data_2PC0
# 
_entry.id   2PC0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2PC0         
RCSB  RCSB042210   
WWPDB D_1000042210 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2HB4 'Apo Wild-type HIV Protease in the curled conformation.' unspecified 
PDB 2HB2 'Apo 6X mutant HIV Protease in the curled conformation.' unspecified 
PDB 2AZ8 'Wild-type HIV Protease in complex with TL-3.'           unspecified 
# 
_pdbx_database_status.entry_id                        2PC0 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-29 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Heaslet, H.'   1 
'Rosenfeld, R.' 2 
'Giffin, M.J.'  3 
'Elder, J.H.'   4 
'McRee, D.E.'   5 
'Stout, C.D.'   6 
# 
_citation.id                        primary 
_citation.title                     'Conformational flexibility in the flap domains of ligand-free HIV protease.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            63 
_citation.page_first                866 
_citation.page_last                 875 
_citation.year                      2007 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17642513 
_citation.pdbx_database_id_DOI      10.1107/S0907444907029125 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Heaslet, H.'   1 
primary 'Rosenfeld, R.' 2 
primary 'Giffin, M.'    3 
primary 'Lin, Y.C.'     4 
primary 'Tam, K.'       5 
primary 'Torbett, B.E.' 6 
primary 'Elder, J.H.'   7 
primary 'McRee, D.E.'   8 
primary 'Stout, C.D.'   9 
# 
_cell.entry_id           2PC0 
_cell.length_a           46.416 
_cell.length_b           46.416 
_cell.length_c           101.370 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2PC0 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Protease          10831.833 1   3.4.23.16 Q7K ? ? 
2 non-polymer syn 'MAGNESIUM ION'   24.305    1   ?         ?   ? ? 
3 non-polymer syn R-1,2-PROPANEDIOL 76.094    1   ?         ?   ? ? 
4 water       nat water             18.015    112 ?         ?   ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGCTLNF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGCTLNF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  GLN n 
1 3  ILE n 
1 4  THR n 
1 5  LEU n 
1 6  TRP n 
1 7  LYS n 
1 8  ARG n 
1 9  PRO n 
1 10 LEU n 
1 11 VAL n 
1 12 THR n 
1 13 ILE n 
1 14 LYS n 
1 15 ILE n 
1 16 GLY n 
1 17 GLY n 
1 18 GLN n 
1 19 LEU n 
1 20 LYS n 
1 21 GLU n 
1 22 ALA n 
1 23 LEU n 
1 24 LEU n 
1 25 ASP n 
1 26 THR n 
1 27 GLY n 
1 28 ALA n 
1 29 ASP n 
1 30 ASP n 
1 31 THR n 
1 32 VAL n 
1 33 LEU n 
1 34 GLU n 
1 35 GLU n 
1 36 MET n 
1 37 ASN n 
1 38 LEU n 
1 39 PRO n 
1 40 GLY n 
1 41 ARG n 
1 42 TRP n 
1 43 LYS n 
1 44 PRO n 
1 45 LYS n 
1 46 MET n 
1 47 ILE n 
1 48 GLY n 
1 49 GLY n 
1 50 ILE n 
1 51 GLY n 
1 52 GLY n 
1 53 PHE n 
1 54 ILE n 
1 55 LYS n 
1 56 VAL n 
1 57 ARG n 
1 58 GLN n 
1 59 TYR n 
1 60 ASP n 
1 61 GLN n 
1 62 ILE n 
1 63 LEU n 
1 64 ILE n 
1 65 GLU n 
1 66 ILE n 
1 67 CYS n 
1 68 GLY n 
1 69 HIS n 
1 70 LYS n 
1 71 ALA n 
1 72 ILE n 
1 73 GLY n 
1 74 THR n 
1 75 VAL n 
1 76 LEU n 
1 77 VAL n 
1 78 GLY n 
1 79 PRO n 
1 80 THR n 
1 81 PRO n 
1 82 VAL n 
1 83 ASN n 
1 84 ILE n 
1 85 ILE n 
1 86 GLY n 
1 87 ARG n 
1 88 ASN n 
1 89 LEU n 
1 90 LEU n 
1 91 THR n 
1 92 GLN n 
1 93 ILE n 
1 94 GLY n 
1 95 CYS n 
1 96 THR n 
1 97 LEU n 
1 98 ASN n 
1 99 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Lentivirus 
_entity_src_gen.pdbx_gene_src_gene                 pol 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    BH10 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human immunodeficiency virus 1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11676 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21.DE 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pLys S' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A3FH86_9HIV1 
_struct_ref.pdbx_db_accession          A3FH86 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGCTLNF
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2PC0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 99 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             A3FH86 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  99 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1001 
_struct_ref_seq.pdbx_auth_seq_align_end       1099 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2PC0 
_struct_ref_seq_dif.mon_id                       LYS 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      7 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   A3FH86 
_struct_ref_seq_dif.db_mon_id                    GLN 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          7 
_struct_ref_seq_dif.details                      ENGINEERED 
_struct_ref_seq_dif.pdbx_auth_seq_num            1007 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION'   ? 'Mg 2'           24.305  
PGR non-polymer         . R-1,2-PROPANEDIOL ? 'C3 H8 O2'       76.094  
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2PC0 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.52 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   51.17 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.2 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'0.2 M Magnesium chloride, 20% w/v PEG 3350, pH 5.2, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           103 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2006-02-01 
_diffrn_detector.details                
'Double-crystal monochromator, 1m long Rh coated bent cylindrical mirror for horizontal and vertical focusing' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Double crystal, parallel' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL1-5' 
_diffrn_source.pdbx_wavelength             0.979 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL1-5 
# 
_reflns.entry_id                     2PC0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   2 
_reflns.d_resolution_high            1.4 
_reflns.d_resolution_low             20.8 
_reflns.number_all                   27866 
_reflns.number_obs                   22409 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.057 
_reflns.pdbx_netI_over_sigmaI        16.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.40 
_reflns_shell.d_res_low              1.44 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   98.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    3.0 
_reflns_shell.pdbx_Rsym_value        0.522 
_reflns_shell.pdbx_redundancy        6.4 
_reflns_shell.number_unique_all      1588 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2PC0 
_refine.ls_d_res_high                            1.400 
_refine.ls_d_res_low                             20.8 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    98.680 
_refine.ls_number_reflns_obs                     22398 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.155 
_refine.ls_R_factor_R_work                       0.153 
_refine.ls_R_factor_R_free                       0.186 
_refine.ls_percent_reflns_R_free                 5.200 
_refine.ls_number_reflns_R_free                  1165 
_refine.B_iso_mean                               15.554 
_refine.aniso_B[1][1]                            0.300 
_refine.aniso_B[2][2]                            0.300 
_refine.aniso_B[3][3]                            -0.600 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.971 
_refine.correlation_coeff_Fo_to_Fc_free          0.961 
_refine.pdbx_overall_ESU_R                       0.060 
_refine.pdbx_overall_ESU_R_Free                  0.057 
_refine.overall_SU_ML                            0.034 
_refine.overall_SU_B                             1.871 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'pdb entry 2AZ8' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        760 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             112 
_refine_hist.number_atoms_total               878 
_refine_hist.d_res_high                       1.400 
_refine_hist.d_res_low                        20.8 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         868  0.008  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d           860  0.000  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1189 1.196  1.995  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        2007 0.593  3.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   117  6.325  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   29   43.646 24.483 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   165  9.025  15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   5    18.353 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           142  0.390  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     974  0.004  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       157  0.002  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            116  0.296  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbd_other              837  0.202  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          432  0.166  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_other            518  0.086  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    54   0.158  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   25   0.216  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     89   0.317  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 23   0.107  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              720  2.151  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other           227  1.610  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             907  2.672  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              361  3.752  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             282  5.026  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.400 
_refine_ls_shell.d_res_low                        1.436 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               97.540 
_refine_ls_shell.number_reflns_R_work             1502 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.209 
_refine_ls_shell.R_factor_R_free                  0.243 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             82 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                1584 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2PC0 
_struct.title                     'Apo Wild-type HIV Protease in the open conformation' 
_struct.pdbx_descriptor           'Protease (E.C.3.4.23.16)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2PC0 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HIV protease, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       GLY 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        86 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ILE 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        93 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        GLY 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         1086 
_struct_conf.end_auth_comp_id        ILE 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         1093 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   8 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 201 A HOH 1  1_555 ? ? ? ? ? ? ? 2.036 ? 
metalc2 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 201 A HOH 85 1_555 ? ? ? ? ? ? ? 2.150 ? 
metalc3 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 201 A HOH 62 1_555 ? ? ? ? ? ? ? 1.939 ? 
metalc4 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 201 A HOH 50 1_555 ? ? ? ? ? ? ? 2.692 ? 
metalc5 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 201 A HOH 1  7_555 ? ? ? ? ? ? ? 2.225 ? 
metalc6 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 201 A HOH 50 7_555 ? ? ? ? ? ? ? 1.526 ? 
metalc7 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 201 A HOH 85 7_555 ? ? ? ? ? ? ? 2.256 ? 
metalc8 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 201 A HOH 62 7_555 ? ? ? ? ? ? ? 2.308 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   8 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 42 ? GLY A 48 ? TRP A 1042 GLY A 1048 
A 2 PHE A 53 ? ILE A 66 ? PHE A 1053 ILE A 1066 
A 3 HIS A 69 ? VAL A 77 ? HIS A 1069 VAL A 1077 
A 4 VAL A 32 ? LEU A 33 ? VAL A 1032 LEU A 1033 
A 5 ILE A 84 ? ILE A 85 ? ILE A 1084 ILE A 1085 
A 6 GLN A 18 ? LEU A 24 ? GLN A 1018 LEU A 1024 
A 7 LEU A 10 ? ILE A 15 ? LEU A 1010 ILE A 1015 
A 8 PHE A 53 ? ILE A 66 ? PHE A 1053 ILE A 1066 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 43 ? N LYS A 1043 O GLN A 58 ? O GLN A 1058 
A 2 3 N ARG A 57 ? N ARG A 1057 O VAL A 77 ? O VAL A 1077 
A 3 4 O LEU A 76 ? O LEU A 1076 N LEU A 33 ? N LEU A 1033 
A 4 5 N VAL A 32 ? N VAL A 1032 O ILE A 84 ? O ILE A 1084 
A 5 6 O ILE A 85 ? O ILE A 1085 N LEU A 23 ? N LEU A 1023 
A 6 7 O LYS A 20 ? O LYS A 1020 N ILE A 13 ? N ILE A 1013 
A 7 8 N LYS A 14 ? N LYS A 1014 O GLU A 65 ? O GLU A 1065 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG A 201'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PGR A 907' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 HOH D .  ? HOH A 1    . ? 1_555 ? 
2  AC1 8 HOH D .  ? HOH A 1    . ? 7_555 ? 
3  AC1 8 HOH D .  ? HOH A 50   . ? 7_555 ? 
4  AC1 8 HOH D .  ? HOH A 50   . ? 1_555 ? 
5  AC1 8 HOH D .  ? HOH A 62   . ? 1_555 ? 
6  AC1 8 HOH D .  ? HOH A 62   . ? 7_555 ? 
7  AC1 8 HOH D .  ? HOH A 85   . ? 1_555 ? 
8  AC1 8 HOH D .  ? HOH A 85   . ? 7_555 ? 
9  AC2 6 HOH D .  ? HOH A 7    . ? 8_554 ? 
10 AC2 6 HOH D .  ? HOH A 100  . ? 1_555 ? 
11 AC2 6 GLY A 52 ? GLY A 1052 . ? 6_454 ? 
12 AC2 6 PHE A 53 ? PHE A 1053 . ? 6_454 ? 
13 AC2 6 LEU A 63 ? LEU A 1063 . ? 1_555 ? 
14 AC2 6 ILE A 72 ? ILE A 1072 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2PC0 
_atom_sites.fract_transf_matrix[1][1]   0.021544 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021544 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009865 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . PRO A 1 1  ? -4.475  -10.469 -7.839  1.00 23.99 ? 1001 PRO A N   1 
ATOM   2   C  CA  . PRO A 1 1  ? -3.664  -11.208 -6.887  1.00 23.50 ? 1001 PRO A CA  1 
ATOM   3   C  C   . PRO A 1 1  ? -3.849  -10.705 -5.464  1.00 22.61 ? 1001 PRO A C   1 
ATOM   4   O  O   . PRO A 1 1  ? -4.385  -9.619  -5.251  1.00 22.30 ? 1001 PRO A O   1 
ATOM   5   C  CB  . PRO A 1 1  ? -2.240  -10.923 -7.356  1.00 23.71 ? 1001 PRO A CB  1 
ATOM   6   C  CG  . PRO A 1 1  ? -2.317  -9.576  -7.950  1.00 25.39 ? 1001 PRO A CG  1 
ATOM   7   C  CD  . PRO A 1 1  ? -3.674  -9.494  -8.598  1.00 25.09 ? 1001 PRO A CD  1 
ATOM   8   N  N   . GLN A 1 2  ? -3.406  -11.503 -4.505  1.00 22.47 ? 1002 GLN A N   1 
ATOM   9   C  CA  . GLN A 1 2  ? -3.196  -11.034 -3.143  1.00 21.24 ? 1002 GLN A CA  1 
ATOM   10  C  C   . GLN A 1 2  ? -1.700  -10.981 -2.870  1.00 21.08 ? 1002 GLN A C   1 
ATOM   11  O  O   . GLN A 1 2  ? -0.997  -11.984 -3.034  1.00 23.44 ? 1002 GLN A O   1 
ATOM   12  C  CB  . GLN A 1 2  ? -3.887  -11.965 -2.148  1.00 21.87 ? 1002 GLN A CB  1 
ATOM   13  C  CG  . GLN A 1 2  ? -3.564  -11.665 -0.701  1.00 23.53 ? 1002 GLN A CG  1 
ATOM   14  C  CD  . GLN A 1 2  ? -4.561  -12.290 0.258   1.00 24.38 ? 1002 GLN A CD  1 
ATOM   15  O  OE1 . GLN A 1 2  ? -5.726  -11.882 0.326   1.00 29.75 ? 1002 GLN A OE1 1 
ATOM   16  N  NE2 . GLN A 1 2  ? -4.111  -13.281 1.002   1.00 30.58 ? 1002 GLN A NE2 1 
ATOM   17  N  N   . ILE A 1 3  ? -1.219  -9.805  -2.474  1.00 18.01 ? 1003 ILE A N   1 
ATOM   18  C  CA  . ILE A 1 3  ? 0.209   -9.547  -2.335  1.00 18.20 ? 1003 ILE A CA  1 
ATOM   19  C  C   . ILE A 1 3  ? 0.523   -9.242  -0.873  1.00 17.18 ? 1003 ILE A C   1 
ATOM   20  O  O   . ILE A 1 3  ? 0.000   -8.281  -0.308  1.00 16.92 ? 1003 ILE A O   1 
ATOM   21  C  CB  . ILE A 1 3  ? 0.647   -8.366  -3.233  1.00 17.76 ? 1003 ILE A CB  1 
ATOM   22  C  CG1 . ILE A 1 3  ? 0.376   -8.709  -4.703  1.00 19.95 ? 1003 ILE A CG1 1 
ATOM   23  C  CG2 . ILE A 1 3  ? 2.124   -8.031  -3.013  1.00 19.19 ? 1003 ILE A CG2 1 
ATOM   24  C  CD1 . ILE A 1 3  ? 0.575   -7.565  -5.646  1.00 18.33 ? 1003 ILE A CD1 1 
ATOM   25  N  N   . THR A 1 4  ? 1.351   -10.083 -0.253  1.00 16.35 ? 1004 THR A N   1 
ATOM   26  C  CA  . THR A 1 4  ? 1.842   -9.803  1.086   1.00 16.56 ? 1004 THR A CA  1 
ATOM   27  C  C   . THR A 1 4  ? 3.015   -8.832  1.033   1.00 16.56 ? 1004 THR A C   1 
ATOM   28  O  O   . THR A 1 4  ? 3.541   -8.519  -0.041  1.00 17.70 ? 1004 THR A O   1 
ATOM   29  C  CB  . THR A 1 4  ? 2.301   -11.087 1.814   1.00 17.41 ? 1004 THR A CB  1 
ATOM   30  O  OG1 . THR A 1 4  ? 3.365   -11.702 1.083   1.00 19.87 ? 1004 THR A OG1 1 
ATOM   31  C  CG2 . THR A 1 4  ? 1.140   -12.055 1.967   1.00 17.70 ? 1004 THR A CG2 1 
ATOM   32  N  N   . LEU A 1 5  ? 3.412   -8.343  2.199   1.00 15.13 ? 1005 LEU A N   1 
ATOM   33  C  CA  . LEU A 1 5  ? 4.276   -7.175  2.271   1.00 15.28 ? 1005 LEU A CA  1 
ATOM   34  C  C   . LEU A 1 5  ? 5.595   -7.446  3.002   1.00 14.84 ? 1005 LEU A C   1 
ATOM   35  O  O   . LEU A 1 5  ? 6.266   -6.529  3.462   1.00 14.75 ? 1005 LEU A O   1 
ATOM   36  C  CB  . LEU A 1 5  ? 3.507   -6.004  2.880   1.00 15.26 ? 1005 LEU A CB  1 
ATOM   37  C  CG  . LEU A 1 5  ? 2.334   -5.535  2.009   1.00 15.05 ? 1005 LEU A CG  1 
ATOM   38  C  CD1 . LEU A 1 5  ? 1.426   -4.579  2.755   1.00 16.45 ? 1005 LEU A CD1 1 
ATOM   39  C  CD2 . LEU A 1 5  ? 2.861   -4.886  0.735   1.00 16.44 ? 1005 LEU A CD2 1 
ATOM   40  N  N   . TRP A 1 6  ? 5.977   -8.719  3.072   1.00 14.92 ? 1006 TRP A N   1 
ATOM   41  C  CA  . TRP A 1 6  ? 7.303   -9.089  3.572   1.00 14.34 ? 1006 TRP A CA  1 
ATOM   42  C  C   . TRP A 1 6  ? 8.423   -8.497  2.739   1.00 15.93 ? 1006 TRP A C   1 
ATOM   43  O  O   . TRP A 1 6  ? 9.474   -8.133  3.269   1.00 18.70 ? 1006 TRP A O   1 
ATOM   44  C  CB  . TRP A 1 6  ? 7.457   -10.608 3.610   1.00 13.63 ? 1006 TRP A CB  1 
ATOM   45  C  CG  . TRP A 1 6  ? 6.480   -11.270 4.504   1.00 12.23 ? 1006 TRP A CG  1 
ATOM   46  C  CD1 . TRP A 1 6  ? 5.308   -11.860 4.141   1.00 11.36 ? 1006 TRP A CD1 1 
ATOM   47  C  CD2 . TRP A 1 6  ? 6.578   -11.406 5.927   1.00 11.60 ? 1006 TRP A CD2 1 
ATOM   48  N  NE1 . TRP A 1 6  ? 4.668   -12.359 5.251   1.00 11.83 ? 1006 TRP A NE1 1 
ATOM   49  C  CE2 . TRP A 1 6  ? 5.432   -12.094 6.358   1.00 12.54 ? 1006 TRP A CE2 1 
ATOM   50  C  CE3 . TRP A 1 6  ? 7.529   -11.020 6.873   1.00 12.57 ? 1006 TRP A CE3 1 
ATOM   51  C  CZ2 . TRP A 1 6  ? 5.212   -12.405 7.700   1.00 13.66 ? 1006 TRP A CZ2 1 
ATOM   52  C  CZ3 . TRP A 1 6  ? 7.306   -11.326 8.197   1.00 13.79 ? 1006 TRP A CZ3 1 
ATOM   53  C  CH2 . TRP A 1 6  ? 6.163   -12.016 8.597   1.00 14.40 ? 1006 TRP A CH2 1 
ATOM   54  N  N   A LYS A 1 7  ? 8.212   -8.389  1.431   0.40 15.77 ? 1007 LYS A N   1 
ATOM   55  N  N   B LYS A 1 7  ? 8.195   -8.458  1.432   0.60 15.74 ? 1007 LYS A N   1 
ATOM   56  C  CA  A LYS A 1 7  ? 9.174   -7.720  0.556   0.40 15.76 ? 1007 LYS A CA  1 
ATOM   57  C  CA  B LYS A 1 7  ? 9.117   -7.855  0.495   0.60 15.60 ? 1007 LYS A CA  1 
ATOM   58  C  C   A LYS A 1 7  ? 8.510   -6.563  -0.178  0.40 15.10 ? 1007 LYS A C   1 
ATOM   59  C  C   B LYS A 1 7  ? 8.474   -6.592  -0.053  0.60 15.21 ? 1007 LYS A C   1 
ATOM   60  O  O   A LYS A 1 7  ? 7.284   -6.475  -0.232  0.40 14.10 ? 1007 LYS A O   1 
ATOM   61  O  O   B LYS A 1 7  ? 7.283   -6.339  0.142   0.60 14.20 ? 1007 LYS A O   1 
ATOM   62  C  CB  A LYS A 1 7  ? 9.763   -8.707  -0.451  0.40 16.50 ? 1007 LYS A CB  1 
ATOM   63  C  CB  B LYS A 1 7  ? 9.410   -8.813  -0.660  0.60 17.48 ? 1007 LYS A CB  1 
ATOM   64  C  CG  A LYS A 1 7  ? 8.750   -9.304  -1.426  0.40 17.65 ? 1007 LYS A CG  1 
ATOM   65  C  CG  B LYS A 1 7  ? 9.583   -10.268 -0.249  0.60 20.42 ? 1007 LYS A CG  1 
ATOM   66  C  CD  A LYS A 1 7  ? 9.448   -10.110 -2.516  0.40 19.10 ? 1007 LYS A CD  1 
ATOM   67  C  CD  B LYS A 1 7  ? 11.006  -10.571 0.149   0.60 24.50 ? 1007 LYS A CD  1 
ATOM   68  C  CE  A LYS A 1 7  ? 8.521   -11.135 -3.140  0.40 20.76 ? 1007 LYS A CE  1 
ATOM   69  C  CE  B LYS A 1 7  ? 11.135  -11.985 0.711   0.60 25.47 ? 1007 LYS A CE  1 
ATOM   70  N  NZ  A LYS A 1 7  ? 9.100   -11.714 -4.380  0.40 23.63 ? 1007 LYS A NZ  1 
ATOM   71  N  NZ  B LYS A 1 7  ? 11.461  -12.985 -0.347  0.60 28.03 ? 1007 LYS A NZ  1 
ATOM   72  N  N   A ARG A 1 8  ? 9.316   -5.669  -0.738  0.50 14.52 ? 1008 ARG A N   1 
ATOM   73  N  N   B ARG A 1 8  ? 9.271   -5.793  -0.745  0.50 14.17 ? 1008 ARG A N   1 
ATOM   74  C  CA  A ARG A 1 8  ? 8.756   -4.556  -1.489  0.50 15.08 ? 1008 ARG A CA  1 
ATOM   75  C  CA  B ARG A 1 8  ? 8.736   -4.639  -1.452  0.50 14.56 ? 1008 ARG A CA  1 
ATOM   76  C  C   A ARG A 1 8  ? 7.825   -5.117  -2.563  0.50 14.60 ? 1008 ARG A C   1 
ATOM   77  C  C   B ARG A 1 8  ? 7.818   -5.134  -2.569  0.50 14.46 ? 1008 ARG A C   1 
ATOM   78  O  O   A ARG A 1 8  ? 8.186   -6.067  -3.262  0.50 14.86 ? 1008 ARG A O   1 
ATOM   79  O  O   B ARG A 1 8  ? 8.184   -6.052  -3.308  0.50 14.86 ? 1008 ARG A O   1 
ATOM   80  C  CB  A ARG A 1 8  ? 9.864   -3.724  -2.126  0.50 15.41 ? 1008 ARG A CB  1 
ATOM   81  C  CB  B ARG A 1 8  ? 9.870   -3.789  -2.028  0.50 14.91 ? 1008 ARG A CB  1 
ATOM   82  C  CG  A ARG A 1 8  ? 10.740  -2.972  -1.135  0.50 16.53 ? 1008 ARG A CG  1 
ATOM   83  C  CG  B ARG A 1 8  ? 10.786  -3.174  -0.976  0.50 14.54 ? 1008 ARG A CG  1 
ATOM   84  C  CD  A ARG A 1 8  ? 11.595  -1.937  -1.855  0.50 19.57 ? 1008 ARG A CD  1 
ATOM   85  C  CD  B ARG A 1 8  ? 11.962  -2.428  -1.603  0.50 16.40 ? 1008 ARG A CD  1 
ATOM   86  N  NE  A ARG A 1 8  ? 12.530  -2.571  -2.781  0.50 23.38 ? 1008 ARG A NE  1 
ATOM   87  N  NE  B ARG A 1 8  ? 12.689  -1.656  -0.603  0.50 16.26 ? 1008 ARG A NE  1 
ATOM   88  C  CZ  A ARG A 1 8  ? 12.918  -2.056  -3.947  0.50 25.15 ? 1008 ARG A CZ  1 
ATOM   89  C  CZ  B ARG A 1 8  ? 13.830  -1.012  -0.828  0.50 20.98 ? 1008 ARG A CZ  1 
ATOM   90  N  NH1 A ARG A 1 8  ? 12.460  -0.880  -4.369  0.50 25.15 ? 1008 ARG A NH1 1 
ATOM   91  N  NH1 B ARG A 1 8  ? 14.388  -1.033  -2.031  0.50 22.95 ? 1008 ARG A NH1 1 
ATOM   92  N  NH2 A ARG A 1 8  ? 13.774  -2.730  -4.697  0.50 23.88 ? 1008 ARG A NH2 1 
ATOM   93  N  NH2 B ARG A 1 8  ? 14.416  -0.343  0.157   0.50 20.60 ? 1008 ARG A NH2 1 
ATOM   94  N  N   . PRO A 1 9  ? 6.614   -4.547  -2.683  1.00 14.21 ? 1009 PRO A N   1 
ATOM   95  C  CA  . PRO A 1 9  ? 5.645   -4.980  -3.684  1.00 15.13 ? 1009 PRO A CA  1 
ATOM   96  C  C   . PRO A 1 9  ? 5.971   -4.505  -5.103  1.00 15.12 ? 1009 PRO A C   1 
ATOM   97  O  O   . PRO A 1 9  ? 5.297   -3.646  -5.670  1.00 15.01 ? 1009 PRO A O   1 
ATOM   98  C  CB  . PRO A 1 9  ? 4.328   -4.417  -3.157  1.00 15.06 ? 1009 PRO A CB  1 
ATOM   99  C  CG  . PRO A 1 9  ? 4.705   -3.205  -2.403  1.00 15.25 ? 1009 PRO A CG  1 
ATOM   100 C  CD  . PRO A 1 9  ? 6.060   -3.495  -1.807  1.00 14.60 ? 1009 PRO A CD  1 
ATOM   101 N  N   . LEU A 1 10 ? 7.028   -5.079  -5.661  1.00 15.10 ? 1010 LEU A N   1 
ATOM   102 C  CA  . LEU A 1 10 ? 7.432   -4.806  -7.025  1.00 16.62 ? 1010 LEU A CA  1 
ATOM   103 C  C   . LEU A 1 10 ? 6.667   -5.724  -7.973  1.00 16.97 ? 1010 LEU A C   1 
ATOM   104 O  O   . LEU A 1 10 ? 6.545   -6.928  -7.741  1.00 20.06 ? 1010 LEU A O   1 
ATOM   105 C  CB  . LEU A 1 10 ? 8.932   -5.038  -7.168  1.00 17.49 ? 1010 LEU A CB  1 
ATOM   106 C  CG  . LEU A 1 10 ? 9.818   -4.118  -6.331  1.00 18.26 ? 1010 LEU A CG  1 
ATOM   107 C  CD1 . LEU A 1 10 ? 11.263  -4.599  -6.343  1.00 24.44 ? 1010 LEU A CD1 1 
ATOM   108 C  CD2 . LEU A 1 10 ? 9.721   -2.678  -6.821  1.00 24.22 ? 1010 LEU A CD2 1 
ATOM   109 N  N   . VAL A 1 11 ? 6.144   -5.141  -9.043  1.00 17.18 ? 1011 VAL A N   1 
ATOM   110 C  CA  . VAL A 1 11 ? 5.423   -5.903  -10.042 1.00 18.59 ? 1011 VAL A CA  1 
ATOM   111 C  C   . VAL A 1 11 ? 5.916   -5.511  -11.420 1.00 19.35 ? 1011 VAL A C   1 
ATOM   112 O  O   . VAL A 1 11 ? 6.546   -4.467  -11.598 1.00 19.43 ? 1011 VAL A O   1 
ATOM   113 C  CB  . VAL A 1 11 ? 3.902   -5.676  -9.957  1.00 20.19 ? 1011 VAL A CB  1 
ATOM   114 C  CG1 . VAL A 1 11 ? 3.358   -6.119  -8.599  1.00 22.52 ? 1011 VAL A CG1 1 
ATOM   115 C  CG2 . VAL A 1 11 ? 3.568   -4.224  -10.226 1.00 21.56 ? 1011 VAL A CG2 1 
ATOM   116 N  N   . THR A 1 12 ? 5.634   -6.365  -12.398 1.00 20.00 ? 1012 THR A N   1 
ATOM   117 C  CA  . THR A 1 12 ? 5.892   -6.039  -13.786 1.00 20.80 ? 1012 THR A CA  1 
ATOM   118 C  C   . THR A 1 12 ? 4.741   -5.225  -14.336 1.00 18.98 ? 1012 THR A C   1 
ATOM   119 O  O   . THR A 1 12 ? 3.564   -5.528  -14.095 1.00 21.25 ? 1012 THR A O   1 
ATOM   120 C  CB  . THR A 1 12 ? 6.073   -7.310  -14.614 1.00 22.83 ? 1012 THR A CB  1 
ATOM   121 O  OG1 . THR A 1 12 ? 7.155   -8.068  -14.068 1.00 25.66 ? 1012 THR A OG1 1 
ATOM   122 C  CG2 . THR A 1 12 ? 6.371   -6.966  -16.070 0.50 21.01 ? 1012 THR A CG2 1 
ATOM   123 N  N   . ILE A 1 13 ? 5.084   -4.159  -15.044 1.00 18.46 ? 1013 ILE A N   1 
ATOM   124 C  CA  . ILE A 1 13 ? 4.086   -3.379  -15.741 1.00 17.25 ? 1013 ILE A CA  1 
ATOM   125 C  C   . ILE A 1 13 ? 4.395   -3.354  -17.236 1.00 16.90 ? 1013 ILE A C   1 
ATOM   126 O  O   . ILE A 1 13 ? 5.555   -3.461  -17.652 1.00 18.32 ? 1013 ILE A O   1 
ATOM   127 C  CB  . ILE A 1 13 ? 4.005   -1.953  -15.185 1.00 16.66 ? 1013 ILE A CB  1 
ATOM   128 C  CG1 . ILE A 1 13 ? 5.323   -1.211  -15.418 1.00 18.24 ? 1013 ILE A CG1 1 
ATOM   129 C  CG2 . ILE A 1 13 ? 3.688   -1.996  -13.699 1.00 18.26 ? 1013 ILE A CG2 1 
ATOM   130 C  CD1 . ILE A 1 13 ? 5.243   0.264   -15.192 1.00 19.02 ? 1013 ILE A CD1 1 
ATOM   131 N  N   . LYS A 1 14 ? 3.340   -3.232  -18.029 1.00 14.99 ? 1014 LYS A N   1 
ATOM   132 C  CA  . LYS A 1 14 ? 3.470   -2.998  -19.458 1.00 16.16 ? 1014 LYS A CA  1 
ATOM   133 C  C   . LYS A 1 14 ? 2.981   -1.591  -19.728 1.00 15.23 ? 1014 LYS A C   1 
ATOM   134 O  O   . LYS A 1 14 ? 1.864   -1.245  -19.376 1.00 14.53 ? 1014 LYS A O   1 
ATOM   135 C  CB  . LYS A 1 14 ? 2.577   -3.954  -20.242 1.00 18.09 ? 1014 LYS A CB  1 
ATOM   136 C  CG  . LYS A 1 14 ? 2.986   -5.400  -20.231 1.00 21.51 ? 1014 LYS A CG  1 
ATOM   137 C  CD  . LYS A 1 14 ? 2.277   -6.126  -21.375 1.00 23.44 ? 1014 LYS A CD  1 
ATOM   138 C  CE  . LYS A 1 14 ? 2.522   -7.605  -21.375 1.00 26.63 ? 1014 LYS A CE  1 
ATOM   139 N  NZ  . LYS A 1 14 ? 1.672   -8.250  -22.412 1.00 26.50 ? 1014 LYS A NZ  1 
ATOM   140 N  N   . ILE A 1 15 ? 3.815   -0.791  -20.368 1.00 14.12 ? 1015 ILE A N   1 
ATOM   141 C  CA  . ILE A 1 15 ? 3.452   0.576   -20.691 1.00 14.56 ? 1015 ILE A CA  1 
ATOM   142 C  C   . ILE A 1 15 ? 4.309   1.064   -21.847 1.00 15.29 ? 1015 ILE A C   1 
ATOM   143 O  O   . ILE A 1 15 ? 5.501   0.771   -21.911 1.00 15.76 ? 1015 ILE A O   1 
ATOM   144 C  CB  . ILE A 1 15 ? 3.643   1.510   -19.462 1.00 14.34 ? 1015 ILE A CB  1 
ATOM   145 C  CG1 . ILE A 1 15 ? 3.233   2.946   -19.803 1.00 15.26 ? 1015 ILE A CG1 1 
ATOM   146 C  CG2 . ILE A 1 15 ? 5.083   1.432   -18.943 1.00 15.91 ? 1015 ILE A CG2 1 
ATOM   147 C  CD1 . ILE A 1 15 ? 3.267   3.917   -18.639 1.00 17.01 ? 1015 ILE A CD1 1 
ATOM   148 N  N   . GLY A 1 16 ? 3.688   1.805   -22.761 1.00 15.72 ? 1016 GLY A N   1 
ATOM   149 C  CA  . GLY A 1 16 ? 4.419   2.420   -23.866 1.00 16.66 ? 1016 GLY A CA  1 
ATOM   150 C  C   . GLY A 1 16 ? 5.176   1.420   -24.713 1.00 16.94 ? 1016 GLY A C   1 
ATOM   151 O  O   . GLY A 1 16 ? 6.229   1.742   -25.280 1.00 18.51 ? 1016 GLY A O   1 
ATOM   152 N  N   . GLY A 1 17 ? 4.659   0.200   -24.806 1.00 16.15 ? 1017 GLY A N   1 
ATOM   153 C  CA  . GLY A 1 17 ? 5.290   -0.818  -25.640 1.00 16.93 ? 1017 GLY A CA  1 
ATOM   154 C  C   . GLY A 1 17 ? 6.505   -1.448  -24.975 1.00 18.07 ? 1017 GLY A C   1 
ATOM   155 O  O   . GLY A 1 17 ? 7.258   -2.172  -25.623 1.00 20.00 ? 1017 GLY A O   1 
ATOM   156 N  N   . GLN A 1 18 ? 6.674   -1.193  -23.675 1.00 17.93 ? 1018 GLN A N   1 
ATOM   157 C  CA  . GLN A 1 18 ? 7.818   -1.665  -22.903 1.00 19.41 ? 1018 GLN A CA  1 
ATOM   158 C  C   . GLN A 1 18 ? 7.358   -2.451  -21.670 1.00 19.07 ? 1018 GLN A C   1 
ATOM   159 O  O   . GLN A 1 18 ? 6.232   -2.289  -21.220 1.00 19.57 ? 1018 GLN A O   1 
ATOM   160 C  CB  . GLN A 1 18 ? 8.640   -0.469  -22.409 1.00 20.80 ? 1018 GLN A CB  1 
ATOM   161 C  CG  . GLN A 1 18 ? 9.195   0.450   -23.485 1.00 24.50 ? 1018 GLN A CG  1 
ATOM   162 C  CD  . GLN A 1 18 ? 10.274  1.362   -22.923 0.50 22.43 ? 1018 GLN A CD  1 
ATOM   163 O  OE1 . GLN A 1 18 ? 10.029  2.532   -22.628 0.50 23.71 ? 1018 GLN A OE1 1 
ATOM   164 N  NE2 . GLN A 1 18 ? 11.472  0.816   -22.747 0.50 25.42 ? 1018 GLN A NE2 1 
ATOM   165 N  N   . LEU A 1 19 ? 8.256   -3.262  -21.118 1.00 20.32 ? 1019 LEU A N   1 
ATOM   166 C  CA  . LEU A 1 19 ? 8.079   -3.879  -19.805 1.00 22.09 ? 1019 LEU A CA  1 
ATOM   167 C  C   . LEU A 1 19 ? 8.977   -3.179  -18.796 1.00 22.15 ? 1019 LEU A C   1 
ATOM   168 O  O   . LEU A 1 19 ? 10.160  -2.942  -19.061 1.00 23.07 ? 1019 LEU A O   1 
ATOM   169 C  CB  . LEU A 1 19 ? 8.477   -5.355  -19.834 1.00 23.60 ? 1019 LEU A CB  1 
ATOM   170 C  CG  . LEU A 1 19 ? 7.586   -6.359  -20.560 1.00 26.58 ? 1019 LEU A CG  1 
ATOM   171 C  CD1 . LEU A 1 19 ? 8.309   -7.699  -20.676 1.00 29.63 ? 1019 LEU A CD1 1 
ATOM   172 C  CD2 . LEU A 1 19 ? 6.261   -6.541  -19.844 1.00 29.56 ? 1019 LEU A CD2 1 
ATOM   173 N  N   . LYS A 1 20 ? 8.429   -2.873  -17.629 1.00 20.73 ? 1020 LYS A N   1 
ATOM   174 C  CA  . LYS A 1 20 ? 9.224   -2.285  -16.567 1.00 21.29 ? 1020 LYS A CA  1 
ATOM   175 C  C   . LYS A 1 20 ? 8.819   -2.899  -15.243 1.00 20.59 ? 1020 LYS A C   1 
ATOM   176 O  O   . LYS A 1 20 ? 7.798   -3.580  -15.152 1.00 22.24 ? 1020 LYS A O   1 
ATOM   177 C  CB  . LYS A 1 20 ? 9.028   -0.772  -16.539 1.00 21.40 ? 1020 LYS A CB  1 
ATOM   178 C  CG  . LYS A 1 20 ? 9.439   -0.090  -17.841 1.00 23.85 ? 1020 LYS A CG  1 
ATOM   179 C  CD  . LYS A 1 20 ? 9.298   1.410   -17.788 0.50 23.30 ? 1020 LYS A CD  1 
ATOM   180 C  CE  . LYS A 1 20 ? 10.070  2.053   -18.933 0.50 25.28 ? 1020 LYS A CE  1 
ATOM   181 N  NZ  . LYS A 1 20 ? 11.530  2.068   -18.664 0.50 25.74 ? 1020 LYS A NZ  1 
ATOM   182 N  N   A GLU A 1 21 ? 9.647   -2.673  -14.229 0.50 20.18 ? 1021 GLU A N   1 
ATOM   183 N  N   B GLU A 1 21 ? 9.630   -2.663  -14.220 0.50 19.91 ? 1021 GLU A N   1 
ATOM   184 C  CA  A GLU A 1 21 ? 9.323   -3.035  -12.855 0.50 20.11 ? 1021 GLU A CA  1 
ATOM   185 C  CA  B GLU A 1 21 ? 9.285   -3.057  -12.862 0.50 19.90 ? 1021 GLU A CA  1 
ATOM   186 C  C   A GLU A 1 21 ? 8.897   -1.768  -12.122 0.50 19.11 ? 1021 GLU A C   1 
ATOM   187 C  C   B GLU A 1 21 ? 8.947   -1.805  -12.063 0.50 19.01 ? 1021 GLU A C   1 
ATOM   188 O  O   A GLU A 1 21 ? 9.467   -0.700  -12.342 0.50 19.31 ? 1021 GLU A O   1 
ATOM   189 O  O   B GLU A 1 21 ? 9.635   -0.791  -12.166 0.50 18.95 ? 1021 GLU A O   1 
ATOM   190 C  CB  A GLU A 1 21 ? 10.544  -3.648  -12.166 0.50 20.42 ? 1021 GLU A CB  1 
ATOM   191 C  CB  B GLU A 1 21 ? 10.452  -3.799  -12.209 0.50 20.84 ? 1021 GLU A CB  1 
ATOM   192 C  CG  A GLU A 1 21 ? 10.245  -4.265  -10.808 0.50 21.32 ? 1021 GLU A CG  1 
ATOM   193 C  CG  B GLU A 1 21 ? 10.821  -5.098  -12.909 0.50 23.12 ? 1021 GLU A CG  1 
ATOM   194 C  CD  A GLU A 1 21 ? 11.399  -5.092  -10.280 0.50 22.95 ? 1021 GLU A CD  1 
ATOM   195 C  CD  B GLU A 1 21 ? 9.814   -6.207  -12.661 0.50 27.32 ? 1021 GLU A CD  1 
ATOM   196 O  OE1 A GLU A 1 21 ? 12.468  -4.512  -9.990  0.50 26.64 ? 1021 GLU A OE1 1 
ATOM   197 O  OE1 B GLU A 1 21 ? 9.672   -6.637  -11.496 0.50 31.42 ? 1021 GLU A OE1 1 
ATOM   198 O  OE2 A GLU A 1 21 ? 11.237  -6.324  -10.161 0.50 27.76 ? 1021 GLU A OE2 1 
ATOM   199 O  OE2 B GLU A 1 21 ? 9.170   -6.656  -13.636 0.50 30.26 ? 1021 GLU A OE2 1 
ATOM   200 N  N   . ALA A 1 22 ? 7.886   -1.882  -11.269 1.00 17.87 ? 1022 ALA A N   1 
ATOM   201 C  CA  . ALA A 1 22 ? 7.448   -0.749  -10.481 1.00 17.03 ? 1022 ALA A CA  1 
ATOM   202 C  C   . ALA A 1 22 ? 6.898   -1.193  -9.141  1.00 15.84 ? 1022 ALA A C   1 
ATOM   203 O  O   . ALA A 1 22 ? 6.460   -2.325  -8.980  1.00 16.54 ? 1022 ALA A O   1 
ATOM   204 C  CB  . ALA A 1 22 ? 6.400   0.050   -11.241 1.00 16.07 ? 1022 ALA A CB  1 
ATOM   205 N  N   . LEU A 1 23 ? 6.909   -0.260  -8.199  1.00 15.16 ? 1023 LEU A N   1 
ATOM   206 C  CA  . LEU A 1 23 ? 6.478   -0.498  -6.825  1.00 16.08 ? 1023 LEU A CA  1 
ATOM   207 C  C   . LEU A 1 23 ? 5.023   -0.082  -6.629  1.00 14.97 ? 1023 LEU A C   1 
ATOM   208 O  O   . LEU A 1 23 ? 4.650   1.054   -6.961  1.00 16.22 ? 1023 LEU A O   1 
ATOM   209 C  CB  . LEU A 1 23 ? 7.363   0.349   -5.918  1.00 15.47 ? 1023 LEU A CB  1 
ATOM   210 C  CG  . LEU A 1 23 ? 7.143   0.237   -4.416  1.00 16.52 ? 1023 LEU A CG  1 
ATOM   211 C  CD1 . LEU A 1 23 ? 7.612   -1.099  -3.926  1.00 18.55 ? 1023 LEU A CD1 1 
ATOM   212 C  CD2 . LEU A 1 23 ? 7.852   1.367   -3.677  1.00 17.77 ? 1023 LEU A CD2 1 
ATOM   213 N  N   . LEU A 1 24 ? 4.206   -0.970  -6.058  1.00 14.32 ? 1024 LEU A N   1 
ATOM   214 C  CA  . LEU A 1 24 ? 2.843   -0.606  -5.685  1.00 14.76 ? 1024 LEU A CA  1 
ATOM   215 C  C   . LEU A 1 24 ? 2.897   0.184   -4.379  1.00 14.97 ? 1024 LEU A C   1 
ATOM   216 O  O   . LEU A 1 24 ? 3.166   -0.387  -3.323  1.00 15.92 ? 1024 LEU A O   1 
ATOM   217 C  CB  . LEU A 1 24 ? 1.963   -1.851  -5.526  1.00 15.01 ? 1024 LEU A CB  1 
ATOM   218 C  CG  . LEU A 1 24 ? 1.881   -2.785  -6.742  1.00 16.47 ? 1024 LEU A CG  1 
ATOM   219 C  CD1 . LEU A 1 24 ? 0.939   -3.962  -6.485  1.00 18.26 ? 1024 LEU A CD1 1 
ATOM   220 C  CD2 . LEU A 1 24 ? 1.461   -2.023  -8.003  1.00 18.58 ? 1024 LEU A CD2 1 
ATOM   221 N  N   . ASP A 1 25 ? 2.659   1.491   -4.457  1.00 15.07 ? 1025 ASP A N   1 
ATOM   222 C  CA  . ASP A 1 25 ? 3.023   2.429   -3.392  1.00 14.72 ? 1025 ASP A CA  1 
ATOM   223 C  C   . ASP A 1 25 ? 1.796   3.200   -2.880  1.00 13.43 ? 1025 ASP A C   1 
ATOM   224 O  O   . ASP A 1 25 ? 1.409   4.217   -3.451  1.00 15.51 ? 1025 ASP A O   1 
ATOM   225 C  CB  . ASP A 1 25 ? 4.069   3.398   -3.941  1.00 15.68 ? 1025 ASP A CB  1 
ATOM   226 C  CG  . ASP A 1 25 ? 4.698   4.261   -2.869  1.00 18.00 ? 1025 ASP A CG  1 
ATOM   227 O  OD1 . ASP A 1 25 ? 4.146   4.323   -1.747  1.00 18.43 ? 1025 ASP A OD1 1 
ATOM   228 O  OD2 . ASP A 1 25 ? 5.756   4.874   -3.159  1.00 19.59 ? 1025 ASP A OD2 1 
ATOM   229 N  N   . THR A 1 26 ? 1.172   2.709   -1.811  1.00 14.25 ? 1026 THR A N   1 
ATOM   230 C  CA  . THR A 1 26 ? 0.003   3.377   -1.247  1.00 14.18 ? 1026 THR A CA  1 
ATOM   231 C  C   . THR A 1 26 ? 0.334   4.692   -0.566  1.00 14.36 ? 1026 THR A C   1 
ATOM   232 O  O   . THR A 1 26 ? -0.579  5.458   -0.227  1.00 16.15 ? 1026 THR A O   1 
ATOM   233 C  CB  . THR A 1 26 ? -0.737  2.496   -0.234  1.00 13.63 ? 1026 THR A CB  1 
ATOM   234 O  OG1 . THR A 1 26 ? 0.136   2.201   0.864   1.00 15.00 ? 1026 THR A OG1 1 
ATOM   235 C  CG2 . THR A 1 26 ? -1.202  1.208   -0.897  1.00 13.82 ? 1026 THR A CG2 1 
ATOM   236 N  N   . GLY A 1 27 ? 1.624   4.956   -0.362  1.00 14.95 ? 1027 GLY A N   1 
ATOM   237 C  CA  . GLY A 1 27 ? 2.055   6.230   0.191   1.00 15.97 ? 1027 GLY A CA  1 
ATOM   238 C  C   . GLY A 1 27 ? 2.325   7.303   -0.849  1.00 17.04 ? 1027 GLY A C   1 
ATOM   239 O  O   . GLY A 1 27 ? 2.772   8.389   -0.524  1.00 19.08 ? 1027 GLY A O   1 
ATOM   240 N  N   . ALA A 1 28 ? 2.076   6.990   -2.115  1.00 16.30 ? 1028 ALA A N   1 
ATOM   241 C  CA  . ALA A 1 28 ? 2.308   7.942   -3.202  1.00 15.79 ? 1028 ALA A CA  1 
ATOM   242 C  C   . ALA A 1 28 ? 0.978   8.322   -3.836  1.00 14.68 ? 1028 ALA A C   1 
ATOM   243 O  O   . ALA A 1 28 ? 0.179   7.450   -4.200  1.00 15.18 ? 1028 ALA A O   1 
ATOM   244 C  CB  . ALA A 1 28 ? 3.217   7.319   -4.248  1.00 17.08 ? 1028 ALA A CB  1 
ATOM   245 N  N   . ASP A 1 29 ? 0.734   9.622   -3.987  1.00 14.62 ? 1029 ASP A N   1 
ATOM   246 C  CA  . ASP A 1 29 ? -0.504  10.079  -4.589  1.00 14.80 ? 1029 ASP A CA  1 
ATOM   247 C  C   . ASP A 1 29 ? -0.494  9.746   -6.080  1.00 14.87 ? 1029 ASP A C   1 
ATOM   248 O  O   . ASP A 1 29 ? -1.521  9.381   -6.637  1.00 15.75 ? 1029 ASP A O   1 
ATOM   249 C  CB  . ASP A 1 29 ? -0.666  11.596  -4.436  1.00 15.73 ? 1029 ASP A CB  1 
ATOM   250 C  CG  . ASP A 1 29 ? -0.705  12.065  -2.986  1.00 19.46 ? 1029 ASP A CG  1 
ATOM   251 O  OD1 . ASP A 1 29 ? -1.019  11.276  -2.073  1.00 19.33 ? 1029 ASP A OD1 1 
ATOM   252 O  OD2 . ASP A 1 29 ? -0.427  13.262  -2.774  1.00 25.60 ? 1029 ASP A OD2 1 
ATOM   253 N  N   . ASP A 1 30 ? 0.673   9.904   -6.711  1.00 14.14 ? 1030 ASP A N   1 
ATOM   254 C  CA  . ASP A 1 30 ? 0.808   9.871   -8.169  1.00 14.97 ? 1030 ASP A CA  1 
ATOM   255 C  C   . ASP A 1 30 ? 1.749   8.758   -8.604  1.00 14.04 ? 1030 ASP A C   1 
ATOM   256 O  O   . ASP A 1 30 ? 2.607   8.301   -7.853  1.00 15.07 ? 1030 ASP A O   1 
ATOM   257 C  CB  . ASP A 1 30 ? 1.372   11.189  -8.709  1.00 16.07 ? 1030 ASP A CB  1 
ATOM   258 C  CG  . ASP A 1 30 ? 0.584   12.390  -8.261  1.00 18.68 ? 1030 ASP A CG  1 
ATOM   259 O  OD1 . ASP A 1 30 ? -0.642  12.411  -8.455  1.00 22.68 ? 1030 ASP A OD1 1 
ATOM   260 O  OD2 . ASP A 1 30 ? 1.192   13.297  -7.664  1.00 27.04 ? 1030 ASP A OD2 1 
ATOM   261 N  N   . THR A 1 31 ? 1.574   8.353   -9.851  1.00 14.11 ? 1031 THR A N   1 
ATOM   262 C  CA  . THR A 1 31 ? 2.426   7.405   -10.524 1.00 12.60 ? 1031 THR A CA  1 
ATOM   263 C  C   . THR A 1 31 ? 3.531   8.148   -11.229 1.00 12.24 ? 1031 THR A C   1 
ATOM   264 O  O   . THR A 1 31 ? 3.269   9.090   -11.996 1.00 13.79 ? 1031 THR A O   1 
ATOM   265 C  CB  . THR A 1 31 ? 1.582   6.601   -11.516 1.00 12.59 ? 1031 THR A CB  1 
ATOM   266 O  OG1 . THR A 1 31 ? 0.619   5.841   -10.770 1.00 12.89 ? 1031 THR A OG1 1 
ATOM   267 C  CG2 . THR A 1 31 ? 2.432   5.672   -12.380 1.00 12.92 ? 1031 THR A CG2 1 
ATOM   268 N  N   A VAL A 1 32 ? 4.771   7.763   -10.949 0.70 12.15 ? 1032 VAL A N   1 
ATOM   269 N  N   B VAL A 1 32 ? 4.760   7.710   -10.956 0.30 12.39 ? 1032 VAL A N   1 
ATOM   270 C  CA  A VAL A 1 32 ? 5.918   8.409   -11.571 0.70 13.09 ? 1032 VAL A CA  1 
ATOM   271 C  CA  B VAL A 1 32 ? 5.981   8.344   -11.445 0.30 12.68 ? 1032 VAL A CA  1 
ATOM   272 C  C   A VAL A 1 32 ? 6.925   7.359   -12.010 0.70 12.92 ? 1032 VAL A C   1 
ATOM   273 C  C   B VAL A 1 32 ? 6.878   7.263   -12.034 0.30 12.96 ? 1032 VAL A C   1 
ATOM   274 O  O   A VAL A 1 32 ? 7.331   6.496   -11.227 0.70 12.87 ? 1032 VAL A O   1 
ATOM   275 O  O   B VAL A 1 32 ? 7.169   6.269   -11.366 0.30 12.94 ? 1032 VAL A O   1 
ATOM   276 C  CB  A VAL A 1 32 ? 6.548   9.486   -10.647 0.70 14.61 ? 1032 VAL A CB  1 
ATOM   277 C  CB  B VAL A 1 32 ? 6.747   9.046   -10.296 0.30 12.47 ? 1032 VAL A CB  1 
ATOM   278 C  CG1 A VAL A 1 32 ? 6.978   8.900   -9.349  0.70 17.31 ? 1032 VAL A CG1 1 
ATOM   279 C  CG1 B VAL A 1 32 ? 5.836   10.036  -9.583  0.30 8.66  ? 1032 VAL A CG1 1 
ATOM   280 C  CG2 A VAL A 1 32 ? 7.709   10.196  -11.321 0.70 12.28 ? 1032 VAL A CG2 1 
ATOM   281 C  CG2 B VAL A 1 32 ? 7.303   8.026   -9.302  0.30 16.38 ? 1032 VAL A CG2 1 
ATOM   282 N  N   . LEU A 1 33 ? 7.298   7.439   -13.284 1.00 13.10 ? 1033 LEU A N   1 
ATOM   283 C  CA  . LEU A 1 33 ? 8.147   6.461   -13.928 1.00 14.17 ? 1033 LEU A CA  1 
ATOM   284 C  C   . LEU A 1 33 ? 9.353   7.126   -14.549 1.00 13.00 ? 1033 LEU A C   1 
ATOM   285 O  O   . LEU A 1 33 ? 9.308   8.297   -14.932 1.00 13.42 ? 1033 LEU A O   1 
ATOM   286 C  CB  . LEU A 1 33 ? 7.395   5.688   -15.011 1.00 15.29 ? 1033 LEU A CB  1 
ATOM   287 C  CG  . LEU A 1 33 ? 6.117   4.964   -14.588 1.00 16.35 ? 1033 LEU A CG  1 
ATOM   288 C  CD1 . LEU A 1 33 ? 5.488   4.344   -15.813 1.00 19.71 ? 1033 LEU A CD1 1 
ATOM   289 C  CD2 . LEU A 1 33 ? 6.397   3.916   -13.543 1.00 17.79 ? 1033 LEU A CD2 1 
ATOM   290 N  N   . GLU A 1 34 ? 10.412  6.335   -14.667 1.00 14.91 ? 1034 GLU A N   1 
ATOM   291 C  CA  . GLU A 1 34 ? 11.649  6.722   -15.305 1.00 16.85 ? 1034 GLU A CA  1 
ATOM   292 C  C   . GLU A 1 34 ? 11.415  7.191   -16.728 1.00 16.41 ? 1034 GLU A C   1 
ATOM   293 O  O   . GLU A 1 34 ? 10.402  6.868   -17.339 1.00 17.10 ? 1034 GLU A O   1 
ATOM   294 C  CB  . GLU A 1 34 ? 12.580  5.502   -15.338 1.00 17.83 ? 1034 GLU A CB  1 
ATOM   295 C  CG  . GLU A 1 34 ? 12.010  4.347   -16.172 0.50 19.16 ? 1034 GLU A CG  1 
ATOM   296 C  CD  . GLU A 1 34 ? 12.936  3.146   -16.274 0.50 19.80 ? 1034 GLU A CD  1 
ATOM   297 O  OE1 . GLU A 1 34 ? 12.768  2.201   -15.487 0.50 18.67 ? 1034 GLU A OE1 1 
ATOM   298 O  OE2 . GLU A 1 34 ? 13.816  3.133   -17.159 0.50 22.79 ? 1034 GLU A OE2 1 
ATOM   299 N  N   . GLU A 1 35 ? 12.382  7.930   -17.253 1.00 16.91 ? 1035 GLU A N   1 
ATOM   300 C  CA  . GLU A 1 35 ? 12.315  8.448   -18.609 1.00 16.51 ? 1035 GLU A CA  1 
ATOM   301 C  C   . GLU A 1 35 ? 11.880  7.394   -19.622 1.00 17.05 ? 1035 GLU A C   1 
ATOM   302 O  O   . GLU A 1 35 ? 12.416  6.280   -19.669 1.00 17.38 ? 1035 GLU A O   1 
ATOM   303 C  CB  . GLU A 1 35 ? 13.657  9.061   -19.019 1.00 18.17 ? 1035 GLU A CB  1 
ATOM   304 C  CG  . GLU A 1 35 ? 13.614  9.745   -20.373 1.00 19.28 ? 1035 GLU A CG  1 
ATOM   305 C  CD  . GLU A 1 35 ? 12.521  10.790  -20.447 1.00 20.88 ? 1035 GLU A CD  1 
ATOM   306 O  OE1 . GLU A 1 35 ? 12.494  11.678  -19.575 1.00 19.60 ? 1035 GLU A OE1 1 
ATOM   307 O  OE2 . GLU A 1 35 ? 11.676  10.723  -21.362 1.00 22.20 ? 1035 GLU A OE2 1 
ATOM   308 N  N   A MET A 1 36 ? 10.902  7.766   -20.437 0.50 15.39 ? 1036 MET A N   1 
ATOM   309 N  N   B MET A 1 36 ? 10.890  7.761   -20.426 0.50 15.52 ? 1036 MET A N   1 
ATOM   310 C  CA  A MET A 1 36 ? 10.399  6.914   -21.504 0.50 15.77 ? 1036 MET A CA  1 
ATOM   311 C  CA  B MET A 1 36 ? 10.355  6.906   -21.477 0.50 15.82 ? 1036 MET A CA  1 
ATOM   312 C  C   A MET A 1 36 ? 9.513   7.750   -22.416 0.50 15.62 ? 1036 MET A C   1 
ATOM   313 C  C   B MET A 1 36 ? 9.604   7.791   -22.459 0.50 15.79 ? 1036 MET A C   1 
ATOM   314 O  O   A MET A 1 36 ? 9.081   8.840   -22.043 0.50 15.37 ? 1036 MET A O   1 
ATOM   315 O  O   B MET A 1 36 ? 9.378   8.970   -22.186 0.50 16.48 ? 1036 MET A O   1 
ATOM   316 C  CB  A MET A 1 36 ? 9.602   5.748   -20.924 0.50 14.90 ? 1036 MET A CB  1 
ATOM   317 C  CB  B MET A 1 36 ? 9.413   5.858   -20.888 0.50 15.17 ? 1036 MET A CB  1 
ATOM   318 C  CG  A MET A 1 36 ? 8.306   6.157   -20.244 0.50 14.19 ? 1036 MET A CG  1 
ATOM   319 C  CG  B MET A 1 36 ? 8.222   6.442   -20.145 0.50 14.78 ? 1036 MET A CG  1 
ATOM   320 S  SD  A MET A 1 36 ? 7.331   4.743   -19.705 0.50 17.44 ? 1036 MET A SD  1 
ATOM   321 S  SD  B MET A 1 36 ? 7.078   5.191   -19.521 0.50 16.00 ? 1036 MET A SD  1 
ATOM   322 C  CE  A MET A 1 36 ? 6.954   3.994   -21.288 0.50 18.73 ? 1036 MET A CE  1 
ATOM   323 C  CE  B MET A 1 36 ? 8.130   4.289   -18.388 0.50 18.31 ? 1036 MET A CE  1 
ATOM   324 N  N   . ASN A 1 37 ? 9.225   7.224   -23.600 1.00 15.55 ? 1037 ASN A N   1 
ATOM   325 C  CA  . ASN A 1 37 ? 8.412   7.929   -24.570 1.00 15.44 ? 1037 ASN A CA  1 
ATOM   326 C  C   . ASN A 1 37 ? 6.945   7.554   -24.397 1.00 15.31 ? 1037 ASN A C   1 
ATOM   327 O  O   . ASN A 1 37 ? 6.594   6.369   -24.430 1.00 17.25 ? 1037 ASN A O   1 
ATOM   328 C  CB  . ASN A 1 37 ? 8.862   7.575   -25.987 1.00 16.89 ? 1037 ASN A CB  1 
ATOM   329 C  CG  . ASN A 1 37 ? 10.246  8.069   -26.297 1.00 20.61 ? 1037 ASN A CG  1 
ATOM   330 O  OD1 . ASN A 1 37 ? 10.691  9.088   -25.763 1.00 22.41 ? 1037 ASN A OD1 1 
ATOM   331 N  ND2 . ASN A 1 37 ? 10.948  7.347   -27.165 1.00 28.24 ? 1037 ASN A ND2 1 
ATOM   332 N  N   . LEU A 1 38 ? 6.097   8.560   -24.204 1.00 13.89 ? 1038 LEU A N   1 
ATOM   333 C  CA  . LEU A 1 38 ? 4.661   8.358   -24.159 1.00 14.04 ? 1038 LEU A CA  1 
ATOM   334 C  C   . LEU A 1 38 ? 3.963   9.306   -25.121 1.00 13.84 ? 1038 LEU A C   1 
ATOM   335 O  O   . LEU A 1 38 ? 4.466   10.394  -25.399 1.00 14.86 ? 1038 LEU A O   1 
ATOM   336 C  CB  . LEU A 1 38 ? 4.131   8.592   -22.746 1.00 13.06 ? 1038 LEU A CB  1 
ATOM   337 C  CG  . LEU A 1 38 ? 4.577   7.597   -21.678 1.00 12.27 ? 1038 LEU A CG  1 
ATOM   338 C  CD1 . LEU A 1 38 ? 3.971   8.010   -20.349 1.00 13.35 ? 1038 LEU A CD1 1 
ATOM   339 C  CD2 . LEU A 1 38 ? 4.179   6.188   -22.024 1.00 14.19 ? 1038 LEU A CD2 1 
ATOM   340 N  N   . PRO A 1 39 ? 2.794   8.886   -25.616 1.00 14.62 ? 1039 PRO A N   1 
ATOM   341 C  CA  . PRO A 1 39 ? 2.040   9.687   -26.562 1.00 14.78 ? 1039 PRO A CA  1 
ATOM   342 C  C   . PRO A 1 39 ? 1.252   10.817  -25.930 1.00 13.75 ? 1039 PRO A C   1 
ATOM   343 O  O   . PRO A 1 39 ? 0.868   10.741  -24.754 1.00 14.73 ? 1039 PRO A O   1 
ATOM   344 C  CB  . PRO A 1 39 ? 1.097   8.666   -27.185 1.00 15.80 ? 1039 PRO A CB  1 
ATOM   345 C  CG  . PRO A 1 39 ? 0.832   7.707   -26.094 1.00 16.13 ? 1039 PRO A CG  1 
ATOM   346 C  CD  . PRO A 1 39 ? 2.129   7.603   -25.339 1.00 15.67 ? 1039 PRO A CD  1 
ATOM   347 N  N   . GLY A 1 40 ? 0.978   11.845  -26.734 1.00 13.77 ? 1040 GLY A N   1 
ATOM   348 C  CA  . GLY A 1 40 ? 0.050   12.885  -26.335 1.00 14.59 ? 1040 GLY A CA  1 
ATOM   349 C  C   . GLY A 1 40 ? 0.749   14.143  -25.860 1.00 14.67 ? 1040 GLY A C   1 
ATOM   350 O  O   . GLY A 1 40 ? 1.984   14.262  -25.887 1.00 15.96 ? 1040 GLY A O   1 
ATOM   351 N  N   . ARG A 1 41 ? -0.074  15.078  -25.424 1.00 14.99 ? 1041 ARG A N   1 
ATOM   352 C  CA  . ARG A 1 41 ? 0.386   16.367  -24.942 1.00 15.46 ? 1041 ARG A CA  1 
ATOM   353 C  C   . ARG A 1 41 ? 0.778   16.225  -23.490 1.00 16.10 ? 1041 ARG A C   1 
ATOM   354 O  O   . ARG A 1 41 ? 0.031   15.689  -22.699 1.00 21.70 ? 1041 ARG A O   1 
ATOM   355 C  CB  . ARG A 1 41 ? -0.741  17.394  -25.071 1.00 17.13 ? 1041 ARG A CB  1 
ATOM   356 C  CG  . ARG A 1 41 ? -0.325  18.819  -24.765 1.00 20.09 ? 1041 ARG A CG  1 
ATOM   357 C  CD  . ARG A 1 41 ? -1.514  19.768  -24.795 1.00 23.32 ? 1041 ARG A CD  1 
ATOM   358 N  NE  . ARG A 1 41 ? -2.229  19.735  -26.069 0.75 28.06 ? 1041 ARG A NE  1 
ATOM   359 C  CZ  . ARG A 1 41 ? -3.393  19.121  -26.279 0.75 26.08 ? 1041 ARG A CZ  1 
ATOM   360 N  NH1 . ARG A 1 41 ? -4.023  18.470  -25.300 0.75 28.15 ? 1041 ARG A NH1 1 
ATOM   361 N  NH2 . ARG A 1 41 ? -3.936  19.168  -27.480 0.75 28.99 ? 1041 ARG A NH2 1 
ATOM   362 N  N   . TRP A 1 42 ? 1.949   16.696  -23.141 1.00 15.19 ? 1042 TRP A N   1 
ATOM   363 C  CA  . TRP A 1 42 ? 2.333   16.695  -21.750 1.00 14.01 ? 1042 TRP A CA  1 
ATOM   364 C  C   . TRP A 1 42 ? 2.488   18.129  -21.286 1.00 14.54 ? 1042 TRP A C   1 
ATOM   365 O  O   . TRP A 1 42 ? 2.566   19.068  -22.100 1.00 14.57 ? 1042 TRP A O   1 
ATOM   366 C  CB  . TRP A 1 42 ? 3.633   15.924  -21.538 1.00 14.55 ? 1042 TRP A CB  1 
ATOM   367 C  CG  . TRP A 1 42 ? 4.771   16.444  -22.359 1.00 15.07 ? 1042 TRP A CG  1 
ATOM   368 C  CD1 . TRP A 1 42 ? 5.108   16.051  -23.613 1.00 17.13 ? 1042 TRP A CD1 1 
ATOM   369 C  CD2 . TRP A 1 42 ? 5.719   17.448  -21.983 1.00 14.60 ? 1042 TRP A CD2 1 
ATOM   370 N  NE1 . TRP A 1 42 ? 6.209   16.748  -24.049 1.00 18.65 ? 1042 TRP A NE1 1 
ATOM   371 C  CE2 . TRP A 1 42 ? 6.612   17.604  -23.062 1.00 16.37 ? 1042 TRP A CE2 1 
ATOM   372 C  CE3 . TRP A 1 42 ? 5.920   18.212  -20.827 1.00 14.81 ? 1042 TRP A CE3 1 
ATOM   373 C  CZ2 . TRP A 1 42 ? 7.670   18.506  -23.035 1.00 16.81 ? 1042 TRP A CZ2 1 
ATOM   374 C  CZ3 . TRP A 1 42 ? 6.971   19.108  -20.802 1.00 17.08 ? 1042 TRP A CZ3 1 
ATOM   375 C  CH2 . TRP A 1 42 ? 7.834   19.246  -21.902 1.00 16.90 ? 1042 TRP A CH2 1 
ATOM   376 N  N   . LYS A 1 43 ? 2.543   18.293  -19.971 1.00 13.87 ? 1043 LYS A N   1 
ATOM   377 C  CA  . LYS A 1 43 ? 2.879   19.580  -19.388 1.00 15.27 ? 1043 LYS A CA  1 
ATOM   378 C  C   . LYS A 1 43 ? 3.778   19.325  -18.198 1.00 15.23 ? 1043 LYS A C   1 
ATOM   379 O  O   . LYS A 1 43 ? 3.681   18.277  -17.578 1.00 14.15 ? 1043 LYS A O   1 
ATOM   380 C  CB  . LYS A 1 43 ? 1.615   20.329  -18.959 1.00 17.09 ? 1043 LYS A CB  1 
ATOM   381 C  CG  . LYS A 1 43 ? 0.786   19.613  -17.919 1.00 19.15 ? 1043 LYS A CG  1 
ATOM   382 C  CD  . LYS A 1 43 ? -0.476  20.383  -17.574 1.00 21.58 ? 1043 LYS A CD  1 
ATOM   383 C  CE  . LYS A 1 43 ? -1.401  19.555  -16.688 1.00 24.21 ? 1043 LYS A CE  1 
ATOM   384 N  NZ  . LYS A 1 43 ? -2.628  20.302  -16.291 1.00 27.18 ? 1043 LYS A NZ  1 
ATOM   385 N  N   . PRO A 1 44 ? 4.672   20.271  -17.889 1.00 15.32 ? 1044 PRO A N   1 
ATOM   386 C  CA  . PRO A 1 44 ? 5.520   20.056  -16.725 1.00 15.44 ? 1044 PRO A CA  1 
ATOM   387 C  C   . PRO A 1 44 ? 4.709   20.127  -15.432 1.00 17.59 ? 1044 PRO A C   1 
ATOM   388 O  O   . PRO A 1 44 ? 3.715   20.847  -15.351 1.00 19.24 ? 1044 PRO A O   1 
ATOM   389 C  CB  . PRO A 1 44 ? 6.537   21.196  -16.816 1.00 17.63 ? 1044 PRO A CB  1 
ATOM   390 C  CG  . PRO A 1 44 ? 5.915   22.215  -17.652 1.00 17.69 ? 1044 PRO A CG  1 
ATOM   391 C  CD  . PRO A 1 44 ? 4.986   21.529  -18.585 1.00 16.48 ? 1044 PRO A CD  1 
ATOM   392 N  N   . LYS A 1 45 ? 5.139   19.365  -14.437 1.00 16.40 ? 1045 LYS A N   1 
ATOM   393 C  CA  . LYS A 1 45 ? 4.500   19.346  -13.113 1.00 16.50 ? 1045 LYS A CA  1 
ATOM   394 C  C   . LYS A 1 45 ? 5.614   19.304  -12.076 1.00 15.64 ? 1045 LYS A C   1 
ATOM   395 O  O   . LYS A 1 45 ? 6.574   18.572  -12.245 1.00 15.12 ? 1045 LYS A O   1 
ATOM   396 C  CB  . LYS A 1 45 ? 3.606   18.111  -12.944 1.00 17.25 ? 1045 LYS A CB  1 
ATOM   397 C  CG  . LYS A 1 45 ? 2.801   18.073  -11.635 1.00 18.22 ? 1045 LYS A CG  1 
ATOM   398 C  CD  . LYS A 1 45 ? 2.038   16.738  -11.453 1.00 21.10 ? 1045 LYS A CD  1 
ATOM   399 C  CE  . LYS A 1 45 ? 1.155   16.730  -10.209 1.00 24.19 ? 1045 LYS A CE  1 
ATOM   400 N  NZ  . LYS A 1 45 ? 0.267   17.921  -10.141 1.00 31.39 ? 1045 LYS A NZ  1 
ATOM   401 N  N   . MET A 1 46 ? 5.490   20.101  -11.018 1.00 16.00 ? 1046 MET A N   1 
ATOM   402 C  CA  . MET A 1 46 ? 6.432   20.051  -9.906  1.00 15.48 ? 1046 MET A CA  1 
ATOM   403 C  C   . MET A 1 46 ? 5.869   19.141  -8.841  1.00 14.46 ? 1046 MET A C   1 
ATOM   404 O  O   . MET A 1 46 ? 4.739   19.329  -8.377  1.00 19.42 ? 1046 MET A O   1 
ATOM   405 C  CB  . MET A 1 46 ? 6.674   21.450  -9.338  1.00 16.31 ? 1046 MET A CB  1 
ATOM   406 C  CG  . MET A 1 46 ? 7.174   22.467  -10.346 1.00 17.75 ? 1046 MET A CG  1 
ATOM   407 S  SD  . MET A 1 46 ? 8.662   21.994  -11.261 1.00 19.69 ? 1046 MET A SD  1 
ATOM   408 C  CE  . MET A 1 46 ? 9.848   21.836  -9.945  1.00 19.17 ? 1046 MET A CE  1 
ATOM   409 N  N   . ILE A 1 47 ? 6.632   18.122  -8.482  1.00 14.00 ? 1047 ILE A N   1 
ATOM   410 C  CA  . ILE A 1 47 ? 6.203   17.189  -7.459  1.00 14.40 ? 1047 ILE A CA  1 
ATOM   411 C  C   . ILE A 1 47 ? 7.178   17.149  -6.303  1.00 13.96 ? 1047 ILE A C   1 
ATOM   412 O  O   . ILE A 1 47 ? 8.275   17.663  -6.372  1.00 14.63 ? 1047 ILE A O   1 
ATOM   413 C  CB  . ILE A 1 47 ? 5.971   15.766  -8.008  1.00 14.32 ? 1047 ILE A CB  1 
ATOM   414 C  CG1 . ILE A 1 47 ? 7.255   15.159  -8.559  1.00 15.43 ? 1047 ILE A CG1 1 
ATOM   415 C  CG2 . ILE A 1 47 ? 4.853   15.769  -9.049  1.00 18.08 ? 1047 ILE A CG2 1 
ATOM   416 C  CD1 . ILE A 1 47 ? 7.143   13.683  -8.920  1.00 16.46 ? 1047 ILE A CD1 1 
ATOM   417 N  N   . GLY A 1 48 ? 6.749   16.529  -5.219  1.00 14.44 ? 1048 GLY A N   1 
ATOM   418 C  CA  . GLY A 1 48 ? 7.570   16.455  -4.033  1.00 15.18 ? 1048 GLY A CA  1 
ATOM   419 C  C   . GLY A 1 48 ? 7.185   17.573  -3.093  1.00 15.22 ? 1048 GLY A C   1 
ATOM   420 O  O   . GLY A 1 48 ? 6.028   17.670  -2.691  1.00 19.87 ? 1048 GLY A O   1 
ATOM   421 N  N   . GLY A 1 49 ? 8.156   18.405  -2.740  1.00 14.62 ? 1049 GLY A N   1 
ATOM   422 C  CA  . GLY A 1 49 ? 7.912   19.557  -1.879  1.00 14.81 ? 1049 GLY A CA  1 
ATOM   423 C  C   . GLY A 1 49 ? 8.655   19.467  -0.557  1.00 15.07 ? 1049 GLY A C   1 
ATOM   424 O  O   . GLY A 1 49 ? 8.983   20.482  0.047   1.00 16.24 ? 1049 GLY A O   1 
ATOM   425 N  N   . ILE A 1 50 ? 8.909   18.248  -0.092  1.00 15.58 ? 1050 ILE A N   1 
ATOM   426 C  CA  . ILE A 1 50 ? 9.597   18.059  1.187   1.00 16.35 ? 1050 ILE A CA  1 
ATOM   427 C  C   . ILE A 1 50 ? 11.097  18.109  0.934   1.00 16.38 ? 1050 ILE A C   1 
ATOM   428 O  O   . ILE A 1 50 ? 11.712  17.124  0.520   1.00 19.61 ? 1050 ILE A O   1 
ATOM   429 C  CB  . ILE A 1 50 ? 9.215   16.716  1.845   1.00 18.50 ? 1050 ILE A CB  1 
ATOM   430 C  CG1 . ILE A 1 50 ? 7.698   16.580  1.962   1.00 20.74 ? 1050 ILE A CG1 1 
ATOM   431 C  CG2 . ILE A 1 50 ? 9.850   16.591  3.211   1.00 18.00 ? 1050 ILE A CG2 1 
ATOM   432 C  CD1 . ILE A 1 50 ? 7.245   15.252  2.578   0.50 19.57 ? 1050 ILE A CD1 1 
ATOM   433 N  N   . GLY A 1 51 ? 11.677  19.279  1.144   1.00 15.03 ? 1051 GLY A N   1 
ATOM   434 C  CA  . GLY A 1 51 ? 13.079  19.505  0.826   1.00 14.65 ? 1051 GLY A CA  1 
ATOM   435 C  C   . GLY A 1 51 ? 13.293  20.217  -0.497  1.00 13.25 ? 1051 GLY A C   1 
ATOM   436 O  O   . GLY A 1 51 ? 14.395  20.653  -0.810  1.00 14.34 ? 1051 GLY A O   1 
ATOM   437 N  N   . GLY A 1 52 ? 12.235  20.332  -1.287  1.00 12.12 ? 1052 GLY A N   1 
ATOM   438 C  CA  . GLY A 1 52 ? 12.365  20.865  -2.636  1.00 12.53 ? 1052 GLY A CA  1 
ATOM   439 C  C   . GLY A 1 52 ? 11.437  20.145  -3.582  1.00 11.85 ? 1052 GLY A C   1 
ATOM   440 O  O   . GLY A 1 52 ? 10.749  19.208  -3.186  1.00 13.34 ? 1052 GLY A O   1 
ATOM   441 N  N   . PHE A 1 53 ? 11.402  20.600  -4.830  1.00 12.06 ? 1053 PHE A N   1 
ATOM   442 C  CA  . PHE A 1 53 ? 10.529  20.013  -5.840  1.00 11.96 ? 1053 PHE A CA  1 
ATOM   443 C  C   . PHE A 1 53 ? 11.335  19.443  -6.977  1.00 11.96 ? 1053 PHE A C   1 
ATOM   444 O  O   . PHE A 1 53 ? 12.431  19.902  -7.269  1.00 12.05 ? 1053 PHE A O   1 
ATOM   445 C  CB  . PHE A 1 53 ? 9.575   21.051  -6.420  1.00 12.90 ? 1053 PHE A CB  1 
ATOM   446 C  CG  . PHE A 1 53 ? 8.561   21.565  -5.443  1.00 15.25 ? 1053 PHE A CG  1 
ATOM   447 C  CD1 . PHE A 1 53 ? 8.793   22.727  -4.738  1.00 15.40 ? 1053 PHE A CD1 1 
ATOM   448 C  CD2 . PHE A 1 53 ? 7.367   20.897  -5.258  1.00 15.02 ? 1053 PHE A CD2 1 
ATOM   449 C  CE1 . PHE A 1 53 ? 7.847   23.214  -3.847  1.00 16.34 ? 1053 PHE A CE1 1 
ATOM   450 C  CE2 . PHE A 1 53 ? 6.419   21.381  -4.370  1.00 17.08 ? 1053 PHE A CE2 1 
ATOM   451 C  CZ  . PHE A 1 53 ? 6.670   22.531  -3.667  1.00 16.25 ? 1053 PHE A CZ  1 
ATOM   452 N  N   . ILE A 1 54 ? 10.729  18.491  -7.666  1.00 12.40 ? 1054 ILE A N   1 
ATOM   453 C  CA  . ILE A 1 54 ? 11.303  17.850  -8.840  1.00 12.20 ? 1054 ILE A CA  1 
ATOM   454 C  C   . ILE A 1 54 ? 10.316  18.107  -9.989  1.00 11.71 ? 1054 ILE A C   1 
ATOM   455 O  O   . ILE A 1 54 ? 9.167   18.005  -9.833  1.00 12.09 ? 1054 ILE A O   1 
ATOM   456 C  CB  . ILE A 1 54 ? 11.412  16.333  -8.609  1.00 14.16 ? 1054 ILE A CB  1 
ATOM   457 C  CG1 . ILE A 1 54 ? 12.186  15.991  -7.339  1.00 14.38 ? 1054 ILE A CG1 1 
ATOM   458 C  CG2 . ILE A 1 54 ? 11.968  15.639  -9.774  1.00 14.52 ? 1054 ILE A CG2 1 
ATOM   459 C  CD1 . ILE A 1 54 ? 13.410  16.353  -7.443  1.00 16.41 ? 1054 ILE A CD1 1 
ATOM   460 N  N   . LYS A 1 55 ? 10.857  18.461  -11.137 1.00 12.26 ? 1055 LYS A N   1 
ATOM   461 C  CA  . LYS A 1 55 ? 10.032  18.636  -12.325 1.00 12.62 ? 1055 LYS A CA  1 
ATOM   462 C  C   . LYS A 1 55 ? 9.918   17.326  -13.089 1.00 11.83 ? 1055 LYS A C   1 
ATOM   463 O  O   . LYS A 1 55 ? 10.911  16.623  -13.309 1.00 13.01 ? 1055 LYS A O   1 
ATOM   464 C  CB  . LYS A 1 55 ? 10.621  19.724  -13.227 1.00 13.82 ? 1055 LYS A CB  1 
ATOM   465 C  CG  . LYS A 1 55 ? 9.733   20.151  -14.370 1.00 13.71 ? 1055 LYS A CG  1 
ATOM   466 C  CD  . LYS A 1 55 ? 10.423  21.145  -15.319 1.00 14.79 ? 1055 LYS A CD  1 
ATOM   467 C  CE  . LYS A 1 55 ? 10.721  22.474  -14.651 1.00 18.80 ? 1055 LYS A CE  1 
ATOM   468 N  NZ  . LYS A 1 55 ? 11.497  23.344  -15.579 1.00 22.34 ? 1055 LYS A NZ  1 
ATOM   469 N  N   . VAL A 1 56 ? 8.685   17.013  -13.480 1.00 11.76 ? 1056 VAL A N   1 
ATOM   470 C  CA  . VAL A 1 56 ? 8.383   15.821  -14.264 1.00 11.17 ? 1056 VAL A CA  1 
ATOM   471 C  C   . VAL A 1 56 ? 7.428   16.233  -15.390 1.00 12.18 ? 1056 VAL A C   1 
ATOM   472 O  O   . VAL A 1 56 ? 6.913   17.349  -15.392 1.00 12.49 ? 1056 VAL A O   1 
ATOM   473 C  CB  . VAL A 1 56 ? 7.743   14.694  -13.388 1.00 12.04 ? 1056 VAL A CB  1 
ATOM   474 C  CG1 . VAL A 1 56 ? 8.715   14.250  -12.332 1.00 14.73 ? 1056 VAL A CG1 1 
ATOM   475 C  CG2 . VAL A 1 56 ? 6.431   15.151  -12.765 1.00 13.74 ? 1056 VAL A CG2 1 
ATOM   476 N  N   . ARG A 1 57 ? 7.203   15.342  -16.351 1.00 11.01 ? 1057 ARG A N   1 
ATOM   477 C  CA  . ARG A 1 57 ? 6.234   15.593  -17.411 1.00 11.27 ? 1057 ARG A CA  1 
ATOM   478 C  C   . ARG A 1 57 ? 4.957   14.818  -17.125 1.00 11.28 ? 1057 ARG A C   1 
ATOM   479 O  O   . ARG A 1 57 ? 5.007   13.615  -16.876 1.00 11.56 ? 1057 ARG A O   1 
ATOM   480 C  CB  . ARG A 1 57 ? 6.799   15.111  -18.737 1.00 11.64 ? 1057 ARG A CB  1 
ATOM   481 C  CG  . ARG A 1 57 ? 8.116   15.750  -19.105 1.00 12.94 ? 1057 ARG A CG  1 
ATOM   482 C  CD  . ARG A 1 57 ? 8.470   15.592  -20.575 1.00 13.76 ? 1057 ARG A CD  1 
ATOM   483 N  NE  . ARG A 1 57 ? 8.387   14.228  -21.076 1.00 14.22 ? 1057 ARG A NE  1 
ATOM   484 C  CZ  . ARG A 1 57 ? 9.286   13.280  -20.848 1.00 14.78 ? 1057 ARG A CZ  1 
ATOM   485 N  NH1 . ARG A 1 57 ? 10.325  13.526  -20.074 1.00 15.12 ? 1057 ARG A NH1 1 
ATOM   486 N  NH2 . ARG A 1 57 ? 9.137   12.075  -21.383 1.00 17.44 ? 1057 ARG A NH2 1 
ATOM   487 N  N   . GLN A 1 58 ? 3.825   15.507  -17.165 1.00 10.96 ? 1058 GLN A N   1 
ATOM   488 C  CA  . GLN A 1 58 ? 2.539   14.883  -16.918 1.00 11.38 ? 1058 GLN A CA  1 
ATOM   489 C  C   . GLN A 1 58 ? 1.849   14.474  -18.221 1.00 11.18 ? 1058 GLN A C   1 
ATOM   490 O  O   . GLN A 1 58 ? 1.522   15.328  -19.050 1.00 12.31 ? 1058 GLN A O   1 
ATOM   491 C  CB  . GLN A 1 58 ? 1.633   15.848  -16.168 1.00 11.63 ? 1058 GLN A CB  1 
ATOM   492 C  CG  . GLN A 1 58 ? 0.277   15.265  -15.866 1.00 12.36 ? 1058 GLN A CG  1 
ATOM   493 C  CD  . GLN A 1 58 ? -0.622  16.192  -15.119 1.00 14.07 ? 1058 GLN A CD  1 
ATOM   494 O  OE1 . GLN A 1 58 ? -0.167  17.042  -14.353 1.00 19.04 ? 1058 GLN A OE1 1 
ATOM   495 N  NE2 . GLN A 1 58 ? -1.922  16.026  -15.319 1.00 16.66 ? 1058 GLN A NE2 1 
ATOM   496 N  N   . TYR A 1 59 ? 1.610   13.176  -18.373 1.00 10.85 ? 1059 TYR A N   1 
ATOM   497 C  CA  . TYR A 1 59 ? 0.851   12.622  -19.496 1.00 11.16 ? 1059 TYR A CA  1 
ATOM   498 C  C   . TYR A 1 59 ? -0.450  12.067  -18.956 1.00 11.05 ? 1059 TYR A C   1 
ATOM   499 O  O   . TYR A 1 59 ? -0.442  11.263  -18.025 1.00 12.44 ? 1059 TYR A O   1 
ATOM   500 C  CB  . TYR A 1 59 ? 1.605   11.472  -20.160 1.00 11.37 ? 1059 TYR A CB  1 
ATOM   501 C  CG  . TYR A 1 59 ? 2.896   11.853  -20.846 1.00 11.90 ? 1059 TYR A CG  1 
ATOM   502 C  CD1 . TYR A 1 59 ? 4.085   11.929  -20.130 1.00 11.20 ? 1059 TYR A CD1 1 
ATOM   503 C  CD2 . TYR A 1 59 ? 2.927   12.136  -22.198 1.00 11.51 ? 1059 TYR A CD2 1 
ATOM   504 C  CE1 . TYR A 1 59 ? 5.268   12.259  -20.758 1.00 12.46 ? 1059 TYR A CE1 1 
ATOM   505 C  CE2 . TYR A 1 59 ? 4.110   12.469  -22.834 1.00 12.53 ? 1059 TYR A CE2 1 
ATOM   506 C  CZ  . TYR A 1 59 ? 5.276   12.539  -22.102 1.00 11.70 ? 1059 TYR A CZ  1 
ATOM   507 O  OH  . TYR A 1 59 ? 6.464   12.863  -22.716 1.00 14.88 ? 1059 TYR A OH  1 
ATOM   508 N  N   . ASP A 1 60 ? -1.565  12.466  -19.560 1.00 11.77 ? 1060 ASP A N   1 
ATOM   509 C  CA  . ASP A 1 60 ? -2.867  11.968  -19.152 1.00 12.56 ? 1060 ASP A CA  1 
ATOM   510 C  C   . ASP A 1 60 ? -3.354  10.823  -20.037 1.00 13.24 ? 1060 ASP A C   1 
ATOM   511 O  O   . ASP A 1 60 ? -2.886  10.637  -21.169 1.00 13.26 ? 1060 ASP A O   1 
ATOM   512 C  CB  . ASP A 1 60 ? -3.885  13.110  -19.135 1.00 13.30 ? 1060 ASP A CB  1 
ATOM   513 C  CG  . ASP A 1 60 ? -3.501  14.211  -18.146 1.00 15.58 ? 1060 ASP A CG  1 
ATOM   514 O  OD1 . ASP A 1 60 ? -3.050  13.880  -17.030 1.00 16.05 ? 1060 ASP A OD1 1 
ATOM   515 O  OD2 . ASP A 1 60 ? -3.608  15.395  -18.509 1.00 24.28 ? 1060 ASP A OD2 1 
ATOM   516 N  N   . GLN A 1 61 ? -4.268  10.039  -19.471 1.00 12.94 ? 1061 GLN A N   1 
ATOM   517 C  CA  . GLN A 1 61 ? -4.958  8.976   -20.180 1.00 14.64 ? 1061 GLN A CA  1 
ATOM   518 C  C   . GLN A 1 61 ? -4.016  8.017   -20.918 1.00 12.97 ? 1061 GLN A C   1 
ATOM   519 O  O   . GLN A 1 61 ? -4.184  7.706   -22.099 1.00 14.67 ? 1061 GLN A O   1 
ATOM   520 C  CB  . GLN A 1 61 ? -6.028  9.560   -21.095 1.00 16.87 ? 1061 GLN A CB  1 
ATOM   521 C  CG  . GLN A 1 61 ? -7.173  10.190  -20.308 1.00 20.90 ? 1061 GLN A CG  1 
ATOM   522 C  CD  . GLN A 1 61 ? -8.406  10.500  -21.154 0.50 17.19 ? 1061 GLN A CD  1 
ATOM   523 O  OE1 . GLN A 1 61 ? -8.559  10.000  -22.266 0.50 23.74 ? 1061 GLN A OE1 1 
ATOM   524 N  NE2 . GLN A 1 61 ? -9.280  11.341  -20.627 0.50 20.78 ? 1061 GLN A NE2 1 
ATOM   525 N  N   . ILE A 1 62 ? -3.047  7.519   -20.158 1.00 12.00 ? 1062 ILE A N   1 
ATOM   526 C  CA  . ILE A 1 62 ? -2.108  6.503   -20.620 1.00 12.03 ? 1062 ILE A CA  1 
ATOM   527 C  C   . ILE A 1 62 ? -2.554  5.120   -20.155 1.00 12.28 ? 1062 ILE A C   1 
ATOM   528 O  O   . ILE A 1 62 ? -2.961  4.929   -18.997 1.00 13.82 ? 1062 ILE A O   1 
ATOM   529 C  CB  . ILE A 1 62 ? -0.698  6.802   -20.055 1.00 11.69 ? 1062 ILE A CB  1 
ATOM   530 C  CG1 . ILE A 1 62 ? -0.227  8.178   -20.540 1.00 12.25 ? 1062 ILE A CG1 1 
ATOM   531 C  CG2 . ILE A 1 62 ? 0.264   5.690   -20.404 1.00 12.93 ? 1062 ILE A CG2 1 
ATOM   532 C  CD1 . ILE A 1 62 ? -0.075  8.290   -22.044 1.00 12.95 ? 1062 ILE A CD1 1 
ATOM   533 N  N   . LEU A 1 63 ? -2.497  4.159   -21.073 1.00 13.26 ? 1063 LEU A N   1 
ATOM   534 C  CA  . LEU A 1 63 ? -2.857  2.785   -20.769 1.00 14.87 ? 1063 LEU A CA  1 
ATOM   535 C  C   . LEU A 1 63 ? -1.657  2.060   -20.147 1.00 14.60 ? 1063 LEU A C   1 
ATOM   536 O  O   . LEU A 1 63 ? -0.529  2.116   -20.665 1.00 16.87 ? 1063 LEU A O   1 
ATOM   537 C  CB  . LEU A 1 63 ? -3.321  2.085   -22.056 1.00 17.14 ? 1063 LEU A CB  1 
ATOM   538 C  CG  . LEU A 1 63 ? -3.933  0.688   -22.029 1.00 19.40 ? 1063 LEU A CG  1 
ATOM   539 C  CD1 . LEU A 1 63 ? -5.311  0.693   -21.449 1.00 21.65 ? 1063 LEU A CD1 1 
ATOM   540 C  CD2 . LEU A 1 63 ? -3.998  0.143   -23.448 0.50 17.75 ? 1063 LEU A CD2 1 
ATOM   541 N  N   A ILE A 1 64 ? -1.927  1.329   -19.076 0.70 14.47 ? 1064 ILE A N   1 
ATOM   542 N  N   B ILE A 1 64 ? -1.898  1.411   -19.015 0.30 15.35 ? 1064 ILE A N   1 
ATOM   543 C  CA  A ILE A 1 64 ? -0.921  0.569   -18.369 0.70 15.22 ? 1064 ILE A CA  1 
ATOM   544 C  CA  B ILE A 1 64 ? -0.919  0.521   -18.419 0.30 15.58 ? 1064 ILE A CA  1 
ATOM   545 C  C   A ILE A 1 64 ? -1.519  -0.796  -18.000 0.70 14.65 ? 1064 ILE A C   1 
ATOM   546 C  C   B ILE A 1 64 ? -1.548  -0.844  -18.186 0.30 15.02 ? 1064 ILE A C   1 
ATOM   547 O  O   A ILE A 1 64 ? -2.712  -0.901  -17.725 0.70 17.03 ? 1064 ILE A O   1 
ATOM   548 O  O   B ILE A 1 64 ? -2.770  -0.999  -18.227 0.30 15.26 ? 1064 ILE A O   1 
ATOM   549 C  CB  A ILE A 1 64 ? -0.484  1.335   -17.109 0.70 16.15 ? 1064 ILE A CB  1 
ATOM   550 C  CB  B ILE A 1 64 ? -0.367  1.086   -17.094 0.30 15.79 ? 1064 ILE A CB  1 
ATOM   551 C  CG1 A ILE A 1 64 ? 0.821   0.778   -16.546 0.70 16.04 ? 1064 ILE A CG1 1 
ATOM   552 C  CG1 B ILE A 1 64 ? 0.195   2.487   -17.327 0.30 14.89 ? 1064 ILE A CG1 1 
ATOM   553 C  CG2 A ILE A 1 64 ? -1.604  1.303   -16.065 0.70 15.72 ? 1064 ILE A CG2 1 
ATOM   554 C  CG2 B ILE A 1 64 ? 0.708   0.170   -16.517 0.30 16.84 ? 1064 ILE A CG2 1 
ATOM   555 C  CD1 A ILE A 1 64 ? 1.462   1.651   -15.484 0.70 15.99 ? 1064 ILE A CD1 1 
ATOM   556 C  CD1 B ILE A 1 64 ? 0.795   3.121   -16.104 0.30 17.83 ? 1064 ILE A CD1 1 
ATOM   557 N  N   . GLU A 1 65 ? -0.698  -1.840  -17.996 1.00 13.85 ? 1065 GLU A N   1 
ATOM   558 C  CA  . GLU A 1 65 ? -1.129  -3.128  -17.514 1.00 16.55 ? 1065 GLU A CA  1 
ATOM   559 C  C   . GLU A 1 65 ? -0.258  -3.439  -16.313 1.00 18.86 ? 1065 GLU A C   1 
ATOM   560 O  O   . GLU A 1 65 ? 0.951   -3.552  -16.431 1.00 19.32 ? 1065 GLU A O   1 
ATOM   561 C  CB  . GLU A 1 65 ? -0.984  -4.161  -18.630 1.00 16.66 ? 1065 GLU A CB  1 
ATOM   562 C  CG  . GLU A 1 65 ? -1.677  -5.467  -18.365 1.00 19.86 ? 1065 GLU A CG  1 
ATOM   563 C  CD  . GLU A 1 65 ? -1.482  -6.436  -19.508 0.75 21.44 ? 1065 GLU A CD  1 
ATOM   564 O  OE1 . GLU A 1 65 ? -1.771  -6.059  -20.666 0.75 26.74 ? 1065 GLU A OE1 1 
ATOM   565 O  OE2 . GLU A 1 65 ? -1.020  -7.562  -19.254 0.75 30.25 ? 1065 GLU A OE2 1 
ATOM   566 N  N   . ILE A 1 66 ? -0.889  -3.506  -15.144 1.00 20.07 ? 1066 ILE A N   1 
ATOM   567 C  CA  . ILE A 1 66 ? -0.178  -3.558  -13.869 1.00 21.68 ? 1066 ILE A CA  1 
ATOM   568 C  C   . ILE A 1 66 ? -0.468  -4.962  -13.415 1.00 24.54 ? 1066 ILE A C   1 
ATOM   569 O  O   . ILE A 1 66 ? -1.607  -5.319  -13.075 1.00 24.83 ? 1066 ILE A O   1 
ATOM   570 C  CB  . ILE A 1 66 ? -0.694  -2.511  -12.852 1.00 21.95 ? 1066 ILE A CB  1 
ATOM   571 C  CG1 . ILE A 1 66 ? -0.428  -1.088  -13.352 1.00 23.22 ? 1066 ILE A CG1 1 
ATOM   572 C  CG2 . ILE A 1 66 ? -0.045  -2.705  -11.486 0.50 19.95 ? 1066 ILE A CG2 1 
ATOM   573 C  CD1 . ILE A 1 66 ? -1.312  -0.039  -12.702 0.50 19.07 ? 1066 ILE A CD1 1 
ATOM   574 N  N   . CYS A 1 67 ? 0.552   -5.796  -13.500 1.00 28.68 ? 1067 CYS A N   1 
ATOM   575 C  CA  . CYS A 1 67 ? 0.430   -7.143  -13.029 1.00 28.56 ? 1067 CYS A CA  1 
ATOM   576 C  C   . CYS A 1 67 ? -0.797  -7.830  -13.635 1.00 28.82 ? 1067 CYS A C   1 
ATOM   577 O  O   . CYS A 1 67 ? -1.537  -8.514  -12.921 1.00 30.49 ? 1067 CYS A O   1 
ATOM   578 C  CB  . CYS A 1 67 ? 0.311   -7.108  -11.509 1.00 29.81 ? 1067 CYS A CB  1 
ATOM   579 S  SG  . CYS A 1 67 ? 0.464   -8.700  -10.818 1.00 31.82 ? 1067 CYS A SG  1 
ATOM   580 N  N   . GLY A 1 68 ? -1.031  -7.630  -14.933 1.00 28.06 ? 1068 GLY A N   1 
ATOM   581 C  CA  . GLY A 1 68 ? -2.100  -8.344  -15.663 1.00 25.62 ? 1068 GLY A CA  1 
ATOM   582 C  C   . GLY A 1 68 ? -3.427  -7.588  -15.808 1.00 25.71 ? 1068 GLY A C   1 
ATOM   583 O  O   . GLY A 1 68 ? -4.319  -8.002  -16.553 1.00 27.29 ? 1068 GLY A O   1 
ATOM   584 N  N   . HIS A 1 69 ? -3.566  -6.482  -15.094 1.00 23.21 ? 1069 HIS A N   1 
ATOM   585 C  CA  . HIS A 1 69 ? -4.829  -5.753  -15.054 1.00 21.22 ? 1069 HIS A CA  1 
ATOM   586 C  C   . HIS A 1 69 ? -4.627  -4.424  -15.753 1.00 19.08 ? 1069 HIS A C   1 
ATOM   587 O  O   . HIS A 1 69 ? -3.708  -3.678  -15.424 1.00 21.20 ? 1069 HIS A O   1 
ATOM   588 C  CB  . HIS A 1 69 ? -5.248  -5.507  -13.605 1.00 21.53 ? 1069 HIS A CB  1 
ATOM   589 C  CG  . HIS A 1 69 ? -5.662  -6.745  -12.873 1.00 23.57 ? 1069 HIS A CG  1 
ATOM   590 N  ND1 . HIS A 1 69 ? -6.925  -6.906  -12.348 1.00 25.75 ? 1069 HIS A ND1 1 
ATOM   591 C  CD2 . HIS A 1 69 ? -4.981  -7.876  -12.568 1.00 24.65 ? 1069 HIS A CD2 1 
ATOM   592 C  CE1 . HIS A 1 69 ? -7.005  -8.084  -11.752 1.00 24.77 ? 1069 HIS A CE1 1 
ATOM   593 N  NE2 . HIS A 1 69 ? -5.839  -8.694  -11.873 1.00 25.95 ? 1069 HIS A NE2 1 
ATOM   594 N  N   . LYS A 1 70 ? -5.498  -4.096  -16.694 1.00 15.24 ? 1070 LYS A N   1 
ATOM   595 C  CA  . LYS A 1 70 ? -5.336  -2.859  -17.428 1.00 16.26 ? 1070 LYS A CA  1 
ATOM   596 C  C   . LYS A 1 70 ? -5.996  -1.677  -16.718 1.00 14.32 ? 1070 LYS A C   1 
ATOM   597 O  O   . LYS A 1 70 ? -7.005  -1.818  -16.039 1.00 16.02 ? 1070 LYS A O   1 
ATOM   598 C  CB  . LYS A 1 70 ? -5.877  -3.009  -18.844 1.00 16.60 ? 1070 LYS A CB  1 
ATOM   599 C  CG  . LYS A 1 70 ? -5.066  -3.988  -19.676 1.00 18.89 ? 1070 LYS A CG  1 
ATOM   600 C  CD  . LYS A 1 70 ? -5.535  -4.039  -21.101 1.00 19.06 ? 1070 LYS A CD  1 
ATOM   601 C  CE  . LYS A 1 70 ? -4.875  -5.209  -21.834 1.00 21.03 ? 1070 LYS A CE  1 
ATOM   602 N  NZ  . LYS A 1 70 ? -5.310  -5.302  -23.256 1.00 21.98 ? 1070 LYS A NZ  1 
ATOM   603 N  N   . ALA A 1 71 ? -5.417  -0.501  -16.909 1.00 13.54 ? 1071 ALA A N   1 
ATOM   604 C  CA  . ALA A 1 71 ? -5.963  0.737   -16.361 1.00 13.80 ? 1071 ALA A CA  1 
ATOM   605 C  C   . ALA A 1 71 ? -5.522  1.879   -17.243 1.00 12.73 ? 1071 ALA A C   1 
ATOM   606 O  O   . ALA A 1 71 ? -4.520  1.781   -17.937 1.00 15.09 ? 1071 ALA A O   1 
ATOM   607 C  CB  . ALA A 1 71 ? -5.481  0.969   -14.934 1.00 15.00 ? 1071 ALA A CB  1 
ATOM   608 N  N   . ILE A 1 72 ? -6.267  2.969   -17.190 1.00 12.92 ? 1072 ILE A N   1 
ATOM   609 C  CA  . ILE A 1 72 ? -5.900  4.202   -17.860 1.00 13.03 ? 1072 ILE A CA  1 
ATOM   610 C  C   . ILE A 1 72 ? -5.805  5.303   -16.827 1.00 11.98 ? 1072 ILE A C   1 
ATOM   611 O  O   . ILE A 1 72 ? -6.649  5.419   -15.960 1.00 13.24 ? 1072 ILE A O   1 
ATOM   612 C  CB  . ILE A 1 72 ? -6.945  4.563   -18.908 1.00 14.51 ? 1072 ILE A CB  1 
ATOM   613 C  CG1 . ILE A 1 72 ? -6.862  3.542   -20.038 1.00 15.92 ? 1072 ILE A CG1 1 
ATOM   614 C  CG2 . ILE A 1 72 ? -6.716  5.964   -19.427 1.00 15.60 ? 1072 ILE A CG2 1 
ATOM   615 C  CD1 . ILE A 1 72 ? -7.993  3.613   -21.007 1.00 18.55 ? 1072 ILE A CD1 1 
ATOM   616 N  N   . GLY A 1 73 ? -4.761  6.104   -16.913 1.00 11.71 ? 1073 GLY A N   1 
ATOM   617 C  CA  . GLY A 1 73 ? -4.660  7.245   -16.049 1.00 11.88 ? 1073 GLY A CA  1 
ATOM   618 C  C   . GLY A 1 73 ? -3.418  8.053   -16.299 1.00 11.17 ? 1073 GLY A C   1 
ATOM   619 O  O   . GLY A 1 73 ? -2.693  7.856   -17.284 1.00 12.40 ? 1073 GLY A O   1 
ATOM   620 N  N   . THR A 1 74 ? -3.172  8.979   -15.384 1.00 11.30 ? 1074 THR A N   1 
ATOM   621 C  CA  . THR A 1 74 ? -2.084  9.911   -15.529 1.00 11.11 ? 1074 THR A CA  1 
ATOM   622 C  C   . THR A 1 74 ? -0.769  9.270   -15.096 1.00 10.89 ? 1074 THR A C   1 
ATOM   623 O  O   . THR A 1 74 ? -0.680  8.613   -14.045 1.00 11.91 ? 1074 THR A O   1 
ATOM   624 C  CB  . THR A 1 74 ? -2.372  11.157  -14.699 1.00 11.92 ? 1074 THR A CB  1 
ATOM   625 O  OG1 . THR A 1 74 ? -3.538  11.818  -15.234 1.00 13.62 ? 1074 THR A OG1 1 
ATOM   626 C  CG2 . THR A 1 74 ? -1.193  12.105  -14.694 1.00 12.78 ? 1074 THR A CG2 1 
ATOM   627 N  N   . VAL A 1 75 ? 0.250   9.458   -15.928 1.00 11.51 ? 1075 VAL A N   1 
ATOM   628 C  CA  . VAL A 1 75 ? 1.585   8.971   -15.655 1.00 11.76 ? 1075 VAL A CA  1 
ATOM   629 C  C   . VAL A 1 75 ? 2.532   10.146  -15.728 1.00 12.66 ? 1075 VAL A C   1 
ATOM   630 O  O   . VAL A 1 75 ? 2.561   10.871  -16.725 1.00 13.43 ? 1075 VAL A O   1 
ATOM   631 C  CB  . VAL A 1 75 ? 2.007   7.894   -16.673 1.00 12.51 ? 1075 VAL A CB  1 
ATOM   632 C  CG1 . VAL A 1 75 ? 3.468   7.468   -16.461 1.00 13.54 ? 1075 VAL A CG1 1 
ATOM   633 C  CG2 . VAL A 1 75 ? 1.043   6.699   -16.571 1.00 14.01 ? 1075 VAL A CG2 1 
ATOM   634 N  N   . LEU A 1 76 ? 3.290   10.338  -14.655 1.00 12.19 ? 1076 LEU A N   1 
ATOM   635 C  CA  . LEU A 1 76 ? 4.335   11.341  -14.632 1.00 12.27 ? 1076 LEU A CA  1 
ATOM   636 C  C   . LEU A 1 76 ? 5.635   10.666  -15.029 1.00 12.20 ? 1076 LEU A C   1 
ATOM   637 O  O   . LEU A 1 76 ? 5.924   9.544   -14.594 1.00 14.48 ? 1076 LEU A O   1 
ATOM   638 C  CB  . LEU A 1 76 ? 4.456   11.973  -13.244 1.00 11.90 ? 1076 LEU A CB  1 
ATOM   639 C  CG  . LEU A 1 76 ? 3.150   12.454  -12.630 1.00 13.14 ? 1076 LEU A CG  1 
ATOM   640 C  CD1 . LEU A 1 76 ? 3.416   13.013  -11.236 1.00 13.43 ? 1076 LEU A CD1 1 
ATOM   641 C  CD2 . LEU A 1 76 ? 2.471   13.495  -13.519 1.00 14.08 ? 1076 LEU A CD2 1 
ATOM   642 N  N   . VAL A 1 77 ? 6.416   11.342  -15.860 1.00 11.31 ? 1077 VAL A N   1 
ATOM   643 C  CA  . VAL A 1 77 ? 7.665   10.790  -16.354 1.00 13.00 ? 1077 VAL A CA  1 
ATOM   644 C  C   . VAL A 1 77 ? 8.787   11.758  -15.996 1.00 12.76 ? 1077 VAL A C   1 
ATOM   645 O  O   . VAL A 1 77 ? 8.715   12.962  -16.280 1.00 13.24 ? 1077 VAL A O   1 
ATOM   646 C  CB  . VAL A 1 77 ? 7.627   10.590  -17.878 1.00 12.93 ? 1077 VAL A CB  1 
ATOM   647 C  CG1 . VAL A 1 77 ? 8.960   10.111  -18.397 1.00 14.31 ? 1077 VAL A CG1 1 
ATOM   648 C  CG2 . VAL A 1 77 ? 6.530   9.616   -18.252 1.00 14.31 ? 1077 VAL A CG2 1 
ATOM   649 N  N   . GLY A 1 78 ? 9.828   11.230  -15.367 1.00 14.68 ? 1078 GLY A N   1 
ATOM   650 C  CA  . GLY A 1 78 ? 10.950  12.058  -14.957 1.00 16.36 ? 1078 GLY A CA  1 
ATOM   651 C  C   . GLY A 1 78 ? 11.874  11.307  -14.030 1.00 17.83 ? 1078 GLY A C   1 
ATOM   652 O  O   . GLY A 1 78 ? 11.794  10.088  -13.902 1.00 18.00 ? 1078 GLY A O   1 
ATOM   653 N  N   . PRO A 1 79 ? 12.782  12.043  -13.399 1.00 19.61 ? 1079 PRO A N   1 
ATOM   654 C  CA  . PRO A 1 79 ? 13.901  11.435  -12.673 1.00 20.90 ? 1079 PRO A CA  1 
ATOM   655 C  C   . PRO A 1 79 ? 13.615  10.912  -11.260 1.00 24.27 ? 1079 PRO A C   1 
ATOM   656 O  O   . PRO A 1 79 ? 14.194  11.384  -10.275 1.00 26.57 ? 1079 PRO A O   1 
ATOM   657 C  CB  . PRO A 1 79 ? 14.952  12.549  -12.660 1.00 23.76 ? 1079 PRO A CB  1 
ATOM   658 C  CG  . PRO A 1 79 ? 14.172  13.819  -12.748 1.00 18.42 ? 1079 PRO A CG  1 
ATOM   659 C  CD  . PRO A 1 79 ? 12.854  13.512  -13.423 1.00 18.80 ? 1079 PRO A CD  1 
ATOM   660 N  N   . THR A 1 80 ? 12.778  9.892   -11.187 1.00 22.85 ? 1080 THR A N   1 
ATOM   661 C  CA  . THR A 1 80 ? 12.422  9.234   -9.937  1.00 21.42 ? 1080 THR A CA  1 
ATOM   662 C  C   . THR A 1 80 ? 13.409  8.106   -9.611  1.00 22.11 ? 1080 THR A C   1 
ATOM   663 O  O   . THR A 1 80 ? 13.869  7.398   -10.507 1.00 22.46 ? 1080 THR A O   1 
ATOM   664 C  CB  . THR A 1 80 ? 10.990  8.662   -10.061 1.00 19.38 ? 1080 THR A CB  1 
ATOM   665 O  OG1 . THR A 1 80 ? 10.590  8.043   -8.831  1.00 19.47 ? 1080 THR A OG1 1 
ATOM   666 C  CG2 . THR A 1 80 ? 10.892  7.660   -11.215 1.00 18.49 ? 1080 THR A CG2 1 
ATOM   667 N  N   . PRO A 1 81 ? 13.756  7.941   -8.328  1.00 24.85 ? 1081 PRO A N   1 
ATOM   668 C  CA  . PRO A 1 81 ? 14.714  6.887   -7.982  1.00 23.76 ? 1081 PRO A CA  1 
ATOM   669 C  C   . PRO A 1 81 ? 14.136  5.484   -8.111  1.00 22.99 ? 1081 PRO A C   1 
ATOM   670 O  O   . PRO A 1 81 ? 14.873  4.518   -8.283  1.00 24.41 ? 1081 PRO A O   1 
ATOM   671 C  CB  . PRO A 1 81 ? 15.065  7.185   -6.521  1.00 25.11 ? 1081 PRO A CB  1 
ATOM   672 C  CG  . PRO A 1 81 ? 14.433  8.508   -6.200  1.00 27.62 ? 1081 PRO A CG  1 
ATOM   673 C  CD  . PRO A 1 81 ? 13.310  8.693   -7.147  1.00 25.15 ? 1081 PRO A CD  1 
ATOM   674 N  N   . VAL A 1 82 ? 12.816  5.379   -8.020  1.00 22.12 ? 1082 VAL A N   1 
ATOM   675 C  CA  . VAL A 1 82 ? 12.129  4.101   -8.126  1.00 22.02 ? 1082 VAL A CA  1 
ATOM   676 C  C   . VAL A 1 82 ? 10.894  4.361   -8.979  1.00 19.49 ? 1082 VAL A C   1 
ATOM   677 O  O   . VAL A 1 82 ? 10.275  5.413   -8.858  1.00 19.69 ? 1082 VAL A O   1 
ATOM   678 C  CB  . VAL A 1 82 ? 11.689  3.593   -6.729  1.00 23.52 ? 1082 VAL A CB  1 
ATOM   679 C  CG1 . VAL A 1 82 ? 10.998  4.681   -5.980  1.00 27.05 ? 1082 VAL A CG1 1 
ATOM   680 C  CG2 . VAL A 1 82 ? 10.802  2.384   -6.830  1.00 25.29 ? 1082 VAL A CG2 1 
ATOM   681 N  N   . ASN A 1 83 ? 10.556  3.424   -9.851  1.00 18.15 ? 1083 ASN A N   1 
ATOM   682 C  CA  . ASN A 1 83 ? 9.293   3.495   -10.575 1.00 16.82 ? 1083 ASN A CA  1 
ATOM   683 C  C   . ASN A 1 83 ? 8.166   3.225   -9.607  1.00 15.93 ? 1083 ASN A C   1 
ATOM   684 O  O   . ASN A 1 83 ? 8.169   2.199   -8.920  1.00 17.39 ? 1083 ASN A O   1 
ATOM   685 C  CB  . ASN A 1 83 ? 9.248   2.454   -11.685 1.00 17.34 ? 1083 ASN A CB  1 
ATOM   686 C  CG  . ASN A 1 83 ? 10.169  2.789   -12.827 1.00 18.49 ? 1083 ASN A CG  1 
ATOM   687 O  OD1 . ASN A 1 83 ? 10.477  3.957   -13.067 1.00 21.87 ? 1083 ASN A OD1 1 
ATOM   688 N  ND2 . ASN A 1 83 ? 10.619  1.764   -13.543 1.00 19.31 ? 1083 ASN A ND2 1 
ATOM   689 N  N   A ILE A 1 84 ? 7.210   4.147   -9.549  0.50 14.66 ? 1084 ILE A N   1 
ATOM   690 N  N   B ILE A 1 84 ? 7.203   4.139   -9.565  0.50 14.92 ? 1084 ILE A N   1 
ATOM   691 C  CA  A ILE A 1 84 ? 6.167   4.133   -8.530  0.50 14.63 ? 1084 ILE A CA  1 
ATOM   692 C  CA  B ILE A 1 84 ? 6.164   4.139   -8.544  0.50 14.86 ? 1084 ILE A CA  1 
ATOM   693 C  C   A ILE A 1 84 ? 4.786   4.072   -9.187  0.50 14.15 ? 1084 ILE A C   1 
ATOM   694 C  C   B ILE A 1 84 ? 4.782   4.073   -9.193  0.50 14.32 ? 1084 ILE A C   1 
ATOM   695 O  O   A ILE A 1 84 ? 4.453   4.926   -10.006 0.50 14.25 ? 1084 ILE A O   1 
ATOM   696 O  O   B ILE A 1 84 ? 4.443   4.924   -10.013 0.50 14.37 ? 1084 ILE A O   1 
ATOM   697 C  CB  A ILE A 1 84 ? 6.252   5.403   -7.665  0.50 14.57 ? 1084 ILE A CB  1 
ATOM   698 C  CB  B ILE A 1 84 ? 6.247   5.424   -7.709  0.50 15.25 ? 1084 ILE A CB  1 
ATOM   699 C  CG1 A ILE A 1 84 ? 7.448   5.318   -6.711  0.50 15.54 ? 1084 ILE A CG1 1 
ATOM   700 C  CG1 B ILE A 1 84 ? 7.603   5.507   -7.004  0.50 17.90 ? 1084 ILE A CG1 1 
ATOM   701 C  CG2 A ILE A 1 84 ? 4.959   5.633   -6.897  0.50 15.50 ? 1084 ILE A CG2 1 
ATOM   702 C  CG2 B ILE A 1 84 ? 5.106   5.499   -6.712  0.50 16.08 ? 1084 ILE A CG2 1 
ATOM   703 C  CD1 A ILE A 1 84 ? 7.929   6.682   -6.220  0.50 15.66 ? 1084 ILE A CD1 1 
ATOM   704 C  CD1 B ILE A 1 84 ? 7.820   4.431   -5.975  0.50 20.78 ? 1084 ILE A CD1 1 
ATOM   705 N  N   . ILE A 1 85 ? 3.993   3.066   -8.819  1.00 14.02 ? 1085 ILE A N   1 
ATOM   706 C  CA  . ILE A 1 85 ? 2.564   3.050   -9.117  1.00 13.46 ? 1085 ILE A CA  1 
ATOM   707 C  C   . ILE A 1 85 ? 1.844   3.613   -7.903  1.00 12.75 ? 1085 ILE A C   1 
ATOM   708 O  O   . ILE A 1 85 ? 1.816   2.989   -6.843  1.00 14.86 ? 1085 ILE A O   1 
ATOM   709 C  CB  . ILE A 1 85 ? 2.028   1.627   -9.412  1.00 13.38 ? 1085 ILE A CB  1 
ATOM   710 C  CG1 . ILE A 1 85 ? 2.862   0.931   -10.501 1.00 15.16 ? 1085 ILE A CG1 1 
ATOM   711 C  CG2 . ILE A 1 85 ? 0.560   1.683   -9.802  1.00 15.68 ? 1085 ILE A CG2 1 
ATOM   712 C  CD1 . ILE A 1 85 ? 2.999   1.722   -11.789 1.00 17.73 ? 1085 ILE A CD1 1 
ATOM   713 N  N   . GLY A 1 86 ? 1.311   4.818   -8.050  1.00 13.45 ? 1086 GLY A N   1 
ATOM   714 C  CA  . GLY A 1 86 ? 0.679   5.513   -6.955  1.00 13.18 ? 1086 GLY A CA  1 
ATOM   715 C  C   . GLY A 1 86 ? -0.817  5.269   -6.905  1.00 13.25 ? 1086 GLY A C   1 
ATOM   716 O  O   . GLY A 1 86 ? -1.394  4.533   -7.723  1.00 13.12 ? 1086 GLY A O   1 
ATOM   717 N  N   . ARG A 1 87 ? -1.466  5.925   -5.952  1.00 13.81 ? 1087 ARG A N   1 
ATOM   718 C  CA  . ARG A 1 87 ? -2.856  5.669   -5.691  1.00 13.85 ? 1087 ARG A CA  1 
ATOM   719 C  C   . ARG A 1 87 ? -3.733  5.955   -6.892  1.00 13.21 ? 1087 ARG A C   1 
ATOM   720 O  O   . ARG A 1 87 ? -4.774  5.336   -7.057  1.00 15.47 ? 1087 ARG A O   1 
ATOM   721 C  CB  . ARG A 1 87 ? -3.334  6.478   -4.488  1.00 13.71 ? 1087 ARG A CB  1 
ATOM   722 C  CG  . ARG A 1 87 ? -2.739  6.008   -3.170  1.00 14.34 ? 1087 ARG A CG  1 
ATOM   723 C  CD  . ARG A 1 87 ? -3.424  6.703   -1.987  1.00 15.33 ? 1087 ARG A CD  1 
ATOM   724 N  NE  . ARG A 1 87 ? -3.165  8.148   -1.975  1.00 15.89 ? 1087 ARG A NE  1 
ATOM   725 C  CZ  . ARG A 1 87 ? -4.015  9.077   -2.414  1.00 16.60 ? 1087 ARG A CZ  1 
ATOM   726 N  NH1 . ARG A 1 87 ? -5.223  8.750   -2.872  1.00 16.97 ? 1087 ARG A NH1 1 
ATOM   727 N  NH2 . ARG A 1 87 ? -3.657  10.353  -2.376  1.00 18.06 ? 1087 ARG A NH2 1 
ATOM   728 N  N   . ASN A 1 88 ? -3.335  6.901   -7.740  1.00 12.88 ? 1088 ASN A N   1 
ATOM   729 C  CA  . ASN A 1 88 ? -4.185  7.214   -8.883  1.00 12.93 ? 1088 ASN A CA  1 
ATOM   730 C  C   . ASN A 1 88 ? -4.444  5.985   -9.756  1.00 13.15 ? 1088 ASN A C   1 
ATOM   731 O  O   . ASN A 1 88 ? -5.540  5.812   -10.273 1.00 15.83 ? 1088 ASN A O   1 
ATOM   732 C  CB  . ASN A 1 88 ? -3.632  8.381   -9.707  1.00 11.97 ? 1088 ASN A CB  1 
ATOM   733 C  CG  . ASN A 1 88 ? -2.421  8.004   -10.532 1.00 12.75 ? 1088 ASN A CG  1 
ATOM   734 O  OD1 . ASN A 1 88 ? -1.415  7.536   -9.987  1.00 12.76 ? 1088 ASN A OD1 1 
ATOM   735 N  ND2 . ASN A 1 88 ? -2.503  8.240   -11.855 1.00 12.70 ? 1088 ASN A ND2 1 
ATOM   736 N  N   . LEU A 1 89 ? -3.432  5.158   -9.956  1.00 13.27 ? 1089 LEU A N   1 
ATOM   737 C  CA  . LEU A 1 89 ? -3.599  3.957   -10.765 1.00 13.08 ? 1089 LEU A CA  1 
ATOM   738 C  C   . LEU A 1 89 ? -3.981  2.741   -9.952  1.00 13.86 ? 1089 LEU A C   1 
ATOM   739 O  O   . LEU A 1 89 ? -4.666  1.850   -10.456 1.00 14.95 ? 1089 LEU A O   1 
ATOM   740 C  CB  . LEU A 1 89 ? -2.351  3.670   -11.590 1.00 14.51 ? 1089 LEU A CB  1 
ATOM   741 C  CG  . LEU A 1 89 ? -2.167  4.609   -12.774 1.00 15.99 ? 1089 LEU A CG  1 
ATOM   742 C  CD1 . LEU A 1 89 ? -0.848  4.354   -13.486 1.00 20.35 ? 1089 LEU A CD1 1 
ATOM   743 C  CD2 . LEU A 1 89 ? -3.319  4.454   -13.724 1.00 19.01 ? 1089 LEU A CD2 1 
ATOM   744 N  N   . LEU A 1 90 ? -3.551  2.691   -8.692  1.00 14.32 ? 1090 LEU A N   1 
ATOM   745 C  CA  . LEU A 1 90 ? -4.019  1.621   -7.815  1.00 14.11 ? 1090 LEU A CA  1 
ATOM   746 C  C   . LEU A 1 90 ? -5.539  1.623   -7.740  1.00 14.58 ? 1090 LEU A C   1 
ATOM   747 O  O   . LEU A 1 90 ? -6.171  0.563   -7.755  1.00 15.08 ? 1090 LEU A O   1 
ATOM   748 C  CB  . LEU A 1 90 ? -3.406  1.753   -6.417  1.00 14.85 ? 1090 LEU A CB  1 
ATOM   749 C  CG  . LEU A 1 90 ? -1.895  1.566   -6.374  1.00 15.82 ? 1090 LEU A CG  1 
ATOM   750 C  CD1 . LEU A 1 90 ? -1.374  1.803   -4.965  1.00 17.12 ? 1090 LEU A CD1 1 
ATOM   751 C  CD2 . LEU A 1 90 ? -1.474  0.188   -6.877  1.00 16.31 ? 1090 LEU A CD2 1 
ATOM   752 N  N   A THR A 1 91 ? -6.157  2.807   -7.641  0.33 13.75 ? 1091 THR A N   1 
ATOM   753 N  N   B THR A 1 91 ? -6.143  2.804   -7.661  0.33 14.61 ? 1091 THR A N   1 
ATOM   754 N  N   C THR A 1 91 ? -6.084  2.824   -7.696  0.33 13.67 ? 1091 THR A N   1 
ATOM   755 C  CA  A THR A 1 91 ? -7.628  2.872   -7.607  0.33 14.04 ? 1091 THR A CA  1 
ATOM   756 C  CA  B THR A 1 91 ? -7.594  2.871   -7.601  0.33 15.37 ? 1091 THR A CA  1 
ATOM   757 C  CA  C THR A 1 91 ? -7.499  3.041   -7.612  0.33 13.58 ? 1091 THR A CA  1 
ATOM   758 C  C   A THR A 1 91 ? -8.217  2.380   -8.924  0.33 14.56 ? 1091 THR A C   1 
ATOM   759 C  C   B THR A 1 91 ? -8.232  2.423   -8.917  0.33 15.39 ? 1091 THR A C   1 
ATOM   760 C  C   C THR A 1 91 ? -8.232  2.552   -8.884  0.33 14.59 ? 1091 THR A C   1 
ATOM   761 O  O   A THR A 1 91 ? -9.206  1.643   -8.930  0.33 15.47 ? 1091 THR A O   1 
ATOM   762 O  O   B THR A 1 91 ? -9.272  1.760   -8.913  0.33 16.02 ? 1091 THR A O   1 
ATOM   763 O  O   C THR A 1 91 ? -9.326  1.988   -8.807  0.33 15.01 ? 1091 THR A O   1 
ATOM   764 C  CB  A THR A 1 91 ? -8.218  4.290   -7.313  0.33 13.82 ? 1091 THR A CB  1 
ATOM   765 C  CB  B THR A 1 91 ? -8.117  4.269   -7.226  0.33 16.12 ? 1091 THR A CB  1 
ATOM   766 C  CB  C THR A 1 91 ? -7.724  4.535   -7.353  0.33 13.66 ? 1091 THR A CB  1 
ATOM   767 O  OG1 A THR A 1 91 ? -7.548  5.284   -8.093  0.33 13.66 ? 1091 THR A OG1 1 
ATOM   768 O  OG1 B THR A 1 91 ? -9.510  4.176   -6.927  0.33 20.23 ? 1091 THR A OG1 1 
ATOM   769 O  OG1 C THR A 1 91 ? -7.124  4.885   -6.088  0.33 10.22 ? 1091 THR A OG1 1 
ATOM   770 C  CG2 A THR A 1 91 ? -8.116  4.633   -5.832  0.33 11.34 ? 1091 THR A CG2 1 
ATOM   771 C  CG2 B THR A 1 91 ? -7.913  5.249   -8.352  0.33 14.98 ? 1091 THR A CG2 1 
ATOM   772 C  CG2 C THR A 1 91 ? -9.181  4.862   -7.355  0.33 12.08 ? 1091 THR A CG2 1 
ATOM   773 N  N   . GLN A 1 92 ? -7.613  2.778   -10.038 1.00 15.15 ? 1092 GLN A N   1 
ATOM   774 C  CA  . GLN A 1 92 ? -8.163  2.391   -11.336 1.00 15.30 ? 1092 GLN A CA  1 
ATOM   775 C  C   . GLN A 1 92 ? -8.206  0.879   -11.488 1.00 16.33 ? 1092 GLN A C   1 
ATOM   776 O  O   . GLN A 1 92 ? -9.155  0.368   -12.067 1.00 18.02 ? 1092 GLN A O   1 
ATOM   777 C  CB  . GLN A 1 92 ? -7.362  3.003   -12.479 1.00 14.90 ? 1092 GLN A CB  1 
ATOM   778 C  CG  . GLN A 1 92 ? -7.510  4.508   -12.618 1.00 13.28 ? 1092 GLN A CG  1 
ATOM   779 C  CD  . GLN A 1 92 ? -8.943  4.964   -12.819 1.00 12.90 ? 1092 GLN A CD  1 
ATOM   780 O  OE1 . GLN A 1 92 ? -9.480  5.795   -12.041 1.00 17.70 ? 1092 GLN A OE1 1 
ATOM   781 N  NE2 . GLN A 1 92 ? -9.580  4.425   -13.829 1.00 10.55 ? 1092 GLN A NE2 1 
ATOM   782 N  N   . ILE A 1 93 ? -7.196  0.155   -10.980 1.00 17.32 ? 1093 ILE A N   1 
ATOM   783 C  CA  . ILE A 1 93 ? -7.227  -1.330  -11.046 1.00 18.15 ? 1093 ILE A CA  1 
ATOM   784 C  C   . ILE A 1 93 ? -7.996  -2.002  -9.915  1.00 18.94 ? 1093 ILE A C   1 
ATOM   785 O  O   . ILE A 1 93 ? -8.085  -3.235  -9.852  1.00 21.58 ? 1093 ILE A O   1 
ATOM   786 C  CB  . ILE A 1 93 ? -5.825  -1.985  -11.101 1.00 19.25 ? 1093 ILE A CB  1 
ATOM   787 C  CG1 . ILE A 1 93 ? -5.022  -1.685  -9.843  1.00 17.66 ? 1093 ILE A CG1 1 
ATOM   788 C  CG2 . ILE A 1 93 ? -5.086  -1.576  -12.326 1.00 19.46 ? 1093 ILE A CG2 1 
ATOM   789 C  CD1 . ILE A 1 93 ? -3.682  -2.353  -9.808  1.00 19.72 ? 1093 ILE A CD1 1 
ATOM   790 N  N   . GLY A 1 94 ? -8.549  -1.214  -9.006  1.00 17.90 ? 1094 GLY A N   1 
ATOM   791 C  CA  . GLY A 1 94 ? -9.354  -1.774  -7.928  1.00 18.72 ? 1094 GLY A CA  1 
ATOM   792 C  C   . GLY A 1 94 ? -8.520  -2.406  -6.829  1.00 19.04 ? 1094 GLY A C   1 
ATOM   793 O  O   . GLY A 1 94 ? -8.977  -3.319  -6.136  1.00 20.90 ? 1094 GLY A O   1 
ATOM   794 N  N   . CYS A 1 95 ? -7.310  -1.894  -6.648  1.00 17.57 ? 1095 CYS A N   1 
ATOM   795 C  CA  . CYS A 1 95 ? -6.424  -2.381  -5.600  1.00 17.20 ? 1095 CYS A CA  1 
ATOM   796 C  C   . CYS A 1 95 ? -6.829  -1.790  -4.252  1.00 18.32 ? 1095 CYS A C   1 
ATOM   797 O  O   . CYS A 1 95 ? -6.988  -0.571  -4.120  1.00 19.93 ? 1095 CYS A O   1 
ATOM   798 C  CB  . CYS A 1 95 ? -4.989  -2.000  -5.939  1.00 18.04 ? 1095 CYS A CB  1 
ATOM   799 S  SG  . CYS A 1 95 ? -3.779  -2.607  -4.760  1.00 18.68 ? 1095 CYS A SG  1 
ATOM   800 N  N   . THR A 1 96 ? -7.002  -2.664  -3.260  1.00 16.88 ? 1096 THR A N   1 
ATOM   801 C  CA  . THR A 1 96 ? -7.359  -2.249  -1.921  1.00 17.22 ? 1096 THR A CA  1 
ATOM   802 C  C   . THR A 1 96 ? -6.344  -2.805  -0.938  1.00 16.69 ? 1096 THR A C   1 
ATOM   803 O  O   . THR A 1 96 ? -5.633  -3.772  -1.229  1.00 16.87 ? 1096 THR A O   1 
ATOM   804 C  CB  . THR A 1 96 ? -8.768  -2.749  -1.514  1.00 18.82 ? 1096 THR A CB  1 
ATOM   805 O  OG1 . THR A 1 96 ? -8.861  -4.166  -1.693  1.00 19.18 ? 1096 THR A OG1 1 
ATOM   806 C  CG2 . THR A 1 96 ? -9.840  -2.069  -2.356  1.00 19.75 ? 1096 THR A CG2 1 
ATOM   807 N  N   . LEU A 1 97 ? -6.279  -2.171  0.225   1.00 15.86 ? 1097 LEU A N   1 
ATOM   808 C  CA  . LEU A 1 97 ? -5.613  -2.759  1.379   1.00 15.51 ? 1097 LEU A CA  1 
ATOM   809 C  C   . LEU A 1 97 ? -6.624  -3.542  2.207   1.00 15.64 ? 1097 LEU A C   1 
ATOM   810 O  O   . LEU A 1 97 ? -7.742  -3.074  2.428   1.00 17.58 ? 1097 LEU A O   1 
ATOM   811 C  CB  . LEU A 1 97 ? -5.012  -1.662  2.248   1.00 15.32 ? 1097 LEU A CB  1 
ATOM   812 C  CG  . LEU A 1 97 ? -3.828  -0.906  1.655   1.00 15.84 ? 1097 LEU A CG  1 
ATOM   813 C  CD1 . LEU A 1 97 ? -3.637  0.434   2.356   1.00 17.38 ? 1097 LEU A CD1 1 
ATOM   814 C  CD2 . LEU A 1 97 ? -2.555  -1.744  1.719   1.00 17.07 ? 1097 LEU A CD2 1 
ATOM   815 N  N   . ASN A 1 98 ? -6.215  -4.713  2.686   1.00 16.05 ? 1098 ASN A N   1 
ATOM   816 C  CA  . ASN A 1 98 ? -7.119  -5.596  3.407   1.00 16.53 ? 1098 ASN A CA  1 
ATOM   817 C  C   . ASN A 1 98 ? -6.421  -6.230  4.585   1.00 17.53 ? 1098 ASN A C   1 
ATOM   818 O  O   . ASN A 1 98 ? -5.308  -6.745  4.462   1.00 17.14 ? 1098 ASN A O   1 
ATOM   819 C  CB  . ASN A 1 98 ? -7.633  -6.704  2.498   1.00 18.36 ? 1098 ASN A CB  1 
ATOM   820 C  CG  . ASN A 1 98 ? -8.450  -6.178  1.363   1.00 18.91 ? 1098 ASN A CG  1 
ATOM   821 O  OD1 . ASN A 1 98 ? -9.682  -6.133  1.435   1.00 25.39 ? 1098 ASN A OD1 1 
ATOM   822 N  ND2 . ASN A 1 98 ? -7.777  -5.759  0.306   1.00 19.37 ? 1098 ASN A ND2 1 
ATOM   823 N  N   . PHE A 1 99 ? -7.093  -6.215  5.723   1.00 19.17 ? 1099 PHE A N   1 
ATOM   824 C  CA  . PHE A 1 99 ? -6.632  -6.993  6.858   1.00 18.99 ? 1099 PHE A CA  1 
ATOM   825 C  C   . PHE A 1 99 ? -7.774  -7.277  7.811   1.00 20.91 ? 1099 PHE A C   1 
ATOM   826 O  O   . PHE A 1 99 ? -8.876  -6.779  7.604   1.00 22.34 ? 1099 PHE A O   1 
ATOM   827 C  CB  . PHE A 1 99 ? -5.464  -6.313  7.582   1.00 20.46 ? 1099 PHE A CB  1 
ATOM   828 C  CG  . PHE A 1 99 ? -5.734  -4.904  8.021   1.00 19.94 ? 1099 PHE A CG  1 
ATOM   829 C  CD1 . PHE A 1 99 ? -6.044  -4.622  9.344   1.00 23.34 ? 1099 PHE A CD1 1 
ATOM   830 C  CD2 . PHE A 1 99 ? -5.640  -3.856  7.123   1.00 21.72 ? 1099 PHE A CD2 1 
ATOM   831 C  CE1 . PHE A 1 99 ? -6.275  -3.324  9.757   1.00 23.87 ? 1099 PHE A CE1 1 
ATOM   832 C  CE2 . PHE A 1 99 ? -5.862  -2.562  7.529   1.00 23.66 ? 1099 PHE A CE2 1 
ATOM   833 C  CZ  . PHE A 1 99 ? -6.190  -2.289  8.845   1.00 24.81 ? 1099 PHE A CZ  1 
ATOM   834 O  OXT . PHE A 1 99 ? -7.589  -8.044  8.756   1.00 22.48 ? 1099 PHE A OXT 1 
HETATM 835 MG MG  . MG  B 2 .  ? 7.441   6.653   -0.187  0.50 20.67 ? 201  MG  A MG  1 
HETATM 836 C  C1  . PGR C 3 .  ? -10.005 -0.600  -17.874 1.00 21.25 ? 907  PGR A C1  1 
HETATM 837 C  C2  . PGR C 3 .  ? -9.514  -0.478  -19.305 1.00 22.18 ? 907  PGR A C2  1 
HETATM 838 C  C3  . PGR C 3 .  ? -10.553 0.184   -20.178 1.00 12.13 ? 907  PGR A C3  1 
HETATM 839 O  O1  . PGR C 3 .  ? -11.155 -1.433  -17.853 1.00 27.89 ? 907  PGR A O1  1 
HETATM 840 O  O2  . PGR C 3 .  ? -8.319  0.287   -19.376 1.00 28.42 ? 907  PGR A O2  1 
HETATM 841 O  O   . HOH D 4 .  ? 5.851   5.385   -0.099  0.50 18.43 ? 1    HOH A O   1 
HETATM 842 O  O   . HOH D 4 .  ? -5.279  8.960   -13.040 1.00 7.16  ? 2    HOH A O   1 
HETATM 843 O  O   . HOH D 4 .  ? 5.894   -10.829 0.408   1.00 21.65 ? 3    HOH A O   1 
HETATM 844 O  O   . HOH D 4 .  ? 0.376   10.111  -11.893 1.00 13.19 ? 4    HOH A O   1 
HETATM 845 O  O   . HOH D 4 .  ? -8.967  2.762   -15.966 1.00 11.86 ? 5    HOH A O   1 
HETATM 846 O  O   . HOH D 4 .  ? 5.346   -7.484  -1.671  1.00 18.99 ? 6    HOH A O   1 
HETATM 847 O  O   . HOH D 4 .  ? 2.083   11.776  -29.492 1.00 18.30 ? 7    HOH A O   1 
HETATM 848 O  O   . HOH D 4 .  ? -5.427  10.780  -16.988 1.00 14.74 ? 8    HOH A O   1 
HETATM 849 O  O   . HOH D 4 .  ? 4.161   12.800  -26.603 1.00 16.83 ? 9    HOH A O   1 
HETATM 850 O  O   . HOH D 4 .  ? 1.500   -8.806  4.341   1.00 17.05 ? 10   HOH A O   1 
HETATM 851 O  O   . HOH D 4 .  ? 11.530  21.963  2.160   1.00 18.47 ? 11   HOH A O   1 
HETATM 852 O  O   . HOH D 4 .  ? -7.674  7.644   -14.738 1.00 17.51 ? 12   HOH A O   1 
HETATM 853 O  O   . HOH D 4 .  ? -1.562  4.660   -23.820 1.00 18.43 ? 13   HOH A O   1 
HETATM 854 O  O   . HOH D 4 .  ? -1.167  8.110   -0.046  1.00 17.30 ? 14   HOH A O   1 
HETATM 855 O  O   . HOH D 4 .  ? 2.639   11.536  -2.698  1.00 25.01 ? 15   HOH A O   1 
HETATM 856 O  O   . HOH D 4 .  ? 0.653   10.279  0.052   1.00 21.03 ? 16   HOH A O   1 
HETATM 857 O  O   . HOH D 4 .  ? -1.640  14.041  -21.927 1.00 16.89 ? 17   HOH A O   1 
HETATM 858 O  O   . HOH D 4 .  ? -7.853  7.139   -10.079 1.00 22.59 ? 19   HOH A O   1 
HETATM 859 O  O   . HOH D 4 .  ? 0.912   2.400   -22.843 1.00 18.31 ? 20   HOH A O   1 
HETATM 860 O  O   . HOH D 4 .  ? -10.626 1.127   -6.347  1.00 20.60 ? 21   HOH A O   1 
HETATM 861 O  O   . HOH D 4 .  ? 3.256   22.087  -10.996 1.00 29.23 ? 22   HOH A O   1 
HETATM 862 O  O   . HOH D 4 .  ? 1.155   4.816   -24.071 1.00 19.30 ? 23   HOH A O   1 
HETATM 863 O  O   . HOH D 4 .  ? -10.243 0.683   -14.566 1.00 24.74 ? 24   HOH A O   1 
HETATM 864 O  O   . HOH D 4 .  ? 8.556   15.313  -1.164  1.00 46.30 ? 25   HOH A O   1 
HETATM 865 O  O   . HOH D 4 .  ? 9.666   9.845   -7.034  1.00 26.62 ? 26   HOH A O   1 
HETATM 866 O  O   . HOH D 4 .  ? 14.596  9.013   -15.557 1.00 29.28 ? 27   HOH A O   1 
HETATM 867 O  O   . HOH D 4 .  ? -2.761  2.228   -25.166 0.50 22.91 ? 28   HOH A O   1 
HETATM 868 O  O   . HOH D 4 .  ? 4.026   -9.017  -11.631 1.00 29.39 ? 29   HOH A O   1 
HETATM 869 O  O   . HOH D 4 .  ? 2.375   -1.591  -24.050 1.00 23.41 ? 30   HOH A O   1 
HETATM 870 O  O   . HOH D 4 .  ? 10.396  -7.503  -4.013  1.00 31.16 ? 31   HOH A O   1 
HETATM 871 O  O   . HOH D 4 .  ? 10.541  4.744   -24.270 1.00 34.12 ? 32   HOH A O   1 
HETATM 872 O  O   . HOH D 4 .  ? 2.848   3.989   -26.389 1.00 15.42 ? 33   HOH A O   1 
HETATM 873 O  O   . HOH D 4 .  ? 1.779   -13.622 5.941   1.00 10.06 ? 34   HOH A O   1 
HETATM 874 O  O   . HOH D 4 .  ? 5.607   8.185   -27.806 1.00 17.98 ? 35   HOH A O   1 
HETATM 875 O  O   . HOH D 4 .  ? -0.940  16.712  -18.954 1.00 20.00 ? 36   HOH A O   1 
HETATM 876 O  O   . HOH D 4 .  ? 6.453   13.425  -25.359 1.00 21.88 ? 37   HOH A O   1 
HETATM 877 O  O   . HOH D 4 .  ? -6.736  3.009   -26.148 1.00 23.29 ? 38   HOH A O   1 
HETATM 878 O  O   . HOH D 4 .  ? 15.303  13.398  -8.908  1.00 25.52 ? 39   HOH A O   1 
HETATM 879 O  O   . HOH D 4 .  ? 5.823   -9.050  -3.815  1.00 29.09 ? 40   HOH A O   1 
HETATM 880 O  O   . HOH D 4 .  ? -6.009  8.080   -6.136  1.00 24.56 ? 41   HOH A O   1 
HETATM 881 O  O   . HOH D 4 .  ? -4.131  10.119  -6.213  1.00 23.91 ? 42   HOH A O   1 
HETATM 882 O  O   . HOH D 4 .  ? 12.226  -6.448  -0.573  1.00 31.10 ? 43   HOH A O   1 
HETATM 883 O  O   . HOH D 4 .  ? -1.630  11.801  -10.919 1.00 30.62 ? 44   HOH A O   1 
HETATM 884 O  O   . HOH D 4 .  ? 12.199  -1.367  -14.923 1.00 33.72 ? 45   HOH A O   1 
HETATM 885 O  O   . HOH D 4 .  ? -9.729  -5.531  -8.989  1.00 29.70 ? 46   HOH A O   1 
HETATM 886 O  O   . HOH D 4 .  ? 7.105   12.905  -4.941  1.00 27.00 ? 47   HOH A O   1 
HETATM 887 O  O   . HOH D 4 .  ? 3.886   9.480   -29.812 1.00 22.13 ? 48   HOH A O   1 
HETATM 888 O  O   . HOH D 4 .  ? 14.639  5.261   -18.477 1.00 28.45 ? 49   HOH A O   1 
HETATM 889 O  O   . HOH D 4 .  ? 5.706   8.603   0.471   0.50 20.75 ? 50   HOH A O   1 
HETATM 890 O  O   . HOH D 4 .  ? 12.391  3.759   -20.921 1.00 30.05 ? 51   HOH A O   1 
HETATM 891 O  O   . HOH D 4 .  ? 1.267   21.403  -22.572 1.00 31.37 ? 52   HOH A O   1 
HETATM 892 O  O   . HOH D 4 .  ? 3.146   18.339  -25.459 1.00 33.20 ? 53   HOH A O   1 
HETATM 893 O  O   . HOH D 4 .  ? 2.845   -11.875 -2.292  1.00 31.18 ? 54   HOH A O   1 
HETATM 894 O  O   . HOH D 4 .  ? 7.040   10.078  -5.886  1.00 33.41 ? 55   HOH A O   1 
HETATM 895 O  O   . HOH D 4 .  ? -5.094  -9.717  4.109   1.00 22.68 ? 57   HOH A O   1 
HETATM 896 O  O   . HOH D 4 .  ? 12.301  9.185   -23.495 1.00 27.98 ? 58   HOH A O   1 
HETATM 897 O  O   . HOH D 4 .  ? -7.315  -11.163 -3.433  1.00 31.44 ? 59   HOH A O   1 
HETATM 898 O  O   . HOH D 4 .  ? -8.593  -3.476  -14.587 1.00 32.12 ? 60   HOH A O   1 
HETATM 899 O  O   . HOH D 4 .  ? 7.454   1.186   -27.745 1.00 26.87 ? 61   HOH A O   1 
HETATM 900 O  O   . HOH D 4 .  ? 8.862   7.972   -0.219  0.50 28.84 ? 62   HOH A O   1 
HETATM 901 O  O   . HOH D 4 .  ? -8.563  -4.629  -12.325 1.00 31.42 ? 63   HOH A O   1 
HETATM 902 O  O   . HOH D 4 .  ? 4.355   -3.495  -23.190 1.00 29.10 ? 64   HOH A O   1 
HETATM 903 O  O   . HOH D 4 .  ? -7.739  -5.802  -17.394 1.00 35.25 ? 65   HOH A O   1 
HETATM 904 O  O   . HOH D 4 .  ? -1.289  21.178  -21.628 1.00 52.89 ? 66   HOH A O   1 
HETATM 905 O  O   . HOH D 4 .  ? 4.946   10.671  -1.726  1.00 36.01 ? 67   HOH A O   1 
HETATM 906 O  O   . HOH D 4 .  ? -9.448  10.967  -18.193 1.00 39.81 ? 68   HOH A O   1 
HETATM 907 O  O   . HOH D 4 .  ? -1.142  14.595  -11.855 1.00 27.63 ? 69   HOH A O   1 
HETATM 908 O  O   . HOH D 4 .  ? 10.749  -3.619  -22.635 1.00 40.82 ? 70   HOH A O   1 
HETATM 909 O  O   . HOH D 4 .  ? 6.739   23.721  -14.041 1.00 38.64 ? 71   HOH A O   1 
HETATM 910 O  O   . HOH D 4 .  ? 3.035   11.551  -5.557  1.00 30.39 ? 74   HOH A O   1 
HETATM 911 O  O   . HOH D 4 .  ? 4.462   9.949   -6.586  1.00 31.11 ? 75   HOH A O   1 
HETATM 912 O  O   . HOH D 4 .  ? -1.441  18.544  -20.954 1.00 33.31 ? 76   HOH A O   1 
HETATM 913 O  O   . HOH D 4 .  ? -4.422  11.539  -11.292 1.00 32.12 ? 77   HOH A O   1 
HETATM 914 O  O   . HOH D 4 .  ? -7.558  9.140   -8.298  1.00 32.27 ? 78   HOH A O   1 
HETATM 915 O  O   . HOH D 4 .  ? 10.774  11.987  -7.826  1.00 33.35 ? 79   HOH A O   1 
HETATM 916 O  O   . HOH D 4 .  ? -0.098  -1.560  -21.993 1.00 37.44 ? 80   HOH A O   1 
HETATM 917 O  O   . HOH D 4 .  ? -11.247 -2.394  -11.273 1.00 33.95 ? 81   HOH A O   1 
HETATM 918 O  O   . HOH D 4 .  ? 2.426   23.047  -16.328 1.00 34.85 ? 82   HOH A O   1 
HETATM 919 O  O   . HOH D 4 .  ? 7.185   4.065   -25.936 1.00 31.03 ? 84   HOH A O   1 
HETATM 920 O  O   . HOH D 4 .  ? 6.524   7.202   -2.053  1.00 28.62 ? 85   HOH A O   1 
HETATM 921 O  O   . HOH D 4 .  ? 3.670   16.284  -5.099  1.00 35.92 ? 86   HOH A O   1 
HETATM 922 O  O   . HOH D 4 .  ? 9.622   23.881  -17.491 1.00 27.84 ? 88   HOH A O   1 
HETATM 923 O  O   . HOH D 4 .  ? 11.871  -6.159  3.234   1.00 37.44 ? 89   HOH A O   1 
HETATM 924 O  O   . HOH D 4 .  ? 9.420   14.022  -5.833  1.00 36.82 ? 90   HOH A O   1 
HETATM 925 O  O   . HOH D 4 .  ? 4.895   14.324  -4.736  1.00 69.62 ? 91   HOH A O   1 
HETATM 926 O  O   . HOH D 4 .  ? -5.398  11.020  -8.746  1.00 30.22 ? 92   HOH A O   1 
HETATM 927 O  O   . HOH D 4 .  ? -2.196  13.932  -7.231  1.00 41.79 ? 93   HOH A O   1 
HETATM 928 O  O   . HOH D 4 .  ? -0.372  -14.002 -0.960  1.00 42.56 ? 94   HOH A O   1 
HETATM 929 O  O   . HOH D 4 .  ? 13.687  6.794   -23.398 1.00 43.40 ? 95   HOH A O   1 
HETATM 930 O  O   . HOH D 4 .  ? -9.774  -4.240  -18.315 1.00 41.03 ? 96   HOH A O   1 
HETATM 931 O  O   . HOH D 4 .  ? 5.606   12.386  -28.932 1.00 44.63 ? 97   HOH A O   1 
HETATM 932 O  O   . HOH D 4 .  ? 2.518   -14.104 -0.459  1.00 35.39 ? 98   HOH A O   1 
HETATM 933 O  O   . HOH D 4 .  ? -2.523  -14.071 -5.397  1.00 62.55 ? 99   HOH A O   1 
HETATM 934 O  O   . HOH D 4 .  ? -13.931 -1.467  -17.627 1.00 37.65 ? 100  HOH A O   1 
HETATM 935 O  O   . HOH D 4 .  ? 14.954  8.018   -12.998 1.00 40.92 ? 105  HOH A O   1 
HETATM 936 O  O   . HOH D 4 .  ? 3.660   1.263   -28.149 1.00 29.98 ? 124  HOH A O   1 
HETATM 937 O  O   . HOH D 4 .  ? 18.603  5.945   -8.250  1.00 38.76 ? 127  HOH A O   1 
HETATM 938 O  O   . HOH D 4 .  ? -14.075 -3.071  -20.031 1.00 35.24 ? 128  HOH A O   1 
HETATM 939 O  O   . HOH D 4 .  ? -17.299 -0.865  -18.151 1.00 80.62 ? 129  HOH A O   1 
HETATM 940 O  O   . HOH D 4 .  ? 4.817   20.292  -24.483 1.00 48.62 ? 131  HOH A O   1 
HETATM 941 O  O   . HOH D 4 .  ? 7.609   22.904  -21.401 1.00 36.70 ? 132  HOH A O   1 
HETATM 942 O  O   . HOH D 4 .  ? 11.499  1.627   -2.499  1.00 37.30 ? 133  HOH A O   1 
HETATM 943 O  O   . HOH D 4 .  ? -8.417  10.176  -5.816  1.00 31.11 ? 134  HOH A O   1 
HETATM 944 O  O   . HOH D 4 .  ? -7.481  11.875  -9.747  1.00 44.05 ? 135  HOH A O   1 
HETATM 945 O  O   . HOH D 4 .  ? 1.475   -6.599  -16.377 1.00 38.92 ? 136  HOH A O   1 
HETATM 946 O  O   . HOH D 4 .  ? 7.921   16.017  -26.420 1.00 42.21 ? 148  HOH A O   1 
HETATM 947 O  O   . HOH D 4 .  ? -0.013  15.205  -4.702  1.00 33.51 ? 153  HOH A O   1 
HETATM 948 O  O   . HOH D 4 .  ? -11.050 -1.793  -14.417 1.00 35.90 ? 157  HOH A O   1 
HETATM 949 O  O   . HOH D 4 .  ? -3.742  17.971  -22.269 1.00 34.46 ? 163  HOH A O   1 
HETATM 950 O  O   . HOH D 4 .  ? 9.808   15.314  -24.498 1.00 41.50 ? 169  HOH A O   1 
HETATM 951 O  O   . HOH D 4 .  ? 7.602   11.372  -24.904 1.00 35.85 ? 173  HOH A O   1 
HETATM 952 O  O   . HOH D 4 .  ? 6.014   9.490   -3.661  1.00 37.61 ? 174  HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N  N   . PRO A 1  ? 0.3081 0.2999 0.3032 0.0054  -0.0047 -0.0099 1001 PRO A N   
2   C  CA  . PRO A 1  ? 0.3061 0.2870 0.2998 0.0026  -0.0018 -0.0031 1001 PRO A CA  
3   C  C   . PRO A 1  ? 0.2950 0.2728 0.2914 0.0078  -0.0026 -0.0046 1001 PRO A C   
4   O  O   . PRO A 1  ? 0.3088 0.2426 0.2958 0.0099  -0.0175 -0.0158 1001 PRO A O   
5   C  CB  . PRO A 1  ? 0.3058 0.2980 0.2968 0.0089  -0.0065 0.0044  1001 PRO A CB  
6   C  CG  . PRO A 1  ? 0.3285 0.3173 0.3186 -0.0014 0.0064  -0.0010 1001 PRO A CG  
7   C  CD  . PRO A 1  ? 0.3216 0.3229 0.3088 0.0048  -0.0050 -0.0079 1001 PRO A CD  
8   N  N   . GLN A 2  ? 0.2881 0.2669 0.2987 0.0015  0.0046  0.0080  1002 GLN A N   
9   C  CA  . GLN A 2  ? 0.2691 0.2524 0.2853 0.0047  -0.0002 0.0071  1002 GLN A CA  
10  C  C   . GLN A 2  ? 0.2600 0.2390 0.3018 0.0192  -0.0035 0.0052  1002 GLN A C   
11  O  O   . GLN A 2  ? 0.2727 0.2349 0.3828 0.0206  -0.0292 -0.0019 1002 GLN A O   
12  C  CB  . GLN A 2  ? 0.2875 0.2443 0.2991 0.0070  -0.0017 0.0029  1002 GLN A CB  
13  C  CG  . GLN A 2  ? 0.3074 0.2686 0.3179 0.0084  0.0140  0.0225  1002 GLN A CG  
14  C  CD  . GLN A 2  ? 0.3095 0.2886 0.3281 0.0051  0.0238  0.0293  1002 GLN A CD  
15  O  OE1 . GLN A 2  ? 0.3919 0.3514 0.3869 0.0052  0.0442  0.0650  1002 GLN A OE1 
16  N  NE2 . GLN A 2  ? 0.3857 0.3586 0.4174 0.0064  0.0218  0.0769  1002 GLN A NE2 
17  N  N   . ILE A 3  ? 0.2206 0.2208 0.2426 0.0121  -0.0199 0.0115  1003 ILE A N   
18  C  CA  . ILE A 3  ? 0.2329 0.2217 0.2368 0.0048  0.0014  0.0127  1003 ILE A CA  
19  C  C   . ILE A 3  ? 0.2140 0.2133 0.2253 0.0110  -0.0080 0.0243  1003 ILE A C   
20  O  O   . ILE A 3  ? 0.2142 0.2097 0.2189 0.0107  -0.0075 0.0403  1003 ILE A O   
21  C  CB  . ILE A 3  ? 0.2213 0.2237 0.2295 0.0192  -0.0040 0.0151  1003 ILE A CB  
22  C  CG1 . ILE A 3  ? 0.2566 0.2418 0.2593 0.0047  -0.0135 0.0259  1003 ILE A CG1 
23  C  CG2 . ILE A 3  ? 0.2437 0.2465 0.2386 0.0071  -0.0066 0.0174  1003 ILE A CG2 
24  C  CD1 . ILE A 3  ? 0.2439 0.2294 0.2230 -0.0016 -0.0005 0.0040  1003 ILE A CD1 
25  N  N   . THR A 4  ? 0.1918 0.1969 0.2324 0.0167  -0.0002 0.0269  1004 THR A N   
26  C  CA  . THR A 4  ? 0.2061 0.1972 0.2258 0.0192  0.0057  0.0253  1004 THR A CA  
27  C  C   . THR A 4  ? 0.2103 0.2030 0.2156 0.0103  0.0015  0.0336  1004 THR A C   
28  O  O   . THR A 4  ? 0.2096 0.2409 0.2219 0.0162  0.0213  0.0194  1004 THR A O   
29  C  CB  . THR A 4  ? 0.2220 0.2098 0.2295 0.0195  0.0141  0.0322  1004 THR A CB  
30  O  OG1 . THR A 4  ? 0.2681 0.2191 0.2677 0.0670  0.0301  0.0540  1004 THR A OG1 
31  C  CG2 . THR A 4  ? 0.2169 0.1997 0.2558 0.0179  -0.0037 0.0129  1004 THR A CG2 
32  N  N   . LEU A 5  ? 0.1921 0.1866 0.1961 0.0228  -0.0008 0.0360  1005 LEU A N   
33  C  CA  . LEU A 5  ? 0.2017 0.1856 0.1931 0.0075  0.0047  0.0280  1005 LEU A CA  
34  C  C   . LEU A 5  ? 0.1966 0.1712 0.1959 0.0021  0.0011  0.0256  1005 LEU A C   
35  O  O   . LEU A 5  ? 0.1957 0.1864 0.1781 0.0156  0.0170  0.0389  1005 LEU A O   
36  C  CB  . LEU A 5  ? 0.2105 0.1838 0.1854 0.0235  0.0034  0.0453  1005 LEU A CB  
37  C  CG  . LEU A 5  ? 0.2022 0.1702 0.1991 0.0248  0.0037  0.0356  1005 LEU A CG  
38  C  CD1 . LEU A 5  ? 0.2246 0.1979 0.2023 0.0440  0.0008  0.0323  1005 LEU A CD1 
39  C  CD2 . LEU A 5  ? 0.2005 0.2294 0.1944 0.0081  0.0042  0.0382  1005 LEU A CD2 
40  N  N   . TRP A 6  ? 0.1874 0.1736 0.2057 0.0088  0.0056  0.0320  1006 TRP A N   
41  C  CA  . TRP A 6  ? 0.1834 0.1814 0.1799 0.0079  0.0042  0.0301  1006 TRP A CA  
42  C  C   . TRP A 6  ? 0.2028 0.2118 0.1906 -0.0086 -0.0067 0.0267  1006 TRP A C   
43  O  O   . TRP A 6  ? 0.2168 0.2717 0.2220 -0.0257 -0.0078 0.0813  1006 TRP A O   
44  C  CB  . TRP A 6  ? 0.2013 0.1685 0.1480 -0.0004 0.0094  0.0100  1006 TRP A CB  
45  C  CG  . TRP A 6  ? 0.2037 0.1310 0.1300 0.0036  0.0060  0.0132  1006 TRP A CG  
46  C  CD1 . TRP A 6  ? 0.1726 0.1445 0.1145 -0.0074 -0.0050 0.0115  1006 TRP A CD1 
47  C  CD2 . TRP A 6  ? 0.2302 0.0819 0.1284 -0.0041 -0.0068 -0.0052 1006 TRP A CD2 
48  N  NE1 . TRP A 6  ? 0.2140 0.1157 0.1196 -0.0012 0.0135  -0.0051 1006 TRP A NE1 
49  C  CE2 . TRP A 6  ? 0.2667 0.1114 0.0982 -0.0076 0.0175  -0.0140 1006 TRP A CE2 
50  C  CE3 . TRP A 6  ? 0.2299 0.1306 0.1170 0.0075  0.0195  -0.0226 1006 TRP A CE3 
51  C  CZ2 . TRP A 6  ? 0.2193 0.1760 0.1237 -0.0315 0.0003  -0.0081 1006 TRP A CZ2 
52  C  CZ3 . TRP A 6  ? 0.2317 0.1638 0.1284 -0.0103 0.0024  -0.0140 1006 TRP A CZ3 
53  C  CH2 . TRP A 6  ? 0.2318 0.1894 0.1259 -0.0061 0.0175  -0.0241 1006 TRP A CH2 
54  N  N   A LYS A 7  ? 0.1918 0.2139 0.1935 -0.0028 -0.0057 0.0332  1007 LYS A N   
55  N  N   B LYS A 7  ? 0.1882 0.2150 0.1949 -0.0023 -0.0085 0.0424  1007 LYS A N   
56  C  CA  A LYS A 7  ? 0.2019 0.2081 0.1887 0.0014  -0.0018 0.0184  1007 LYS A CA  
57  C  CA  B LYS A 7  ? 0.2019 0.2023 0.1882 0.0009  -0.0043 0.0271  1007 LYS A CA  
58  C  C   A LYS A 7  ? 0.1961 0.2044 0.1733 0.0031  -0.0008 0.0177  1007 LYS A C   
59  C  C   B LYS A 7  ? 0.1973 0.1974 0.1830 0.0009  -0.0077 0.0245  1007 LYS A C   
60  O  O   A LYS A 7  ? 0.1938 0.2216 0.1199 0.0026  0.0168  0.0276  1007 LYS A O   
61  O  O   B LYS A 7  ? 0.1910 0.1937 0.1546 -0.0071 -0.0162 0.0430  1007 LYS A O   
62  C  CB  A LYS A 7  ? 0.2082 0.2092 0.2092 0.0057  -0.0043 0.0181  1007 LYS A CB  
63  C  CB  B LYS A 7  ? 0.2242 0.2107 0.2292 0.0108  -0.0086 0.0278  1007 LYS A CB  
64  C  CG  A LYS A 7  ? 0.2301 0.2120 0.2282 0.0101  -0.0142 -0.0002 1007 LYS A CG  
65  C  CG  B LYS A 7  ? 0.2695 0.2464 0.2599 0.0049  0.0012  0.0249  1007 LYS A CG  
66  C  CD  A LYS A 7  ? 0.2368 0.2467 0.2422 0.0015  -0.0099 0.0061  1007 LYS A CD  
67  C  CD  B LYS A 7  ? 0.3143 0.3066 0.3099 -0.0180 -0.0080 0.0215  1007 LYS A CD  
68  C  CE  A LYS A 7  ? 0.2578 0.2657 0.2651 -0.0017 -0.0065 -0.0072 1007 LYS A CE  
69  C  CE  B LYS A 7  ? 0.3286 0.3112 0.3278 -0.0076 -0.0138 0.0009  1007 LYS A CE  
70  N  NZ  A LYS A 7  ? 0.2905 0.3043 0.3030 -0.0007 -0.0253 0.0063  1007 LYS A NZ  
71  N  NZ  B LYS A 7  ? 0.3540 0.3247 0.3861 -0.0227 -0.0147 -0.0301 1007 LYS A NZ  
72  N  N   A ARG A 8  ? 0.1896 0.1988 0.1633 0.0021  0.0064  0.0170  1008 ARG A N   
73  N  N   B ARG A 8  ? 0.1868 0.1887 0.1628 0.0018  0.0000  0.0242  1008 ARG A N   
74  C  CA  A ARG A 8  ? 0.2011 0.1995 0.1722 0.0056  -0.0017 0.0132  1008 ARG A CA  
75  C  CA  B ARG A 8  ? 0.1960 0.1926 0.1644 0.0056  -0.0031 0.0175  1008 ARG A CA  
76  C  C   A ARG A 8  ? 0.2051 0.1966 0.1529 0.0048  0.0048  0.0134  1008 ARG A C   
77  C  C   B ARG A 8  ? 0.2041 0.1944 0.1509 0.0048  0.0042  0.0152  1008 ARG A C   
78  O  O   A ARG A 8  ? 0.2333 0.1837 0.1477 0.0108  -0.0051 0.0187  1008 ARG A O   
79  O  O   B ARG A 8  ? 0.2339 0.1837 0.1468 0.0108  -0.0029 0.0172  1008 ARG A O   
80  C  CB  A ARG A 8  ? 0.2069 0.2061 0.1725 -0.0058 -0.0002 0.0093  1008 ARG A CB  
81  C  CB  B ARG A 8  ? 0.2030 0.2032 0.1603 -0.0067 -0.0003 0.0146  1008 ARG A CB  
82  C  CG  A ARG A 8  ? 0.2111 0.2179 0.1991 -0.0105 0.0000  0.0085  1008 ARG A CG  
83  C  CG  B ARG A 8  ? 0.1866 0.1969 0.1687 -0.0093 -0.0004 0.0157  1008 ARG A CG  
84  C  CD  A ARG A 8  ? 0.2547 0.2483 0.2403 -0.0055 0.0129  -0.0011 1008 ARG A CD  
85  C  CD  B ARG A 8  ? 0.2224 0.2186 0.1820 -0.0030 0.0099  0.0143  1008 ARG A CD  
86  N  NE  A ARG A 8  ? 0.2927 0.3043 0.2913 -0.0248 0.0316  0.0054  1008 ARG A NE  
87  N  NE  B ARG A 8  ? 0.2082 0.2480 0.1614 -0.0222 0.0275  0.0243  1008 ARG A NE  
88  C  CZ  A ARG A 8  ? 0.3202 0.3197 0.3156 -0.0160 0.0041  0.0026  1008 ARG A CZ  
89  C  CZ  B ARG A 8  ? 0.2526 0.3032 0.2410 -0.0214 0.0280  0.0032  1008 ARG A CZ  
90  N  NH1 A ARG A 8  ? 0.3294 0.3225 0.3033 -0.0429 0.0195  0.0066  1008 ARG A NH1 
91  N  NH1 B ARG A 8  ? 0.3038 0.3338 0.2344 -0.0119 0.0535  -0.0022 1008 ARG A NH1 
92  N  NH2 A ARG A 8  ? 0.3295 0.2985 0.2790 -0.0145 0.0373  -0.0072 1008 ARG A NH2 
93  N  NH2 B ARG A 8  ? 0.2278 0.3366 0.2182 -0.0207 0.0565  -0.0053 1008 ARG A NH2 
94  N  N   . PRO A 9  ? 0.2058 0.1939 0.1400 0.0105  -0.0018 0.0158  1009 PRO A N   
95  C  CA  . PRO A 9  ? 0.2183 0.2011 0.1552 0.0060  -0.0057 0.0175  1009 PRO A CA  
96  C  C   . PRO A 9  ? 0.2282 0.1993 0.1469 0.0062  -0.0216 0.0086  1009 PRO A C   
97  O  O   . PRO A 9  ? 0.2370 0.1899 0.1433 0.0099  -0.0288 0.0077  1009 PRO A O   
98  C  CB  . PRO A 9  ? 0.2222 0.2088 0.1411 0.0015  -0.0218 0.0301  1009 PRO A CB  
99  C  CG  . PRO A 9  ? 0.2220 0.2025 0.1547 0.0236  -0.0047 0.0124  1009 PRO A CG  
100 C  CD  . PRO A 9  ? 0.2099 0.1991 0.1456 0.0219  -0.0119 0.0230  1009 PRO A CD  
101 N  N   . LEU A 10 ? 0.2361 0.1927 0.1448 0.0164  -0.0096 0.0217  1010 LEU A N   
102 C  CA  . LEU A 10 ? 0.2494 0.2071 0.1750 0.0047  -0.0010 0.0106  1010 LEU A CA  
103 C  C   . LEU A 10 ? 0.2787 0.1945 0.1715 0.0108  -0.0019 0.0152  1010 LEU A C   
104 O  O   . LEU A 10 ? 0.3429 0.2169 0.2020 0.0182  -0.0070 0.0101  1010 LEU A O   
105 C  CB  . LEU A 10 ? 0.2508 0.2207 0.1930 0.0104  0.0040  0.0113  1010 LEU A CB  
106 C  CG  . LEU A 10 ? 0.2317 0.2465 0.2152 -0.0221 0.0146  0.0245  1010 LEU A CG  
107 C  CD1 . LEU A 10 ? 0.3325 0.2779 0.3182 -0.0143 -0.0217 0.0267  1010 LEU A CD1 
108 C  CD2 . LEU A 10 ? 0.2985 0.3187 0.3028 -0.0078 -0.0145 -0.0205 1010 LEU A CD2 
109 N  N   . VAL A 11 ? 0.2755 0.1967 0.1806 0.0152  -0.0144 0.0084  1011 VAL A N   
110 C  CA  . VAL A 11 ? 0.2812 0.2209 0.2040 0.0095  -0.0092 -0.0056 1011 VAL A CA  
111 C  C   . VAL A 11 ? 0.2938 0.2223 0.2190 0.0056  -0.0073 -0.0046 1011 VAL A C   
112 O  O   . VAL A 11 ? 0.3297 0.2338 0.1745 0.0117  -0.0060 -0.0017 1011 VAL A O   
113 C  CB  . VAL A 11 ? 0.2980 0.2428 0.2260 -0.0016 -0.0207 -0.0071 1011 VAL A CB  
114 C  CG1 . VAL A 11 ? 0.3102 0.2823 0.2630 0.0019  0.0064  -0.0208 1011 VAL A CG1 
115 C  CG2 . VAL A 11 ? 0.3287 0.2536 0.2367 0.0224  -0.0219 -0.0129 1011 VAL A CG2 
116 N  N   . THR A 12 ? 0.3103 0.2425 0.2069 0.0102  -0.0132 -0.0069 1012 THR A N   
117 C  CA  . THR A 12 ? 0.2897 0.2630 0.2376 0.0158  -0.0041 -0.0130 1012 THR A CA  
118 C  C   . THR A 12 ? 0.2566 0.2544 0.2099 0.0014  -0.0097 0.0034  1012 THR A C   
119 O  O   . THR A 12 ? 0.3069 0.2771 0.2230 -0.0132 -0.0267 0.0071  1012 THR A O   
120 C  CB  . THR A 12 ? 0.3231 0.2909 0.2533 0.0143  -0.0122 -0.0190 1012 THR A CB  
121 O  OG1 . THR A 12 ? 0.3727 0.3205 0.2817 0.0792  -0.0052 -0.0515 1012 THR A OG1 
122 C  CG2 . THR A 12 ? 0.3094 0.2729 0.2158 0.0187  -0.0037 -0.0138 1012 THR A CG2 
123 N  N   . ILE A 13 ? 0.2408 0.2649 0.1956 0.0060  -0.0097 0.0033  1013 ILE A N   
124 C  CA  . ILE A 13 ? 0.2295 0.2434 0.1823 0.0018  0.0037  0.0123  1013 ILE A CA  
125 C  C   . ILE A 13 ? 0.2073 0.2651 0.1695 -0.0014 0.0158  0.0079  1013 ILE A C   
126 O  O   . ILE A 13 ? 0.2161 0.3061 0.1738 0.0132  0.0096  0.0049  1013 ILE A O   
127 C  CB  . ILE A 13 ? 0.2138 0.2412 0.1779 0.0108  0.0018  0.0213  1013 ILE A CB  
128 C  CG1 . ILE A 13 ? 0.2551 0.2212 0.2164 -0.0105 0.0076  0.0259  1013 ILE A CG1 
129 C  CG2 . ILE A 13 ? 0.2528 0.2559 0.1848 -0.0109 0.0199  0.0031  1013 ILE A CG2 
130 C  CD1 . ILE A 13 ? 0.2568 0.2526 0.2132 0.0009  0.0120  -0.0140 1013 ILE A CD1 
131 N  N   . LYS A 14 ? 0.2075 0.2127 0.1493 -0.0006 0.0088  0.0232  1014 LYS A N   
132 C  CA  . LYS A 14 ? 0.2150 0.2265 0.1724 -0.0035 0.0061  0.0076  1014 LYS A CA  
133 C  C   . LYS A 14 ? 0.2098 0.2186 0.1501 -0.0068 0.0033  0.0072  1014 LYS A C   
134 O  O   . LYS A 14 ? 0.1805 0.2159 0.1554 0.0050  0.0024  0.0200  1014 LYS A O   
135 C  CB  . LYS A 14 ? 0.2430 0.2433 0.2009 -0.0096 0.0120  0.0078  1014 LYS A CB  
136 C  CG  . LYS A 14 ? 0.2898 0.2878 0.2395 -0.0105 -0.0169 -0.0074 1014 LYS A CG  
137 C  CD  . LYS A 14 ? 0.3104 0.2968 0.2831 -0.0059 -0.0197 -0.0113 1014 LYS A CD  
138 C  CE  . LYS A 14 ? 0.3368 0.3313 0.3435 -0.0042 -0.0217 -0.0108 1014 LYS A CE  
139 N  NZ  . LYS A 14 ? 0.3844 0.3358 0.2865 -0.0216 -0.0410 -0.0264 1014 LYS A NZ  
140 N  N   . ILE A 15 ? 0.1901 0.2024 0.1440 -0.0036 0.0167  -0.0001 1015 ILE A N   
141 C  CA  . ILE A 15 ? 0.1921 0.2032 0.1579 -0.0016 0.0136  0.0096  1015 ILE A CA  
142 C  C   . ILE A 15 ? 0.1983 0.2202 0.1623 0.0067  0.0147  0.0141  1015 ILE A C   
143 O  O   . ILE A 15 ? 0.1930 0.2501 0.1555 -0.0050 0.0284  0.0026  1015 ILE A O   
144 C  CB  . ILE A 15 ? 0.1802 0.2023 0.1622 -0.0049 0.0047  0.0000  1015 ILE A CB  
145 C  CG1 . ILE A 15 ? 0.2015 0.2020 0.1760 -0.0128 0.0168  0.0017  1015 ILE A CG1 
146 C  CG2 . ILE A 15 ? 0.2228 0.2090 0.1726 -0.0049 0.0102  -0.0029 1015 ILE A CG2 
147 C  CD1 . ILE A 15 ? 0.2267 0.2245 0.1950 0.0030  0.0019  0.0152  1015 ILE A CD1 
148 N  N   . GLY A 16 ? 0.2035 0.2332 0.1604 0.0111  0.0255  0.0231  1016 GLY A N   
149 C  CA  . GLY A 16 ? 0.2141 0.2319 0.1869 -0.0058 0.0231  0.0171  1016 GLY A CA  
150 C  C   . GLY A 16 ? 0.2202 0.2326 0.1907 0.0011  0.0185  0.0113  1016 GLY A C   
151 O  O   . GLY A 16 ? 0.2435 0.2708 0.1887 -0.0083 0.0438  0.0146  1016 GLY A O   
152 N  N   . GLY A 17 ? 0.2101 0.2233 0.1801 0.0073  0.0226  0.0037  1017 GLY A N   
153 C  CA  . GLY A 17 ? 0.2133 0.2384 0.1915 0.0098  0.0257  0.0002  1017 GLY A CA  
154 C  C   . GLY A 17 ? 0.2222 0.2576 0.2065 0.0177  0.0219  -0.0058 1017 GLY A C   
155 O  O   . GLY A 17 ? 0.2478 0.2967 0.2154 0.0315  0.0218  -0.0450 1017 GLY A O   
156 N  N   . GLN A 18 ? 0.2178 0.2596 0.2036 0.0185  0.0178  -0.0087 1018 GLN A N   
157 C  CA  . GLN A 18 ? 0.2414 0.2700 0.2258 0.0036  0.0170  -0.0020 1018 GLN A CA  
158 C  C   . GLN A 18 ? 0.2389 0.2623 0.2232 0.0041  0.0214  0.0009  1018 GLN A C   
159 O  O   . GLN A 18 ? 0.2311 0.2741 0.2381 0.0262  0.0561  -0.0038 1018 GLN A O   
160 C  CB  . GLN A 18 ? 0.2597 0.2823 0.2481 -0.0039 0.0132  0.0052  1018 GLN A CB  
161 C  CG  . GLN A 18 ? 0.2912 0.3228 0.3169 0.0012  -0.0016 -0.0032 1018 GLN A CG  
162 C  CD  . GLN A 18 ? 0.2636 0.2846 0.3040 0.0016  0.0127  -0.0119 1018 GLN A CD  
163 O  OE1 . GLN A 18 ? 0.2727 0.2602 0.3678 0.0356  0.0337  -0.0183 1018 GLN A OE1 
164 N  NE2 . GLN A 18 ? 0.3033 0.3047 0.3575 -0.0015 -0.0087 -0.0364 1018 GLN A NE2 
165 N  N   . LEU A 19 ? 0.2460 0.2941 0.2317 0.0120  0.0221  -0.0035 1019 LEU A N   
166 C  CA  . LEU A 19 ? 0.2641 0.3077 0.2673 0.0019  0.0108  -0.0034 1019 LEU A CA  
167 C  C   . LEU A 19 ? 0.2544 0.3287 0.2582 0.0035  0.0057  -0.0047 1019 LEU A C   
168 O  O   . LEU A 19 ? 0.2335 0.3954 0.2477 0.0030  0.0092  0.0003  1019 LEU A O   
169 C  CB  . LEU A 19 ? 0.2709 0.3212 0.3043 0.0036  0.0150  0.0008  1019 LEU A CB  
170 C  CG  . LEU A 19 ? 0.3388 0.3445 0.3263 0.0056  0.0085  -0.0201 1019 LEU A CG  
171 C  CD1 . LEU A 19 ? 0.3758 0.3609 0.3890 0.0128  0.0026  -0.0092 1019 LEU A CD1 
172 C  CD2 . LEU A 19 ? 0.3611 0.3778 0.3839 -0.0018 0.0144  -0.0244 1019 LEU A CD2 
173 N  N   . LYS A 20 ? 0.2323 0.3168 0.2383 -0.0006 0.0015  0.0085  1020 LYS A N   
174 C  CA  . LYS A 20 ? 0.2634 0.2981 0.2472 0.0013  0.0076  0.0047  1020 LYS A CA  
175 C  C   . LYS A 20 ? 0.2546 0.2836 0.2441 -0.0035 -0.0011 0.0178  1020 LYS A C   
176 O  O   . LYS A 20 ? 0.2724 0.3255 0.2469 0.0004  -0.0054 0.0541  1020 LYS A O   
177 C  CB  . LYS A 20 ? 0.2745 0.2954 0.2431 -0.0106 -0.0041 0.0178  1020 LYS A CB  
178 C  CG  . LYS A 20 ? 0.3171 0.3247 0.2642 -0.0044 -0.0090 0.0120  1020 LYS A CG  
179 C  CD  . LYS A 20 ? 0.2939 0.3160 0.2753 0.0014  0.0127  0.0088  1020 LYS A CD  
180 C  CE  . LYS A 20 ? 0.3260 0.3260 0.3083 -0.0021 0.0157  0.0139  1020 LYS A CE  
181 N  NZ  . LYS A 20 ? 0.3111 0.3529 0.3139 -0.0089 0.0099  -0.0087 1020 LYS A NZ  
182 N  N   A GLU A 21 ? 0.2601 0.2711 0.2352 0.0068  0.0030  0.0036  1021 GLU A N   
183 N  N   B GLU A 21 ? 0.2558 0.2695 0.2312 0.0071  0.0027  0.0019  1021 GLU A N   
184 C  CA  A GLU A 21 ? 0.2628 0.2654 0.2359 0.0065  0.0002  0.0053  1021 GLU A CA  
185 C  CA  B GLU A 21 ? 0.2593 0.2632 0.2334 0.0077  -0.0006 0.0043  1021 GLU A CA  
186 C  C   A GLU A 21 ? 0.2519 0.2530 0.2209 0.0094  -0.0025 0.0018  1021 GLU A C   
187 C  C   B GLU A 21 ? 0.2517 0.2518 0.2187 0.0092  -0.0038 0.0028  1021 GLU A C   
188 O  O   A GLU A 21 ? 0.2572 0.2650 0.2115 0.0148  0.0087  -0.0098 1021 GLU A O   
189 O  O   B GLU A 21 ? 0.2586 0.2561 0.2053 0.0102  0.0082  -0.0008 1021 GLU A O   
190 C  CB  A GLU A 21 ? 0.2755 0.2624 0.2379 0.0065  -0.0006 0.0037  1021 GLU A CB  
191 C  CB  B GLU A 21 ? 0.2800 0.2687 0.2431 0.0088  -0.0023 0.0011  1021 GLU A CB  
192 C  CG  A GLU A 21 ? 0.2808 0.2748 0.2542 0.0082  0.0015  0.0113  1021 GLU A CG  
193 C  CG  B GLU A 21 ? 0.2923 0.2955 0.2906 0.0191  -0.0095 -0.0017 1021 GLU A CG  
194 C  CD  A GLU A 21 ? 0.3065 0.2911 0.2743 0.0004  -0.0013 0.0103  1021 GLU A CD  
195 C  CD  B GLU A 21 ? 0.3476 0.3556 0.3347 0.0087  -0.0113 -0.0053 1021 GLU A CD  
196 O  OE1 A GLU A 21 ? 0.3307 0.3812 0.3000 0.0043  -0.0287 0.0128  1021 GLU A OE1 
197 O  OE1 B GLU A 21 ? 0.3832 0.4013 0.4094 0.0266  -0.0149 -0.0300 1021 GLU A OE1 
198 O  OE2 A GLU A 21 ? 0.4056 0.3094 0.3396 0.0166  -0.0033 0.0191  1021 GLU A OE2 
199 O  OE2 B GLU A 21 ? 0.3703 0.4045 0.3748 0.0347  -0.0239 0.0140  1021 GLU A OE2 
200 N  N   . ALA A 22 ? 0.2562 0.2362 0.1864 0.0099  -0.0130 0.0257  1022 ALA A N   
201 C  CA  . ALA A 22 ? 0.2367 0.2306 0.1796 0.0059  -0.0038 0.0146  1022 ALA A CA  
202 C  C   . ALA A 22 ? 0.2487 0.2054 0.1477 0.0025  0.0017  0.0153  1022 ALA A C   
203 O  O   . ALA A 22 ? 0.2838 0.2010 0.1434 0.0068  -0.0066 0.0151  1022 ALA A O   
204 C  CB  . ALA A 22 ? 0.2249 0.2300 0.1557 0.0043  -0.0062 0.0296  1022 ALA A CB  
205 N  N   . LEU A 23 ? 0.2356 0.2018 0.1387 0.0001  -0.0056 0.0209  1023 LEU A N   
206 C  CA  . LEU A 23 ? 0.2433 0.2071 0.1603 -0.0041 -0.0029 0.0155  1023 LEU A CA  
207 C  C   . LEU A 23 ? 0.2382 0.1898 0.1406 -0.0084 -0.0104 0.0315  1023 LEU A C   
208 O  O   . LEU A 23 ? 0.2598 0.1955 0.1607 0.0271  -0.0164 0.0470  1023 LEU A O   
209 C  CB  . LEU A 23 ? 0.2309 0.1954 0.1613 -0.0127 -0.0108 0.0178  1023 LEU A CB  
210 C  CG  . LEU A 23 ? 0.2320 0.2109 0.1847 -0.0184 -0.0102 0.0127  1023 LEU A CG  
211 C  CD1 . LEU A 23 ? 0.2842 0.2415 0.1792 0.0139  -0.0078 -0.0045 1023 LEU A CD1 
212 C  CD2 . LEU A 23 ? 0.2728 0.2354 0.1670 -0.0189 -0.0192 -0.0065 1023 LEU A CD2 
213 N  N   . LEU A 24 ? 0.2341 0.1756 0.1342 -0.0012 -0.0133 0.0223  1024 LEU A N   
214 C  CA  . LEU A 24 ? 0.2294 0.1821 0.1491 0.0002  -0.0233 0.0198  1024 LEU A CA  
215 C  C   . LEU A 24 ? 0.2368 0.1855 0.1464 0.0024  -0.0147 0.0095  1024 LEU A C   
216 O  O   . LEU A 24 ? 0.2945 0.1781 0.1321 0.0246  -0.0304 0.0312  1024 LEU A O   
217 C  CB  . LEU A 24 ? 0.2312 0.1887 0.1500 0.0071  -0.0144 0.0151  1024 LEU A CB  
218 C  CG  . LEU A 24 ? 0.2668 0.1934 0.1654 0.0019  -0.0251 0.0207  1024 LEU A CG  
219 C  CD1 . LEU A 24 ? 0.2749 0.2058 0.2127 -0.0017 -0.0206 -0.0190 1024 LEU A CD1 
220 C  CD2 . LEU A 24 ? 0.3066 0.2335 0.1658 0.0127  -0.0570 -0.0090 1024 LEU A CD2 
221 N  N   . ASP A 25 ? 0.2349 0.2041 0.1333 -0.0050 -0.0201 0.0127  1025 ASP A N   
222 C  CA  . ASP A 25 ? 0.2248 0.1816 0.1528 0.0091  -0.0152 0.0107  1025 ASP A CA  
223 C  C   . ASP A 25 ? 0.1971 0.1837 0.1294 0.0082  -0.0216 0.0147  1025 ASP A C   
224 O  O   . ASP A 25 ? 0.2733 0.1781 0.1378 0.0343  -0.0512 0.0160  1025 ASP A O   
225 C  CB  . ASP A 25 ? 0.2267 0.1994 0.1694 0.0037  -0.0169 -0.0021 1025 ASP A CB  
226 C  CG  . ASP A 25 ? 0.2678 0.2205 0.1955 -0.0046 -0.0136 -0.0008 1025 ASP A CG  
227 O  OD1 . ASP A 25 ? 0.2651 0.2685 0.1666 0.0088  -0.0312 -0.0044 1025 ASP A OD1 
228 O  OD2 . ASP A 25 ? 0.2932 0.2504 0.2005 -0.0047 0.0093  0.0225  1025 ASP A OD2 
229 N  N   . THR A 26 ? 0.2239 0.1877 0.1295 0.0154  -0.0335 0.0171  1026 THR A N   
230 C  CA  . THR A 26 ? 0.2135 0.1957 0.1295 0.0076  -0.0330 0.0105  1026 THR A CA  
231 C  C   . THR A 26 ? 0.2132 0.1949 0.1374 0.0148  -0.0324 0.0130  1026 THR A C   
232 O  O   . THR A 26 ? 0.2573 0.2011 0.1550 0.0300  -0.0411 -0.0002 1026 THR A O   
233 C  CB  . THR A 26 ? 0.1885 0.1999 0.1292 0.0183  -0.0225 0.0025  1026 THR A CB  
234 O  OG1 . THR A 26 ? 0.2065 0.2383 0.1249 0.0195  -0.0578 0.0210  1026 THR A OG1 
235 C  CG2 . THR A 26 ? 0.1855 0.2164 0.1229 0.0099  -0.0399 0.0146  1026 THR A CG2 
236 N  N   . GLY A 27 ? 0.2321 0.1918 0.1438 0.0141  -0.0380 0.0179  1027 GLY A N   
237 C  CA  . GLY A 27 ? 0.2361 0.2041 0.1664 0.0014  -0.0295 0.0112  1027 GLY A CA  
238 C  C   . GLY A 27 ? 0.2718 0.2031 0.1724 -0.0052 -0.0348 0.0040  1027 GLY A C   
239 O  O   . GLY A 27 ? 0.3488 0.2149 0.1611 -0.0028 -0.0484 0.0047  1027 GLY A O   
240 N  N   . ALA A 28 ? 0.2641 0.2075 0.1475 -0.0017 -0.0379 0.0065  1028 ALA A N   
241 C  CA  . ALA A 28 ? 0.2370 0.1933 0.1695 -0.0021 -0.0209 0.0048  1028 ALA A CA  
242 C  C   . ALA A 28 ? 0.2363 0.1654 0.1558 0.0024  -0.0281 0.0032  1028 ALA A C   
243 O  O   . ALA A 28 ? 0.2598 0.1698 0.1470 -0.0104 -0.0298 0.0042  1028 ALA A O   
244 C  CB  . ALA A 28 ? 0.2495 0.2164 0.1828 0.0111  -0.0294 0.0069  1028 ALA A CB  
245 N  N   . ASP A 29 ? 0.2391 0.1698 0.1465 -0.0019 -0.0130 -0.0078 1029 ASP A N   
246 C  CA  . ASP A 29 ? 0.2243 0.1805 0.1574 0.0074  -0.0113 -0.0117 1029 ASP A CA  
247 C  C   . ASP A 29 ? 0.2147 0.1948 0.1554 -0.0029 -0.0089 -0.0129 1029 ASP A C   
248 O  O   . ASP A 29 ? 0.2246 0.2149 0.1589 0.0092  -0.0026 -0.0193 1029 ASP A O   
249 C  CB  . ASP A 29 ? 0.2600 0.1754 0.1620 0.0018  -0.0051 -0.0145 1029 ASP A CB  
250 C  CG  . ASP A 29 ? 0.3269 0.2260 0.1864 -0.0064 -0.0049 -0.0326 1029 ASP A CG  
251 O  OD1 . ASP A 29 ? 0.3482 0.2280 0.1581 -0.0045 0.0024  -0.0291 1029 ASP A OD1 
252 O  OD2 . ASP A 29 ? 0.4890 0.2618 0.2219 -0.0348 0.0472  -0.0528 1029 ASP A OD2 
253 N  N   . ASP A 30 ? 0.2116 0.1907 0.1348 0.0066  -0.0093 -0.0074 1030 ASP A N   
254 C  CA  . ASP A 30 ? 0.2123 0.1932 0.1633 0.0004  -0.0237 -0.0058 1030 ASP A CA  
255 C  C   . ASP A 30 ? 0.1935 0.1884 0.1513 0.0033  -0.0273 -0.0022 1030 ASP A C   
256 O  O   . ASP A 30 ? 0.2223 0.2027 0.1474 0.0193  -0.0482 0.0080  1030 ASP A O   
257 C  CB  . ASP A 30 ? 0.2345 0.2077 0.1684 0.0143  -0.0175 -0.0032 1030 ASP A CB  
258 C  CG  . ASP A 30 ? 0.2841 0.2475 0.1781 -0.0007 -0.0328 -0.0309 1030 ASP A CG  
259 O  OD1 . ASP A 30 ? 0.3263 0.3196 0.2156 0.0647  -0.0413 -0.0075 1030 ASP A OD1 
260 O  OD2 . ASP A 30 ? 0.3540 0.2888 0.3844 -0.0447 -0.0723 -0.0967 1030 ASP A OD2 
261 N  N   . THR A 31 ? 0.1981 0.1879 0.1500 0.0053  -0.0173 -0.0065 1031 THR A N   
262 C  CA  . THR A 31 ? 0.1748 0.1688 0.1352 -0.0046 -0.0080 0.0143  1031 THR A CA  
263 C  C   . THR A 31 ? 0.1624 0.1642 0.1384 0.0012  -0.0136 0.0066  1031 THR A C   
264 O  O   . THR A 31 ? 0.2012 0.1893 0.1335 -0.0097 -0.0243 0.0318  1031 THR A O   
265 C  CB  . THR A 31 ? 0.1797 0.1623 0.1360 0.0040  -0.0093 0.0183  1031 THR A CB  
266 O  OG1 . THR A 31 ? 0.1698 0.1954 0.1245 -0.0150 -0.0067 0.0239  1031 THR A OG1 
267 C  CG2 . THR A 31 ? 0.1819 0.1740 0.1349 -0.0110 0.0026  0.0095  1031 THR A CG2 
268 N  N   A VAL A 32 ? 0.1564 0.1708 0.1344 -0.0034 -0.0058 0.0271  1032 VAL A N   
269 N  N   B VAL A 32 ? 0.1617 0.1691 0.1397 -0.0017 -0.0078 0.0171  1032 VAL A N   
270 C  CA  A VAL A 32 ? 0.1800 0.1729 0.1443 -0.0087 -0.0066 0.0191  1032 VAL A CA  
271 C  CA  B VAL A 32 ? 0.1706 0.1677 0.1434 -0.0040 -0.0074 0.0107  1032 VAL A CA  
272 C  C   A VAL A 32 ? 0.1702 0.1811 0.1393 -0.0128 -0.0222 0.0163  1032 VAL A C   
273 C  C   B VAL A 32 ? 0.1688 0.1769 0.1465 -0.0066 -0.0135 0.0121  1032 VAL A C   
274 O  O   A VAL A 32 ? 0.1899 0.1656 0.1333 0.0103  -0.0292 0.0211  1032 VAL A O   
275 O  O   B VAL A 32 ? 0.1742 0.1751 0.1423 -0.0060 -0.0160 0.0109  1032 VAL A O   
276 C  CB  A VAL A 32 ? 0.1917 0.1871 0.1760 -0.0109 0.0014  0.0161  1032 VAL A CB  
277 C  CB  B VAL A 32 ? 0.1555 0.1663 0.1518 -0.0027 -0.0047 0.0129  1032 VAL A CB  
278 C  CG1 A VAL A 32 ? 0.2367 0.2099 0.2110 0.0082  -0.0089 0.0039  1032 VAL A CG1 
279 C  CG1 B VAL A 32 ? 0.1445 0.1048 0.0794 -0.0077 -0.0027 -0.0189 1032 VAL A CG1 
280 C  CG2 A VAL A 32 ? 0.1590 0.1541 0.1535 -0.0101 -0.0042 0.0048  1032 VAL A CG2 
281 C  CG2 B VAL A 32 ? 0.2080 0.1923 0.2220 -0.0003 0.0051  -0.0100 1032 VAL A CG2 
282 N  N   . LEU A 33 ? 0.1770 0.1819 0.1387 -0.0007 -0.0197 0.0206  1033 LEU A N   
283 C  CA  . LEU A 33 ? 0.1911 0.1931 0.1540 0.0030  -0.0136 0.0117  1033 LEU A CA  
284 C  C   . LEU A 33 ? 0.1653 0.1827 0.1458 0.0070  -0.0222 -0.0010 1033 LEU A C   
285 O  O   . LEU A 33 ? 0.1665 0.1886 0.1546 0.0142  -0.0153 0.0081  1033 LEU A O   
286 C  CB  . LEU A 33 ? 0.1986 0.1972 0.1851 0.0042  -0.0095 -0.0020 1033 LEU A CB  
287 C  CG  . LEU A 33 ? 0.2235 0.2067 0.1909 -0.0157 -0.0231 0.0010  1033 LEU A CG  
288 C  CD1 . LEU A 33 ? 0.2436 0.2506 0.2547 -0.0249 -0.0428 0.0059  1033 LEU A CD1 
289 C  CD2 . LEU A 33 ? 0.2413 0.2034 0.2309 -0.0504 -0.0065 -0.0171 1033 LEU A CD2 
290 N  N   . GLU A 34 ? 0.1774 0.2161 0.1730 0.0155  -0.0071 0.0097  1034 GLU A N   
291 C  CA  . GLU A 34 ? 0.2025 0.2318 0.2057 0.0064  0.0026  0.0114  1034 GLU A CA  
292 C  C   . GLU A 34 ? 0.1868 0.2348 0.2017 0.0051  0.0016  0.0021  1034 GLU A C   
293 O  O   . GLU A 34 ? 0.2160 0.2455 0.1879 0.0018  0.0164  -0.0063 1034 GLU A O   
294 C  CB  . GLU A 34 ? 0.2141 0.2381 0.2251 0.0176  0.0018  0.0214  1034 GLU A CB  
295 C  CG  . GLU A 34 ? 0.2419 0.2504 0.2354 0.0173  0.0109  0.0118  1034 GLU A CG  
296 C  CD  . GLU A 34 ? 0.2427 0.2671 0.2424 0.0175  0.0273  0.0084  1034 GLU A CD  
297 O  OE1 . GLU A 34 ? 0.2458 0.2607 0.2027 0.0335  0.0950  0.0245  1034 GLU A OE1 
298 O  OE2 . GLU A 34 ? 0.3029 0.3057 0.2573 0.0249  0.0971  0.0132  1034 GLU A OE2 
299 N  N   . GLU A 35 ? 0.1922 0.2475 0.2027 -0.0023 0.0117  0.0097  1035 GLU A N   
300 C  CA  . GLU A 35 ? 0.1940 0.2275 0.2055 0.0023  0.0146  0.0096  1035 GLU A CA  
301 C  C   . GLU A 35 ? 0.2094 0.2276 0.2107 0.0135  0.0249  0.0085  1035 GLU A C   
302 O  O   . GLU A 35 ? 0.2200 0.2234 0.2169 0.0344  0.0292  0.0145  1035 GLU A O   
303 C  CB  . GLU A 35 ? 0.1989 0.2481 0.2432 0.0023  0.0225  0.0035  1035 GLU A CB  
304 C  CG  . GLU A 35 ? 0.2130 0.2810 0.2384 -0.0088 0.0307  -0.0008 1035 GLU A CG  
305 C  CD  . GLU A 35 ? 0.2598 0.2834 0.2500 -0.0156 0.0206  0.0192  1035 GLU A CD  
306 O  OE1 . GLU A 35 ? 0.2378 0.2552 0.2518 -0.0257 0.0797  -0.0363 1035 GLU A OE1 
307 O  OE2 . GLU A 35 ? 0.2263 0.3511 0.2659 -0.0055 0.0286  -0.0071 1035 GLU A OE2 
308 N  N   A MET A 36 ? 0.1943 0.2118 0.1784 0.0153  0.0135  -0.0028 1036 MET A N   
309 N  N   B MET A 36 ? 0.1955 0.2124 0.1816 0.0166  0.0127  -0.0032 1036 MET A N   
310 C  CA  A MET A 36 ? 0.2004 0.2103 0.1883 0.0052  0.0109  0.0038  1036 MET A CA  
311 C  CA  B MET A 36 ? 0.1967 0.2120 0.1921 0.0085  0.0114  0.0010  1036 MET A CA  
312 C  C   A MET A 36 ? 0.2079 0.2051 0.1803 0.0053  0.0154  -0.0002 1036 MET A C   
313 C  C   B MET A 36 ? 0.2072 0.2072 0.1853 0.0089  0.0142  -0.0021 1036 MET A C   
314 O  O   A MET A 36 ? 0.2255 0.2012 0.1572 0.0164  0.0268  0.0127  1036 MET A O   
315 O  O   B MET A 36 ? 0.2287 0.2177 0.1798 0.0278  0.0212  0.0008  1036 MET A O   
316 C  CB  A MET A 36 ? 0.1953 0.2093 0.1615 0.0007  0.0139  -0.0040 1036 MET A CB  
317 C  CB  B MET A 36 ? 0.1997 0.2069 0.1696 0.0065  0.0113  -0.0063 1036 MET A CB  
318 C  CG  A MET A 36 ? 0.1753 0.2026 0.1612 0.0050  0.0076  0.0027  1036 MET A CG  
319 C  CG  B MET A 36 ? 0.1695 0.2230 0.1691 0.0124  0.0081  0.0092  1036 MET A CG  
320 S  SD  A MET A 36 ? 0.2237 0.2328 0.2060 -0.0075 -0.0052 0.0191  1036 MET A SD  
321 S  SD  B MET A 36 ? 0.1778 0.2284 0.2014 0.0080  0.0072  -0.0028 1036 MET A SD  
322 C  CE  A MET A 36 ? 0.2282 0.2393 0.2441 -0.0157 0.0052  0.0128  1036 MET A CE  
323 C  CE  B MET A 36 ? 0.1867 0.2685 0.2405 0.0065  0.0091  -0.0121 1036 MET A CE  
324 N  N   . ASN A 37 ? 0.2082 0.2093 0.1731 0.0114  0.0245  -0.0048 1037 ASN A N   
325 C  CA  . ASN A 37 ? 0.1989 0.2060 0.1817 0.0133  0.0201  -0.0103 1037 ASN A CA  
326 C  C   . ASN A 37 ? 0.1938 0.1927 0.1949 0.0097  0.0289  -0.0070 1037 ASN A C   
327 O  O   . ASN A 37 ? 0.2054 0.1896 0.2601 0.0139  0.0535  -0.0118 1037 ASN A O   
328 C  CB  . ASN A 37 ? 0.2271 0.2219 0.1927 -0.0008 0.0205  -0.0142 1037 ASN A CB  
329 C  CG  . ASN A 37 ? 0.2582 0.2919 0.2329 0.0103  0.0562  -0.0313 1037 ASN A CG  
330 O  OD1 . ASN A 37 ? 0.2635 0.3404 0.2473 -0.0544 0.0751  -0.0190 1037 ASN A OD1 
331 N  ND2 . ASN A 37 ? 0.3638 0.3687 0.3405 -0.0123 0.1217  -0.0417 1037 ASN A ND2 
332 N  N   . LEU A 38 ? 0.1945 0.1916 0.1417 0.0167  0.0098  0.0019  1038 LEU A N   
333 C  CA  . LEU A 38 ? 0.2034 0.1825 0.1475 0.0157  0.0034  0.0041  1038 LEU A CA  
334 C  C   . LEU A 38 ? 0.1984 0.1867 0.1406 0.0166  -0.0028 0.0009  1038 LEU A C   
335 O  O   . LEU A 38 ? 0.2164 0.2040 0.1440 0.0136  0.0051  0.0056  1038 LEU A O   
336 C  CB  . LEU A 38 ? 0.1762 0.1795 0.1406 0.0135  0.0048  -0.0181 1038 LEU A CB  
337 C  CG  . LEU A 38 ? 0.1531 0.1689 0.1441 0.0041  -0.0007 -0.0071 1038 LEU A CG  
338 C  CD1 . LEU A 38 ? 0.1649 0.2050 0.1372 0.0003  -0.0056 -0.0136 1038 LEU A CD1 
339 C  CD2 . LEU A 38 ? 0.1927 0.1984 0.1478 0.0187  0.0175  0.0120  1038 LEU A CD2 
340 N  N   . PRO A 39 ? 0.2069 0.1915 0.1567 0.0227  -0.0103 0.0080  1039 PRO A N   
341 C  CA  . PRO A 39 ? 0.2077 0.1972 0.1567 0.0209  -0.0080 0.0067  1039 PRO A CA  
342 C  C   . PRO A 39 ? 0.2053 0.1834 0.1334 0.0229  -0.0115 0.0114  1039 PRO A C   
343 O  O   . PRO A 39 ? 0.2182 0.2035 0.1378 0.0167  -0.0096 0.0039  1039 PRO A O   
344 C  CB  . PRO A 39 ? 0.2042 0.2179 0.1781 0.0204  -0.0114 0.0027  1039 PRO A CB  
345 C  CG  . PRO A 39 ? 0.2306 0.1718 0.2104 0.0017  -0.0196 -0.0131 1039 PRO A CG  
346 C  CD  . PRO A 39 ? 0.2145 0.2002 0.1806 0.0127  -0.0186 -0.0007 1039 PRO A CD  
347 N  N   . GLY A 40 ? 0.2002 0.1839 0.1391 0.0164  -0.0107 0.0024  1040 GLY A N   
348 C  CA  . GLY A 40 ? 0.2034 0.1927 0.1581 0.0031  -0.0134 0.0008  1040 GLY A CA  
349 C  C   . GLY A 40 ? 0.2114 0.1993 0.1464 -0.0044 -0.0181 0.0015  1040 GLY A C   
350 O  O   . GLY A 40 ? 0.2412 0.2097 0.1555 0.0051  -0.0130 -0.0191 1040 GLY A O   
351 N  N   . ARG A 41 ? 0.1982 0.2143 0.1567 0.0070  -0.0260 -0.0094 1041 ARG A N   
352 C  CA  . ARG A 41 ? 0.2081 0.2241 0.1551 -0.0107 -0.0209 -0.0050 1041 ARG A CA  
353 C  C   . ARG A 41 ? 0.2151 0.2532 0.1431 -0.0461 -0.0107 0.0095  1041 ARG A C   
354 O  O   . ARG A 41 ? 0.2699 0.4093 0.1452 -0.1055 -0.0101 -0.0119 1041 ARG A O   
355 C  CB  . ARG A 41 ? 0.2233 0.2465 0.1809 -0.0036 -0.0260 -0.0124 1041 ARG A CB  
356 C  CG  . ARG A 41 ? 0.2661 0.2594 0.2377 0.0126  -0.0204 -0.0266 1041 ARG A CG  
357 C  CD  . ARG A 41 ? 0.3046 0.2972 0.2841 0.0110  -0.0162 -0.0266 1041 ARG A CD  
358 N  NE  . ARG A 41 ? 0.3491 0.3359 0.3811 0.0374  -0.0080 -0.0207 1041 ARG A NE  
359 C  CZ  . ARG A 41 ? 0.3350 0.3052 0.3507 0.0144  -0.0003 -0.0187 1041 ARG A CZ  
360 N  NH1 . ARG A 41 ? 0.3471 0.3273 0.3951 0.0145  -0.0398 -0.0257 1041 ARG A NH1 
361 N  NH2 . ARG A 41 ? 0.3930 0.3221 0.3864 0.0159  0.0078  -0.0089 1041 ARG A NH2 
362 N  N   . TRP A 42 ? 0.2126 0.2329 0.1313 -0.0249 -0.0016 0.0011  1042 TRP A N   
363 C  CA  . TRP A 42 ? 0.1878 0.2045 0.1400 -0.0231 -0.0139 0.0038  1042 TRP A CA  
364 C  C   . TRP A 42 ? 0.2107 0.1937 0.1478 -0.0053 -0.0135 0.0092  1042 TRP A C   
365 O  O   . TRP A 42 ? 0.2287 0.1791 0.1456 -0.0125 -0.0143 0.0114  1042 TRP A O   
366 C  CB  . TRP A 42 ? 0.1975 0.1959 0.1591 -0.0157 -0.0071 0.0072  1042 TRP A CB  
367 C  CG  . TRP A 42 ? 0.2079 0.2034 0.1612 -0.0094 -0.0127 -0.0074 1042 TRP A CG  
368 C  CD1 . TRP A 42 ? 0.2282 0.2476 0.1750 -0.0245 -0.0113 -0.0109 1042 TRP A CD1 
369 C  CD2 . TRP A 42 ? 0.1812 0.2030 0.1705 -0.0120 0.0110  0.0114  1042 TRP A CD2 
370 N  NE1 . TRP A 42 ? 0.2532 0.2610 0.1944 -0.0286 0.0139  -0.0099 1042 TRP A NE1 
371 C  CE2 . TRP A 42 ? 0.1995 0.2273 0.1950 -0.0459 0.0059  0.0043  1042 TRP A CE2 
372 C  CE3 . TRP A 42 ? 0.1975 0.1897 0.1756 -0.0066 -0.0140 -0.0096 1042 TRP A CE3 
373 C  CZ2 . TRP A 42 ? 0.2174 0.2385 0.1828 -0.0297 0.0068  0.0208  1042 TRP A CZ2 
374 C  CZ3 . TRP A 42 ? 0.2187 0.2358 0.1944 -0.0178 0.0070  -0.0109 1042 TRP A CZ3 
375 C  CH2 . TRP A 42 ? 0.2300 0.2020 0.2099 -0.0402 -0.0058 -0.0028 1042 TRP A CH2 
376 N  N   . LYS A 43 ? 0.2127 0.1863 0.1280 -0.0029 -0.0214 0.0132  1043 LYS A N   
377 C  CA  . LYS A 43 ? 0.2146 0.2049 0.1606 -0.0061 -0.0085 0.0045  1043 LYS A CA  
378 C  C   . LYS A 43 ? 0.2247 0.2054 0.1483 -0.0099 -0.0205 -0.0043 1043 LYS A C   
379 O  O   . LYS A 43 ? 0.2096 0.1764 0.1514 -0.0160 -0.0220 -0.0045 1043 LYS A O   
380 C  CB  . LYS A 43 ? 0.2378 0.2239 0.1873 -0.0013 -0.0182 0.0064  1043 LYS A CB  
381 C  CG  . LYS A 43 ? 0.2400 0.2535 0.2341 0.0093  -0.0034 -0.0053 1043 LYS A CG  
382 C  CD  . LYS A 43 ? 0.2796 0.2812 0.2590 0.0149  -0.0004 -0.0011 1043 LYS A CD  
383 C  CE  . LYS A 43 ? 0.3064 0.3094 0.3041 0.0355  0.0266  0.0015  1043 LYS A CE  
384 N  NZ  . LYS A 43 ? 0.3234 0.3529 0.3562 0.0205  0.0505  -0.0217 1043 LYS A NZ  
385 N  N   . PRO A 44 ? 0.2250 0.1908 0.1661 -0.0015 -0.0228 0.0129  1044 PRO A N   
386 C  CA  . PRO A 44 ? 0.2119 0.2109 0.1637 0.0001  -0.0191 -0.0058 1044 PRO A CA  
387 C  C   . PRO A 44 ? 0.2346 0.2431 0.1906 0.0156  -0.0124 -0.0279 1044 PRO A C   
388 O  O   . PRO A 44 ? 0.2629 0.2765 0.1916 0.0358  -0.0559 -0.0394 1044 PRO A O   
389 C  CB  . PRO A 44 ? 0.2332 0.2272 0.2092 -0.0064 -0.0252 -0.0143 1044 PRO A CB  
390 C  CG  . PRO A 44 ? 0.2558 0.2143 0.2018 -0.0277 -0.0089 -0.0187 1044 PRO A CG  
391 C  CD  . PRO A 44 ? 0.2356 0.2021 0.1885 -0.0068 -0.0182 0.0068  1044 PRO A CD  
392 N  N   . LYS A 45 ? 0.2112 0.2341 0.1776 0.0159  -0.0172 -0.0123 1045 LYS A N   
393 C  CA  . LYS A 45 ? 0.2121 0.2365 0.1782 0.0128  -0.0077 -0.0178 1045 LYS A CA  
394 C  C   . LYS A 45 ? 0.1997 0.2277 0.1668 0.0168  -0.0143 -0.0222 1045 LYS A C   
395 O  O   . LYS A 45 ? 0.1780 0.2529 0.1434 0.0110  -0.0065 -0.0510 1045 LYS A O   
396 C  CB  . LYS A 45 ? 0.2124 0.2565 0.1863 0.0263  -0.0167 -0.0164 1045 LYS A CB  
397 C  CG  . LYS A 45 ? 0.2372 0.2417 0.2132 -0.0099 -0.0144 -0.0065 1045 LYS A CG  
398 C  CD  . LYS A 45 ? 0.2590 0.2847 0.2578 0.0002  0.0090  -0.0134 1045 LYS A CD  
399 C  CE  . LYS A 45 ? 0.3158 0.3261 0.2772 0.0190  -0.0139 -0.0003 1045 LYS A CE  
400 N  NZ  . LYS A 45 ? 0.3530 0.4435 0.3962 0.0137  0.0088  -0.0146 1045 LYS A NZ  
401 N  N   . MET A 46 ? 0.2011 0.2479 0.1587 0.0247  -0.0241 -0.0331 1046 MET A N   
402 C  CA  . MET A 46 ? 0.1851 0.2272 0.1758 0.0189  -0.0060 -0.0204 1046 MET A CA  
403 C  C   . MET A 46 ? 0.1651 0.2280 0.1560 0.0261  -0.0036 -0.0274 1046 MET A C   
404 O  O   . MET A 46 ? 0.1787 0.3334 0.2255 0.0477  0.0251  -0.0098 1046 MET A O   
405 C  CB  . MET A 46 ? 0.1963 0.2329 0.1902 0.0227  -0.0243 -0.0385 1046 MET A CB  
406 C  CG  . MET A 46 ? 0.2421 0.2363 0.1958 0.0314  -0.0175 -0.0424 1046 MET A CG  
407 S  SD  . MET A 46 ? 0.3267 0.2441 0.1773 0.0065  -0.0186 -0.0269 1046 MET A SD  
408 C  CE  . MET A 46 ? 0.3129 0.2489 0.1664 0.0139  0.0063  -0.0199 1046 MET A CE  
409 N  N   . ILE A 47 ? 0.1604 0.2339 0.1374 0.0155  0.0093  -0.0313 1047 ILE A N   
410 C  CA  . ILE A 47 ? 0.1816 0.2233 0.1421 -0.0019 0.0123  -0.0197 1047 ILE A CA  
411 C  C   . ILE A 47 ? 0.1789 0.2203 0.1313 -0.0147 0.0183  -0.0253 1047 ILE A C   
412 O  O   . ILE A 47 ? 0.1891 0.2625 0.1042 -0.0059 0.0314  -0.0330 1047 ILE A O   
413 C  CB  . ILE A 47 ? 0.1843 0.2207 0.1389 -0.0217 0.0017  -0.0173 1047 ILE A CB  
414 C  CG1 . ILE A 47 ? 0.2175 0.2311 0.1377 -0.0118 0.0081  -0.0305 1047 ILE A CG1 
415 C  CG2 . ILE A 47 ? 0.2020 0.2876 0.1972 -0.0055 0.0070  -0.0342 1047 ILE A CG2 
416 C  CD1 . ILE A 47 ? 0.2298 0.2561 0.1392 -0.0153 0.0133  -0.0174 1047 ILE A CD1 
417 N  N   . GLY A 48 ? 0.1873 0.2306 0.1306 -0.0241 0.0233  0.0006  1048 GLY A N   
418 C  CA  . GLY A 48 ? 0.2145 0.2119 0.1501 -0.0086 0.0092  -0.0168 1048 GLY A CA  
419 C  C   . GLY A 48 ? 0.2137 0.2002 0.1642 -0.0090 0.0196  -0.0146 1048 GLY A C   
420 O  O   . GLY A 48 ? 0.2638 0.2704 0.2205 -0.0144 0.0395  -0.0836 1048 GLY A O   
421 N  N   . GLY A 49 ? 0.2023 0.1997 0.1534 -0.0028 -0.0033 -0.0140 1049 GLY A N   
422 C  CA  . GLY A 49 ? 0.2169 0.1860 0.1596 0.0079  -0.0135 -0.0065 1049 GLY A CA  
423 C  C   . GLY A 49 ? 0.2339 0.1904 0.1482 0.0079  -0.0245 -0.0093 1049 GLY A C   
424 O  O   . GLY A 49 ? 0.2645 0.1769 0.1753 0.0179  -0.0486 -0.0325 1049 GLY A O   
425 N  N   . ILE A 50 ? 0.2534 0.1826 0.1558 0.0046  -0.0245 -0.0207 1050 ILE A N   
426 C  CA  . ILE A 50 ? 0.2370 0.2042 0.1800 0.0000  -0.0144 -0.0043 1050 ILE A CA  
427 C  C   . ILE A 50 ? 0.2496 0.2026 0.1701 0.0046  -0.0130 -0.0020 1050 ILE A C   
428 O  O   . ILE A 50 ? 0.2860 0.2227 0.2361 0.0068  0.0050  -0.0124 1050 ILE A O   
429 C  CB  . ILE A 50 ? 0.2636 0.2343 0.2048 0.0007  -0.0077 -0.0126 1050 ILE A CB  
430 C  CG1 . ILE A 50 ? 0.2924 0.2384 0.2572 0.0012  -0.0075 0.0084  1050 ILE A CG1 
431 C  CG2 . ILE A 50 ? 0.2790 0.2145 0.1901 0.0048  -0.0156 0.0224  1050 ILE A CG2 
432 C  CD1 . ILE A 50 ? 0.2735 0.2321 0.2377 -0.0025 -0.0018 0.0165  1050 ILE A CD1 
433 N  N   . GLY A 51 ? 0.2286 0.1880 0.1544 0.0066  -0.0177 0.0135  1051 GLY A N   
434 C  CA  . GLY A 51 ? 0.1961 0.1893 0.1712 0.0001  -0.0094 -0.0013 1051 GLY A CA  
435 C  C   . GLY A 51 ? 0.1783 0.1631 0.1619 0.0127  -0.0191 -0.0144 1051 GLY A C   
436 O  O   . GLY A 51 ? 0.1810 0.1919 0.1717 0.0211  -0.0341 -0.0091 1051 GLY A O   
437 N  N   . GLY A 52 ? 0.1635 0.1775 0.1193 0.0211  -0.0154 -0.0146 1052 GLY A N   
438 C  CA  . GLY A 52 ? 0.1758 0.1630 0.1370 0.0095  -0.0081 -0.0068 1052 GLY A CA  
439 C  C   . GLY A 52 ? 0.1475 0.1730 0.1297 0.0050  -0.0011 -0.0127 1052 GLY A C   
440 O  O   . GLY A 52 ? 0.1966 0.1787 0.1314 0.0124  -0.0193 -0.0155 1052 GLY A O   
441 N  N   . PHE A 53 ? 0.1492 0.1895 0.1194 -0.0010 0.0076  -0.0289 1053 PHE A N   
442 C  CA  . PHE A 53 ? 0.1537 0.1832 0.1176 0.0044  0.0104  -0.0099 1053 PHE A CA  
443 C  C   . PHE A 53 ? 0.1439 0.1820 0.1286 0.0070  0.0079  -0.0178 1053 PHE A C   
444 O  O   . PHE A 53 ? 0.1594 0.1868 0.1116 -0.0060 0.0068  -0.0320 1053 PHE A O   
445 C  CB  . PHE A 53 ? 0.1643 0.2040 0.1217 0.0214  0.0096  -0.0204 1053 PHE A CB  
446 C  CG  . PHE A 53 ? 0.1827 0.2485 0.1480 0.0490  -0.0225 0.0022  1053 PHE A CG  
447 C  CD1 . PHE A 53 ? 0.1777 0.2436 0.1639 0.0554  -0.0039 -0.0246 1053 PHE A CD1 
448 C  CD2 . PHE A 53 ? 0.1869 0.2322 0.1515 0.0607  0.0458  -0.0177 1053 PHE A CD2 
449 C  CE1 . PHE A 53 ? 0.2018 0.2530 0.1659 0.0617  -0.0091 -0.0322 1053 PHE A CE1 
450 C  CE2 . PHE A 53 ? 0.1856 0.2609 0.2025 0.0585  0.0144  0.0178  1053 PHE A CE2 
451 C  CZ  . PHE A 53 ? 0.1956 0.2533 0.1682 0.0855  0.0186  0.0088  1053 PHE A CZ  
452 N  N   . ILE A 54 ? 0.1579 0.1935 0.1194 -0.0009 0.0130  -0.0251 1054 ILE A N   
453 C  CA  . ILE A 54 ? 0.1479 0.1914 0.1240 0.0021  0.0031  -0.0166 1054 ILE A CA  
454 C  C   . ILE A 54 ? 0.1367 0.1865 0.1214 -0.0035 0.0078  -0.0233 1054 ILE A C   
455 O  O   . ILE A 54 ? 0.1309 0.2167 0.1117 0.0141  0.0009  -0.0326 1054 ILE A O   
456 C  CB  . ILE A 54 ? 0.1636 0.2170 0.1573 0.0044  -0.0114 -0.0138 1054 ILE A CB  
457 C  CG1 . ILE A 54 ? 0.1739 0.1992 0.1729 -0.0053 0.0119  -0.0147 1054 ILE A CG1 
458 C  CG2 . ILE A 54 ? 0.1782 0.2134 0.1598 0.0003  -0.0051 -0.0193 1054 ILE A CG2 
459 C  CD1 . ILE A 54 ? 0.2061 0.2197 0.1973 -0.0054 -0.0009 -0.0148 1054 ILE A CD1 
460 N  N   . LYS A 55 ? 0.1406 0.2095 0.1157 -0.0152 0.0014  -0.0211 1055 LYS A N   
461 C  CA  . LYS A 55 ? 0.1583 0.1995 0.1215 -0.0098 0.0065  -0.0206 1055 LYS A CA  
462 C  C   . LYS A 55 ? 0.1381 0.1928 0.1183 -0.0196 0.0142  -0.0242 1055 LYS A C   
463 O  O   . LYS A 55 ? 0.1462 0.2295 0.1186 -0.0237 0.0208  -0.0403 1055 LYS A O   
464 C  CB  . LYS A 55 ? 0.1931 0.2000 0.1319 -0.0183 0.0033  -0.0208 1055 LYS A CB  
465 C  CG  . LYS A 55 ? 0.1680 0.2220 0.1309 -0.0284 -0.0016 -0.0005 1055 LYS A CG  
466 C  CD  . LYS A 55 ? 0.2282 0.1948 0.1388 -0.0348 -0.0107 -0.0034 1055 LYS A CD  
467 C  CE  . LYS A 55 ? 0.2584 0.2667 0.1889 -0.0490 -0.0041 -0.0007 1055 LYS A CE  
468 N  NZ  . LYS A 55 ? 0.2704 0.3008 0.2776 -0.0329 0.0582  0.0419  1055 LYS A NZ  
469 N  N   . VAL A 56 ? 0.1299 0.1975 0.1194 -0.0128 0.0100  -0.0227 1056 VAL A N   
470 C  CA  . VAL A 56 ? 0.1361 0.1795 0.1088 -0.0266 0.0117  -0.0166 1056 VAL A CA  
471 C  C   . VAL A 56 ? 0.1530 0.1909 0.1188 -0.0192 0.0175  -0.0082 1056 VAL A C   
472 O  O   . VAL A 56 ? 0.1610 0.2004 0.1129 -0.0166 0.0024  -0.0125 1056 VAL A O   
473 C  CB  . VAL A 56 ? 0.1472 0.1860 0.1240 -0.0164 0.0045  -0.0155 1056 VAL A CB  
474 C  CG1 . VAL A 56 ? 0.2008 0.2425 0.1160 -0.0169 -0.0120 0.0006  1056 VAL A CG1 
475 C  CG2 . VAL A 56 ? 0.1787 0.2129 0.1305 -0.0324 0.0140  -0.0098 1056 VAL A CG2 
476 N  N   . ARG A 57 ? 0.1447 0.1624 0.1109 -0.0071 0.0098  -0.0054 1057 ARG A N   
477 C  CA  . ARG A 57 ? 0.1431 0.1677 0.1174 -0.0120 0.0095  -0.0034 1057 ARG A CA  
478 C  C   . ARG A 57 ? 0.1434 0.1729 0.1123 -0.0092 0.0066  -0.0069 1057 ARG A C   
479 O  O   . ARG A 57 ? 0.1491 0.1607 0.1292 -0.0066 0.0190  0.0072  1057 ARG A O   
480 C  CB  . ARG A 57 ? 0.1632 0.1778 0.1013 -0.0007 0.0027  -0.0145 1057 ARG A CB  
481 C  CG  . ARG A 57 ? 0.1817 0.1977 0.1123 0.0110  0.0234  -0.0183 1057 ARG A CG  
482 C  CD  . ARG A 57 ? 0.1695 0.2006 0.1526 -0.0160 0.0213  -0.0120 1057 ARG A CD  
483 N  NE  . ARG A 57 ? 0.1755 0.2315 0.1332 -0.0114 0.0468  0.0082  1057 ARG A NE  
484 C  CZ  . ARG A 57 ? 0.1760 0.2122 0.1732 -0.0245 0.0342  -0.0349 1057 ARG A CZ  
485 N  NH1 . ARG A 57 ? 0.1568 0.2304 0.1872 -0.0402 0.0118  0.0232  1057 ARG A NH1 
486 N  NH2 . ARG A 57 ? 0.2154 0.2296 0.2173 0.0016  0.0256  -0.0148 1057 ARG A NH2 
487 N  N   . GLN A 58 ? 0.1438 0.1468 0.1256 -0.0071 0.0114  0.0009  1058 GLN A N   
488 C  CA  . GLN A 58 ? 0.1408 0.1699 0.1216 -0.0054 -0.0076 0.0017  1058 GLN A CA  
489 C  C   . GLN A 58 ? 0.1280 0.1828 0.1137 -0.0139 0.0078  -0.0032 1058 GLN A C   
490 O  O   . GLN A 58 ? 0.1593 0.1771 0.1310 -0.0136 -0.0125 0.0130  1058 GLN A O   
491 C  CB  . GLN A 58 ? 0.1501 0.1747 0.1170 -0.0114 -0.0046 -0.0104 1058 GLN A CB  
492 C  CG  . GLN A 58 ? 0.1614 0.1703 0.1376 0.0017  0.0200  0.0052  1058 GLN A CG  
493 C  CD  . GLN A 58 ? 0.1639 0.2203 0.1503 -0.0026 0.0029  -0.0254 1058 GLN A CD  
494 O  OE1 . GLN A 58 ? 0.2200 0.3069 0.1964 0.0114  -0.0181 -0.0912 1058 GLN A OE1 
495 N  NE2 . GLN A 58 ? 0.1805 0.2555 0.1967 0.0101  0.0010  -0.0045 1058 GLN A NE2 
496 N  N   . TYR A 59 ? 0.1334 0.1651 0.1135 -0.0103 -0.0106 0.0059  1059 TYR A N   
497 C  CA  . TYR A 59 ? 0.1429 0.1648 0.1163 -0.0136 0.0012  0.0021  1059 TYR A CA  
498 C  C   . TYR A 59 ? 0.1362 0.1742 0.1095 -0.0083 -0.0026 0.0028  1059 TYR A C   
499 O  O   . TYR A 59 ? 0.1464 0.2023 0.1238 -0.0079 -0.0020 0.0305  1059 TYR A O   
500 C  CB  . TYR A 59 ? 0.1465 0.1762 0.1093 -0.0094 -0.0063 0.0062  1059 TYR A CB  
501 C  CG  . TYR A 59 ? 0.1469 0.1855 0.1195 -0.0241 0.0117  -0.0069 1059 TYR A CG  
502 C  CD1 . TYR A 59 ? 0.1393 0.1802 0.1058 -0.0300 0.0112  0.0004  1059 TYR A CD1 
503 C  CD2 . TYR A 59 ? 0.1317 0.1939 0.1115 -0.0121 -0.0009 -0.0151 1059 TYR A CD2 
504 C  CE1 . TYR A 59 ? 0.1469 0.1981 0.1284 -0.0104 -0.0112 -0.0222 1059 TYR A CE1 
505 C  CE2 . TYR A 59 ? 0.1648 0.2098 0.1014 -0.0301 0.0023  -0.0234 1059 TYR A CE2 
506 C  CZ  . TYR A 59 ? 0.1295 0.1945 0.1203 -0.0274 0.0130  0.0021  1059 TYR A CZ  
507 O  OH  . TYR A 59 ? 0.1450 0.2629 0.1574 -0.0299 0.0238  -0.0165 1059 TYR A OH  
508 N  N   . ASP A 60 ? 0.1316 0.1982 0.1172 -0.0076 0.0044  0.0259  1060 ASP A N   
509 C  CA  . ASP A 60 ? 0.1548 0.1822 0.1400 0.0014  0.0077  0.0101  1060 ASP A CA  
510 C  C   . ASP A 60 ? 0.1558 0.1987 0.1485 0.0038  0.0097  0.0088  1060 ASP A C   
511 O  O   . ASP A 60 ? 0.1587 0.2064 0.1387 0.0027  0.0137  0.0122  1060 ASP A O   
512 C  CB  . ASP A 60 ? 0.1764 0.1916 0.1373 -0.0068 -0.0013 0.0056  1060 ASP A CB  
513 C  CG  . ASP A 60 ? 0.2248 0.1942 0.1730 -0.0056 -0.0171 0.0019  1060 ASP A CG  
514 O  OD1 . ASP A 60 ? 0.2262 0.2080 0.1753 0.0121  -0.0080 -0.0018 1060 ASP A OD1 
515 O  OD2 . ASP A 60 ? 0.4320 0.2211 0.2692 0.0047  -0.0623 0.0180  1060 ASP A OD2 
516 N  N   . GLN A 61 ? 0.1435 0.1881 0.1598 -0.0041 0.0108  -0.0023 1061 GLN A N   
517 C  CA  . GLN A 61 ? 0.1812 0.1988 0.1761 -0.0002 0.0027  -0.0064 1061 GLN A CA  
518 C  C   . GLN A 61 ? 0.1477 0.1962 0.1489 -0.0033 0.0162  -0.0095 1061 GLN A C   
519 O  O   . GLN A 61 ? 0.1831 0.2060 0.1682 -0.0109 -0.0131 -0.0111 1061 GLN A O   
520 C  CB  . GLN A 61 ? 0.1910 0.2370 0.2127 0.0052  -0.0026 -0.0227 1061 GLN A CB  
521 C  CG  . GLN A 61 ? 0.2472 0.2750 0.2719 0.0104  -0.0028 -0.0216 1061 GLN A CG  
522 C  CD  . GLN A 61 ? 0.1962 0.2533 0.2037 0.0211  -0.0073 -0.0022 1061 GLN A CD  
523 O  OE1 . GLN A 61 ? 0.2062 0.3368 0.3589 0.0536  -0.0739 -0.0065 1061 GLN A OE1 
524 N  NE2 . GLN A 61 ? 0.2310 0.3142 0.2443 -0.0271 0.0293  0.0573  1061 GLN A NE2 
525 N  N   . ILE A 62 ? 0.1487 0.1832 0.1240 0.0052  0.0008  -0.0011 1062 ILE A N   
526 C  CA  . ILE A 62 ? 0.1606 0.1587 0.1377 -0.0090 0.0042  -0.0036 1062 ILE A CA  
527 C  C   . ILE A 62 ? 0.1659 0.1701 0.1304 -0.0147 0.0123  -0.0129 1062 ILE A C   
528 O  O   . ILE A 62 ? 0.1902 0.1912 0.1436 -0.0093 0.0335  -0.0059 1062 ILE A O   
529 C  CB  . ILE A 62 ? 0.1597 0.1634 0.1208 0.0062  0.0093  0.0080  1062 ILE A CB  
530 C  CG1 . ILE A 62 ? 0.1458 0.1793 0.1401 -0.0114 -0.0019 0.0029  1062 ILE A CG1 
531 C  CG2 . ILE A 62 ? 0.1545 0.1891 0.1475 -0.0024 0.0086  0.0062  1062 ILE A CG2 
532 C  CD1 . ILE A 62 ? 0.1519 0.1609 0.1789 -0.0038 0.0019  -0.0044 1062 ILE A CD1 
533 N  N   . LEU A 63 ? 0.1724 0.1880 0.1433 -0.0093 0.0130  -0.0203 1063 LEU A N   
534 C  CA  . LEU A 63 ? 0.1836 0.2106 0.1706 0.0029  0.0213  -0.0138 1063 LEU A CA  
535 C  C   . LEU A 63 ? 0.1847 0.2013 0.1684 -0.0048 0.0163  -0.0132 1063 LEU A C   
536 O  O   . LEU A 63 ? 0.1922 0.2569 0.1919 0.0017  0.0459  -0.0070 1063 LEU A O   
537 C  CB  . LEU A 63 ? 0.2071 0.2243 0.2198 -0.0086 0.0109  -0.0295 1063 LEU A CB  
538 C  CG  . LEU A 63 ? 0.2460 0.2392 0.2517 0.0208  0.0112  -0.0221 1063 LEU A CG  
539 C  CD1 . LEU A 63 ? 0.2574 0.2808 0.2844 -0.0384 0.0408  0.0270  1063 LEU A CD1 
540 C  CD2 . LEU A 63 ? 0.2324 0.2384 0.2035 -0.0152 0.0102  -0.0239 1063 LEU A CD2 
541 N  N   A ILE A 64 ? 0.1783 0.1959 0.1753 0.0053  0.0359  -0.0118 1064 ILE A N   
542 N  N   B ILE A 64 ? 0.1905 0.2071 0.1855 -0.0024 0.0197  -0.0086 1064 ILE A N   
543 C  CA  A ILE A 64 ? 0.1861 0.2163 0.1758 -0.0035 0.0259  -0.0088 1064 ILE A CA  
544 C  CA  B ILE A 64 ? 0.1946 0.2110 0.1861 -0.0022 0.0154  -0.0048 1064 ILE A CA  
545 C  C   A ILE A 64 ? 0.1847 0.2054 0.1665 0.0129  0.0226  0.0026  1064 ILE A C   
546 C  C   B ILE A 64 ? 0.1907 0.2026 0.1772 0.0047  0.0175  -0.0022 1064 ILE A C   
547 O  O   A ILE A 64 ? 0.1950 0.2340 0.2181 -0.0058 0.0481  0.0178  1064 ILE A O   
548 O  O   B ILE A 64 ? 0.1995 0.2002 0.1797 -0.0045 0.0306  -0.0021 1064 ILE A O   
549 C  CB  A ILE A 64 ? 0.1979 0.2099 0.2058 0.0012  0.0238  -0.0214 1064 ILE A CB  
550 C  CB  B ILE A 64 ? 0.1931 0.2062 0.2006 -0.0005 0.0139  -0.0109 1064 ILE A CB  
551 C  CG1 A ILE A 64 ? 0.2245 0.2122 0.1727 -0.0061 0.0258  -0.0018 1064 ILE A CG1 
552 C  CG1 B ILE A 64 ? 0.1905 0.1832 0.1921 -0.0022 0.0206  -0.0017 1064 ILE A CG1 
553 C  CG2 A ILE A 64 ? 0.1935 0.2245 0.1793 -0.0002 0.0379  -0.0575 1064 ILE A CG2 
554 C  CG2 B ILE A 64 ? 0.2133 0.2262 0.2003 -0.0061 0.0119  -0.0115 1064 ILE A CG2 
555 C  CD1 A ILE A 64 ? 0.1938 0.2294 0.1840 0.0068  0.0195  -0.0087 1064 ILE A CD1 
556 C  CD1 B ILE A 64 ? 0.2240 0.2335 0.2200 -0.0032 0.0097  0.0039  1064 ILE A CD1 
557 N  N   . GLU A 65 ? 0.1765 0.1911 0.1585 0.0065  0.0304  -0.0061 1065 GLU A N   
558 C  CA  . GLU A 65 ? 0.2119 0.2292 0.1875 0.0113  0.0056  0.0046  1065 GLU A CA  
559 C  C   . GLU A 65 ? 0.2324 0.2853 0.1986 0.0100  0.0112  0.0158  1065 GLU A C   
560 O  O   . GLU A 65 ? 0.2322 0.3313 0.1705 0.0194  -0.0038 0.0733  1065 GLU A O   
561 C  CB  . GLU A 65 ? 0.2177 0.2165 0.1986 0.0005  0.0215  -0.0008 1065 GLU A CB  
562 C  CG  . GLU A 65 ? 0.2540 0.2463 0.2542 0.0129  -0.0004 0.0035  1065 GLU A CG  
563 C  CD  . GLU A 65 ? 0.3020 0.2632 0.2492 0.0201  -0.0021 -0.0053 1065 GLU A CD  
564 O  OE1 . GLU A 65 ? 0.4306 0.2641 0.3213 0.0464  -0.0317 -0.0525 1065 GLU A OE1 
565 O  OE2 . GLU A 65 ? 0.4050 0.3581 0.3863 0.0356  0.0112  -0.0265 1065 GLU A OE2 
566 N  N   . ILE A 66 ? 0.2374 0.3201 0.2049 0.0103  0.0006  0.0273  1066 ILE A N   
567 C  CA  . ILE A 66 ? 0.2604 0.3047 0.2584 0.0183  0.0045  0.0135  1066 ILE A CA  
568 C  C   . ILE A 66 ? 0.2867 0.3518 0.2937 0.0150  0.0028  0.0375  1066 ILE A C   
569 O  O   . ILE A 66 ? 0.2977 0.3873 0.2581 0.0313  0.0089  0.0806  1066 ILE A O   
570 C  CB  . ILE A 66 ? 0.2853 0.3013 0.2471 0.0108  -0.0072 0.0183  1066 ILE A CB  
571 C  CG1 . ILE A 66 ? 0.2994 0.3040 0.2788 0.0026  0.0128  0.0120  1066 ILE A CG1 
572 C  CG2 . ILE A 66 ? 0.2473 0.2965 0.2140 0.0128  -0.0116 -0.0048 1066 ILE A CG2 
573 C  CD1 . ILE A 66 ? 0.2487 0.2615 0.2143 0.0023  0.0000  -0.0028 1066 ILE A CD1 
574 N  N   . CYS A 67 ? 0.3483 0.3681 0.3730 0.0079  0.0084  0.0199  1067 CYS A N   
575 C  CA  . CYS A 67 ? 0.3522 0.3634 0.3693 0.0016  0.0075  0.0203  1067 CYS A CA  
576 C  C   . CYS A 67 ? 0.3580 0.3685 0.3684 -0.0068 0.0056  0.0148  1067 CYS A C   
577 O  O   . CYS A 67 ? 0.3791 0.3522 0.4271 -0.0388 0.0149  0.0341  1067 CYS A O   
578 C  CB  . CYS A 67 ? 0.3608 0.3674 0.4044 0.0042  0.0036  0.0101  1067 CYS A CB  
579 S  SG  . CYS A 67 ? 0.4036 0.3869 0.4184 0.0219  -0.0161 0.0584  1067 CYS A SG  
580 N  N   . GLY A 68 ? 0.3507 0.3468 0.3686 0.0022  0.0085  0.0202  1068 GLY A N   
581 C  CA  . GLY A 68 ? 0.3195 0.3248 0.3291 0.0021  0.0029  0.0133  1068 GLY A CA  
582 C  C   . GLY A 68 ? 0.3299 0.3200 0.3269 -0.0001 0.0012  0.0102  1068 GLY A C   
583 O  O   . GLY A 68 ? 0.3301 0.3487 0.3581 0.0122  0.0112  0.0077  1068 GLY A O   
584 N  N   . HIS A 69 ? 0.2998 0.3047 0.2771 0.0082  0.0127  0.0263  1069 HIS A N   
585 C  CA  . HIS A 69 ? 0.2758 0.2745 0.2557 -0.0006 0.0107  0.0196  1069 HIS A CA  
586 C  C   . HIS A 69 ? 0.2497 0.2483 0.2269 -0.0109 0.0080  0.0199  1069 HIS A C   
587 O  O   . HIS A 69 ? 0.2488 0.3184 0.2384 -0.0218 0.0023  0.0633  1069 HIS A O   
588 C  CB  . HIS A 69 ? 0.2898 0.2741 0.2539 -0.0101 0.0149  0.0238  1069 HIS A CB  
589 C  CG  . HIS A 69 ? 0.3281 0.2879 0.2794 -0.0105 0.0239  0.0338  1069 HIS A CG  
590 N  ND1 . HIS A 69 ? 0.3716 0.3159 0.2906 -0.0488 0.0470  0.0478  1069 HIS A ND1 
591 C  CD2 . HIS A 69 ? 0.3600 0.3287 0.2476 -0.0240 0.0747  0.0513  1069 HIS A CD2 
592 C  CE1 . HIS A 69 ? 0.3779 0.2772 0.2858 -0.0290 0.0418  0.0639  1069 HIS A CE1 
593 N  NE2 . HIS A 69 ? 0.3947 0.3241 0.2673 -0.0355 0.0406  0.0526  1069 HIS A NE2 
594 N  N   . LYS A 70 ? 0.1968 0.1964 0.1859 0.0026  0.0196  -0.0028 1070 LYS A N   
595 C  CA  . LYS A 70 ? 0.2159 0.2080 0.1940 0.0002  0.0096  -0.0076 1070 LYS A CA  
596 C  C   . LYS A 70 ? 0.1836 0.1826 0.1776 -0.0025 0.0237  -0.0079 1070 LYS A C   
597 O  O   . LYS A 70 ? 0.2187 0.1890 0.2006 -0.0066 0.0303  -0.0031 1070 LYS A O   
598 C  CB  . LYS A 70 ? 0.2248 0.2014 0.2044 0.0117  0.0116  -0.0049 1070 LYS A CB  
599 C  CG  . LYS A 70 ? 0.2559 0.2441 0.2177 0.0015  0.0111  -0.0188 1070 LYS A CG  
600 C  CD  . LYS A 70 ? 0.2520 0.2415 0.2305 0.0122  0.0100  -0.0253 1070 LYS A CD  
601 C  CE  . LYS A 70 ? 0.2696 0.2631 0.2660 0.0371  -0.0039 -0.0205 1070 LYS A CE  
602 N  NZ  . LYS A 70 ? 0.2888 0.2906 0.2555 0.0412  0.0156  -0.0397 1070 LYS A NZ  
603 N  N   . ALA A 71 ? 0.1784 0.1693 0.1666 -0.0043 0.0258  -0.0059 1071 ALA A N   
604 C  CA  . ALA A 71 ? 0.1739 0.1738 0.1765 -0.0055 0.0123  -0.0020 1071 ALA A CA  
605 C  C   . ALA A 71 ? 0.1558 0.1739 0.1540 -0.0097 0.0247  -0.0068 1071 ALA A C   
606 O  O   . ALA A 71 ? 0.1561 0.2158 0.2012 0.0078  0.0575  -0.0198 1071 ALA A O   
607 C  CB  . ALA A 71 ? 0.1826 0.1934 0.1936 -0.0031 0.0280  0.0034  1071 ALA A CB  
608 N  N   . ILE A 72 ? 0.1647 0.1662 0.1596 -0.0071 0.0311  -0.0092 1072 ILE A N   
609 C  CA  . ILE A 72 ? 0.1573 0.1778 0.1600 -0.0140 0.0108  -0.0056 1072 ILE A CA  
610 C  C   . ILE A 72 ? 0.1437 0.1552 0.1563 -0.0082 0.0018  0.0003  1072 ILE A C   
611 O  O   . ILE A 72 ? 0.1602 0.1803 0.1625 -0.0177 0.0089  -0.0006 1072 ILE A O   
612 C  CB  . ILE A 72 ? 0.1835 0.1862 0.1816 -0.0193 0.0240  0.0025  1072 ILE A CB  
613 C  CG1 . ILE A 72 ? 0.1889 0.2321 0.1839 -0.0300 0.0122  -0.0162 1072 ILE A CG1 
614 C  CG2 . ILE A 72 ? 0.2150 0.2091 0.1686 -0.0177 -0.0215 0.0148  1072 ILE A CG2 
615 C  CD1 . ILE A 72 ? 0.2117 0.2517 0.2415 -0.0182 -0.0100 -0.0070 1072 ILE A CD1 
616 N  N   . GLY A 73 ? 0.1422 0.1607 0.1420 -0.0009 0.0050  -0.0017 1073 GLY A N   
617 C  CA  . GLY A 73 ? 0.1550 0.1633 0.1329 -0.0140 0.0004  -0.0049 1073 GLY A CA  
618 C  C   . GLY A 73 ? 0.1390 0.1664 0.1190 -0.0090 0.0056  -0.0074 1073 GLY A C   
619 O  O   . GLY A 73 ? 0.1735 0.1744 0.1231 -0.0148 0.0150  -0.0072 1073 GLY A O   
620 N  N   . THR A 74 ? 0.1560 0.1613 0.1117 -0.0131 0.0018  -0.0109 1074 THR A N   
621 C  CA  . THR A 74 ? 0.1500 0.1634 0.1087 -0.0120 0.0049  0.0025  1074 THR A CA  
622 C  C   . THR A 74 ? 0.1323 0.1735 0.1080 -0.0247 0.0044  0.0089  1074 THR A C   
623 O  O   . THR A 74 ? 0.1569 0.1913 0.1041 -0.0229 0.0105  0.0283  1074 THR A O   
624 C  CB  . THR A 74 ? 0.1687 0.1581 0.1260 -0.0061 0.0013  -0.0065 1074 THR A CB  
625 O  OG1 . THR A 74 ? 0.1628 0.1890 0.1654 0.0194  -0.0032 -0.0066 1074 THR A OG1 
626 C  CG2 . THR A 74 ? 0.1853 0.1673 0.1330 -0.0201 -0.0025 -0.0082 1074 THR A CG2 
627 N  N   . VAL A 75 ? 0.1535 0.1733 0.1103 -0.0111 0.0068  0.0216  1075 VAL A N   
628 C  CA  . VAL A 75 ? 0.1593 0.1679 0.1196 -0.0068 -0.0072 0.0113  1075 VAL A CA  
629 C  C   . VAL A 75 ? 0.1505 0.2025 0.1278 -0.0061 0.0009  0.0211  1075 VAL A C   
630 O  O   . VAL A 75 ? 0.1724 0.2173 0.1203 -0.0248 -0.0135 0.0300  1075 VAL A O   
631 C  CB  . VAL A 75 ? 0.1737 0.1788 0.1228 -0.0017 -0.0025 0.0199  1075 VAL A CB  
632 C  CG1 . VAL A 75 ? 0.1882 0.1911 0.1350 0.0029  0.0044  0.0035  1075 VAL A CG1 
633 C  CG2 . VAL A 75 ? 0.1915 0.1890 0.1518 -0.0044 -0.0046 -0.0072 1075 VAL A CG2 
634 N  N   . LEU A 76 ? 0.1412 0.2011 0.1208 -0.0173 -0.0117 0.0195  1076 LEU A N   
635 C  CA  . LEU A 76 ? 0.1488 0.1789 0.1384 0.0016  -0.0044 0.0199  1076 LEU A CA  
636 C  C   . LEU A 76 ? 0.1407 0.1807 0.1419 0.0004  0.0100  0.0154  1076 LEU A C   
637 O  O   . LEU A 76 ? 0.1706 0.2008 0.1785 0.0252  0.0195  0.0363  1076 LEU A O   
638 C  CB  . LEU A 76 ? 0.1411 0.1717 0.1391 -0.0098 -0.0142 0.0108  1076 LEU A CB  
639 C  CG  . LEU A 76 ? 0.1789 0.1914 0.1287 -0.0109 -0.0033 0.0075  1076 LEU A CG  
640 C  CD1 . LEU A 76 ? 0.1771 0.1773 0.1556 -0.0297 0.0071  -0.0071 1076 LEU A CD1 
641 C  CD2 . LEU A 76 ? 0.1662 0.2251 0.1434 0.0131  0.0195  0.0194  1076 LEU A CD2 
642 N  N   . VAL A 77 ? 0.1371 0.1718 0.1208 -0.0079 -0.0024 0.0252  1077 VAL A N   
643 C  CA  . VAL A 77 ? 0.1631 0.1820 0.1487 -0.0100 -0.0074 0.0035  1077 VAL A CA  
644 C  C   . VAL A 77 ? 0.1518 0.1911 0.1417 -0.0123 -0.0070 0.0074  1077 VAL A C   
645 O  O   . VAL A 77 ? 0.1448 0.2039 0.1543 -0.0177 -0.0165 0.0029  1077 VAL A O   
646 C  CB  . VAL A 77 ? 0.1686 0.1838 0.1388 -0.0114 -0.0001 0.0048  1077 VAL A CB  
647 C  CG1 . VAL A 77 ? 0.1946 0.1954 0.1536 -0.0056 0.0024  -0.0015 1077 VAL A CG1 
648 C  CG2 . VAL A 77 ? 0.1899 0.2102 0.1434 0.0044  -0.0081 -0.0110 1077 VAL A CG2 
649 N  N   . GLY A 78 ? 0.1625 0.2008 0.1942 -0.0177 -0.0259 0.0046  1078 GLY A N   
650 C  CA  . GLY A 78 ? 0.1860 0.2225 0.2131 -0.0065 -0.0289 0.0092  1078 GLY A CA  
651 C  C   . GLY A 78 ? 0.1987 0.2399 0.2389 -0.0058 -0.0377 0.0139  1078 GLY A C   
652 O  O   . GLY A 78 ? 0.1763 0.2550 0.2525 -0.0086 -0.0625 0.0346  1078 GLY A O   
653 N  N   . PRO A 79 ? 0.2216 0.2644 0.2588 -0.0187 -0.0451 0.0106  1079 PRO A N   
654 C  CA  . PRO A 79 ? 0.2437 0.2745 0.2758 -0.0147 -0.0444 0.0053  1079 PRO A CA  
655 C  C   . PRO A 79 ? 0.2992 0.3079 0.3150 -0.0307 -0.0401 -0.0106 1079 PRO A C   
656 O  O   . PRO A 79 ? 0.3250 0.3795 0.3048 -0.0286 -0.0908 0.0029  1079 PRO A O   
657 C  CB  . PRO A 79 ? 0.2822 0.2876 0.3327 -0.0255 -0.0419 0.0008  1079 PRO A CB  
658 C  CG  . PRO A 79 ? 0.1885 0.2571 0.2539 -0.0002 -0.0481 -0.0062 1079 PRO A CG  
659 C  CD  . PRO A 79 ? 0.1905 0.2721 0.2515 0.0047  -0.0608 0.0025  1079 PRO A CD  
660 N  N   . THR A 80 ? 0.2693 0.3005 0.2982 -0.0314 -0.0148 -0.0038 1080 THR A N   
661 C  CA  . THR A 80 ? 0.2654 0.2833 0.2650 -0.0096 -0.0263 -0.0013 1080 THR A CA  
662 C  C   . THR A 80 ? 0.2641 0.2951 0.2809 -0.0169 -0.0221 0.0014  1080 THR A C   
663 O  O   . THR A 80 ? 0.2451 0.3042 0.3038 -0.0233 0.0026  0.0072  1080 THR A O   
664 C  CB  . THR A 80 ? 0.2349 0.2615 0.2400 -0.0148 -0.0193 -0.0017 1080 THR A CB  
665 O  OG1 . THR A 80 ? 0.2626 0.3007 0.1762 -0.0167 -0.0188 0.0125  1080 THR A OG1 
666 C  CG2 . THR A 80 ? 0.2489 0.2603 0.1933 -0.0041 -0.0178 0.0112  1080 THR A CG2 
667 N  N   . PRO A 81 ? 0.3006 0.3218 0.3216 0.0041  -0.0144 -0.0058 1081 PRO A N   
668 C  CA  . PRO A 81 ? 0.2839 0.3165 0.3021 0.0044  -0.0189 0.0023  1081 PRO A CA  
669 C  C   . PRO A 81 ? 0.2770 0.3049 0.2915 0.0100  -0.0081 0.0042  1081 PRO A C   
670 O  O   . PRO A 81 ? 0.2599 0.3433 0.3239 0.0171  -0.0373 0.0132  1081 PRO A O   
671 C  CB  . PRO A 81 ? 0.3030 0.3304 0.3204 0.0119  -0.0186 -0.0108 1081 PRO A CB  
672 C  CG  . PRO A 81 ? 0.3521 0.3501 0.3468 0.0106  -0.0377 -0.0106 1081 PRO A CG  
673 C  CD  . PRO A 81 ? 0.2956 0.3322 0.3277 0.0128  -0.0338 -0.0055 1081 PRO A CD  
674 N  N   . VAL A 82 ? 0.2671 0.2997 0.2735 -0.0031 -0.0292 0.0080  1082 VAL A N   
675 C  CA  . VAL A 82 ? 0.2743 0.2951 0.2672 -0.0007 -0.0135 0.0151  1082 VAL A CA  
676 C  C   . VAL A 82 ? 0.2338 0.2662 0.2401 -0.0027 -0.0170 0.0208  1082 VAL A C   
677 O  O   . VAL A 82 ? 0.2178 0.2909 0.2392 -0.0063 -0.0288 0.0139  1082 VAL A O   
678 C  CB  . VAL A 82 ? 0.3054 0.3086 0.2794 -0.0032 -0.0369 0.0208  1082 VAL A CB  
679 C  CG1 . VAL A 82 ? 0.3448 0.3785 0.3045 0.0109  -0.0276 0.0121  1082 VAL A CG1 
680 C  CG2 . VAL A 82 ? 0.3207 0.3416 0.2984 -0.0169 -0.0237 0.0279  1082 VAL A CG2 
681 N  N   . ASN A 83 ? 0.2265 0.2421 0.2207 0.0086  -0.0057 0.0350  1083 ASN A N   
682 C  CA  . ASN A 83 ? 0.2158 0.2210 0.2020 0.0057  -0.0039 0.0258  1083 ASN A CA  
683 C  C   . ASN A 83 ? 0.2046 0.2075 0.1930 0.0070  0.0030  0.0268  1083 ASN A C   
684 O  O   . ASN A 83 ? 0.2419 0.2119 0.2067 0.0256  0.0008  0.0693  1083 ASN A O   
685 C  CB  . ASN A 83 ? 0.2242 0.2258 0.2088 0.0251  0.0056  0.0319  1083 ASN A CB  
686 C  CG  . ASN A 83 ? 0.2110 0.2536 0.2376 0.0255  0.0148  0.0382  1083 ASN A CG  
687 O  OD1 . ASN A 83 ? 0.2520 0.2754 0.3034 0.0313  0.0634  0.0673  1083 ASN A OD1 
688 N  ND2 . ASN A 83 ? 0.2366 0.2391 0.2580 0.0374  0.0346  0.0257  1083 ASN A ND2 
689 N  N   A ILE A 84 ? 0.1914 0.1961 0.1694 0.0050  -0.0092 0.0211  1084 ILE A N   
690 N  N   B ILE A 84 ? 0.1929 0.1992 0.1746 0.0060  -0.0091 0.0217  1084 ILE A N   
691 C  CA  A ILE A 84 ? 0.1913 0.1916 0.1727 0.0031  -0.0107 0.0154  1084 ILE A CA  
692 C  CA  B ILE A 84 ? 0.1929 0.1968 0.1749 0.0067  -0.0106 0.0173  1084 ILE A CA  
693 C  C   A ILE A 84 ? 0.1862 0.1887 0.1624 0.0016  -0.0168 0.0157  1084 ILE A C   
694 C  C   B ILE A 84 ? 0.1880 0.1914 0.1645 0.0027  -0.0167 0.0162  1084 ILE A C   
695 O  O   A ILE A 84 ? 0.1924 0.1849 0.1639 -0.0043 -0.0139 0.0303  1084 ILE A O   
696 O  O   B ILE A 84 ? 0.1949 0.1864 0.1646 -0.0031 -0.0138 0.0308  1084 ILE A O   
697 C  CB  A ILE A 84 ? 0.1866 0.1984 0.1682 0.0098  -0.0134 0.0139  1084 ILE A CB  
698 C  CB  B ILE A 84 ? 0.1933 0.2092 0.1766 0.0112  -0.0125 0.0138  1084 ILE A CB  
699 C  CG1 A ILE A 84 ? 0.2077 0.1863 0.1962 0.0002  -0.0015 -0.0008 1084 ILE A CG1 
700 C  CG1 B ILE A 84 ? 0.2355 0.2293 0.2153 0.0070  0.0052  0.0026  1084 ILE A CG1 
701 C  CG2 A ILE A 84 ? 0.2092 0.2105 0.1692 0.0004  -0.0098 0.0184  1084 ILE A CG2 
702 C  CG2 B ILE A 84 ? 0.2070 0.2136 0.1901 0.0013  -0.0118 0.0196  1084 ILE A CG2 
703 C  CD1 A ILE A 84 ? 0.2120 0.1871 0.1958 -0.0238 -0.0075 0.0000  1084 ILE A CD1 
704 C  CD1 B ILE A 84 ? 0.2709 0.2696 0.2490 0.0112  0.0061  0.0004  1084 ILE A CD1 
705 N  N   . ILE A 85 ? 0.1924 0.1803 0.1600 0.0085  -0.0185 0.0187  1085 ILE A N   
706 C  CA  . ILE A 85 ? 0.1947 0.1719 0.1448 -0.0011 -0.0204 0.0146  1085 ILE A CA  
707 C  C   . ILE A 85 ? 0.1860 0.1644 0.1340 0.0046  -0.0297 0.0192  1085 ILE A C   
708 O  O   . ILE A 85 ? 0.2266 0.2018 0.1363 -0.0076 -0.0168 0.0290  1085 ILE A O   
709 C  CB  . ILE A 85 ? 0.2018 0.1753 0.1313 -0.0007 -0.0228 0.0168  1085 ILE A CB  
710 C  CG1 . ILE A 85 ? 0.2179 0.1828 0.1750 -0.0164 -0.0275 0.0139  1085 ILE A CG1 
711 C  CG2 . ILE A 85 ? 0.2311 0.1969 0.1676 -0.0051 -0.0230 0.0017  1085 ILE A CG2 
712 C  CD1 . ILE A 85 ? 0.2661 0.2107 0.1966 -0.0237 0.0258  0.0116  1085 ILE A CD1 
713 N  N   . GLY A 86 ? 0.1980 0.1758 0.1371 0.0121  -0.0137 0.0150  1086 GLY A N   
714 C  CA  . GLY A 86 ? 0.2003 0.1675 0.1327 0.0139  -0.0159 0.0256  1086 GLY A CA  
715 C  C   . GLY A 86 ? 0.1971 0.1802 0.1260 -0.0002 -0.0020 0.0063  1086 GLY A C   
716 O  O   . GLY A 86 ? 0.2090 0.1732 0.1163 -0.0223 0.0054  0.0040  1086 GLY A O   
717 N  N   . ARG A 87 ? 0.2250 0.1761 0.1237 0.0000  -0.0061 -0.0145 1087 ARG A N   
718 C  CA  . ARG A 87 ? 0.2074 0.1801 0.1387 0.0078  0.0033  0.0016  1087 ARG A CA  
719 C  C   . ARG A 87 ? 0.2024 0.1733 0.1260 -0.0111 0.0101  -0.0006 1087 ARG A C   
720 O  O   . ARG A 87 ? 0.2522 0.2164 0.1189 -0.0230 0.0199  -0.0102 1087 ARG A O   
721 C  CB  . ARG A 87 ? 0.2158 0.1761 0.1287 0.0105  -0.0030 -0.0071 1087 ARG A CB  
722 C  CG  . ARG A 87 ? 0.2366 0.1926 0.1155 0.0122  -0.0108 0.0079  1087 ARG A CG  
723 C  CD  . ARG A 87 ? 0.2387 0.2089 0.1347 0.0345  -0.0035 -0.0029 1087 ARG A CD  
724 N  NE  . ARG A 87 ? 0.2444 0.2358 0.1236 0.0445  -0.0048 -0.0062 1087 ARG A NE  
725 C  CZ  . ARG A 87 ? 0.2677 0.2143 0.1484 0.0158  -0.0215 -0.0098 1087 ARG A CZ  
726 N  NH1 . ARG A 87 ? 0.2839 0.2081 0.1527 0.0343  -0.0453 -0.0267 1087 ARG A NH1 
727 N  NH2 . ARG A 87 ? 0.3010 0.1958 0.1891 0.0489  -0.0447 -0.0186 1087 ARG A NH2 
728 N  N   . ASN A 88 ? 0.1797 0.1897 0.1199 -0.0222 -0.0007 0.0032  1088 ASN A N   
729 C  CA  . ASN A 88 ? 0.1773 0.1859 0.1279 0.0029  0.0006  -0.0092 1088 ASN A CA  
730 C  C   . ASN A 88 ? 0.1816 0.1981 0.1196 -0.0171 -0.0012 -0.0114 1088 ASN A C   
731 O  O   . ASN A 88 ? 0.1795 0.2498 0.1718 -0.0237 0.0289  -0.0695 1088 ASN A O   
732 C  CB  . ASN A 88 ? 0.1560 0.1786 0.1200 0.0096  -0.0052 -0.0092 1088 ASN A CB  
733 C  CG  . ASN A 88 ? 0.1518 0.2028 0.1295 0.0076  -0.0012 -0.0009 1088 ASN A CG  
734 O  OD1 . ASN A 88 ? 0.1788 0.1761 0.1297 0.0063  -0.0207 0.0011  1088 ASN A OD1 
735 N  ND2 . ASN A 88 ? 0.1617 0.1878 0.1328 0.0013  0.0281  0.0135  1088 ASN A ND2 
736 N  N   . LEU A 89 ? 0.2025 0.1684 0.1331 -0.0190 -0.0224 -0.0021 1089 LEU A N   
737 C  CA  . LEU A 89 ? 0.1885 0.1706 0.1375 -0.0046 -0.0167 -0.0052 1089 LEU A CA  
738 C  C   . LEU A 89 ? 0.2086 0.1919 0.1260 -0.0125 -0.0244 0.0027  1089 LEU A C   
739 O  O   . LEU A 89 ? 0.2203 0.2127 0.1351 -0.0079 -0.0500 -0.0033 1089 LEU A O   
740 C  CB  . LEU A 89 ? 0.2111 0.1765 0.1633 -0.0019 -0.0232 -0.0152 1089 LEU A CB  
741 C  CG  . LEU A 89 ? 0.2150 0.2127 0.1796 -0.0085 0.0307  -0.0252 1089 LEU A CG  
742 C  CD1 . LEU A 89 ? 0.2534 0.2649 0.2548 -0.0392 -0.0020 -0.0418 1089 LEU A CD1 
743 C  CD2 . LEU A 89 ? 0.2224 0.3062 0.1937 0.0181  0.0260  0.0425  1089 LEU A CD2 
744 N  N   . LEU A 90 ? 0.2246 0.1863 0.1333 -0.0159 -0.0335 0.0001  1090 LEU A N   
745 C  CA  . LEU A 90 ? 0.2076 0.1816 0.1470 -0.0056 -0.0173 0.0011  1090 LEU A CA  
746 C  C   . LEU A 90 ? 0.2190 0.1853 0.1496 0.0023  -0.0162 0.0066  1090 LEU A C   
747 O  O   . LEU A 90 ? 0.2183 0.2051 0.1492 -0.0038 -0.0247 0.0110  1090 LEU A O   
748 C  CB  . LEU A 90 ? 0.2412 0.1718 0.1512 -0.0133 -0.0132 0.0232  1090 LEU A CB  
749 C  CG  . LEU A 90 ? 0.2346 0.2027 0.1637 -0.0218 -0.0262 0.0238  1090 LEU A CG  
750 C  CD1 . LEU A 90 ? 0.2402 0.2423 0.1680 -0.0139 -0.0485 0.0149  1090 LEU A CD1 
751 C  CD2 . LEU A 90 ? 0.2137 0.2308 0.1750 -0.0042 -0.0208 0.0053  1090 LEU A CD2 
752 N  N   A THR A 91 ? 0.2037 0.1795 0.1389 0.0033  -0.0077 0.0005  1091 THR A N   
753 N  N   B THR A 91 ? 0.2126 0.1889 0.1537 0.0026  -0.0098 0.0010  1091 THR A N   
754 N  N   C THR A 91 ? 0.2041 0.1758 0.1395 -0.0001 -0.0073 0.0026  1091 THR A N   
755 C  CA  A THR A 91 ? 0.2001 0.1887 0.1444 0.0105  -0.0114 -0.0027 1091 THR A CA  
756 C  CA  B THR A 91 ? 0.2130 0.2027 0.1681 0.0090  -0.0162 -0.0031 1091 THR A CA  
757 C  CA  C THR A 91 ? 0.1939 0.1809 0.1409 0.0013  -0.0098 -0.0016 1091 THR A CA  
758 C  C   A THR A 91 ? 0.2007 0.1990 0.1534 0.0103  -0.0138 -0.0029 1091 THR A C   
759 C  C   B THR A 91 ? 0.2088 0.2087 0.1670 0.0093  -0.0155 -0.0032 1091 THR A C   
760 C  C   C THR A 91 ? 0.2003 0.1992 0.1546 0.0060  -0.0108 -0.0023 1091 THR A C   
761 O  O   A THR A 91 ? 0.2288 0.2120 0.1467 0.0183  -0.0342 -0.0063 1091 THR A O   
762 O  O   B THR A 91 ? 0.2290 0.2199 0.1595 0.0186  -0.0322 -0.0090 1091 THR A O   
763 O  O   C THR A 91 ? 0.2086 0.2056 0.1561 0.0189  -0.0196 -0.0169 1091 THR A O   
764 C  CB  A THR A 91 ? 0.1965 0.1846 0.1438 0.0086  -0.0062 -0.0023 1091 THR A CB  
765 C  CB  B THR A 91 ? 0.2237 0.2080 0.1807 0.0036  -0.0119 -0.0029 1091 THR A CB  
766 C  CB  C THR A 91 ? 0.2050 0.1757 0.1383 -0.0123 -0.0022 0.0015  1091 THR A CB  
767 O  OG1 A THR A 91 ? 0.1739 0.2035 0.1412 0.0225  0.0165  -0.0020 1091 THR A OG1 
768 O  OG1 B THR A 91 ? 0.2699 0.2548 0.2439 0.0105  -0.0324 -0.0084 1091 THR A OG1 
769 O  OG1 C THR A 91 ? 0.1570 0.1569 0.0741 -0.0362 -0.0122 -0.0135 1091 THR A OG1 
770 C  CG2 A THR A 91 ? 0.1800 0.1730 0.0776 -0.0013 0.0065  -0.0062 1091 THR A CG2 
771 C  CG2 B THR A 91 ? 0.1830 0.2101 0.1757 0.0061  -0.0162 -0.0066 1091 THR A CG2 
772 C  CG2 C THR A 91 ? 0.1748 0.1606 0.1234 -0.0307 0.0139  0.0126  1091 THR A CG2 
773 N  N   . GLN A 92 ? 0.2034 0.2242 0.1479 0.0215  -0.0194 -0.0154 1092 GLN A N   
774 C  CA  . GLN A 92 ? 0.1941 0.2223 0.1646 0.0096  -0.0195 -0.0115 1092 GLN A CA  
775 C  C   . GLN A 92 ? 0.2097 0.2343 0.1765 0.0195  -0.0269 -0.0055 1092 GLN A C   
776 O  O   . GLN A 92 ? 0.2347 0.2498 0.1998 0.0145  -0.0380 -0.0157 1092 GLN A O   
777 C  CB  . GLN A 92 ? 0.1566 0.2585 0.1508 0.0051  -0.0163 -0.0242 1092 GLN A CB  
778 C  CG  . GLN A 92 ? 0.1391 0.2397 0.1255 0.0108  -0.0130 -0.0224 1092 GLN A CG  
779 C  CD  . GLN A 92 ? 0.1679 0.2437 0.0782 0.0311  0.0122  -0.0427 1092 GLN A CD  
780 O  OE1 . GLN A 92 ? 0.2030 0.3135 0.1557 0.0611  -0.0001 -0.0916 1092 GLN A OE1 
781 N  NE2 . GLN A 92 ? 0.1166 0.2105 0.0736 0.0269  0.0082  -0.0372 1092 GLN A NE2 
782 N  N   . ILE A 93 ? 0.2292 0.2453 0.1833 0.0302  -0.0425 -0.0137 1093 ILE A N   
783 C  CA  . ILE A 93 ? 0.2195 0.2524 0.2174 0.0137  -0.0419 -0.0161 1093 ILE A CA  
784 C  C   . ILE A 93 ? 0.2213 0.2456 0.2525 0.0211  -0.0594 -0.0067 1093 ILE A C   
785 O  O   . ILE A 93 ? 0.2533 0.2620 0.3043 -0.0002 -0.0793 -0.0323 1093 ILE A O   
786 C  CB  . ILE A 93 ? 0.2407 0.2592 0.2315 0.0252  -0.0256 -0.0148 1093 ILE A CB  
787 C  CG1 . ILE A 93 ? 0.2349 0.2525 0.1836 0.0128  -0.0407 0.0046  1093 ILE A CG1 
788 C  CG2 . ILE A 93 ? 0.2259 0.2928 0.2205 0.0271  -0.0290 0.0313  1093 ILE A CG2 
789 C  CD1 . ILE A 93 ? 0.2618 0.2651 0.2221 0.0076  -0.0104 -0.0209 1093 ILE A CD1 
790 N  N   . GLY A 94 ? 0.2316 0.2331 0.2151 0.0059  -0.0486 -0.0237 1094 GLY A N   
791 C  CA  . GLY A 94 ? 0.2291 0.2386 0.2433 -0.0019 -0.0444 0.0043  1094 GLY A CA  
792 C  C   . GLY A 94 ? 0.2402 0.2372 0.2457 -0.0028 -0.0434 0.0095  1094 GLY A C   
793 O  O   . GLY A 94 ? 0.2450 0.2744 0.2745 -0.0304 -0.0844 0.0357  1094 GLY A O   
794 N  N   . CYS A 95 ? 0.2284 0.2143 0.2250 0.0014  -0.0511 0.0238  1095 CYS A N   
795 C  CA  . CYS A 95 ? 0.2243 0.2126 0.2164 0.0106  -0.0353 0.0051  1095 CYS A CA  
796 C  C   . CYS A 95 ? 0.2475 0.2209 0.2275 0.0079  -0.0376 0.0121  1095 CYS A C   
797 O  O   . CYS A 95 ? 0.3120 0.2174 0.2277 0.0248  -0.0714 0.0155  1095 CYS A O   
798 C  CB  . CYS A 95 ? 0.2270 0.2325 0.2260 0.0120  -0.0542 0.0098  1095 CYS A CB  
799 S  SG  . CYS A 95 ? 0.2375 0.2447 0.2274 -0.0152 -0.0699 0.0435  1095 CYS A SG  
800 N  N   . THR A 96 ? 0.2321 0.2203 0.1889 0.0011  -0.0304 0.0116  1096 THR A N   
801 C  CA  . THR A 96 ? 0.2187 0.2175 0.2179 0.0123  -0.0279 0.0000  1096 THR A CA  
802 C  C   . THR A 96 ? 0.2072 0.2243 0.2026 0.0116  -0.0207 0.0075  1096 THR A C   
803 O  O   . THR A 96 ? 0.2177 0.2146 0.2085 -0.0004 -0.0351 0.0014  1096 THR A O   
804 C  CB  . THR A 96 ? 0.2498 0.2426 0.2224 0.0067  -0.0294 -0.0040 1096 THR A CB  
805 O  OG1 . THR A 96 ? 0.2162 0.2517 0.2609 0.0066  -0.0134 -0.0088 1096 THR A OG1 
806 C  CG2 . THR A 96 ? 0.2441 0.2674 0.2389 0.0224  -0.0448 -0.0142 1096 THR A CG2 
807 N  N   . LEU A 97 ? 0.1954 0.2068 0.2003 0.0180  -0.0231 -0.0027 1097 LEU A N   
808 C  CA  . LEU A 97 ? 0.2004 0.2024 0.1863 0.0143  -0.0134 0.0052  1097 LEU A CA  
809 C  C   . LEU A 97 ? 0.1828 0.2064 0.2050 0.0119  -0.0135 0.0061  1097 LEU A C   
810 O  O   . LEU A 97 ? 0.1832 0.2432 0.2413 0.0242  0.0024  0.0223  1097 LEU A O   
811 C  CB  . LEU A 97 ? 0.2043 0.1937 0.1838 0.0204  -0.0222 -0.0043 1097 LEU A CB  
812 C  CG  . LEU A 97 ? 0.2078 0.2107 0.1832 0.0104  -0.0265 0.0076  1097 LEU A CG  
813 C  CD1 . LEU A 97 ? 0.2327 0.2238 0.2037 -0.0197 -0.0042 0.0195  1097 LEU A CD1 
814 C  CD2 . LEU A 97 ? 0.2147 0.2404 0.1932 0.0016  -0.0087 0.0204  1097 LEU A CD2 
815 N  N   . ASN A 98 ? 0.1785 0.2191 0.2122 0.0048  -0.0076 0.0114  1098 ASN A N   
816 C  CA  . ASN A 98 ? 0.1980 0.2198 0.2100 0.0128  -0.0035 0.0090  1098 ASN A CA  
817 C  C   . ASN A 98 ? 0.2078 0.2414 0.2166 0.0044  -0.0060 0.0193  1098 ASN A C   
818 O  O   . ASN A 98 ? 0.1854 0.2382 0.2276 -0.0128 -0.0037 0.0221  1098 ASN A O   
819 C  CB  . ASN A 98 ? 0.2097 0.2526 0.2350 -0.0117 0.0011  0.0133  1098 ASN A CB  
820 C  CG  . ASN A 98 ? 0.1888 0.2634 0.2663 -0.0114 -0.0192 0.0026  1098 ASN A CG  
821 O  OD1 . ASN A 98 ? 0.2360 0.3956 0.3330 -0.0163 -0.0139 0.0272  1098 ASN A OD1 
822 N  ND2 . ASN A 98 ? 0.2282 0.2400 0.2678 -0.0357 -0.0430 0.0249  1098 ASN A ND2 
823 N  N   . PHE A 99 ? 0.2150 0.2741 0.2392 0.0056  0.0029  0.0199  1099 PHE A N   
824 C  CA  . PHE A 99 ? 0.2296 0.2513 0.2404 0.0033  0.0088  0.0240  1099 PHE A CA  
825 C  C   . PHE A 99 ? 0.2402 0.2881 0.2660 0.0000  0.0096  0.0152  1099 PHE A C   
826 O  O   . PHE A 99 ? 0.2409 0.3208 0.2870 -0.0025 0.0319  0.0365  1099 PHE A O   
827 C  CB  . PHE A 99 ? 0.2519 0.2663 0.2588 -0.0032 0.0034  0.0197  1099 PHE A CB  
828 C  CG  . PHE A 99 ? 0.2172 0.2904 0.2497 -0.0095 0.0159  0.0292  1099 PHE A CG  
829 C  CD1 . PHE A 99 ? 0.2557 0.2924 0.3386 -0.0074 0.0036  0.0051  1099 PHE A CD1 
830 C  CD2 . PHE A 99 ? 0.2777 0.2794 0.2679 0.0007  -0.0248 0.0202  1099 PHE A CD2 
831 C  CE1 . PHE A 99 ? 0.2869 0.3040 0.3157 -0.0120 0.0300  0.0077  1099 PHE A CE1 
832 C  CE2 . PHE A 99 ? 0.2968 0.2894 0.3128 -0.0012 -0.0124 0.0355  1099 PHE A CE2 
833 C  CZ  . PHE A 99 ? 0.3166 0.3069 0.3190 0.0133  0.0017  0.0135  1099 PHE A CZ  
835 MG MG  . MG  B .  ? 0.3139 0.3127 0.1585 -0.0318 -0.0043 0.0517  201  MG  A MG  
836 C  C1  . PGR C .  ? 0.2832 0.3318 0.1922 -0.0227 -0.0375 -0.0012 907  PGR A C1  
837 C  C2  . PGR C .  ? 0.2881 0.3233 0.2311 0.0006  -0.0124 0.0240  907  PGR A C2  
838 C  C3  . PGR C .  ? 0.1415 0.2288 0.0905 0.0330  -0.0077 -0.0084 907  PGR A C3  
839 O  O1  . PGR C .  ? 0.3955 0.4007 0.2634 -0.0313 0.0015  0.0265  907  PGR A O1  
840 O  O2  . PGR C .  ? 0.3884 0.3943 0.2972 -0.0497 -0.0578 -0.0038 907  PGR A O2  
841 O  O   . HOH D .  ? 0.2309 0.3264 0.1429 -0.0227 0.0183  0.0401  1    HOH A O   
842 O  O   . HOH D .  ? 0.0525 0.1875 0.0320 0.0308  -0.0023 -0.0005 2    HOH A O   
843 O  O   . HOH D .  ? 0.2010 0.4919 0.1294 0.1692  0.0130  0.0181  3    HOH A O   
844 O  O   . HOH D .  ? 0.1921 0.1916 0.1171 -0.0190 -0.0379 0.0451  4    HOH A O   
845 O  O   . HOH D .  ? 0.1474 0.2058 0.0973 0.0021  0.0030  -0.0260 5    HOH A O   
846 O  O   . HOH D .  ? 0.2591 0.2699 0.1925 0.0228  -0.0011 0.0559  6    HOH A O   
847 O  O   . HOH D .  ? 0.3202 0.2665 0.1086 0.0129  -0.0203 -0.0179 7    HOH A O   
848 O  O   . HOH D .  ? 0.1509 0.2813 0.1275 -0.0134 0.0145  0.0097  8    HOH A O   
849 O  O   . HOH D .  ? 0.2006 0.2944 0.1441 -0.0013 0.0176  0.0199  9    HOH A O   
850 O  O   . HOH D .  ? 0.2146 0.2447 0.1884 0.0213  0.0017  0.0586  10   HOH A O   
851 O  O   . HOH D .  ? 0.3221 0.2361 0.1435 -0.0662 -0.0497 0.0027  11   HOH A O   
852 O  O   . HOH D .  ? 0.2257 0.2592 0.1802 -0.0062 -0.0081 0.0121  12   HOH A O   
853 O  O   . HOH D .  ? 0.2496 0.3156 0.1347 0.0180  0.0366  -0.0051 13   HOH A O   
854 O  O   . HOH D .  ? 0.2856 0.2319 0.1397 0.0623  -0.0527 -0.0086 14   HOH A O   
855 O  O   . HOH D .  ? 0.4087 0.2644 0.2771 -0.0553 -0.0865 -0.0261 15   HOH A O   
856 O  O   . HOH D .  ? 0.3528 0.2455 0.2006 0.0192  -0.0063 -0.0252 16   HOH A O   
857 O  O   . HOH D .  ? 0.2272 0.2806 0.1336 0.0281  -0.0074 0.0508  17   HOH A O   
858 O  O   . HOH D .  ? 0.3635 0.2656 0.2293 0.1287  -0.1556 -0.1119 19   HOH A O   
859 O  O   . HOH D .  ? 0.2170 0.3271 0.1513 -0.0042 0.0151  0.0093  20   HOH A O   
860 O  O   . HOH D .  ? 0.2320 0.3100 0.2406 0.0590  -0.0349 -0.0665 21   HOH A O   
861 O  O   . HOH D .  ? 0.3153 0.5558 0.2395 0.2214  -0.0941 -0.1192 22   HOH A O   
862 O  O   . HOH D .  ? 0.2481 0.2897 0.1953 -0.0082 -0.0220 -0.0096 23   HOH A O   
863 O  O   . HOH D .  ? 0.3858 0.3453 0.2089 -0.0998 -0.0875 0.0640  24   HOH A O   
864 O  O   . HOH D .  ? 1.1995 0.2870 0.2724 0.0990  -0.2422 -0.2439 25   HOH A O   
865 O  O   . HOH D .  ? 0.3088 0.4292 0.2733 0.0042  0.0226  -0.0858 26   HOH A O   
866 O  O   . HOH D .  ? 0.2477 0.5842 0.2806 -0.0022 -0.0635 -0.0065 27   HOH A O   
867 O  O   . HOH D .  ? 0.4054 0.2902 0.1748 -0.0854 -0.0817 0.0594  28   HOH A O   
868 O  O   . HOH D .  ? 0.4798 0.2536 0.3831 0.0332  0.0853  -0.0048 29   HOH A O   
869 O  O   . HOH D .  ? 0.3259 0.3719 0.1916 -0.0418 -0.0274 0.0094  30   HOH A O   
870 O  O   . HOH D .  ? 0.3942 0.4892 0.3005 0.2442  0.1155  0.1469  31   HOH A O   
871 O  O   . HOH D .  ? 0.7099 0.3039 0.2824 0.1698  0.1108  0.0073  32   HOH A O   
872 O  O   . HOH D .  ? 0.2140 0.2374 0.1343 0.0139  0.0320  0.0155  33   HOH A O   
873 O  O   . HOH D .  ? 0.1788 0.1112 0.0922 0.0551  0.0343  -0.0024 34   HOH A O   
874 O  O   . HOH D .  ? 0.2492 0.3129 0.1210 0.0708  -0.0365 -0.0386 35   HOH A O   
875 O  O   . HOH D .  ? 0.2572 0.2590 0.2434 0.0532  -0.0357 0.0261  36   HOH A O   
876 O  O   . HOH D .  ? 0.2602 0.4117 0.1593 -0.0550 0.0209  -0.0135 37   HOH A O   
877 O  O   . HOH D .  ? 0.2924 0.3603 0.2321 -0.0007 0.0747  0.0271  38   HOH A O   
878 O  O   . HOH D .  ? 0.2065 0.4305 0.3325 0.0670  0.0470  0.1722  39   HOH A O   
879 O  O   . HOH D .  ? 0.4429 0.3438 0.3186 0.0160  0.0699  -0.0360 40   HOH A O   
880 O  O   . HOH D .  ? 0.3745 0.3512 0.2074 -0.0207 0.0302  -0.0495 41   HOH A O   
881 O  O   . HOH D .  ? 0.2671 0.3428 0.2983 0.0439  -0.0419 -0.0701 42   HOH A O   
882 O  O   . HOH D .  ? 0.2189 0.4600 0.5027 0.1130  0.0252  0.0701  43   HOH A O   
883 O  O   . HOH D .  ? 0.4213 0.4853 0.2568 0.1905  -0.0835 -0.1602 44   HOH A O   
884 O  O   . HOH D .  ? 0.3244 0.5905 0.3661 -0.0477 0.0194  0.0187  45   HOH A O   
885 O  O   . HOH D .  ? 0.3126 0.3286 0.4870 -0.0372 -0.1377 0.0711  46   HOH A O   
886 O  O   . HOH D .  ? 0.4042 0.3241 0.2973 -0.0714 0.0913  0.0102  47   HOH A O   
887 O  O   . HOH D .  ? 0.2313 0.3930 0.2164 0.0350  -0.0197 0.0336  48   HOH A O   
888 O  O   . HOH D .  ? 0.2926 0.4645 0.3237 0.1158  0.0002  -0.0386 49   HOH A O   
889 O  O   . HOH D .  ? 0.4318 0.1376 0.2190 -0.0064 -0.0456 -0.0768 50   HOH A O   
890 O  O   . HOH D .  ? 0.2184 0.4073 0.5160 0.0222  0.0640  -0.0743 51   HOH A O   
891 O  O   . HOH D .  ? 0.5765 0.2766 0.3385 0.0833  -0.1066 0.0052  52   HOH A O   
892 O  O   . HOH D .  ? 0.4350 0.5190 0.3073 -0.1221 0.0212  0.1964  53   HOH A O   
893 O  O   . HOH D .  ? 0.4034 0.3543 0.4268 0.1761  0.0393  -0.0144 54   HOH A O   
894 O  O   . HOH D .  ? 0.2825 0.7812 0.2058 -0.0461 -0.0286 -0.1453 55   HOH A O   
895 O  O   . HOH D .  ? 0.3341 0.2858 0.2416 -0.0192 0.0401  0.0223  57   HOH A O   
896 O  O   . HOH D .  ? 0.3507 0.4514 0.2610 0.0687  0.0704  0.0095  58   HOH A O   
897 O  O   . HOH D .  ? 0.4631 0.2837 0.4475 0.0152  -0.0484 0.0436  59   HOH A O   
898 O  O   . HOH D .  ? 0.4119 0.4233 0.3851 -0.0606 0.1183  0.0810  60   HOH A O   
899 O  O   . HOH D .  ? 0.3585 0.4283 0.2340 -0.0387 0.0348  0.0294  61   HOH A O   
900 O  O   . HOH D .  ? 0.2054 0.5273 0.3629 -0.0046 -0.1031 0.1790  62   HOH A O   
901 O  O   . HOH D .  ? 0.3862 0.4573 0.3502 -0.1059 0.1070  -0.1024 63   HOH A O   
902 O  O   . HOH D .  ? 0.4483 0.4201 0.2370 -0.0448 0.0321  0.0216  64   HOH A O   
903 O  O   . HOH D .  ? 0.4993 0.2393 0.6006 -0.1321 -0.1321 0.0794  65   HOH A O   
904 O  O   . HOH D .  ? 0.6665 0.9264 0.4164 0.3818  0.0328  0.0863  66   HOH A O   
905 O  O   . HOH D .  ? 0.6497 0.3495 0.3688 -0.0892 -0.0404 -0.0244 67   HOH A O   
906 O  O   . HOH D .  ? 0.2629 0.4905 0.7590 -0.0126 -0.0953 0.2939  68   HOH A O   
907 O  O   . HOH D .  ? 0.4635 0.3325 0.2538 -0.0102 -0.0126 -0.0254 69   HOH A O   
908 O  O   . HOH D .  ? 0.2270 0.9010 0.4227 0.0754  0.1738  0.0538  70   HOH A O   
909 O  O   . HOH D .  ? 0.6756 0.4574 0.3349 -0.0048 -0.1212 -0.0286 71   HOH A O   
910 O  O   . HOH D .  ? 0.3296 0.5546 0.2701 0.0325  -0.0438 -0.1190 74   HOH A O   
911 O  O   . HOH D .  ? 0.4484 0.3513 0.3822 -0.0952 -0.1708 -0.0393 75   HOH A O   
912 O  O   . HOH D .  ? 0.5512 0.3416 0.3728 -0.0649 -0.1661 0.0740  76   HOH A O   
913 O  O   . HOH D .  ? 0.6253 0.3611 0.2341 0.1243  -0.0461 0.0414  77   HOH A O   
914 O  O   . HOH D .  ? 0.3299 0.4792 0.4167 0.0109  -0.0247 -0.2593 78   HOH A O   
915 O  O   . HOH D .  ? 0.3856 0.5199 0.3617 -0.0069 -0.0732 -0.0195 79   HOH A O   
916 O  O   . HOH D .  ? 0.7511 0.4193 0.2521 -0.0481 -0.0339 -0.0308 80   HOH A O   
917 O  O   . HOH D .  ? 0.3695 0.4533 0.4670 0.0540  -0.0767 -0.1880 81   HOH A O   
918 O  O   . HOH D .  ? 0.5941 0.4012 0.3288 0.1587  -0.0870 -0.0390 82   HOH A O   
919 O  O   . HOH D .  ? 0.3875 0.3532 0.4380 0.0465  0.0117  0.0353  84   HOH A O   
920 O  O   . HOH D .  ? 0.4944 0.4301 0.1628 -0.1001 -0.0760 0.0801  85   HOH A O   
921 O  O   . HOH D .  ? 0.2520 0.7465 0.3662 -0.0796 0.0707  -0.0660 86   HOH A O   
922 O  O   . HOH D .  ? 0.4907 0.2913 0.2758 -0.0047 -0.0918 -0.0674 88   HOH A O   
923 O  O   . HOH D .  ? 0.4878 0.3199 0.6145 0.1329  -0.2316 -0.0251 89   HOH A O   
924 O  O   . HOH D .  ? 0.3176 0.5878 0.4935 -0.1436 0.1063  -0.1202 90   HOH A O   
925 O  O   . HOH D .  ? 0.8446 1.2260 0.5743 -0.2225 -0.0241 -0.1681 91   HOH A O   
926 O  O   . HOH D .  ? 0.3480 0.4969 0.3032 0.1235  -0.0478 -0.0831 92   HOH A O   
927 O  O   . HOH D .  ? 0.5641 0.6008 0.4227 0.2522  0.0299  -0.0920 93   HOH A O   
928 O  O   . HOH D .  ? 0.6816 0.3554 0.5800 0.1445  -0.2283 0.0767  94   HOH A O   
929 O  O   . HOH D .  ? 0.6730 0.4889 0.4871 0.1610  0.1191  0.1844  95   HOH A O   
930 O  O   . HOH D .  ? 0.7172 0.5389 0.3027 -0.1263 0.0874  0.0529  96   HOH A O   
931 O  O   . HOH D .  ? 0.5229 0.9344 0.2383 0.1808  0.0876  0.0560  97   HOH A O   
932 O  O   . HOH D .  ? 0.4915 0.4782 0.3749 0.1892  -0.0757 -0.0205 98   HOH A O   
933 O  O   . HOH D .  ? 1.4341 0.3105 0.6317 0.4648  0.0378  0.1918  99   HOH A O   
934 O  O   . HOH D .  ? 0.6991 0.3871 0.3443 -0.0430 0.1230  -0.0412 100  HOH A O   
935 O  O   . HOH D .  ? 0.4024 0.8550 0.2973 0.2491  0.0141  0.1484  105  HOH A O   
936 O  O   . HOH D .  ? 0.3807 0.4784 0.2797 0.0044  -0.0996 0.0835  124  HOH A O   
937 O  O   . HOH D .  ? 0.4083 0.5345 0.5298 -0.1121 0.1766  -0.1292 127  HOH A O   
938 O  O   . HOH D .  ? 0.5140 0.5184 0.3065 -0.1221 0.1337  -0.0491 128  HOH A O   
939 O  O   . HOH D .  ? 1.5117 1.2894 0.2621 -0.7307 0.2049  -0.1509 129  HOH A O   
940 O  O   . HOH D .  ? 0.5275 0.6916 0.6279 -0.0669 0.0551  -0.3156 131  HOH A O   
941 O  O   . HOH D .  ? 0.5319 0.4534 0.4091 0.1054  -0.0017 0.0974  132  HOH A O   
942 O  O   . HOH D .  ? 0.4728 0.6938 0.2504 -0.1634 0.0741  -0.0353 133  HOH A O   
943 O  O   . HOH D .  ? 0.3197 0.5356 0.3265 0.0543  0.0162  -0.0407 134  HOH A O   
944 O  O   . HOH D .  ? 0.4775 0.7735 0.4227 -0.2833 0.1074  -0.0135 135  HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PRO 1  1001 1001 PRO PRO A . n 
A 1 2  GLN 2  1002 1002 GLN GLN A . n 
A 1 3  ILE 3  1003 1003 ILE ILE A . n 
A 1 4  THR 4  1004 1004 THR THR A . n 
A 1 5  LEU 5  1005 1005 LEU LEU A . n 
A 1 6  TRP 6  1006 1006 TRP TRP A . n 
A 1 7  LYS 7  1007 1007 LYS LYS A . n 
A 1 8  ARG 8  1008 1008 ARG ARG A . n 
A 1 9  PRO 9  1009 1009 PRO PRO A . n 
A 1 10 LEU 10 1010 1010 LEU LEU A . n 
A 1 11 VAL 11 1011 1011 VAL VAL A . n 
A 1 12 THR 12 1012 1012 THR THR A . n 
A 1 13 ILE 13 1013 1013 ILE ILE A . n 
A 1 14 LYS 14 1014 1014 LYS LYS A . n 
A 1 15 ILE 15 1015 1015 ILE ILE A . n 
A 1 16 GLY 16 1016 1016 GLY GLY A . n 
A 1 17 GLY 17 1017 1017 GLY GLY A . n 
A 1 18 GLN 18 1018 1018 GLN GLN A . n 
A 1 19 LEU 19 1019 1019 LEU LEU A . n 
A 1 20 LYS 20 1020 1020 LYS LYS A . n 
A 1 21 GLU 21 1021 1021 GLU GLU A . n 
A 1 22 ALA 22 1022 1022 ALA ALA A . n 
A 1 23 LEU 23 1023 1023 LEU LEU A . n 
A 1 24 LEU 24 1024 1024 LEU LEU A . n 
A 1 25 ASP 25 1025 1025 ASP ASP A . n 
A 1 26 THR 26 1026 1026 THR THR A . n 
A 1 27 GLY 27 1027 1027 GLY GLY A . n 
A 1 28 ALA 28 1028 1028 ALA ALA A . n 
A 1 29 ASP 29 1029 1029 ASP ASP A . n 
A 1 30 ASP 30 1030 1030 ASP ASP A . n 
A 1 31 THR 31 1031 1031 THR THR A . n 
A 1 32 VAL 32 1032 1032 VAL VAL A . n 
A 1 33 LEU 33 1033 1033 LEU LEU A . n 
A 1 34 GLU 34 1034 1034 GLU GLU A . n 
A 1 35 GLU 35 1035 1035 GLU GLU A . n 
A 1 36 MET 36 1036 1036 MET MET A . n 
A 1 37 ASN 37 1037 1037 ASN ASN A . n 
A 1 38 LEU 38 1038 1038 LEU LEU A . n 
A 1 39 PRO 39 1039 1039 PRO PRO A . n 
A 1 40 GLY 40 1040 1040 GLY GLY A . n 
A 1 41 ARG 41 1041 1041 ARG ARG A . n 
A 1 42 TRP 42 1042 1042 TRP TRP A . n 
A 1 43 LYS 43 1043 1043 LYS LYS A . n 
A 1 44 PRO 44 1044 1044 PRO PRO A . n 
A 1 45 LYS 45 1045 1045 LYS LYS A . n 
A 1 46 MET 46 1046 1046 MET MET A . n 
A 1 47 ILE 47 1047 1047 ILE ILE A . n 
A 1 48 GLY 48 1048 1048 GLY GLY A . n 
A 1 49 GLY 49 1049 1049 GLY GLY A . n 
A 1 50 ILE 50 1050 1050 ILE ILE A . n 
A 1 51 GLY 51 1051 1051 GLY GLY A . n 
A 1 52 GLY 52 1052 1052 GLY GLY A . n 
A 1 53 PHE 53 1053 1053 PHE PHE A . n 
A 1 54 ILE 54 1054 1054 ILE ILE A . n 
A 1 55 LYS 55 1055 1055 LYS LYS A . n 
A 1 56 VAL 56 1056 1056 VAL VAL A . n 
A 1 57 ARG 57 1057 1057 ARG ARG A . n 
A 1 58 GLN 58 1058 1058 GLN GLN A . n 
A 1 59 TYR 59 1059 1059 TYR TYR A . n 
A 1 60 ASP 60 1060 1060 ASP ASP A . n 
A 1 61 GLN 61 1061 1061 GLN GLN A . n 
A 1 62 ILE 62 1062 1062 ILE ILE A . n 
A 1 63 LEU 63 1063 1063 LEU LEU A . n 
A 1 64 ILE 64 1064 1064 ILE ILE A . n 
A 1 65 GLU 65 1065 1065 GLU GLU A . n 
A 1 66 ILE 66 1066 1066 ILE ILE A . n 
A 1 67 CYS 67 1067 1067 CYS CYS A . n 
A 1 68 GLY 68 1068 1068 GLY GLY A . n 
A 1 69 HIS 69 1069 1069 HIS HIS A . n 
A 1 70 LYS 70 1070 1070 LYS LYS A . n 
A 1 71 ALA 71 1071 1071 ALA ALA A . n 
A 1 72 ILE 72 1072 1072 ILE ILE A . n 
A 1 73 GLY 73 1073 1073 GLY GLY A . n 
A 1 74 THR 74 1074 1074 THR THR A . n 
A 1 75 VAL 75 1075 1075 VAL VAL A . n 
A 1 76 LEU 76 1076 1076 LEU LEU A . n 
A 1 77 VAL 77 1077 1077 VAL VAL A . n 
A 1 78 GLY 78 1078 1078 GLY GLY A . n 
A 1 79 PRO 79 1079 1079 PRO PRO A . n 
A 1 80 THR 80 1080 1080 THR THR A . n 
A 1 81 PRO 81 1081 1081 PRO PRO A . n 
A 1 82 VAL 82 1082 1082 VAL VAL A . n 
A 1 83 ASN 83 1083 1083 ASN ASN A . n 
A 1 84 ILE 84 1084 1084 ILE ILE A . n 
A 1 85 ILE 85 1085 1085 ILE ILE A . n 
A 1 86 GLY 86 1086 1086 GLY GLY A . n 
A 1 87 ARG 87 1087 1087 ARG ARG A . n 
A 1 88 ASN 88 1088 1088 ASN ASN A . n 
A 1 89 LEU 89 1089 1089 LEU LEU A . n 
A 1 90 LEU 90 1090 1090 LEU LEU A . n 
A 1 91 THR 91 1091 1091 THR THR A . n 
A 1 92 GLN 92 1092 1092 GLN GLN A . n 
A 1 93 ILE 93 1093 1093 ILE ILE A . n 
A 1 94 GLY 94 1094 1094 GLY GLY A . n 
A 1 95 CYS 95 1095 1095 CYS CYS A . n 
A 1 96 THR 96 1096 1096 THR THR A . n 
A 1 97 LEU 97 1097 1097 LEU LEU A . n 
A 1 98 ASN 98 1098 1098 ASN ASN A . n 
A 1 99 PHE 99 1099 1099 PHE PHE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   201 201 MG  MG  A . 
C 3 PGR 1   907 907 PGR PGR A . 
D 4 HOH 1   1   1   HOH HOH A . 
D 4 HOH 2   2   2   HOH HOH A . 
D 4 HOH 3   3   3   HOH HOH A . 
D 4 HOH 4   4   4   HOH HOH A . 
D 4 HOH 5   5   5   HOH HOH A . 
D 4 HOH 6   6   6   HOH HOH A . 
D 4 HOH 7   7   7   HOH HOH A . 
D 4 HOH 8   8   8   HOH HOH A . 
D 4 HOH 9   9   9   HOH HOH A . 
D 4 HOH 10  10  10  HOH HOH A . 
D 4 HOH 11  11  11  HOH HOH A . 
D 4 HOH 12  12  12  HOH HOH A . 
D 4 HOH 13  13  13  HOH HOH A . 
D 4 HOH 14  14  14  HOH HOH A . 
D 4 HOH 15  15  15  HOH HOH A . 
D 4 HOH 16  16  16  HOH HOH A . 
D 4 HOH 17  17  17  HOH HOH A . 
D 4 HOH 18  19  19  HOH HOH A . 
D 4 HOH 19  20  20  HOH HOH A . 
D 4 HOH 20  21  21  HOH HOH A . 
D 4 HOH 21  22  22  HOH HOH A . 
D 4 HOH 22  23  23  HOH HOH A . 
D 4 HOH 23  24  24  HOH HOH A . 
D 4 HOH 24  25  25  HOH HOH A . 
D 4 HOH 25  26  26  HOH HOH A . 
D 4 HOH 26  27  27  HOH HOH A . 
D 4 HOH 27  28  28  HOH HOH A . 
D 4 HOH 28  29  29  HOH HOH A . 
D 4 HOH 29  30  30  HOH HOH A . 
D 4 HOH 30  31  31  HOH HOH A . 
D 4 HOH 31  32  32  HOH HOH A . 
D 4 HOH 32  33  33  HOH HOH A . 
D 4 HOH 33  34  34  HOH HOH A . 
D 4 HOH 34  35  35  HOH HOH A . 
D 4 HOH 35  36  36  HOH HOH A . 
D 4 HOH 36  37  37  HOH HOH A . 
D 4 HOH 37  38  38  HOH HOH A . 
D 4 HOH 38  39  39  HOH HOH A . 
D 4 HOH 39  40  40  HOH HOH A . 
D 4 HOH 40  41  41  HOH HOH A . 
D 4 HOH 41  42  42  HOH HOH A . 
D 4 HOH 42  43  43  HOH HOH A . 
D 4 HOH 43  44  44  HOH HOH A . 
D 4 HOH 44  45  45  HOH HOH A . 
D 4 HOH 45  46  46  HOH HOH A . 
D 4 HOH 46  47  47  HOH HOH A . 
D 4 HOH 47  48  48  HOH HOH A . 
D 4 HOH 48  49  49  HOH HOH A . 
D 4 HOH 49  50  50  HOH HOH A . 
D 4 HOH 50  51  51  HOH HOH A . 
D 4 HOH 51  52  52  HOH HOH A . 
D 4 HOH 52  53  53  HOH HOH A . 
D 4 HOH 53  54  54  HOH HOH A . 
D 4 HOH 54  55  55  HOH HOH A . 
D 4 HOH 55  57  57  HOH HOH A . 
D 4 HOH 56  58  58  HOH HOH A . 
D 4 HOH 57  59  59  HOH HOH A . 
D 4 HOH 58  60  60  HOH HOH A . 
D 4 HOH 59  61  61  HOH HOH A . 
D 4 HOH 60  62  62  HOH HOH A . 
D 4 HOH 61  63  63  HOH HOH A . 
D 4 HOH 62  64  64  HOH HOH A . 
D 4 HOH 63  65  65  HOH HOH A . 
D 4 HOH 64  66  66  HOH HOH A . 
D 4 HOH 65  67  67  HOH HOH A . 
D 4 HOH 66  68  68  HOH HOH A . 
D 4 HOH 67  69  69  HOH HOH A . 
D 4 HOH 68  70  70  HOH HOH A . 
D 4 HOH 69  71  71  HOH HOH A . 
D 4 HOH 70  74  74  HOH HOH A . 
D 4 HOH 71  75  75  HOH HOH A . 
D 4 HOH 72  76  76  HOH HOH A . 
D 4 HOH 73  77  77  HOH HOH A . 
D 4 HOH 74  78  78  HOH HOH A . 
D 4 HOH 75  79  79  HOH HOH A . 
D 4 HOH 76  80  80  HOH HOH A . 
D 4 HOH 77  81  81  HOH HOH A . 
D 4 HOH 78  82  82  HOH HOH A . 
D 4 HOH 79  84  84  HOH HOH A . 
D 4 HOH 80  85  85  HOH HOH A . 
D 4 HOH 81  86  86  HOH HOH A . 
D 4 HOH 82  88  88  HOH HOH A . 
D 4 HOH 83  89  89  HOH HOH A . 
D 4 HOH 84  90  90  HOH HOH A . 
D 4 HOH 85  91  91  HOH HOH A . 
D 4 HOH 86  92  92  HOH HOH A . 
D 4 HOH 87  93  93  HOH HOH A . 
D 4 HOH 88  94  94  HOH HOH A . 
D 4 HOH 89  95  95  HOH HOH A . 
D 4 HOH 90  96  96  HOH HOH A . 
D 4 HOH 91  97  97  HOH HOH A . 
D 4 HOH 92  98  98  HOH HOH A . 
D 4 HOH 93  99  99  HOH HOH A . 
D 4 HOH 94  100 100 HOH HOH A . 
D 4 HOH 95  105 105 HOH HOH A . 
D 4 HOH 96  124 124 HOH HOH A . 
D 4 HOH 97  127 127 HOH HOH A . 
D 4 HOH 98  128 128 HOH HOH A . 
D 4 HOH 99  129 129 HOH HOH A . 
D 4 HOH 100 131 131 HOH HOH A . 
D 4 HOH 101 132 132 HOH HOH A . 
D 4 HOH 102 133 133 HOH HOH A . 
D 4 HOH 103 134 134 HOH HOH A . 
D 4 HOH 104 135 135 HOH HOH A . 
D 4 HOH 105 136 136 HOH HOH A . 
D 4 HOH 106 148 148 HOH HOH A . 
D 4 HOH 107 153 153 HOH HOH A . 
D 4 HOH 108 157 157 HOH HOH A . 
D 4 HOH 109 163 163 HOH HOH A . 
D 4 HOH 110 169 169 HOH HOH A . 
D 4 HOH 111 173 173 HOH HOH A . 
D 4 HOH 112 174 174 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3360  ? 
1 MORE         -34   ? 
1 'SSA (A^2)'  10710 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? D HOH . ? A HOH 1  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 85 ? 1_555 82.2  ? 
2  O ? D HOH . ? A HOH 1  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 62 ? 1_555 175.4 ? 
3  O ? D HOH . ? A HOH 85 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 62 ? 1_555 97.2  ? 
4  O ? D HOH . ? A HOH 1  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 50 ? 1_555 86.4  ? 
5  O ? D HOH . ? A HOH 85 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 50 ? 1_555 75.7  ? 
6  O ? D HOH . ? A HOH 62 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 50 ? 1_555 89.1  ? 
7  O ? D HOH . ? A HOH 1  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 1  ? 7_555 17.9  ? 
8  O ? D HOH . ? A HOH 85 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 1  ? 7_555 79.0  ? 
9  O ? D HOH . ? A HOH 62 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 1  ? 7_555 157.6 ? 
10 O ? D HOH . ? A HOH 50 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 1  ? 7_555 68.5  ? 
11 O ? D HOH . ? A HOH 1  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 50 ? 7_555 102.5 ? 
12 O ? D HOH . ? A HOH 85 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 50 ? 7_555 108.8 ? 
13 O ? D HOH . ? A HOH 62 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 50 ? 7_555 82.0  ? 
14 O ? D HOH . ? A HOH 50 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 50 ? 7_555 170.4 ? 
15 O ? D HOH . ? A HOH 1  ? 7_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 50 ? 7_555 120.3 ? 
16 O ? D HOH . ? A HOH 1  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 85 ? 7_555 80.7  ? 
17 O ? D HOH . ? A HOH 85 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 85 ? 7_555 146.2 ? 
18 O ? D HOH . ? A HOH 62 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 85 ? 7_555 97.6  ? 
19 O ? D HOH . ? A HOH 50 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 85 ? 7_555 74.4  ? 
20 O ? D HOH . ? A HOH 1  ? 7_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 85 ? 7_555 75.8  ? 
21 O ? D HOH . ? A HOH 50 ? 7_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 85 ? 7_555 103.3 ? 
22 O ? D HOH . ? A HOH 1  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 62 ? 7_555 140.2 ? 
23 O ? D HOH . ? A HOH 85 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 62 ? 7_555 90.4  ? 
24 O ? D HOH . ? A HOH 62 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 62 ? 7_555 35.2  ? 
25 O ? D HOH . ? A HOH 50 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 62 ? 7_555 54.0  ? 
26 O ? D HOH . ? A HOH 1  ? 7_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 62 ? 7_555 122.3 ? 
27 O ? D HOH . ? A HOH 50 ? 7_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 62 ? 7_555 116.8 ? 
28 O ? D HOH . ? A HOH 85 ? 7_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 62 ? 7_555 84.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-06-26 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification'       
2 4 'Structure model' '_software.contact_author'       
3 4 'Structure model' '_software.contact_author_email' 
4 4 'Structure model' '_software.date'                 
5 4 'Structure model' '_software.language'             
6 4 'Structure model' '_software.location'             
7 4 'Structure model' '_software.name'                 
8 4 'Structure model' '_software.type'                 
9 4 'Structure model' '_software.version'              
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         3.0660 
_pdbx_refine_tls.origin_y         4.6361 
_pdbx_refine_tls.origin_z         -11.3929 
_pdbx_refine_tls.T[1][1]          -0.0169 
_pdbx_refine_tls.T[2][2]          0.0011 
_pdbx_refine_tls.T[3][3]          -0.0262 
_pdbx_refine_tls.T[1][2]          0.0168 
_pdbx_refine_tls.T[1][3]          -0.0052 
_pdbx_refine_tls.T[2][3]          0.0036 
_pdbx_refine_tls.L[1][1]          0.2187 
_pdbx_refine_tls.L[2][2]          0.2088 
_pdbx_refine_tls.L[3][3]          0.6463 
_pdbx_refine_tls.L[1][2]          0.1052 
_pdbx_refine_tls.L[1][3]          -0.1084 
_pdbx_refine_tls.L[2][3]          -0.2261 
_pdbx_refine_tls.S[1][1]          -0.0351 
_pdbx_refine_tls.S[2][2]          0.0249 
_pdbx_refine_tls.S[3][3]          0.0102 
_pdbx_refine_tls.S[1][2]          -0.0004 
_pdbx_refine_tls.S[1][3]          -0.0038 
_pdbx_refine_tls.S[2][3]          -0.0077 
_pdbx_refine_tls.S[2][1]          -0.0032 
_pdbx_refine_tls.S[3][1]          0.0672 
_pdbx_refine_tls.S[3][2]          0.0960 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 1  A 21 ALL A 1001 A 1021 'X-RAY DIFFRACTION' ? 
2 1 A 22 A 40 ALL A 1022 A 1040 'X-RAY DIFFRACTION' ? 
3 1 A 41 A 55 ALL A 1041 A 1055 'X-RAY DIFFRACTION' ? 
4 1 A 56 A 79 ALL A 1056 A 1079 'X-RAY DIFFRACTION' ? 
5 1 A 80 A 99 ALL A 1080 A 1099 'X-RAY DIFFRACTION' ? 
# 
_pdbx_phasing_MR.entry_id                     2PC0 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           20.760 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        20.760 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
PHASER      .     ?                other   'R. J. Read'         cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/      ?          ? 3 
REFMAC      .     ?                program 'Murshudov, G.N.'    ccp4@dl.ac.uk               refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 4 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 5 
Blu-Ice     .     ?                ?       ?                    ?                           'data collection' ? ?          ? 6 
MOSFLM      .     ?                ?       ?                    ?                           'data reduction'  ? ?          ? 7 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'   MG  
3 R-1,2-PROPANEDIOL PGR 
4 water             HOH 
#