   1  
ATOM   8566   C  C    . VAL B 1 234 ? 2.480   28.710 72.803 1.00 9.98   ? 237 VAL B C    1  
ATOM   8567   O  O    . VAL B 1 234 ? 1.782   28.964 73.764 1.00 10.78  ? 237 VAL B O    1  
ATOM   8568   C  CB   . VAL B 1 234 ? 3.704   26.622 73.384 1.00 10.59  ? 237 VAL B CB   1  
ATOM   8569   C  CG1  . VAL B 1 234 ? 2.726   25.913 72.445 1.00 11.30  ? 237 VAL B CG1  1  
ATOM   8570   C  CG2  . VAL B 1 234 ? 5.068   25.932 73.314 1.00 10.69  ? 237 VAL B CG2  1  
ATOM   8571   H  H    . VAL B 1 234 ? 5.024   28.340 74.729 1.00 0.00   ? 237 VAL B H    1  
ATOM   8572   H  HA   . VAL B 1 234 ? 4.383   28.136 72.020 1.00 0.00   ? 237 VAL B HA   1  
ATOM   8573   H  HB   . VAL B 1 234 ? 3.327   26.578 74.396 1.00 0.00   ? 237 VAL B HB   1  
ATOM   8574   H  HG11 . VAL B 1 234 ? 2.791   26.351 71.460 1.00 0.00   ? 237 VAL B HG11 1  
ATOM   8575   H  HG12 . VAL B 1 234 ? 1.721   26.022 72.823 1.00 0.00   ? 237 VAL B HG12 1  
ATOM   8576   H  HG13 . VAL B 1 234 ? 2.978   24.864 72.389 1.00 0.00   ? 237 VAL B HG13 1  
ATOM   8577   H  HG21 . VAL B 1 234 ? 5.790   26.503 73.878 1.00 0.00   ? 237 VAL B HG21 1  
ATOM   8578   H  HG22 . VAL B 1 234 ? 5.386   25.867 72.284 1.00 0.00   ? 237 VAL B HG22 1  
ATOM   8579   H  HG23 . VAL B 1 234 ? 4.991   24.938 73.730 1.00 0.00   ? 237 VAL B HG23 1  
ATOM   8580   N  N    . GLY B 1 235 ? 2.095   28.971 71.600 1.00 9.69   ? 238 GLY B N    1  
ATOM   8581   C  CA   . GLY B 1 235 ? 0.756   29.605 71.361 1.00 10.12  ? 238 GLY B CA   1  
ATOM   8582   C  C    . GLY B 1 235 ? 0.850   31.155 71.351 1.00 10.21  ? 238 GLY B C    1  
ATOM   8583   O  O    . GLY B 1 235 ? -0.141  31.833 71.165 1.00 10.71  ? 238 GLY B O    1  
ATOM   8584   H  H    . GLY B 1 235 ? 2.681   28.764 70.842 1.00 0.00   ? 238 GLY B H    1  
ATOM   8585   H  HA2  . GLY B 1 235 ? 0.371   29.269 70.409 1.00 0.00   ? 238 GLY B HA2  1  
ATOM   8586   H  HA3  . GLY B 1 235 ? 0.077   29.300 72.143 1.00 0.00   ? 238 GLY B HA3  1  
ATOM   8587   N  N    . GLU B 1 236 ? 2.019   31.719 71.548 1.00 9.94   ? 239 GLU B N    1  
ATOM   8588   C  CA   . GLU B 1 236 ? 2.158   33.195 71.548 1.00 9.79   ? 239 GLU B CA   1  
ATOM   8589   C  C    . GLU B 1 236 ? 2.525   33.670 70.143 1.00 9.04   ? 239 GLU B C    1  
ATOM   8590   O  O    . GLU B 1 236 ? 3.342   33.083 69.461 1.00 9.83   ? 239 GLU B O    1  
ATOM   8591   C  CB   . GLU B 1 236 ? 3.259   33.604 72.529 1.00 9.74   ? 239 GLU B CB   1  
ATOM   8592   C  CG   . GLU B 1 236 ? 3.162   35.105 72.807 1.00 10.54  ? 239 GLU B CG   1  
ATOM   8593   C  CD   . GLU B 1 236 ? 3.808   35.416 74.159 1.00 11.46  ? 239 GLU B CD   1  
ATOM   8594   O  OE1  . GLU B 1 236 ? 4.677   34.663 74.566 1.00 10.67  ? 239 GLU B OE1  1  
ATOM   8595   O  OE2  . GLU B 1 236 ? 3.422   36.403 74.764 1.00 13.88  ? 239 GLU B OE2  1  
ATOM   8596   H  H    . GLU B 1 236 ? 2.809   31.158 71.697 1.00 0.00   ? 239 GLU B H    1  
ATOM   8597   H  HA   . GLU B 1 236 ? 1.223   33.645 71.848 1.00 0.00   ? 239 GLU B HA   1  
ATOM   8598   H  HB2  . GLU B 1 236 ? 3.139   33.057 73.452 1.00 0.00   ? 239 GLU B HB2  1  
ATOM   8599   H  HB3  . GLU B 1 236 ? 4.224   33.381 72.100 1.00 0.00   ? 239 GLU B HB3  1  
ATOM   8600   H  HG2  . GLU B 1 236 ? 3.676   35.650 72.028 1.00 0.00   ? 239 GLU B HG2  1  
ATOM   8601   H  HG3  . GLU B 1 236 ? 2.124   35.401 72.830 1.00 0.00   ? 239 GLU B HG3  1  
ATOM   8602   N  N    . LYS B 1 237 ? 1.917   34.731 69.718 1.00 9.51   ? 240 LYS B N    1  
ATOM   8603   C  CA   . LYS B 1 237 ? 2.187   35.285 68.377 1.00 9.44   ? 240 LYS B CA   1  
ATOM   8604   C  C    . LYS B 1 237 ? 3.116   36.455 68.578 1.00 9.30   ? 240 LYS B C    1  
ATOM   8605   O  O    . LYS B 1 237 ? 2.851   37.343 69.364 1.00 9.88   ? 240 LYS B O    1  
ATOM   8606   C  CB   . LYS B 1 237 ? 0.881   35.756 67.735 1.00 9.59   ? 240 LYS B CB   1  
ATOM   8607   C  CG   . LYS B 1 237 ? -0.306  35.177 68.507 1.00 10.09  ? 240 LYS B CG   1  
ATOM   8608   C  CD   . LYS B 1 237 ? -1.598  35.442 67.733 1.00 11.62  ? 240 LYS B CD   1  
ATOM   8609   C  CE   . LYS B 1 237 ? -2.598  36.163 68.638 1.00 12.57  ? 240 LYS B CE   1  
ATOM   8610   N  NZ   . LYS B 1 237 ? -3.798  36.549 67.844 1.00 14.53  ? 240 LYS B NZ   1  
ATOM   8611   H  H    . LYS B 1 237 ? 1.264   35.175 70.298 1.00 0.00   ? 240 LYS B H    1  
ATOM   8612   H  HA   . LYS B 1 237 ? 2.661   34.538 67.756 1.00 0.00   ? 240 LYS B HA   1  
ATOM   8613   H  HB2  . LYS B 1 237 ? 0.837   36.835 67.761 1.00 0.00   ? 240 LYS B HB2  1  
ATOM   8614   H  HB3  . LYS B 1 237 ? 0.842   35.417 66.711 1.00 0.00   ? 240 LYS B HB3  1  
ATOM   8615   H  HG2  . LYS B 1 237 ? -0.170  34.112 68.630 1.00 0.00   ? 240 LYS B HG2  1  
ATOM   8616   H  HG3  . LYS B 1 237 ? -0.367  35.646 69.478 1.00 0.00   ? 240 LYS B HG3  1  
ATOM   8617   H  HD2  . LYS B 1 237 ? -1.381  36.058 66.872 1.00 0.00   ? 240 LYS B HD2  1  
ATOM   8618   H  HD3  . LYS B 1 237 ? -2.022  34.504 67.407 1.00 0.00   ? 240 LYS B HD3  1  
ATOM   8619   H  HE2  . LYS B 1 237 ? -2.894  35.506 69.443 1.00 0.00   ? 240 LYS B HE2  1  
ATOM   8620   H  HE3  . LYS B 1 237 ? -2.137  37.050 69.048 1.00 0.00   ? 240 LYS B HE3  1  
ATOM   8621   H  HZ1  . LYS B 1 237 ? -4.040  35.782 67.186 1.00 0.00   ? 240 LYS B HZ1  1  
ATOM   8622   H  HZ2  . LYS B 1 237 ? -3.595  37.414 67.305 1.00 0.00   ? 240 LYS B HZ2  1  
ATOM   8623   H  HZ3  . LYS B 1 237 ? -4.598  36.720 68.488 1.00 0.00   ? 240 LYS B HZ3  1  
ATOM   8624   N  N    . VAL B 1 238 ? 4.223   36.446 67.931 1.00 9.26   ? 241 VAL B N    1  
ATOM   8625   C  CA   . VAL B 1 238 ? 5.187   37.548 68.156 1.00 9.18   ? 241 VAL B CA   1  
ATOM   8626   C  C    . VAL B 1 238 ? 5.671   38.127 66.839 1.00 8.46   ? 241 VAL B C    1  
ATOM   8627   O  O    . VAL B 1 238 ? 6.082   37.424 65.937 1.00 9.25   ? 241 VAL B O    1  
ATOM   8628   C  CB   . VAL B 1 238 ? 6.386   37.015 68.942 1.00 9.76   ? 241 VAL B CB   1  
ATOM   8629   C  CG1  . VAL B 1 238 ? 7.421   38.128 69.112 1.00 10.15  ? 241 VAL B CG1  1  
ATOM   8630   C  CG2  . VAL B 1 238 ? 5.920   36.539 70.320 1.00 10.01  ? 241 VAL B CG2  1  
ATOM   8631   H  H    . VAL B 1 238 ? 4.445   35.702 67.333 1.00 0.00   ? 241 VAL B H    1  
ATOM   8632   H  HA   . VAL B 1 238 ? 4.709   38.325 68.731 1.00 0.00   ? 241 VAL B HA   1  
ATOM   8633   H  HB   . VAL B 1 238 ? 6.830   36.189 68.405 1.00 0.00   ? 241 VAL B HB   1  
ATOM   8634   H  HG11 . VAL B 1 238 ? 8.337   37.846 68.614 1.00 0.00   ? 241 VAL B HG11 1  
ATOM   8635   H  HG12 . VAL B 1 238 ? 7.616   38.281 70.163 1.00 0.00   ? 241 VAL B HG12 1  
ATOM   8636   H  HG13 . VAL B 1 238 ? 7.042   39.041 68.679 1.00 0.00   ? 241 VAL B HG13 1  
ATOM   8637   H  HG21 . VAL B 1 238 ? 6.304   37.204 71.079 1.00 0.00   ? 241 VAL B HG21 1  
ATOM   8638   H  HG22 . VAL B 1 238 ? 6.286   35.539 70.498 1.00 0.00   ? 241 VAL B HG22 1  
ATOM   8639   H  HG23 . VAL B 1 238 ? 4.840   36.539 70.354 1.00 0.00   ? 241 VAL B HG23 1  
ATOM   8640   N  N    . LEU B 1 239 ? 5.647   39.417 66.749 1.00 8.72   ? 242 LEU B N    1  
ATOM   8641   C  CA   . LEU B 1 239 ? 6.128   40.104 65.520 1.00 8.45   ? 242 LEU B CA   1  
ATOM   8642   C  C    . LEU B 1 239 ? 7.538   40.636 65.790 1.00 8.54   ? 242 LEU B C    1  
ATOM   8643   O  O    . LEU B 1 239 ? 7.761   41.393 66.714 1.00 8.85   ? 242 LEU B O    1  
ATOM   8644   C  CB   . LEU B 1 239 ? 5.194   41.268 65.181 1.00 9.20   ? 242 LEU B CB   1  
ATOM   8645   C  CG   . LEU B 1 239 ? 5.703   41.982 63.928 1.00 9.22   ? 242 LEU B CG   1  
ATOM   8646   C  CD1  . LEU B 1 239 ? 5.111   41.318 62.684 1.00 10.67  ? 242 LEU B CD1  1  
ATOM   8647   C  CD2  . LEU B 1 239 ? 5.276   43.451 63.971 1.00 11.23  ? 242 LEU B CD2  1  
ATOM   8648   H  H    . LEU B 1 239 ? 5.328   39.949 67.508 1.00 0.00   ? 242 LEU B H    1  
ATOM   8649   H  HA   . LEU B 1 239 ? 6.154   39.403 64.698 1.00 0.00   ? 242 LEU B HA   1  
ATOM   8650   H  HB2  . LEU B 1 239 ? 4.198   40.889 65.001 1.00 0.00   ? 242 LEU B HB2  1  
ATOM   8651   H  HB3  . LEU B 1 239 ? 5.172   41.964 66.006 1.00 0.00   ? 242 LEU B HB3  1  
ATOM   8652   H  HG   . LEU B 1 239 ? 6.781   41.919 63.891 1.00 0.00   ? 242 LEU B HG   1  
ATOM   8653   H  HD11 . LEU B 1 239 ? 5.808   40.588 62.299 1.00 0.00   ? 242 LEU B HD11 1  
ATOM   8654   H  HD12 . LEU B 1 239 ? 4.922   42.068 61.931 1.00 0.00   ? 242 LEU B HD12 1  
ATOM   8655   H  HD13 . LEU B 1 239 ? 4.184   40.828 62.945 1.00 0.00   ? 242 LEU B HD13 1  
ATOM   8656   H  HD21 . LEU B 1 239 ? 5.081   43.799 62.968 1.00 0.00   ? 242 LEU B HD21 1  
ATOM   8657   H  HD22 . LEU B 1 239 ? 6.066   44.043 64.410 1.00 0.00   ? 242 LEU B HD22 1  
ATOM   8658   H  HD23 . LEU B 1 239 ? 4.381   43.549 64.567 1.00 0.00   ? 242 LEU B HD23 1  
ATOM   8659   N  N    . ILE B 1 240 ? 8.493   40.225 65.008 1.00 8.44   ? 243 ILE B N    1  
ATOM   8660   C  CA   . ILE B 1 240 ? 9.894   40.676 65.226 1.00 8.76   ? 243 ILE B CA   1  
ATOM   8661   C  C    . ILE B 1 240 ? 10.337  41.597 64.089 1.00 8.12   ? 243 ILE B C    1  
ATOM   8662   O  O    . ILE B 1 240 ? 10.622  41.165 62.990 1.00 8.71   ? 243 ILE B O    1  
ATOM   8663   C  CB   . ILE B 1 240 ? 10.816  39.457 65.278 1.00 9.12   ? 243 ILE B CB   1  
ATOM   8664   C  CG1  . ILE B 1 240 ? 10.339  38.506 66.379 1.00 9.96   ? 243 ILE B CG1  1  
ATOM   8665   C  CG2  . ILE B 1 240 ? 12.245  39.910 65.581 1.00 9.58   ? 243 ILE B CG2  1  
ATOM   8666   C  CD1  . ILE B 1 240 ? 10.941  37.118 66.150 1.00 12.43  ? 243 ILE B CD1  1  
ATOM   8667   H  H    . ILE B 1 240 ? 8.291   39.600 64.281 1.00 0.00   ? 243 ILE B H    1  
ATOM   8668   H  HA   . ILE B 1 240 ? 9.955   41.210 66.162 1.00 0.00   ? 243 ILE B HA   1  
ATOM   8669   H  HB   . ILE B 1 240 ? 10.794  38.948 64.325 1.00 0.00   ? 243 ILE B HB   1  
ATOM   8670   H  HG12 . ILE B 1 240 ? 10.655  38.883 67.341 1.00 0.00   ? 243 ILE B HG12 1  
ATOM   8671   H  HG13 . ILE B 1 240 ? 9.262   38.437 66.354 1.00 0.00   ? 243 ILE B HG13 1  
ATOM   8672   H  HG21 . ILE B 1 240 ? 12.796  39.093 66.022 1.00 0.00   ? 243 ILE B HG21 1  
ATOM   8673   H  HG22 . ILE B 1 240 ? 12.221  40.741 66.271 1.00 0.00   ? 243 ILE B HG22 1  
ATOM   8674   H  HG23 . ILE B 1 240 ? 12.727  40.217 64.665 1.00 0.00   ? 243 ILE B HG23 1  
ATOM   8675   H  HD11 . ILE B 1 240 ? 11.739  36.951 66.859 1.00 0.00   ? 243 ILE B HD11 1  
ATOM   8676   H  HD12 . ILE B 1 240 ? 11.333  37.057 65.146 1.00 0.00   ? 243 ILE B HD12 1  
ATOM   8677   H  HD13 . ILE B 1 240 ? 10.177  36.368 66.285 1.00 0.00   ? 243 ILE B HD13 1  
ATOM   8678   N  N    . VAL B 1 241 ? 10.410  42.863 64.366 1.00 8.25   ? 244 VAL B N    1  
ATOM   8679   C  CA   . VAL B 1 241 ? 10.846  43.843 63.355 1.00 8.04   ? 244 VAL B CA   1  
ATOM   8680   C  C    . VAL B 1 241 ? 12.360  43.863 63.374 1.00 7.82   ? 244 VAL B C    1  
ATOM   8681   O  O    . VAL B 1 241 ? 12.984  43.805 64.416 1.00 9.66   ? 244 VAL B O    1  
ATOM   8682   C  CB   . VAL B 1 241 ? 10.302  45.230 63.706 1.00 9.00   ? 244 VAL B CB   1  
ATOM   8683   C  CG1  . VAL B 1 241 ? 10.813  46.252 62.690 1.00 9.59   ? 244 VAL B CG1  1  
ATOM   8684   C  CG2  . VAL B 1 241 ? 8.773   45.200 63.673 1.00 10.37  ? 244 VAL B CG2  1  
ATOM   8685   H  H    . VAL B 1 241 ? 10.185  43.171 65.269 1.00 0.00   ? 244 VAL B H    1  
ATOM   8686   H  HA   . VAL B 1 241 ? 10.494  43.545 62.378 1.00 0.00   ? 244 VAL B HA   1  
ATOM   8687   H  HB   . VAL B 1 241 ? 10.638  45.507 64.695 1.00 0.00   ? 244 VAL B HB   1  
ATOM   8688   H  HG11 . VAL B 1 241 ? 11.887  46.170 62.606 1.00 0.00   ? 244 VAL B HG11 1  
ATOM   8689   H  HG12 . VAL B 1 241 ? 10.553  47.247 63.017 1.00 0.00   ? 244 VAL B HG12 1  
ATOM   8690   H  HG13 . VAL B 1 241 ? 10.361  46.059 61.728 1.00 0.00   ? 244 VAL B HG13 1  
ATOM   8691   H  HG21 . VAL B 1 241 ? 8.383   45.973 64.319 1.00 0.00   ? 244 VAL B HG21 1  
ATOM   8692   H  HG22 . VAL B 1 241 ? 8.424   44.236 64.014 1.00 0.00   ? 244 VAL B HG22 1  
ATOM   8693   H  HG23 . VAL B 1 241 ? 8.431   45.370 62.663 1.00 0.00   ? 244 VAL B HG23 1  
ATOM   8694   N  N    . HIS B 1 242 ? 12.955  43.910 62.238 1.00 7.72   ? 245 HIS B N    1  
ATOM   8695   C  CA   . HIS B 1 242 ? 14.429  43.893 62.176 1.00 7.43   ? 245 HIS B CA   1  
ATOM   8696   C  C    . HIS B 1 242 ? 14.872  44.917 61.159 1.00 7.61   ? 245 HIS B C    1  
ATOM   8697   O  O    . HIS B 1 242 ? 14.292  45.058 60.101 1.00 8.55   ? 245 HIS B O    1  
ATOM   8698   C  CB   . HIS B 1 242 ? 14.911  42.504 61.753 1.00 7.55   ? 245 HIS B CB   1  
ATOM   8699   C  CG   . HIS B 1 242 ? 16.404  42.420 61.917 1.00 7.59   ? 245 HIS B CG   1  
ATOM   8700   N  ND1  . HIS B 1 242 ? 17.014  41.392 62.623 1.00 8.09   ? 245 HIS B ND1  1  
ATOM   8701   C  CD2  . HIS B 1 242 ? 17.423  43.227 61.472 1.00 9.10   ? 245 HIS B CD2  1  
ATOM   8702   C  CE1  . HIS B 1 242 ? 18.343  41.606 62.583 1.00 8.54   ? 245 HIS B CE1  1  
ATOM   8703   N  NE2  . HIS B 1 242 ? 18.642  42.709 61.895 1.00 8.28   ? 245 HIS B NE2  1  
ATOM   8704   H  H    . HIS B 1 242 ? 12.430  43.931 61.411 1.00 0.00   ? 245 HIS B H    1  
ATOM   8705   H  HA   . HIS B 1 242 ? 14.837  44.140 63.144 1.00 0.00   ? 245 HIS B HA   1  
ATOM   8706   H  HB2  . HIS B 1 242 ? 14.438  41.755 62.371 1.00 0.00   ? 245 HIS B HB2  1  
ATOM   8707   H  HB3  . HIS B 1 242 ? 14.653  42.333 60.718 1.00 0.00   ? 245 HIS B HB3  1  
ATOM   8708   H  HD1  . HIS B 1 242 ? 16.561  40.647 63.069 1.00 0.00   ? 245 HIS B HD1  1  
ATOM   8709   H  HD2  . HIS B 1 242 ? 17.296  44.125 60.886 1.00 0.00   ? 245 HIS B HD2  1  
ATOM   8710   H  HE1  . HIS B 1 242 ? 19.075  40.964 63.050 1.00 0.00   ? 245 HIS B HE1  1  
ATOM   8711   H  HE2  . HIS B 1 242 ? 19.533  43.078 61.724 1.00 0.00   ? 245 HIS B HE2  1  
ATOM   8712   N  N    . SER B 1 243 ? 15.883  45.645 61.475 1.00 7.52   ? 246 SER B N    1  
ATOM   8713   C  CA   . SER B 1 243 ? 16.361  46.690 60.527 1.00 7.35   ? 246 SER B CA   1  
ATOM   8714   C  C    . SER B 1 243 ? 17.892  46.660 60.367 1.00 7.30   ? 246 SER B C    1  
ATOM   8715   O  O    . SER B 1 243 ? 18.634  46.314 61.265 1.00 7.71   ? 246 SER B O    1  
ATOM   8716   C  CB   . SER B 1 243 ? 15.941  48.065 61.046 1.00 8.13   ? 246 SER B CB   1  
ATOM   8717   O  OG   . SER B 1 243 ? 16.537  48.289 62.317 1.00 8.89   ? 246 SER B OG   1  
ATOM   8718   H  H    . SER B 1 243 ? 16.328  45.523 62.340 1.00 0.00   ? 246 SER B H    1  
ATOM   8719   H  HA   . SER B 1 243 ? 15.904  46.526 59.563 1.00 0.00   ? 246 SER B HA   1  
ATOM   8720   H  HB2  . SER B 1 243 ? 16.271  48.827 60.360 1.00 0.00   ? 246 SER B HB2  1  
ATOM   8721   H  HB3  . SER B 1 243 ? 14.863  48.102 61.131 1.00 0.00   ? 246 SER B HB3  1  
ATOM   8722   H  HG   . SER B 1 243 ? 15.872  48.674 62.893 1.00 0.00   ? 246 SER B HG   1  
ATOM   8723   N  N    . GLN B 1 244 ? 18.339  47.060 59.208 1.00 7.67   ? 247 GLN B N    1  
ATOM   8724   C  CA   . GLN B 1 244 ? 19.789  47.133 58.872 1.00 7.16   ? 247 GLN B CA   1  
ATOM   8725   C  C    . GLN B 1 244 ? 19.963  48.372 57.982 1.00 7.50   ? 247 GLN B C    1  
ATOM   8726   O  O    . GLN B 1 244 ? 19.575  48.384 56.831 1.00 8.16   ? 247 GLN B O    1  
ATOM   8727   C  CB   . GLN B 1 244 ? 20.214  45.876 58.109 1.00 7.83   ? 247 GLN B CB   1  
ATOM   8728   C  CG   . GLN B 1 244 ? 21.423  45.242 58.800 1.00 8.02   ? 247 GLN B CG   1  
ATOM   8729   C  CD   . GLN B 1 244 ? 22.561  46.261 58.875 1.00 7.50   ? 247 GLN B CD   1  
ATOM   8730   O  OE1  . GLN B 1 244 ? 22.334  47.451 58.776 1.00 8.24   ? 247 GLN B OE1  1  
ATOM   8731   N  NE2  . GLN B 1 244 ? 23.785  45.843 59.046 1.00 7.89   ? 247 GLN B NE2  1  
ATOM   8732   H  H    . GLN B 1 244 ? 17.690  47.346 58.532 1.00 0.00   ? 247 GLN B H    1  
ATOM   8733   H  HA   . GLN B 1 244 ? 20.374  47.240 59.776 1.00 0.00   ? 247 GLN B HA   1  
ATOM   8734   H  HB2  . GLN B 1 244 ? 19.395  45.170 58.094 1.00 0.00   ? 247 GLN B HB2  1  
ATOM   8735   H  HB3  . GLN B 1 244 ? 20.478  46.141 57.097 1.00 0.00   ? 247 GLN B HB3  1  
ATOM   8736   H  HG2  . GLN B 1 244 ? 21.146  44.935 59.798 1.00 0.00   ? 247 GLN B HG2  1  
ATOM   8737   H  HG3  . GLN B 1 244 ? 21.750  44.381 58.236 1.00 0.00   ? 247 GLN B HG3  1  
ATOM   8738   H  HE21 . GLN B 1 244 ? 23.968  44.884 59.126 1.00 0.00   ? 247 GLN B HE21 1  
ATOM   8739   H  HE22 . GLN B 1 244 ? 24.521  46.488 59.095 1.00 0.00   ? 247 GLN B HE22 1  
ATOM   8740   N  N    . ALA B 1 245 ? 20.478  49.430 58.535 1.00 7.55   ? 248 ALA B N    1  
ATOM   8741   C  CA   . ALA B 1 245 ? 20.615  50.713 57.774 1.00 7.60   ? 248 ALA B CA   1  
ATOM   8742   C  C    . ALA B 1 245 ? 22.043  50.883 57.292 1.00 8.11   ? 248 ALA B C    1  
ATOM   8743   O  O    . ALA B 1 245 ? 22.648  51.929 57.413 1.00 8.54   ? 248 ALA B O    1  
ATOM   8744   C  CB   . ALA B 1 245 ? 20.244  51.885 58.685 1.00 8.74   ? 248 ALA B CB   1  
ATOM   8745   H  H    . ALA B 1 245 ? 20.733  49.403 59.481 1.00 0.00   ? 248 ALA B H    1  
ATOM   8746   H  HA   . ALA B 1 245 ? 19.950  50.698 56.924 1.00 0.00   ? 248 ALA B HA   1  
ATOM   8747   H  HB1  . ALA B 1 245 ? 19.684  52.616 58.121 1.00 0.00   ? 248 ALA B HB1  1  
ATOM   8748   H  HB2  . ALA B 1 245 ? 21.145  52.341 59.070 1.00 0.00   ? 248 ALA B HB2  1  
ATOM   8749   H  HB3  . ALA B 1 245 ? 19.643  51.526 59.507 1.00 0.00   ? 248 ALA B HB3  1  
ATOM   8750   N  N    . ASN B 1 246 ? 22.564  49.852 56.739 1.00 8.35   ? 249 ASN B N    1  
ATOM   8751   C  CA   . ASN B 1 246 ? 23.954  49.872 56.206 1.00 8.43   ? 249 ASN B CA   1  
ATOM   8752   C  C    . ASN B 1 246 ? 24.452  48.438 55.874 1.00 8.65   ? 249 ASN B C    1  
ATOM   8753   O  O    . ASN B 1 246 ? 25.635  48.175 55.958 1.00 9.34   ? 249 ASN B O    1  
ATOM   8754   C  CB   . ASN B 1 246 ? 24.882  50.496 57.250 1.00 8.58   ? 249 ASN B CB   1  
ATOM   8755   C  CG   . ASN B 1 246 ? 26.200  50.899 56.585 1.00 8.94   ? 249 ASN B CG   1  
ATOM   8756   O  OD1  . ASN B 1 246 ? 26.269  51.904 55.907 1.00 9.26   ? 249 ASN B OD1  1  
ATOM   8757   N  ND2  . ASN B 1 246 ? 27.256  50.151 56.754 1.00 9.83   ? 249 ASN B ND2  1  
ATOM   8758   H  H    . ASN B 1 246 ? 22.032  49.033 56.657 1.00 0.00   ? 249 ASN B H    1  
ATOM   8759   H  HA   . ASN B 1 246 ? 23.979  50.471 55.309 1.00 0.00   ? 249 ASN B HA   1  
ATOM   8760   H  HB2  . ASN B 1 246 ? 24.409  51.371 57.674 1.00 0.00   ? 249 ASN B HB2  1  
ATOM   8761   H  HB3  . ASN B 1 246 ? 25.080  49.778 58.031 1.00 0.00   ? 249 ASN B HB3  1  
ATOM   8762   H  HD21 . ASN B 1 246 ? 27.200  49.340 57.301 1.00 0.00   ? 249 ASN B HD21 1  
ATOM   8763   H  HD22 . ASN B 1 246 ? 28.105  50.400 56.332 1.00 0.00   ? 249 ASN B HD22 1  
ATOM   8764   N  N    . ARG B 1 247 ? 23.594  47.503 55.481 1.00 8.31   ? 250 ARG B N    1  
ATOM   8765   C  CA   . ARG B 1 247 ? 24.120  46.146 55.151 1.00 8.49   ? 250 ARG B CA   1  
ATOM   8766   C  C    . ARG B 1 247 ? 22.969  45.166 54.963 1.00 8.32   ? 250 ARG B C    1  
ATOM   8767   O  O    . ARG B 1 247 ? 21.993  45.198 55.685 1.00 8.43   ? 250 ARG B O    1  
ATOM   8768   C  CB   . ARG B 1 247 ? 25.018  45.660 56.291 1.00 9.87   ? 250 ARG B CB   1  
ATOM   8769   C  CG   . ARG B 1 247 ? 25.499  44.238 55.991 1.00 10.83  ? 250 ARG B CG   1  
ATOM   8770   C  CD   . ARG B 1 247 ? 26.887  44.293 55.351 1.00 10.52  ? 250 ARG B CD   1  
ATOM   8771   N  NE   . ARG B 1 247 ? 27.791  43.332 56.042 1.00 9.49   ? 250 ARG B NE   1  
ATOM   8772   C  CZ   . ARG B 1 247 ? 27.646  42.049 55.855 1.00 9.28   ? 250 ARG B CZ   1  
ATOM   8773   N  NH1  . ARG B 1 247 ? 26.708  41.608 55.061 1.00 10.48  ? 250 ARG B NH1  1  
ATOM   8774   N  NH2  . ARG B 1 247 ? 28.438  41.206 56.460 1.00 9.82   ? 250 ARG B NH2  1  
ATOM   8775   H  H    . ARG B 1 247 ? 22.639  47.704 55.395 1.00 0.00   ? 250 ARG B H    1  
ATOM   8776   H  HA   . ARG B 1 247 ? 24.698  46.198 54.241 1.00 0.00   ? 250 ARG B HA   1  
ATOM   8777   H  HB2  . ARG B 1 247 ? 25.870  46.317 56.383 1.00 0.00   ? 250 ARG B HB2  1  
ATOM   8778   H  HB3  . ARG B 1 247 ? 24.460  45.661 57.215 1.00 0.00   ? 250 ARG B HB3  1  
ATOM   8779   H  HG2  . ARG B 1 247 ? 25.548  43.674 56.911 1.00 0.00   ? 250 ARG B HG2  1  
ATOM   8780   H  HG3  . ARG B 1 247 ? 24.810  43.761 55.312 1.00 0.00   ? 250 ARG B HG3  1  
ATOM   8781   H  HD2  . ARG B 1 247 ? 26.812  44.030 54.306 1.00 0.00   ? 250 ARG B HD2  1  
ATOM   8782   H  HD3  . ARG B 1 247 ? 27.286  45.293 55.442 1.00 0.00   ? 250 ARG B HD3  1  
ATOM   8783   H  HE   . ARG B 1 247 ? 28.496  43.663 56.638 1.00 0.00   ? 250 ARG B HE   1  
ATOM   8784   H  HH11 . ARG B 1 247 ? 26.101  42.253 54.598 1.00 0.00   ? 250 ARG B HH11 1  
ATOM   8785   H  HH12 . ARG B 1 247 ? 26.596  40.624 54.918 1.00 0.00   ? 250 ARG B HH12 1  
ATOM   8786   H  HH21 . ARG B 1 247 ? 29.156  41.544 57.068 1.00 0.00   ? 250 ARG B HH21 1  
ATOM   8787   H  HH22 . ARG B 1 247 ? 28.326  40.223 56.316 1.00 0.00   ? 250 ARG B HH22 1  
ATOM   8788   N  N    . ASP B 1 248 ? 23.071  44.283 54.004 1.00 7.71   ? 251 ASP B N    1  
ATOM   8789   C  CA   . ASP B 1 248 ? 21.950  43.295 53.806 1.00 7.98   ? 251 ASP B CA   1  
ATOM   8790   C  C    . ASP B 1 248 ? 22.073  42.097 54.787 1.00 8.07   ? 251 ASP B C    1  
ATOM   8791   O  O    . ASP B 1 248 ? 23.132  41.523 54.943 1.00 8.00   ? 251 ASP B O    1  
ATOM   8792   C  CB   . ASP B 1 248 ? 21.993  42.772 52.368 1.00 8.24   ? 251 ASP B CB   1  
ATOM   8793   C  CG   . ASP B 1 248 ? 22.084  43.951 51.398 1.00 8.66   ? 251 ASP B CG   1  
ATOM   8794   O  OD1  . ASP B 1 248 ? 21.462  44.965 51.669 1.00 9.48   ? 251 ASP B OD1  1  
ATOM   8795   O  OD2  . ASP B 1 248 ? 22.774  43.819 50.401 1.00 9.46   ? 251 ASP B OD2  1  
ATOM   8796   H  H    . ASP B 1 248 ? 23.865  44.259 53.430 1.00 0.00   ? 251 ASP B H    1  
ATOM   8797   H  HA   . ASP B 1 248 ? 21.007  43.793 53.972 1.00 0.00   ? 251 ASP B HA   1  
ATOM   8798   H  HB2  . ASP B 1 248 ? 22.856  42.133 52.243 1.00 0.00   ? 251 ASP B HB2  1  
ATOM   8799   H  HB3  . ASP B 1 248 ? 21.095  42.208 52.164 1.00 0.00   ? 251 ASP B HB3  1  
ATOM   8800   N  N    . THR B 1 249 ? 20.979  41.699 55.426 1.00 8.03   ? 252 THR B N    1  
ATOM   8801   C  CA   . THR B 1 249 ? 21.017  40.549 56.345 1.00 7.55   ? 252 THR B CA   1  
ATOM   8802   C  C    . THR B 1 249 ? 19.985  39.530 55.868 1.00 7.64   ? 252 THR B C    1  
ATOM   8803   O  O    . THR B 1 249 ? 19.272  39.747 54.909 1.00 8.40   ? 252 THR B O    1  
ATOM   8804   C  CB   . THR B 1 249 ? 20.673  41.009 57.764 1.00 7.80   ? 252 THR B CB   1  
ATOM   8805   O  OG1  . THR B 1 249 ? 20.560  39.875 58.613 1.00 8.56   ? 252 THR B OG1  1  
ATOM   8806   C  CG2  . THR B 1 249 ? 19.347  41.771 57.748 1.00 9.10   ? 252 THR B CG2  1  
ATOM   8807   H  H    . THR B 1 249 ? 20.131  42.163 55.268 1.00 0.00   ? 252 THR B H    1  
ATOM   8808   H  HA   . THR B 1 249 ? 22.002  40.105 56.333 1.00 0.00   ? 252 THR B HA   1  
ATOM   8809   H  HB   . THR B 1 249 ? 21.452  41.659 58.131 1.00 0.00   ? 252 THR B HB   1  
ATOM   8810   H  HG1  . THR B 1 249 ? 19.850  39.323 58.277 1.00 0.00   ? 252 THR B HG1  1  
ATOM   8811   H  HG21 . THR B 1 249 ? 19.135  42.103 56.742 1.00 0.00   ? 252 THR B HG21 1  
ATOM   8812   H  HG22 . THR B 1 249 ? 19.416  42.628 58.402 1.00 0.00   ? 252 THR B HG22 1  
ATOM   8813   H  HG23 . THR B 1 249 ? 18.554  41.121 58.087 1.00 0.00   ? 252 THR B HG23 1  
ATOM   8814   N  N    . ARG B 1 250 ? 19.909  38.429 56.532 1.00 7.68   ? 253 ARG B N    1  
ATOM   8815   C  CA   . ARG B 1 250 ? 18.936  37.362 56.153 1.00 7.32   ? 253 ARG B CA   1  
ATOM   8816   C  C    . ARG B 1 250 ? 18.499  36.641 57.430 1.00 7.06   ? 253 ARG B C    1  
ATOM   8817   O  O    . ARG B 1 250 ? 19.060  35.636 57.818 1.00 7.60   ? 253 ARG B O    1  
ATOM   8818   C  CB   . ARG B 1 250 ? 19.607  36.367 55.203 1.00 7.85   ? 253 ARG B CB   1  
ATOM   8819   C  CG   . ARG B 1 250 ? 20.924  35.885 55.814 1.00 7.75   ? 253 ARG B CG   1  
ATOM   8820   C  CD   . ARG B 1 250 ? 22.058  36.085 54.806 1.00 8.59   ? 253 ARG B CD   1  
ATOM   8821   N  NE   . ARG B 1 250 ? 22.225  37.539 54.529 1.00 8.31   ? 253 ARG B NE   1  
ATOM   8822   C  CZ   . ARG B 1 250 ? 23.420  38.063 54.493 1.00 8.19   ? 253 ARG B CZ   1  
ATOM   8823   N  NH1  . ARG B 1 250 ? 24.468  37.313 54.699 1.00 9.06   ? 253 ARG B NH1  1  
ATOM   8824   N  NH2  . ARG B 1 250 ? 23.567  39.337 54.250 1.00 9.24   ? 253 ARG B NH2  1  
ATOM   8825   H  H    . ARG B 1 250 ? 20.501  38.289 57.300 1.00 0.00   ? 253 ARG B H    1  
ATOM   8826   H  HA   . ARG B 1 250 ? 18.077  37.806 55.672 1.00 0.00   ? 253 ARG B HA   1  
ATOM   8827   H  HB2  . ARG B 1 250 ? 18.951  35.522 55.046 1.00 0.00   ? 253 ARG B HB2  1  
ATOM   8828   H  HB3  . ARG B 1 250 ? 19.806  36.849 54.258 1.00 0.00   ? 253 ARG B HB3  1  
ATOM   8829   H  HG2  . ARG B 1 250 ? 21.133  36.452 56.710 1.00 0.00   ? 253 ARG B HG2  1  
ATOM   8830   H  HG3  . ARG B 1 250 ? 20.845  34.837 56.060 1.00 0.00   ? 253 ARG B HG3  1  
ATOM   8831   H  HD2  . ARG B 1 250 ? 22.976  35.688 55.214 1.00 0.00   ? 253 ARG B HD2  1  
ATOM   8832   H  HD3  . ARG B 1 250 ? 21.819  35.569 53.888 1.00 0.00   ? 253 ARG B HD3  1  
ATOM   8833   H  HE   . ARG B 1 250 ? 21.438  38.103 54.375 1.00 0.00   ? 253 ARG B HE   1  
ATOM   8834   H  HH11 . ARG B 1 250 ? 24.355  36.337 54.885 1.00 0.00   ? 253 ARG B HH11 1  
ATOM   8835   H  HH12 . ARG B 1 250 ? 25.383  37.715 54.671 1.00 0.00   ? 253 ARG B HH12 1  
ATOM   8836   H  HH21 . ARG B 1 250 ? 22.764  39.912 54.092 1.00 0.00   ? 253 ARG B HH21 1  
ATOM   8837   H  HH22 . ARG B 1 250 ? 24.482  39.739 54.222 1.00 0.00   ? 253 ARG B HH22 1  
ATOM   8838   N  N    . PRO B 1 251 ? 17.522  37.191 58.087 1.00 7.13   ? 254 PRO B N    1  
ATOM   8839   C  CA   . PRO B 1 251 ? 16.985  36.660 59.373 1.00 7.76   ? 254 PRO B CA   1  
ATOM   8840   C  C    . PRO B 1 251 ? 16.530  35.205 59.299 1.00 7.96   ? 254 PRO B C    1  
ATOM   8841   O  O    . PRO B 1 251 ? 16.058  34.730 58.285 1.00 8.15   ? 254 PRO B O    1  
ATOM   8842   C  CB   . PRO B 1 251 ? 15.789  37.566 59.684 1.00 8.50   ? 254 PRO B CB   1  
ATOM   8843   C  CG   . PRO B 1 251 ? 16.011  38.812 58.895 1.00 8.12   ? 254 PRO B CG   1  
ATOM   8844   C  CD   . PRO B 1 251 ? 16.812  38.406 57.662 1.00 8.01   ? 254 PRO B CD   1  
ATOM   8845   H  HA   . PRO B 1 251 ? 17.721  36.774 60.152 1.00 0.00   ? 254 PRO B HA   1  
ATOM   8846   H  HB2  . PRO B 1 251 ? 14.870  37.086 59.378 1.00 0.00   ? 254 PRO B HB2  1  
ATOM   8847   H  HB3  . PRO B 1 251 ? 15.759  37.798 60.737 1.00 0.00   ? 254 PRO B HB3  1  
ATOM   8848   H  HG2  . PRO B 1 251 ? 15.061  39.238 58.602 1.00 0.00   ? 254 PRO B HG2  1  
ATOM   8849   H  HG3  . PRO B 1 251 ? 16.575  39.524 59.476 1.00 0.00   ? 254 PRO B HG3  1  
ATOM   8850   H  HD2  . PRO B 1 251 ? 16.149  38.193 56.834 1.00 0.00   ? 254 PRO B HD2  1  
ATOM   8851   H  HD3  . PRO B 1 251 ? 17.519  39.177 57.397 1.00 0.00   ? 254 PRO B HD3  1  
ATOM   8852   N  N    . HIS B 1 252 ? 16.654  34.510 60.392 1.00 7.50   ? 255 HIS B N    1  
ATOM   8853   C  CA   . HIS B 1 252 ? 16.216  33.076 60.450 1.00 7.85   ? 255 HIS B CA   1  
ATOM   8854   C  C    . HIS B 1 252 ? 16.063  32.607 61.921 1.00 7.91   ? 255 HIS B C    1  
ATOM   8855   O  O    . HIS B 1 252 ? 17.011  32.602 62.681 1.00 8.29   ? 255 HIS B O    1  
ATOM   8856   C  CB   . HIS B 1 252 ? 17.257  32.203 59.749 1.00 8.24   ? 255 HIS B CB   1  
ATOM   8857   C  CG   . HIS B 1 252 ? 17.177  30.799 60.284 1.00 9.27   ? 255 HIS B CG   1  
ATOM   8858   N  ND1  . HIS B 1 252 ? 16.497  29.790 59.615 1.00 11.86  ? 255 HIS B ND1  1  
ATOM   8859   C  CD2  . HIS B 1 252 ? 17.686  30.220 61.421 1.00 12.71  ? 255 HIS B CD2  1  
ATOM   8860   C  CE1  . HIS B 1 252 ? 16.614  28.668 60.349 1.00 13.59  ? 255 HIS B CE1  1  
ATOM   8861   N  NE2  . HIS B 1 252 ? 17.328  28.878 61.456 1.00 12.77  ? 255 HIS B NE2  1  
ATOM   8862   H  H    . HIS B 1 252 ? 17.023  34.935 61.195 1.00 0.00   ? 255 HIS B H    1  
ATOM   8863   H  HA   . HIS B 1 252 ? 15.267  32.974 59.944 1.00 0.00   ? 255 HIS B HA   1  
ATOM   8864   H  HB2  . HIS B 1 252 ? 17.064  32.195 58.686 1.00 0.00   ? 255 HIS B HB2  1  
ATOM   8865   H  HB3  . HIS B 1 252 ? 18.244  32.601 59.932 1.00 0.00   ? 255 HIS B HB3  1  
ATOM   8866   H  HD1  . HIS B 1 252 ? 16.019  29.879 58.764 1.00 0.00   ? 255 HIS B HD1  1  
ATOM   8867   H  HD2  . HIS B 1 252 ? 18.273  30.729 62.171 1.00 0.00   ? 255 HIS B HD2  1  
ATOM   8868   H  HE1  . HIS B 1 252 ? 16.183  27.716 60.076 1.00 0.00   ? 255 HIS B HE1  1  
ATOM   8869   H  HE2  . HIS B 1 252 ? 17.553  28.223 62.150 1.00 0.00   ? 255 HIS B HE2  1  
ATOM   8870   N  N    . LEU B 1 253 ? 14.872  32.191 62.312 1.00 8.43   ? 256 LEU B N    1  
ATOM   8871   C  CA   . LEU B 1 253 ? 14.637  31.698 63.694 1.00 8.27   ? 256 LEU B CA   1  
ATOM   8872   C  C    . LEU B 1 253 ? 14.922  30.195 63.729 1.00 8.84   ? 256 LEU B C    1  
ATOM   8873   O  O    . LEU B 1 253 ? 14.198  29.391 63.177 1.00 8.30   ? 256 LEU B O    1  
ATOM   8874   C  CB   . LEU B 1 253 ? 13.182  31.955 64.091 1.00 8.94   ? 256 LEU B CB   1  
ATOM   8875   C  CG   . LEU B 1 253 ? 12.935  31.418 65.502 1.00 9.66   ? 256 LEU B CG   1  
ATOM   8876   C  CD1  . LEU B 1 253 ? 13.730  32.249 66.511 1.00 10.96  ? 256 LEU B CD1  1  
ATOM   8877   C  CD2  . LEU B 1 253 ? 11.443  31.513 65.829 1.00 10.75  ? 256 LEU B CD2  1  
ATOM   8878   H  H    . LEU B 1 253 ? 14.131  32.191 61.671 1.00 0.00   ? 256 LEU B H    1  
ATOM   8879   H  HA   . LEU B 1 253 ? 15.298  32.209 64.379 1.00 0.00   ? 256 LEU B HA   1  
ATOM   8880   H  HB2  . LEU B 1 253 ? 12.985  33.017 64.070 1.00 0.00   ? 256 LEU B HB2  1  
ATOM   8881   H  HB3  . LEU B 1 253 ? 12.525  31.452 63.397 1.00 0.00   ? 256 LEU B HB3  1  
ATOM   8882   H  HG   . LEU B 1 253 ? 13.253  30.387 65.555 1.00 0.00   ? 256 LEU B HG   1  
ATOM   8883   H  HD11 . LEU B 1 253 ? 14.716  32.445 66.118 1.00 0.00   ? 256 LEU B HD11 1  
ATOM   8884   H  HD12 . LEU B 1 253 ? 13.814  31.704 67.439 1.00 0.00   ? 256 LEU B HD12 1  
ATOM   8885   H  HD13 . LEU B 1 253 ? 13.220  33.185 66.688 1.00 0.00   ? 256 LEU B HD13 1  
ATOM   8886   H  HD21 . LEU B 1 253 ? 10.881  31.630 64.914 1.00 0.00   ? 256 LEU B HD21 1  
ATOM   8887   H  HD22 . LEU B 1 253 ? 11.268  32.364 66.470 1.00 0.00   ? 256 LEU B HD22 1  
ATOM   8888   H  HD23 . LEU B 1 253 ? 11.127  30.612 66.333 1.00 0.00   ? 256 LEU B HD23 1  
ATOM   8889   N  N    . ILE B 1 254 ? 15.990  29.833 64.361 1.00 9.34   ? 257 ILE B N    1  
ATOM   8890   C  CA   . ILE B 1 254 ? 16.400  28.419 64.454 1.00 9.33   ? 257 ILE B CA   1  
ATOM   8891   C  C    . ILE B 1 254 ? 15.338  27.653 65.201 1.00 9.52   ? 257 ILE B C    1  
ATOM   8892   O  O    . ILE B 1 254 ? 14.975  27.977 66.314 1.00 11.30  ? 257 ILE B O    1  
ATOM   8893   C  CB   . ILE B 1 254 ? 17.730  28.318 65.204 1.00 9.52   ? 257 ILE B CB   1  
ATOM   8894   C  CG1  . ILE B 1 254 ? 18.755  29.245 64.548 1.00 11.06  ? 257 ILE B CG1  1  
ATOM   8895   C  CG2  . ILE B 1 254 ? 18.239  26.876 65.149 1.00 10.50  ? 257 ILE B CG2  1  
ATOM   8896   C  CD1  . ILE B 1 254 ? 20.159  28.876 65.030 1.00 13.64  ? 257 ILE B CD1  1  
ATOM   8897   H  H    . ILE B 1 254 ? 16.552  30.519 64.777 1.00 0.00   ? 257 ILE B H    1  
ATOM   8898   H  HA   . ILE B 1 254 ? 16.513  28.008 63.462 1.00 0.00   ? 257 ILE B HA   1  
ATOM   8899   H  HB   . ILE B 1 254 ? 17.584  28.609 66.234 1.00 0.00   ? 257 ILE B HB   1  
ATOM   8900   H  HG12 . ILE B 1 254 ? 18.702  29.138 63.474 1.00 0.00   ? 257 ILE B HG12 1  
ATOM   8901   H  HG13 . ILE B 1 254 ? 18.541  30.268 64.819 1.00 0.00   ? 257 ILE B HG13 1  
ATOM   8902   H  HG21 . ILE B 1 254 ? 18.448  26.607 64.125 1.00 0.00   ? 257 ILE B HG21 1  
ATOM   8903   H  HG22 . ILE B 1 254 ? 17.486  26.213 65.550 1.00 0.00   ? 257 ILE B HG22 1  
ATOM   8904   H  HG23 . ILE B 1 254 ? 19.142  26.791 65.735 1.00 0.00   ? 257 ILE B HG23 1  
ATOM   8905   H  HD11 . ILE B 1 254 ? 20.859  29.637 64.718 1.00 0.00   ? 257 ILE B HD11 1  
ATOM   8906   H  HD12 . ILE B 1 254 ? 20.448  27.926 64.604 1.00 0.00   ? 257 ILE B HD12 1  
ATOM   8907   H  HD13 . ILE B 1 254 ? 20.163  28.803 66.107 1.00 0.00   ? 257 ILE B HD13 1  
ATOM   8908   N  N    . GLY B 1 255 ? 14.832  26.646 64.589 1.00 10.24  ? 258 GLY B N    1  
ATOM   8909   C  CA   . GLY B 1 255 ? 13.765  25.837 65.244 1.00 10.19  ? 258 GLY B CA   1  
ATOM   8910   C  C    . GLY B 1 255 ? 12.370  26.382 64.879 1.00 9.62   ? 258 GLY B C    1  
ATOM   8911   O  O    . GLY B 1 255 ? 11.368  25.753 65.155 1.00 9.82   ? 258 GLY B O    1  
ATOM   8912   H  H    . GLY B 1 255 ? 15.140  26.414 63.688 1.00 0.00   ? 258 GLY B H    1  
ATOM   8913   H  HA2  . GLY B 1 255 ? 13.845  24.810 64.916 1.00 0.00   ? 258 GLY B HA2  1  
ATOM   8914   H  HA3  . GLY B 1 255 ? 13.891  25.880 66.315 1.00 0.00   ? 258 GLY B HA3  1  
ATOM   8915   N  N    . GLY B 1 256 ? 12.286  27.541 64.267 1.00 9.51   ? 259 GLY B N    1  
ATOM   8916   C  CA   . GLY B 1 256 ? 10.950  28.087 63.910 1.00 9.43   ? 259 GLY B CA   1  
ATOM   8917   C  C    . GLY B 1 256 ? 10.943  28.546 62.452 1.00 8.63   ? 259 GLY B C    1  
ATOM   8918   O  O    . GLY B 1 256 ? 11.677  28.049 61.622 1.00 9.09   ? 259 GLY B O    1  
ATOM   8919   H  H    . GLY B 1 256 ? 13.098  28.044 64.050 1.00 0.00   ? 259 GLY B H    1  
ATOM   8920   H  HA2  . GLY B 1 256 ? 10.202  27.320 64.049 1.00 0.00   ? 259 GLY B HA2  1  
ATOM   8921   H  HA3  . GLY B 1 256 ? 10.725  28.928 64.548 1.00 0.00   ? 259 GLY B HA3  1  
ATOM   8922   N  N    . HIS B 1 257 ? 10.105  29.493 62.144 1.00 8.65   ? 260 HIS B N    1  
ATOM   8923   C  CA   . HIS B 1 257 ? 10.010  30.009 60.758 1.00 8.62   ? 260 HIS B CA   1  
ATOM   8924   C  C    . HIS B 1 257 ? 9.102   31.241 60.755 1.00 8.53   ? 260 HIS B C    1  
ATOM   8925   O  O    . HIS B 1 257 ? 8.295   31.435 61.641 1.00 9.45   ? 260 HIS B O    1  
ATOM   8926   C  CB   . HIS B 1 257 ? 9.417   28.931 59.848 1.00 9.53   ? 260 HIS B CB   1  
ATOM   8927   C  CG   . HIS B 1 257 ? 10.024  27.598 60.187 1.00 11.83  ? 260 HIS B CG   1  
ATOM   8928   N  ND1  . HIS B 1 257 ? 9.619   26.859 61.290 1.00 13.74  ? 260 HIS B ND1  1  
ATOM   8929   C  CD2  . HIS B 1 257 ? 11.008  26.856 59.580 1.00 12.66  ? 260 HIS B CD2  1  
ATOM   8930   C  CE1  . HIS B 1 257 ? 10.349  25.728 61.312 1.00 13.28  ? 260 HIS B CE1  1  
ATOM   8931   N  NE2  . HIS B 1 257 ? 11.209  25.680 60.293 1.00 15.16  ? 260 HIS B NE2  1  
ATOM   8932   H  H    . HIS B 1 257 ? 9.524   29.868 62.839 1.00 0.00   ? 260 HIS B H    1  
ATOM   8933   H  HA   . HIS B 1 257 ? 10.994  30.282 60.404 1.00 0.00   ? 260 HIS B HA   1  
ATOM   8934   H  HB2  . HIS B 1 257 ? 8.347   28.887 59.992 1.00 0.00   ? 260 HIS B HB2  1  
ATOM   8935   H  HB3  . HIS B 1 257 ? 9.631   29.172 58.817 1.00 0.00   ? 260 HIS B HB3  1  
ATOM   8936   H  HD1  . HIS B 1 257 ? 8.926   27.114 61.935 1.00 0.00   ? 260 HIS B HD1  1  
ATOM   8937   H  HD2  . HIS B 1 257 ? 11.544  27.143 58.687 1.00 0.00   ? 260 HIS B HD2  1  
ATOM   8938   H  HE1  . HIS B 1 257 ? 10.252  24.957 62.062 1.00 0.00   ? 260 HIS B HE1  1  
ATOM   8939   H  HE2  . HIS B 1 257 ? 11.847  24.965 60.090 1.00 0.00   ? 260 HIS B HE2  1  
ATOM   8940   N  N    . GLY B 1 258 ? 9.238   32.072 59.768 1.00 8.59   ? 261 GLY B N    1  
ATOM   8941   C  CA   . GLY B 1 258 ? 8.405   33.299 59.686 1.00 9.07   ? 261 GLY B CA   1  
ATOM   8942   C  C    . GLY B 1 258 ? 7.083   32.933 59.041 1.00 8.93   ? 261 GLY B C    1  
ATOM   8943   O  O    . GLY B 1 258 ? 6.998   32.711 57.849 1.00 9.73   ? 261 GLY B O    1  
ATOM   8944   H  H    . GLY B 1 258 ? 9.902   31.891 59.070 1.00 0.00   ? 261 GLY B H    1  
ATOM   8945   H  HA2  . GLY B 1 258 ? 8.233   33.688 60.680 1.00 0.00   ? 261 GLY B HA2  1  
ATOM   8946   H  HA3  . GLY B 1 258 ? 8.906   34.041 59.085 1.00 0.00   ? 261 GLY B HA3  1  
ATOM   8947   N  N    . ASP B 1 259 ? 6.057   32.839 59.821 1.00 9.23   ? 262 ASP B N    1  
ATOM   8948   C  CA   . ASP B 1 259 ? 4.732   32.450 59.255 1.00 8.87   ? 262 ASP B CA   1  
ATOM   8949   C  C    . ASP B 1 259 ? 4.368   33.442 58.168 1.00 9.03   ? 262 ASP B C    1  
ATOM   8950   O  O    . ASP B 1 259 ? 4.063   33.088 57.046 1.00 9.61   ? 262 ASP B O    1  
ATOM   8951   C  CB   . ASP B 1 259 ? 3.672   32.481 60.358 1.00 9.52   ? 262 ASP B CB   1  
ATOM   8952   C  CG   . ASP B 1 259 ? 3.820   31.244 61.245 1.00 10.59  ? 262 ASP B CG   1  
ATOM   8953   O  OD1  . ASP B 1 259 ? 4.420   30.283 60.792 1.00 12.09  ? 262 ASP B OD1  1  
ATOM   8954   O  OD2  . ASP B 1 259 ? 3.331   31.278 62.362 1.00 10.89  ? 262 ASP B OD2  1  
ATOM   8955   H  H    . ASP B 1 259 ? 6.153   33.001 60.783 1.00 0.00   ? 262 ASP B H    1  
ATOM   8956   H  HA   . ASP B 1 259 ? 4.793   31.456 58.836 1.00 0.00   ? 262 ASP B HA   1  
ATOM   8957   H  HB2  . ASP B 1 259 ? 3.801   33.372 60.956 1.00 0.00   ? 262 ASP B HB2  1  
ATOM   8958   H  HB3  . ASP B 1 259 ? 2.688   32.486 59.912 1.00 0.00   ? 262 ASP B HB3  1  
ATOM   8959   N  N    . TYR B 1 260 ? 4.423   34.686 58.503 1.00 9.21   ? 263 TYR B N    1  
ATOM   8960   C  CA   . TYR B 1 260 ? 4.113   35.758 57.521 1.00 9.20   ? 263 TYR B CA   1  
ATOM   8961   C  C    . TYR B 1 260 ? 5.249   36.763 57.606 1.00 9.13   ? 263 TYR B C    1  
ATOM   8962   O  O    . TYR B 1 260 ? 5.564   37.253 58.672 1.00 10.50  ? 263 TYR B O    1  
ATOM   8963   C  CB   . TYR B 1 260 ? 2.789   36.433 57.885 1.00 10.06  ? 263 TYR B CB   1  
ATOM   8964   C  CG   . TYR B 1 260 ? 1.707   35.388 58.009 1.00 11.28  ? 263 TYR B CG   1  
ATOM   8965   C  CD1  . TYR B 1 260 ? 1.498   34.737 59.231 1.00 12.52  ? 263 TYR B CD1  1  
ATOM   8966   C  CD2  . TYR B 1 260 ? 0.912   35.068 56.902 1.00 13.18  ? 263 TYR B CD2  1  
ATOM   8967   C  CE1  . TYR B 1 260 ? 0.495   33.767 59.346 1.00 15.57  ? 263 TYR B CE1  1  
ATOM   8968   C  CE2  . TYR B 1 260 ? -0.091  34.099 57.017 1.00 14.87  ? 263 TYR B CE2  1  
ATOM   8969   C  CZ   . TYR B 1 260 ? -0.300  33.448 58.239 1.00 15.57  ? 263 TYR B CZ   1  
ATOM   8970   O  OH   . TYR B 1 260 ? -1.289  32.492 58.352 1.00 21.01  ? 263 TYR B OH   1  
ATOM   8971   H  H    . TYR B 1 260 ? 4.689   34.929 59.414 1.00 0.00   ? 263 TYR B H    1  
ATOM   8972   H  HA   . TYR B 1 260 ? 4.059   35.343 56.525 1.00 0.00   ? 263 TYR B HA   1  
ATOM   8973   H  HB2  . TYR B 1 260 ? 2.897   36.953 58.826 1.00 0.00   ? 263 TYR B HB2  1  
ATOM   8974   H  HB3  . TYR B 1 260 ? 2.520   37.139 57.113 1.00 0.00   ? 263 TYR B HB3  1  
ATOM   8975   H  HD1  . TYR B 1 260 ? 2.111   34.983 60.086 1.00 0.00   ? 263 TYR B HD1  1  
ATOM   8976   H  HD2  . TYR B 1 260 ? 1.072   35.570 55.959 1.00 0.00   ? 263 TYR B HD2  1  
ATOM   8977   H  HE1  . TYR B 1 260 ? 0.334   33.266 60.289 1.00 0.00   ? 263 TYR B HE1  1  
ATOM   8978   H  HE2  . TYR B 1 260 ? -0.705  33.852 56.162 1.00 0.00   ? 263 TYR B HE2  1  
ATOM   8979   H  HH   . TYR B 1 260 ? -2.120  32.943 58.517 1.00 0.00   ? 263 TYR B HH   1  
ATOM   8980   N  N    . VAL B 1 261 ? 5.911   37.045 56.525 1.00 8.45   ? 264 VAL B N    1  
ATOM   8981   C  CA   . VAL B 1 261 ? 7.061   37.983 56.636 1.00 8.36   ? 264 VAL B CA   1  
ATOM   8982   C  C    . VAL B 1 261 ? 7.037   39.076 55.567 1.00 7.90   ? 264 VAL B C    1  
ATOM   8983   O  O    . VAL B 1 261 ? 7.309   38.839 54.407 1.00 8.74   ? 264 VAL B O    1  
ATOM   8984   C  CB   . VAL B 1 261 ? 8.362   37.190 56.504 1.00 8.68   ? 264 VAL B CB   1  
ATOM   8985   C  CG1  . VAL B 1 261 ? 9.554   38.126 56.712 1.00 10.35  ? 264 VAL B CG1  1  
ATOM   8986   C  CG2  . VAL B 1 261 ? 8.392   36.084 57.561 1.00 9.28   ? 264 VAL B CG2  1  
ATOM   8987   H  H    . VAL B 1 261 ? 5.686   36.621 55.671 1.00 0.00   ? 264 VAL B H    1  
ATOM   8988   H  HA   . VAL B 1 261 ? 7.039   38.448 57.609 1.00 0.00   ? 264 VAL B HA   1  
ATOM   8989   H  HB   . VAL B 1 261 ? 8.417   36.751 55.518 1.00 0.00   ? 264 VAL B HB   1  
ATOM   8990   H  HG11 . VAL B 1 261 ? 10.295  37.634 57.325 1.00 0.00   ? 264 VAL B HG11 1  
ATOM   8991   H  HG12 . VAL B 1 261 ? 9.222   39.028 57.204 1.00 0.00   ? 264 VAL B HG12 1  
ATOM   8992   H  HG13 . VAL B 1 261 ? 9.987   38.375 55.755 1.00 0.00   ? 264 VAL B HG13 1  
ATOM   8993   H  HG21 . VAL B 1 261 ? 9.313   36.147 58.122 1.00 0.00   ? 264 VAL B HG21 1  
ATOM   8994   H  HG22 . VAL B 1 261 ? 8.331   35.121 57.076 1.00 0.00   ? 264 VAL B HG22 1  
ATOM   8995   H  HG23 . VAL B 1 261 ? 7.554   36.204 58.232 1.00 0.00   ? 264 VAL B HG23 1  
ATOM   8996   N  N    . TRP B 1 262 ? 6.783   40.287 55.978 1.00 8.57   ? 265 TRP B N    1  
ATOM   8997   C  CA   . TRP B 1 262 ? 6.818   41.434 55.026 1.00 8.89   ? 265 TRP B CA   1  
ATOM   8998   C  C    . TRP B 1 262 ? 8.296   41.731 54.841 1.00 9.11   ? 265 TRP B C    1  
ATOM   8999   O  O    . TRP B 1 262 ? 8.891   42.510 55.558 1.00 9.07   ? 265 TRP B O    1  
ATOM   9000   C  CB   . TRP B 1 262 ? 6.105   42.647 55.630 1.00 9.15   ? 265 TRP B CB   1  
ATOM   9001   C  CG   . TRP B 1 262 ? 4.663   42.318 55.850 1.00 9.31   ? 265 TRP B CG   1  
ATOM   9002   C  CD1  . TRP B 1 262 ? 3.676   42.506 54.943 1.00 9.91   ? 265 TRP B CD1  1  
ATOM   9003   C  CD2  . TRP B 1 262 ? 4.030   41.749 57.033 1.00 10.21  ? 265 TRP B CD2  1  
ATOM   9004   N  NE1  . TRP B 1 262 ? 2.478   42.089 55.494 1.00 10.58  ? 265 TRP B NE1  1  
ATOM   9005   C  CE2  . TRP B 1 262 ? 2.644   41.615 56.781 1.00 9.82   ? 265 TRP B CE2  1  
ATOM   9006   C  CE3  . TRP B 1 262 ? 4.518   41.342 58.287 1.00 10.19  ? 265 TRP B CE3  1  
ATOM   9007   C  CZ2  . TRP B 1 262 ? 1.774   41.094 57.739 1.00 10.18  ? 265 TRP B CZ2  1  
ATOM   9008   C  CZ3  . TRP B 1 262 ? 3.645   40.817 59.254 1.00 11.09  ? 265 TRP B CZ3  1  
ATOM   9009   C  CH2  . TRP B 1 262 ? 2.275   40.694 58.980 1.00 11.04  ? 265 TRP B CH2  1  
ATOM   9010   H  H    . TRP B 1 262 ? 6.621   40.452 56.930 1.00 0.00   ? 265 TRP B H    1  
ATOM   9011   H  HA   . TRP B 1 262 ? 6.369   41.154 54.083 1.00 0.00   ? 265 TRP B HA   1  
ATOM   9012   H  HB2  . TRP B 1 262 ? 6.564   42.902 56.573 1.00 0.00   ? 265 TRP B HB2  1  
ATOM   9013   H  HB3  . TRP B 1 262 ? 6.184   43.484 54.953 1.00 0.00   ? 265 TRP B HB3  1  
ATOM   9014   H  HD1  . TRP B 1 262 ? 3.804   42.914 53.952 1.00 0.00   ? 265 TRP B HD1  1  
ATOM   9015   H  HE1  . TRP B 1 262 ? 1.608   42.118 55.044 1.00 0.00   ? 265 TRP B HE1  1  
ATOM   9016   H  HE3  . TRP B 1 262 ? 5.571   41.433 58.508 1.00 0.00   ? 265 TRP B HE3  1  
ATOM   9017   H  HZ2  . TRP B 1 262 ? 0.719   41.001 57.523 1.00 0.00   ? 265 TRP B HZ2  1  
ATOM   9018   H  HZ3  . TRP B 1 262 ? 4.031   40.508 60.214 1.00 0.00   ? 265 TRP B HZ3  1  
ATOM   9019   H  HH2  . TRP B 1 262 ? 1.609   40.290 59.728 1.00 0.00   ? 265 TRP B HH2  1  
ATOM   9020   N  N    . ALA B 1 263 ? 8.904   41.017 53.954 1.00 9.68   ? 266 ALA B N    1  
ATOM   9021   C  CA   . ALA B 1 263 ? 10.384  41.121 53.768 1.00 9.95   ? 266 ALA B CA   1  
ATOM   9022   C  C    . ALA B 1 263 ? 10.765  42.528 53.410 1.00 10.42  ? 266 ALA B C    1  
ATOM   9023   O  O    . ALA B 1 263 ? 11.771  43.055 53.843 1.00 11.71  ? 266 ALA B O    1  
ATOM   9024   C  CB   . ALA B 1 263 ? 10.822  40.176 52.648 1.00 11.16  ? 266 ALA B CB   1  
ATOM   9025   H  H    . ALA B 1 263 ? 8.403   40.338 53.456 1.00 0.00   ? 266 ALA B H    1  
ATOM   9026   H  HA   . ALA B 1 263 ? 10.879  40.838 54.685 1.00 0.00   ? 266 ALA B HA   1  
ATOM   9027   H  HB1  . ALA B 1 263 ? 11.639  39.561 52.995 1.00 0.00   ? 266 ALA B HB1  1  
ATOM   9028   H  HB2  . ALA B 1 263 ? 11.143  40.754 51.795 1.00 0.00   ? 266 ALA B HB2  1  
ATOM   9029   H  HB3  . ALA B 1 263 ? 9.992   39.545 52.364 1.00 0.00   ? 266 ALA B HB3  1  
ATOM   9030   N  N    . THR B 1 264 ? 9.974   43.129 52.613 1.00 10.01  ? 267 THR B N    1  
ATOM   9031   C  CA   . THR B 1 264 ? 10.267  44.525 52.181 1.00 10.50  ? 267 THR B CA   1  
ATOM   9032   C  C    . THR B 1 264 ? 9.887   45.514 53.287 1.00 8.96   ? 267 THR B C    1  
ATOM   9033   O  O    . THR B 1 264 ? 10.163  46.694 53.192 1.00 9.32   ? 267 THR B O    1  
ATOM   9034   C  CB   . THR B 1 264 ? 9.463   44.844 50.918 1.00 10.38  ? 267 THR B CB   1  
ATOM   9035   O  OG1  . THR B 1 264 ? 8.099   45.038 51.264 1.00 11.72  ? 267 THR B OG1  1  
ATOM   9036   C  CG2  . THR B 1 264 ? 9.580   43.683 49.929 1.00 12.17  ? 267 THR B CG2  1  
ATOM   9037   H  H    . THR B 1 264 ? 9.177   42.669 52.276 1.00 0.00   ? 267 THR B H    1  
ATOM   9038   H  HA   . THR B 1 264 ? 11.321  44.619 51.965 1.00 0.00   ? 267 THR B HA   1  
ATOM   9039   H  HB   . THR B 1 264 ? 9.850   45.741 50.460 1.00 0.00   ? 267 THR B HB   1  
ATOM   9040   H  HG1  . THR B 1 264 ? 7.822   45.889 50.914 1.00 0.00   ? 267 THR B HG1  1  
ATOM   9041   H  HG21 . THR B 1 264 ? 9.778   42.769 50.469 1.00 0.00   ? 267 THR B HG21 1  
ATOM   9042   H  HG22 . THR B 1 264 ? 10.389  43.877 49.241 1.00 0.00   ? 267 THR B HG22 1  
ATOM   9043   H  HG23 . THR B 1 264 ? 8.655   43.583 49.380 1.00 0.00   ? 267 THR B HG23 1  
ATOM   9044   N  N    . GLY B 1 265 ? 9.255   45.055 54.333 1.00 8.79   ? 268 GLY B N    1  
ATOM   9045   C  CA   . GLY B 1 265 ? 8.865   46.001 55.437 1.00 8.77   ? 268 GLY B CA   1  
ATOM   9046   C  C    . GLY B 1 265 ? 7.722   46.955 54.997 1.00 9.19   ? 268 GLY B C    1  
ATOM   9047   O  O    . GLY B 1 265 ? 7.570   48.036 55.530 1.00 10.21  ? 268 GLY B O    1  
ATOM   9048   H  H    . GLY B 1 265 ? 9.035   44.102 54.398 1.00 0.00   ? 268 GLY B H    1  
ATOM   9049   H  HA2  . GLY B 1 265 ? 8.536   45.428 56.292 1.00 0.00   ? 268 GLY B HA2  1  
ATOM   9050   H  HA3  . GLY B 1 265 ? 9.725   46.590 55.717 1.00 0.00   ? 268 GLY B HA3  1  
ATOM   9051   N  N    . LYS B 1 266 ? 6.914   46.552 54.051 1.00 8.87   ? 269 LYS B N    1  
ATOM   9052   C  CA   . LYS B 1 266 ? 5.781   47.388 53.584 1.00 9.19   ? 269 LYS B CA   1  
ATOM   9053   C  C    . LYS B 1 266 ? 4.511   46.574 53.799 1.00 9.60   ? 269 LYS B C    1  
ATOM   9054   O  O    . LYS B 1 266 ? 4.400   45.448 53.356 1.00 10.39  ? 269 LYS B O    1  
ATOM   9055   C  CB   . LYS B 1 266 ? 5.949   47.710 52.097 1.00 9.44   ? 269 LYS B CB   1  
ATOM   9056   C  CG   . LYS B 1 266 ? 7.339   48.303 51.857 1.00 9.60   ? 269 LYS B CG   1  
ATOM   9057   C  CD   . LYS B 1 266 ? 7.661   49.314 52.959 1.00 9.06   ? 269 LYS B CD   1  
ATOM   9058   C  CE   . LYS B 1 266 ? 9.147   49.670 52.907 1.00 9.82   ? 269 LYS B CE   1  
ATOM   9059   N  NZ   . LYS B 1 266 ? 9.866   48.966 54.006 1.00 9.59   ? 269 LYS B NZ   1  
ATOM   9060   H  H    . LYS B 1 266 ? 7.052   45.668 53.650 1.00 0.00   ? 269 LYS B H    1  
ATOM   9061   H  HA   . LYS B 1 266 ? 5.736   48.301 54.160 1.00 0.00   ? 269 LYS B HA   1  
ATOM   9062   H  HB2  . LYS B 1 266 ? 5.838   46.804 51.519 1.00 0.00   ? 269 LYS B HB2  1  
ATOM   9063   H  HB3  . LYS B 1 266 ? 5.198   48.424 51.796 1.00 0.00   ? 269 LYS B HB3  1  
ATOM   9064   H  HG2  . LYS B 1 266 ? 8.074   47.512 51.866 1.00 0.00   ? 269 LYS B HG2  1  
ATOM   9065   H  HG3  . LYS B 1 266 ? 7.357   48.800 50.899 1.00 0.00   ? 269 LYS B HG3  1  
ATOM   9066   H  HD2  . LYS B 1 266 ? 7.070   50.206 52.812 1.00 0.00   ? 269 LYS B HD2  1  
ATOM   9067   H  HD3  . LYS B 1 266 ? 7.429   48.883 53.922 1.00 0.00   ? 269 LYS B HD3  1  
ATOM   9068   H  HE2  . LYS B 1 266 ? 9.557   49.366 51.955 1.00 0.00   ? 269 LYS B HE2  1  
ATOM   9069   H  HE3  . LYS B 1 266 ? 9.266   50.737 53.025 1.00 0.00   ? 269 LYS B HE3  1  
ATOM   9070   H  HZ1  . LYS B 1 266 ? 10.215  49.661 54.695 1.00 0.00   ? 269 LYS B HZ1  1  
ATOM   9071   H  HZ2  . LYS B 1 266 ? 10.670  48.438 53.612 1.00 0.00   ? 269 LYS B HZ2  1  
ATOM   9072   H  HZ3  . LYS B 1 266 ? 9.214   48.306 54.478 1.00 0.00   ? 269 LYS B HZ3  1  
ATOM   9073   N  N    . PHE B 1 267 ? 3.574   47.110 54.511 1.00 10.52  ? 270 PHE B N    1  
ATOM   9074   C  CA   . PHE B 1 267 ? 2.323   46.342 54.804 1.00 10.86  ? 270 PHE B CA   1  
ATOM   9075   C  C    . PHE B 1 267 ? 1.486   46.132 53.539 1.00 11.69  ? 270 PHE B C    1  
ATOM   9076   O  O    . PHE B 1 267 ? 0.874   45.099 53.355 1.00 13.72  ? 270 PHE B O    1  
ATOM   9077   C  CB   . PHE B 1 267 ? 1.492   47.111 55.833 1.00 11.01  ? 270 PHE B CB   1  
ATOM   9078   C  CG   . PHE B 1 267 ? 2.106   46.944 57.202 1.00 11.17  ? 270 PHE B CG   1  
ATOM   9079   C  CD1  . PHE B 1 267 ? 2.479   45.671 57.651 1.00 11.76  ? 270 PHE B CD1  1  
ATOM   9080   C  CD2  . PHE B 1 267 ? 2.301   48.061 58.023 1.00 11.90  ? 270 PHE B CD2  1  
ATOM   9081   C  CE1  . PHE B 1 267 ? 3.048   45.516 58.921 1.00 12.56  ? 270 PHE B CE1  1  
ATOM   9082   C  CE2  . PHE B 1 267 ? 2.870   47.905 59.293 1.00 11.86  ? 270 PHE B CE2  1  
ATOM   9083   C  CZ   . PHE B 1 267 ? 3.243   46.633 59.742 1.00 12.59  ? 270 PHE B CZ   1  
ATOM   9084   H  H    . PHE B 1 267 ? 3.698   48.006 54.888 1.00 0.00   ? 270 PHE B H    1  
ATOM   9085   H  HA   . PHE B 1 267 ? 2.588   45.380 55.216 1.00 0.00   ? 270 PHE B HA   1  
ATOM   9086   H  HB2  . PHE B 1 267 ? 1.476   48.159 55.571 1.00 0.00   ? 270 PHE B HB2  1  
ATOM   9087   H  HB3  . PHE B 1 267 ? 0.484   46.726 55.842 1.00 0.00   ? 270 PHE B HB3  1  
ATOM   9088   H  HD1  . PHE B 1 267 ? 2.328   44.809 57.018 1.00 0.00   ? 270 PHE B HD1  1  
ATOM   9089   H  HD2  . PHE B 1 267 ? 2.013   49.042 57.677 1.00 0.00   ? 270 PHE B HD2  1  
ATOM   9090   H  HE1  . PHE B 1 267 ? 3.336   44.534 59.268 1.00 0.00   ? 270 PHE B HE1  1  
ATOM   9091   H  HE2  . PHE B 1 267 ? 3.021   48.767 59.926 1.00 0.00   ? 270 PHE B HE2  1  
ATOM   9092   H  HZ   . PHE B 1 267 ? 3.682   46.513 60.722 1.00 0.00   ? 270 PHE B HZ   1  
ATOM   9093   N  N    . ASN B 1 268 ? 1.430   47.106 52.682 1.00 11.73  ? 271 ASN B N    1  
ATOM   9094   C  CA   . ASN B 1 268 ? 0.606   46.972 51.446 1.00 12.56  ? 271 ASN B CA   1  
ATOM   9095   C  C    . ASN B 1 268 ? 1.133   45.820 50.601 1.00 12.64  ? 271 ASN B C    1  
ATOM   9096   O  O    . ASN B 1 268 ? 0.396   45.161 49.894 1.00 13.99  ? 271 ASN B O    1  
ATOM   9097   C  CB   . ASN B 1 268 ? 0.681   48.271 50.640 1.00 13.52  ? 271 ASN B CB   1  
ATOM   9098   C  CG   . ASN B 1 268 ? -0.320  49.281 51.204 1.00 15.67  ? 271 ASN B CG   1  
ATOM   9099   O  OD1  . ASN B 1 268 ? -1.312  48.905 51.796 1.00 19.29  ? 271 ASN B OD1  1  
ATOM   9100   N  ND2  . ASN B 1 268 ? -0.101  50.557 51.044 1.00 17.83  ? 271 ASN B ND2  1  
ATOM   9101   H  H    . ASN B 1 268 ? 1.915   47.939 52.858 1.00 0.00   ? 271 ASN B H    1  
ATOM   9102   H  HA   . ASN B 1 268 ? -0.421  46.778 51.718 1.00 0.00   ? 271 ASN B HA   1  
ATOM   9103   H  HB2  . ASN B 1 268 ? 1.680   48.677 50.706 1.00 0.00   ? 271 ASN B HB2  1  
ATOM   9104   H  HB3  . ASN B 1 268 ? 0.441   48.068 49.607 1.00 0.00   ? 271 ASN B HB3  1  
ATOM   9105   H  HD21 . ASN B 1 268 ? 0.699   50.861 50.566 1.00 0.00   ? 271 ASN B HD21 1  
ATOM   9106   H  HD22 . ASN B 1 268 ? -0.736  51.212 51.401 1.00 0.00   ? 271 ASN B HD22 1  
ATOM   9107   N  N    . THR B 1 269 ? 2.405   45.574 50.668 1.00 11.84  ? 272 THR B N    1  
ATOM   9108   C  CA   . THR B 1 269 ? 2.994   44.467 49.871 1.00 12.08  ? 272 THR B CA   1  
ATOM   9109   C  C    . THR B 1 269 ? 2.718   43.154 50.589 1.00 12.22  ? 272 THR B C    1  
ATOM   9110   O  O    . THR B 1 269 ? 3.187   42.928 51.687 1.00 12.21  ? 272 THR B O    1  
ATOM   9111   C  CB   . THR B 1 269 ? 4.505   44.674 49.740 1.00 11.81  ? 272 THR B CB   1  
ATOM   9112   O  OG1  . THR B 1 269 ? 4.757   45.923 49.111 1.00 12.69  ? 272 THR B OG1  1  
ATOM   9113   C  CG2  . THR B 1 269 ? 5.106   43.547 48.899 1.00 12.64  ? 272 THR B CG2  1  
ATOM   9114   H  H    . THR B 1 269 ? 2.979   46.121 51.244 1.00 0.00   ? 272 THR B H    1  
ATOM   9115   H  HA   . THR B 1 269 ? 2.543   44.446 48.889 1.00 0.00   ? 272 THR B HA   1  
ATOM   9116   H  HB   . THR B 1 269 ? 4.956   44.666 50.720 1.00 0.00   ? 272 THR B HB   1  
ATOM   9117   H  HG1  . THR B 1 269 ? 4.299   45.929 48.268 1.00 0.00   ? 272 THR B HG1  1  
ATOM   9118   H  HG21 . THR B 1 269 ? 5.711   42.912 49.529 1.00 0.00   ? 272 THR B HG21 1  
ATOM   9119   H  HG22 . THR B 1 269 ? 5.720   43.969 48.117 1.00 0.00   ? 272 THR B HG22 1  
ATOM   9120   H  HG23 . THR B 1 269 ? 4.311   42.964 48.457 1.00 0.00   ? 272 THR B HG23 1  
ATOM   9121   N  N    . PRO B 1 270 ? 1.949   42.300 49.982 1.00 12.32  ? 273 PRO B N    1  
ATOM   9122   C  CA   . PRO B 1 270 ? 1.586   40.979 50.590 1.00 12.54  ? 273 PRO B CA   1  
ATOM   9123   C  C    . PRO B 1 270 ? 2.784   40.308 51.282 1.00 11.42  ? 273 PRO B C    1  
ATOM   9124   O  O    . PRO B 1 270 ? 3.872   40.283 50.741 1.00 11.88  ? 273 PRO B O    1  
ATOM   9125   C  CB   . PRO B 1 270 ? 1.127   40.159 49.386 1.00 13.52  ? 273 PRO B CB   1  
ATOM   9126   C  CG   . PRO B 1 270 ? 0.604   41.157 48.400 1.00 15.42  ? 273 PRO B CG   1  
ATOM   9127   C  CD   . PRO B 1 270 ? 1.339   42.479 48.657 1.00 13.35  ? 273 PRO B CD   1  
ATOM   9128   H  HA   . PRO B 1 270 ? 0.768   41.096 51.282 1.00 0.00   ? 273 PRO B HA   1  
ATOM   9129   H  HB2  . PRO B 1 270 ? 1.961   39.614 48.966 1.00 0.00   ? 273 PRO B HB2  1  
ATOM   9130   H  HB3  . PRO B 1 270 ? 0.340   39.479 49.674 1.00 0.00   ? 273 PRO B HB3  1  
ATOM   9131   H  HG2  . PRO B 1 270 ? 0.797   40.813 47.393 1.00 0.00   ? 273 PRO B HG2  1  
ATOM   9132   H  HG3  . PRO B 1 270 ? -0.456  41.299 48.546 1.00 0.00   ? 273 PRO B HG3  1  
ATOM   9133   H  HD2  . PRO B 1 270 ? 2.099   42.640 47.906 1.00 0.00   ? 273 PRO B HD2  1  
ATOM   9134   H  HD3  . PRO B 1 270 ? 0.642   43.303 48.676 1.00 0.00   ? 273 PRO B HD3  1  
ATOM   9135   N  N    . PRO B 1 271 ? 2.602   39.773 52.475 1.00 10.65  ? 274 PRO B N    1  
ATOM   9136   C  CA   . PRO B 1 271 ? 3.728   39.111 53.218 1.00 10.70  ? 274 PRO B CA   1  
ATOM   9137   C  C    . PRO B 1 271 ? 4.013   37.654 52.775 1.00 10.57  ? 274 PRO B C    1  
ATOM   9138   O  O    . PRO B 1 271 ? 3.134   36.816 52.807 1.00 11.80  ? 274 PRO B O    1  
ATOM   9139   C  CB   . PRO B 1 271 ? 3.231   39.132 54.662 1.00 10.32  ? 274 PRO B CB   1  
ATOM   9140   C  CG   . PRO B 1 271 ? 1.736   39.100 54.572 1.00 11.22  ? 274 PRO B CG   1  
ATOM   9141   C  CD   . PRO B 1 271 ? 1.345   39.741 53.233 1.00 11.14  ? 274 PRO B CD   1  
ATOM   9142   H  HA   . PRO B 1 271 ? 4.623   39.705 53.143 1.00 0.00   ? 274 PRO B HA   1  
ATOM   9143   H  HB2  . PRO B 1 271 ? 3.595   38.264 55.194 1.00 0.00   ? 274 PRO B HB2  1  
ATOM   9144   H  HB3  . PRO B 1 271 ? 3.551   40.037 55.156 1.00 0.00   ? 274 PRO B HB3  1  
ATOM   9145   H  HG2  . PRO B 1 271 ? 1.388   38.077 54.610 1.00 0.00   ? 274 PRO B HG2  1  
ATOM   9146   H  HG3  . PRO B 1 271 ? 1.305   39.667 55.383 1.00 0.00   ? 274 PRO B HG3  1  
ATOM   9147   H  HD2  . PRO B 1 271 ? 0.608   39.135 52.725 1.00 0.00   ? 274 PRO B HD2  1  
ATOM   9148   H  HD3  . PRO B 1 271 ? 0.976   40.743 53.385 1.00 0.00   ? 274 PRO B HD3  1  
ATOM   9149   N  N    . ASP B 1 272 ? 5.245   37.325 52.394 1.00 10.25  ? 275 ASP B N    1  
ATOM   9150   C  CA   . ASP B 1 272 ? 5.528   35.930 52.012 1.00 9.92   ? 275 ASP B CA   1  
ATOM   9151   C  C    . ASP B 1 272 ? 5.010   35.058 53.144 1.00 9.63   ? 275 ASP B C    1  
ATOM   9152   O  O    . ASP B 1 272 ? 4.576   35.553 54.165 1.00 10.73  ? 275 ASP B O    1  
ATOM   9153   C  CB   . ASP B 1 272 ? 7.036   35.729 51.844 1.00 10.00  ? 275 ASP B CB   1  
ATOM   9154   C  CG   . ASP B 1 272 ? 7.544   36.610 50.701 1.00 10.91  ? 275 ASP B CG   1  
ATOM   9155   O  OD1  . ASP B 1 272 ? 6.790   36.827 49.766 1.00 13.03  ? 275 ASP B OD1  1  
ATOM   9156   O  OD2  . ASP B 1 272 ? 8.678   37.052 50.779 1.00 13.19  ? 275 ASP B OD2  1  
ATOM   9157   H  H    . ASP B 1 272 ? 5.961   37.995 52.394 1.00 0.00   ? 275 ASP B H    1  
ATOM   9158   H  HA   . ASP B 1 272 ? 5.014   35.687 51.093 1.00 0.00   ? 275 ASP B HA   1  
ATOM   9159   H  HB2  . ASP B 1 272 ? 7.539   36.001 52.760 1.00 0.00   ? 275 ASP B HB2  1  
ATOM   9160   H  HB3  . ASP B 1 272 ? 7.238   34.694 51.615 1.00 0.00   ? 275 ASP B HB3  1  
ATOM   9161   N  N    . VAL B 1 273 ? 5.039   33.780 52.988 1.00 9.26   ? 276 VAL B N    1  
ATOM   9162   C  CA   . VAL B 1 273 ? 4.528   32.901 54.086 1.00 9.76   ? 276 VAL B CA   1  
ATOM   9163   C  C    . VAL B 1 273 ? 5.360   31.615 54.196 1.00 9.25   ? 276 VAL B C    1  
ATOM   9164   O  O    . VAL B 1 273 ? 5.888   31.114 53.223 1.00 9.85   ? 276 VAL B O    1  
ATOM   9165   C  CB   . VAL B 1 273 ? 3.071   32.534 53.798 1.00 10.25  ? 276 VAL B CB   1  
ATOM   9166   C  CG1  . VAL B 1 273 ? 2.222   33.806 53.757 1.00 12.26  ? 276 VAL B CG1  1  
ATOM   9167   C  CG2  . VAL B 1 273 ? 2.983   31.820 52.448 1.00 11.27  ? 276 VAL B CG2  1  
ATOM   9168   H  H    . VAL B 1 273 ? 5.386   33.388 52.159 1.00 0.00   ? 276 VAL B H    1  
ATOM   9169   H  HA   . VAL B 1 273 ? 4.579   33.438 55.021 1.00 0.00   ? 276 VAL B HA   1  
ATOM   9170   H  HB   . VAL B 1 273 ? 2.704   31.883 54.578 1.00 0.00   ? 276 VAL B HB   1  
ATOM   9171   H  HG11 . VAL B 1 273 ? 2.190   34.250 54.741 1.00 0.00   ? 276 VAL B HG11 1  
ATOM   9172   H  HG12 . VAL B 1 273 ? 1.220   33.560 53.440 1.00 0.00   ? 276 VAL B HG12 1  
ATOM   9173   H  HG13 . VAL B 1 273 ? 2.658   34.507 53.059 1.00 0.00   ? 276 VAL B HG13 1  
ATOM   9174   H  HG21 . VAL B 1 273 ? 2.156   31.125 52.462 1.00 0.00   ? 276 VAL B HG21 1  
ATOM   9175   H  HG22 . VAL B 1 273 ? 3.902   31.282 52.265 1.00 0.00   ? 276 VAL B HG22 1  
ATOM   9176   H  HG23 . VAL B 1 273 ? 2.830   32.547 51.665 1.00 0.00   ? 276 VAL B HG23 1  
ATOM   9177   N  N    . ASP B 1 274 ? 5.459   31.072 55.386 1.00 9.00   ? 277 ASP B N    1  
ATOM   9178   C  CA   . ASP B 1 274 ? 6.223   29.819 55.588 1.00 9.26   ? 277 ASP B CA   1  
ATOM   9179   C  C    . ASP B 1 274 ? 7.644   30.091 55.176 1.00 9.00   ? 277 ASP B C    1  
ATOM   9180   O  O    . ASP B 1 274 ? 8.189   29.439 54.308 1.00 10.05  ? 277 ASP B O    1  
ATOM   9181   C  CB   . ASP B 1 274 ? 5.634   28.705 54.720 1.00 9.43   ? 277 ASP B CB   1  
ATOM   9182   C  CG   . ASP B 1 274 ? 4.164   28.493 55.089 1.00 10.88  ? 277 ASP B CG   1  
ATOM   9183   O  OD1  . ASP B 1 274 ? 3.790   28.869 56.187 1.00 14.02  ? 277 ASP B OD1  1  
ATOM   9184   O  OD2  . ASP B 1 274 ? 3.439   27.959 54.266 1.00 13.10  ? 277 ASP B OD2  1  
ATOM   9185   H  H    . ASP B 1 274 ? 5.010   31.493 56.149 1.00 0.00   ? 277 ASP B H    1  
ATOM   9186   H  HA   . ASP B 1 274 ? 6.191   29.532 56.629 1.00 0.00   ? 277 ASP B HA   1  
ATOM   9187   H  HB2  . ASP B 1 274 ? 5.709   28.983 53.678 1.00 0.00   ? 277 ASP B HB2  1  
ATOM   9188   H  HB3  . ASP B 1 274 ? 6.181   27.790 54.889 1.00 0.00   ? 277 ASP B HB3  1  
ATOM   9189   N  N    . GLN B 1 275 ? 8.244   31.080 55.760 1.00 8.83   ? 278 GLN B N    1  
ATOM   9190   C  CA   . GLN B 1 275 ? 9.649   31.407 55.334 1.00 8.87   ? 278 GLN B CA   1  
ATOM   9191   C  C    . GLN B 1 275 ? 10.710  30.835 56.295 1.00 8.62   ? 278 GLN B C    1  
ATOM   9192   O  O    . GLN B 1 275 ? 10.670  31.070 57.486 1.00 8.63   ? 278 GLN B O    1  
ATOM   9193   C  CB   . GLN B 1 275 ? 9.806   32.927 55.272 1.00 8.76   ? 278 GLN B CB   1  
ATOM   9194   C  CG   . GLN B 1 275 ? 8.757   33.511 54.324 1.00 8.74   ? 278 GLN B CG   1  
ATOM   9195   C  CD   . GLN B 1 275 ? 9.207   33.307 52.876 1.00 8.57   ? 278 GLN B CD   1  
ATOM   9196   O  OE1  . GLN B 1 275 ? 10.179  33.893 52.442 1.00 9.95   ? 278 GLN B OE1  1  
ATOM   9197   N  NE2  . GLN B 1 275 ? 8.536   32.496 52.105 1.00 9.21   ? 278 GLN B NE2  1  
ATOM   9198   H  H    . GLN B 1 275 ? 7.784   31.620 56.437 1.00 0.00   ? 278 GLN B H    1  
ATOM   9199   H  HA   . GLN B 1 275 ? 9.817   31.002 54.348 1.00 0.00   ? 278 GLN B HA   1  
ATOM   9200   H  HB2  . GLN B 1 275 ? 9.671   33.343 56.260 1.00 0.00   ? 278 GLN B HB2  1  
ATOM   9201   H  HB3  . GLN B 1 275 ? 10.793  33.173 54.909 1.00 0.00   ? 278 GLN B HB3  1  
ATOM   9202   H  HG2  . GLN B 1 275 ? 7.812   33.012 54.482 1.00 0.00   ? 278 GLN B HG2  1  
ATOM   9203   H  HG3  . GLN B 1 275 ? 8.644   34.567 54.518 1.00 0.00   ? 278 GLN B HG3  1  
ATOM   9204   H  HE21 . GLN B 1 275 ? 7.752   32.023 52.455 1.00 0.00   ? 278 GLN B HE21 1  
ATOM   9205   H  HE22 . GLN B 1 275 ? 8.817   32.358 51.176 1.00 0.00   ? 278 GLN B HE22 1  
ATOM   9206   N  N    . GLU B 1 276 ? 11.701  30.127 55.771 1.00 8.63   ? 279 GLU B N    1  
ATOM   9207   C  CA   . GLU B 1 276 ? 12.791  29.606 56.652 1.00 8.22   ? 279 GLU B CA   1  
ATOM   9208   C  C    . GLU B 1 276 ? 13.842  30.720 56.893 1.00 7.96   ? 279 GLU B C    1  
ATOM   9209   O  O    . GLU B 1 276 ? 14.367  30.865 57.979 1.00 8.47   ? 279 GLU B O    1  
ATOM   9210   C  CB   . GLU B 1 276 ? 13.463  28.409 55.977 1.00 8.10   ? 279 GLU B CB   1  
ATOM   9211   C  CG   . GLU B 1 276 ? 14.177  28.874 54.706 1.00 8.41   ? 279 GLU B CG   1  
ATOM   9212   C  CD   . GLU B 1 276 ? 14.754  27.662 53.971 1.00 7.65   ? 279 GLU B CD   1  
ATOM   9213   O  OE1  . GLU B 1 276 ? 15.457  26.891 54.603 1.00 8.08   ? 279 GLU B OE1  1  
ATOM   9214   O  OE2  . GLU B 1 276 ? 14.483  27.527 52.790 1.00 7.94   ? 279 GLU B OE2  1  
ATOM   9215   H  H    . GLU B 1 276 ? 11.742  29.982 54.803 1.00 0.00   ? 279 GLU B H    1  
ATOM   9216   H  HA   . GLU B 1 276 ? 12.371  29.297 57.599 1.00 0.00   ? 279 GLU B HA   1  
ATOM   9217   H  HB2  . GLU B 1 276 ? 14.181  27.970 56.654 1.00 0.00   ? 279 GLU B HB2  1  
ATOM   9218   H  HB3  . GLU B 1 276 ? 12.715  27.674 55.718 1.00 0.00   ? 279 GLU B HB3  1  
ATOM   9219   H  HG2  . GLU B 1 276 ? 13.474  29.384 54.064 1.00 0.00   ? 279 GLU B HG2  1  
ATOM   9220   H  HG3  . GLU B 1 276 ? 14.979  29.548 54.970 1.00 0.00   ? 279 GLU B HG3  1  
ATOM   9221   N  N    . THR B 1 277 ? 14.148  31.504 55.880 1.00 8.31   ? 280 THR B N    1  
ATOM   9222   C  CA   . THR B 1 277 ? 15.144  32.596 56.019 1.00 8.17   ? 280 THR B CA   1  
ATOM   9223   C  C    . THR B 1 277 ? 14.733  33.709 55.061 1.00 8.23   ? 280 THR B C    1  
ATOM   9224   O  O    . THR B 1 277 ? 14.572  33.492 53.877 1.00 10.19  ? 280 THR B O    1  
ATOM   9225   C  CB   . THR B 1 277 ? 16.537  32.080 55.648 1.00 8.43   ? 280 THR B CB   1  
ATOM   9226   O  OG1  . THR B 1 277 ? 16.907  31.039 56.542 1.00 8.99   ? 280 THR B OG1  1  
ATOM   9227   C  CG2  . THR B 1 277 ? 17.549  33.222 55.744 1.00 9.55   ? 280 THR B CG2  1  
ATOM   9228   H  H    . THR B 1 277 ? 13.709  31.363 55.015 1.00 0.00   ? 280 THR B H    1  
ATOM   9229   H  HA   . THR B 1 277 ? 15.144  32.966 57.034 1.00 0.00   ? 280 THR B HA   1  
ATOM   9230   H  HB   . THR B 1 277 ? 16.524  31.700 54.638 1.00 0.00   ? 280 THR B HB   1  
ATOM   9231   H  HG1  . THR B 1 277 ? 16.364  30.273 56.346 1.00 0.00   ? 280 THR B HG1  1  
ATOM   9232   H  HG21 . THR B 1 277 ? 18.407  32.995 55.129 1.00 0.00   ? 280 THR B HG21 1  
ATOM   9233   H  HG22 . THR B 1 277 ? 17.863  33.340 56.771 1.00 0.00   ? 280 THR B HG22 1  
ATOM   9234   H  HG23 . THR B 1 277 ? 17.092  34.138 55.400 1.00 0.00   ? 280 THR B HG23 1  
ATOM   9235   N  N    . TRP B 1 278 ? 14.522  34.884 55.564 1.00 7.63   ? 281 TRP B N    1  
ATOM   9236   C  CA   . TRP B 1 278 ? 14.075  35.991 54.684 1.00 7.74   ? 281 TRP B CA   1  
ATOM   9237   C  C    . TRP B 1 278 ? 15.272  36.792 54.203 1.00 8.32   ? 281 TRP B C    1  
ATOM   9238   O  O    . TRP B 1 278 ? 16.401  36.344 54.249 1.00 10.11  ? 281 TRP B O    1  
ATOM   9239   C  CB   . TRP B 1 278 ? 13.130  36.909 55.462 1.00 8.22   ? 281 TRP B CB   1  
ATOM   9240   C  CG   . TRP B 1 278 ? 13.089  36.483 56.895 1.00 7.25   ? 281 TRP B CG   1  
ATOM   9241   C  CD1  . TRP B 1 278 ? 13.265  37.305 57.954 1.00 7.53   ? 281 TRP B CD1  1  
ATOM   9242   C  CD2  . TRP B 1 278 ? 12.860  35.152 57.442 1.00 7.67   ? 281 TRP B CD2  1  
ATOM   9243   N  NE1  . TRP B 1 278 ? 13.159  36.564 59.118 1.00 8.90   ? 281 TRP B NE1  1  
ATOM   9244   C  CE2  . TRP B 1 278 ? 12.910  35.232 58.854 1.00 8.48   ? 281 TRP B CE2  1  
ATOM   9245   C  CE3  . TRP B 1 278 ? 12.617  33.897 56.857 1.00 8.39   ? 281 TRP B CE3  1  
ATOM   9246   C  CZ2  . TRP B 1 278 ? 12.725  34.105 59.657 1.00 8.95   ? 281 TRP B CZ2  1  
ATOM   9247   C  CZ3  . TRP B 1 278 ? 12.431  32.761 57.661 1.00 9.37   ? 281 TRP B CZ3  1  
ATOM   9248   C  CH2  . TRP B 1 278 ? 12.485  32.865 59.059 1.00 9.56   ? 281 TRP B CH2  1  
ATOM   9249   H  H    . TRP B 1 278 ? 14.628  35.033 56.527 1.00 0.00   ? 281 TRP B H    1  
ATOM   9250   H  HA   . TRP B 1 278 ? 13.552  35.582 53.833 1.00 0.00   ? 281 TRP B HA   1  
ATOM   9251   H  HB2  . TRP B 1 278 ? 13.485  37.927 55.399 1.00 0.00   ? 281 TRP B HB2  1  
ATOM   9252   H  HB3  . TRP B 1 278 ? 12.138  36.846 55.039 1.00 0.00   ? 281 TRP B HB3  1  
ATOM   9253   H  HD1  . TRP B 1 278 ? 13.456  38.367 57.901 1.00 0.00   ? 281 TRP B HD1  1  
ATOM   9254   H  HE1  . TRP B 1 278 ? 13.246  36.922 60.026 1.00 0.00   ? 281 TRP B HE1  1  
ATOM   9255   H  HE3  . TRP B 1 278 ? 12.574  33.806 55.781 1.00 0.00   ? 281 TRP B HE3  1  
ATOM   9256   H  HZ2  . TRP B 1 278 ? 12.768  34.191 60.732 1.00 0.00   ? 281 TRP B HZ2  1  
ATOM   9257   H  HZ3  . TRP B 1 278 ? 12.245  31.802 57.202 1.00 0.00   ? 281 TRP B HZ3  1  
ATOM   9258   H  HH2  . TRP B 1 278 ? 12.341  31.988 59.672 1.00 0.00   ? 281 TRP B HH2  1  
ATOM   9259   N  N    . PHE B 1 279 ? 15.027  37.976 53.736 1.00 8.60   ? 282 PHE B N    1  
ATOM   9260   C  CA   . PHE B 1 279 ? 16.143  38.830 53.236 1.00 8.33   ? 282 PHE B CA   1  
ATOM   9261   C  C    . PHE B 1 279 ? 15.761  40.316 53.322 1.00 8.27   ? 282 PHE B C    1  
ATOM   9262   O  O    . PHE B 1 279 ? 14.820  40.769 52.700 1.00 9.69   ? 282 PHE B O    1  
ATOM   9263   C  CB   . PHE B 1 279 ? 16.444  38.468 51.781 1.00 8.75   ? 282 PHE B CB   1  
ATOM   9264   C  CG   . PHE B 1 279 ? 17.671  39.216 51.319 1.00 8.99   ? 282 PHE B CG   1  
ATOM   9265   C  CD1  . PHE B 1 279 ? 18.940  38.813 51.750 1.00 9.07   ? 282 PHE B CD1  1  
ATOM   9266   C  CD2  . PHE B 1 279 ? 17.539  40.313 50.459 1.00 10.08  ? 282 PHE B CD2  1  
ATOM   9267   C  CE1  . PHE B 1 279 ? 20.078  39.507 51.322 1.00 8.93   ? 282 PHE B CE1  1  
ATOM   9268   C  CE2  . PHE B 1 279 ? 18.677  41.007 50.031 1.00 10.20  ? 282 PHE B CE2  1  
ATOM   9269   C  CZ   . PHE B 1 279 ? 19.947  40.604 50.462 1.00 9.50   ? 282 PHE B CZ   1  
ATOM   9270   H  H    . PHE B 1 279 ? 14.106  38.309 53.708 1.00 0.00   ? 282 PHE B H    1  
ATOM   9271   H  HA   . PHE B 1 279 ? 17.023  38.653 53.836 1.00 0.00   ? 282 PHE B HA   1  
ATOM   9272   H  HB2  . PHE B 1 279 ? 16.619  37.405 51.703 1.00 0.00   ? 282 PHE B HB2  1  
ATOM   9273   H  HB3  . PHE B 1 279 ? 15.602  38.740 51.161 1.00 0.00   ? 282 PHE B HB3  1  
ATOM   9274   H  HD1  . PHE B 1 279 ? 19.042  37.967 52.413 1.00 0.00   ? 282 PHE B HD1  1  
ATOM   9275   H  HD2  . PHE B 1 279 ? 16.560  40.624 50.126 1.00 0.00   ? 282 PHE B HD2  1  
ATOM   9276   H  HE1  . PHE B 1 279 ? 21.057  39.196 51.654 1.00 0.00   ? 282 PHE B HE1  1  
ATOM   9277   H  HE2  . PHE B 1 279 ? 18.576  41.854 49.367 1.00 0.00   ? 282 PHE B HE2  1  
ATOM   9278   H  HZ   . PHE B 1 279 ? 20.824  41.140 50.132 1.00 0.00   ? 282 PHE B HZ   1  
ATOM   9279   N  N    . ILE B 1 280 ? 16.508  41.074 54.079 1.00 8.16   ? 283 ILE B N    1  
ATOM   9280   C  CA   . ILE B 1 280 ? 16.245  42.531 54.219 1.00 8.36   ? 283 ILE B CA   1  
ATOM   9281   C  C    . ILE B 1 280 ? 17.483  43.264 53.715 1.00 7.51   ? 283 ILE B C    1  
ATOM   9282   O  O    . ILE B 1 280 ? 18.564  43.118 54.251 1.00 8.72   ? 283 ILE B O    1  
ATOM   9283   C  CB   . ILE B 1 280 ? 15.999  42.876 55.689 1.00 8.10   ? 283 ILE B CB   1  
ATOM   9284   C  CG1  . ILE B 1 280 ? 14.742  42.153 56.178 1.00 9.30   ? 283 ILE B CG1  1  
ATOM   9285   C  CG2  . ILE B 1 280 ? 15.806  44.387 55.834 1.00 9.53   ? 283 ILE B CG2  1  
ATOM   9286   C  CD1  . ILE B 1 280 ? 14.665  42.236 57.703 1.00 9.56   ? 283 ILE B CD1  1  
ATOM   9287   H  H    . ILE B 1 280 ? 17.267  40.676 54.554 1.00 0.00   ? 283 ILE B H    1  
ATOM   9288   H  HA   . ILE B 1 280 ? 15.386  42.808 53.624 1.00 0.00   ? 283 ILE B HA   1  
ATOM   9289   H  HB   . ILE B 1 280 ? 16.849  42.564 56.279 1.00 0.00   ? 283 ILE B HB   1  
ATOM   9290   H  HG12 . ILE B 1 280 ? 13.868  42.620 55.747 1.00 0.00   ? 283 ILE B HG12 1  
ATOM   9291   H  HG13 . ILE B 1 280 ? 14.782  41.117 55.877 1.00 0.00   ? 283 ILE B HG13 1  
ATOM   9292   H  HG21 . ILE B 1 280 ? 16.755  44.885 55.708 1.00 0.00   ? 283 ILE B HG21 1  
ATOM   9293   H  HG22 . ILE B 1 280 ? 15.411  44.606 56.815 1.00 0.00   ? 283 ILE B HG22 1  
ATOM   9294   H  HG23 . ILE B 1 280 ? 15.114  44.735 55.081 1.00 0.00   ? 283 ILE B HG23 1  
ATOM   9295   H  HD11 . ILE B 1 280 ? 13.994  43.033 57.987 1.00 0.00   ? 283 ILE B HD11 1  
ATOM   9296   H  HD12 . ILE B 1 280 ? 15.649  42.434 58.103 1.00 0.00   ? 283 ILE B HD12 1  
ATOM   9297   H  HD13 . ILE B 1 280 ? 14.299  41.299 58.097 1.00 0.00   ? 283 ILE B HD13 1  
ATOM   9298   N  N    . PRO B 1 281 ? 17.335  44.005 52.661 1.00 8.05   ? 284 PRO B N    1  
ATOM   9299   C  CA   . PRO B 1 281 ? 18.470  44.738 52.020 1.00 8.21   ? 284 PRO B CA   1  
ATOM   9300   C  C    . PRO B 1 281 ? 18.958  45.959 52.806 1.00 7.86   ? 284 PRO B C    1  
ATOM   9301   O  O    . PRO B 1 281 ? 18.180  46.778 53.254 1.00 8.49   ? 284 PRO B O    1  
ATOM   9302   C  CB   . PRO B 1 281 ? 17.896  45.177 50.672 1.00 8.96   ? 284 PRO B CB   1  
ATOM   9303   C  CG   . PRO B 1 281 ? 16.419  45.255 50.874 1.00 8.80   ? 284 PRO B CG   1  
ATOM   9304   C  CD   . PRO B 1 281 ? 16.065  44.232 51.955 1.00 8.19   ? 284 PRO B CD   1  
ATOM   9305   H  HA   . PRO B 1 281 ? 19.291  44.063 51.846 1.00 0.00   ? 284 PRO B HA   1  
ATOM   9306   H  HB2  . PRO B 1 281 ? 18.291  46.145 50.396 1.00 0.00   ? 284 PRO B HB2  1  
ATOM   9307   H  HB3  . PRO B 1 281 ? 18.125  44.447 49.912 1.00 0.00   ? 284 PRO B HB3  1  
ATOM   9308   H  HG2  . PRO B 1 281 ? 16.144  46.250 51.198 1.00 0.00   ? 284 PRO B HG2  1  
ATOM   9309   H  HG3  . PRO B 1 281 ? 15.905  45.007 49.959 1.00 0.00   ? 284 PRO B HG3  1  
ATOM   9310   H  HD2  . PRO B 1 281 ? 15.321  44.636 52.628 1.00 0.00   ? 284 PRO B HD2  1  
ATOM   9311   H  HD3  . PRO B 1 281 ? 15.718  43.313 51.509 1.00 0.00   ? 284 PRO B HD3  1  
ATOM   9312   N  N    . GLY B 1 282 ? 20.255  46.102 52.943 1.00 8.13   ? 285 GLY B N    1  
ATOM   9313   C  CA   . GLY B 1 282 ? 20.801  47.277 53.654 1.00 7.79   ? 285 GLY B CA   1  
ATOM   9314   C  C    . GLY B 1 282 ? 19.948  48.484 53.295 1.00 8.11   ? 285 GLY B C    1  
ATOM   9315   O  O    . GLY B 1 282 ? 19.537  48.661 52.165 1.00 8.45   ? 285 GLY B O    1  
ATOM   9316   H  H    . GLY B 1 282 ? 20.864  45.442 52.550 1.00 0.00   ? 285 GLY B H    1  
ATOM   9317   H  HA2  . GLY B 1 282 ? 20.766  47.105 54.721 1.00 0.00   ? 285 GLY B HA2  1  
ATOM   9318   H  HA3  . GLY B 1 282 ? 21.819  47.451 53.344 1.00 0.00   ? 285 GLY B HA3  1  
ATOM   9319   N  N    . GLY B 1 283 ? 19.663  49.296 54.253 1.00 8.67   ? 286 GLY B N    1  
ATOM   9320   C  CA   . GLY B 1 283 ? 18.819  50.485 54.012 1.00 8.28   ? 286 GLY B CA   1  
ATOM   9321   C  C    . GLY B 1 283 ? 17.339  50.101 54.122 1.00 8.58   ? 286 GLY B C    1  
ATOM   9322   O  O    . GLY B 1 283 ? 16.501  50.705 53.482 1.00 8.93   ? 286 GLY B O    1  
ATOM   9323   H  H    . GLY B 1 283 ? 19.997  49.114 55.156 1.00 0.00   ? 286 GLY B H    1  
ATOM   9324   H  HA2  . GLY B 1 283 ? 19.050  51.243 54.748 1.00 0.00   ? 286 GLY B HA2  1  
ATOM   9325   H  HA3  . GLY B 1 283 ? 19.013  50.871 53.023 1.00 0.00   ? 286 GLY B HA3  1  
ATOM   9326   N  N    . ALA B 1 284 ? 16.981  49.110 54.918 1.00 8.20   ? 287 ALA B N    1  
ATOM   9327   C  CA   . ALA B 1 284 ? 15.519  48.774 54.993 1.00 8.05   ? 287 ALA B CA   1  
ATOM   9328   C  C    . ALA B 1 284 ? 15.185  47.918 56.221 1.00 7.81   ? 287 ALA B C    1  
ATOM   9329   O  O    . ALA B 1 284 ? 15.985  47.126 56.678 1.00 8.00   ? 287 ALA B O    1  
ATOM   9330   C  CB   . ALA B 1 284 ? 15.119  48.010 53.730 1.00 9.76   ? 287 ALA B CB   1  
ATOM   9331   H  H    . ALA B 1 284 ? 17.644  48.614 55.442 1.00 0.00   ? 287 ALA B H    1  
ATOM   9332   H  HA   . ALA B 1 284 ? 14.951  49.690 55.039 1.00 0.00   ? 287 ALA B HA   1  
ATOM   9333   H  HB1  . ALA B 1 284 ? 15.866  47.261 53.510 1.00 0.00   ? 287 ALA B HB1  1  
ATOM   9334   H  HB2  . ALA B 1 284 ? 15.044  48.698 52.901 1.00 0.00   ? 287 ALA B HB2  1  
ATOM   9335   H  HB3  . ALA B 1 284 ? 14.164  47.530 53.887 1.00 0.00   ? 287 ALA B HB3  1  
ATOM   9336   N  N    . ALA B 1 285 ? 13.981  48.055 56.739 1.00 8.26   ? 288 ALA B N    1  
ATOM   9337   C  CA   . ALA B 1 285 ? 13.573  47.225 57.918 1.00 8.04   ? 288 ALA B CA   1  
ATOM   9338   C  C    . ALA B 1 285 ? 12.372  46.339 57.531 1.00 7.87   ? 288 ALA B C    1  
ATOM   9339   O  O    . ALA B 1 285 ? 11.445  46.794 56.890 1.00 8.42   ? 288 ALA B O    1  
ATOM   9340   C  CB   . ALA B 1 285 ? 13.177  48.143 59.076 1.00 8.60   ? 288 ALA B CB   1  
ATOM   9341   H  H    . ALA B 1 285 ? 13.344  48.684 56.339 1.00 0.00   ? 288 ALA B H    1  
ATOM   9342   H  HA   . ALA B 1 285 ? 14.400  46.598 58.220 1.00 0.00   ? 288 ALA B HA   1  
ATOM   9343   H  HB1  . ALA B 1 285 ? 13.594  49.126 58.914 1.00 0.00   ? 288 ALA B HB1  1  
ATOM   9344   H  HB2  . ALA B 1 285 ? 13.557  47.739 60.002 1.00 0.00   ? 288 ALA B HB2  1  
ATOM   9345   H  HB3  . ALA B 1 285 ? 12.101  48.213 59.128 1.00 0.00   ? 288 ALA B HB3  1  
ATOM   9346   N  N    . GLY B 1 286 ? 12.376  45.079 57.911 1.00 7.96   ? 289 GLY B N    1  
ATOM   9347   C  CA   . GLY B 1 286 ? 11.236  44.197 57.555 1.00 8.34   ? 289 GLY B CA   1  
ATOM   9348   C  C    . GLY B 1 286 ? 10.488  43.792 58.823 1.00 8.44   ? 289 GLY B C    1  
ATOM   9349   O  O    . GLY B 1 286 ? 10.645  44.387 59.871 1.00 8.34   ? 289 GLY B O    1  
ATOM   9350   H  H    . GLY B 1 286 ? 13.130  44.724 58.427 1.00 0.00   ? 289 GLY B H    1  
ATOM   9351   H  HA2  . GLY B 1 286 ? 10.565  44.726 56.893 1.00 0.00   ? 289 GLY B HA2  1  
ATOM   9352   H  HA3  . GLY B 1 286 ? 11.605  43.311 57.062 1.00 0.00   ? 289 GLY B HA3  1  
ATOM   9353   N  N    . ALA B 1 287 ? 9.675   42.782 58.730 1.00 8.51   ? 290 ALA B N    1  
ATOM   9354   C  CA   . ALA B 1 287 ? 8.903   42.318 59.917 1.00 8.60   ? 290 ALA B CA   1  
ATOM   9355   C  C    . ALA B 1 287 ? 8.418   40.879 59.688 1.00 8.30   ? 290 ALA B C    1  
ATOM   9356   O  O    . ALA B 1 287 ? 7.919   40.539 58.633 1.00 9.58   ? 290 ALA B O    1  
ATOM   9357   C  CB   . ALA B 1 287 ? 7.697   43.234 60.131 1.00 9.79   ? 290 ALA B CB   1  
ATOM   9358   H  H    . ALA B 1 287 ? 9.569   42.322 57.871 1.00 0.00   ? 290 ALA B H    1  
ATOM   9359   H  HA   . ALA B 1 287 ? 9.537   42.348 60.792 1.00 0.00   ? 290 ALA B HA   1  
ATOM   9360   H  HB1  . ALA B 1 287 ? 7.958   44.244 59.850 1.00 0.00   ? 290 ALA B HB1  1  
ATOM   9361   H  HB2  . ALA B 1 287 ? 7.409   43.213 61.171 1.00 0.00   ? 290 ALA B HB2  1  
ATOM   9362   H  HB3  . ALA B 1 287 ? 6.873   42.893 59.522 1.00 0.00   ? 290 ALA B HB3  1  
ATOM   9363   N  N    . ALA B 1 288 ? 8.561   40.038 60.676 1.00 8.28   ? 291 ALA B N    1  
ATOM   9364   C  CA   . ALA B 1 288 ? 8.119   38.628 60.550 1.00 8.40   ? 291 ALA B CA   1  
ATOM   9365   C  C    . ALA B 1 288 ? 7.204   38.293 61.729 1.00 8.61   ? 291 ALA B C    1  
ATOM   9366   O  O    . ALA B 1 288 ? 7.475   38.639 62.861 1.00 9.13   ? 291 ALA B O    1  
ATOM   9367   C  CB   . ALA B 1 288 ? 9.338   37.703 60.567 1.00 8.60   ? 291 ALA B CB   1  
ATOM   9368   H  H    . ALA B 1 288 ? 8.965   40.344 61.515 1.00 0.00   ? 291 ALA B H    1  
ATOM   9369   H  HA   . ALA B 1 288 ? 7.578   38.498 59.624 1.00 0.00   ? 291 ALA B HA   1  
ATOM   9370   H  HB1  . ALA B 1 288 ? 9.145   36.865 61.220 1.00 0.00   ? 291 ALA B HB1  1  
ATOM   9371   H  HB2  . ALA B 1 288 ? 10.198  38.249 60.926 1.00 0.00   ? 291 ALA B HB2  1  
ATOM   9372   H  HB3  . ALA B 1 288 ? 9.531   37.344 59.567 1.00 0.00   ? 291 ALA B HB3  1  
ATOM   9373   N  N    . PHE B 1 289 ? 6.121   37.633 61.461 1.00 8.80   ? 292 PHE B N    1  
ATOM   9374   C  CA   . PHE B 1 289 ? 5.162   37.272 62.536 1.00 8.61   ? 292 PHE B CA   1  
ATOM   9375   C  C    . PHE B 1 289 ? 5.110   35.754 62.632 1.00 8.28   ? 292 PHE B C    1  
ATOM   9376   O  O    . PHE B 1 289 ? 4.924   35.070 61.645 1.00 8.95   ? 292 PHE B O    1  
ATOM   9377   C  CB   . PHE B 1 289 ? 3.779   37.819 62.172 1.00 9.37   ? 292 PHE B CB   1  
ATOM   9378   C  CG   . PHE B 1 289 ? 2.806   37.563 63.297 1.00 9.60   ? 292 PHE B CG   1  
ATOM   9379   C  CD1  . PHE B 1 289 ? 2.580   36.258 63.748 1.00 10.77  ? 292 PHE B CD1  1  
ATOM   9380   C  CD2  . PHE B 1 289 ? 2.122   38.635 63.883 1.00 9.96   ? 292 PHE B CD2  1  
ATOM   9381   C  CE1  . PHE B 1 289 ? 1.668   36.024 64.785 1.00 11.56  ? 292 PHE B CE1  1  
ATOM   9382   C  CE2  . PHE B 1 289 ? 1.213   38.402 64.921 1.00 10.72  ? 292 PHE B CE2  1  
ATOM   9383   C  CZ   . PHE B 1 289 ? 0.985   37.097 65.371 1.00 10.97  ? 292 PHE B CZ   1  
ATOM   9384   H  H    . PHE B 1 289 ? 5.928   37.376 60.535 1.00 0.00   ? 292 PHE B H    1  
ATOM   9385   H  HA   . PHE B 1 289 ? 5.488   37.690 63.477 1.00 0.00   ? 292 PHE B HA   1  
ATOM   9386   H  HB2  . PHE B 1 289 ? 3.850   38.882 61.995 1.00 0.00   ? 292 PHE B HB2  1  
ATOM   9387   H  HB3  . PHE B 1 289 ? 3.426   37.330 61.276 1.00 0.00   ? 292 PHE B HB3  1  
ATOM   9388   H  HD1  . PHE B 1 289 ? 3.107   35.431 63.296 1.00 0.00   ? 292 PHE B HD1  1  
ATOM   9389   H  HD2  . PHE B 1 289 ? 2.298   39.642 63.535 1.00 0.00   ? 292 PHE B HD2  1  
ATOM   9390   H  HE1  . PHE B 1 289 ? 1.493   35.017 65.134 1.00 0.00   ? 292 PHE B HE1  1  
ATOM   9391   H  HE2  . PHE B 1 289 ? 0.686   39.230 65.373 1.00 0.00   ? 292 PHE B HE2  1  
ATOM   9392   H  HZ   . PHE B 1 289 ? 0.281   36.918 66.170 1.00 0.00   ? 292 PHE B HZ   1  
ATOM   9393   N  N    . TYR B 1 290 ? 5.296   35.212 63.797 1.00 8.59   ? 293 TYR B N    1  
ATOM   9394   C  CA   . TYR B 1 290 ? 5.279   33.731 63.912 1.00 8.53   ? 293 TYR B CA   1  
ATOM   9395   C  C    . TYR B 1 290 ? 4.701   33.294 65.256 1.00 8.84   ? 293 TYR B C    1  
ATOM   9396   O  O    . TYR B 1 290 ? 5.013   33.838 66.297 1.00 9.55   ? 293 TYR B O    1  
ATOM   9397   C  CB   . TYR B 1 290 ? 6.708   33.199 63.781 1.00 9.06   ? 293 TYR B CB   1  
ATOM   9398   C  CG   . TYR B 1 290 ? 6.732   31.729 64.126 1.00 9.23   ? 293 TYR B CG   1  
ATOM   9399   C  CD1  . TYR B 1 290 ? 6.220   30.790 63.223 1.00 8.94   ? 293 TYR B CD1  1  
ATOM   9400   C  CD2  . TYR B 1 290 ? 7.266   31.306 65.349 1.00 9.11   ? 293 TYR B CD2  1  
ATOM   9401   C  CE1  . TYR B 1 290 ? 6.243   29.427 63.542 1.00 8.87   ? 293 TYR B CE1  1  
ATOM   9402   C  CE2  . TYR B 1 290 ? 7.288   29.943 65.668 1.00 9.07   ? 293 TYR B CE2  1  
ATOM   9403   C  CZ   . TYR B 1 290 ? 6.777   29.004 64.765 1.00 8.87   ? 293 TYR B CZ   1  
ATOM   9404   O  OH   . TYR B 1 290 ? 6.799   27.660 65.080 1.00 9.62   ? 293 TYR B OH   1  
ATOM   9405   H  H    . TYR B 1 290 ? 5.465   35.770 64.585 1.00 0.00   ? 293 TYR B H    1  
ATOM   9406   H  HA   . TYR B 1 290 ? 4.677   33.320 63.116 1.00 0.00   ? 293 TYR B HA   1  
ATOM   9407   H  HB2  . TYR B 1 290 ? 7.052   33.337 62.766 1.00 0.00   ? 293 TYR B HB2  1  
ATOM   9408   H  HB3  . TYR B 1 290 ? 7.355   33.737 64.457 1.00 0.00   ? 293 TYR B HB3  1  
ATOM   9409   H  HD1  . TYR B 1 290 ? 5.808   31.117 62.279 1.00 0.00   ? 293 TYR B HD1  1  
ATOM   9410   H  HD2  . TYR B 1 290 ? 7.661   32.031 66.045 1.00 0.00   ? 293 TYR B HD2  1  
ATOM   9411   H  HE1  . TYR B 1 290 ? 5.848   28.702 62.846 1.00 0.00   ? 293 TYR B HE1  1  
ATOM   9412   H  HE2  . TYR B 1 290 ? 7.700   29.616 66.612 1.00 0.00   ? 293 TYR B HE2  1  
ATOM   9413   H  HH   . TYR B 1 290 ? 7.428   27.533 65.794 1.00 0.00   ? 293 TYR B HH   1  
ATOM   9414   N  N    . THR B 1 291 ? 3.876   32.290 65.225 1.00 9.28   ? 294 THR B N    1  
ATOM   9415   C  CA   . THR B 1 291 ? 3.268   31.754 66.468 1.00 9.78   ? 294 THR B CA   1  
ATOM   9416   C  C    . THR B 1 291 ? 4.107   30.564 66.925 1.00 9.09   ? 294 THR B C    1  
ATOM   9417   O  O    . THR B 1 291 ? 4.256   29.584 66.223 1.00 9.71   ? 294 THR B O    1  
ATOM   9418   C  CB   . THR B 1 291 ? 1.833   31.299 66.188 1.00 10.06  ? 294 THR B CB   1  
ATOM   9419   O  OG1  . THR B 1 291 ? 1.050   32.419 65.801 1.00 11.07  ? 294 THR B OG1  1  
ATOM   9420   C  CG2  . THR B 1 291 ? 1.240   30.669 67.449 1.00 11.43  ? 294 THR B CG2  1  
ATOM   9421   H  H    . THR B 1 291 ? 3.665   31.868 64.366 1.00 0.00   ? 294 THR B H    1  
ATOM   9422   H  HA   . THR B 1 291 ? 3.268   32.517 67.234 1.00 0.00   ? 294 THR B HA   1  
ATOM   9423   H  HB   . THR B 1 291 ? 1.836   30.569 65.394 1.00 0.00   ? 294 THR B HB   1  
ATOM   9424   H  HG1  . THR B 1 291 ? 1.545   33.214 66.012 1.00 0.00   ? 294 THR B HG1  1  
ATOM   9425   H  HG21 . THR B 1 291 ? 1.627   31.176 68.321 1.00 0.00   ? 294 THR B HG21 1  
ATOM   9426   H  HG22 . THR B 1 291 ? 1.509   29.624 67.491 1.00 0.00   ? 294 THR B HG22 1  
ATOM   9427   H  HG23 . THR B 1 291 ? 0.164   30.763 67.427 1.00 0.00   ? 294 THR B HG23 1  
ATOM   9428   N  N    . PHE B 1 292 ? 4.679   30.663 68.081 1.00 9.24   ? 295 PHE B N    1  
ATOM   9429   C  CA   . PHE B 1 292 ? 5.545   29.574 68.597 1.00 9.51   ? 295 PHE B CA   1  
ATOM   9430   C  C    . PHE B 1 292 ? 4.721   28.322 68.857 1.00 9.99   ? 295 PHE B C    1  
ATOM   9431   O  O    . PHE B 1 292 ? 3.610   28.379 69.346 1.00 10.17  ? 295 PHE B O    1  
ATOM   9432   C  CB   . PHE B 1 292 ? 6.206   30.026 69.900 1.00 9.42   ? 295 PHE B CB   1  
ATOM   9433   C  CG   . PHE B 1 292 ? 7.395   30.902 69.585 1.00 9.37   ? 295 PHE B CG   1  
ATOM   9434   C  CD1  . PHE B 1 292 ? 8.657   30.326 69.393 1.00 9.81   ? 295 PHE B CD1  1  
ATOM   9435   C  CD2  . PHE B 1 292 ? 7.236   32.289 69.486 1.00 10.55  ? 295 PHE B CD2  1  
ATOM   9436   C  CE1  . PHE B 1 292 ? 9.759   31.138 69.101 1.00 9.91   ? 295 PHE B CE1  1  
ATOM   9437   C  CE2  . PHE B 1 292 ? 8.338   33.101 69.194 1.00 10.68  ? 295 PHE B CE2  1  
ATOM   9438   C  CZ   . PHE B 1 292 ? 9.600   32.526 69.002 1.00 9.97   ? 295 PHE B CZ   1  
ATOM   9439   H  H    . PHE B 1 292 ? 4.558   31.477 68.612 1.00 0.00   ? 295 PHE B H    1  
ATOM   9440   H  HA   . PHE B 1 292 ? 6.312   29.352 67.869 1.00 0.00   ? 295 PHE B HA   1  
ATOM   9441   H  HB2  . PHE B 1 292 ? 5.493   30.584 70.490 1.00 0.00   ? 295 PHE B HB2  1  
ATOM   9442   H  HB3  . PHE B 1 292 ? 6.535   29.161 70.456 1.00 0.00   ? 295 PHE B HB3  1  
ATOM   9443   H  HD1  . PHE B 1 292 ? 8.780   29.256 69.470 1.00 0.00   ? 295 PHE B HD1  1  
ATOM   9444   H  HD2  . PHE B 1 292 ? 6.262   32.733 69.634 1.00 0.00   ? 295 PHE B HD2  1  
ATOM   9445   H  HE1  . PHE B 1 292 ? 10.732  30.694 68.953 1.00 0.00   ? 295 PHE B HE1  1  
ATOM   9446   H  HE2  . PHE B 1 292 ? 8.215   34.171 69.117 1.00 0.00   ? 295 PHE B HE2  1  
ATOM   9447   H  HZ   . PHE B 1 292 ? 10.450  33.152 68.776 1.00 0.00   ? 295 PHE B HZ   1  
ATOM   9448   N  N    . GLN B 1 293 ? 5.271   27.190 68.542 1.00 10.14  ? 296 GLN B N    1  
ATOM   9449   C  CA   . GLN B 1 293 ? 4.542   25.904 68.775 1.00 10.89  ? 296 GLN B CA   1  
ATOM   9450   C  C    . GLN B 1 293 ? 5.362   24.946 69.676 1.00 10.72  ? 296 GLN B C    1  
ATOM   9451   O  O    . GLN B 1 293 ? 4.832   23.985 70.197 1.00 11.68  ? 296 GLN B O    1  
ATOM   9452   C  CB   . GLN B 1 293 ? 4.280   25.225 67.429 1.00 12.14  ? 296 GLN B CB   1  
ATOM   9453   C  CG   . GLN B 1 293 ? 3.732   26.253 66.437 1.00 16.72  ? 296 GLN B CG   1  
ATOM   9454   C  CD   . GLN B 1 293 ? 2.206   26.156 66.391 1.00 22.56  ? 296 GLN B CD   1  
ATOM   9455   O  OE1  . GLN B 1 293 ? 1.645   25.108 66.644 1.00 27.13  ? 296 GLN B OE1  1  
ATOM   9456   N  NE2  . GLN B 1 293 ? 1.507   27.212 66.078 1.00 26.90  ? 296 GLN B NE2  1  
ATOM   9457   H  H    . GLN B 1 293 ? 6.173   27.176 68.158 1.00 0.00   ? 296 GLN B H    1  
ATOM   9458   H  HA   . GLN B 1 293 ? 3.597   26.116 69.253 1.00 0.00   ? 296 GLN B HA   1  
ATOM   9459   H  HB2  . GLN B 1 293 ? 5.204   24.813 67.049 1.00 0.00   ? 296 GLN B HB2  1  
ATOM   9460   H  HB3  . GLN B 1 293 ? 3.558   24.433 67.560 1.00 0.00   ? 296 GLN B HB3  1  
ATOM   9461   H  HG2  . GLN B 1 293 ? 4.022   27.245 66.750 1.00 0.00   ? 296 GLN B HG2  1  
ATOM   9462   H  HG3  . GLN B 1 293 ? 4.133   26.053 65.454 1.00 0.00   ? 296 GLN B HG3  1  
ATOM   9463   H  HE21 . GLN B 1 293 ? 1.960   28.057 65.874 1.00 0.00   ? 296 GLN B HE21 1  
ATOM   9464   H  HE22 . GLN B 1 293 ? 0.529   27.160 66.046 1.00 0.00   ? 296 GLN B HE22 1  
ATOM   9465   N  N    . GLN B 1 294 ? 6.643   25.182 69.860 1.00 9.69   ? 297 GLN B N    1  
ATOM   9466   C  CA   . GLN B 1 294 ? 7.455   24.269 70.711 1.00 9.63   ? 297 GLN B CA   1  
ATOM   9467   C  C    . GLN B 1 294 ? 8.262   25.089 71.718 1.00 9.74   ? 297 GLN B C    1  
ATOM   9468   O  O    . GLN B 1 294 ? 8.765   26.152 71.410 1.00 9.88   ? 297 GLN B O    1  
ATOM   9469   C  CB   . GLN B 1 294 ? 8.411   23.464 69.828 1.00 9.42   ? 297 GLN B CB   1  
ATOM   9470   C  CG   . GLN B 1 294 ? 7.604   22.620 68.840 1.00 9.40   ? 297 GLN B CG   1  
ATOM   9471   C  CD   . GLN B 1 294 ? 7.470   21.194 69.377 1.00 9.16   ? 297 GLN B CD   1  
ATOM   9472   O  OE1  . GLN B 1 294 ? 7.020   20.990 70.486 1.00 9.64   ? 297 GLN B OE1  1  
ATOM   9473   N  NE2  . GLN B 1 294 ? 7.845   20.191 68.630 1.00 9.38   ? 297 GLN B NE2  1  
ATOM   9474   H  H    . GLN B 1 294 ? 7.065   25.955 69.430 1.00 0.00   ? 297 GLN B H    1  
ATOM   9475   H  HA   . GLN B 1 294 ? 6.800   23.593 71.241 1.00 0.00   ? 297 GLN B HA   1  
ATOM   9476   H  HB2  . GLN B 1 294 ? 9.054   24.141 69.284 1.00 0.00   ? 297 GLN B HB2  1  
ATOM   9477   H  HB3  . GLN B 1 294 ? 9.012   22.815 70.446 1.00 0.00   ? 297 GLN B HB3  1  
ATOM   9478   H  HG2  . GLN B 1 294 ? 6.622   23.053 68.715 1.00 0.00   ? 297 GLN B HG2  1  
ATOM   9479   H  HG3  . GLN B 1 294 ? 8.111   22.597 67.887 1.00 0.00   ? 297 GLN B HG3  1  
ATOM   9480   H  HE21 . GLN B 1 294 ? 8.208   20.355 67.735 1.00 0.00   ? 297 GLN B HE21 1  
ATOM   9481   H  HE22 . GLN B 1 294 ? 7.763   19.274 68.965 1.00 0.00   ? 297 GLN B HE22 1  
ATOM   9482   N  N    . PRO B 1 295 ? 8.374   24.592 72.916 1.00 9.87   ? 298 PRO B N    1  
ATOM   9483   C  CA   . PRO B 1 295 ? 9.116   25.262 74.008 1.00 9.91   ? 298 PRO B CA   1  
ATOM   9484   C  C    . PRO B 1 295 ? 10.604  24.928 73.980 1.00 10.30  ? 298 PRO B C    1  
ATOM   9485   O  O    . PRO B 1 295 ? 11.017  23.919 73.443 1.00 10.77  ? 298 PRO B O    1  
ATOM   9486   C  CB   . PRO B 1 295 ? 8.465   24.694 75.266 1.00 10.24  ? 298 PRO B CB   1  
ATOM   9487   C  CG   . PRO B 1 295 ? 7.995   23.325 74.886 1.00 10.58  ? 298 PRO B CG   1  
ATOM   9488   C  CD   . PRO B 1 295 ? 7.792   23.319 73.365 1.00 10.40  ? 298 PRO B CD   1  
ATOM   9489   H  HA   . PRO B 1 295 ? 8.965   26.327 73.971 1.00 0.00   ? 298 PRO B HA   1  
ATOM   9490   H  HB2  . PRO B 1 295 ? 9.190   24.635 76.067 1.00 0.00   ? 298 PRO B HB2  1  
ATOM   9491   H  HB3  . PRO B 1 295 ? 7.625   25.303 75.562 1.00 0.00   ? 298 PRO B HB3  1  
ATOM   9492   H  HG2  . PRO B 1 295 ? 8.738   22.591 75.165 1.00 0.00   ? 298 PRO B HG2  1  
ATOM   9493   H  HG3  . PRO B 1 295 ? 7.059   23.107 75.376 1.00 0.00   ? 298 PRO B HG3  1  
ATOM   9494   H  HD2  . PRO B 1 295 ? 8.314   22.483 72.919 1.00 0.00   ? 298 PRO B HD2  1  
ATOM   9495   H  HD3  . PRO B 1 295 ? 6.741   23.284 73.123 1.00 0.00   ? 298 PRO B HD3  1  
ATOM   9496   N  N    . GLY B 1 296 ? 11.410  25.766 74.557 1.00 10.12  ? 299 GLY B N    1  
ATOM   9497   C  CA   . GLY B 1 296 ? 12.873  25.502 74.571 1.00 10.50  ? 299 GLY B CA   1  
ATOM   9498   C  C    . GLY B 1 296 ? 13.622  26.787 74.225 1.00 10.71  ? 299 GLY B C    1  
ATOM   9499   O  O    . GLY B 1 296 ? 13.073  27.870 74.264 1.00 11.48  ? 299 GLY B O    1  
ATOM   9500   H  H    . GLY B 1 296 ? 11.054  26.572 74.986 1.00 0.00   ? 299 GLY B H    1  
ATOM   9501   H  HA2  . GLY B 1 296 ? 13.168  25.163 75.554 1.00 0.00   ? 299 GLY B HA2  1  
ATOM   9502   H  HA3  . GLY B 1 296 ? 13.110  24.744 73.840 1.00 0.00   ? 299 GLY B HA3  1  
ATOM   9503   N  N    . ILE B 1 297 ? 14.873  26.674 73.886 1.00 11.50  ? 300 ILE B N    1  
ATOM   9504   C  CA   . ILE B 1 297 ? 15.665  27.886 73.535 1.00 11.95  ? 300 ILE B CA   1  
ATOM   9505   C  C    . ILE B 1 297 ? 15.936  27.905 72.028 1.00 11.57  ? 300 ILE B C    1  
ATOM   9506   O  O    . ILE B 1 297 ? 16.459  26.962 71.468 1.00 13.74  ? 300 ILE B O    1  
ATOM   9507   C  CB   . ILE B 1 297 ? 16.994  27.863 74.291 1.00 12.78  ? 300 ILE B CB   1  
ATOM   9508   C  CG1  . ILE B 1 297 ? 16.723  27.760 75.794 1.00 15.98  ? 300 ILE B CG1  1  
ATOM   9509   C  CG2  . ILE B 1 297 ? 17.770  29.149 74.002 1.00 14.88  ? 300 ILE B CG2  1  
ATOM   9510   C  CD1  . ILE B 1 297 ? 15.937  28.989 76.257 1.00 18.30  ? 300 ILE B CD1  1  
ATOM   9511   H  H    . ILE B 1 297 ? 15.295  25.790 73.861 1.00 0.00   ? 300 ILE B H    1  
ATOM   9512   H  HA   . ILE B 1 297 ? 15.110  28.771 73.811 1.00 0.00   ? 300 ILE B HA   1  
ATOM   9513   H  HB   . ILE B 1 297 ? 17.576  27.012 73.969 1.00 0.00   ? 300 ILE B HB   1  
ATOM   9514   H  HG12 . ILE B 1 297 ? 16.148  26.867 75.995 1.00 0.00   ? 300 ILE B HG12 1  
ATOM   9515   H  HG13 . ILE B 1 297 ? 17.660  27.713 76.327 1.00 0.00   ? 300 ILE B HG13 1  
ATOM   9516   H  HG21 . ILE B 1 297 ? 18.313  29.449 74.886 1.00 0.00   ? 300 ILE B HG21 1  
ATOM   9517   H  HG22 . ILE B 1 297 ? 17.079  29.931 73.721 1.00 0.00   ? 300 ILE B HG22 1  
ATOM   9518   H  HG23 . ILE B 1 297 ? 18.465  28.976 73.193 1.00 0.00   ? 300 ILE B HG23 1  
ATOM   9519   H  HD11 . ILE B 1 297 ? 16.279  29.859 75.716 1.00 0.00   ? 300 ILE B HD11 1  
ATOM   9520   H  HD12 . ILE B 1 297 ? 16.093  29.138 77.315 1.00 0.00   ? 300 ILE B HD12 1  
ATOM   9521   H  HD13 . ILE B 1 297 ? 14.885  28.836 76.066 1.00 0.00   ? 300 ILE B HD13 1  
ATOM   9522   N  N    . TYR B 1 298 ? 15.585  28.976 71.370 1.00 10.66  ? 301 TYR B N    1  
ATOM   9523   C  CA   . TYR B 1 298 ? 15.819  29.070 69.905 1.00 9.67   ? 301 TYR B CA   1  
ATOM   9524   C  C    . TYR B 1 298 ? 16.724  30.268 69.619 1.00 9.51   ? 301 TYR B C    1  
ATOM   9525   O  O    . TYR B 1 298 ? 16.648  31.289 70.273 1.00 10.49  ? 301 TYR B O    1  
ATOM   9526   C  CB   . TYR B 1 298 ? 14.482  29.254 69.184 1.00 9.66   ? 301 TYR B CB   1  
ATOM   9527   C  CG   . TYR B 1 298 ? 13.608  28.048 69.428 1.00 9.40   ? 301 TYR B CG   1  
ATOM   9528   C  CD1  . TYR B 1 298 ? 13.323  27.642 70.737 1.00 9.83   ? 301 TYR B CD1  1  
ATOM   9529   C  CD2  . TYR B 1 298 ? 13.081  27.335 68.344 1.00 10.02  ? 301 TYR B CD2  1  
ATOM   9530   C  CE1  . TYR B 1 298 ? 12.513  26.523 70.963 1.00 9.70   ? 301 TYR B CE1  1  
ATOM   9531   C  CE2  . TYR B 1 298 ? 12.271  26.216 68.570 1.00 9.36   ? 301 TYR B CE2  1  
ATOM   9532   C  CZ   . TYR B 1 298 ? 11.986  25.810 69.879 1.00 10.20  ? 301 TYR B CZ   1  
ATOM   9533   O  OH   . TYR B 1 298 ? 11.187  24.707 70.102 1.00 10.19  ? 301 TYR B OH   1  
ATOM   9534   H  H    . TYR B 1 298 ? 15.167  29.724 71.845 1.00 0.00   ? 301 TYR B H    1  
ATOM   9535   H  HA   . TYR B 1 298 ? 16.296  28.166 69.557 1.00 0.00   ? 301 TYR B HA   1  
ATOM   9536   H  HB2  . TYR B 1 298 ? 13.989  30.139 69.561 1.00 0.00   ? 301 TYR B HB2  1  
ATOM   9537   H  HB3  . TYR B 1 298 ? 14.657  29.363 68.124 1.00 0.00   ? 301 TYR B HB3  1  
ATOM   9538   H  HD1  . TYR B 1 298 ? 13.729  28.192 71.573 1.00 0.00   ? 301 TYR B HD1  1  
ATOM   9539   H  HD2  . TYR B 1 298 ? 13.301  27.647 67.334 1.00 0.00   ? 301 TYR B HD2  1  
ATOM   9540   H  HE1  . TYR B 1 298 ? 12.293  26.210 71.973 1.00 0.00   ? 301 TYR B HE1  1  
ATOM   9541   H  HE2  . TYR B 1 298 ? 11.865  25.666 67.734 1.00 0.00   ? 301 TYR B HE2  1  
ATOM   9542   H  HH   . TYR B 1 298 ? 10.271  24.984 70.023 1.00 0.00   ? 301 TYR B HH   1  
ATOM   9543   N  N    . ALA B 1 299 ? 17.582  30.148 68.649 1.00 9.48   ? 302 ALA B N    1  
ATOM   9544   C  CA   . ALA B 1 299 ? 18.498  31.267 68.315 1.00 9.53   ? 302 ALA B CA   1  
ATOM   9545   C  C    . ALA B 1 299 ? 17.969  31.971 67.076 1.00 10.30  ? 302 ALA B C    1  
ATOM   9546   O  O    . ALA B 1 299 ? 17.561  31.342 66.119 1.00 13.30  ? 302 ALA B O    1  
ATOM   9547   C  CB   . ALA B 1 299 ? 19.899  30.718 68.036 1.00 9.75   ? 302 ALA B CB   1  
ATOM   9548   H  H    . ALA B 1 299 ? 17.626  29.313 68.138 1.00 0.00   ? 302 ALA B H    1  
ATOM   9549   H  HA   . ALA B 1 299 ? 18.538  31.963 69.140 1.00 0.00   ? 302 ALA B HA   1  
ATOM   9550   H  HB1  . ALA B 1 299 ? 20.474  30.716 68.951 1.00 0.00   ? 302 ALA B HB1  1  
ATOM   9551   H  HB2  . ALA B 1 299 ? 20.391  31.342 67.304 1.00 0.00   ? 302 ALA B HB2  1  
ATOM   9552   H  HB3  . ALA B 1 299 ? 19.822  29.710 67.657 1.00 0.00   ? 302 ALA B HB3  1  
ATOM   9553   N  N    . TYR B 1 300 ? 17.953  33.267 67.084 1.00 9.09   ? 303 TYR B N    1  
ATOM   9554   C  CA   . TYR B 1 300 ? 17.428  33.996 65.903 1.00 8.43   ? 303 TYR B CA   1  
ATOM   9555   C  C    . TYR B 1 300 ? 18.576  34.788 65.352 1.00 8.32   ? 303 TYR B C    1  
ATOM   9556   O  O    . TYR B 1 300 ? 19.128  35.628 66.034 1.00 8.33   ? 303 TYR B O    1  
ATOM   9557   C  CB   . TYR B 1 300 ? 16.298  34.937 66.327 1.00 8.37   ? 303 TYR B CB   1  
ATOM   9558   C  CG   . TYR B 1 300 ? 16.081  35.979 65.256 1.00 7.27   ? 303 TYR B CG   1  
ATOM   9559   C  CD1  . TYR B 1 300 ? 16.881  37.128 65.226 1.00 8.75   ? 303 TYR B CD1  1  
ATOM   9560   C  CD2  . TYR B 1 300 ? 15.081  35.797 64.293 1.00 8.69   ? 303 TYR B CD2  1  
ATOM   9561   C  CE1  . TYR B 1 300 ? 16.680  38.094 64.233 1.00 8.85   ? 303 TYR B CE1  1  
ATOM   9562   C  CE2  . TYR B 1 300 ? 14.881  36.763 63.301 1.00 8.70   ? 303 TYR B CE2  1  
ATOM   9563   C  CZ   . TYR B 1 300 ? 15.680  37.912 63.270 1.00 7.84   ? 303 TYR B CZ   1  
ATOM   9564   O  OH   . TYR B 1 300 ? 15.483  38.865 62.292 1.00 8.68   ? 303 TYR B OH   1  
ATOM   9565   H  H    . TYR B 1 300 ? 18.274  33.761 67.867 1.00 0.00   ? 303 TYR B H    1  
ATOM   9566   H  HA   . TYR B 1 300 ? 17.072  33.294 65.162 1.00 0.00   ? 303 TYR B HA   1  
ATOM   9567   H  HB2  . TYR B 1 300 ? 15.389  34.368 66.465 1.00 0.00   ? 303 TYR B HB2  1  
ATOM   9568   H  HB3  . TYR B 1 300 ? 16.563  35.423 67.253 1.00 0.00   ? 303 TYR B HB3  1  
ATOM   9569   H  HD1  . TYR B 1 300 ? 17.653  37.268 65.968 1.00 0.00   ? 303 TYR B HD1  1  
ATOM   9570   H  HD2  . TYR B 1 300 ? 14.464  34.910 64.317 1.00 0.00   ? 303 TYR B HD2  1  
ATOM   9571   H  HE1  . TYR B 1 300 ? 17.297  38.980 64.210 1.00 0.00   ? 303 TYR B HE1  1  
ATOM   9572   H  HE2  . TYR B 1 300 ? 14.109  36.622 62.558 1.00 0.00   ? 303 TYR B HE2  1  
ATOM   9573   H  HH   . TYR B 1 300 ? 14.701  39.371 62.524 1.00 0.00   ? 303 TYR B HH   1  
ATOM   9574   N  N    . VAL B 1 301 ? 19.010  34.520 64.163 1.00 7.79   ? 304 VAL B N    1  
ATOM   9575   C  CA   . VAL B 1 301 ? 20.192  35.295 63.724 1.00 8.10   ? 304 VAL B CA   1  
ATOM   9576   C  C    . VAL B 1 301 ? 20.337  35.356 62.219 1.00 8.01   ? 304 VAL B C    1  
ATOM   9577   O  O    . VAL B 1 301 ? 19.647  34.699 61.465 1.00 8.43   ? 304 VAL B O    1  
ATOM   9578   C  CB   . VAL B 1 301 ? 21.441  34.637 64.310 1.00 8.01   ? 304 VAL B CB   1  
ATOM   9579   C  CG1  . VAL B 1 301 ? 21.081  33.934 65.620 1.00 8.82   ? 304 VAL B CG1  1  
ATOM   9580   C  CG2  . VAL B 1 301 ? 21.985  33.608 63.316 1.00 8.63   ? 304 VAL B CG2  1  
ATOM   9581   H  H    . VAL B 1 301 ? 18.614  33.815 63.610 1.00 0.00   ? 304 VAL B H    1  
ATOM   9582   H  HA   . VAL B 1 301 ? 20.120  36.298 64.112 1.00 0.00   ? 304 VAL B HA   1  
ATOM   9583   H  HB   . VAL B 1 301 ? 22.189  35.388 64.499 1.00 0.00   ? 304 VAL B HB   1  
ATOM   9584   H  HG11 . VAL B 1 301 ? 21.986  33.625 66.123 1.00 0.00   ? 304 VAL B HG11 1  
ATOM   9585   H  HG12 . VAL B 1 301 ? 20.473  33.067 65.409 1.00 0.00   ? 304 VAL B HG12 1  
ATOM   9586   H  HG13 . VAL B 1 301 ? 20.531  34.613 66.254 1.00 0.00   ? 304 VAL B HG13 1  
ATOM   9587   H  HG21 . VAL B 1 301 ? 21.274  32.802 63.207 1.00 0.00   ? 304 VAL B HG21 1  
ATOM   9588   H  HG22 . VAL B 1 301 ? 22.922  33.215 63.682 1.00 0.00   ? 304 VAL B HG22 1  
ATOM   9589   H  HG23 . VAL B 1 301 ? 22.142  34.081 62.358 1.00 0.00   ? 304 VAL B HG23 1  
ATOM   9590   N  N    . ASN B 1 302 ? 21.271  36.153 61.801 1.00 7.56   ? 305 ASN B N    1  
ATOM   9591   C  CA   . ASN B 1 302 ? 21.558  36.313 60.366 1.00 7.54   ? 305 ASN B CA   1  
ATOM   9592   C  C    . ASN B 1 302 ? 22.076  34.982 59.902 1.00 7.54   ? 305 ASN B C    1  
ATOM   9593   O  O    . ASN B 1 302 ? 22.942  34.392 60.517 1.00 8.15   ? 305 ASN B O    1  
ATOM   9594   C  CB   . ASN B 1 302 ? 22.622  37.393 60.158 1.00 7.64   ? 305 ASN B CB   1  
ATOM   9595   C  CG   . ASN B 1 302 ? 22.936  37.521 58.666 1.00 7.90   ? 305 ASN B CG   1  
ATOM   9596   O  OD1  . ASN B 1 302 ? 22.632  36.636 57.891 1.00 8.69   ? 305 ASN B OD1  1  
ATOM   9597   N  ND2  . ASN B 1 302 ? 23.535  38.595 58.228 1.00 8.24   ? 305 ASN B ND2  1  
ATOM   9598   H  H    . ASN B 1 302 ? 21.807  36.648 62.455 1.00 0.00   ? 305 ASN B H    1  
ATOM   9599   H  HA   . ASN B 1 302 ? 20.655  36.568 59.831 1.00 0.00   ? 305 ASN B HA   1  
ATOM   9600   H  HB2  . ASN B 1 302 ? 22.254  38.337 60.532 1.00 0.00   ? 305 ASN B HB2  1  
ATOM   9601   H  HB3  . ASN B 1 302 ? 23.521  37.120 60.690 1.00 0.00   ? 305 ASN B HB3  1  
ATOM   9602   H  HD21 . ASN B 1 302 ? 23.780  39.309 58.853 1.00 0.00   ? 305 ASN B HD21 1  
ATOM   9603   H  HD22 . ASN B 1 302 ? 23.740  38.687 57.274 1.00 0.00   ? 305 ASN B HD22 1  
ATOM   9604   N  N    . HIS B 1 303 ? 21.524  34.465 58.873 1.00 7.44   ? 306 HIS B N    1  
ATOM   9605   C  CA   . HIS B 1 303 ? 21.966  33.116 58.439 1.00 7.16   ? 306 HIS B CA   1  
ATOM   9606   C  C    . HIS B 1 303 ? 23.426  33.192 58.106 1.00 7.61   ? 306 HIS B C    1  
ATOM   9607   O  O    . HIS B 1 303 ? 24.199  32.385 58.584 1.00 8.22   ? 306 HIS B O    1  
ATOM   9608   C  CB   . HIS B 1 303 ? 21.162  32.560 57.255 1.00 7.83   ? 306 HIS B CB   1  
ATOM   9609   C  CG   . HIS B 1 303 ? 21.049  31.048 57.414 1.00 7.55   ? 306 HIS B CG   1  
ATOM   9610   N  ND1  . HIS B 1 303 ? 21.603  30.149 56.501 1.00 7.47   ? 306 HIS B ND1  1  
ATOM   9611   C  CD2  . HIS B 1 303 ? 20.474  30.262 58.384 1.00 7.69   ? 306 HIS B CD2  1  
ATOM   9612   C  CE1  . HIS B 1 303 ? 21.353  28.904 56.932 1.00 7.86   ? 306 HIS B CE1  1  
ATOM   9613   N  NE2  . HIS B 1 303 ? 20.677  28.938 58.070 1.00 8.14   ? 306 HIS B NE2  1  
ATOM   9614   H  H    . HIS B 1 303 ? 20.792  34.925 58.411 1.00 0.00   ? 306 HIS B H    1  
ATOM   9615   H  HA   . HIS B 1 303 ? 21.851  32.442 59.279 1.00 0.00   ? 306 HIS B HA   1  
ATOM   9616   H  HB2  . HIS B 1 303 ? 20.176  33.002 57.248 1.00 0.00   ? 306 HIS B HB2  1  
ATOM   9617   H  HB3  . HIS B 1 303 ? 21.671  32.789 56.331 1.00 0.00   ? 306 HIS B HB3  1  
ATOM   9618   H  HD1  . HIS B 1 303 ? 22.090  30.388 55.684 1.00 0.00   ? 306 HIS B HD1  1  
ATOM   9619   H  HD2  . HIS B 1 303 ? 19.946  30.625 59.254 1.00 0.00   ? 306 HIS B HD2  1  
ATOM   9620   H  HE1  . HIS B 1 303 ? 21.661  28.001 56.423 1.00 0.00   ? 306 HIS B HE1  1  
ATOM   9621   N  N    . ASN B 1 304 ? 23.877  34.157 57.349 1.00 7.35   ? 307 ASN B N    1  
ATOM   9622   C  CA   . ASN B 1 304 ? 25.364  34.136 57.166 1.00 7.68   ? 307 ASN B CA   1  
ATOM   9623   C  C    . ASN B 1 304 ? 25.946  33.471 58.453 1.00 7.36   ? 307 ASN B C    1  
ATOM   9624   O  O    . ASN B 1 304 ? 26.202  34.139 59.435 1.00 7.81   ? 307 ASN B O    1  
ATOM   9625   C  CB   . ASN B 1 304 ? 25.895  35.566 57.029 1.00 8.22   ? 307 ASN B CB   1  
ATOM   9626   C  CG   . ASN B 1 304 ? 27.082  35.580 56.064 1.00 8.72   ? 307 ASN B CG   1  
ATOM   9627   O  OD1  . ASN B 1 304 ? 28.105  34.983 56.333 1.00 10.78  ? 307 ASN B OD1  1  
ATOM   9628   N  ND2  . ASN B 1 304 ? 26.988  36.241 54.943 1.00 10.03  ? 307 ASN B ND2  1  
ATOM   9629   H  H    . ASN B 1 304 ? 23.302  34.857 56.976 1.00 0.00   ? 307 ASN B H    1  
ATOM   9630   H  HA   . ASN B 1 304 ? 25.623  33.549 56.294 1.00 0.00   ? 307 ASN B HA   1  
ATOM   9631   H  HB2  . ASN B 1 304 ? 25.112  36.205 56.647 1.00 0.00   ? 307 ASN B HB2  1  
ATOM   9632   H  HB3  . ASN B 1 304 ? 26.215  35.925 57.995 1.00 0.00   ? 307 ASN B HB3  1  
ATOM   9633   H  HD21 . ASN B 1 304 ? 26.163  36.722 54.725 1.00 0.00   ? 307 ASN B HD21 1  
ATOM   9634   H  HD22 . ASN B 1 304 ? 27.743  36.256 54.318 1.00 0.00   ? 307 ASN B HD22 1  
ATOM   9635   N  N    . LEU B 1 305 ? 26.084  32.149 58.478 1.00 7.45   ? 308 LEU B N    1  
ATOM   9636   C  CA   . LEU B 1 305 ? 26.554  31.444 59.706 1.00 7.51   ? 308 LEU B CA   1  
ATOM   9637   C  C    . LEU B 1 305 ? 27.760  32.152 60.266 1.00 7.64   ? 308 LEU B C    1  
ATOM   9638   O  O    . LEU B 1 305 ? 27.879  32.379 61.454 1.00 8.35   ? 308 LEU B O    1  
ATOM   9639   C  CB   . LEU B 1 305 ? 26.927  30.002 59.354 1.00 7.55   ? 308 LEU B CB   1  
ATOM   9640   C  CG   . LEU B 1 305 ? 25.661  29.214 59.018 1.00 8.79   ? 308 LEU B CG   1  
ATOM   9641   C  CD1  . LEU B 1 305 ? 26.016  27.741 58.808 1.00 10.48  ? 308 LEU B CD1  1  
ATOM   9642   C  CD2  . LEU B 1 305 ? 24.664  29.337 60.173 1.00 10.39  ? 308 LEU B CD2  1  
ATOM   9643   H  H    . LEU B 1 305 ? 25.820  31.624 57.694 1.00 0.00   ? 308 LEU B H    1  
ATOM   9644   H  HA   . LEU B 1 305 ? 25.765  31.439 60.442 1.00 0.00   ? 308 LEU B HA   1  
ATOM   9645   H  HB2  . LEU B 1 305 ? 27.591  30.000 58.501 1.00 0.00   ? 308 LEU B HB2  1  
ATOM   9646   H  HB3  . LEU B 1 305 ? 27.422  29.543 60.196 1.00 0.00   ? 308 LEU B HB3  1  
ATOM   9647   H  HG   . LEU B 1 305 ? 25.220  29.610 58.115 1.00 0.00   ? 308 LEU B HG   1  
ATOM   9648   H  HD11 . LEU B 1 305 ? 26.943  27.669 58.260 1.00 0.00   ? 308 LEU B HD11 1  
ATOM   9649   H  HD12 . LEU B 1 305 ? 25.228  27.257 58.250 1.00 0.00   ? 308 LEU B HD12 1  
ATOM   9650   H  HD13 . LEU B 1 305 ? 26.127  27.257 59.768 1.00 0.00   ? 308 LEU B HD13 1  
ATOM   9651   H  HD21 . LEU B 1 305 ? 25.179  29.680 61.058 1.00 0.00   ? 308 LEU B HD21 1  
ATOM   9652   H  HD22 . LEU B 1 305 ? 24.216  28.373 60.367 1.00 0.00   ? 308 LEU B HD22 1  
ATOM   9653   H  HD23 . LEU B 1 305 ? 23.892  30.045 59.908 1.00 0.00   ? 308 LEU B HD23 1  
ATOM   9654   N  N    . ILE B 1 306 ? 28.653  32.498 59.415 1.00 7.51   ? 309 ILE B N    1  
ATOM   9655   C  CA   . ILE B 1 306 ? 29.883  33.200 59.869 1.00 7.92   ? 309 ILE B CA   1  
ATOM   9656   C  C    . ILE B 1 306 ? 29.474  34.488 60.566 1.00 7.64   ? 309 ILE B C    1  
ATOM   9657   O  O    . ILE B 1 306 ? 29.894  34.774 61.670 1.00 8.10   ? 309 ILE B O    1  
ATOM   9658   C  CB   . ILE B 1 306 ? 30.764  33.527 58.661 1.00 7.93   ? 309 ILE B CB   1  
ATOM   9659   C  CG1  . ILE B 1 306 ? 31.133  32.231 57.935 1.00 8.53   ? 309 ILE B CG1  1  
ATOM   9660   C  CG2  . ILE B 1 306 ? 32.040  34.226 59.134 1.00 8.97   ? 309 ILE B CG2  1  
ATOM   9661   C  CD1  . ILE B 1 306 ? 31.826  32.566 56.613 1.00 8.87   ? 309 ILE B CD1  1  
ATOM   9662   H  H    . ILE B 1 306 ? 28.526  32.298 58.464 1.00 0.00   ? 309 ILE B H    1  
ATOM   9663   H  HA   . ILE B 1 306 ? 30.428  32.571 60.557 1.00 0.00   ? 309 ILE B HA   1  
ATOM   9664   H  HB   . ILE B 1 306 ? 30.225  34.179 57.989 1.00 0.00   ? 309 ILE B HB   1  
ATOM   9665   H  HG12 . ILE B 1 306 ? 31.799  31.649 58.554 1.00 0.00   ? 309 ILE B HG12 1  
ATOM   9666   H  HG13 . ILE B 1 306 ? 30.237  31.663 57.735 1.00 0.00   ? 309 ILE B HG13 1  
ATOM   9667   H  HG21 . ILE B 1 306 ? 32.878  33.881 58.546 1.00 0.00   ? 309 ILE B HG21 1  
ATOM   9668   H  HG22 . ILE B 1 306 ? 32.212  33.996 60.175 1.00 0.00   ? 309 ILE B HG22 1  
ATOM   9669   H  HG23 . ILE B 1 306 ? 31.931  35.293 59.013 1.00 0.00   ? 309 ILE B HG23 1  
ATOM   9670   H  HD11 . ILE B 1 306 ? 32.111  31.652 56.114 1.00 0.00   ? 309 ILE B HD11 1  
ATOM   9671   H  HD12 . ILE B 1 306 ? 32.706  33.160 56.808 1.00 0.00   ? 309 ILE B HD12 1  
ATOM   9672   H  HD13 . ILE B 1 306 ? 31.148  33.123 55.982 1.00 0.00   ? 309 ILE B HD13 1  
ATOM   9673   N  N    . GLU B 1 307 ? 28.638  35.260 59.936 1.00 7.72   ? 310 GLU B N    1  
ATOM   9674   C  CA   . GLU B 1 307 ? 28.177  36.531 60.573 1.00 8.10   ? 310 GLU B CA   1  
ATOM   9675   C  C    . GLU B 1 307 ? 27.387  36.244 61.872 1.00 7.95   ? 310 GLU B C    1  
ATOM   9676   O  O    . GLU B 1 307 ? 27.439  37.011 62.812 1.00 8.67   ? 310 GLU B O    1  
ATOM   9677   C  CB   . GLU B 1 307 ? 27.278  37.288 59.593 1.00 7.60   ? 310 GLU B CB   1  
ATOM   9678   C  CG   . GLU B 1 307 ? 27.866  37.197 58.184 1.00 9.50   ? 310 GLU B CG   1  
ATOM   9679   C  CD   . GLU B 1 307 ? 26.829  37.672 57.165 1.00 13.32  ? 310 GLU B CD   1  
ATOM   9680   O  OE1  . GLU B 1 307 ? 25.669  37.768 57.531 1.00 17.25  ? 310 GLU B OE1  1  
ATOM   9681   O  OE2  . GLU B 1 307 ? 27.212  37.931 56.037 1.00 15.46  ? 310 GLU B OE2  1  
ATOM   9682   H  H    . GLU B 1 307 ? 28.301  35.003 59.052 1.00 0.00   ? 310 GLU B H    1  
ATOM   9683   H  HA   . GLU B 1 307 ? 29.036  37.142 60.808 1.00 0.00   ? 310 GLU B HA   1  
ATOM   9684   H  HB2  . GLU B 1 307 ? 26.290  36.850 59.601 1.00 0.00   ? 310 GLU B HB2  1  
ATOM   9685   H  HB3  . GLU B 1 307 ? 27.215  38.324 59.889 1.00 0.00   ? 310 GLU B HB3  1  
ATOM   9686   H  HG2  . GLU B 1 307 ? 28.746  37.820 58.121 1.00 0.00   ? 310 GLU B HG2  1  
ATOM   9687   H  HG3  . GLU B 1 307 ? 28.134  36.173 57.971 1.00 0.00   ? 310 GLU B HG3  1  
ATOM   9688   N  N    . ALA B 1 308 ? 26.643  35.161 61.931 1.00 7.49   ? 311 ALA B N    1  
ATOM   9689   C  CA   . ALA B 1 308 ? 25.847  34.858 63.165 1.00 8.29   ? 311 ALA B CA   1  
ATOM   9690   C  C    . ALA B 1 308 ? 26.672  34.183 64.300 1.00 8.60   ? 311 ALA B C    1  
ATOM   9691   O  O    . ALA B 1 308 ? 26.305  34.294 65.453 1.00 10.21  ? 311 ALA B O    1  
ATOM   9692   C  CB   . ALA B 1 308 ? 24.690  33.934 62.785 1.00 8.75   ? 311 ALA B CB   1  
ATOM   9693   H  H    . ALA B 1 308 ? 26.599  34.556 61.161 1.00 0.00   ? 311 ALA B H    1  
ATOM   9694   H  HA   . ALA B 1 308 ? 25.434  35.781 63.543 1.00 0.00   ? 311 ALA B HA   1  
ATOM   9695   H  HB1  . ALA B 1 308 ? 24.652  33.103 63.474 1.00 0.00   ? 311 ALA B HB1  1  
ATOM   9696   H  HB2  . ALA B 1 308 ? 24.840  33.563 61.782 1.00 0.00   ? 311 ALA B HB2  1  
ATOM   9697   H  HB3  . ALA B 1 308 ? 23.761  34.483 62.831 1.00 0.00   ? 311 ALA B HB3  1  
ATOM   9698   N  N    . PHE B 1 309 ? 27.743  33.458 64.027 1.00 8.71   ? 312 PHE B N    1  
ATOM   9699   C  CA   . PHE B 1 309 ? 28.465  32.798 65.156 1.00 9.51   ? 312 PHE B CA   1  
ATOM   9700   C  C    . PHE B 1 309 ? 29.847  33.409 65.337 1.00 10.30  ? 312 PHE B C    1  
ATOM   9701   O  O    . PHE B 1 309 ? 30.320  33.592 66.441 1.00 13.32  ? 312 PHE B O    1  
ATOM   9702   C  CB   . PHE B 1 309 ? 28.609  31.304 64.859 1.00 9.09   ? 312 PHE B CB   1  
ATOM   9703   C  CG   . PHE B 1 309 ? 27.275  30.622 65.050 1.00 9.11   ? 312 PHE B CG   1  
ATOM   9704   C  CD1  . PHE B 1 309 ? 26.738  30.484 66.335 1.00 11.37  ? 312 PHE B CD1  1  
ATOM   9705   C  CD2  . PHE B 1 309 ? 26.577  30.127 63.942 1.00 10.57  ? 312 PHE B CD2  1  
ATOM   9706   C  CE1  . PHE B 1 309 ? 25.501  29.851 66.513 1.00 12.55  ? 312 PHE B CE1  1  
ATOM   9707   C  CE2  . PHE B 1 309 ? 25.341  29.494 64.120 1.00 10.89  ? 312 PHE B CE2  1  
ATOM   9708   C  CZ   . PHE B 1 309 ? 24.803  29.357 65.405 1.00 11.66  ? 312 PHE B CZ   1  
ATOM   9709   H  H    . PHE B 1 309 ? 28.039  33.331 63.101 1.00 0.00   ? 312 PHE B H    1  
ATOM   9710   H  HA   . PHE B 1 309 ? 27.897  32.925 66.065 1.00 0.00   ? 312 PHE B HA   1  
ATOM   9711   H  HB2  . PHE B 1 309 ? 28.939  31.170 63.839 1.00 0.00   ? 312 PHE B HB2  1  
ATOM   9712   H  HB3  . PHE B 1 309 ? 29.333  30.871 65.532 1.00 0.00   ? 312 PHE B HB3  1  
ATOM   9713   H  HD1  . PHE B 1 309 ? 27.276  30.865 67.190 1.00 0.00   ? 312 PHE B HD1  1  
ATOM   9714   H  HD2  . PHE B 1 309 ? 26.992  30.233 62.951 1.00 0.00   ? 312 PHE B HD2  1  
ATOM   9715   H  HE1  . PHE B 1 309 ? 25.086  29.745 67.504 1.00 0.00   ? 312 PHE B HE1  1  
ATOM   9716   H  HE2  . PHE B 1 309 ? 24.802  29.113 63.265 1.00 0.00   ? 312 PHE B HE2  1  
ATOM   9717   H  HZ   . PHE B 1 309 ? 23.849  28.869 65.541 1.00 0.00   ? 312 PHE B HZ   1  
ATOM   9718   N  N    . GLU B 1 310 ? 30.503  33.712 64.264 1.00 9.35   ? 313 GLU B N    1  
ATOM   9719   C  CA   . GLU B 1 310 ? 31.875  34.300 64.364 1.00 9.62   ? 313 GLU B CA   1  
ATOM   9720   C  C    . GLU B 1 310 ? 31.852  35.841 64.513 1.00 9.45   ? 313 GLU B C    1  
ATOM   9721   O  O    . GLU B 1 310 ? 32.765  36.411 65.076 1.00 10.93  ? 313 GLU B O    1  
ATOM   9722   C  CB   . GLU B 1 310 ? 32.663  33.936 63.104 1.00 9.90   ? 313 GLU B CB   1  
ATOM   9723   C  CG   . GLU B 1 310 ? 33.040  32.454 63.147 1.00 12.26  ? 313 GLU B CG   1  
ATOM   9724   C  CD   . GLU B 1 310 ? 34.174  32.245 64.152 1.00 13.90  ? 313 GLU B CD   1  
ATOM   9725   O  OE1  . GLU B 1 310 ? 34.748  33.232 64.582 1.00 15.95  ? 313 GLU B OE1  1  
ATOM   9726   O  OE2  . GLU B 1 310 ? 34.449  31.101 64.475 1.00 17.49  ? 313 GLU B OE2  1  
ATOM   9727   H  H    . GLU B 1 310 ? 30.105  33.545 63.384 1.00 0.00   ? 313 GLU B H    1  
ATOM   9728   H  HA   . GLU B 1 310 ? 32.376  33.874 65.219 1.00 0.00   ? 313 GLU B HA   1  
ATOM   9729   H  HB2  . GLU B 1 310 ? 32.055  34.129 62.231 1.00 0.00   ? 313 GLU B HB2  1  
ATOM   9730   H  HB3  . GLU B 1 310 ? 33.561  34.533 63.056 1.00 0.00   ? 313 GLU B HB3  1  
ATOM   9731   H  HG2  . GLU B 1 310 ? 32.180  31.873 63.447 1.00 0.00   ? 313 GLU B HG2  1  
ATOM   9732   H  HG3  . GLU B 1 310 ? 33.366  32.137 62.168 1.00 0.00   ? 313 GLU B HG3  1  
ATOM   9733   N  N    . LEU B 1 311 ? 30.857  36.534 64.003 1.00 8.55   ? 314 LEU B N    1  
ATOM   9734   C  CA   . LEU B 1 311 ? 30.872  38.024 64.128 1.00 8.60   ? 314 LEU B CA   1  
ATOM   9735   C  C    . LEU B 1 311 ? 30.070  38.454 65.352 1.00 8.15   ? 314 LEU B C    1  
ATOM   9736   O  O    . LEU B 1 311 ? 30.475  39.312 66.111 1.00 8.18   ? 314 LEU B O    1  
ATOM   9737   C  CB   . LEU B 1 311 ? 30.255  38.645 62.873 1.00 8.73   ? 314 LEU B CB   1  
ATOM   9738   C  CG   . LEU B 1 311 ? 31.099  38.276 61.652 1.00 9.10   ? 314 LEU B CG   1  
ATOM   9739   C  CD1  . LEU B 1 311 ? 30.917  39.337 60.565 1.00 10.63  ? 314 LEU B CD1  1  
ATOM   9740   C  CD2  . LEU B 1 311 ? 32.574  38.210 62.056 1.00 9.94   ? 314 LEU B CD2  1  
ATOM   9741   H  H    . LEU B 1 311 ? 30.129  36.082 63.528 1.00 0.00   ? 314 LEU B H    1  
ATOM   9742   H  HA   . LEU B 1 311 ? 31.892  38.365 64.230 1.00 0.00   ? 314 LEU B HA   1  
ATOM   9743   H  HB2  . LEU B 1 311 ? 29.250  38.269 62.743 1.00 0.00   ? 314 LEU B HB2  1  
ATOM   9744   H  HB3  . LEU B 1 311 ? 30.227  39.719 62.978 1.00 0.00   ? 314 LEU B HB3  1  
ATOM   9745   H  HG   . LEU B 1 311 ? 30.784  37.315 61.273 1.00 0.00   ? 314 LEU B HG   1  
ATOM   9746   H  HD11 . LEU B 1 311 ? 31.784  39.345 59.921 1.00 0.00   ? 314 LEU B HD11 1  
ATOM   9747   H  HD12 . LEU B 1 311 ? 30.801  40.307 61.025 1.00 0.00   ? 314 LEU B HD12 1  
ATOM   9748   H  HD13 . LEU B 1 311 ? 30.037  39.107 59.982 1.00 0.00   ? 314 LEU B HD13 1  
ATOM   9749   H  HD21 . LEU B 1 311 ? 32.894  39.178 62.412 1.00 0.00   ? 314 LEU B HD21 1  
ATOM   9750   H  HD22 . LEU B 1 311 ? 33.169  37.926 61.200 1.00 0.00   ? 314 LEU B HD22 1  
ATOM   9751   H  HD23 . LEU B 1 311 ? 32.700  37.478 62.840 1.00 0.00   ? 314 LEU B HD23 1  
ATOM   9752   N  N    . GLY B 1 312 ? 28.933  37.866 65.535 1.00 8.16   ? 315 GLY B N    1  
ATOM   9753   C  CA   . GLY B 1 312 ? 28.064  38.220 66.697 1.00 7.59   ? 315 GLY B CA   1  
ATOM   9754   C  C    . GLY B 1 312 ? 26.616  38.573 66.256 1.00 8.00   ? 315 GLY B C    1  
ATOM   9755   O  O    . GLY B 1 312 ? 25.978  39.401 66.876 1.00 8.89   ? 315 GLY B O    1  
ATOM   9756   H  H    . GLY B 1 312 ? 28.634  37.183 64.899 1.00 0.00   ? 315 GLY B H    1  
ATOM   9757   H  HA2  . GLY B 1 312 ? 28.030  37.382 67.377 1.00 0.00   ? 315 GLY B HA2  1  
ATOM   9758   H  HA3  . GLY B 1 312 ? 28.491  39.070 67.208 1.00 0.00   ? 315 GLY B HA3  1  
ATOM   9759   N  N    . ALA B 1 313 ? 26.066  37.953 65.223 1.00 8.05   ? 316 ALA B N    1  
ATOM   9760   C  CA   . ALA B 1 313 ? 24.667  38.285 64.841 1.00 8.15   ? 316 ALA B CA   1  
ATOM   9761   C  C    . ALA B 1 313 ? 23.730  37.149 65.281 1.00 7.71   ? 316 ALA B C    1  
ATOM   9762   O  O    . ALA B 1 313 ? 23.083  36.533 64.461 1.00 8.22   ? 316 ALA B O    1  
ATOM   9763   C  CB   . ALA B 1 313 ? 24.581  38.458 63.324 1.00 8.68   ? 316 ALA B CB   1  
ATOM   9764   H  H    . ALA B 1 313 ? 26.566  37.269 64.730 1.00 0.00   ? 316 ALA B H    1  
ATOM   9765   H  HA   . ALA B 1 313 ? 24.371  39.204 65.326 1.00 0.00   ? 316 ALA B HA   1  
ATOM   9766   H  HB1  . ALA B 1 313 ? 25.071  37.627 62.838 1.00 0.00   ? 316 ALA B HB1  1  
ATOM   9767   H  HB2  . ALA B 1 313 ? 25.067  39.379 63.038 1.00 0.00   ? 316 ALA B HB2  1  
ATOM   9768   H  HB3  . ALA B 1 313 ? 23.544  38.490 63.023 1.00 0.00   ? 316 ALA B HB3  1  
ATOM   9769   N  N    . ALA B 1 314 ? 23.643  36.859 66.565 1.00 8.07   ? 317 ALA B N    1  
ATOM   9770   C  CA   . ALA B 1 314 ? 22.734  35.757 67.001 1.00 8.43   ? 317 ALA B CA   1  
ATOM   9771   C  C    . ALA B 1 314 ? 22.158  36.043 68.395 1.00 8.74   ? 317 ALA B C    1  
ATOM   9772   O  O    . ALA B 1 314 ? 22.882  36.178 69.361 1.00 9.61   ? 317 ALA B O    1  
ATOM   9773   C  CB   . ALA B 1 314 ? 23.517  34.444 67.040 1.00 8.80   ? 317 ALA B CB   1  
ATOM   9774   H  H    . ALA B 1 314 ? 24.167  37.360 67.224 1.00 0.00   ? 317 ALA B H    1  
ATOM   9775   H  HA   . ALA B 1 314 ? 21.924  35.665 66.294 1.00 0.00   ? 317 ALA B HA   1  
ATOM   9776   H  HB1  . ALA B 1 314 ? 24.469  34.606 67.524 1.00 0.00   ? 317 ALA B HB1  1  
ATOM   9777   H  HB2  . ALA B 1 314 ? 23.681  34.092 66.032 1.00 0.00   ? 317 ALA B HB2  1  
ATOM   9778   H  HB3  . ALA B 1 314 ? 22.955  33.705 67.591 1.00 0.00   ? 317 ALA B HB3  1  
ATOM   9779   N  N    . ALA B 1 315 ? 20.853  36.108 68.507 1.00 8.48   ? 318 ALA B N    1  
ATOM   9780   C  CA   . ALA B 1 315 ? 20.229  36.350 69.827 1.00 9.11   ? 318 ALA B CA   1  
ATOM   9781   C  C    . ALA B 1 315 ? 19.575  35.047 70.258 1.00 8.75   ? 318 ALA B C    1  
ATOM   9782   O  O    . ALA B 1 315 ? 19.712  34.036 69.598 1.00 8.83   ? 318 ALA B O    1  
ATOM   9783   C  CB   . ALA B 1 315 ? 19.171  37.449 69.710 1.00 9.33   ? 318 ALA B CB   1  
ATOM   9784   H  H    . ALA B 1 315 ? 20.288  35.976 67.717 1.00 0.00   ? 318 ALA B H    1  
ATOM   9785   H  HA   . ALA B 1 315 ? 20.984  36.637 70.545 1.00 0.00   ? 318 ALA B HA   1  
ATOM   9786   H  HB1  . ALA B 1 315 ? 18.580  37.286 68.821 1.00 0.00   ? 318 ALA B HB1  1  
ATOM   9787   H  HB2  . ALA B 1 315 ? 19.657  38.412 69.647 1.00 0.00   ? 318 ALA B HB2  1  
ATOM   9788   H  HB3  . ALA B 1 315 ? 18.529  37.426 70.578 1.00 0.00   ? 318 ALA B HB3  1  
ATOM   9789   N  N    . HIS B 1 316 ? 18.864  35.038 71.340 1.00 8.75   ? 319 HIS B N    1  
ATOM   9790   C  CA   . HIS B 1 316 ? 18.216  33.750 71.757 1.00 9.36   ? 319 HIS B CA   1  
ATOM   9791   C  C    . HIS B 1 316 ? 16.847  33.994 72.413 1.00 9.28   ? 319 HIS B C    1  
ATOM   9792   O  O    . HIS B 1 316 ? 16.710  34.826 73.288 1.00 10.04  ? 319 HIS B O    1  
ATOM   9793   C  CB   . HIS B 1 316 ? 19.127  33.031 72.754 1.00 10.47  ? 319 HIS B CB   1  
ATOM   9794   C  CG   . HIS B 1 316 ? 20.455  32.749 72.106 1.00 11.82  ? 319 HIS B CG   1  
ATOM   9795   N  ND1  . HIS B 1 316 ? 21.656  32.888 72.789 1.00 13.01  ? 319 HIS B ND1  1  
ATOM   9796   C  CD2  . HIS B 1 316 ? 20.789  32.335 70.840 1.00 13.52  ? 319 HIS B CD2  1  
ATOM   9797   C  CE1  . HIS B 1 316 ? 22.646  32.563 71.937 1.00 13.79  ? 319 HIS B CE1  1  
ATOM   9798   N  NE2  . HIS B 1 316 ? 22.170  32.220 70.739 1.00 14.96  ? 319 HIS B NE2  1  
ATOM   9799   H  H    . HIS B 1 316 ? 18.749  35.853 71.872 1.00 0.00   ? 319 HIS B H    1  
ATOM   9800   H  HA   . HIS B 1 316 ? 18.084  33.124 70.888 1.00 0.00   ? 319 HIS B HA   1  
ATOM   9801   H  HB2  . HIS B 1 316 ? 19.275  33.657 73.622 1.00 0.00   ? 319 HIS B HB2  1  
ATOM   9802   H  HB3  . HIS B 1 316 ? 18.669  32.101 73.054 1.00 0.00   ? 319 HIS B HB3  1  
ATOM   9803   H  HD1  . HIS B 1 316 ? 21.763  33.171 73.721 1.00 0.00   ? 319 HIS B HD1  1  
ATOM   9804   H  HD2  . HIS B 1 316 ? 20.086  32.131 70.045 1.00 0.00   ? 319 HIS B HD2  1  
ATOM   9805   H  HE1  . HIS B 1 316 ? 23.696  32.578 72.192 1.00 0.00   ? 319 HIS B HE1  1  
ATOM   9806   H  HE2  . HIS B 1 316 ? 22.686  31.944 69.953 1.00 0.00   ? 319 HIS B HE2  1  
ATOM   9807   N  N    . PHE B 1 317 ? 15.833  33.247 72.019 1.00 9.71   ? 320 PHE B N    1  
ATOM   9808   C  CA   . PHE B 1 317 ? 14.486  33.422 72.658 1.00 9.83   ? 320 PHE B CA   1  
ATOM   9809   C  C    . PHE B 1 317 ? 14.113  32.181 73.513 1.00 10.34  ? 320 PHE B C    1  
ATOM   9810   O  O    . PHE B 1 317 ? 14.041  31.075 73.016 1.00 10.78  ? 320 PHE B O    1  
ATOM   9811   C  CB   . PHE B 1 317 ? 13.432  33.615 71.565 1.00 10.54  ? 320 PHE B CB   1  
ATOM   9812   C  CG   . PHE B 1 317 ? 13.562  35.001 70.979 1.00 10.67  ? 320 PHE B CG   1  
ATOM   9813   C  CD1  . PHE B 1 317 ? 14.829  35.542 70.736 1.00 11.64  ? 320 PHE B CD1  1  
ATOM   9814   C  CD2  . PHE B 1 317 ? 12.414  35.744 70.680 1.00 12.52  ? 320 PHE B CD2  1  
ATOM   9815   C  CE1  . PHE B 1 317 ? 14.949  36.827 70.193 1.00 13.53  ? 320 PHE B CE1  1  
ATOM   9816   C  CE2  . PHE B 1 317 ? 12.534  37.029 70.137 1.00 14.16  ? 320 PHE B CE2  1  
ATOM   9817   C  CZ   . PHE B 1 317 ? 13.801  37.570 69.894 1.00 13.57  ? 320 PHE B CZ   1  
ATOM   9818   H  H    . PHE B 1 317 ? 15.965  32.563 71.330 1.00 0.00   ? 320 PHE B H    1  
ATOM   9819   H  HA   . PHE B 1 317 ? 14.504  34.297 73.291 1.00 0.00   ? 320 PHE B HA   1  
ATOM   9820   H  HB2  . PHE B 1 317 ? 13.581  32.880 70.788 1.00 0.00   ? 320 PHE B HB2  1  
ATOM   9821   H  HB3  . PHE B 1 317 ? 12.447  33.495 71.990 1.00 0.00   ? 320 PHE B HB3  1  
ATOM   9822   H  HD1  . PHE B 1 317 ? 15.715  34.969 70.967 1.00 0.00   ? 320 PHE B HD1  1  
ATOM   9823   H  HD2  . PHE B 1 317 ? 11.436  35.326 70.868 1.00 0.00   ? 320 PHE B HD2  1  
ATOM   9824   H  HE1  . PHE B 1 317 ? 15.927  37.245 70.005 1.00 0.00   ? 320 PHE B HE1  1  
ATOM   9825   H  HE2  . PHE B 1 317 ? 11.648  37.602 69.906 1.00 0.00   ? 320 PHE B HE2  1  
ATOM   9826   H  HZ   . PHE B 1 317 ? 13.894  38.562 69.475 1.00 0.00   ? 320 PHE B HZ   1  
ATOM   9827   N  N    . LYS B 1 318 ? 13.851  32.373 74.794 1.00 9.46   ? 321 LYS B N    1  
ATOM   9828   C  CA   . LYS B 1 318 ? 13.461  31.257 75.674 1.00 10.05  ? 321 LYS B CA   1  
ATOM   9829   C  C    . LYS B 1 318 ? 11.958  31.132 75.562 1.00 9.47   ? 321 LYS B C    1  
ATOM   9830   O  O    . LYS B 1 318 ? 11.241  32.114 75.545 1.00 10.65  ? 321 LYS B O    1  
ATOM   9831   C  CB   . LYS B 1 318 ? 13.855  31.567 77.120 1.00 10.53  ? 321 LYS B CB   1  
ATOM   9832   C  CG   . LYS B 1 318 ? 15.261  32.169 77.148 1.00 11.68  ? 321 LYS B CG   1  
ATOM   9833   C  CD   . LYS B 1 318 ? 15.408  33.066 78.379 1.00 13.44  ? 321 LYS B CD   1  
ATOM   9834   C  CE   . LYS B 1 318 ? 16.826  32.936 78.939 1.00 14.01  ? 321 LYS B CE   1  
ATOM   9835   N  NZ   . LYS B 1 318 ? 16.947  33.751 80.180 1.00 14.41  ? 321 LYS B NZ   1  
ATOM   9836   H  H    . LYS B 1 318 ? 13.899  33.280 75.162 1.00 0.00   ? 321 LYS B H    1  
ATOM   9837   H  HA   . LYS B 1 318 ? 13.934  30.343 75.345 1.00 0.00   ? 321 LYS B HA   1  
ATOM   9838   H  HB2  . LYS B 1 318 ? 13.152  32.271 77.541 1.00 0.00   ? 321 LYS B HB2  1  
ATOM   9839   H  HB3  . LYS B 1 318 ? 13.844  30.656 77.699 1.00 0.00   ? 321 LYS B HB3  1  
ATOM   9840   H  HG2  . LYS B 1 318 ? 15.992  31.375 77.190 1.00 0.00   ? 321 LYS B HG2  1  
ATOM   9841   H  HG3  . LYS B 1 318 ? 15.419  32.757 76.256 1.00 0.00   ? 321 LYS B HG3  1  
ATOM   9842   H  HD2  . LYS B 1 318 ? 15.223  34.093 78.100 1.00 0.00   ? 321 LYS B HD2  1  
ATOM   9843   H  HD3  . LYS B 1 318 ? 14.697  32.763 79.132 1.00 0.00   ? 321 LYS B HD3  1  
ATOM   9844   H  HE2  . LYS B 1 318 ? 17.029  31.900 79.168 1.00 0.00   ? 321 LYS B HE2  1  
ATOM   9845   H  HE3  . LYS B 1 318 ? 17.536  33.288 78.206 1.00 0.00   ? 321 LYS B HE3  1  
ATOM   9846   H  HZ1  . LYS B 1 318 ? 16.179  34.451 80.212 1.00 0.00   ? 321 LYS B HZ1  1  
ATOM   9847   H  HZ2  . LYS B 1 318 ? 17.862  34.244 80.184 1.00 0.00   ? 321 LYS B HZ2  1  
ATOM   9848   H  HZ3  . LYS B 1 318 ? 16.884  33.128 81.012 1.00 0.00   ? 321 LYS B HZ3  1  
ATOM   9849   N  N    . VAL B 1 319 ? 11.475  29.952 75.437 1.00 9.15   ? 322 VAL B N    1  
ATOM   9850   C  CA   . VAL B 1 319 ? 10.018  29.777 75.268 1.00 9.49   ? 322 VAL B CA   1  
ATOM   9851   C  C    . VAL B 1 319 ? 9.516   28.734 76.242 1.00 9.61   ? 322 VAL B C    1  
ATOM   9852   O  O    . VAL B 1 319 ? 10.051  27.649 76.351 1.00 10.55  ? 322 VAL B O    1  
ATOM   9853   C  CB   . VAL B 1 319 ? 9.720   29.325 73.838 1.00 9.43   ? 322 VAL B CB   1  
ATOM   9854   C  CG1  . VAL B 1 319 ? 8.209   29.183 73.650 1.00 9.62   ? 322 VAL B CG1  1  
ATOM   9855   C  CG2  . VAL B 1 319 ? 10.259  30.365 72.853 1.00 10.37  ? 322 VAL B CG2  1  
ATOM   9856   H  H    . VAL B 1 319 ? 12.071  29.175 75.416 1.00 0.00   ? 322 VAL B H    1  
ATOM   9857   H  HA   . VAL B 1 319 ? 9.519   30.715 75.457 1.00 0.00   ? 322 VAL B HA   1  
ATOM   9858   H  HB   . VAL B 1 319 ? 10.196  28.372 73.655 1.00 0.00   ? 322 VAL B HB   1  
ATOM   9859   H  HG11 . VAL B 1 319 ? 7.960   29.321 72.608 1.00 0.00   ? 322 VAL B HG11 1  
ATOM   9860   H  HG12 . VAL B 1 319 ? 7.701   29.929 74.244 1.00 0.00   ? 322 VAL B HG12 1  
ATOM   9861   H  HG13 . VAL B 1 319 ? 7.898   28.198 73.967 1.00 0.00   ? 322 VAL B HG13 1  
ATOM   9862   H  HG21 . VAL B 1 319 ? 10.544  29.876 71.933 1.00 0.00   ? 322 VAL B HG21 1  
ATOM   9863   H  HG22 . VAL B 1 319 ? 11.121  30.854 73.282 1.00 0.00   ? 322 VAL B HG22 1  
ATOM   9864   H  HG23 . VAL B 1 319 ? 9.493   31.098 72.648 1.00 0.00   ? 322 VAL B HG23 1  
ATOM   9865   N  N    . THR B 1 320 ? 8.488   29.060 76.946 1.00 10.07  ? 323 THR B N    1  
ATOM   9866   C  CA   . THR B 1 320 ? 7.922   28.096 77.930 1.00 10.52  ? 323 THR B CA   1  
ATOM   9867   C  C    . THR B 1 320 ? 6.688   27.421 77.327 1.00 10.62  ? 323 THR B C    1  
ATOM   9868   O  O    . THR B 1 320 ? 6.039   27.960 76.452 1.00 11.42  ? 323 THR B O    1  
ATOM   9869   C  CB   . THR B 1 320 ? 7.524   28.842 79.205 1.00 11.25  ? 323 THR B CB   1  
ATOM   9870   O  OG1  . THR B 1 320 ? 6.540   29.818 78.893 1.00 11.43  ? 323 THR B OG1  1  
ATOM   9871   C  CG2  . THR B 1 320 ? 8.753   29.527 79.803 1.00 12.02  ? 323 THR B CG2  1  
ATOM   9872   H  H    . THR B 1 320 ? 8.077   29.942 76.833 1.00 0.00   ? 323 THR B H    1  
ATOM   9873   H  HA   . THR B 1 320 ? 8.663   27.346 78.167 1.00 0.00   ? 323 THR B HA   1  
ATOM   9874   H  HB   . THR B 1 320 ? 7.123   28.142 79.922 1.00 0.00   ? 323 THR B HB   1  
ATOM   9875   H  HG1  . THR B 1 320 ? 6.775   30.217 78.052 1.00 0.00   ? 323 THR B HG1  1  
ATOM   9876   H  HG21 . THR B 1 320 ? 8.510   30.548 80.055 1.00 0.00   ? 323 THR B HG21 1  
ATOM   9877   H  HG22 . THR B 1 320 ? 9.558   29.515 79.083 1.00 0.00   ? 323 THR B HG22 1  
ATOM   9878   H  HG23 . THR B 1 320 ? 9.061   29.000 80.695 1.00 0.00   ? 323 THR B HG23 1  
ATOM   9879   N  N    . GLY B 1 321 ? 6.360   26.245 77.786 1.00 10.30  ? 324 GLY B N    1  
ATOM   9880   C  CA   . GLY B 1 321 ? 5.168   25.535 77.238 1.00 10.37  ? 324 GLY B CA   1  
ATOM   9881   C  C    . GLY B 1 321 ? 5.378   24.015 77.306 1.00 10.20  ? 324 GLY B C    1  
ATOM   9882   O  O    . GLY B 1 321 ? 6.224   23.523 78.026 1.00 10.99  ? 324 GLY B O    1  
ATOM   9883   H  H    . GLY B 1 321 ? 6.898   25.827 78.491 1.00 0.00   ? 324 GLY B H    1  
ATOM   9884   H  HA2  . GLY B 1 321 ? 4.295   25.803 77.817 1.00 0.00   ? 324 GLY B HA2  1  
ATOM   9885   H  HA3  . GLY B 1 321 ? 5.019   25.826 76.210 1.00 0.00   ? 324 GLY B HA3  1  
ATOM   9886   N  N    . GLU B 1 322 ? 4.602   23.276 76.558 1.00 11.31  ? 325 GLU B N    1  
ATOM   9887   C  CA   . GLU B 1 322 ? 4.722   21.803 76.556 1.00 12.59  ? 325 GLU B CA   1  
ATOM   9888   C  C    . GLU B 1 322 ? 5.218   21.357 75.188 1.00 11.58  ? 325 GLU B C    1  
ATOM   9889   O  O    . GLU B 1 322 ? 4.820   21.874 74.163 1.00 11.72  ? 325 GLU B O    1  
ATOM   9890   C  CB   . GLU B 1 322 ? 3.355   21.176 76.838 1.00 13.63  ? 325 GLU B CB   1  
ATOM   9891   C  CG   . GLU B 1 322 ? 2.709   21.875 78.036 1.00 19.57  ? 325 GLU B CG   1  
ATOM   9892   C  CD   . GLU B 1 322 ? 1.216   21.542 78.077 1.00 25.32  ? 325 GLU B CD   1  
ATOM   9893   O  OE1  . GLU B 1 322 ? 0.743   20.915 77.144 1.00 31.74  ? 325 GLU B OE1  1  
ATOM   9894   O  OE2  . GLU B 1 322 ? 0.571   21.921 79.041 1.00 27.71  ? 325 GLU B OE2  1  
ATOM   9895   H  H    . GLU B 1 322 ? 3.927   23.705 75.991 1.00 0.00   ? 325 GLU B H    1  
ATOM   9896   H  HA   . GLU B 1 322 ? 5.426   21.496 77.316 1.00 0.00   ? 325 GLU B HA   1  
ATOM   9897   H  HB2  . GLU B 1 322 ? 2.722   21.288 75.970 1.00 0.00   ? 325 GLU B HB2  1  
ATOM   9898   H  HB3  . GLU B 1 322 ? 3.479   20.126 77.060 1.00 0.00   ? 325 GLU B HB3  1  
ATOM   9899   H  HG2  . GLU B 1 322 ? 3.180   21.535 78.947 1.00 0.00   ? 325 GLU B HG2  1  
ATOM   9900   H  HG3  . GLU B 1 322 ? 2.835   22.943 77.941 1.00 0.00   ? 325 GLU B HG3  1  
ATOM   9901   N  N    . TRP B 1 323 ? 6.092   20.410 75.176 1.00 10.80  ? 326 TRP B N    1  
ATOM   9902   C  CA   . TRP B 1 323 ? 6.652   19.909 73.911 1.00 10.91  ? 326 TRP B CA   1  
ATOM   9903   C  C    . TRP B 1 323 ? 5.555   19.226 73.121 1.00 11.24  ? 326 TRP B C    1  
ATOM   9904   O  O    . TRP B 1 323 ? 4.584   18.734 73.661 1.00 12.24  ? 326 TRP B O    1  
ATOM   9905   C  CB   . TRP B 1 323 ? 7.770   18.907 74.205 1.00 11.09  ? 326 TRP B CB   1  
ATOM   9906   C  CG   . TRP B 1 323 ? 8.351   18.415 72.919 1.00 10.23  ? 326 TRP B CG   1  
ATOM   9907   C  CD1  . TRP B 1 323 ? 8.037   17.241 72.324 1.00 11.69  ? 326 TRP B CD1  1  
ATOM   9908   C  CD2  . TRP B 1 323 ? 9.336   19.059 72.060 1.00 9.80   ? 326 TRP B CD2  1  
ATOM   9909   N  NE1  . TRP B 1 323 ? 8.768   17.124 71.155 1.00 11.32  ? 326 TRP B NE1  1  
ATOM   9910   C  CE2  . TRP B 1 323 ? 9.583   18.219 70.948 1.00 10.24  ? 326 TRP B CE2  1  
ATOM   9911   C  CE3  . TRP B 1 323 ? 10.033  20.279 72.137 1.00 10.55  ? 326 TRP B CE3  1  
ATOM   9912   C  CZ2  . TRP B 1 323 ? 10.488  18.576 69.949 1.00 9.97   ? 326 TRP B CZ2  1  
ATOM   9913   C  CZ3  . TRP B 1 323 ? 10.945  20.641 71.132 1.00 10.41  ? 326 TRP B CZ3  1  
ATOM   9914   C  CH2  . TRP B 1 323 ? 11.172  19.791 70.040 1.00 10.31  ? 326 TRP B CH2  1  
ATOM   9915   H  H    . TRP B 1 323 ? 6.396   20.024 76.024 1.00 0.00   ? 326 TRP B H    1  
ATOM   9916   H  HA   . TRP B 1 323 ? 7.049   20.734 73.339 1.00 0.00   ? 326 TRP B HA   1  
ATOM   9917   H  HB2  . TRP B 1 323 ? 8.542   19.390 74.787 1.00 0.00   ? 326 TRP B HB2  1  
ATOM   9918   H  HB3  . TRP B 1 323 ? 7.369   18.073 74.762 1.00 0.00   ? 326 TRP B HB3  1  
ATOM   9919   H  HD1  . TRP B 1 323 ? 7.333   16.515 72.700 1.00 0.00   ? 326 TRP B HD1  1  
ATOM   9920   H  HE1  . TRP B 1 323 ? 8.726   16.365 70.536 1.00 0.00   ? 326 TRP B HE1  1  
ATOM   9921   H  HE3  . TRP B 1 323 ? 9.866   20.941 72.974 1.00 0.00   ? 326 TRP B HE3  1  
ATOM   9922   H  HZ2  . TRP B 1 323 ? 10.659  17.918 69.110 1.00 0.00   ? 326 TRP B HZ2  1  
ATOM   9923   H  HZ3  . TRP B 1 323 ? 11.475  21.580 71.201 1.00 0.00   ? 326 TRP B HZ3  1  
ATOM   9924   H  HH2  . TRP B 1 323 ? 11.875  20.075 69.271 1.00 0.00   ? 326 TRP B HH2  1  
ATOM   9925   N  N    . ASN B 1 324 ? 5.710   19.202 71.847 1.00 10.94  ? 327 ASN B N    1  
ATOM   9926   C  CA   . ASN B 1 324 ? 4.694   18.563 70.969 1.00 10.37  ? 327 ASN B CA   1  
ATOM   9927   C  C    . ASN B 1 324 ? 5.390   17.497 70.131 1.00 10.32  ? 327 ASN B C    1  
ATOM   9928   O  O    . ASN B 1 324 ? 6.083   17.792 69.178 1.00 10.23  ? 327 ASN B O    1  
ATOM   9929   C  CB   . ASN B 1 324 ? 4.071   19.616 70.050 1.00 9.61   ? 327 ASN B CB   1  
ATOM   9930   C  CG   . ASN B 1 324 ? 2.955   18.975 69.223 1.00 10.19  ? 327 ASN B CG   1  
ATOM   9931   O  OD1  . ASN B 1 324 ? 2.930   17.774 69.041 1.00 11.56  ? 327 ASN B OD1  1  
ATOM   9932   N  ND2  . ASN B 1 324 ? 2.024   19.732 68.709 1.00 11.59  ? 327 ASN B ND2  1  
ATOM   9933   H  H    . ASN B 1 324 ? 6.505   19.613 71.448 1.00 0.00   ? 327 ASN B H    1  
ATOM   9934   H  HA   . ASN B 1 324 ? 3.926   18.105 71.575 1.00 0.00   ? 327 ASN B HA   1  
ATOM   9935   H  HB2  . ASN B 1 324 ? 3.663   20.418 70.648 1.00 0.00   ? 327 ASN B HB2  1  
ATOM   9936   H  HB3  . ASN B 1 324 ? 4.827   20.009 69.388 1.00 0.00   ? 327 ASN B HB3  1  
ATOM   9937   H  HD21 . ASN B 1 324 ? 2.044   20.701 68.856 1.00 0.00   ? 327 ASN B HD21 1  
ATOM   9938   H  HD22 . ASN B 1 324 ? 1.305   19.331 68.178 1.00 0.00   ? 327 ASN B HD22 1  
ATOM   9939   N  N    . ASP B 1 325 ? 5.229   16.264 70.497 1.00 10.21  ? 328 ASP B N    1  
ATOM   9940   C  CA   . ASP B 1 325 ? 5.901   15.166 69.747 1.00 10.24  ? 328 ASP B CA   1  
ATOM   9941   C  C    . ASP B 1 325 ? 5.354   15.115 68.329 1.00 10.40  ? 328 ASP B C    1  
ATOM   9942   O  O    . ASP B 1 325 ? 6.082   14.920 67.376 1.00 11.43  ? 328 ASP B O    1  
ATOM   9943   C  CB   . ASP B 1 325 ? 5.631   13.832 70.446 1.00 10.59  ? 328 ASP B CB   1  
ATOM   9944   C  CG   . ASP B 1 325 ? 6.505   13.725 71.697 1.00 12.00  ? 328 ASP B CG   1  
ATOM   9945   O  OD1  . ASP B 1 325 ? 7.714   13.657 71.547 1.00 13.19  ? 328 ASP B OD1  1  
ATOM   9946   O  OD2  . ASP B 1 325 ? 5.951   13.712 72.784 1.00 14.46  ? 328 ASP B OD2  1  
ATOM   9947   H  H    . ASP B 1 325 ? 4.680   16.055 71.281 1.00 0.00   ? 328 ASP B H    1  
ATOM   9948   H  HA   . ASP B 1 325 ? 6.964   15.348 69.718 1.00 0.00   ? 328 ASP B HA   1  
ATOM   9949   H  HB2  . ASP B 1 325 ? 4.590   13.777 70.728 1.00 0.00   ? 328 ASP B HB2  1  
ATOM   9950   H  HB3  . ASP B 1 325 ? 5.866   13.020 69.775 1.00 0.00   ? 328 ASP B HB3  1  
ATOM   9951   N  N    . ASP B 1 326 ? 4.077   15.290 68.181 1.00 10.33  ? 329 ASP B N    1  
ATOM   9952   C  CA   . ASP B 1 326 ? 3.478   15.253 66.816 1.00 10.60  ? 329 ASP B CA   1  
ATOM   9953   C  C    . ASP B 1 326 ? 4.362   16.052 65.856 1.00 10.47  ? 329 ASP B C    1  
ATOM   9954   O  O    . ASP B 1 326 ? 4.689   15.604 64.774 1.00 10.82  ? 329 ASP B O    1  
ATOM   9955   C  CB   . ASP B 1 326 ? 2.078   15.871 66.855 1.00 11.44  ? 329 ASP B CB   1  
ATOM   9956   C  CG   . ASP B 1 326 ? 1.331   15.525 65.566 1.00 13.15  ? 329 ASP B CG   1  
ATOM   9957   O  OD1  . ASP B 1 326 ? 1.807   14.668 64.840 1.00 17.32  ? 329 ASP B OD1  1  
ATOM   9958   O  OD2  . ASP B 1 326 ? 0.295   16.123 65.326 1.00 18.08  ? 329 ASP B OD2  1  
ATOM   9959   H  H    . ASP B 1 326 ? 3.508   15.446 68.964 1.00 0.00   ? 329 ASP B H    1  
ATOM   9960   H  HA   . ASP B 1 326 ? 3.412   14.229 66.479 1.00 0.00   ? 329 ASP B HA   1  
ATOM   9961   H  HB2  . ASP B 1 326 ? 1.536   15.478 67.703 1.00 0.00   ? 329 ASP B HB2  1  
ATOM   9962   H  HB3  . ASP B 1 326 ? 2.160   16.943 66.944 1.00 0.00   ? 329 ASP B HB3  1  
ATOM   9963   N  N    . LEU B 1 327 ? 4.754   17.231 66.249 1.00 10.06  ? 330 LEU B N    1  
ATOM   9964   C  CA   . LEU B 1 327 ? 5.619   18.068 65.376 1.00 9.61   ? 330 LEU B CA   1  
ATOM   9965   C  C    . LEU B 1 327 ? 7.040   17.489 65.322 1.00 8.94   ? 330 LEU B C    1  
ATOM   9966   O  O    . LEU B 1 327 ? 7.661   17.470 64.277 1.00 9.21   ? 330 LEU B O    1  
ATOM   9967   C  CB   . LEU B 1 327 ? 5.674   19.492 65.932 1.00 10.28  ? 330 LEU B CB   1  
ATOM   9968   C  CG   . LEU B 1 327 ? 4.329   20.183 65.699 1.00 10.65  ? 330 LEU B CG   1  
ATOM   9969   C  CD1  . LEU B 1 327 ? 4.348   21.568 66.347 1.00 11.42  ? 330 LEU B CD1  1  
ATOM   9970   C  CD2  . LEU B 1 327 ? 4.086   20.328 64.195 1.00 13.27  ? 330 LEU B CD2  1  
ATOM   9971   H  H    . LEU B 1 327 ? 4.479   17.567 67.127 1.00 0.00   ? 330 LEU B H    1  
ATOM   9972   H  HA   . LEU B 1 327 ? 5.205   18.091 64.379 1.00 0.00   ? 330 LEU B HA   1  
ATOM   9973   H  HB2  . LEU B 1 327 ? 5.882   19.456 66.992 1.00 0.00   ? 330 LEU B HB2  1  
ATOM   9974   H  HB3  . LEU B 1 327 ? 6.453   20.045 65.430 1.00 0.00   ? 330 LEU B HB3  1  
ATOM   9975   H  HG   . LEU B 1 327 ? 3.539   19.591 66.138 1.00 0.00   ? 330 LEU B HG   1  
ATOM   9976   H  HD11 . LEU B 1 327 ? 5.354   21.960 66.332 1.00 0.00   ? 330 LEU B HD11 1  
ATOM   9977   H  HD12 . LEU B 1 327 ? 4.006   21.492 67.369 1.00 0.00   ? 330 LEU B HD12 1  
ATOM   9978   H  HD13 . LEU B 1 327 ? 3.696   22.232 65.798 1.00 0.00   ? 330 LEU B HD13 1  
ATOM   9979   H  HD21 . LEU B 1 327 ? 4.082   19.351 63.735 1.00 0.00   ? 330 LEU B HD21 1  
ATOM   9980   H  HD22 . LEU B 1 327 ? 4.872   20.928 63.759 1.00 0.00   ? 330 LEU B HD22 1  
ATOM   9981   H  HD23 . LEU B 1 327 ? 3.133   20.808 64.029 1.00 0.00   ? 330 LEU B HD23 1  
ATOM   9982   N  N    . MET B 1 328 ? 7.577   17.026 66.427 1.00 9.28   ? 331 MET B N    1  
ATOM   9983   C  CA   . MET B 1 328 ? 8.958   16.478 66.377 1.00 8.99   ? 331 MET B CA   1  
ATOM   9984   C  C    . MET B 1 328 ? 9.193   15.567 67.571 1.00 9.09   ? 331 MET B C    1  
ATOM   9985   O  O    . MET B 1 328 ? 8.801   15.867 68.682 1.00 9.83   ? 331 MET B O    1  
ATOM   9986   C  CB   . MET B 1 328 ? 9.964   17.631 66.410 1.00 9.23   ? 331 MET B CB   1  
ATOM   9987   C  CG   . MET B 1 328 ? 11.386  17.067 66.427 1.00 9.13   ? 331 MET B CG   1  
ATOM   9988   S  SD   . MET B 1 328 ? 12.570  18.420 66.634 1.00 9.77   ? 331 MET B SD   1  
ATOM   9989   C  CE   . MET B 1 328 ? 12.367  19.153 64.992 1.00 9.53   ? 331 MET B CE   1  
ATOM   9990   H  H    . MET B 1 328 ? 7.080   17.049 67.271 1.00 0.00   ? 331 MET B H    1  
ATOM   9991   H  HA   . MET B 1 328 ? 9.089   15.915 65.465 1.00 0.00   ? 331 MET B HA   1  
ATOM   9992   H  HB2  . MET B 1 328 ? 9.831   18.249 65.534 1.00 0.00   ? 331 MET B HB2  1  
ATOM   9993   H  HB3  . MET B 1 328 ? 9.804   18.223 67.298 1.00 0.00   ? 331 MET B HB3  1  
ATOM   9994   H  HG2  . MET B 1 328 ? 11.488  16.371 67.246 1.00 0.00   ? 331 MET B HG2  1  
ATOM   9995   H  HG3  . MET B 1 328 ? 11.582  16.557 65.495 1.00 0.00   ? 331 MET B HG3  1  
ATOM   9996   H  HE1  . MET B 1 328 ? 11.745  18.508 64.386 1.00 0.00   ? 331 MET B HE1  1  
ATOM   9997   H  HE2  . MET B 1 328 ? 13.337  19.268 64.528 1.00 0.00   ? 331 MET B HE2  1  
ATOM   9998   H  HE3  . MET B 1 328 ? 11.898  20.119 65.083 1.00 0.00   ? 331 MET B HE3  1  
ATOM   9999   N  N    . THR B 1 329 ? 9.834   14.457 67.357 1.00 9.42   ? 332 THR B N    1  
ATOM   10000  C  CA   . THR B 1 329 ? 10.095  13.529 68.500 1.00 10.09  ? 332 THR B CA   1  
ATOM   10001  C  C    . THR B 1 329 ? 11.361  12.701 68.241 1.00 9.84   ? 332 THR B C    1  
ATOM   10002  O  O    . THR B 1 329 ? 11.550  12.156 67.172 1.00 10.01  ? 332 THR B O    1  
ATOM   10003  C  CB   . THR B 1 329 ? 8.901   12.586 68.668 1.00 10.97  ? 332 THR B CB   1  
ATOM   10004  O  OG1  . THR B 1 329 ? 8.869   12.099 70.002 1.00 12.80  ? 332 THR B OG1  1  
ATOM   10005  C  CG2  . THR B 1 329 ? 9.034   11.413 67.696 1.00 12.48  ? 332 THR B CG2  1  
ATOM   10006  H  H    . THR B 1 329 ? 10.146  14.232 66.456 1.00 0.00   ? 332 THR B H    1  
ATOM   10007  H  HA   . THR B 1 329 ? 10.224  14.105 69.404 1.00 0.00   ? 332 THR B HA   1  
ATOM   10008  H  HB   . THR B 1 329 ? 7.987   13.121 68.458 1.00 0.00   ? 332 THR B HB   1  
ATOM   10009  H  HG1  . THR B 1 329 ? 8.754   12.849 70.589 1.00 0.00   ? 332 THR B HG1  1  
ATOM   10010  H  HG21 . THR B 1 329 ? 9.646   10.643 68.143 1.00 0.00   ? 332 THR B HG21 1  
ATOM   10011  H  HG22 . THR B 1 329 ? 9.494   11.753 66.781 1.00 0.00   ? 332 THR B HG22 1  
ATOM   10012  H  HG23 . THR B 1 329 ? 8.054   11.013 67.479 1.00 0.00   ? 332 THR B HG23 1  
ATOM   10013  N  N    . SER B 1 330 ? 12.224  12.591 69.223 1.00 10.55  ? 333 SER B N    1  
ATOM   10014  C  CA   . SER B 1 330 ? 13.464  11.786 69.041 1.00 10.95  ? 333 SER B CA   1  
ATOM   10015  C  C    . SER B 1 330 ? 13.118  10.309 69.235 1.00 10.99  ? 333 SER B C    1  
ATOM   10016  O  O    . SER B 1 330 ? 13.032  9.821  70.344 1.00 11.89  ? 333 SER B O    1  
ATOM   10017  C  CB   . SER B 1 330 ? 14.507  12.209 70.076 1.00 12.13  ? 333 SER B CB   1  
ATOM   10018  O  OG   . SER B 1 330 ? 15.625  11.333 70.001 1.00 13.50  ? 333 SER B OG   1  
ATOM   10019  H  H    . SER B 1 330 ? 12.047  13.029 70.082 1.00 0.00   ? 333 SER B H    1  
ATOM   10020  H  HA   . SER B 1 330 ? 13.854  11.940 68.046 1.00 0.00   ? 333 SER B HA   1  
ATOM   10021  H  HB2  . SER B 1 330 ? 14.832  13.215 69.873 1.00 0.00   ? 333 SER B HB2  1  
ATOM   10022  H  HB3  . SER B 1 330 ? 14.069  12.167 71.065 1.00 0.00   ? 333 SER B HB3  1  
ATOM   10023  H  HG   . SER B 1 330 ? 16.411  11.867 69.864 1.00 0.00   ? 333 SER B HG   1  
ATOM   10024  N  N    . VAL B 1 331 ? 12.899  9.600  68.164 1.00 10.86  ? 334 VAL B N    1  
ATOM   10025  C  CA   . VAL B 1 331 ? 12.535  8.161  68.282 1.00 11.12  ? 334 VAL B CA   1  
ATOM   10026  C  C    . VAL B 1 331 ? 13.675  7.423  68.961 1.00 11.87  ? 334 VAL B C    1  
ATOM   10027  O  O    . VAL B 1 331 ? 13.477  6.638  69.867 1.00 12.73  ? 334 VAL B O    1  
ATOM   10028  C  CB   . VAL B 1 331 ? 12.301  7.575  66.889 1.00 11.91  ? 334 VAL B CB   1  
ATOM   10029  C  CG1  . VAL B 1 331 ? 11.962  6.088  67.010 1.00 12.66  ? 334 VAL B CG1  1  
ATOM   10030  C  CG2  . VAL B 1 331 ? 11.138  8.309  66.217 1.00 12.84  ? 334 VAL B CG2  1  
ATOM   10031  H  H    . VAL B 1 331 ? 12.959  10.018 67.280 1.00 0.00   ? 334 VAL B H    1  
ATOM   10032  H  HA   . VAL B 1 331 ? 11.636  8.062  68.873 1.00 0.00   ? 334 VAL B HA   1  
ATOM   10033  H  HB   . VAL B 1 331 ? 13.196  7.692  66.294 1.00 0.00   ? 334 VAL B HB   1  
ATOM   10034  H  HG11 . VAL B 1 331 ? 12.854  5.501  66.848 1.00 0.00   ? 334 VAL B HG11 1  
ATOM   10035  H  HG12 . VAL B 1 331 ? 11.220  5.827  66.270 1.00 0.00   ? 334 VAL B HG12 1  
ATOM   10036  H  HG13 . VAL B 1 331 ? 11.573  5.887  67.997 1.00 0.00   ? 334 VAL B HG13 1  
ATOM   10037  H  HG21 . VAL B 1 331 ? 10.926  7.849  65.263 1.00 0.00   ? 334 VAL B HG21 1  
ATOM   10038  H  HG22 . VAL B 1 331 ? 11.405  9.344  66.066 1.00 0.00   ? 334 VAL B HG22 1  
ATOM   10039  H  HG23 . VAL B 1 331 ? 10.264  8.251  66.847 1.00 0.00   ? 334 VAL B HG23 1  
ATOM   10040  N  N    . LEU B 1 332 ? 14.872  7.680  68.533 1.00 11.53  ? 335 LEU B N    1  
ATOM   10041  C  CA   . LEU B 1 332 ? 16.047  7.005  69.157 1.00 12.05  ? 335 LEU B CA   1  
ATOM   10042  C  C    . LEU B 1 332 ? 17.097  8.054  69.548 1.00 11.80  ? 335 LEU B C    1  
ATOM   10043  O  O    . LEU B 1 332 ? 17.752  8.631  68.702 1.00 11.53  ? 335 LEU B O    1  
ATOM   10044  C  CB   . LEU B 1 332 ? 16.659  6.020  68.159 1.00 12.33  ? 335 LEU B CB   1  
ATOM   10045  C  CG   . LEU B 1 332 ? 17.903  5.377  68.772 1.00 13.87  ? 335 LEU B CG   1  
ATOM   10046  C  CD1  . LEU B 1 332 ? 17.490  4.464  69.928 1.00 16.11  ? 335 LEU B CD1  1  
ATOM   10047  C  CD2  . LEU B 1 332 ? 18.628  4.552  67.706 1.00 14.48  ? 335 LEU B CD2  1  
ATOM   10048  H  H    . LEU B 1 332 ? 15.005  8.324  67.806 1.00 0.00   ? 335 LEU B H    1  
ATOM   10049  H  HA   . LEU B 1 332 ? 15.728  6.471  70.040 1.00 0.00   ? 335 LEU B HA   1  
ATOM   10050  H  HB2  . LEU B 1 332 ? 15.935  5.253  67.922 1.00 0.00   ? 335 LEU B HB2  1  
ATOM   10051  H  HB3  . LEU B 1 332 ? 16.935  6.546  67.257 1.00 0.00   ? 335 LEU B HB3  1  
ATOM   10052  H  HG   . LEU B 1 332 ? 18.562  6.149  69.142 1.00 0.00   ? 335 LEU B HG   1  
ATOM   10053  H  HD11 . LEU B 1 332 ? 18.194  3.650  70.013 1.00 0.00   ? 335 LEU B HD11 1  
ATOM   10054  H  HD12 . LEU B 1 332 ? 16.503  4.068  69.739 1.00 0.00   ? 335 LEU B HD12 1  
ATOM   10055  H  HD13 . LEU B 1 332 ? 17.480  5.029  70.848 1.00 0.00   ? 335 LEU B HD13 1  
ATOM   10056  H  HD21 . LEU B 1 332 ? 18.546  3.502  67.947 1.00 0.00   ? 335 LEU B HD21 1  
ATOM   10057  H  HD22 . LEU B 1 332 ? 19.669  4.835  67.678 1.00 0.00   ? 335 LEU B HD22 1  
ATOM   10058  H  HD23 . LEU B 1 332 ? 18.178  4.736  66.742 1.00 0.00   ? 335 LEU B HD23 1  
ATOM   10059  N  N    . ALA B 1 333 ? 17.267  8.304  70.822 1.00 12.43  ? 336 ALA B N    1  
ATOM   10060  C  CA   . ALA B 1 333 ? 18.275  9.310  71.254 1.00 13.10  ? 336 ALA B CA   1  
ATOM   10061  C  C    . ALA B 1 333 ? 19.670  8.818  70.870 1.00 12.59  ? 336 ALA B C    1  
ATOM   10062  O  O    . ALA B 1 333 ? 19.903  7.633  70.736 1.00 13.14  ? 336 ALA B O    1  
ATOM   10063  C  CB   . ALA B 1 333 ? 18.197  9.494  72.771 1.00 13.91  ? 336 ALA B CB   1  
ATOM   10064  H  H    . ALA B 1 333 ? 16.732  7.827  71.491 1.00 0.00   ? 336 ALA B H    1  
ATOM   10065  H  HA   . ALA B 1 333 ? 18.078  10.253 70.765 1.00 0.00   ? 336 ALA B HA   1  
ATOM   10066  H  HB1  . ALA B 1 333 ? 18.763  10.368 73.057 1.00 0.00   ? 336 ALA B HB1  1  
ATOM   10067  H  HB2  . ALA B 1 333 ? 18.608  8.623  73.261 1.00 0.00   ? 336 ALA B HB2  1  
ATOM   10068  H  HB3  . ALA B 1 333 ? 17.166  9.620  73.066 1.00 0.00   ? 336 ALA B HB3  1  
ATOM   10069  N  N    . PRO B 1 334 ? 20.590  9.724  70.693 1.00 12.82  ? 337 PRO B N    1  
ATOM   10070  C  CA   . PRO B 1 334 ? 21.991  9.384  70.314 1.00 13.36  ? 337 PRO B CA   1  
ATOM   10071  C  C    . PRO B 1 334 ? 22.548  8.233  71.156 1.00 14.06  ? 337 PRO B C    1  
ATOM   10072  O  O    . PRO B 1 334 ? 22.688  8.345  72.358 1.00 14.75  ? 337 PRO B O    1  
ATOM   10073  C  CB   . PRO B 1 334 ? 22.762  10.675 70.590 1.00 12.99  ? 337 PRO B CB   1  
ATOM   10074  C  CG   . PRO B 1 334 ? 21.756  11.773 70.468 1.00 13.49  ? 337 PRO B CG   1  
ATOM   10075  C  CD   . PRO B 1 334 ? 20.395  11.175 70.835 1.00 12.47  ? 337 PRO B CD   1  
ATOM   10076  H  HA   . PRO B 1 334 ? 22.049  9.145  69.265 1.00 0.00   ? 337 PRO B HA   1  
ATOM   10077  H  HB2  . PRO B 1 334 ? 23.179  10.654 71.588 1.00 0.00   ? 337 PRO B HB2  1  
ATOM   10078  H  HB3  . PRO B 1 334 ? 23.544  10.808 69.859 1.00 0.00   ? 337 PRO B HB3  1  
ATOM   10079  H  HG2  . PRO B 1 334 ? 22.006  12.577 71.148 1.00 0.00   ? 337 PRO B HG2  1  
ATOM   10080  H  HG3  . PRO B 1 334 ? 21.729  12.139 69.454 1.00 0.00   ? 337 PRO B HG3  1  
ATOM   10081  H  HD2  . PRO B 1 334 ? 20.135  11.427 71.854 1.00 0.00   ? 337 PRO B HD2  1  
ATOM   10082  H  HD3  . PRO B 1 334 ? 19.634  11.517 70.152 1.00 0.00   ? 337 PRO B HD3  1  
ATOM   10083  N  N    . SER B 1 335 ? 22.863  7.124  70.541 1.00 14.47  ? 338 SER B N    1  
ATOM   10084  C  CA   . SER B 1 335 ? 23.400  5.981  71.322 1.00 16.43  ? 338 SER B CA   1  
ATOM   10085  C  C    . SER B 1 335 ? 24.410  5.217  70.475 1.00 17.30  ? 338 SER B C    1  
ATOM   10086  O  O    . SER B 1 335 ? 24.808  5.656  69.414 1.00 15.78  ? 338 SER B O    1  
ATOM   10087  C  CB   . SER B 1 335 ? 22.254  5.049  71.716 1.00 17.82  ? 338 SER B CB   1  
ATOM   10088  O  OG   . SER B 1 335 ? 21.397  4.862  70.597 1.00 20.10  ? 338 SER B OG   1  
ATOM   10089  H  H    . SER B 1 335 ? 22.741  7.045  69.572 1.00 0.00   ? 338 SER B H    1  
ATOM   10090  H  HA   . SER B 1 335 ? 23.885  6.351  72.214 1.00 0.00   ? 338 SER B HA   1  
ATOM   10091  H  HB2  . SER B 1 335 ? 22.652  4.095  72.021 1.00 0.00   ? 338 SER B HB2  1  
ATOM   10092  H  HB3  . SER B 1 335 ? 21.702  5.486  72.537 1.00 0.00   ? 338 SER B HB3  1  
ATOM   10093  H  HG   . SER B 1 335 ? 20.609  5.394  70.735 1.00 0.00   ? 338 SER B HG   1  
ATOM   10094  N  N    . GLY B 1 336 ? 24.826  4.076  70.936 1.00 18.72  ? 339 GLY B N    1  
ATOM   10095  C  CA   . GLY B 1 336 ? 25.814  3.274  70.160 1.00 20.47  ? 339 GLY B CA   1  
ATOM   10096  C  C    . GLY B 1 336 ? 25.112  2.601  68.980 1.00 22.33  ? 339 GLY B C    1  
ATOM   10097  O  O    . GLY B 1 336 ? 24.041  2.054  69.186 1.00 23.51  ? 339 GLY B O    1  
ATOM   10098  H  H    . GLY B 1 336 ? 24.490  3.742  71.794 1.00 0.00   ? 339 GLY B H    1  
ATOM   10099  H  HA2  . GLY B 1 336 ? 26.595  3.925  69.793 1.00 0.00   ? 339 GLY B HA2  1  
ATOM   10100  H  HA3  . GLY B 1 336 ? 26.244  2.517  70.797 1.00 0.00   ? 339 GLY B HA3  1  
ATOM   10101  N  N    . ALA C 1 1   ? 5.489   32.164 14.951 1.00 21.59  ? 4   ALA C N    1  
ATOM   10102  C  CA   . ALA C 1 1   ? 5.264   32.677 13.570 1.00 21.02  ? 4   ALA C CA   1  
ATOM   10103  C  C    . ALA C 1 1   ? 6.249   32.008 12.608 1.00 20.56  ? 4   ALA C C    1  
ATOM   10104  O  O    . ALA C 1 1   ? 7.307   31.558 13.000 1.00 20.80  ? 4   ALA C O    1  
ATOM   10105  C  CB   . ALA C 1 1   ? 5.480   34.191 13.548 1.00 21.71  ? 4   ALA C CB   1  
ATOM   10106  H  HA   . ALA C 1 1   ? 4.253   32.454 13.263 1.00 0.00   ? 4   ALA C HA   1  
ATOM   10107  H  HB1  . ALA C 1 1   ? 6.239   34.436 12.819 1.00 0.00   ? 4   ALA C HB1  1  
ATOM   10108  H  HB2  . ALA C 1 1   ? 5.799   34.524 14.525 1.00 0.00   ? 4   ALA C HB2  1  
ATOM   10109  H  HB3  . ALA C 1 1   ? 4.556   34.683 13.284 1.00 0.00   ? 4   ALA C HB3  1  
ATOM   10110  N  N    . THR C 1 2   ? 5.908   31.939 11.350 1.00 20.04  ? 5   THR C N    1  
ATOM   10111  C  CA   . THR C 1 2   ? 6.818   31.303 10.366 1.00 19.53  ? 5   THR C CA   1  
ATOM   10112  C  C    . THR C 1 2   ? 7.738   32.369 9.779  1.00 18.96  ? 5   THR C C    1  
ATOM   10113  O  O    . THR C 1 2   ? 7.537   33.552 9.969  1.00 17.84  ? 5   THR C O    1  
ATOM   10114  C  CB   . THR C 1 2   ? 5.995   30.663 9.246  1.00 19.80  ? 5   THR C CB   1  
ATOM   10115  O  OG1  . THR C 1 2   ? 5.408   31.683 8.450  1.00 19.55  ? 5   THR C OG1  1  
ATOM   10116  C  CG2  . THR C 1 2   ? 4.895   29.790 9.852  1.00 20.39  ? 5   THR C CG2  1  
ATOM   10117  H  H    . THR C 1 2   ? 5.050   32.309 11.055 1.00 0.00   ? 5   THR C H    1  
ATOM   10118  H  HA   . THR C 1 2   ? 7.410   30.545 10.858 1.00 0.00   ? 5   THR C HA   1  
ATOM   10119  H  HB   . THR C 1 2   ? 6.636   30.051 8.631  1.00 0.00   ? 5   THR C HB   1  
ATOM   10120  H  HG1  . THR C 1 2   ? 5.938   31.781 7.655  1.00 0.00   ? 5   THR C HG1  1  
ATOM   10121  H  HG21 . THR C 1 2   ? 5.257   29.336 10.763 1.00 0.00   ? 5   THR C HG21 1  
ATOM   10122  H  HG22 . THR C 1 2   ? 4.620   29.018 9.149  1.00 0.00   ? 5   THR C HG22 1  
ATOM   10123  H  HG23 . THR C 1 2   ? 4.032   30.401 10.073 1.00 0.00   ? 5   THR C HG23 1  
ATOM   10124  N  N    . ALA C 1 3   ? 8.746   31.960 9.070  1.00 18.61  ? 6   ALA C N    1  
ATOM   10125  C  CA   . ALA C 1 3   ? 9.685   32.950 8.470  1.00 18.51  ? 6   ALA C CA   1  
ATOM   10126  C  C    . ALA C 1 3   ? 8.911   33.924 7.577  1.00 18.25  ? 6   ALA C C    1  
ATOM   10127  O  O    . ALA C 1 3   ? 9.142   35.117 7.598  1.00 18.09  ? 6   ALA C O    1  
ATOM   10128  C  CB   . ALA C 1 3   ? 10.732  32.214 7.631  1.00 18.53  ? 6   ALA C CB   1  
ATOM   10129  H  H    . ALA C 1 3   ? 8.890   31.001 8.931  1.00 0.00   ? 6   ALA C H    1  
ATOM   10130  H  HA   . ALA C 1 3   ? 10.179  33.500 9.257  1.00 0.00   ? 6   ALA C HA   1  
ATOM   10131  H  HB1  . ALA C 1 3   ? 10.688  31.157 7.848  1.00 0.00   ? 6   ALA C HB1  1  
ATOM   10132  H  HB2  . ALA C 1 3   ? 11.715  32.591 7.871  1.00 0.00   ? 6   ALA C HB2  1  
ATOM   10133  H  HB3  . ALA C 1 3   ? 10.530  32.374 6.582  1.00 0.00   ? 6   ALA C HB3  1  
ATOM   10134  N  N    . ALA C 1 4   ? 7.997   33.427 6.788  1.00 18.43  ? 7   ALA C N    1  
ATOM   10135  C  CA   . ALA C 1 4   ? 7.215   34.326 5.893  1.00 17.47  ? 7   ALA C CA   1  
ATOM   10136  C  C    . ALA C 1 4   ? 6.460   35.356 6.733  1.00 17.23  ? 7   ALA C C    1  
ATOM   10137  O  O    . ALA C 1 4   ? 6.465   36.535 6.440  1.00 17.20  ? 7   ALA C O    1  
ATOM   10138  C  CB   . ALA C 1 4   ? 6.215   33.496 5.085  1.00 17.74  ? 7   ALA C CB   1  
ATOM   10139  H  H    . ALA C 1 4   ? 7.827   32.462 6.782  1.00 0.00   ? 7   ALA C H    1  
ATOM   10140  H  HA   . ALA C 1 4   ? 7.888   34.835 5.218  1.00 0.00   ? 7   ALA C HA   1  
ATOM   10141  H  HB1  . ALA C 1 4   ? 6.448   32.447 5.193  1.00 0.00   ? 7   ALA C HB1  1  
ATOM   10142  H  HB2  . ALA C 1 4   ? 6.277   33.773 4.043  1.00 0.00   ? 7   ALA C HB2  1  
ATOM   10143  H  HB3  . ALA C 1 4   ? 5.216   33.683 5.449  1.00 0.00   ? 7   ALA C HB3  1  
ATOM   10144  N  N    . GLU C 1 5   ? 5.809   34.921 7.776  1.00 16.45  ? 8   GLU C N    1  
ATOM   10145  C  CA   . GLU C 1 5   ? 5.051   35.876 8.635  1.00 16.84  ? 8   GLU C CA   1  
ATOM   10146  C  C    . GLU C 1 5   ? 6.000   36.939 9.203  1.00 16.76  ? 8   GLU C C    1  
ATOM   10147  O  O    . GLU C 1 5   ? 5.678   38.110 9.246  1.00 17.12  ? 8   GLU C O    1  
ATOM   10148  C  CB   . GLU C 1 5   ? 4.396   35.112 9.788  1.00 17.36  ? 8   GLU C CB   1  
ATOM   10149  C  CG   . GLU C 1 5   ? 3.121   34.429 9.288  1.00 18.35  ? 8   GLU C CG   1  
ATOM   10150  C  CD   . GLU C 1 5   ? 2.639   33.422 10.334 1.00 22.48  ? 8   GLU C CD   1  
ATOM   10151  O  OE1  . GLU C 1 5   ? 3.406   33.114 11.230 1.00 22.32  ? 8   GLU C OE1  1  
ATOM   10152  O  OE2  . GLU C 1 5   ? 1.509   32.975 10.220 1.00 25.74  ? 8   GLU C OE2  1  
ATOM   10153  H  H    . GLU C 1 5   ? 5.816   33.966 7.994  1.00 0.00   ? 8   GLU C H    1  
ATOM   10154  H  HA   . GLU C 1 5   ? 4.286   36.359 8.045  1.00 0.00   ? 8   GLU C HA   1  
ATOM   10155  H  HB2  . GLU C 1 5   ? 5.083   34.367 10.162 1.00 0.00   ? 8   GLU C HB2  1  
ATOM   10156  H  HB3  . GLU C 1 5   ? 4.145   35.801 10.580 1.00 0.00   ? 8   GLU C HB3  1  
ATOM   10157  H  HG2  . GLU C 1 5   ? 2.355   35.173 9.123  1.00 0.00   ? 8   GLU C HG2  1  
ATOM   10158  H  HG3  . GLU C 1 5   ? 3.328   33.912 8.363  1.00 0.00   ? 8   GLU C HG3  1  
ATOM   10159  N  N    . ILE C 1 6   ? 7.163   36.543 9.649  1.00 16.27  ? 9   ILE C N    1  
ATOM   10160  C  CA   . ILE C 1 6   ? 8.120   37.534 10.222 1.00 16.74  ? 9   ILE C CA   1  
ATOM   10161  C  C    . ILE C 1 6   ? 8.629   38.476 9.124  1.00 16.82  ? 9   ILE C C    1  
ATOM   10162  O  O    . ILE C 1 6   ? 8.872   39.643 9.361  1.00 16.38  ? 9   ILE C O    1  
ATOM   10163  C  CB   . ILE C 1 6   ? 9.305   36.793 10.844 1.00 17.28  ? 9   ILE C CB   1  
ATOM   10164  C  CG1  . ILE C 1 6   ? 8.809   35.919 11.998 1.00 17.06  ? 9   ILE C CG1  1  
ATOM   10165  C  CG2  . ILE C 1 6   ? 10.320  37.807 11.374 1.00 17.88  ? 9   ILE C CG2  1  
ATOM   10166  C  CD1  . ILE C 1 6   ? 9.915   34.947 12.414 1.00 18.47  ? 9   ILE C CD1  1  
ATOM   10167  H  H    . ILE C 1 6   ? 7.404   35.594 9.613  1.00 0.00   ? 9   ILE C H    1  
ATOM   10168  H  HA   . ILE C 1 6   ? 7.621   38.113 10.985 1.00 0.00   ? 9   ILE C HA   1  
ATOM   10169  H  HB   . ILE C 1 6   ? 9.774   36.172 10.094 1.00 0.00   ? 9   ILE C HB   1  
ATOM   10170  H  HG12 . ILE C 1 6   ? 8.546   36.546 12.837 1.00 0.00   ? 9   ILE C HG12 1  
ATOM   10171  H  HG13 . ILE C 1 6   ? 7.942   35.360 11.680 1.00 0.00   ? 9   ILE C HG13 1  
ATOM   10172  H  HG21 . ILE C 1 6   ? 11.047  37.300 11.991 1.00 0.00   ? 9   ILE C HG21 1  
ATOM   10173  H  HG22 . ILE C 1 6   ? 9.809   38.555 11.961 1.00 0.00   ? 9   ILE C HG22 1  
ATOM   10174  H  HG23 . ILE C 1 6   ? 10.822  38.282 10.543 1.00 0.00   ? 9   ILE C HG23 1  
ATOM   10175  H  HD11 . ILE C 1 6   ? 10.638  35.464 13.026 1.00 0.00   ? 9   ILE C HD11 1  
ATOM   10176  H  HD12 . ILE C 1 6   ? 10.403  34.558 11.532 1.00 0.00   ? 9   ILE C HD12 1  
ATOM   10177  H  HD13 . ILE C 1 6   ? 9.485   34.131 12.976 1.00 0.00   ? 9   ILE C HD13 1  
ATOM   10178  N  N    . ALA C 1 7   ? 8.803   37.981 7.929  1.00 16.85  ? 10  ALA C N    1  
ATOM   10179  C  CA   . ALA C 1 7   ? 9.308   38.852 6.825  1.00 17.19  ? 10  ALA C CA   1  
ATOM   10180  C  C    . ALA C 1 7   ? 8.260   39.910 6.438  1.00 16.73  ? 10  ALA C C    1  
ATOM   10181  O  O    . ALA C 1 7   ? 8.594   40.958 5.922  1.00 17.41  ? 10  ALA C O    1  
ATOM   10182  C  CB   . ALA C 1 7   ? 9.623   37.986 5.604  1.00 17.66  ? 10  ALA C CB   1  
ATOM   10183  H  H    . ALA C 1 7   ? 8.609   37.036 7.757  1.00 0.00   ? 10  ALA C H    1  
ATOM   10184  H  HA   . ALA C 1 7   ? 10.211  39.349 7.149  1.00 0.00   ? 10  ALA C HA   1  
ATOM   10185  H  HB1  . ALA C 1 7   ? 10.037  37.042 5.929  1.00 0.00   ? 10  ALA C HB1  1  
ATOM   10186  H  HB2  . ALA C 1 7   ? 10.339  38.495 4.976  1.00 0.00   ? 10  ALA C HB2  1  
ATOM   10187  H  HB3  . ALA C 1 7   ? 8.717   37.807 5.045  1.00 0.00   ? 10  ALA C HB3  1  
ATOM   10188  N  N    . ALA C 1 8   ? 7.001   39.646 6.667  1.00 16.71  ? 11  ALA C N    1  
ATOM   10189  C  CA   . ALA C 1 8   ? 5.948   40.641 6.292  1.00 17.05  ? 11  ALA C CA   1  
ATOM   10190  C  C    . ALA C 1 8   ? 5.659   41.632 7.441  1.00 16.95  ? 11  ALA C C    1  
ATOM   10191  O  O    . ALA C 1 8   ? 4.840   42.518 7.295  1.00 17.37  ? 11  ALA C O    1  
ATOM   10192  C  CB   . ALA C 1 8   ? 4.660   39.895 5.940  1.00 17.11  ? 11  ALA C CB   1  
ATOM   10193  H  H    . ALA C 1 8   ? 6.745   38.792 7.075  1.00 0.00   ? 11  ALA C H    1  
ATOM   10194  H  HA   . ALA C 1 8   ? 6.279   41.194 5.426  1.00 0.00   ? 11  ALA C HA   1  
ATOM   10195  H  HB1  . ALA C 1 8   ? 4.766   38.852 6.197  1.00 0.00   ? 11  ALA C HB1  1  
ATOM   10196  H  HB2  . ALA C 1 8   ? 4.468   39.988 4.882  1.00 0.00   ? 11  ALA C HB2  1  
ATOM   10197  H  HB3  . ALA C 1 8   ? 3.835   40.320 6.494  1.00 0.00   ? 11  ALA C HB3  1  
ATOM   10198  N  N    . LEU C 1 9   ? 6.305   41.509 8.575  1.00 17.21  ? 12  LEU C N    1  
ATOM   10199  C  CA   . LEU C 1 9   ? 6.024   42.470 9.689  1.00 17.41  ? 12  LEU C CA   1  
ATOM   10200  C  C    . LEU C 1 9   ? 6.747   43.797 9.422  1.00 17.55  ? 12  LEU C C    1  
ATOM   10201  O  O    . LEU C 1 9   ? 7.831   43.815 8.874  1.00 17.37  ? 12  LEU C O    1  
ATOM   10202  C  CB   . LEU C 1 9   ? 6.520   41.877 11.010 1.00 17.16  ? 12  LEU C CB   1  
ATOM   10203  C  CG   . LEU C 1 9   ? 5.731   40.606 11.327 1.00 17.33  ? 12  LEU C CG   1  
ATOM   10204  C  CD1  . LEU C 1 9   ? 6.338   39.920 12.552 1.00 17.15  ? 12  LEU C CD1  1  
ATOM   10205  C  CD2  . LEU C 1 9   ? 4.274   40.972 11.619 1.00 18.58  ? 12  LEU C CD2  1  
ATOM   10206  H  H    . LEU C 1 9   ? 6.965   40.794 8.693  1.00 0.00   ? 12  LEU C H    1  
ATOM   10207  H  HA   . LEU C 1 9   ? 4.960   42.647 9.751  1.00 0.00   ? 12  LEU C HA   1  
ATOM   10208  H  HB2  . LEU C 1 9   ? 7.570   41.638 10.925 1.00 0.00   ? 12  LEU C HB2  1  
ATOM   10209  H  HB3  . LEU C 1 9   ? 6.376   42.595 11.803 1.00 0.00   ? 12  LEU C HB3  1  
ATOM   10210  H  HG   . LEU C 1 9   ? 5.773   39.936 10.481 1.00 0.00   ? 12  LEU C HG   1  
ATOM   10211  H  HD11 . LEU C 1 9   ? 6.505   38.875 12.333 1.00 0.00   ? 12  LEU C HD11 1  
ATOM   10212  H  HD12 . LEU C 1 9   ? 5.660   40.009 13.388 1.00 0.00   ? 12  LEU C HD12 1  
ATOM   10213  H  HD13 . LEU C 1 9   ? 7.278   40.390 12.799 1.00 0.00   ? 12  LEU C HD13 1  
ATOM   10214  H  HD21 . LEU C 1 9   ? 4.046   41.929 11.174 1.00 0.00   ? 12  LEU C HD21 1  
ATOM   10215  H  HD22 . LEU C 1 9   ? 4.123   41.026 12.687 1.00 0.00   ? 12  LEU C HD22 1  
ATOM   10216  H  HD23 . LEU C 1 9   ? 3.623   40.217 11.202 1.00 0.00   ? 12  LEU C HD23 1  
ATOM   10217  N  N    . PRO C 1 10  ? 6.155   44.904 9.812  1.00 18.91  ? 13  PRO C N    1  
ATOM   10218  C  CA   . PRO C 1 10  ? 6.774   46.254 9.607  1.00 20.01  ? 13  PRO C CA   1  
ATOM   10219  C  C    . PRO C 1 10  ? 8.070   46.442 10.422 1.00 20.10  ? 13  PRO C C    1  
ATOM   10220  O  O    . PRO C 1 10  ? 8.128   46.111 11.590 1.00 19.99  ? 13  PRO C O    1  
ATOM   10221  C  CB   . PRO C 1 10  ? 5.695   47.231 10.087 1.00 20.23  ? 13  PRO C CB   1  
ATOM   10222  C  CG   . PRO C 1 10  ? 4.790   46.435 10.972 1.00 21.45  ? 13  PRO C CG   1  
ATOM   10223  C  CD   . PRO C 1 10  ? 4.852   44.989 10.482 1.00 18.66  ? 13  PRO C CD   1  
ATOM   10224  H  HA   . PRO C 1 10  ? 6.967   46.420 8.560  1.00 0.00   ? 13  PRO C HA   1  
ATOM   10225  H  HB2  . PRO C 1 10  ? 6.148   48.040 10.644 1.00 0.00   ? 13  PRO C HB2  1  
ATOM   10226  H  HB3  . PRO C 1 10  ? 5.141   47.618 9.247  1.00 0.00   ? 13  PRO C HB3  1  
ATOM   10227  H  HG2  . PRO C 1 10  ? 5.128   46.497 11.997 1.00 0.00   ? 13  PRO C HG2  1  
ATOM   10228  H  HG3  . PRO C 1 10  ? 3.778   46.802 10.892 1.00 0.00   ? 13  PRO C HG3  1  
ATOM   10229  H  HD2  . PRO C 1 10  ? 4.805   44.304 11.318 1.00 0.00   ? 13  PRO C HD2  1  
ATOM   10230  H  HD3  . PRO C 1 10  ? 4.057   44.790 9.780  1.00 0.00   ? 13  PRO C HD3  1  
ATOM   10231  N  N    . ARG C 1 11  ? 9.110   46.976 9.817  1.00 20.89  ? 14  ARG C N    1  
ATOM   10232  C  CA   . ARG C 1 11  ? 10.384  47.183 10.566 1.00 21.37  ? 14  ARG C CA   1  
ATOM   10233  C  C    . ARG C 1 11  ? 10.553  48.669 10.921 1.00 22.05  ? 14  ARG C C    1  
ATOM   10234  O  O    . ARG C 1 11  ? 10.269  49.546 10.129 1.00 22.60  ? 14  ARG C O    1  
ATOM   10235  C  CB   . ARG C 1 11  ? 11.561  46.732 9.699  1.00 21.67  ? 14  ARG C CB   1  
ATOM   10236  C  CG   . ARG C 1 11  ? 12.065  45.373 10.188 1.00 22.44  ? 14  ARG C CG   1  
ATOM   10237  C  CD   . ARG C 1 11  ? 11.196  44.262 9.595  1.00 23.24  ? 14  ARG C CD   1  
ATOM   10238  N  NE   . ARG C 1 11  ? 11.999  43.012 9.478  1.00 21.95  ? 14  ARG C NE   1  
ATOM   10239  C  CZ   . ARG C 1 11  ? 11.416  41.889 9.161  1.00 20.94  ? 14  ARG C CZ   1  
ATOM   10240  N  NH1  . ARG C 1 11  ? 10.129  41.860 8.947  1.00 18.56  ? 14  ARG C NH1  1  
ATOM   10241  N  NH2  . ARG C 1 11  ? 12.119  40.794 9.059  1.00 21.84  ? 14  ARG C NH2  1  
ATOM   10242  H  H    . ARG C 1 11  ? 9.046   47.241 8.876  1.00 0.00   ? 14  ARG C H    1  
ATOM   10243  H  HA   . ARG C 1 11  ? 10.365  46.599 11.474 1.00 0.00   ? 14  ARG C HA   1  
ATOM   10244  H  HB2  . ARG C 1 11  ? 11.239  46.649 8.670  1.00 0.00   ? 14  ARG C HB2  1  
ATOM   10245  H  HB3  . ARG C 1 11  ? 12.359  47.456 9.769  1.00 0.00   ? 14  ARG C HB3  1  
ATOM   10246  H  HG2  . ARG C 1 11  ? 13.090  45.236 9.875  1.00 0.00   ? 14  ARG C HG2  1  
ATOM   10247  H  HG3  . ARG C 1 11  ? 12.009  45.334 11.265 1.00 0.00   ? 14  ARG C HG3  1  
ATOM   10248  H  HD2  . ARG C 1 11  ? 10.348  44.086 10.239 1.00 0.00   ? 14  ARG C HD2  1  
ATOM   10249  H  HD3  . ARG C 1 11  ? 10.850  44.560 8.616  1.00 0.00   ? 14  ARG C HD3  1  
ATOM   10250  H  HE   . ARG C 1 11  ? 12.966  43.034 9.639  1.00 0.00   ? 14  ARG C HE   1  
ATOM   10251  H  HH11 . ARG C 1 11  ? 9.590   42.699 9.025  1.00 0.00   ? 14  ARG C HH11 1  
ATOM   10252  H  HH12 . ARG C 1 11  ? 9.681   40.999 8.704  1.00 0.00   ? 14  ARG C HH12 1  
ATOM   10253  H  HH21 . ARG C 1 11  ? 13.105  40.817 9.224  1.00 0.00   ? 14  ARG C HH21 1  
ATOM   10254  H  HH22 . ARG C 1 11  ? 11.672  39.934 8.817  1.00 0.00   ? 14  ARG C HH22 1  
ATOM   10255  N  N    . GLN C 1 12  ? 11.024  48.949 12.109 1.00 22.21  ? 15  GLN C N    1  
ATOM   10256  C  CA   . GLN C 1 12  ? 11.232  50.360 12.538 1.00 22.70  ? 15  GLN C CA   1  
ATOM   10257  C  C    . GLN C 1 12  ? 12.659  50.519 13.084 1.00 22.46  ? 15  GLN C C    1  
ATOM   10258  O  O    . GLN C 1 12  ? 13.063  49.845 14.010 1.00 21.19  ? 15  GLN C O    1  
ATOM   10259  C  CB   . GLN C 1 12  ? 10.224  50.714 13.634 1.00 23.38  ? 15  GLN C CB   1  
ATOM   10260  C  CG   . GLN C 1 12  ? 10.413  52.175 14.049 1.00 25.98  ? 15  GLN C CG   1  
ATOM   10261  C  CD   . GLN C 1 12  ? 9.519   52.483 15.251 1.00 29.47  ? 15  GLN C CD   1  
ATOM   10262  O  OE1  . GLN C 1 12  ? 8.970   51.587 15.861 1.00 31.98  ? 15  GLN C OE1  1  
ATOM   10263  N  NE2  . GLN C 1 12  ? 9.349   53.723 15.621 1.00 33.42  ? 15  GLN C NE2  1  
ATOM   10264  H  H    . GLN C 1 12  ? 11.250  48.219 12.723 1.00 0.00   ? 15  GLN C H    1  
ATOM   10265  H  HA   . GLN C 1 12  ? 11.093  51.018 11.693 1.00 0.00   ? 15  GLN C HA   1  
ATOM   10266  H  HB2  . GLN C 1 12  ? 9.221   50.572 13.258 1.00 0.00   ? 15  GLN C HB2  1  
ATOM   10267  H  HB3  . GLN C 1 12  ? 10.383  50.075 14.489 1.00 0.00   ? 15  GLN C HB3  1  
ATOM   10268  H  HG2  . GLN C 1 12  ? 11.447  52.342 14.315 1.00 0.00   ? 15  GLN C HG2  1  
ATOM   10269  H  HG3  . GLN C 1 12  ? 10.143  52.821 13.227 1.00 0.00   ? 15  GLN C HG3  1  
ATOM   10270  H  HE21 . GLN C 1 12  ? 9.791   54.446 15.129 1.00 0.00   ? 15  GLN C HE21 1  
ATOM   10271  H  HE22 . GLN C 1 12  ? 8.778   53.932 16.390 1.00 0.00   ? 15  GLN C HE22 1  
ATOM   10272  N  N    . LYS C 1 13  ? 13.417  51.406 12.505 1.00 22.30  ? 16  LYS C N    1  
ATOM   10273  C  CA   . LYS C 1 13  ? 14.804  51.634 12.948 1.00 23.06  ? 16  LYS C CA   1  
ATOM   10274  C  C    . LYS C 1 13  ? 14.768  52.647 14.069 1.00 22.59  ? 16  LYS C C    1  
ATOM   10275  O  O    . LYS C 1 13  ? 14.040  53.619 14.028 1.00 22.66  ? 16  LYS C O    1  
ATOM   10276  C  CB   . LYS C 1 13  ? 15.638  52.176 11.785 1.00 23.78  ? 16  LYS C CB   1  
ATOM   10277  C  CG   . LYS C 1 13  ? 15.929  51.047 10.795 1.00 27.85  ? 16  LYS C CG   1  
ATOM   10278  C  CD   . LYS C 1 13  ? 16.971  51.516 9.778  1.00 32.25  ? 16  LYS C CD   1  
ATOM   10279  C  CE   . LYS C 1 13  ? 16.294  52.379 8.712  1.00 34.31  ? 16  LYS C CE   1  
ATOM   10280  N  NZ   . LYS C 1 13  ? 15.126  51.646 8.147  1.00 35.71  ? 16  LYS C NZ   1  
ATOM   10281  H  H    . LYS C 1 13  ? 13.059  51.930 11.758 1.00 0.00   ? 16  LYS C H    1  
ATOM   10282  H  HA   . LYS C 1 13  ? 15.231  50.708 13.305 1.00 0.00   ? 16  LYS C HA   1  
ATOM   10283  H  HB2  . LYS C 1 13  ? 15.090  52.962 11.286 1.00 0.00   ? 16  LYS C HB2  1  
ATOM   10284  H  HB3  . LYS C 1 13  ? 16.569  52.570 12.163 1.00 0.00   ? 16  LYS C HB3  1  
ATOM   10285  H  HG2  . LYS C 1 13  ? 16.307  50.188 11.330 1.00 0.00   ? 16  LYS C HG2  1  
ATOM   10286  H  HG3  . LYS C 1 13  ? 15.020  50.778 10.278 1.00 0.00   ? 16  LYS C HG3  1  
ATOM   10287  H  HD2  . LYS C 1 13  ? 17.731  52.095 10.283 1.00 0.00   ? 16  LYS C HD2  1  
ATOM   10288  H  HD3  . LYS C 1 13  ? 17.426  50.657 9.307  1.00 0.00   ? 16  LYS C HD3  1  
ATOM   10289  H  HE2  . LYS C 1 13  ? 15.957  53.303 9.159  1.00 0.00   ? 16  LYS C HE2  1  
ATOM   10290  H  HE3  . LYS C 1 13  ? 16.999  52.597 7.923  1.00 0.00   ? 16  LYS C HE3  1  
ATOM   10291  H  HZ1  . LYS C 1 13  ? 14.722  51.023 8.875  1.00 0.00   ? 16  LYS C HZ1  1  
ATOM   10292  H  HZ2  . LYS C 1 13  ? 15.435  51.072 7.337  1.00 0.00   ? 16  LYS C HZ2  1  
ATOM   10293  H  HZ3  . LYS C 1 13  ? 14.406  52.329 7.835  1.00 0.00   ? 16  LYS C HZ3  1  
ATOM   10294  N  N    . VAL C 1 14  ? 15.523  52.414 15.079 1.00 21.50  ? 17  VAL C N    1  
ATOM   10295  C  CA   . VAL C 1 14  ? 15.521  53.346 16.234 1.00 21.52  ? 17  VAL C CA   1  
ATOM   10296  C  C    . VAL C 1 14  ? 16.931  53.870 16.505 1.00 21.11  ? 17  VAL C C    1  
ATOM   10297  O  O    . VAL C 1 14  ? 17.902  53.139 16.493 1.00 21.49  ? 17  VAL C O    1  
ATOM   10298  C  CB   . VAL C 1 14  ? 15.008  52.612 17.474 1.00 21.39  ? 17  VAL C CB   1  
ATOM   10299  C  CG1  . VAL C 1 14  ? 15.158  53.514 18.700 1.00 22.54  ? 17  VAL C CG1  1  
ATOM   10300  C  CG2  . VAL C 1 14  ? 13.532  52.257 17.281 1.00 22.52  ? 17  VAL C CG2  1  
ATOM   10301  H  H    . VAL C 1 14  ? 16.085  51.612 15.097 1.00 0.00   ? 17  VAL C H    1  
ATOM   10302  H  HA   . VAL C 1 14  ? 14.867  54.178 16.020 1.00 0.00   ? 17  VAL C HA   1  
ATOM   10303  H  HB   . VAL C 1 14  ? 15.582  51.708 17.620 1.00 0.00   ? 17  VAL C HB   1  
ATOM   10304  H  HG11 . VAL C 1 14  ? 16.206  53.638 18.930 1.00 0.00   ? 17  VAL C HG11 1  
ATOM   10305  H  HG12 . VAL C 1 14  ? 14.656  53.062 19.543 1.00 0.00   ? 17  VAL C HG12 1  
ATOM   10306  H  HG13 . VAL C 1 14  ? 14.718  54.478 18.494 1.00 0.00   ? 17  VAL C HG13 1  
ATOM   10307  H  HG21 . VAL C 1 14  ? 12.993  52.448 18.197 1.00 0.00   ? 17  VAL C HG21 1  
ATOM   10308  H  HG22 . VAL C 1 14  ? 13.444  51.212 17.023 1.00 0.00   ? 17  VAL C HG22 1  
ATOM   10309  H  HG23 . VAL C 1 14  ? 13.118  52.860 16.487 1.00 0.00   ? 17  VAL C HG23 1  
ATOM   10310  N  N    . GLU C 1 15  ? 17.027  55.137 16.768 1.00 21.26  ? 18  GLU C N    1  
ATOM   10311  C  CA   . GLU C 1 15  ? 18.329  55.769 17.069 1.00 21.96  ? 18  GLU C CA   1  
ATOM   10312  C  C    . GLU C 1 15  ? 18.492  55.748 18.576 1.00 20.09  ? 18  GLU C C    1  
ATOM   10313  O  O    . GLU C 1 15  ? 17.646  56.214 19.313 1.00 20.13  ? 18  GLU C O    1  
ATOM   10314  C  CB   . GLU C 1 15  ? 18.337  57.213 16.563 1.00 23.12  ? 18  GLU C CB   1  
ATOM   10315  C  CG   . GLU C 1 15  ? 18.885  57.252 15.135 1.00 28.59  ? 18  GLU C CG   1  
ATOM   10316  C  CD   . GLU C 1 15  ? 17.909  56.543 14.195 1.00 33.55  ? 18  GLU C CD   1  
ATOM   10317  O  OE1  . GLU C 1 15  ? 16.759  56.946 14.152 1.00 38.75  ? 18  GLU C OE1  1  
ATOM   10318  O  OE2  . GLU C 1 15  ? 18.329  55.608 13.532 1.00 37.23  ? 18  GLU C OE2  1  
ATOM   10319  H  H    . GLU C 1 15  ? 16.215  55.686 16.780 1.00 0.00   ? 18  GLU C H    1  
ATOM   10320  H  HA   . GLU C 1 15  ? 19.127  55.208 16.604 1.00 0.00   ? 18  GLU C HA   1  
ATOM   10321  H  HB2  . GLU C 1 15  ? 17.330  57.604 16.574 1.00 0.00   ? 18  GLU C HB2  1  
ATOM   10322  H  HB3  . GLU C 1 15  ? 18.964  57.816 17.203 1.00 0.00   ? 18  GLU C HB3  1  
ATOM   10323  H  HG2  . GLU C 1 15  ? 19.005  58.279 14.823 1.00 0.00   ? 18  GLU C HG2  1  
ATOM   10324  H  HG3  . GLU C 1 15  ? 19.841  56.751 15.103 1.00 0.00   ? 18  GLU C HG3  1  
ATOM   10325  N  N    . LEU C 1 16  ? 19.542  55.170 19.038 1.00 19.07  ? 19  LEU C N    1  
ATOM   10326  C  CA   . LEU C 1 16  ? 19.746  55.059 20.507 1.00 18.65  ? 19  LEU C CA   1  
ATOM   10327  C  C    . LEU C 1 16  ? 20.428  56.305 21.052 1.00 18.25  ? 19  LEU C C    1  
ATOM   10328  O  O    . LEU C 1 16  ? 21.185  56.968 20.371 1.00 18.69  ? 19  LEU C O    1  
ATOM   10329  C  CB   . LEU C 1 16  ? 20.616  53.836 20.805 1.00 18.49  ? 19  LEU C CB   1  
ATOM   10330  C  CG   . LEU C 1 16  ? 19.845  52.563 20.453 1.00 18.66  ? 19  LEU C CG   1  
ATOM   10331  C  CD1  . LEU C 1 16  ? 20.833  51.433 20.158 1.00 20.19  ? 19  LEU C CD1  1  
ATOM   10332  C  CD2  . LEU C 1 16  ? 18.955  52.165 21.633 1.00 18.74  ? 19  LEU C CD2  1  
ATOM   10333  H  H    . LEU C 1 16  ? 20.191  54.770 18.422 1.00 0.00   ? 19  LEU C H    1  
ATOM   10334  H  HA   . LEU C 1 16  ? 18.789  54.937 20.991 1.00 0.00   ? 19  LEU C HA   1  
ATOM   10335  H  HB2  . LEU C 1 16  ? 21.520  53.886 20.214 1.00 0.00   ? 19  LEU C HB2  1  
ATOM   10336  H  HB3  . LEU C 1 16  ? 20.871  53.823 21.854 1.00 0.00   ? 19  LEU C HB3  1  
ATOM   10337  H  HG   . LEU C 1 16  ? 19.232  52.743 19.582 1.00 0.00   ? 19  LEU C HG   1  
ATOM   10338  H  HD11 . LEU C 1 16  ? 21.838  51.769 20.366 1.00 0.00   ? 19  LEU C HD11 1  
ATOM   10339  H  HD12 . LEU C 1 16  ? 20.755  51.150 19.118 1.00 0.00   ? 19  LEU C HD12 1  
ATOM   10340  H  HD13 . LEU C 1 16  ? 20.602  50.581 20.780 1.00 0.00   ? 19  LEU C HD13 1  
ATOM   10341  H  HD21 . LEU C 1 16  ? 18.262  52.965 21.847 1.00 0.00   ? 19  LEU C HD21 1  
ATOM   10342  H  HD22 . LEU C 1 16  ? 19.570  51.981 22.502 1.00 0.00   ? 19  LEU C HD22 1  
ATOM   10343  H  HD23 . LEU C 1 16  ? 18.406  51.269 21.384 1.00 0.00   ? 19  LEU C HD23 1  
ATOM   10344  N  N    . VAL C 1 17  ? 20.171  56.616 22.289 1.00 17.48  ? 20  VAL C N    1  
ATOM   10345  C  CA   . VAL C 1 17  ? 20.804  57.803 22.905 1.00 17.49  ? 20  VAL C CA   1  
ATOM   10346  C  C    . VAL C 1 17  ? 21.767  57.311 23.973 1.00 16.52  ? 20  VAL C C    1  
ATOM   10347  O  O    . VAL C 1 17  ? 21.942  56.123 24.156 1.00 16.02  ? 20  VAL C O    1  
ATOM   10348  C  CB   . VAL C 1 17  ? 19.732  58.690 23.542 1.00 17.84  ? 20  VAL C CB   1  
ATOM   10349  C  CG1  . VAL C 1 17  ? 18.913  59.370 22.445 1.00 19.17  ? 20  VAL C CG1  1  
ATOM   10350  C  CG2  . VAL C 1 17  ? 18.808  57.829 24.407 1.00 19.44  ? 20  VAL C CG2  1  
ATOM   10351  H  H    . VAL C 1 17  ? 19.564  56.056 22.817 1.00 0.00   ? 20  VAL C H    1  
ATOM   10352  H  HA   . VAL C 1 17  ? 21.344  58.361 22.154 1.00 0.00   ? 20  VAL C HA   1  
ATOM   10353  H  HB   . VAL C 1 17  ? 20.206  59.442 24.156 1.00 0.00   ? 20  VAL C HB   1  
ATOM   10354  H  HG11 . VAL C 1 17  ? 19.272  60.379 22.300 1.00 0.00   ? 20  VAL C HG11 1  
ATOM   10355  H  HG12 . VAL C 1 17  ? 17.873  59.396 22.735 1.00 0.00   ? 20  VAL C HG12 1  
ATOM   10356  H  HG13 . VAL C 1 17  ? 19.016  58.817 21.523 1.00 0.00   ? 20  VAL C HG13 1  
ATOM   10357  H  HG21 . VAL C 1 17  ? 18.306  58.455 25.130 1.00 0.00   ? 20  VAL C HG21 1  
ATOM   10358  H  HG22 . VAL C 1 17  ? 19.392  57.081 24.923 1.00 0.00   ? 20  VAL C HG22 1  
ATOM   10359  H  HG23 . VAL C 1 17  ? 18.076  57.344 23.779 1.00 0.00   ? 20  VAL C HG23 1  
ATOM   10360  N  N    . ASP C 1 18  ? 22.394  58.193 24.683 1.00 16.47  ? 21  ASP C N    1  
ATOM   10361  C  CA   . ASP C 1 18  ? 23.346  57.724 25.742 1.00 16.24  ? 21  ASP C CA   1  
ATOM   10362  C  C    . ASP C 1 18  ? 22.714  57.878 27.135 1.00 15.47  ? 21  ASP C C    1  
ATOM   10363  O  O    . ASP C 1 18  ? 22.183  58.921 27.462 1.00 15.13  ? 21  ASP C O    1  
ATOM   10364  C  CB   . ASP C 1 18  ? 24.629  58.555 25.673 1.00 16.26  ? 21  ASP C CB   1  
ATOM   10365  C  CG   . ASP C 1 18  ? 25.364  58.254 24.366 1.00 18.34  ? 21  ASP C CG   1  
ATOM   10366  O  OD1  . ASP C 1 18  ? 25.025  57.268 23.733 1.00 19.56  ? 21  ASP C OD1  1  
ATOM   10367  O  OD2  . ASP C 1 18  ? 26.252  59.015 24.020 1.00 20.62  ? 21  ASP C OD2  1  
ATOM   10368  H  H    . ASP C 1 18  ? 22.248  59.150 24.532 1.00 0.00   ? 21  ASP C H    1  
ATOM   10369  H  HA   . ASP C 1 18  ? 23.585  56.684 25.572 1.00 0.00   ? 21  ASP C HA   1  
ATOM   10370  H  HB2  . ASP C 1 18  ? 24.379  59.606 25.714 1.00 0.00   ? 21  ASP C HB2  1  
ATOM   10371  H  HB3  . ASP C 1 18  ? 25.266  58.304 26.508 1.00 0.00   ? 21  ASP C HB3  1  
ATOM   10372  N  N    . PRO C 1 19  ? 22.783  56.852 27.961 1.00 14.34  ? 22  PRO C N    1  
ATOM   10373  C  CA   . PRO C 1 19  ? 22.219  56.908 29.336 1.00 13.83  ? 22  PRO C CA   1  
ATOM   10374  C  C    . PRO C 1 19  ? 22.588  58.222 30.039 1.00 13.47  ? 22  PRO C C    1  
ATOM   10375  O  O    . PRO C 1 19  ? 23.548  58.875 29.682 1.00 13.68  ? 22  PRO C O    1  
ATOM   10376  C  CB   . PRO C 1 19  ? 22.869  55.716 30.039 1.00 13.57  ? 22  PRO C CB   1  
ATOM   10377  C  CG   . PRO C 1 19  ? 23.193  54.741 28.952 1.00 14.90  ? 22  PRO C CG   1  
ATOM   10378  C  CD   . PRO C 1 19  ? 23.401  55.551 27.668 1.00 14.97  ? 22  PRO C CD   1  
ATOM   10379  H  HA   . PRO C 1 19  ? 21.150  56.779 29.312 1.00 0.00   ? 22  PRO C HA   1  
ATOM   10380  H  HB2  . PRO C 1 19  ? 23.771  56.030 30.546 1.00 0.00   ? 22  PRO C HB2  1  
ATOM   10381  H  HB3  . PRO C 1 19  ? 22.179  55.272 30.739 1.00 0.00   ? 22  PRO C HB3  1  
ATOM   10382  H  HG2  . PRO C 1 19  ? 24.096  54.200 29.202 1.00 0.00   ? 22  PRO C HG2  1  
ATOM   10383  H  HG3  . PRO C 1 19  ? 22.374  54.053 28.817 1.00 0.00   ? 22  PRO C HG3  1  
ATOM   10384  H  HD2  . PRO C 1 19  ? 24.457  55.667 27.463 1.00 0.00   ? 22  PRO C HD2  1  
ATOM   10385  H  HD3  . PRO C 1 19  ? 22.901  55.079 26.837 1.00 0.00   ? 22  PRO C HD3  1  
ATOM   10386  N  N    . PRO C 1 20  ? 21.828  58.606 31.029 1.00 13.29  ? 23  PRO C N    1  
ATOM   10387  C  CA   . PRO C 1 20  ? 20.641  57.826 31.493 1.00 13.49  ? 23  PRO C CA   1  
ATOM   10388  C  C    . PRO C 1 20  ? 19.387  58.057 30.630 1.00 13.43  ? 23  PRO C C    1  
ATOM   10389  O  O    . PRO C 1 20  ? 18.348  57.472 30.866 1.00 13.86  ? 23  PRO C O    1  
ATOM   10390  C  CB   . PRO C 1 20  ? 20.413  58.352 32.908 1.00 13.56  ? 23  PRO C CB   1  
ATOM   10391  C  CG   . PRO C 1 20  ? 20.926  59.757 32.896 1.00 14.61  ? 23  PRO C CG   1  
ATOM   10392  C  CD   . PRO C 1 20  ? 22.018  59.830 31.822 1.00 13.44  ? 23  PRO C CD   1  
ATOM   10393  H  HA   . PRO C 1 20  ? 20.877  56.776 31.536 1.00 0.00   ? 23  PRO C HA   1  
ATOM   10394  H  HB2  . PRO C 1 20  ? 19.358  58.337 33.147 1.00 0.00   ? 23  PRO C HB2  1  
ATOM   10395  H  HB3  . PRO C 1 20  ? 20.969  57.763 33.622 1.00 0.00   ? 23  PRO C HB3  1  
ATOM   10396  H  HG2  . PRO C 1 20  ? 20.122  60.439 32.657 1.00 0.00   ? 23  PRO C HG2  1  
ATOM   10397  H  HG3  . PRO C 1 20  ? 21.348  60.004 33.858 1.00 0.00   ? 23  PRO C HG3  1  
ATOM   10398  H  HD2  . PRO C 1 20  ? 21.882  60.708 31.206 1.00 0.00   ? 23  PRO C HD2  1  
ATOM   10399  H  HD3  . PRO C 1 20  ? 22.996  59.831 32.276 1.00 0.00   ? 23  PRO C HD3  1  
ATOM   10400  N  N    . PHE C 1 21  ? 19.473  58.903 29.639 1.00 13.83  ? 24  PHE C N    1  
ATOM   10401  C  CA   . PHE C 1 21  ? 18.296  59.169 28.775 1.00 14.07  ? 24  PHE C CA   1  
ATOM   10402  C  C    . PHE C 1 21  ? 17.969  57.926 27.947 1.00 14.60  ? 24  PHE C C    1  
ATOM   10403  O  O    . PHE C 1 21  ? 18.811  57.089 27.691 1.00 14.98  ? 24  PHE C O    1  
ATOM   10404  C  CB   . PHE C 1 21  ? 18.606  60.338 27.838 1.00 14.57  ? 24  PHE C CB   1  
ATOM   10405  C  CG   . PHE C 1 21  ? 18.889  61.576 28.654 1.00 14.90  ? 24  PHE C CG   1  
ATOM   10406  C  CD1  . PHE C 1 21  ? 17.837  62.264 29.271 1.00 19.66  ? 24  PHE C CD1  1  
ATOM   10407  C  CD2  . PHE C 1 21  ? 20.203  62.038 28.794 1.00 19.14  ? 24  PHE C CD2  1  
ATOM   10408  C  CE1  . PHE C 1 21  ? 18.099  63.412 30.027 1.00 20.24  ? 24  PHE C CE1  1  
ATOM   10409  C  CE2  . PHE C 1 21  ? 20.466  63.186 29.550 1.00 20.27  ? 24  PHE C CE2  1  
ATOM   10410  C  CZ   . PHE C 1 21  ? 19.413  63.873 30.167 1.00 19.81  ? 24  PHE C CZ   1  
ATOM   10411  H  H    . PHE C 1 21  ? 20.319  59.367 29.466 1.00 0.00   ? 24  PHE C H    1  
ATOM   10412  H  HA   . PHE C 1 21  ? 17.447  59.421 29.393 1.00 0.00   ? 24  PHE C HA   1  
ATOM   10413  H  HB2  . PHE C 1 21  ? 19.470  60.097 27.236 1.00 0.00   ? 24  PHE C HB2  1  
ATOM   10414  H  HB3  . PHE C 1 21  ? 17.758  60.518 27.194 1.00 0.00   ? 24  PHE C HB3  1  
ATOM   10415  H  HD1  . PHE C 1 21  ? 16.823  61.908 29.163 1.00 0.00   ? 24  PHE C HD1  1  
ATOM   10416  H  HD2  . PHE C 1 21  ? 21.015  61.507 28.318 1.00 0.00   ? 24  PHE C HD2  1  
ATOM   10417  H  HE1  . PHE C 1 21  ? 17.287  63.942 30.503 1.00 0.00   ? 24  PHE C HE1  1  
ATOM   10418  H  HE2  . PHE C 1 21  ? 21.480  63.542 29.658 1.00 0.00   ? 24  PHE C HE2  1  
ATOM   10419  H  HZ   . PHE C 1 21  ? 19.616  64.759 30.751 1.00 0.00   ? 24  PHE C HZ   1  
ATOM   10420  N  N    . VAL C 1 22  ? 16.745  57.815 27.529 1.00 14.47  ? 25  VAL C N    1  
ATOM   10421  C  CA   . VAL C 1 22  ? 16.321  56.668 26.725 1.00 15.13  ? 25  VAL C CA   1  
ATOM   10422  C  C    . VAL C 1 22  ? 15.845  57.211 25.397 1.00 15.66  ? 25  VAL C C    1  
ATOM   10423  O  O    . VAL C 1 22  ? 15.540  58.378 25.256 1.00 16.51  ? 25  VAL C O    1  
ATOM   10424  C  CB   . VAL C 1 22  ? 15.179  55.931 27.428 1.00 14.94  ? 25  VAL C CB   1  
ATOM   10425  C  CG1  . VAL C 1 22  ? 14.720  54.757 26.562 1.00 15.44  ? 25  VAL C CG1  1  
ATOM   10426  C  CG2  . VAL C 1 22  ? 15.668  55.407 28.779 1.00 15.60  ? 25  VAL C CG2  1  
ATOM   10427  H  H    . VAL C 1 22  ? 16.094  58.512 27.754 1.00 0.00   ? 25  VAL C H    1  
ATOM   10428  H  HA   . VAL C 1 22  ? 17.154  55.998 26.571 1.00 0.00   ? 25  VAL C HA   1  
ATOM   10429  H  HB   . VAL C 1 22  ? 14.353  56.611 27.580 1.00 0.00   ? 25  VAL C HB   1  
ATOM   10430  H  HG11 . VAL C 1 22  ? 15.499  54.500 25.860 1.00 0.00   ? 25  VAL C HG11 1  
ATOM   10431  H  HG12 . VAL C 1 22  ? 13.826  55.035 26.023 1.00 0.00   ? 25  VAL C HG12 1  
ATOM   10432  H  HG13 . VAL C 1 22  ? 14.509  53.906 27.193 1.00 0.00   ? 25  VAL C HG13 1  
ATOM   10433  H  HG21 . VAL C 1 22  ? 15.105  55.876 29.573 1.00 0.00   ? 25  VAL C HG21 1  
ATOM   10434  H  HG22 . VAL C 1 22  ? 16.716  55.637 28.897 1.00 0.00   ? 25  VAL C HG22 1  
ATOM   10435  H  HG23 . VAL C 1 22  ? 15.527  54.337 28.822 1.00 0.00   ? 25  VAL C HG23 1  
ATOM   10436  N  N    . HIS C 1 23  ? 15.797  56.384 24.427 1.00 15.63  ? 26  HIS C N    1  
ATOM   10437  C  CA   . HIS C 1 23  ? 15.362  56.832 23.083 1.00 16.04  ? 26  HIS C CA   1  
ATOM   10438  C  C    . HIS C 1 23  ? 13.851  57.015 23.066 1.00 16.94  ? 26  HIS C C    1  
ATOM   10439  O  O    . HIS C 1 23  ? 13.148  56.625 23.977 1.00 16.89  ? 26  HIS C O    1  
ATOM   10440  C  CB   . HIS C 1 23  ? 15.759  55.782 22.043 1.00 16.48  ? 26  HIS C CB   1  
ATOM   10441  C  CG   . HIS C 1 23  ? 14.958  54.529 22.264 1.00 15.82  ? 26  HIS C CG   1  
ATOM   10442  N  ND1  . HIS C 1 23  ? 15.352  53.547 23.162 1.00 18.85  ? 26  HIS C ND1  1  
ATOM   10443  C  CD2  . HIS C 1 23  ? 13.782  54.083 21.712 1.00 13.10  ? 26  HIS C CD2  1  
ATOM   10444  C  CE1  . HIS C 1 23  ? 14.429  52.568 23.124 1.00 13.62  ? 26  HIS C CE1  1  
ATOM   10445  N  NE2  . HIS C 1 23  ? 13.454  52.847 22.257 1.00 17.90  ? 26  HIS C NE2  1  
ATOM   10446  H  H    . HIS C 1 23  ? 16.063  55.451 24.568 1.00 0.00   ? 26  HIS C H    1  
ATOM   10447  H  HA   . HIS C 1 23  ? 15.841  57.770 22.845 1.00 0.00   ? 26  HIS C HA   1  
ATOM   10448  H  HB2  . HIS C 1 23  ? 15.564  56.165 21.052 1.00 0.00   ? 26  HIS C HB2  1  
ATOM   10449  H  HB3  . HIS C 1 23  ? 16.811  55.558 22.142 1.00 0.00   ? 26  HIS C HB3  1  
ATOM   10450  H  HD1  . HIS C 1 23  ? 16.156  53.563 23.721 1.00 0.00   ? 26  HIS C HD1  1  
ATOM   10451  H  HD2  . HIS C 1 23  ? 13.202  54.611 20.969 1.00 0.00   ? 26  HIS C HD2  1  
ATOM   10452  H  HE1  . HIS C 1 23  ? 14.472  51.668 23.720 1.00 0.00   ? 26  HIS C HE1  1  
ATOM   10453  H  HE2  . HIS C 1 23  ? 12.670  52.296 22.049 1.00 0.00   ? 26  HIS C HE2  1  
ATOM   10454  N  N    . ALA C 1 24  ? 13.353  57.609 22.027 1.00 18.10  ? 27  ALA C N    1  
ATOM   10455  C  CA   . ALA C 1 24  ? 11.893  57.835 21.913 1.00 17.81  ? 27  ALA C CA   1  
ATOM   10456  C  C    . ALA C 1 24  ? 11.180  56.492 21.805 1.00 17.01  ? 27  ALA C C    1  
ATOM   10457  O  O    . ALA C 1 24  ? 11.656  55.562 21.184 1.00 18.02  ? 27  ALA C O    1  
ATOM   10458  C  CB   . ALA C 1 24  ? 11.602  58.670 20.664 1.00 18.61  ? 27  ALA C CB   1  
ATOM   10459  H  H    . ALA C 1 24  ? 13.948  57.911 21.309 1.00 0.00   ? 27  ALA C H    1  
ATOM   10460  H  HA   . ALA C 1 24  ? 11.541  58.361 22.787 1.00 0.00   ? 27  ALA C HA   1  
ATOM   10461  H  HB1  . ALA C 1 24  ? 11.371  58.013 19.838 1.00 0.00   ? 27  ALA C HB1  1  
ATOM   10462  H  HB2  . ALA C 1 24  ? 12.468  59.266 20.419 1.00 0.00   ? 27  ALA C HB2  1  
ATOM   10463  H  HB3  . ALA C 1 24  ? 10.760  59.319 20.854 1.00 0.00   ? 27  ALA C HB3  1  
ATOM   10464  N  N    . HIS C 1 25  ? 10.040  56.394 22.411 1.00 16.77  ? 28  HIS C N    1  
ATOM   10465  C  CA   . HIS C 1 25  ? 9.258   55.128 22.373 1.00 16.44  ? 28  HIS C CA   1  
ATOM   10466  C  C    . HIS C 1 25  ? 7.883   55.375 23.005 1.00 16.95  ? 28  HIS C C    1  
ATOM   10467  O  O    . HIS C 1 25  ? 7.719   56.245 23.837 1.00 17.73  ? 28  HIS C O    1  
ATOM   10468  C  CB   . HIS C 1 25  ? 9.997   54.044 23.161 1.00 16.03  ? 28  HIS C CB   1  
ATOM   10469  C  CG   . HIS C 1 25  ? 9.989   54.393 24.623 1.00 15.62  ? 28  HIS C CG   1  
ATOM   10470  N  ND1  . HIS C 1 25  ? 10.909  55.272 25.180 1.00 16.84  ? 28  HIS C ND1  1  
ATOM   10471  C  CD2  . HIS C 1 25  ? 9.180   53.991 25.658 1.00 15.95  ? 28  HIS C CD2  1  
ATOM   10472  C  CE1  . HIS C 1 25  ? 10.633  55.368 26.494 1.00 17.60  ? 28  HIS C CE1  1  
ATOM   10473  N  NE2  . HIS C 1 25  ? 9.590   54.609 26.834 1.00 15.67  ? 28  HIS C NE2  1  
ATOM   10474  H  H    . HIS C 1 25  ? 9.687   57.165 22.903 1.00 0.00   ? 28  HIS C H    1  
ATOM   10475  H  HA   . HIS C 1 25  ? 9.133   54.811 21.348 1.00 0.00   ? 28  HIS C HA   1  
ATOM   10476  H  HB2  . HIS C 1 25  ? 9.506   53.094 23.014 1.00 0.00   ? 28  HIS C HB2  1  
ATOM   10477  H  HB3  . HIS C 1 25  ? 11.018  53.979 22.813 1.00 0.00   ? 28  HIS C HB3  1  
ATOM   10478  H  HD1  . HIS C 1 25  ? 11.628  55.736 24.703 1.00 0.00   ? 28  HIS C HD1  1  
ATOM   10479  H  HD2  . HIS C 1 25  ? 8.353   53.302 25.571 1.00 0.00   ? 28  HIS C HD2  1  
ATOM   10480  H  HE1  . HIS C 1 25  ? 11.187  55.984 27.187 1.00 0.00   ? 28  HIS C HE1  1  
ATOM   10481  H  HE2  . HIS C 1 25  ? 9.196   54.507 27.725 1.00 0.00   ? 28  HIS C HE2  1  
ATOM   10482  N  N    . SER C 1 26  ? 6.894   54.620 22.614 1.00 17.05  ? 29  SER C N    1  
ATOM   10483  C  CA   . SER C 1 26  ? 5.536   54.809 23.180 1.00 17.38  ? 29  SER C CA   1  
ATOM   10484  C  C    . SER C 1 26  ? 5.285   53.719 24.209 1.00 17.10  ? 29  SER C C    1  
ATOM   10485  O  O    . SER C 1 26  ? 5.675   52.582 24.032 1.00 17.11  ? 29  SER C O    1  
ATOM   10486  C  CB   . SER C 1 26  ? 4.496   54.711 22.064 1.00 17.81  ? 29  SER C CB   1  
ATOM   10487  O  OG   . SER C 1 26  ? 3.196   54.866 22.618 1.00 21.54  ? 29  SER C OG   1  
ATOM   10488  H  H    . SER C 1 26  ? 7.048   53.927 21.939 1.00 0.00   ? 29  SER C H    1  
ATOM   10489  H  HA   . SER C 1 26  ? 5.472   55.778 23.653 1.00 0.00   ? 29  SER C HA   1  
ATOM   10490  H  HB2  . SER C 1 26  ? 4.667   55.490 21.340 1.00 0.00   ? 29  SER C HB2  1  
ATOM   10491  H  HB3  . SER C 1 26  ? 4.579   53.748 21.579 1.00 0.00   ? 29  SER C HB3  1  
ATOM   10492  H  HG   . SER C 1 26  ? 2.584   54.350 22.089 1.00 0.00   ? 29  SER C HG   1  
ATOM   10493  N  N    . GLN C 1 27  ? 4.652   54.053 25.289 1.00 16.39  ? 30  GLN C N    1  
ATOM   10494  C  CA   . GLN C 1 27  ? 4.394   53.025 26.336 1.00 16.79  ? 30  GLN C CA   1  
ATOM   10495  C  C    . GLN C 1 27  ? 3.476   51.992 25.725 1.00 17.12  ? 30  GLN C C    1  
ATOM   10496  O  O    . GLN C 1 27  ? 3.798   50.826 25.611 1.00 16.57  ? 30  GLN C O    1  
ATOM   10497  C  CB   . GLN C 1 27  ? 3.717   53.673 27.546 1.00 16.62  ? 30  GLN C CB   1  
ATOM   10498  C  CG   . GLN C 1 27  ? 4.765   54.407 28.385 1.00 16.50  ? 30  GLN C CG   1  
ATOM   10499  C  CD   . GLN C 1 27  ? 4.065   55.360 29.356 1.00 15.89  ? 30  GLN C CD   1  
ATOM   10500  O  OE1  . GLN C 1 27  ? 3.146   54.972 30.050 1.00 16.71  ? 30  GLN C OE1  1  
ATOM   10501  N  NE2  . GLN C 1 27  ? 4.464   56.600 29.436 1.00 16.09  ? 30  GLN C NE2  1  
ATOM   10502  H  H    . GLN C 1 27  ? 4.353   54.977 25.420 1.00 0.00   ? 30  GLN C H    1  
ATOM   10503  H  HA   . GLN C 1 27  ? 5.323   52.562 26.634 1.00 0.00   ? 30  GLN C HA   1  
ATOM   10504  H  HB2  . GLN C 1 27  ? 2.969   54.375 27.207 1.00 0.00   ? 30  GLN C HB2  1  
ATOM   10505  H  HB3  . GLN C 1 27  ? 3.248   52.909 28.148 1.00 0.00   ? 30  GLN C HB3  1  
ATOM   10506  H  HG2  . GLN C 1 27  ? 5.348   53.688 28.942 1.00 0.00   ? 30  GLN C HG2  1  
ATOM   10507  H  HG3  . GLN C 1 27  ? 5.415   54.973 27.735 1.00 0.00   ? 30  GLN C HG3  1  
ATOM   10508  H  HE21 . GLN C 1 27  ? 5.206   56.913 28.876 1.00 0.00   ? 30  GLN C HE21 1  
ATOM   10509  H  HE22 . GLN C 1 27  ? 4.023   57.218 30.055 1.00 0.00   ? 30  GLN C HE22 1  
ATOM   10510  N  N    . VAL C 1 28  ? 2.349   52.440 25.286 1.00 17.16  ? 31  VAL C N    1  
ATOM   10511  C  CA   . VAL C 1 28  ? 1.388   51.534 24.615 1.00 17.79  ? 31  VAL C CA   1  
ATOM   10512  C  C    . VAL C 1 28  ? 1.912   51.276 23.203 1.00 17.77  ? 31  VAL C C    1  
ATOM   10513  O  O    . VAL C 1 28  ? 2.332   52.180 22.509 1.00 18.58  ? 31  VAL C O    1  
ATOM   10514  C  CB   . VAL C 1 28  ? 0.011   52.198 24.545 1.00 17.69  ? 31  VAL C CB   1  
ATOM   10515  C  CG1  . VAL C 1 28  ? -0.932  51.331 23.708 1.00 18.13  ? 31  VAL C CG1  1  
ATOM   10516  C  CG2  . VAL C 1 28  ? -0.555  52.346 25.959 1.00 18.13  ? 31  VAL C CG2  1  
ATOM   10517  H  H    . VAL C 1 28  ? 2.143   53.395 25.364 1.00 0.00   ? 31  VAL C H    1  
ATOM   10518  H  HA   . VAL C 1 28  ? 1.322   50.602 25.158 1.00 0.00   ? 31  VAL C HA   1  
ATOM   10519  H  HB   . VAL C 1 28  ? 0.105   53.172 24.088 1.00 0.00   ? 31  VAL C HB   1  
ATOM   10520  H  HG11 . VAL C 1 28  ? -1.088  51.796 22.745 1.00 0.00   ? 31  VAL C HG11 1  
ATOM   10521  H  HG12 . VAL C 1 28  ? -1.878  51.232 24.218 1.00 0.00   ? 31  VAL C HG12 1  
ATOM   10522  H  HG13 . VAL C 1 28  ? -0.494  50.354 23.568 1.00 0.00   ? 31  VAL C HG13 1  
ATOM   10523  H  HG21 . VAL C 1 28  ? -0.014  53.119 26.484 1.00 0.00   ? 31  VAL C HG21 1  
ATOM   10524  H  HG22 . VAL C 1 28  ? -0.450  51.410 26.488 1.00 0.00   ? 31  VAL C HG22 1  
ATOM   10525  H  HG23 . VAL C 1 28  ? -1.600  52.612 25.902 1.00 0.00   ? 31  VAL C HG23 1  
ATOM   10526  N  N    . ALA C 1 29  ? 1.921   50.050 22.789 1.00 19.11  ? 32  ALA C N    1  
ATOM   10527  C  CA   . ALA C 1 29  ? 2.451   49.709 21.441 1.00 20.46  ? 32  ALA C CA   1  
ATOM   10528  C  C    . ALA C 1 29  ? 1.608   50.362 20.350 1.00 21.60  ? 32  ALA C C    1  
ATOM   10529  O  O    . ALA C 1 29  ? 0.393   50.328 20.378 1.00 22.04  ? 32  ALA C O    1  
ATOM   10530  C  CB   . ALA C 1 29  ? 2.426   48.191 21.258 1.00 20.53  ? 32  ALA C CB   1  
ATOM   10531  H  H    . ALA C 1 29  ? 1.599   49.336 23.379 1.00 0.00   ? 32  ALA C H    1  
ATOM   10532  H  HA   . ALA C 1 29  ? 3.469   50.058 21.360 1.00 0.00   ? 32  ALA C HA   1  
ATOM   10533  H  HB1  . ALA C 1 29  ? 1.644   47.767 21.870 1.00 0.00   ? 32  ALA C HB1  1  
ATOM   10534  H  HB2  . ALA C 1 29  ? 3.378   47.776 21.553 1.00 0.00   ? 32  ALA C HB2  1  
ATOM   10535  H  HB3  . ALA C 1 29  ? 2.238   47.956 20.220 1.00 0.00   ? 32  ALA C HB3  1  
ATOM   10536  N  N    . GLU C 1 30  ? 2.252   50.941 19.377 1.00 23.22  ? 33  GLU C N    1  
ATOM   10537  C  CA   . GLU C 1 30  ? 1.505   51.584 18.259 1.00 24.68  ? 33  GLU C CA   1  
ATOM   10538  C  C    . GLU C 1 30  ? 1.473   50.618 17.072 1.00 25.24  ? 33  GLU C C    1  
ATOM   10539  O  O    . GLU C 1 30  ? 2.399   50.549 16.289 1.00 26.81  ? 33  GLU C O    1  
ATOM   10540  C  CB   . GLU C 1 30  ? 2.209   52.879 17.848 1.00 25.32  ? 33  GLU C CB   1  
ATOM   10541  C  CG   . GLU C 1 30  ? 2.299   53.817 19.054 1.00 27.53  ? 33  GLU C CG   1  
ATOM   10542  C  CD   . GLU C 1 30  ? 2.977   55.122 18.637 1.00 31.51  ? 33  GLU C CD   1  
ATOM   10543  O  OE1  . GLU C 1 30  ? 3.728   55.096 17.676 1.00 36.04  ? 33  GLU C OE1  1  
ATOM   10544  O  OE2  . GLU C 1 30  ? 2.735   56.127 19.286 1.00 34.26  ? 33  GLU C OE2  1  
ATOM   10545  H  H    . GLU C 1 30  ? 3.232   50.941 19.372 1.00 0.00   ? 33  GLU C H    1  
ATOM   10546  H  HA   . GLU C 1 30  ? 0.495   51.803 18.576 1.00 0.00   ? 33  GLU C HA   1  
ATOM   10547  H  HB2  . GLU C 1 30  ? 3.204   52.651 17.494 1.00 0.00   ? 33  GLU C HB2  1  
ATOM   10548  H  HB3  . GLU C 1 30  ? 1.648   53.361 17.062 1.00 0.00   ? 33  GLU C HB3  1  
ATOM   10549  H  HG2  . GLU C 1 30  ? 1.304   54.027 19.420 1.00 0.00   ? 33  GLU C HG2  1  
ATOM   10550  H  HG3  . GLU C 1 30  ? 2.878   53.346 19.834 1.00 0.00   ? 33  GLU C HG3  1  
ATOM   10551  N  N    . GLY C 1 31  ? 0.420   49.858 16.944 1.00 25.70  ? 34  GLY C N    1  
ATOM   10552  C  CA   . GLY C 1 31  ? 0.332   48.883 15.827 1.00 25.34  ? 34  GLY C CA   1  
ATOM   10553  C  C    . GLY C 1 31  ? 0.624   47.484 16.370 1.00 24.92  ? 34  GLY C C    1  
ATOM   10554  O  O    . GLY C 1 31  ? 0.755   47.286 17.562 1.00 25.00  ? 34  GLY C O    1  
ATOM   10555  H  H    . GLY C 1 31  ? -0.309  49.921 17.595 1.00 0.00   ? 34  GLY C H    1  
ATOM   10556  H  HA2  . GLY C 1 31  ? -0.661  48.910 15.401 1.00 0.00   ? 34  GLY C HA2  1  
ATOM   10557  H  HA3  . GLY C 1 31  ? 1.059   49.132 15.070 1.00 0.00   ? 34  GLY C HA3  1  
ATOM   10558  N  N    . GLY C 1 32  ? 0.728   46.515 15.510 1.00 23.86  ? 35  GLY C N    1  
ATOM   10559  C  CA   . GLY C 1 32  ? 1.014   45.126 15.975 1.00 22.97  ? 35  GLY C CA   1  
ATOM   10560  C  C    . GLY C 1 32  ? 2.529   44.914 16.113 1.00 21.79  ? 35  GLY C C    1  
ATOM   10561  O  O    . GLY C 1 32  ? 3.290   45.853 16.236 1.00 21.55  ? 35  GLY C O    1  
ATOM   10562  H  H    . GLY C 1 32  ? 0.620   46.697 14.553 1.00 0.00   ? 35  GLY C H    1  
ATOM   10563  H  HA2  . GLY C 1 32  ? 0.540   44.966 16.933 1.00 0.00   ? 35  GLY C HA2  1  
ATOM   10564  H  HA3  . GLY C 1 32  ? 0.621   44.421 15.259 1.00 0.00   ? 35  GLY C HA3  1  
ATOM   10565  N  N    . PRO C 1 33  ? 2.949   43.675 16.101 1.00 21.13  ? 36  PRO C N    1  
ATOM   10566  C  CA   . PRO C 1 33  ? 4.379   43.292 16.233 1.00 20.46  ? 36  PRO C CA   1  
ATOM   10567  C  C    . PRO C 1 33  ? 5.236   43.883 15.122 1.00 19.67  ? 36  PRO C C    1  
ATOM   10568  O  O    . PRO C 1 33  ? 4.833   43.957 13.978 1.00 18.52  ? 36  PRO C O    1  
ATOM   10569  C  CB   . PRO C 1 33  ? 4.377   41.761 16.142 1.00 20.62  ? 36  PRO C CB   1  
ATOM   10570  C  CG   . PRO C 1 33  ? 2.969   41.339 16.400 1.00 21.77  ? 36  PRO C CG   1  
ATOM   10571  C  CD   . PRO C 1 33  ? 2.081   42.499 15.959 1.00 21.70  ? 36  PRO C CD   1  
ATOM   10572  H  HA   . PRO C 1 33  ? 4.758   43.593 17.196 1.00 0.00   ? 36  PRO C HA   1  
ATOM   10573  H  HB2  . PRO C 1 33  ? 4.689   41.447 15.156 1.00 0.00   ? 36  PRO C HB2  1  
ATOM   10574  H  HB3  . PRO C 1 33  ? 5.029   41.342 16.893 1.00 0.00   ? 36  PRO C HB3  1  
ATOM   10575  H  HG2  . PRO C 1 33  ? 2.738   40.452 15.825 1.00 0.00   ? 36  PRO C HG2  1  
ATOM   10576  H  HG3  . PRO C 1 33  ? 2.824   41.150 17.452 1.00 0.00   ? 36  PRO C HG3  1  
ATOM   10577  H  HD2  . PRO C 1 33  ? 1.774   42.370 14.930 1.00 0.00   ? 36  PRO C HD2  1  
ATOM   10578  H  HD3  . PRO C 1 33  ? 1.223   42.588 16.606 1.00 0.00   ? 36  PRO C HD3  1  
ATOM   10579  N  N    . LYS C 1 34  ? 6.416   44.299 15.455 1.00 19.16  ? 37  LYS C N    1  
ATOM   10580  C  CA   . LYS C 1 34  ? 7.324   44.890 14.428 1.00 19.45  ? 37  LYS C CA   1  
ATOM   10581  C  C    . LYS C 1 34  ? 8.798   44.585 14.762 1.00 18.36  ? 37  LYS C C    1  
ATOM   10582  O  O    . LYS C 1 34  ? 9.212   44.604 15.904 1.00 17.05  ? 37  LYS C O    1  
ATOM   10583  C  CB   . LYS C 1 34  ? 7.119   46.406 14.386 1.00 20.66  ? 37  LYS C CB   1  
ATOM   10584  C  CG   . LYS C 1 34  ? 5.623   46.721 14.432 1.00 24.67  ? 37  LYS C CG   1  
ATOM   10585  C  CD   . LYS C 1 34  ? 5.383   48.139 13.910 1.00 29.19  ? 37  LYS C CD   1  
ATOM   10586  C  CE   . LYS C 1 34  ? 4.140   48.726 14.580 1.00 30.71  ? 37  LYS C CE   1  
ATOM   10587  N  NZ   . LYS C 1 34  ? 2.937   47.953 14.160 1.00 31.65  ? 37  LYS C NZ   1  
ATOM   10588  H  H    . LYS C 1 34  ? 6.715   44.224 16.385 1.00 0.00   ? 37  LYS C H    1  
ATOM   10589  H  HA   . LYS C 1 34  ? 7.086   44.473 13.460 1.00 0.00   ? 37  LYS C HA   1  
ATOM   10590  H  HB2  . LYS C 1 34  ? 7.610   46.858 15.236 1.00 0.00   ? 37  LYS C HB2  1  
ATOM   10591  H  HB3  . LYS C 1 34  ? 7.541   46.801 13.474 1.00 0.00   ? 37  LYS C HB3  1  
ATOM   10592  H  HG2  . LYS C 1 34  ? 5.088   46.013 13.815 1.00 0.00   ? 37  LYS C HG2  1  
ATOM   10593  H  HG3  . LYS C 1 34  ? 5.271   46.650 15.450 1.00 0.00   ? 37  LYS C HG3  1  
ATOM   10594  H  HD2  . LYS C 1 34  ? 6.241   48.755 14.137 1.00 0.00   ? 37  LYS C HD2  1  
ATOM   10595  H  HD3  . LYS C 1 34  ? 5.234   48.109 12.841 1.00 0.00   ? 37  LYS C HD3  1  
ATOM   10596  H  HE2  . LYS C 1 34  ? 4.248   48.669 15.653 1.00 0.00   ? 37  LYS C HE2  1  
ATOM   10597  H  HE3  . LYS C 1 34  ? 4.026   49.759 14.284 1.00 0.00   ? 37  LYS C HE3  1  
ATOM   10598  H  HZ1  . LYS C 1 34  ? 2.679   47.279 14.908 1.00 0.00   ? 37  LYS C HZ1  1  
ATOM   10599  H  HZ2  . LYS C 1 34  ? 3.147   47.433 13.285 1.00 0.00   ? 37  LYS C HZ2  1  
ATOM   10600  H  HZ3  . LYS C 1 34  ? 2.145   48.608 13.994 1.00 0.00   ? 37  LYS C HZ3  1  
ATOM   10601  N  N    . VAL C 1 35  ? 9.585   44.323 13.749 1.00 16.96  ? 38  VAL C N    1  
ATOM   10602  C  CA   . VAL C 1 35  ? 11.030  44.033 13.926 1.00 16.81  ? 38  VAL C CA   1  
ATOM   10603  C  C    . VAL C 1 35  ? 11.765  45.350 14.140 1.00 16.99  ? 38  VAL C C    1  
ATOM   10604  O  O    . VAL C 1 35  ? 11.985  46.126 13.232 1.00 17.22  ? 38  VAL C O    1  
ATOM   10605  C  CB   . VAL C 1 35  ? 11.572  43.339 12.675 1.00 16.53  ? 38  VAL C CB   1  
ATOM   10606  C  CG1  . VAL C 1 35  ? 13.100  43.407 12.675 1.00 17.24  ? 38  VAL C CG1  1  
ATOM   10607  C  CG2  . VAL C 1 35  ? 11.128  41.875 12.673 1.00 16.59  ? 38  VAL C CG2  1  
ATOM   10608  H  H    . VAL C 1 35  ? 9.211   44.332 12.843 1.00 0.00   ? 38  VAL C H    1  
ATOM   10609  H  HA   . VAL C 1 35  ? 11.169  43.394 14.786 1.00 0.00   ? 38  VAL C HA   1  
ATOM   10610  H  HB   . VAL C 1 35  ? 11.190  43.835 11.795 1.00 0.00   ? 38  VAL C HB   1  
ATOM   10611  H  HG11 . VAL C 1 35  ? 13.423  44.245 12.076 1.00 0.00   ? 38  VAL C HG11 1  
ATOM   10612  H  HG12 . VAL C 1 35  ? 13.501  42.493 12.261 1.00 0.00   ? 38  VAL C HG12 1  
ATOM   10613  H  HG13 . VAL C 1 35  ? 13.455  43.529 13.687 1.00 0.00   ? 38  VAL C HG13 1  
ATOM   10614  H  HG21 . VAL C 1 35  ? 11.763  41.305 13.335 1.00 0.00   ? 38  VAL C HG21 1  
ATOM   10615  H  HG22 . VAL C 1 35  ? 11.203  41.477 11.672 1.00 0.00   ? 38  VAL C HG22 1  
ATOM   10616  H  HG23 . VAL C 1 35  ? 10.104  41.808 13.011 1.00 0.00   ? 38  VAL C HG23 1  
ATOM   10617  N  N    . VAL C 1 36  ? 12.114  45.594 15.352 1.00 16.77  ? 39  VAL C N    1  
ATOM   10618  C  CA   . VAL C 1 36  ? 12.804  46.821 15.736 1.00 16.81  ? 39  VAL C CA   1  
ATOM   10619  C  C    . VAL C 1 36  ? 14.241  46.628 15.391 1.00 16.57  ? 39  VAL C C    1  
ATOM   10620  O  O    . VAL C 1 36  ? 14.808  45.568 15.564 1.00 17.30  ? 39  VAL C O    1  
ATOM   10621  C  CB   . VAL C 1 36  ? 12.653  47.058 17.240 1.00 16.94  ? 39  VAL C CB   1  
ATOM   10622  C  CG1  . VAL C 1 36  ? 11.955  48.398 17.478 1.00 17.24  ? 39  VAL C CG1  1  
ATOM   10623  C  CG2  . VAL C 1 36  ? 11.816  45.933 17.851 1.00 16.79  ? 39  VAL C CG2  1  
ATOM   10624  H  H    . VAL C 1 36  ? 11.895  44.939 16.047 1.00 0.00   ? 39  VAL C H    1  
ATOM   10625  H  HA   . VAL C 1 36  ? 12.401  47.659 15.187 1.00 0.00   ? 39  VAL C HA   1  
ATOM   10626  H  HB   . VAL C 1 36  ? 13.630  47.075 17.701 1.00 0.00   ? 39  VAL C HB   1  
ATOM   10627  H  HG11 . VAL C 1 36  ? 12.396  49.152 16.842 1.00 0.00   ? 39  VAL C HG11 1  
ATOM   10628  H  HG12 . VAL C 1 36  ? 12.073  48.687 18.512 1.00 0.00   ? 39  VAL C HG12 1  
ATOM   10629  H  HG13 . VAL C 1 36  ? 10.904  48.303 17.248 1.00 0.00   ? 39  VAL C HG13 1  
ATOM   10630  H  HG21 . VAL C 1 36  ? 11.501  46.217 18.844 1.00 0.00   ? 39  VAL C HG21 1  
ATOM   10631  H  HG22 . VAL C 1 36  ? 12.409  45.032 17.905 1.00 0.00   ? 39  VAL C HG22 1  
ATOM   10632  H  HG23 . VAL C 1 36  ? 10.947  45.755 17.235 1.00 0.00   ? 39  VAL C HG23 1  
ATOM   10633  N  N    . GLU C 1 37  ? 14.819  47.619 14.865 1.00 17.09  ? 40  GLU C N    1  
ATOM   10634  C  CA   . GLU C 1 37  ? 16.238  47.493 14.443 1.00 17.05  ? 40  GLU C CA   1  
ATOM   10635  C  C    . GLU C 1 37  ? 17.114  48.494 15.185 1.00 17.07  ? 40  GLU C C    1  
ATOM   10636  O  O    . GLU C 1 37  ? 16.867  49.684 15.186 1.00 17.68  ? 40  GLU C O    1  
ATOM   10637  C  CB   . GLU C 1 37  ? 16.342  47.749 12.938 1.00 17.71  ? 40  GLU C CB   1  
ATOM   10638  C  CG   . GLU C 1 37  ? 15.512  46.709 12.184 1.00 19.31  ? 40  GLU C CG   1  
ATOM   10639  C  CD   . GLU C 1 37  ? 15.321  47.160 10.735 1.00 23.69  ? 40  GLU C CD   1  
ATOM   10640  O  OE1  . GLU C 1 37  ? 14.750  48.220 10.536 1.00 28.60  ? 40  GLU C OE1  1  
ATOM   10641  O  OE2  . GLU C 1 37  ? 15.749  46.439 9.849  1.00 28.45  ? 40  GLU C OE2  1  
ATOM   10642  H  H    . GLU C 1 37  ? 14.327  48.452 14.706 1.00 0.00   ? 40  GLU C H    1  
ATOM   10643  H  HA   . GLU C 1 37  ? 16.584  46.493 14.655 1.00 0.00   ? 40  GLU C HA   1  
ATOM   10644  H  HB2  . GLU C 1 37  ? 15.969  48.739 12.716 1.00 0.00   ? 40  GLU C HB2  1  
ATOM   10645  H  HB3  . GLU C 1 37  ? 17.374  47.675 12.631 1.00 0.00   ? 40  GLU C HB3  1  
ATOM   10646  H  HG2  . GLU C 1 37  ? 16.025  45.758 12.202 1.00 0.00   ? 40  GLU C HG2  1  
ATOM   10647  H  HG3  . GLU C 1 37  ? 14.547  46.606 12.657 1.00 0.00   ? 40  GLU C HG3  1  
ATOM   10648  N  N    . PHE C 1 38  ? 18.155  48.011 15.792 1.00 16.62  ? 41  PHE C N    1  
ATOM   10649  C  CA   . PHE C 1 38  ? 19.097  48.915 16.524 1.00 16.10  ? 41  PHE C CA   1  
ATOM   10650  C  C    . PHE C 1 38  ? 20.546  48.492 16.218 1.00 15.73  ? 41  PHE C C    1  
ATOM   10651  O  O    . PHE C 1 38  ? 20.848  47.318 16.130 1.00 16.01  ? 41  PHE C O    1  
ATOM   10652  C  CB   . PHE C 1 38  ? 18.841  48.808 18.029 1.00 15.69  ? 41  PHE C CB   1  
ATOM   10653  C  CG   . PHE C 1 38  ? 17.467  49.347 18.346 1.00 15.99  ? 41  PHE C CG   1  
ATOM   10654  C  CD1  . PHE C 1 38  ? 16.332  48.733 17.802 1.00 16.58  ? 41  PHE C CD1  1  
ATOM   10655  C  CD2  . PHE C 1 38  ? 17.327  50.460 19.183 1.00 16.84  ? 41  PHE C CD2  1  
ATOM   10656  C  CE1  . PHE C 1 38  ? 15.057  49.232 18.096 1.00 16.91  ? 41  PHE C CE1  1  
ATOM   10657  C  CE2  . PHE C 1 38  ? 16.052  50.960 19.477 1.00 17.70  ? 41  PHE C CE2  1  
ATOM   10658  C  CZ   . PHE C 1 38  ? 14.918  50.346 18.933 1.00 15.91  ? 41  PHE C CZ   1  
ATOM   10659  H  H    . PHE C 1 38  ? 18.336  47.049 15.754 1.00 0.00   ? 41  PHE C H    1  
ATOM   10660  H  HA   . PHE C 1 38  ? 18.943  49.934 16.202 1.00 0.00   ? 41  PHE C HA   1  
ATOM   10661  H  HB2  . PHE C 1 38  ? 18.901  47.773 18.332 1.00 0.00   ? 41  PHE C HB2  1  
ATOM   10662  H  HB3  . PHE C 1 38  ? 19.584  49.383 18.562 1.00 0.00   ? 41  PHE C HB3  1  
ATOM   10663  H  HD1  . PHE C 1 38  ? 16.440  47.874 17.157 1.00 0.00   ? 41  PHE C HD1  1  
ATOM   10664  H  HD2  . PHE C 1 38  ? 18.202  50.934 19.602 1.00 0.00   ? 41  PHE C HD2  1  
ATOM   10665  H  HE1  . PHE C 1 38  ? 14.182  48.759 17.677 1.00 0.00   ? 41  PHE C HE1  1  
ATOM   10666  H  HE2  . PHE C 1 38  ? 15.945  51.819 20.122 1.00 0.00   ? 41  PHE C HE2  1  
ATOM   10667  H  HZ   . PHE C 1 38  ? 13.934  50.731 19.160 1.00 0.00   ? 41  PHE C HZ   1  
ATOM   10668  N  N    . THR C 1 39  ? 21.447  49.434 16.050 1.00 16.41  ? 42  THR C N    1  
ATOM   10669  C  CA   . THR C 1 39  ? 22.859  49.065 15.748 1.00 17.02  ? 42  THR C CA   1  
ATOM   10670  C  C    . THR C 1 39  ? 23.787  49.717 16.773 1.00 16.84  ? 42  THR C C    1  
ATOM   10671  O  O    . THR C 1 39  ? 23.653  50.882 17.094 1.00 18.08  ? 42  THR C O    1  
ATOM   10672  C  CB   . THR C 1 39  ? 23.225  49.554 14.345 1.00 17.56  ? 42  THR C CB   1  
ATOM   10673  O  OG1  . THR C 1 39  ? 22.552  48.759 13.378 1.00 21.18  ? 42  THR C OG1  1  
ATOM   10674  C  CG2  . THR C 1 39  ? 24.736  49.439 14.140 1.00 18.80  ? 42  THR C CG2  1  
ATOM   10675  H  H    . THR C 1 39  ? 21.190  50.377 16.121 1.00 0.00   ? 42  THR C H    1  
ATOM   10676  H  HA   . THR C 1 39  ? 22.968  47.992 15.795 1.00 0.00   ? 42  THR C HA   1  
ATOM   10677  H  HB   . THR C 1 39  ? 22.929  50.585 14.233 1.00 0.00   ? 42  THR C HB   1  
ATOM   10678  H  HG1  . THR C 1 39  ? 21.622  48.998 13.393 1.00 0.00   ? 42  THR C HG1  1  
ATOM   10679  H  HG21 . THR C 1 39  ? 25.152  48.778 14.887 1.00 0.00   ? 42  THR C HG21 1  
ATOM   10680  H  HG22 . THR C 1 39  ? 25.188  50.416 14.233 1.00 0.00   ? 42  THR C HG22 1  
ATOM   10681  H  HG23 . THR C 1 39  ? 24.937  49.042 13.156 1.00 0.00   ? 42  THR C HG23 1  
ATOM   10682  N  N    . MET C 1 40  ? 24.729  48.977 17.289 1.00 16.43  ? 43  MET C N    1  
ATOM   10683  C  CA   . MET C 1 40  ? 25.667  49.561 18.295 1.00 16.15  ? 43  MET C CA   1  
ATOM   10684  C  C    . MET C 1 40  ? 27.115  49.116 18.016 1.00 16.17  ? 43  MET C C    1  
ATOM   10685  O  O    . MET C 1 40  ? 27.416  47.941 17.947 1.00 16.48  ? 43  MET C O    1  
ATOM   10686  C  CB   . MET C 1 40  ? 25.258  49.097 19.694 1.00 16.21  ? 43  MET C CB   1  
ATOM   10687  C  CG   . MET C 1 40  ? 23.867  49.639 20.026 1.00 15.85  ? 43  MET C CG   1  
ATOM   10688  S  SD   . MET C 1 40  ? 23.444  49.210 21.733 1.00 16.16  ? 43  MET C SD   1  
ATOM   10689  C  CE   . MET C 1 40  ? 24.113  47.529 21.717 1.00 16.64  ? 43  MET C CE   1  
ATOM   10690  H  H    . MET C 1 40  ? 24.822  48.040 17.017 1.00 0.00   ? 43  MET C H    1  
ATOM   10691  H  HA   . MET C 1 40  ? 25.611  50.638 18.249 1.00 0.00   ? 43  MET C HA   1  
ATOM   10692  H  HB2  . MET C 1 40  ? 25.241  48.017 19.724 1.00 0.00   ? 43  MET C HB2  1  
ATOM   10693  H  HB3  . MET C 1 40  ? 25.969  49.466 20.418 1.00 0.00   ? 43  MET C HB3  1  
ATOM   10694  H  HG2  . MET C 1 40  ? 23.863  50.713 19.914 1.00 0.00   ? 43  MET C HG2  1  
ATOM   10695  H  HG3  . MET C 1 40  ? 23.141  49.204 19.355 1.00 0.00   ? 43  MET C HG3  1  
ATOM   10696  H  HE1  . MET C 1 40  ? 23.532  46.905 22.383 1.00 0.00   ? 43  MET C HE1  1  
ATOM   10697  H  HE2  . MET C 1 40  ? 25.144  47.550 22.041 1.00 0.00   ? 43  MET C HE2  1  
ATOM   10698  H  HE3  . MET C 1 40  ? 24.060  47.129 20.717 1.00 0.00   ? 43  MET C HE3  1  
ATOM   10699  N  N    . VAL C 1 41  ? 28.011  50.062 17.883 1.00 16.34  ? 44  VAL C N    1  
ATOM   10700  C  CA   . VAL C 1 41  ? 29.431  49.746 17.643 1.00 15.92  ? 44  VAL C CA   1  
ATOM   10701  C  C    . VAL C 1 41  ? 30.111  49.682 18.999 1.00 15.94  ? 44  VAL C C    1  
ATOM   10702  O  O    . VAL C 1 41  ? 29.828  50.459 19.889 1.00 16.79  ? 44  VAL C O    1  
ATOM   10703  C  CB   . VAL C 1 41  ? 30.072  50.843 16.790 1.00 16.20  ? 44  VAL C CB   1  
ATOM   10704  C  CG1  . VAL C 1 41  ? 31.560  50.541 16.603 1.00 16.46  ? 44  VAL C CG1  1  
ATOM   10705  C  CG2  . VAL C 1 41  ? 29.386  50.890 15.423 1.00 17.20  ? 44  VAL C CG2  1  
ATOM   10706  H  H    . VAL C 1 41  ? 27.735  50.999 17.963 1.00 0.00   ? 44  VAL C H    1  
ATOM   10707  H  HA   . VAL C 1 41  ? 29.516  48.791 17.143 1.00 0.00   ? 44  VAL C HA   1  
ATOM   10708  H  HB   . VAL C 1 41  ? 29.957  51.796 17.286 1.00 0.00   ? 44  VAL C HB   1  
ATOM   10709  H  HG11 . VAL C 1 41  ? 32.144  51.243 17.179 1.00 0.00   ? 44  VAL C HG11 1  
ATOM   10710  H  HG12 . VAL C 1 41  ? 31.816  50.630 15.558 1.00 0.00   ? 44  VAL C HG12 1  
ATOM   10711  H  HG13 . VAL C 1 41  ? 31.769  49.537 16.941 1.00 0.00   ? 44  VAL C HG13 1  
ATOM   10712  H  HG21 . VAL C 1 41  ? 30.026  50.430 14.684 1.00 0.00   ? 44  VAL C HG21 1  
ATOM   10713  H  HG22 . VAL C 1 41  ? 29.199  51.917 15.149 1.00 0.00   ? 44  VAL C HG22 1  
ATOM   10714  H  HG23 . VAL C 1 41  ? 28.450  50.354 15.471 1.00 0.00   ? 44  VAL C HG23 1  
ATOM   10715  N  N    . ILE C 1 42  ? 30.974  48.746 19.173 1.00 15.74  ? 45  ILE C N    1  
ATOM   10716  C  CA   . ILE C 1 42  ? 31.654  48.590 20.479 1.00 16.09  ? 45  ILE C CA   1  
ATOM   10717  C  C    . ILE C 1 42  ? 32.946  49.373 20.448 1.00 16.49  ? 45  ILE C C    1  
ATOM   10718  O  O    . ILE C 1 42  ? 33.702  49.305 19.500 1.00 17.12  ? 45  ILE C O    1  
ATOM   10719  C  CB   . ILE C 1 42  ? 31.955  47.111 20.728 1.00 15.91  ? 45  ILE C CB   1  
ATOM   10720  C  CG1  . ILE C 1 42  ? 30.652  46.310 20.674 1.00 15.66  ? 45  ILE C CG1  1  
ATOM   10721  C  CG2  . ILE C 1 42  ? 32.598  46.946 22.106 1.00 16.25  ? 45  ILE C CG2  1  
ATOM   10722  C  CD1  . ILE C 1 42  ? 30.919  44.941 20.047 1.00 15.10  ? 45  ILE C CD1  1  
ATOM   10723  H  H    . ILE C 1 42  ? 31.164  48.117 18.446 1.00 0.00   ? 45  ILE C H    1  
ATOM   10724  H  HA   . ILE C 1 42  ? 31.019  48.968 21.267 1.00 0.00   ? 45  ILE C HA   1  
ATOM   10725  H  HB   . ILE C 1 42  ? 32.634  46.750 19.969 1.00 0.00   ? 45  ILE C HB   1  
ATOM   10726  H  HG12 . ILE C 1 42  ? 30.269  46.180 21.676 1.00 0.00   ? 45  ILE C HG12 1  
ATOM   10727  H  HG13 . ILE C 1 42  ? 29.927  46.842 20.077 1.00 0.00   ? 45  ILE C HG13 1  
ATOM   10728  H  HG21 . ILE C 1 42  ? 33.022  45.956 22.189 1.00 0.00   ? 45  ILE C HG21 1  
ATOM   10729  H  HG22 . ILE C 1 42  ? 31.848  47.081 22.872 1.00 0.00   ? 45  ILE C HG22 1  
ATOM   10730  H  HG23 . ILE C 1 42  ? 33.377  47.683 22.231 1.00 0.00   ? 45  ILE C HG23 1  
ATOM   10731  H  HD11 . ILE C 1 42  ? 30.741  44.168 20.780 1.00 0.00   ? 45  ILE C HD11 1  
ATOM   10732  H  HD12 . ILE C 1 42  ? 31.945  44.892 19.714 1.00 0.00   ? 45  ILE C HD12 1  
ATOM   10733  H  HD13 . ILE C 1 42  ? 30.260  44.797 19.204 1.00 0.00   ? 45  ILE C HD13 1  
ATOM   10734  N  N    . GLU C 1 43  ? 33.209  50.127 21.464 1.00 16.61  ? 46  GLU C N    1  
ATOM   10735  C  CA   . GLU C 1 43  ? 34.471  50.923 21.454 1.00 17.18  ? 46  GLU C CA   1  
ATOM   10736  C  C    . GLU C 1 43  ? 35.276  50.678 22.730 1.00 16.76  ? 46  GLU C C    1  
ATOM   10737  O  O    . GLU C 1 43  ? 34.893  51.103 23.802 1.00 17.00  ? 46  GLU C O    1  
ATOM   10738  C  CB   . GLU C 1 43  ? 34.128  52.410 21.352 1.00 18.35  ? 46  GLU C CB   1  
ATOM   10739  C  CG   . GLU C 1 43  ? 33.203  52.641 20.156 1.00 22.32  ? 46  GLU C CG   1  
ATOM   10740  C  CD   . GLU C 1 43  ? 34.040  52.982 18.921 1.00 26.56  ? 46  GLU C CD   1  
ATOM   10741  O  OE1  . GLU C 1 43  ? 35.229  52.709 18.942 1.00 30.01  ? 46  GLU C OE1  1  
ATOM   10742  O  OE2  . GLU C 1 43  ? 33.478  53.510 17.976 1.00 29.27  ? 46  GLU C OE2  1  
ATOM   10743  H  H