data_2PDA
# 
_entry.id   2PDA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2PDA         
RCSB  RCSB000078   
WWPDB D_1000000078 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2PDA 
_pdbx_database_status.recvd_initial_deposition_date   1998-11-10 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chabriere, E.' 1 
'Charon, M.H.'  2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structures of the key anaerobic enzyme pyruvate:ferredoxin oxidoreductase, free and in complex with pyruvate.' 
Nat.Struct.Biol.           6  182 190 1999 NSBIEW US 1072-8368 2024 ? 10048931 10.1038/5870 
1       
'Crystallization and Preliminary Crystallographic Analysis of the Pyruvate- Ferredoxin Oxidoreductase from Desulfovibrio Africanus' 
'Acta Crystallogr.,Sect.D' 55 329 331 1999 ABCRE6 DK 0907-4449 0766 ? ?        ?            
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chabriere, E.'          1  
primary 'Charon, M.H.'           2  
primary 'Volbeda, A.'            3  
primary 'Pieulle, L.'            4  
primary 'Hatchikian, E.C.'       5  
primary 'Fontecilla-Camps, J.C.' 6  
1       'Pieulle, L.'            7  
1       'Chabriere, E.'          8  
1       'Hatchikian, E.C.'       9  
1       'Fontecilla-Camps, J.F.' 10 
1       'Charon, M.H.'           11 
# 
_cell.entry_id           2PDA 
_cell.length_a           86.000 
_cell.length_b           146.300 
_cell.length_c           211.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2PDA 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)' 133703.906 2  1.2.7.1 ? ? 
'COMPLEXED WITH IRON/SULFUR CLUSTER, THIAMIN DIPHOSPHATE, PYRUVIC ACID' 
2 non-polymer syn 'MAGNESIUM ION'                                24.305     2  ?       ? ? ? 
3 non-polymer syn 'CALCIUM ION'                                  40.078     2  ?       ? ? ? 
4 non-polymer syn 'IRON/SULFUR CLUSTER'                          351.640    6  ?       ? ? ? 
5 non-polymer syn 'THIAMINE DIPHOSPHATE'                         425.314    2  ?       ? ? ? 
6 non-polymer syn 'PYRUVIC ACID'                                 88.062     2  ?       ? ? ? 
7 water       nat water                                          18.015     14 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GKKMMTTDGNTATAHVAYAMSEVAAIYPITPSSTMGEEADDWAAQGRKNIFGQTLTIREMQSEAGAAGAVHGALAAGALT
TTFTASQGLLLMIPNMYKISGELLPGVFHVTARAIAAHALSIFGDHQDIYAARQTGFAMLASSSVQEAHDMALVAHLAAI
ESNVPFMHFFDGFRTSHEIQKIEVLDYADMASLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVPG
IVAEYMQKVASLTGRSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASA
KVITVLDRTKEPGAPGDPLYLDVCSAFVERGEAMPKILAGRYGLGSKEFSPAMVKSVYDNMSGAKKNHFTVGIEDDVTGT
SLPVDNAFADTTPKGTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKPIQSTYLV
NRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDVGLGGRINM
IMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVTSLQEFKYPDSWKDAPAETKAEPMTNEFFKN
VVKPILTQQGDKLPVSAFEADGRFPLGTSQFEKRGVAINVPQWVPENCIQCNQCAFVCPHSAILPVLAKEEELVGAPANF
TALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPKEKALVMQPLDTQRDAQVPNLEYAARIPVKSEVLPRDSLKGSQF
QEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNRLGQGPAWGNSLFEDAAEYGFGMNM
SMFARRTHLADLAAKALESDASGDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQKDGLLGQIAAMSDLYTKKSVWIFG
GDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRTGKKDLARMVMTYGYVYVATVS
MGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPD
GSVEEFLMAQNRFAVLDRSFPEDAKRLRAQVAHELDVRFKELEHMAATNIFESFAPAGGKADGSVDFGEGAEFCTRDDTP
MMARPDSGEACDQNRAGTSEQQGDLSKRTKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GKKMMTTDGNTATAHVAYAMSEVAAIYPITPSSTMGEEADDWAAQGRKNIFGQTLTIREMQSEAGAAGAVHGALAAGALT
TTFTASQGLLLMIPNMYKISGELLPGVFHVTARAIAAHALSIFGDHQDIYAARQTGFAMLASSSVQEAHDMALVAHLAAI
ESNVPFMHFFDGFRTSHEIQKIEVLDYADMASLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVPG
IVAEYMQKVASLTGRSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASA
KVITVLDRTKEPGAPGDPLYLDVCSAFVERGEAMPKILAGRYGLGSKEFSPAMVKSVYDNMSGAKKNHFTVGIEDDVTGT
SLPVDNAFADTTPKGTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKPIQSTYLV
NRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDVGLGGRINM
IMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVTSLQEFKYPDSWKDAPAETKAEPMTNEFFKN
VVKPILTQQGDKLPVSAFEADGRFPLGTSQFEKRGVAINVPQWVPENCIQCNQCAFVCPHSAILPVLAKEEELVGAPANF
TALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPKEKALVMQPLDTQRDAQVPNLEYAARIPVKSEVLPRDSLKGSQF
QEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNRLGQGPAWGNSLFEDAAEYGFGMNM
SMFARRTHLADLAAKALESDASGDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQKDGLLGQIAAMSDLYTKKSVWIFG
GDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRTGKKDLARMVMTYGYVYVATVS
MGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPD
GSVEEFLMAQNRFAVLDRSFPEDAKRLRAQVAHELDVRFKELEHMAATNIFESFAPAGGKADGSVDFGEGAEFCTRDDTP
MMARPDSGEACDQNRAGTSEQQGDLSKRTKK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLY n 
1 2    LYS n 
1 3    LYS n 
1 4    MET n 
1 5    MET n 
1 6    THR n 
1 7    THR n 
1 8    ASP n 
1 9    GLY n 
1 10   ASN n 
1 11   THR n 
1 12   ALA n 
1 13   THR n 
1 14   ALA n 
1 15   HIS n 
1 16   VAL n 
1 17   ALA n 
1 18   TYR n 
1 19   ALA n 
1 20   MET n 
1 21   SER n 
1 22   GLU n 
1 23   VAL n 
1 24   ALA n 
1 25   ALA n 
1 26   ILE n 
1 27   TYR n 
1 28   PRO n 
1 29   ILE n 
1 30   THR n 
1 31   PRO n 
1 32   SER n 
1 33   SER n 
1 34   THR n 
1 35   MET n 
1 36   GLY n 
1 37   GLU n 
1 38   GLU n 
1 39   ALA n 
1 40   ASP n 
1 41   ASP n 
1 42   TRP n 
1 43   ALA n 
1 44   ALA n 
1 45   GLN n 
1 46   GLY n 
1 47   ARG n 
1 48   LYS n 
1 49   ASN n 
1 50   ILE n 
1 51   PHE n 
1 52   GLY n 
1 53   GLN n 
1 54   THR n 
1 55   LEU n 
1 56   THR n 
1 57   ILE n 
1 58   ARG n 
1 59   GLU n 
1 60   MET n 
1 61   GLN n 
1 62   SER n 
1 63   GLU n 
1 64   ALA n 
1 65   GLY n 
1 66   ALA n 
1 67   ALA n 
1 68   GLY n 
1 69   ALA n 
1 70   VAL n 
1 71   HIS n 
1 72   GLY n 
1 73   ALA n 
1 74   LEU n 
1 75   ALA n 
1 76   ALA n 
1 77   GLY n 
1 78   ALA n 
1 79   LEU n 
1 80   THR n 
1 81   THR n 
1 82   THR n 
1 83   PHE n 
1 84   THR n 
1 85   ALA n 
1 86   SER n 
1 87   GLN n 
1 88   GLY n 
1 89   LEU n 
1 90   LEU n 
1 91   LEU n 
1 92   MET n 
1 93   ILE n 
1 94   PRO n 
1 95   ASN n 
1 96   MET n 
1 97   TYR n 
1 98   LYS n 
1 99   ILE n 
1 100  SER n 
1 101  GLY n 
1 102  GLU n 
1 103  LEU n 
1 104  LEU n 
1 105  PRO n 
1 106  GLY n 
1 107  VAL n 
1 108  PHE n 
1 109  HIS n 
1 110  VAL n 
1 111  THR n 
1 112  ALA n 
1 113  ARG n 
1 114  ALA n 
1 115  ILE n 
1 116  ALA n 
1 117  ALA n 
1 118  HIS n 
1 119  ALA n 
1 120  LEU n 
1 121  SER n 
1 122  ILE n 
1 123  PHE n 
1 124  GLY n 
1 125  ASP n 
1 126  HIS n 
1 127  GLN n 
1 128  ASP n 
1 129  ILE n 
1 130  TYR n 
1 131  ALA n 
1 132  ALA n 
1 133  ARG n 
1 134  GLN n 
1 135  THR n 
1 136  GLY n 
1 137  PHE n 
1 138  ALA n 
1 139  MET n 
1 140  LEU n 
1 141  ALA n 
1 142  SER n 
1 143  SER n 
1 144  SER n 
1 145  VAL n 
1 146  GLN n 
1 147  GLU n 
1 148  ALA n 
1 149  HIS n 
1 150  ASP n 
1 151  MET n 
1 152  ALA n 
1 153  LEU n 
1 154  VAL n 
1 155  ALA n 
1 156  HIS n 
1 157  LEU n 
1 158  ALA n 
1 159  ALA n 
1 160  ILE n 
1 161  GLU n 
1 162  SER n 
1 163  ASN n 
1 164  VAL n 
1 165  PRO n 
1 166  PHE n 
1 167  MET n 
1 168  HIS n 
1 169  PHE n 
1 170  PHE n 
1 171  ASP n 
1 172  GLY n 
1 173  PHE n 
1 174  ARG n 
1 175  THR n 
1 176  SER n 
1 177  HIS n 
1 178  GLU n 
1 179  ILE n 
1 180  GLN n 
1 181  LYS n 
1 182  ILE n 
1 183  GLU n 
1 184  VAL n 
1 185  LEU n 
1 186  ASP n 
1 187  TYR n 
1 188  ALA n 
1 189  ASP n 
1 190  MET n 
1 191  ALA n 
1 192  SER n 
1 193  LEU n 
1 194  VAL n 
1 195  ASN n 
1 196  GLN n 
1 197  LYS n 
1 198  ALA n 
1 199  LEU n 
1 200  ALA n 
1 201  GLU n 
1 202  PHE n 
1 203  ARG n 
1 204  ALA n 
1 205  LYS n 
1 206  SER n 
1 207  MET n 
1 208  ASN n 
1 209  PRO n 
1 210  GLU n 
1 211  HIS n 
1 212  PRO n 
1 213  HIS n 
1 214  VAL n 
1 215  ARG n 
1 216  GLY n 
1 217  THR n 
1 218  ALA n 
1 219  GLN n 
1 220  ASN n 
1 221  PRO n 
1 222  ASP n 
1 223  ILE n 
1 224  TYR n 
1 225  PHE n 
1 226  GLN n 
1 227  GLY n 
1 228  ARG n 
1 229  GLU n 
1 230  ALA n 
1 231  ALA n 
1 232  ASN n 
1 233  PRO n 
1 234  TYR n 
1 235  TYR n 
1 236  LEU n 
1 237  LYS n 
1 238  VAL n 
1 239  PRO n 
1 240  GLY n 
1 241  ILE n 
1 242  VAL n 
1 243  ALA n 
1 244  GLU n 
1 245  TYR n 
1 246  MET n 
1 247  GLN n 
1 248  LYS n 
1 249  VAL n 
1 250  ALA n 
1 251  SER n 
1 252  LEU n 
1 253  THR n 
1 254  GLY n 
1 255  ARG n 
1 256  SER n 
1 257  TYR n 
1 258  LYS n 
1 259  LEU n 
1 260  PHE n 
1 261  ASP n 
1 262  TYR n 
1 263  VAL n 
1 264  GLY n 
1 265  ALA n 
1 266  PRO n 
1 267  ASP n 
1 268  ALA n 
1 269  GLU n 
1 270  ARG n 
1 271  VAL n 
1 272  ILE n 
1 273  VAL n 
1 274  SER n 
1 275  MET n 
1 276  GLY n 
1 277  SER n 
1 278  SER n 
1 279  CYS n 
1 280  GLU n 
1 281  THR n 
1 282  ILE n 
1 283  GLU n 
1 284  GLU n 
1 285  VAL n 
1 286  ILE n 
1 287  ASN n 
1 288  HIS n 
1 289  LEU n 
1 290  ALA n 
1 291  ALA n 
1 292  LYS n 
1 293  GLY n 
1 294  GLU n 
1 295  LYS n 
1 296  ILE n 
1 297  GLY n 
1 298  LEU n 
1 299  ILE n 
1 300  LYS n 
1 301  VAL n 
1 302  ARG n 
1 303  LEU n 
1 304  TYR n 
1 305  ARG n 
1 306  PRO n 
1 307  PHE n 
1 308  VAL n 
1 309  SER n 
1 310  GLU n 
1 311  ALA n 
1 312  PHE n 
1 313  PHE n 
1 314  ALA n 
1 315  ALA n 
1 316  LEU n 
1 317  PRO n 
1 318  ALA n 
1 319  SER n 
1 320  ALA n 
1 321  LYS n 
1 322  VAL n 
1 323  ILE n 
1 324  THR n 
1 325  VAL n 
1 326  LEU n 
1 327  ASP n 
1 328  ARG n 
1 329  THR n 
1 330  LYS n 
1 331  GLU n 
1 332  PRO n 
1 333  GLY n 
1 334  ALA n 
1 335  PRO n 
1 336  GLY n 
1 337  ASP n 
1 338  PRO n 
1 339  LEU n 
1 340  TYR n 
1 341  LEU n 
1 342  ASP n 
1 343  VAL n 
1 344  CYS n 
1 345  SER n 
1 346  ALA n 
1 347  PHE n 
1 348  VAL n 
1 349  GLU n 
1 350  ARG n 
1 351  GLY n 
1 352  GLU n 
1 353  ALA n 
1 354  MET n 
1 355  PRO n 
1 356  LYS n 
1 357  ILE n 
1 358  LEU n 
1 359  ALA n 
1 360  GLY n 
1 361  ARG n 
1 362  TYR n 
1 363  GLY n 
1 364  LEU n 
1 365  GLY n 
1 366  SER n 
1 367  LYS n 
1 368  GLU n 
1 369  PHE n 
1 370  SER n 
1 371  PRO n 
1 372  ALA n 
1 373  MET n 
1 374  VAL n 
1 375  LYS n 
1 376  SER n 
1 377  VAL n 
1 378  TYR n 
1 379  ASP n 
1 380  ASN n 
1 381  MET n 
1 382  SER n 
1 383  GLY n 
1 384  ALA n 
1 385  LYS n 
1 386  LYS n 
1 387  ASN n 
1 388  HIS n 
1 389  PHE n 
1 390  THR n 
1 391  VAL n 
1 392  GLY n 
1 393  ILE n 
1 394  GLU n 
1 395  ASP n 
1 396  ASP n 
1 397  VAL n 
1 398  THR n 
1 399  GLY n 
1 400  THR n 
1 401  SER n 
1 402  LEU n 
1 403  PRO n 
1 404  VAL n 
1 405  ASP n 
1 406  ASN n 
1 407  ALA n 
1 408  PHE n 
1 409  ALA n 
1 410  ASP n 
1 411  THR n 
1 412  THR n 
1 413  PRO n 
1 414  LYS n 
1 415  GLY n 
1 416  THR n 
1 417  ILE n 
1 418  GLN n 
1 419  CYS n 
1 420  GLN n 
1 421  PHE n 
1 422  TRP n 
1 423  GLY n 
1 424  LEU n 
1 425  GLY n 
1 426  ALA n 
1 427  ASP n 
1 428  GLY n 
1 429  THR n 
1 430  VAL n 
1 431  GLY n 
1 432  ALA n 
1 433  ASN n 
1 434  LYS n 
1 435  GLN n 
1 436  ALA n 
1 437  ILE n 
1 438  LYS n 
1 439  ILE n 
1 440  ILE n 
1 441  GLY n 
1 442  ASP n 
1 443  ASN n 
1 444  THR n 
1 445  ASP n 
1 446  LEU n 
1 447  PHE n 
1 448  ALA n 
1 449  GLN n 
1 450  GLY n 
1 451  TYR n 
1 452  PHE n 
1 453  SER n 
1 454  TYR n 
1 455  ASP n 
1 456  SER n 
1 457  LYS n 
1 458  LYS n 
1 459  SER n 
1 460  GLY n 
1 461  GLY n 
1 462  ILE n 
1 463  THR n 
1 464  ILE n 
1 465  SER n 
1 466  HIS n 
1 467  LEU n 
1 468  ARG n 
1 469  PHE n 
1 470  GLY n 
1 471  GLU n 
1 472  LYS n 
1 473  PRO n 
1 474  ILE n 
1 475  GLN n 
1 476  SER n 
1 477  THR n 
1 478  TYR n 
1 479  LEU n 
1 480  VAL n 
1 481  ASN n 
1 482  ARG n 
1 483  ALA n 
1 484  ASP n 
1 485  TYR n 
1 486  VAL n 
1 487  ALA n 
1 488  CYS n 
1 489  HIS n 
1 490  ASN n 
1 491  PRO n 
1 492  ALA n 
1 493  TYR n 
1 494  VAL n 
1 495  GLY n 
1 496  ILE n 
1 497  TYR n 
1 498  ASP n 
1 499  ILE n 
1 500  LEU n 
1 501  GLU n 
1 502  GLY n 
1 503  ILE n 
1 504  LYS n 
1 505  ASP n 
1 506  GLY n 
1 507  GLY n 
1 508  THR n 
1 509  PHE n 
1 510  VAL n 
1 511  LEU n 
1 512  ASN n 
1 513  SER n 
1 514  PRO n 
1 515  TRP n 
1 516  SER n 
1 517  SER n 
1 518  LEU n 
1 519  GLU n 
1 520  ASP n 
1 521  MET n 
1 522  ASP n 
1 523  LYS n 
1 524  HIS n 
1 525  LEU n 
1 526  PRO n 
1 527  SER n 
1 528  GLY n 
1 529  ILE n 
1 530  LYS n 
1 531  ARG n 
1 532  THR n 
1 533  ILE n 
1 534  ALA n 
1 535  ASN n 
1 536  LYS n 
1 537  LYS n 
1 538  LEU n 
1 539  LYS n 
1 540  PHE n 
1 541  TYR n 
1 542  ASN n 
1 543  ILE n 
1 544  ASP n 
1 545  ALA n 
1 546  VAL n 
1 547  LYS n 
1 548  ILE n 
1 549  ALA n 
1 550  THR n 
1 551  ASP n 
1 552  VAL n 
1 553  GLY n 
1 554  LEU n 
1 555  GLY n 
1 556  GLY n 
1 557  ARG n 
1 558  ILE n 
1 559  ASN n 
1 560  MET n 
1 561  ILE n 
1 562  MET n 
1 563  GLN n 
1 564  THR n 
1 565  ALA n 
1 566  PHE n 
1 567  PHE n 
1 568  LYS n 
1 569  LEU n 
1 570  ALA n 
1 571  GLY n 
1 572  VAL n 
1 573  LEU n 
1 574  PRO n 
1 575  PHE n 
1 576  GLU n 
1 577  LYS n 
1 578  ALA n 
1 579  VAL n 
1 580  ASP n 
1 581  LEU n 
1 582  LEU n 
1 583  LYS n 
1 584  LYS n 
1 585  SER n 
1 586  ILE n 
1 587  HIS n 
1 588  LYS n 
1 589  ALA n 
1 590  TYR n 
1 591  GLY n 
1 592  LYS n 
1 593  LYS n 
1 594  GLY n 
1 595  GLU n 
1 596  LYS n 
1 597  ILE n 
1 598  VAL n 
1 599  LYS n 
1 600  MET n 
1 601  ASN n 
1 602  THR n 
1 603  ASP n 
1 604  ALA n 
1 605  VAL n 
1 606  ASP n 
1 607  GLN n 
1 608  ALA n 
1 609  VAL n 
1 610  THR n 
1 611  SER n 
1 612  LEU n 
1 613  GLN n 
1 614  GLU n 
1 615  PHE n 
1 616  LYS n 
1 617  TYR n 
1 618  PRO n 
1 619  ASP n 
1 620  SER n 
1 621  TRP n 
1 622  LYS n 
1 623  ASP n 
1 624  ALA n 
1 625  PRO n 
1 626  ALA n 
1 627  GLU n 
1 628  THR n 
1 629  LYS n 
1 630  ALA n 
1 631  GLU n 
1 632  PRO n 
1 633  MET n 
1 634  THR n 
1 635  ASN n 
1 636  GLU n 
1 637  PHE n 
1 638  PHE n 
1 639  LYS n 
1 640  ASN n 
1 641  VAL n 
1 642  VAL n 
1 643  LYS n 
1 644  PRO n 
1 645  ILE n 
1 646  LEU n 
1 647  THR n 
1 648  GLN n 
1 649  GLN n 
1 650  GLY n 
1 651  ASP n 
1 652  LYS n 
1 653  LEU n 
1 654  PRO n 
1 655  VAL n 
1 656  SER n 
1 657  ALA n 
1 658  PHE n 
1 659  GLU n 
1 660  ALA n 
1 661  ASP n 
1 662  GLY n 
1 663  ARG n 
1 664  PHE n 
1 665  PRO n 
1 666  LEU n 
1 667  GLY n 
1 668  THR n 
1 669  SER n 
1 670  GLN n 
1 671  PHE n 
1 672  GLU n 
1 673  LYS n 
1 674  ARG n 
1 675  GLY n 
1 676  VAL n 
1 677  ALA n 
1 678  ILE n 
1 679  ASN n 
1 680  VAL n 
1 681  PRO n 
1 682  GLN n 
1 683  TRP n 
1 684  VAL n 
1 685  PRO n 
1 686  GLU n 
1 687  ASN n 
1 688  CYS n 
1 689  ILE n 
1 690  GLN n 
1 691  CYS n 
1 692  ASN n 
1 693  GLN n 
1 694  CYS n 
1 695  ALA n 
1 696  PHE n 
1 697  VAL n 
1 698  CYS n 
1 699  PRO n 
1 700  HIS n 
1 701  SER n 
1 702  ALA n 
1 703  ILE n 
1 704  LEU n 
1 705  PRO n 
1 706  VAL n 
1 707  LEU n 
1 708  ALA n 
1 709  LYS n 
1 710  GLU n 
1 711  GLU n 
1 712  GLU n 
1 713  LEU n 
1 714  VAL n 
1 715  GLY n 
1 716  ALA n 
1 717  PRO n 
1 718  ALA n 
1 719  ASN n 
1 720  PHE n 
1 721  THR n 
1 722  ALA n 
1 723  LEU n 
1 724  GLU n 
1 725  ALA n 
1 726  LYS n 
1 727  GLY n 
1 728  LYS n 
1 729  GLU n 
1 730  LEU n 
1 731  LYS n 
1 732  GLY n 
1 733  TYR n 
1 734  LYS n 
1 735  PHE n 
1 736  ARG n 
1 737  ILE n 
1 738  GLN n 
1 739  ILE n 
1 740  ASN n 
1 741  THR n 
1 742  LEU n 
1 743  ASP n 
1 744  CYS n 
1 745  MET n 
1 746  GLY n 
1 747  CYS n 
1 748  GLY n 
1 749  ASN n 
1 750  CYS n 
1 751  ALA n 
1 752  ASP n 
1 753  ILE n 
1 754  CYS n 
1 755  PRO n 
1 756  PRO n 
1 757  LYS n 
1 758  GLU n 
1 759  LYS n 
1 760  ALA n 
1 761  LEU n 
1 762  VAL n 
1 763  MET n 
1 764  GLN n 
1 765  PRO n 
1 766  LEU n 
1 767  ASP n 
1 768  THR n 
1 769  GLN n 
1 770  ARG n 
1 771  ASP n 
1 772  ALA n 
1 773  GLN n 
1 774  VAL n 
1 775  PRO n 
1 776  ASN n 
1 777  LEU n 
1 778  GLU n 
1 779  TYR n 
1 780  ALA n 
1 781  ALA n 
1 782  ARG n 
1 783  ILE n 
1 784  PRO n 
1 785  VAL n 
1 786  LYS n 
1 787  SER n 
1 788  GLU n 
1 789  VAL n 
1 790  LEU n 
1 791  PRO n 
1 792  ARG n 
1 793  ASP n 
1 794  SER n 
1 795  LEU n 
1 796  LYS n 
1 797  GLY n 
1 798  SER n 
1 799  GLN n 
1 800  PHE n 
1 801  GLN n 
1 802  GLU n 
1 803  PRO n 
1 804  LEU n 
1 805  MET n 
1 806  GLU n 
1 807  PHE n 
1 808  SER n 
1 809  GLY n 
1 810  ALA n 
1 811  CYS n 
1 812  SER n 
1 813  GLY n 
1 814  CYS n 
1 815  GLY n 
1 816  GLU n 
1 817  THR n 
1 818  PRO n 
1 819  TYR n 
1 820  VAL n 
1 821  ARG n 
1 822  VAL n 
1 823  ILE n 
1 824  THR n 
1 825  GLN n 
1 826  LEU n 
1 827  PHE n 
1 828  GLY n 
1 829  GLU n 
1 830  ARG n 
1 831  MET n 
1 832  PHE n 
1 833  ILE n 
1 834  ALA n 
1 835  ASN n 
1 836  ALA n 
1 837  THR n 
1 838  GLY n 
1 839  CYS n 
1 840  SER n 
1 841  SER n 
1 842  ILE n 
1 843  TRP n 
1 844  GLY n 
1 845  ALA n 
1 846  SER n 
1 847  ALA n 
1 848  PRO n 
1 849  SER n 
1 850  MET n 
1 851  PRO n 
1 852  TYR n 
1 853  LYS n 
1 854  THR n 
1 855  ASN n 
1 856  ARG n 
1 857  LEU n 
1 858  GLY n 
1 859  GLN n 
1 860  GLY n 
1 861  PRO n 
1 862  ALA n 
1 863  TRP n 
1 864  GLY n 
1 865  ASN n 
1 866  SER n 
1 867  LEU n 
1 868  PHE n 
1 869  GLU n 
1 870  ASP n 
1 871  ALA n 
1 872  ALA n 
1 873  GLU n 
1 874  TYR n 
1 875  GLY n 
1 876  PHE n 
1 877  GLY n 
1 878  MET n 
1 879  ASN n 
1 880  MET n 
1 881  SER n 
1 882  MET n 
1 883  PHE n 
1 884  ALA n 
1 885  ARG n 
1 886  ARG n 
1 887  THR n 
1 888  HIS n 
1 889  LEU n 
1 890  ALA n 
1 891  ASP n 
1 892  LEU n 
1 893  ALA n 
1 894  ALA n 
1 895  LYS n 
1 896  ALA n 
1 897  LEU n 
1 898  GLU n 
1 899  SER n 
1 900  ASP n 
1 901  ALA n 
1 902  SER n 
1 903  GLY n 
1 904  ASP n 
1 905  VAL n 
1 906  LYS n 
1 907  GLU n 
1 908  ALA n 
1 909  LEU n 
1 910  GLN n 
1 911  GLY n 
1 912  TRP n 
1 913  LEU n 
1 914  ALA n 
1 915  GLY n 
1 916  LYS n 
1 917  ASN n 
1 918  ASP n 
1 919  PRO n 
1 920  ILE n 
1 921  LYS n 
1 922  SER n 
1 923  LYS n 
1 924  GLU n 
1 925  TYR n 
1 926  GLY n 
1 927  ASP n 
1 928  LYS n 
1 929  LEU n 
1 930  LYS n 
1 931  LYS n 
1 932  LEU n 
1 933  LEU n 
1 934  ALA n 
1 935  GLY n 
1 936  GLN n 
1 937  LYS n 
1 938  ASP n 
1 939  GLY n 
1 940  LEU n 
1 941  LEU n 
1 942  GLY n 
1 943  GLN n 
1 944  ILE n 
1 945  ALA n 
1 946  ALA n 
1 947  MET n 
1 948  SER n 
1 949  ASP n 
1 950  LEU n 
1 951  TYR n 
1 952  THR n 
1 953  LYS n 
1 954  LYS n 
1 955  SER n 
1 956  VAL n 
1 957  TRP n 
1 958  ILE n 
1 959  PHE n 
1 960  GLY n 
1 961  GLY n 
1 962  ASP n 
1 963  GLY n 
1 964  TRP n 
1 965  ALA n 
1 966  TYR n 
1 967  ASP n 
1 968  ILE n 
1 969  GLY n 
1 970  TYR n 
1 971  GLY n 
1 972  GLY n 
1 973  LEU n 
1 974  ASP n 
1 975  HIS n 
1 976  VAL n 
1 977  LEU n 
1 978  ALA n 
1 979  SER n 
1 980  GLY n 
1 981  GLU n 
1 982  ASP n 
1 983  VAL n 
1 984  ASN n 
1 985  VAL n 
1 986  PHE n 
1 987  VAL n 
1 988  MET n 
1 989  ASP n 
1 990  THR n 
1 991  GLU n 
1 992  VAL n 
1 993  TYR n 
1 994  SER n 
1 995  ASN n 
1 996  THR n 
1 997  GLY n 
1 998  GLY n 
1 999  GLN n 
1 1000 SER n 
1 1001 SER n 
1 1002 LYS n 
1 1003 ALA n 
1 1004 THR n 
1 1005 PRO n 
1 1006 THR n 
1 1007 GLY n 
1 1008 ALA n 
1 1009 VAL n 
1 1010 ALA n 
1 1011 LYS n 
1 1012 PHE n 
1 1013 ALA n 
1 1014 ALA n 
1 1015 ALA n 
1 1016 GLY n 
1 1017 LYS n 
1 1018 ARG n 
1 1019 THR n 
1 1020 GLY n 
1 1021 LYS n 
1 1022 LYS n 
1 1023 ASP n 
1 1024 LEU n 
1 1025 ALA n 
1 1026 ARG n 
1 1027 MET n 
1 1028 VAL n 
1 1029 MET n 
1 1030 THR n 
1 1031 TYR n 
1 1032 GLY n 
1 1033 TYR n 
1 1034 VAL n 
1 1035 TYR n 
1 1036 VAL n 
1 1037 ALA n 
1 1038 THR n 
1 1039 VAL n 
1 1040 SER n 
1 1041 MET n 
1 1042 GLY n 
1 1043 TYR n 
1 1044 SER n 
1 1045 LYS n 
1 1046 GLN n 
1 1047 GLN n 
1 1048 PHE n 
1 1049 LEU n 
1 1050 LYS n 
1 1051 VAL n 
1 1052 LEU n 
1 1053 LYS n 
1 1054 GLU n 
1 1055 ALA n 
1 1056 GLU n 
1 1057 SER n 
1 1058 PHE n 
1 1059 PRO n 
1 1060 GLY n 
1 1061 PRO n 
1 1062 SER n 
1 1063 LEU n 
1 1064 VAL n 
1 1065 ILE n 
1 1066 ALA n 
1 1067 TYR n 
1 1068 ALA n 
1 1069 THR n 
1 1070 CYS n 
1 1071 ILE n 
1 1072 ASN n 
1 1073 GLN n 
1 1074 GLY n 
1 1075 LEU n 
1 1076 ARG n 
1 1077 LYS n 
1 1078 GLY n 
1 1079 MET n 
1 1080 GLY n 
1 1081 LYS n 
1 1082 SER n 
1 1083 GLN n 
1 1084 ASP n 
1 1085 VAL n 
1 1086 MET n 
1 1087 ASN n 
1 1088 THR n 
1 1089 ALA n 
1 1090 VAL n 
1 1091 LYS n 
1 1092 SER n 
1 1093 GLY n 
1 1094 TYR n 
1 1095 TRP n 
1 1096 PRO n 
1 1097 LEU n 
1 1098 PHE n 
1 1099 ARG n 
1 1100 TYR n 
1 1101 ASP n 
1 1102 PRO n 
1 1103 ARG n 
1 1104 LEU n 
1 1105 ALA n 
1 1106 ALA n 
1 1107 GLN n 
1 1108 GLY n 
1 1109 LYS n 
1 1110 ASN n 
1 1111 PRO n 
1 1112 PHE n 
1 1113 GLN n 
1 1114 LEU n 
1 1115 ASP n 
1 1116 SER n 
1 1117 LYS n 
1 1118 ALA n 
1 1119 PRO n 
1 1120 ASP n 
1 1121 GLY n 
1 1122 SER n 
1 1123 VAL n 
1 1124 GLU n 
1 1125 GLU n 
1 1126 PHE n 
1 1127 LEU n 
1 1128 MET n 
1 1129 ALA n 
1 1130 GLN n 
1 1131 ASN n 
1 1132 ARG n 
1 1133 PHE n 
1 1134 ALA n 
1 1135 VAL n 
1 1136 LEU n 
1 1137 ASP n 
1 1138 ARG n 
1 1139 SER n 
1 1140 PHE n 
1 1141 PRO n 
1 1142 GLU n 
1 1143 ASP n 
1 1144 ALA n 
1 1145 LYS n 
1 1146 ARG n 
1 1147 LEU n 
1 1148 ARG n 
1 1149 ALA n 
1 1150 GLN n 
1 1151 VAL n 
1 1152 ALA n 
1 1153 HIS n 
1 1154 GLU n 
1 1155 LEU n 
1 1156 ASP n 
1 1157 VAL n 
1 1158 ARG n 
1 1159 PHE n 
1 1160 LYS n 
1 1161 GLU n 
1 1162 LEU n 
1 1163 GLU n 
1 1164 HIS n 
1 1165 MET n 
1 1166 ALA n 
1 1167 ALA n 
1 1168 THR n 
1 1169 ASN n 
1 1170 ILE n 
1 1171 PHE n 
1 1172 GLU n 
1 1173 SER n 
1 1174 PHE n 
1 1175 ALA n 
1 1176 PRO n 
1 1177 ALA n 
1 1178 GLY n 
1 1179 GLY n 
1 1180 LYS n 
1 1181 ALA n 
1 1182 ASP n 
1 1183 GLY n 
1 1184 SER n 
1 1185 VAL n 
1 1186 ASP n 
1 1187 PHE n 
1 1188 GLY n 
1 1189 GLU n 
1 1190 GLY n 
1 1191 ALA n 
1 1192 GLU n 
1 1193 PHE n 
1 1194 CYS n 
1 1195 THR n 
1 1196 ARG n 
1 1197 ASP n 
1 1198 ASP n 
1 1199 THR n 
1 1200 PRO n 
1 1201 MET n 
1 1202 MET n 
1 1203 ALA n 
1 1204 ARG n 
1 1205 PRO n 
1 1206 ASP n 
1 1207 SER n 
1 1208 GLY n 
1 1209 GLU n 
1 1210 ALA n 
1 1211 CYS n 
1 1212 ASP n 
1 1213 GLN n 
1 1214 ASN n 
1 1215 ARG n 
1 1216 ALA n 
1 1217 GLY n 
1 1218 THR n 
1 1219 SER n 
1 1220 GLU n 
1 1221 GLN n 
1 1222 GLN n 
1 1223 GLY n 
1 1224 ASP n 
1 1225 LEU n 
1 1226 SER n 
1 1227 LYS n 
1 1228 ARG n 
1 1229 THR n 
1 1230 LYS n 
1 1231 LYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Desulfovibrio africanus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      873 
_entity_src_nat.genus                      Desulfovibrio 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     'NCIB 8401' 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     CYTOPLASM 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    P94692_DESAF 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P94692 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2PDA A 1 ? 1231 ? P94692 2 ? 1232 ? 2 1232 
2 1 2PDA B 1 ? 1231 ? P94692 2 ? 1232 ? 2 1232 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ? 'C3 H7 N O2'           89.093  
ARG 'L-peptide linking' y ARGININE               ? 'C6 H15 N4 O2 1'       175.209 
ASN 'L-peptide linking' y ASPARAGINE             ? 'C4 H8 N2 O3'          132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ? 'C4 H7 N O4'           133.103 
CA  non-polymer         . 'CALCIUM ION'          ? 'Ca 2'                 40.078  
CYS 'L-peptide linking' y CYSTEINE               ? 'C3 H7 N O2 S'         121.158 
GLN 'L-peptide linking' y GLUTAMINE              ? 'C5 H10 N2 O3'         146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ? 'C5 H9 N O4'           147.129 
GLY 'peptide linking'   y GLYCINE                ? 'C2 H5 N O2'           75.067  
HIS 'L-peptide linking' y HISTIDINE              ? 'C6 H10 N3 O2 1'       156.162 
HOH non-polymer         . WATER                  ? 'H2 O'                 18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ? 'C6 H13 N O2'          131.173 
LEU 'L-peptide linking' y LEUCINE                ? 'C6 H13 N O2'          131.173 
LYS 'L-peptide linking' y LYSINE                 ? 'C6 H15 N2 O2 1'       147.195 
MET 'L-peptide linking' y METHIONINE             ? 'C5 H11 N O2 S'        149.211 
MG  non-polymer         . 'MAGNESIUM ION'        ? 'Mg 2'                 24.305  
PHE 'L-peptide linking' y PHENYLALANINE          ? 'C9 H11 N O2'          165.189 
PRO 'L-peptide linking' y PROLINE                ? 'C5 H9 N O2'           115.130 
PYR non-polymer         . 'PYRUVIC ACID'         ? 'C3 H4 O3'             88.062  
SER 'L-peptide linking' y SERINE                 ? 'C3 H7 N O3'           105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER'  ? 'Fe4 S4'               351.640 
THR 'L-peptide linking' y THREONINE              ? 'C4 H9 N O3'           119.119 
TPP non-polymer         . 'THIAMINE DIPHOSPHATE' ? 'C12 H19 N4 O7 P2 S 1' 425.314 
TRP 'L-peptide linking' y TRYPTOPHAN             ? 'C11 H12 N2 O2'        204.225 
TYR 'L-peptide linking' y TYROSINE               ? 'C9 H11 N O3'          181.189 
VAL 'L-peptide linking' y VALINE                 ? 'C5 H11 N O2'          117.146 
# 
_exptl.entry_id          2PDA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.34 
_exptl_crystal.density_percent_sol   50.63 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.2 
_exptl_crystal_grow.pdbx_details    
;PEG6000 11% 
MGCL2 100MM 
CACODYLATE 100MM PH 6.2 
PYRUVATE 100MM
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-09 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.997 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM14' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM14 
_diffrn_source.pdbx_wavelength             0.997 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2PDA 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   50700 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.098 
_reflns.pdbx_netI_over_sigmaI        6.9 
_reflns.B_iso_Wilson_estimate        33.65 
_reflns.pdbx_redundancy              2.6 
_reflns.R_free_details               ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.16 
_reflns_shell.percent_possible_all   96.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.179 
_reflns_shell.meanI_over_sigI_obs    4.1 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2PDA 
_refine.ls_number_reflns_obs                     49492 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            3.0 
_refine.ls_percent_reflns_obs                    94.2 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.234 
_refine.ls_R_factor_R_free                       0.297 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2475 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               12.4 
_refine.aniso_B[1][1]                            6.3 
_refine.aniso_B[2][2]                            2.45 
_refine.aniso_B[3][3]                            -8.75 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2PDA 
_refine_analyze.Luzzati_coordinate_error_obs    0.36 
_refine_analyze.Luzzati_sigma_a_obs             0.49 
_refine_analyze.Luzzati_d_res_low_obs           4.0 
_refine_analyze.Luzzati_coordinate_error_free   0.47 
_refine_analyze.Luzzati_sigma_a_free            0.76 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        18764 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         116 
_refine_hist.number_atoms_solvent             14 
_refine_hist.number_atoms_total               18894 
_refine_hist.d_res_high                       3.0 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.015 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.0   ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.21 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.76  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             0.6   1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            1.05  2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             0.82  2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            1.32  2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTRAINTS 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       3.0 
_refine_ls_shell.d_res_low                        3.13 
_refine_ls_shell.number_reflns_R_work             5900 
_refine_ls_shell.R_factor_R_work                  0.2997 
_refine_ls_shell.percent_reflns_obs               96.1 
_refine_ls_shell.R_factor_R_free                  0.384 
_refine_ls_shell.R_factor_R_free_error            0.02 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             316 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       PARHCSDX.PRO 
_pdbx_xplor_file.topol_file       TOPHCSDX.PRO 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.995625 
_struct_ncs_oper.matrix[1][2]   0.043420 
_struct_ncs_oper.matrix[1][3]   -0.082740 
_struct_ncs_oper.matrix[2][1]   0.041889 
_struct_ncs_oper.matrix[2][2]   -0.584115 
_struct_ncs_oper.matrix[2][3]   -0.812509 
_struct_ncs_oper.matrix[3][1]   -0.083525 
_struct_ncs_oper.matrix[3][2]   -0.810509 
_struct_ncs_oper.matrix[3][3]   0.579741 
_struct_ncs_oper.vector[1]      -39.02300 
_struct_ncs_oper.vector[2]      -68.05900 
_struct_ncs_oper.vector[3]      -36.97600 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2PDA 
_struct.title                     
'CRYSTAL STRUCTURE OF THE COMPLEX BETWEEN PYRUVATE-FERREDOXIN OXIDOREDUCTASE FROM DESULFOVIBRIO AFRICANUS AND PYRUVATE.' 
_struct.pdbx_descriptor           'PYRUVATE-FERREDOXIN OXIDOREDUCTASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2PDA 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'OXIDOREDUCTASE, PYRUVATE CATABOLISM, IRON-SULFUR CLUSTER, TPP-DEPENDENT ENZYME, COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 2 ? 
K N N 3 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 5 ? 
P N N 6 ? 
Q N N 7 ? 
R N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 9    ? MET A 20   ? GLY A 10   MET A 21   1 ? 12 
HELX_P HELX_P2  2  SER A 33   ? GLN A 45   ? SER A 34   GLN A 46   1 ? 13 
HELX_P HELX_P3  3  GLU A 63   ? ALA A 75   ? GLU A 64   ALA A 76   1 ? 13 
HELX_P HELX_P4  4  SER A 86   ? GLY A 101  ? SER A 87   GLY A 102  1 ? 16 
HELX_P HELX_P5  5  TYR A 130  ? ALA A 132  ? TYR A 131  ALA A 133  5 ? 3  
HELX_P HELX_P6  6  VAL A 145  ? SER A 162  ? VAL A 146  SER A 163  1 ? 18 
HELX_P HELX_P7  7  TYR A 187  ? LEU A 193  ? TYR A 188  LEU A 194  1 ? 7  
HELX_P HELX_P8  8  GLN A 196  ? LYS A 205  ? GLN A 197  LYS A 206  1 ? 10 
HELX_P HELX_P9  9  PRO A 221  ? THR A 253  ? PRO A 222  THR A 254  1 ? 33 
HELX_P HELX_P10 10 SER A 277  ? LYS A 292  ? SER A 278  LYS A 293  5 ? 16 
HELX_P HELX_P11 11 SER A 309  ? ALA A 315  ? SER A 310  ALA A 316  1 ? 7  
HELX_P HELX_P12 12 PRO A 338  ? ARG A 350  ? PRO A 339  ARG A 351  1 ? 13 
HELX_P HELX_P13 13 LEU A 364  ? SER A 366  ? LEU A 365  SER A 367  5 ? 3  
HELX_P HELX_P14 14 PRO A 371  ? SER A 382  ? PRO A 372  SER A 383  1 ? 12 
HELX_P HELX_P15 15 THR A 429  ? ASN A 443  ? THR A 430  ASN A 444  1 ? 15 
HELX_P HELX_P16 16 PRO A 491  ? ILE A 496  ? PRO A 492  ILE A 497  5 ? 6  
HELX_P HELX_P17 17 LEU A 518  ? ASP A 522  ? LEU A 519  ASP A 523  1 ? 5  
HELX_P HELX_P18 18 SER A 527  ? ASN A 535  ? SER A 528  ASN A 536  1 ? 9  
HELX_P HELX_P19 19 ALA A 545  ? ASP A 551  ? ALA A 546  ASP A 552  1 ? 7  
HELX_P HELX_P20 20 ASN A 559  ? LEU A 569  ? ASN A 560  LEU A 570  1 ? 11 
HELX_P HELX_P21 21 PHE A 575  ? LYS A 588  ? PHE A 576  LYS A 589  1 ? 14 
HELX_P HELX_P22 22 GLY A 594  ? SER A 611  ? GLY A 595  SER A 612  1 ? 18 
HELX_P HELX_P23 23 ASP A 619  ? ASP A 623  ? ASP A 620  ASP A 624  5 ? 5  
HELX_P HELX_P24 24 GLU A 636  ? ASN A 640  ? GLU A 637  ASN A 641  1 ? 5  
HELX_P HELX_P25 25 VAL A 642  ? LEU A 646  ? VAL A 643  LEU A 647  1 ? 5  
HELX_P HELX_P26 26 VAL A 655  ? ALA A 657  ? VAL A 656  ALA A 658  5 ? 3  
HELX_P HELX_P27 27 THR A 668  ? PHE A 671  ? THR A 669  PHE A 672  5 ? 4  
HELX_P HELX_P28 28 GLN A 693  ? VAL A 697  ? GLN A 694  VAL A 698  1 ? 5  
HELX_P HELX_P29 29 ASN A 749  ? ILE A 753  ? ASN A 750  ILE A 754  1 ? 5  
HELX_P HELX_P30 30 LEU A 766  ? ARG A 782  ? LEU A 767  ARG A 783  1 ? 17 
HELX_P HELX_P31 31 LEU A 795  ? PHE A 800  ? LEU A 796  PHE A 801  1 ? 6  
HELX_P HELX_P32 32 THR A 817  ? ARG A 830  ? THR A 818  ARG A 831  1 ? 14 
HELX_P HELX_P33 33 CYS A 839  ? GLY A 844  ? CYS A 840  GLY A 845  1 ? 6  
HELX_P HELX_P34 34 ALA A 871  ? GLU A 898  ? ALA A 872  GLU A 899  1 ? 28 
HELX_P HELX_P35 35 GLY A 903  ? GLY A 915  ? GLY A 904  GLY A 916  1 ? 13 
HELX_P HELX_P36 36 LYS A 921  ? LEU A 932  ? LYS A 922  LEU A 933  1 ? 12 
HELX_P HELX_P37 37 GLY A 939  ? ALA A 946  ? GLY A 940  ALA A 947  1 ? 8  
HELX_P HELX_P38 38 ASP A 962  ? TYR A 966  ? ASP A 963  TYR A 967  1 ? 5  
HELX_P HELX_P39 39 TYR A 970  ? SER A 979  ? TYR A 971  SER A 980  1 ? 10 
HELX_P HELX_P40 40 LEU A 1024 ? THR A 1030 ? LEU A 1025 THR A 1031 1 ? 7  
HELX_P HELX_P41 41 GLN A 1046 ? SER A 1057 ? GLN A 1047 SER A 1058 1 ? 12 
HELX_P HELX_P42 42 MET A 1079 ? LYS A 1091 ? MET A 1080 LYS A 1092 5 ? 13 
HELX_P HELX_P43 43 PRO A 1102 ? ALA A 1106 ? PRO A 1103 ALA A 1107 1 ? 5  
HELX_P HELX_P44 44 VAL A 1123 ? ALA A 1129 ? VAL A 1124 ALA A 1130 1 ? 7  
HELX_P HELX_P45 45 ASN A 1131 ? ALA A 1166 ? ASN A 1132 ALA A 1167 1 ? 36 
HELX_P HELX_P46 46 SER A 1219 ? ARG A 1228 ? SER A 1220 ARG A 1229 1 ? 10 
HELX_P HELX_P47 47 GLY B 9    ? MET B 20   ? GLY B 10   MET B 21   1 ? 12 
HELX_P HELX_P48 48 SER B 33   ? GLN B 45   ? SER B 34   GLN B 46   1 ? 13 
HELX_P HELX_P49 49 GLU B 63   ? ALA B 75   ? GLU B 64   ALA B 76   1 ? 13 
HELX_P HELX_P50 50 SER B 86   ? GLY B 101  ? SER B 87   GLY B 102  1 ? 16 
HELX_P HELX_P51 51 TYR B 130  ? ALA B 132  ? TYR B 131  ALA B 133  5 ? 3  
HELX_P HELX_P52 52 VAL B 145  ? SER B 162  ? VAL B 146  SER B 163  1 ? 18 
HELX_P HELX_P53 53 TYR B 187  ? LEU B 193  ? TYR B 188  LEU B 194  1 ? 7  
HELX_P HELX_P54 54 GLN B 196  ? LYS B 205  ? GLN B 197  LYS B 206  1 ? 10 
HELX_P HELX_P55 55 PRO B 221  ? THR B 253  ? PRO B 222  THR B 254  1 ? 33 
HELX_P HELX_P56 56 SER B 277  ? LYS B 292  ? SER B 278  LYS B 293  5 ? 16 
HELX_P HELX_P57 57 SER B 309  ? ALA B 315  ? SER B 310  ALA B 316  1 ? 7  
HELX_P HELX_P58 58 PRO B 338  ? ARG B 350  ? PRO B 339  ARG B 351  1 ? 13 
HELX_P HELX_P59 59 LEU B 364  ? SER B 366  ? LEU B 365  SER B 367  5 ? 3  
HELX_P HELX_P60 60 PRO B 371  ? SER B 382  ? PRO B 372  SER B 383  1 ? 12 
HELX_P HELX_P61 61 THR B 429  ? ASN B 443  ? THR B 430  ASN B 444  1 ? 15 
HELX_P HELX_P62 62 PRO B 491  ? ILE B 496  ? PRO B 492  ILE B 497  5 ? 6  
HELX_P HELX_P63 63 LEU B 518  ? ASP B 522  ? LEU B 519  ASP B 523  1 ? 5  
HELX_P HELX_P64 64 SER B 527  ? ASN B 535  ? SER B 528  ASN B 536  1 ? 9  
HELX_P HELX_P65 65 ALA B 545  ? ASP B 551  ? ALA B 546  ASP B 552  1 ? 7  
HELX_P HELX_P66 66 ASN B 559  ? LEU B 569  ? ASN B 560  LEU B 570  1 ? 11 
HELX_P HELX_P67 67 PHE B 575  ? LYS B 588  ? PHE B 576  LYS B 589  1 ? 14 
HELX_P HELX_P68 68 GLY B 594  ? SER B 611  ? GLY B 595  SER B 612  1 ? 18 
HELX_P HELX_P69 69 ASP B 619  ? ASP B 623  ? ASP B 620  ASP B 624  5 ? 5  
HELX_P HELX_P70 70 GLU B 636  ? ASN B 640  ? GLU B 637  ASN B 641  1 ? 5  
HELX_P HELX_P71 71 VAL B 642  ? LEU B 646  ? VAL B 643  LEU B 647  1 ? 5  
HELX_P HELX_P72 72 VAL B 655  ? ALA B 657  ? VAL B 656  ALA B 658  5 ? 3  
HELX_P HELX_P73 73 THR B 668  ? PHE B 671  ? THR B 669  PHE B 672  5 ? 4  
HELX_P HELX_P74 74 GLN B 693  ? VAL B 697  ? GLN B 694  VAL B 698  1 ? 5  
HELX_P HELX_P75 75 ASN B 749  ? ILE B 753  ? ASN B 750  ILE B 754  1 ? 5  
HELX_P HELX_P76 76 LEU B 766  ? ARG B 782  ? LEU B 767  ARG B 783  1 ? 17 
HELX_P HELX_P77 77 LEU B 795  ? PHE B 800  ? LEU B 796  PHE B 801  1 ? 6  
HELX_P HELX_P78 78 THR B 817  ? ARG B 830  ? THR B 818  ARG B 831  1 ? 14 
HELX_P HELX_P79 79 CYS B 839  ? GLY B 844  ? CYS B 840  GLY B 845  1 ? 6  
HELX_P HELX_P80 80 ALA B 871  ? GLU B 898  ? ALA B 872  GLU B 899  1 ? 28 
HELX_P HELX_P81 81 GLY B 903  ? GLY B 915  ? GLY B 904  GLY B 916  1 ? 13 
HELX_P HELX_P82 82 LYS B 921  ? LEU B 932  ? LYS B 922  LEU B 933  1 ? 12 
HELX_P HELX_P83 83 GLY B 939  ? ALA B 946  ? GLY B 940  ALA B 947  1 ? 8  
HELX_P HELX_P84 84 ASP B 962  ? TYR B 966  ? ASP B 963  TYR B 967  1 ? 5  
HELX_P HELX_P85 85 TYR B 970  ? SER B 979  ? TYR B 971  SER B 980  1 ? 10 
HELX_P HELX_P86 86 LEU B 1024 ? THR B 1030 ? LEU B 1025 THR B 1031 1 ? 7  
HELX_P HELX_P87 87 GLN B 1046 ? SER B 1057 ? GLN B 1047 SER B 1058 1 ? 12 
HELX_P HELX_P88 88 MET B 1079 ? LYS B 1091 ? MET B 1080 LYS B 1092 5 ? 13 
HELX_P HELX_P89 89 PRO B 1102 ? ALA B 1106 ? PRO B 1103 ALA B 1107 1 ? 5  
HELX_P HELX_P90 90 VAL B 1123 ? ALA B 1129 ? VAL B 1124 ALA B 1130 1 ? 7  
HELX_P HELX_P91 91 ASN B 1131 ? ALA B 1166 ? ASN B 1132 ALA B 1167 1 ? 36 
HELX_P HELX_P92 92 SER B 1219 ? ARG B 1228 ? SER B 1220 ARG B 1229 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 1194 SG  ? ? ? 1_555 A CYS 1211 SG  ? ? A CYS 1195 A CYS 1212 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf2  disulf ? ? B CYS 1194 SG  ? ? ? 1_555 B CYS 1211 SG  ? ? B CYS 1195 B CYS 1212 1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc1  metalc ? ? A CYS 688  SG  ? ? ? 1_555 E SF4 .    FE1 ? ? A CYS 689  A SF4 1233 1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc2  metalc ? ? A CYS 691  SG  ? ? ? 1_555 E SF4 .    FE2 ? ? A CYS 692  A SF4 1233 1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc3  metalc ? ? A CYS 694  SG  ? ? ? 1_555 E SF4 .    FE3 ? ? A CYS 695  A SF4 1233 1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc4  metalc ? ? A CYS 698  SG  ? ? ? 1_555 F SF4 .    FE1 ? ? A CYS 699  A SF4 1234 1_555 ? ? ? ? ? ? ? 2.280 ? 
metalc5  metalc ? ? A CYS 744  SG  ? ? ? 1_555 F SF4 .    FE2 ? ? A CYS 745  A SF4 1234 1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc6  metalc ? ? A CYS 747  SG  ? ? ? 1_555 F SF4 .    FE4 ? ? A CYS 748  A SF4 1234 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc7  metalc ? ? A CYS 750  SG  ? ? ? 1_555 F SF4 .    FE3 ? ? A CYS 751  A SF4 1234 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc8  metalc ? ? A CYS 754  SG  ? ? ? 1_555 E SF4 .    FE4 ? ? A CYS 755  A SF4 1233 1_555 ? ? ? ? ? ? ? 2.286 ? 
metalc9  metalc ? ? A CYS 811  SG  ? ? ? 1_555 G SF4 .    FE1 ? ? A CYS 812  A SF4 1235 1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc10 metalc ? ? A CYS 814  SG  ? ? ? 1_555 G SF4 .    FE2 ? ? A CYS 815  A SF4 1235 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc11 metalc ? ? A CYS 839  SG  ? ? ? 1_555 G SF4 .    FE3 ? ? A CYS 840  A SF4 1235 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc12 metalc ? ? A ASP 962  OD1 ? ? ? 1_555 C MG  .    MG  ? ? A ASP 963  A MG  1237 1_555 ? ? ? ? ? ? ? 2.390 ? 
metalc13 metalc ? ? A ASP 982  OD1 ? ? ? 1_555 D CA  .    CA  ? ? A ASP 983  A CA  1238 1_555 ? ? ? ? ? ? ? 2.950 ? 
metalc14 metalc ? ? A ASN 984  OD1 ? ? ? 1_555 D CA  .    CA  ? ? A ASN 985  A CA  1238 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc15 metalc ? ? A VAL 992  O   ? ? ? 1_555 C MG  .    MG  ? ? A VAL 993  A MG  1237 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc16 metalc ? ? A ALA 1055 O   ? ? ? 1_555 D CA  .    CA  ? ? A ALA 1056 A CA  1238 1_555 ? ? ? ? ? ? ? 2.808 ? 
metalc17 metalc ? ? A PHE 1058 O   ? ? ? 1_555 D CA  .    CA  ? ? A PHE 1059 A CA  1238 1_555 ? ? ? ? ? ? ? 2.795 ? 
metalc18 metalc ? ? A GLY 1060 O   ? ? ? 1_555 D CA  .    CA  ? ? A GLY 1061 A CA  1238 1_555 ? ? ? ? ? ? ? 2.682 ? 
metalc19 metalc ? ? A SER 1062 OG  ? ? ? 1_555 D CA  .    CA  ? ? A SER 1063 A CA  1238 1_555 ? ? ? ? ? ? ? 2.890 ? 
metalc20 metalc ? ? A CYS 1070 SG  ? ? ? 1_555 G SF4 .    FE4 ? ? A CYS 1071 A SF4 1235 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc21 metalc ? ? B CYS 688  SG  ? ? ? 1_555 L SF4 .    FE1 ? ? B CYS 689  B SF4 1240 1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc22 metalc ? ? B CYS 691  SG  ? ? ? 1_555 L SF4 .    FE2 ? ? B CYS 692  B SF4 1240 1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc23 metalc ? ? B CYS 694  SG  ? ? ? 1_555 L SF4 .    FE3 ? ? B CYS 695  B SF4 1240 1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc24 metalc ? ? B CYS 698  SG  ? ? ? 1_555 M SF4 .    FE1 ? ? B CYS 699  B SF4 1241 1_555 ? ? ? ? ? ? ? 2.280 ? 
metalc25 metalc ? ? B CYS 744  SG  ? ? ? 1_555 M SF4 .    FE2 ? ? B CYS 745  B SF4 1241 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc26 metalc ? ? B CYS 747  SG  ? ? ? 1_555 M SF4 .    FE4 ? ? B CYS 748  B SF4 1241 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc27 metalc ? ? B CYS 750  SG  ? ? ? 1_555 M SF4 .    FE3 ? ? B CYS 751  B SF4 1241 1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc28 metalc ? ? B CYS 754  SG  ? ? ? 1_555 L SF4 .    FE4 ? ? B CYS 755  B SF4 1240 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc29 metalc ? ? B CYS 811  SG  ? ? ? 1_555 N SF4 .    FE1 ? ? B CYS 812  B SF4 1242 1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc30 metalc ? ? B CYS 814  SG  ? ? ? 1_555 N SF4 .    FE2 ? ? B CYS 815  B SF4 1242 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc31 metalc ? ? B CYS 839  SG  ? ? ? 1_555 N SF4 .    FE3 ? ? B CYS 840  B SF4 1242 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc32 metalc ? ? B ASP 962  OD1 ? ? ? 1_555 J MG  .    MG  ? ? B ASP 963  B MG  1244 1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc33 metalc ? ? B ASP 982  OD1 ? ? ? 1_555 K CA  .    CA  ? ? B ASP 983  B CA  1245 1_555 ? ? ? ? ? ? ? 2.950 ? 
metalc34 metalc ? ? B ASN 984  OD1 ? ? ? 1_555 K CA  .    CA  ? ? B ASN 985  B CA  1245 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc35 metalc ? ? B VAL 992  O   ? ? ? 1_555 J MG  .    MG  ? ? B VAL 993  B MG  1244 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc36 metalc ? ? B ALA 1055 O   ? ? ? 1_555 K CA  .    CA  ? ? B ALA 1056 B CA  1245 1_555 ? ? ? ? ? ? ? 2.808 ? 
metalc37 metalc ? ? B PHE 1058 O   ? ? ? 1_555 K CA  .    CA  ? ? B PHE 1059 B CA  1245 1_555 ? ? ? ? ? ? ? 2.796 ? 
metalc38 metalc ? ? B GLY 1060 O   ? ? ? 1_555 K CA  .    CA  ? ? B GLY 1061 B CA  1245 1_555 ? ? ? ? ? ? ? 2.682 ? 
metalc39 metalc ? ? B SER 1062 OG  ? ? ? 1_555 K CA  .    CA  ? ? B SER 1063 B CA  1245 1_555 ? ? ? ? ? ? ? 2.890 ? 
metalc40 metalc ? ? B CYS 1070 SG  ? ? ? 1_555 N SF4 .    FE4 ? ? B CYS 1071 B SF4 1242 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc41 metalc ? ? C MG  .    MG  ? ? ? 1_555 H TPP .    O1B ? ? A MG  1237 A TPP 1236 1_555 ? ? ? ? ? ? ? 1.763 ? 
metalc42 metalc ? ? J MG  .    MG  ? ? ? 1_555 O TPP .    O1B ? ? B MG  1244 B TPP 1243 1_555 ? ? ? ? ? ? ? 1.763 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 30  A . ? THR 31  A PRO 31  A ? PRO 32  A 1 0.12  
2 ARG 305 A . ? ARG 306 A PRO 306 A ? PRO 307 A 1 -0.46 
3 ALA 847 A . ? ALA 848 A PRO 848 A ? PRO 849 A 1 0.23  
4 THR 30  B . ? THR 31  B PRO 31  B ? PRO 32  B 1 0.07  
5 ARG 305 B . ? ARG 306 B PRO 306 B ? PRO 307 B 1 -0.51 
6 ALA 847 B . ? ALA 848 B PRO 848 B ? PRO 849 B 1 0.28  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 4 ? 
D ? 6 ? 
E ? 6 ? 
F ? 2 ? 
G ? 2 ? 
H ? 6 ? 
I ? 2 ? 
J ? 2 ? 
K ? 2 ? 
L ? 4 ? 
M ? 6 ? 
N ? 6 ? 
O ? 2 ? 
P ? 2 ? 
Q ? 6 ? 
R ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? parallel      
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? parallel      
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
M 1 2 ? anti-parallel 
M 2 3 ? parallel      
M 3 4 ? parallel      
M 4 5 ? parallel      
M 5 6 ? parallel      
N 1 2 ? parallel      
N 2 3 ? parallel      
N 3 4 ? parallel      
N 4 5 ? anti-parallel 
N 5 6 ? anti-parallel 
O 1 2 ? anti-parallel 
P 1 2 ? anti-parallel 
Q 1 2 ? parallel      
Q 2 3 ? parallel      
Q 3 4 ? parallel      
Q 4 5 ? parallel      
Q 5 6 ? parallel      
R 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 3    ? THR A 7    ? LYS A 4    THR A 8    
A 2 GLN A 180  ? VAL A 184  ? GLN A 181  VAL A 185  
B 1 VAL A 23   ? ILE A 26   ? VAL A 24   ILE A 27   
B 2 THR A 56   ? GLU A 59   ? THR A 57   GLU A 60   
C 1 THR A 81   ? THR A 84   ? THR A 82   THR A 85   
C 2 VAL A 107  ? ALA A 112  ? VAL A 108  ALA A 113  
C 3 PHE A 166  ? ASP A 171  ? PHE A 167  ASP A 172  
C 4 ALA A 138  ? ALA A 141  ? ALA A 139  ALA A 142  
D 1 PHE A 260  ? GLY A 264  ? PHE A 261  GLY A 265  
D 2 ILE A 296  ? VAL A 301  ? ILE A 297  VAL A 302  
D 3 ARG A 270  ? SER A 274  ? ARG A 271  SER A 275  
D 4 VAL A 322  ? ASP A 327  ? VAL A 323  ASP A 328  
D 5 ILE A 357  ? TYR A 362  ? ILE A 358  TYR A 363  
D 6 PHE A 389  ? VAL A 391  ? PHE A 390  VAL A 392  
E 1 LYS A 539  ? ILE A 543  ? LYS A 540  ILE A 544  
E 2 THR A 508  ? ASN A 512  ? THR A 509  ASN A 513  
E 3 TYR A 485  ? CYS A 488  ? TYR A 486  CYS A 489  
E 4 THR A 416  ? LEU A 424  ? THR A 417  LEU A 425  
E 5 ILE A 462  ? GLY A 470  ? ILE A 463  GLY A 471  
E 6 PHE A 447  ? SER A 453  ? PHE A 448  SER A 454  
F 1 ASN A 679  ? TRP A 683  ? ASN A 680  TRP A 684  
F 2 LEU A 761  ? PRO A 765  ? LEU A 762  PRO A 766  
G 1 ILE A 703  ? LYS A 709  ? ILE A 704  LYS A 710  
G 2 TYR A 733  ? ILE A 739  ? TYR A 734  ILE A 740  
H 1 ALA A 862  ? GLY A 864  ? ALA A 863  GLY A 865  
H 2 MET A 831  ? ASN A 835  ? MET A 832  ASN A 836  
H 3 SER A 955  ? GLY A 961  ? SER A 956  GLY A 962  
H 4 ASN A 984  ? ASP A 989  ? ASN A 985  ASP A 990  
H 5 SER A 1062 ? TYR A 1067 ? SER A 1063 TYR A 1068 
H 6 TYR A 1035 ? VAL A 1039 ? TYR A 1036 VAL A 1040 
I 1 PHE A 1098 ? TYR A 1100 ? PHE A 1099 TYR A 1101 
I 2 PHE A 1112 ? LEU A 1114 ? PHE A 1113 LEU A 1115 
J 1 LYS B 3    ? THR B 7    ? LYS B 4    THR B 8    
J 2 GLN B 180  ? VAL B 184  ? GLN B 181  VAL B 185  
K 1 VAL B 23   ? ILE B 26   ? VAL B 24   ILE B 27   
K 2 THR B 56   ? GLU B 59   ? THR B 57   GLU B 60   
L 1 THR B 81   ? THR B 84   ? THR B 82   THR B 85   
L 2 VAL B 107  ? ALA B 112  ? VAL B 108  ALA B 113  
L 3 PHE B 166  ? ASP B 171  ? PHE B 167  ASP B 172  
L 4 ALA B 138  ? ALA B 141  ? ALA B 139  ALA B 142  
M 1 PHE B 260  ? GLY B 264  ? PHE B 261  GLY B 265  
M 2 ILE B 296  ? VAL B 301  ? ILE B 297  VAL B 302  
M 3 ARG B 270  ? SER B 274  ? ARG B 271  SER B 275  
M 4 VAL B 322  ? ASP B 327  ? VAL B 323  ASP B 328  
M 5 ILE B 357  ? TYR B 362  ? ILE B 358  TYR B 363  
M 6 PHE B 389  ? VAL B 391  ? PHE B 390  VAL B 392  
N 1 LYS B 539  ? ILE B 543  ? LYS B 540  ILE B 544  
N 2 THR B 508  ? ASN B 512  ? THR B 509  ASN B 513  
N 3 TYR B 485  ? CYS B 488  ? TYR B 486  CYS B 489  
N 4 THR B 416  ? LEU B 424  ? THR B 417  LEU B 425  
N 5 ILE B 462  ? GLY B 470  ? ILE B 463  GLY B 471  
N 6 PHE B 447  ? SER B 453  ? PHE B 448  SER B 454  
O 1 ASN B 679  ? TRP B 683  ? ASN B 680  TRP B 684  
O 2 LEU B 761  ? PRO B 765  ? LEU B 762  PRO B 766  
P 1 ILE B 703  ? LYS B 709  ? ILE B 704  LYS B 710  
P 2 TYR B 733  ? ILE B 739  ? TYR B 734  ILE B 740  
Q 1 ALA B 862  ? GLY B 864  ? ALA B 863  GLY B 865  
Q 2 MET B 831  ? ASN B 835  ? MET B 832  ASN B 836  
Q 3 SER B 955  ? GLY B 961  ? SER B 956  GLY B 962  
Q 4 ASN B 984  ? ASP B 989  ? ASN B 985  ASP B 990  
Q 5 SER B 1062 ? TYR B 1067 ? SER B 1063 TYR B 1068 
Q 6 TYR B 1035 ? VAL B 1039 ? TYR B 1036 VAL B 1040 
R 1 PHE B 1098 ? TYR B 1100 ? PHE B 1099 TYR B 1101 
R 2 PHE B 1112 ? LEU B 1114 ? PHE B 1113 LEU B 1115 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 3    ? O LYS A 4    N VAL A 184  ? N VAL A 185  
B 1 2 O ALA A 24   ? O ALA A 25   N THR A 56   ? N THR A 57   
C 1 2 O THR A 82   ? O THR A 83   N VAL A 107  ? N VAL A 108  
C 2 3 O PHE A 108  ? O PHE A 109  N PHE A 166  ? N PHE A 167  
C 3 4 O MET A 167  ? O MET A 168  N ALA A 138  ? N ALA A 139  
D 1 2 O ASP A 261  ? O ASP A 262  N LYS A 300  ? N LYS A 301  
D 2 3 O GLY A 297  ? O GLY A 298  N ARG A 270  ? N ARG A 271  
D 3 4 O VAL A 271  ? O VAL A 272  N VAL A 322  ? N VAL A 323  
D 4 5 O ILE A 323  ? O ILE A 324  N LEU A 358  ? N LEU A 359  
D 5 6 O ARG A 361  ? O ARG A 362  N PHE A 389  ? N PHE A 390  
E 1 2 O LYS A 539  ? O LYS A 540  N PHE A 509  ? N PHE A 510  
E 2 3 O THR A 508  ? O THR A 509  N VAL A 486  ? N VAL A 487  
E 3 4 O TYR A 485  ? O TYR A 486  N GLN A 420  ? N GLN A 421  
E 4 5 O ILE A 417  ? O ILE A 418  N PHE A 469  ? N PHE A 470  
E 5 6 O ILE A 464  ? O ILE A 465  N SER A 453  ? N SER A 454  
F 1 2 O VAL A 680  ? O VAL A 681  N GLN A 764  ? N GLN A 765  
G 1 2 O LEU A 704  ? O LEU A 705  N GLN A 738  ? N GLN A 739  
H 1 2 O ALA A 862  ? O ALA A 863  N ILE A 833  ? N ILE A 834  
H 2 3 O PHE A 832  ? O PHE A 833  N SER A 955  ? N SER A 956  
H 3 4 O ILE A 958  ? O ILE A 959  N ASN A 984  ? N ASN A 985  
H 4 5 O VAL A 985  ? O VAL A 986  N SER A 1062 ? N SER A 1063 
H 5 6 O LEU A 1063 ? O LEU A 1064 N TYR A 1035 ? N TYR A 1036 
I 1 2 O ARG A 1099 ? O ARG A 1100 N GLN A 1113 ? N GLN A 1114 
J 1 2 O LYS B 3    ? O LYS B 4    N VAL B 184  ? N VAL B 185  
K 1 2 O ALA B 24   ? O ALA B 25   N THR B 56   ? N THR B 57   
L 1 2 O THR B 82   ? O THR B 83   N VAL B 107  ? N VAL B 108  
L 2 3 O PHE B 108  ? O PHE B 109  N PHE B 166  ? N PHE B 167  
L 3 4 O MET B 167  ? O MET B 168  N ALA B 138  ? N ALA B 139  
M 1 2 O ASP B 261  ? O ASP B 262  N LYS B 300  ? N LYS B 301  
M 2 3 O GLY B 297  ? O GLY B 298  N ARG B 270  ? N ARG B 271  
M 3 4 O VAL B 271  ? O VAL B 272  N VAL B 322  ? N VAL B 323  
M 4 5 O ILE B 323  ? O ILE B 324  N LEU B 358  ? N LEU B 359  
M 5 6 O ARG B 361  ? O ARG B 362  N PHE B 389  ? N PHE B 390  
N 1 2 O LYS B 539  ? O LYS B 540  N PHE B 509  ? N PHE B 510  
N 2 3 O THR B 508  ? O THR B 509  N VAL B 486  ? N VAL B 487  
N 3 4 O TYR B 485  ? O TYR B 486  N GLN B 420  ? N GLN B 421  
N 4 5 O ILE B 417  ? O ILE B 418  N PHE B 469  ? N PHE B 470  
N 5 6 O ILE B 464  ? O ILE B 465  N SER B 453  ? N SER B 454  
O 1 2 O VAL B 680  ? O VAL B 681  N GLN B 764  ? N GLN B 765  
P 1 2 O LEU B 704  ? O LEU B 705  N GLN B 738  ? N GLN B 739  
Q 1 2 O ALA B 862  ? O ALA B 863  N ILE B 833  ? N ILE B 834  
Q 2 3 O PHE B 832  ? O PHE B 833  N SER B 955  ? N SER B 956  
Q 3 4 O ILE B 958  ? O ILE B 959  N ASN B 984  ? N ASN B 985  
Q 4 5 O VAL B 985  ? O VAL B 986  N SER B 1062 ? N SER B 1063 
Q 5 6 O LEU B 1063 ? O LEU B 1064 N TYR B 1035 ? N TYR B 1036 
R 1 2 O ARG B 1099 ? O ARG B 1100 N GLN B 1113 ? N GLN B 1114 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
MGA Author   ? ? ? ? 4  'MG BINDING SITE'                     
MGB Author   ? ? ? ? 4  'MG BINDING SITE'                     
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 1237'  
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 1238'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG B 1244'  
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA B 1245'  
AC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SF4 A 1233' 
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SF4 A 1234' 
AC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SF4 A 1235' 
AC8 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE TPP A 1236' 
AC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE PYR A 1239' 
BC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SF4 B 1240' 
BC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SF4 B 1241' 
BC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SF4 B 1242' 
BC4 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE TPP B 1243' 
BC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE PYR B 1246' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   MGA 4  ASP A 962  ? ASP A 963  . ? 1_555 ? 
2   MGA 4  THR A 990  ? THR A 991  . ? 1_555 ? 
3   MGA 4  VAL A 992  ? VAL A 993  . ? 1_555 ? 
4   MGA 4  TPP H .    ? TPP A 1236 . ? 1_555 ? 
5   MGB 4  ASP B 962  ? ASP B 963  . ? 1_555 ? 
6   MGB 4  THR B 990  ? THR B 991  . ? 1_555 ? 
7   MGB 4  VAL B 992  ? VAL B 993  . ? 1_555 ? 
8   MGB 4  TPP O .    ? TPP B 1243 . ? 1_555 ? 
9   AC1 5  ASP A 962  ? ASP A 963  . ? 1_555 ? 
10  AC1 5  THR A 990  ? THR A 991  . ? 1_555 ? 
11  AC1 5  VAL A 992  ? VAL A 993  . ? 1_555 ? 
12  AC1 5  TPP H .    ? TPP A 1236 . ? 1_555 ? 
13  AC1 5  HOH Q .    ? HOH A 2004 . ? 1_555 ? 
14  AC2 7  ASP A 982  ? ASP A 983  . ? 1_555 ? 
15  AC2 7  ASN A 984  ? ASN A 985  . ? 1_555 ? 
16  AC2 7  ALA A 1055 ? ALA A 1056 . ? 1_555 ? 
17  AC2 7  GLU A 1056 ? GLU A 1057 . ? 1_555 ? 
18  AC2 7  PHE A 1058 ? PHE A 1059 . ? 1_555 ? 
19  AC2 7  GLY A 1060 ? GLY A 1061 . ? 1_555 ? 
20  AC2 7  SER A 1062 ? SER A 1063 . ? 1_555 ? 
21  AC3 5  ASP B 962  ? ASP B 963  . ? 1_555 ? 
22  AC3 5  THR B 990  ? THR B 991  . ? 1_555 ? 
23  AC3 5  VAL B 992  ? VAL B 993  . ? 1_555 ? 
24  AC3 5  TPP O .    ? TPP B 1243 . ? 1_555 ? 
25  AC3 5  HOH R .    ? HOH B 2104 . ? 1_555 ? 
26  AC4 7  ASP B 982  ? ASP B 983  . ? 1_555 ? 
27  AC4 7  ASN B 984  ? ASN B 985  . ? 1_555 ? 
28  AC4 7  ALA B 1055 ? ALA B 1056 . ? 1_555 ? 
29  AC4 7  GLU B 1056 ? GLU B 1057 . ? 1_555 ? 
30  AC4 7  PHE B 1058 ? PHE B 1059 . ? 1_555 ? 
31  AC4 7  GLY B 1060 ? GLY B 1061 . ? 1_555 ? 
32  AC4 7  SER B 1062 ? SER B 1063 . ? 1_555 ? 
33  AC5 10 TRP A 683  ? TRP A 684  . ? 1_555 ? 
34  AC5 10 CYS A 688  ? CYS A 689  . ? 1_555 ? 
35  AC5 10 ILE A 689  ? ILE A 690  . ? 1_555 ? 
36  AC5 10 CYS A 691  ? CYS A 692  . ? 1_555 ? 
37  AC5 10 ASN A 692  ? ASN A 693  . ? 1_555 ? 
38  AC5 10 CYS A 694  ? CYS A 695  . ? 1_555 ? 
39  AC5 10 CYS A 754  ? CYS A 755  . ? 1_555 ? 
40  AC5 10 PRO A 755  ? PRO A 756  . ? 1_555 ? 
41  AC5 10 ALA A 760  ? ALA A 761  . ? 1_555 ? 
42  AC5 10 LEU A 761  ? LEU A 762  . ? 1_555 ? 
43  AC6 10 PRO A 681  ? PRO A 682  . ? 1_555 ? 
44  AC6 10 CYS A 698  ? CYS A 699  . ? 1_555 ? 
45  AC6 10 ALA A 702  ? ALA A 703  . ? 1_555 ? 
46  AC6 10 ILE A 703  ? ILE A 704  . ? 1_555 ? 
47  AC6 10 CYS A 744  ? CYS A 745  . ? 1_555 ? 
48  AC6 10 MET A 745  ? MET A 746  . ? 1_555 ? 
49  AC6 10 GLY A 746  ? GLY A 747  . ? 1_555 ? 
50  AC6 10 CYS A 747  ? CYS A 748  . ? 1_555 ? 
51  AC6 10 GLY A 748  ? GLY A 749  . ? 1_555 ? 
52  AC6 10 CYS A 750  ? CYS A 751  . ? 1_555 ? 
53  AC7 7  LYS A 458  ? LYS A 459  . ? 1_555 ? 
54  AC7 7  CYS A 811  ? CYS A 812  . ? 1_555 ? 
55  AC7 7  CYS A 814  ? CYS A 815  . ? 1_555 ? 
56  AC7 7  GLU A 816  ? GLU A 817  . ? 1_555 ? 
57  AC7 7  CYS A 839  ? CYS A 840  . ? 1_555 ? 
58  AC7 7  CYS A 1070 ? CYS A 1071 . ? 1_555 ? 
59  AC7 7  ILE A 1071 ? ILE A 1072 . ? 1_555 ? 
60  AC8 22 PRO A 28   ? PRO A 29   . ? 1_555 ? 
61  AC8 22 GLU A 63   ? GLU A 64   . ? 1_555 ? 
62  AC8 22 GLU A 816  ? GLU A 817  . ? 1_555 ? 
63  AC8 22 GLY A 838  ? GLY A 839  . ? 1_555 ? 
64  AC8 22 CYS A 839  ? CYS A 840  . ? 1_555 ? 
65  AC8 22 PHE A 868  ? PHE A 869  . ? 1_555 ? 
66  AC8 22 GLU A 869  ? GLU A 870  . ? 1_555 ? 
67  AC8 22 GLY A 961  ? GLY A 962  . ? 1_555 ? 
68  AC8 22 ASP A 962  ? ASP A 963  . ? 1_555 ? 
69  AC8 22 GLY A 963  ? GLY A 964  . ? 1_555 ? 
70  AC8 22 TRP A 964  ? TRP A 965  . ? 1_555 ? 
71  AC8 22 THR A 990  ? THR A 991  . ? 1_555 ? 
72  AC8 22 VAL A 992  ? VAL A 993  . ? 1_555 ? 
73  AC8 22 TYR A 993  ? TYR A 994  . ? 1_555 ? 
74  AC8 22 SER A 994  ? SER A 995  . ? 1_555 ? 
75  AC8 22 ASN A 995  ? ASN A 996  . ? 1_555 ? 
76  AC8 22 THR A 996  ? THR A 997  . ? 1_555 ? 
77  AC8 22 MG  C .    ? MG  A 1237 . ? 1_555 ? 
78  AC8 22 PYR I .    ? PYR A 1239 . ? 1_555 ? 
79  AC8 22 HOH Q .    ? HOH A 2001 . ? 1_555 ? 
80  AC8 22 HOH Q .    ? HOH A 2003 . ? 1_555 ? 
81  AC8 22 HOH Q .    ? HOH A 2004 . ? 1_555 ? 
82  AC9 7  ILE A 29   ? ILE A 30   . ? 1_555 ? 
83  AC9 7  THR A 30   ? THR A 31   . ? 1_555 ? 
84  AC9 7  ARG A 113  ? ARG A 114  . ? 1_555 ? 
85  AC9 7  ASN A 995  ? ASN A 996  . ? 1_555 ? 
86  AC9 7  THR A 996  ? THR A 997  . ? 1_555 ? 
87  AC9 7  TPP H .    ? TPP A 1236 . ? 1_555 ? 
88  AC9 7  MET B 1201 ? MET B 1202 . ? 1_555 ? 
89  BC1 10 TRP B 683  ? TRP B 684  . ? 1_555 ? 
90  BC1 10 CYS B 688  ? CYS B 689  . ? 1_555 ? 
91  BC1 10 ILE B 689  ? ILE B 690  . ? 1_555 ? 
92  BC1 10 CYS B 691  ? CYS B 692  . ? 1_555 ? 
93  BC1 10 ASN B 692  ? ASN B 693  . ? 1_555 ? 
94  BC1 10 CYS B 694  ? CYS B 695  . ? 1_555 ? 
95  BC1 10 CYS B 754  ? CYS B 755  . ? 1_555 ? 
96  BC1 10 PRO B 755  ? PRO B 756  . ? 1_555 ? 
97  BC1 10 ALA B 760  ? ALA B 761  . ? 1_555 ? 
98  BC1 10 LEU B 761  ? LEU B 762  . ? 1_555 ? 
99  BC2 10 PRO B 681  ? PRO B 682  . ? 1_555 ? 
100 BC2 10 CYS B 698  ? CYS B 699  . ? 1_555 ? 
101 BC2 10 ALA B 702  ? ALA B 703  . ? 1_555 ? 
102 BC2 10 ILE B 703  ? ILE B 704  . ? 1_555 ? 
103 BC2 10 CYS B 744  ? CYS B 745  . ? 1_555 ? 
104 BC2 10 MET B 745  ? MET B 746  . ? 1_555 ? 
105 BC2 10 GLY B 746  ? GLY B 747  . ? 1_555 ? 
106 BC2 10 CYS B 747  ? CYS B 748  . ? 1_555 ? 
107 BC2 10 GLY B 748  ? GLY B 749  . ? 1_555 ? 
108 BC2 10 CYS B 750  ? CYS B 751  . ? 1_555 ? 
109 BC3 8  MET A 1202 ? MET A 1203 . ? 1_555 ? 
110 BC3 8  LYS B 458  ? LYS B 459  . ? 1_555 ? 
111 BC3 8  CYS B 811  ? CYS B 812  . ? 1_555 ? 
112 BC3 8  CYS B 814  ? CYS B 815  . ? 1_555 ? 
113 BC3 8  GLU B 816  ? GLU B 817  . ? 1_555 ? 
114 BC3 8  CYS B 839  ? CYS B 840  . ? 1_555 ? 
115 BC3 8  CYS B 1070 ? CYS B 1071 . ? 1_555 ? 
116 BC3 8  ILE B 1071 ? ILE B 1072 . ? 1_555 ? 
117 BC4 22 PRO B 28   ? PRO B 29   . ? 1_555 ? 
118 BC4 22 GLU B 63   ? GLU B 64   . ? 1_555 ? 
119 BC4 22 GLU B 816  ? GLU B 817  . ? 1_555 ? 
120 BC4 22 GLY B 838  ? GLY B 839  . ? 1_555 ? 
121 BC4 22 CYS B 839  ? CYS B 840  . ? 1_555 ? 
122 BC4 22 PHE B 868  ? PHE B 869  . ? 1_555 ? 
123 BC4 22 GLU B 869  ? GLU B 870  . ? 1_555 ? 
124 BC4 22 GLY B 961  ? GLY B 962  . ? 1_555 ? 
125 BC4 22 ASP B 962  ? ASP B 963  . ? 1_555 ? 
126 BC4 22 GLY B 963  ? GLY B 964  . ? 1_555 ? 
127 BC4 22 TRP B 964  ? TRP B 965  . ? 1_555 ? 
128 BC4 22 THR B 990  ? THR B 991  . ? 1_555 ? 
129 BC4 22 VAL B 992  ? VAL B 993  . ? 1_555 ? 
130 BC4 22 TYR B 993  ? TYR B 994  . ? 1_555 ? 
131 BC4 22 SER B 994  ? SER B 995  . ? 1_555 ? 
132 BC4 22 ASN B 995  ? ASN B 996  . ? 1_555 ? 
133 BC4 22 THR B 996  ? THR B 997  . ? 1_555 ? 
134 BC4 22 MG  J .    ? MG  B 1244 . ? 1_555 ? 
135 BC4 22 PYR P .    ? PYR B 1246 . ? 1_555 ? 
136 BC4 22 HOH R .    ? HOH B 2101 . ? 1_555 ? 
137 BC4 22 HOH R .    ? HOH B 2103 . ? 1_555 ? 
138 BC4 22 HOH R .    ? HOH B 2104 . ? 1_555 ? 
139 BC5 7  MET A 1201 ? MET A 1202 . ? 1_555 ? 
140 BC5 7  ILE B 29   ? ILE B 30   . ? 1_555 ? 
141 BC5 7  THR B 30   ? THR B 31   . ? 1_555 ? 
142 BC5 7  ARG B 113  ? ARG B 114  . ? 1_555 ? 
143 BC5 7  ASN B 995  ? ASN B 996  . ? 1_555 ? 
144 BC5 7  THR B 996  ? THR B 997  . ? 1_555 ? 
145 BC5 7  TPP O .    ? TPP B 1243 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2PDA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2PDA 
_atom_sites.fract_transf_matrix[1][1]   0.011628 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006835 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004719 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
FE 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A 1 1    ? -62.653 -67.537  35.938  1.00 38.92 ? 2    GLY A N     1 
ATOM   2     C  CA    . GLY A 1 1    ? -61.845 -68.341  36.837  1.00 37.19 ? 2    GLY A CA    1 
ATOM   3     C  C     . GLY A 1 1    ? -60.798 -69.303  36.309  1.00 35.97 ? 2    GLY A C     1 
ATOM   4     O  O     . GLY A 1 1    ? -60.147 -69.069  35.301  1.00 35.74 ? 2    GLY A O     1 
ATOM   5     N  N     . LYS A 1 2    ? -60.656 -70.405  37.041  1.00 35.11 ? 3    LYS A N     1 
ATOM   6     C  CA    . LYS A 1 2    ? -59.696 -71.473  36.780  1.00 34.06 ? 3    LYS A CA    1 
ATOM   7     C  C     . LYS A 1 2    ? -59.840 -72.152  35.435  1.00 32.82 ? 3    LYS A C     1 
ATOM   8     O  O     . LYS A 1 2    ? -60.935 -72.272  34.893  1.00 32.89 ? 3    LYS A O     1 
ATOM   9     C  CB    . LYS A 1 2    ? -59.806 -72.539  37.872  1.00 34.96 ? 3    LYS A CB    1 
ATOM   10    C  CG    . LYS A 1 2    ? -59.649 -72.027  39.298  1.00 35.59 ? 3    LYS A CG    1 
ATOM   11    C  CD    . LYS A 1 2    ? -60.473 -72.901  40.228  1.00 36.46 ? 3    LYS A CD    1 
ATOM   12    C  CE    . LYS A 1 2    ? -60.071 -72.747  41.685  1.00 37.27 ? 3    LYS A CE    1 
ATOM   13    N  NZ    . LYS A 1 2    ? -61.068 -73.398  42.607  1.00 37.68 ? 3    LYS A NZ    1 
ATOM   14    N  N     . LYS A 1 3    ? -58.724 -72.674  34.949  1.00 31.19 ? 4    LYS A N     1 
ATOM   15    C  CA    . LYS A 1 3    ? -58.698 -73.354  33.679  1.00 29.86 ? 4    LYS A CA    1 
ATOM   16    C  C     . LYS A 1 3    ? -57.641 -74.456  33.689  1.00 28.74 ? 4    LYS A C     1 
ATOM   17    O  O     . LYS A 1 3    ? -56.491 -74.201  34.026  1.00 29.14 ? 4    LYS A O     1 
ATOM   18    C  CB    . LYS A 1 3    ? -58.394 -72.358  32.569  1.00 30.30 ? 4    LYS A CB    1 
ATOM   19    C  CG    . LYS A 1 3    ? -58.465 -73.007  31.217  1.00 31.73 ? 4    LYS A CG    1 
ATOM   20    C  CD    . LYS A 1 3    ? -58.306 -72.035  30.079  1.00 33.28 ? 4    LYS A CD    1 
ATOM   21    C  CE    . LYS A 1 3    ? -58.932 -72.637  28.825  1.00 34.31 ? 4    LYS A CE    1 
ATOM   22    N  NZ    . LYS A 1 3    ? -58.621 -71.854  27.594  1.00 35.60 ? 4    LYS A NZ    1 
ATOM   23    N  N     . MET A 1 4    ? -58.022 -75.685  33.347  1.00 26.92 ? 5    MET A N     1 
ATOM   24    C  CA    . MET A 1 4    ? -57.046 -76.769  33.321  1.00 25.03 ? 5    MET A CA    1 
ATOM   25    C  C     . MET A 1 4    ? -56.212 -76.566  32.079  1.00 22.91 ? 5    MET A C     1 
ATOM   26    O  O     . MET A 1 4    ? -56.703 -76.062  31.077  1.00 23.05 ? 5    MET A O     1 
ATOM   27    C  CB    . MET A 1 4    ? -57.730 -78.127  33.293  1.00 26.43 ? 5    MET A CB    1 
ATOM   28    C  CG    . MET A 1 4    ? -58.344 -78.514  34.618  1.00 27.86 ? 5    MET A CG    1 
ATOM   29    S  SD    . MET A 1 4    ? -57.028 -78.891  35.798  1.00 29.68 ? 5    MET A SD    1 
ATOM   30    C  CE    . MET A 1 4    ? -57.364 -77.704  37.165  1.00 29.71 ? 5    MET A CE    1 
ATOM   31    N  N     . MET A 1 5    ? -54.961 -76.983  32.131  1.00 20.27 ? 6    MET A N     1 
ATOM   32    C  CA    . MET A 1 5    ? -54.079 -76.780  31.014  1.00 17.42 ? 6    MET A CA    1 
ATOM   33    C  C     . MET A 1 5    ? -52.910 -77.677  31.265  1.00 16.41 ? 6    MET A C     1 
ATOM   34    O  O     . MET A 1 5    ? -52.484 -77.859  32.406  1.00 15.98 ? 6    MET A O     1 
ATOM   35    C  CB    . MET A 1 5    ? -53.607 -75.340  31.046  1.00 16.76 ? 6    MET A CB    1 
ATOM   36    C  CG    . MET A 1 5    ? -53.228 -74.755  29.730  1.00 16.60 ? 6    MET A CG    1 
ATOM   37    S  SD    . MET A 1 5    ? -53.043 -72.964  29.869  1.00 16.96 ? 6    MET A SD    1 
ATOM   38    C  CE    . MET A 1 5    ? -51.375 -72.866  30.481  1.00 16.22 ? 6    MET A CE    1 
ATOM   39    N  N     . THR A 1 6    ? -52.409 -78.288  30.211  1.00 14.84 ? 7    THR A N     1 
ATOM   40    C  CA    . THR A 1 6    ? -51.270 -79.146  30.376  1.00 13.33 ? 7    THR A CA    1 
ATOM   41    C  C     . THR A 1 6    ? -50.104 -78.555  29.561  1.00 12.33 ? 7    THR A C     1 
ATOM   42    O  O     . THR A 1 6    ? -50.083 -78.633  28.334  1.00 12.48 ? 7    THR A O     1 
ATOM   43    C  CB    . THR A 1 6    ? -51.631 -80.625  30.045  1.00 13.08 ? 7    THR A CB    1 
ATOM   44    O  OG1   . THR A 1 6    ? -51.026 -81.037  28.826  1.00 13.46 ? 7    THR A OG1   1 
ATOM   45    C  CG2   . THR A 1 6    ? -53.125 -80.783  29.905  1.00 13.91 ? 7    THR A CG2   1 
ATOM   46    N  N     . THR A 1 7    ? -49.202 -77.858  30.256  1.00 10.72 ? 8    THR A N     1 
ATOM   47    C  CA    . THR A 1 7    ? -48.039 -77.245  29.631  1.00 9.13  ? 8    THR A CA    1 
ATOM   48    C  C     . THR A 1 7    ? -46.829 -77.198  30.530  1.00 8.34  ? 8    THR A C     1 
ATOM   49    O  O     . THR A 1 7    ? -46.864 -77.615  31.677  1.00 8.56  ? 8    THR A O     1 
ATOM   50    C  CB    . THR A 1 7    ? -48.288 -75.822  29.294  1.00 9.33  ? 8    THR A CB    1 
ATOM   51    O  OG1   . THR A 1 7    ? -48.544 -75.098  30.503  1.00 8.80  ? 8    THR A OG1   1 
ATOM   52    C  CG2   . THR A 1 7    ? -49.437 -75.706  28.335  1.00 9.98  ? 8    THR A CG2   1 
ATOM   53    N  N     . ASP A 1 8    ? -45.781 -76.583  30.020  1.00 7.07  ? 9    ASP A N     1 
ATOM   54    C  CA    . ASP A 1 8    ? -44.542 -76.462  30.737  1.00 6.49  ? 9    ASP A CA    1 
ATOM   55    C  C     . ASP A 1 8    ? -44.537 -75.260  31.662  1.00 5.67  ? 9    ASP A C     1 
ATOM   56    O  O     . ASP A 1 8    ? -45.463 -74.448  31.630  1.00 5.58  ? 9    ASP A O     1 
ATOM   57    C  CB    . ASP A 1 8    ? -43.409 -76.341  29.741  1.00 8.09  ? 9    ASP A CB    1 
ATOM   58    C  CG    . ASP A 1 8    ? -43.553 -75.139  28.838  1.00 9.59  ? 9    ASP A CG    1 
ATOM   59    O  OD1   . ASP A 1 8    ? -44.388 -74.262  29.127  1.00 10.03 ? 9    ASP A OD1   1 
ATOM   60    O  OD2   . ASP A 1 8    ? -42.828 -75.071  27.825  1.00 11.10 ? 9    ASP A OD2   1 
ATOM   61    N  N     . GLY A 1 9    ? -43.429 -75.095  32.382  1.00 4.32  ? 10   GLY A N     1 
ATOM   62    C  CA    . GLY A 1 9    ? -43.277 -74.013  33.327  1.00 2.61  ? 10   GLY A CA    1 
ATOM   63    C  C     . GLY A 1 9    ? -43.118 -72.700  32.638  1.00 2.46  ? 10   GLY A C     1 
ATOM   64    O  O     . GLY A 1 9    ? -43.562 -71.695  33.159  1.00 2.32  ? 10   GLY A O     1 
ATOM   65    N  N     . ASN A 1 10   ? -42.497 -72.700  31.466  1.00 2.54  ? 11   ASN A N     1 
ATOM   66    C  CA    . ASN A 1 10   ? -42.285 -71.472  30.694  1.00 2.81  ? 11   ASN A CA    1 
ATOM   67    C  C     . ASN A 1 10   ? -43.593 -70.788  30.305  1.00 3.02  ? 11   ASN A C     1 
ATOM   68    O  O     . ASN A 1 10   ? -43.853 -69.629  30.644  1.00 3.58  ? 11   ASN A O     1 
ATOM   69    C  CB    . ASN A 1 10   ? -41.572 -71.804  29.398  1.00 3.67  ? 11   ASN A CB    1 
ATOM   70    C  CG    . ASN A 1 10   ? -40.087 -71.588  29.456  1.00 4.59  ? 11   ASN A CG    1 
ATOM   71    O  OD1   . ASN A 1 10   ? -39.375 -72.098  28.587  1.00 5.19  ? 11   ASN A OD1   1 
ATOM   72    N  ND2   . ASN A 1 10   ? -39.604 -70.801  30.428  1.00 4.33  ? 11   ASN A ND2   1 
ATOM   73    N  N     . THR A 1 11   ? -44.393 -71.501  29.533  1.00 2.76  ? 12   THR A N     1 
ATOM   74    C  CA    . THR A 1 11   ? -45.650 -70.964  29.093  1.00 3.08  ? 12   THR A CA    1 
ATOM   75    C  C     . THR A 1 11   ? -46.542 -70.802  30.312  1.00 3.06  ? 12   THR A C     1 
ATOM   76    O  O     . THR A 1 11   ? -47.421 -69.956  30.321  1.00 3.14  ? 12   THR A O     1 
ATOM   77    C  CB    . THR A 1 11   ? -46.298 -71.849  28.009  1.00 3.23  ? 12   THR A CB    1 
ATOM   78    O  OG1   . THR A 1 11   ? -47.142 -72.828  28.611  1.00 4.26  ? 12   THR A OG1   1 
ATOM   79    C  CG2   . THR A 1 11   ? -45.231 -72.560  27.224  1.00 2.00  ? 12   THR A CG2   1 
ATOM   80    N  N     . ALA A 1 12   ? -46.334 -71.615  31.347  1.00 2.79  ? 13   ALA A N     1 
ATOM   81    C  CA    . ALA A 1 12   ? -47.131 -71.441  32.550  1.00 2.32  ? 13   ALA A CA    1 
ATOM   82    C  C     . ALA A 1 12   ? -46.840 -70.038  33.018  1.00 2.61  ? 13   ALA A C     1 
ATOM   83    O  O     . ALA A 1 12   ? -47.771 -69.324  33.315  1.00 3.36  ? 13   ALA A O     1 
ATOM   84    C  CB    . ALA A 1 12   ? -46.752 -72.408  33.622  1.00 2.10  ? 13   ALA A CB    1 
ATOM   85    N  N     . THR A 1 13   ? -45.577 -69.599  33.002  1.00 2.54  ? 14   THR A N     1 
ATOM   86    C  CA    . THR A 1 13   ? -45.308 -68.241  33.466  1.00 2.95  ? 14   THR A CA    1 
ATOM   87    C  C     . THR A 1 13   ? -45.552 -67.152  32.450  1.00 3.07  ? 14   THR A C     1 
ATOM   88    O  O     . THR A 1 13   ? -46.006 -66.056  32.829  1.00 3.16  ? 14   THR A O     1 
ATOM   89    C  CB    . THR A 1 13   ? -43.954 -68.039  34.181  1.00 3.04  ? 14   THR A CB    1 
ATOM   90    O  OG1   . THR A 1 13   ? -43.108 -67.196  33.411  1.00 4.10  ? 14   THR A OG1   1 
ATOM   91    C  CG2   . THR A 1 13   ? -43.284 -69.312  34.400  1.00 3.40  ? 14   THR A CG2   1 
ATOM   92    N  N     . ALA A 1 14   ? -45.324 -67.451  31.167  1.00 2.90  ? 15   ALA A N     1 
ATOM   93    C  CA    . ALA A 1 14   ? -45.564 -66.450  30.119  1.00 2.57  ? 15   ALA A CA    1 
ATOM   94    C  C     . ALA A 1 14   ? -47.049 -66.134  30.058  1.00 2.00  ? 15   ALA A C     1 
ATOM   95    O  O     . ALA A 1 14   ? -47.435 -65.137  29.535  1.00 2.00  ? 15   ALA A O     1 
ATOM   96    C  CB    . ALA A 1 14   ? -45.058 -66.924  28.771  1.00 2.01  ? 15   ALA A CB    1 
ATOM   97    N  N     . HIS A 1 15   ? -47.876 -67.012  30.595  1.00 2.32  ? 16   HIS A N     1 
ATOM   98    C  CA    . HIS A 1 15   ? -49.319 -66.819  30.634  1.00 2.95  ? 16   HIS A CA    1 
ATOM   99    C  C     . HIS A 1 15   ? -49.488 -65.574  31.500  1.00 3.29  ? 16   HIS A C     1 
ATOM   100   O  O     . HIS A 1 15   ? -49.891 -64.517  31.005  1.00 3.63  ? 16   HIS A O     1 
ATOM   101   C  CB    . HIS A 1 15   ? -49.985 -68.047  31.308  1.00 3.46  ? 16   HIS A CB    1 
ATOM   102   C  CG    . HIS A 1 15   ? -51.489 -68.008  31.362  1.00 4.17  ? 16   HIS A CG    1 
ATOM   103   N  ND1   . HIS A 1 15   ? -52.193 -68.106  32.547  1.00 4.63  ? 16   HIS A ND1   1 
ATOM   104   C  CD2   . HIS A 1 15   ? -52.422 -67.929  30.381  1.00 4.80  ? 16   HIS A CD2   1 
ATOM   105   C  CE1   . HIS A 1 15   ? -53.488 -68.088  32.295  1.00 4.41  ? 16   HIS A CE1   1 
ATOM   106   N  NE2   . HIS A 1 15   ? -53.655 -67.982  30.991  1.00 4.71  ? 16   HIS A NE2   1 
ATOM   107   N  N     . VAL A 1 16   ? -49.028 -65.673  32.750  1.00 2.59  ? 17   VAL A N     1 
ATOM   108   C  CA    . VAL A 1 16   ? -49.142 -64.601  33.726  1.00 2.00  ? 17   VAL A CA    1 
ATOM   109   C  C     . VAL A 1 16   ? -48.462 -63.291  33.350  1.00 2.12  ? 17   VAL A C     1 
ATOM   110   O  O     . VAL A 1 16   ? -48.989 -62.227  33.652  1.00 2.08  ? 17   VAL A O     1 
ATOM   111   C  CB    . VAL A 1 16   ? -48.629 -65.067  35.086  1.00 2.00  ? 17   VAL A CB    1 
ATOM   112   C  CG1   . VAL A 1 16   ? -48.790 -63.996  36.098  1.00 2.00  ? 17   VAL A CG1   1 
ATOM   113   C  CG2   . VAL A 1 16   ? -49.386 -66.280  35.534  1.00 2.00  ? 17   VAL A CG2   1 
ATOM   114   N  N     . ALA A 1 17   ? -47.290 -63.366  32.711  1.00 2.38  ? 18   ALA A N     1 
ATOM   115   C  CA    . ALA A 1 17   ? -46.532 -62.173  32.313  1.00 2.00  ? 18   ALA A CA    1 
ATOM   116   C  C     . ALA A 1 17   ? -47.231 -61.392  31.237  1.00 2.00  ? 18   ALA A C     1 
ATOM   117   O  O     . ALA A 1 17   ? -47.343 -60.185  31.335  1.00 2.66  ? 18   ALA A O     1 
ATOM   118   C  CB    . ALA A 1 17   ? -45.142 -62.524  31.869  1.00 2.00  ? 18   ALA A CB    1 
ATOM   119   N  N     . TYR A 1 18   ? -47.709 -62.054  30.201  1.00 2.00  ? 19   TYR A N     1 
ATOM   120   C  CA    . TYR A 1 18   ? -48.405 -61.332  29.166  1.00 2.00  ? 19   TYR A CA    1 
ATOM   121   C  C     . TYR A 1 18   ? -49.602 -60.574  29.784  1.00 2.08  ? 19   TYR A C     1 
ATOM   122   O  O     . TYR A 1 18   ? -49.842 -59.408  29.490  1.00 2.00  ? 19   TYR A O     1 
ATOM   123   C  CB    . TYR A 1 18   ? -48.859 -62.301  28.091  1.00 2.00  ? 19   TYR A CB    1 
ATOM   124   C  CG    . TYR A 1 18   ? -49.358 -61.602  26.872  1.00 2.00  ? 19   TYR A CG    1 
ATOM   125   C  CD1   . TYR A 1 18   ? -50.454 -60.782  26.946  1.00 2.00  ? 19   TYR A CD1   1 
ATOM   126   C  CD2   . TYR A 1 18   ? -48.683 -61.698  25.659  1.00 2.00  ? 19   TYR A CD2   1 
ATOM   127   C  CE1   . TYR A 1 18   ? -50.868 -60.059  25.874  1.00 2.03  ? 19   TYR A CE1   1 
ATOM   128   C  CE2   . TYR A 1 18   ? -49.090 -60.975  24.576  1.00 2.00  ? 19   TYR A CE2   1 
ATOM   129   C  CZ    . TYR A 1 18   ? -50.192 -60.154  24.697  1.00 2.08  ? 19   TYR A CZ    1 
ATOM   130   O  OH    . TYR A 1 18   ? -50.639 -59.390  23.658  1.00 2.70  ? 19   TYR A OH    1 
ATOM   131   N  N     . ALA A 1 19   ? -50.306 -61.223  30.703  1.00 2.39  ? 20   ALA A N     1 
ATOM   132   C  CA    . ALA A 1 19   ? -51.465 -60.629  31.359  1.00 2.00  ? 20   ALA A CA    1 
ATOM   133   C  C     . ALA A 1 19   ? -51.152 -59.379  32.154  1.00 2.12  ? 20   ALA A C     1 
ATOM   134   O  O     . ALA A 1 19   ? -51.879 -58.409  32.078  1.00 2.39  ? 20   ALA A O     1 
ATOM   135   C  CB    . ALA A 1 19   ? -52.118 -61.646  32.282  1.00 2.00  ? 20   ALA A CB    1 
ATOM   136   N  N     . MET A 1 20   ? -50.058 -59.399  32.902  1.00 2.23  ? 21   MET A N     1 
ATOM   137   C  CA    . MET A 1 20   ? -49.684 -58.285  33.773  1.00 2.34  ? 21   MET A CA    1 
ATOM   138   C  C     . MET A 1 20   ? -48.711 -57.254  33.212  1.00 2.26  ? 21   MET A C     1 
ATOM   139   O  O     . MET A 1 20   ? -48.190 -56.424  33.973  1.00 2.00  ? 21   MET A O     1 
ATOM   140   C  CB    . MET A 1 20   ? -49.036 -58.842  35.043  1.00 2.51  ? 21   MET A CB    1 
ATOM   141   C  CG    . MET A 1 20   ? -49.755 -59.971  35.715  1.00 2.85  ? 21   MET A CG    1 
ATOM   142   S  SD    . MET A 1 20   ? -51.368 -59.521  36.387  1.00 3.88  ? 21   MET A SD    1 
ATOM   143   C  CE    . MET A 1 20   ? -51.120 -57.959  37.131  1.00 3.10  ? 21   MET A CE    1 
ATOM   144   N  N     . SER A 1 21   ? -48.446 -57.304  31.912  1.00 2.00  ? 22   SER A N     1 
ATOM   145   C  CA    . SER A 1 21   ? -47.473 -56.397  31.338  1.00 2.00  ? 22   SER A CA    1 
ATOM   146   C  C     . SER A 1 21   ? -47.929 -55.526  30.190  1.00 2.68  ? 22   SER A C     1 
ATOM   147   O  O     . SER A 1 21   ? -48.793 -55.907  29.390  1.00 3.34  ? 22   SER A O     1 
ATOM   148   C  CB    . SER A 1 21   ? -46.253 -57.189  30.925  1.00 2.00  ? 22   SER A CB    1 
ATOM   149   O  OG    . SER A 1 21   ? -45.752 -57.880  32.049  1.00 2.00  ? 22   SER A OG    1 
ATOM   150   N  N     . GLU A 1 22   ? -47.364 -54.331  30.117  1.00 2.49  ? 23   GLU A N     1 
ATOM   151   C  CA    . GLU A 1 22   ? -47.715 -53.431  29.045  1.00 2.53  ? 23   GLU A CA    1 
ATOM   152   C  C     . GLU A 1 22   ? -46.576 -53.328  28.074  1.00 2.75  ? 23   GLU A C     1 
ATOM   153   O  O     . GLU A 1 22   ? -46.766 -52.874  26.960  1.00 3.55  ? 23   GLU A O     1 
ATOM   154   C  CB    . GLU A 1 22   ? -47.980 -52.039  29.575  1.00 2.84  ? 23   GLU A CB    1 
ATOM   155   C  CG    . GLU A 1 22   ? -49.155 -51.911  30.467  1.00 4.16  ? 23   GLU A CG    1 
ATOM   156   C  CD    . GLU A 1 22   ? -49.308 -50.491  30.941  1.00 5.56  ? 23   GLU A CD    1 
ATOM   157   O  OE1   . GLU A 1 22   ? -48.439 -50.065  31.723  1.00 6.56  ? 23   GLU A OE1   1 
ATOM   158   O  OE2   . GLU A 1 22   ? -50.262 -49.786  30.520  1.00 6.32  ? 23   GLU A OE2   1 
ATOM   159   N  N     . VAL A 1 23   ? -45.387 -53.755  28.473  1.00 2.65  ? 24   VAL A N     1 
ATOM   160   C  CA    . VAL A 1 23   ? -44.243 -53.623  27.597  1.00 2.47  ? 24   VAL A CA    1 
ATOM   161   C  C     . VAL A 1 23   ? -43.289 -54.706  27.907  1.00 2.75  ? 24   VAL A C     1 
ATOM   162   O  O     . VAL A 1 23   ? -43.141 -55.066  29.062  1.00 3.86  ? 24   VAL A O     1 
ATOM   163   C  CB    . VAL A 1 23   ? -43.495 -52.319  27.894  1.00 2.10  ? 24   VAL A CB    1 
ATOM   164   C  CG1   . VAL A 1 23   ? -42.087 -52.381  27.354  1.00 2.00  ? 24   VAL A CG1   1 
ATOM   165   C  CG2   . VAL A 1 23   ? -44.232 -51.144  27.311  1.00 2.00  ? 24   VAL A CG2   1 
ATOM   166   N  N     . ALA A 1 24   ? -42.582 -55.171  26.893  1.00 2.65  ? 25   ALA A N     1 
ATOM   167   C  CA    . ALA A 1 24   ? -41.576 -56.189  27.081  1.00 2.81  ? 25   ALA A CA    1 
ATOM   168   C  C     . ALA A 1 24   ? -40.433 -55.859  26.147  1.00 3.33  ? 25   ALA A C     1 
ATOM   169   O  O     . ALA A 1 24   ? -40.664 -55.664  24.949  1.00 3.90  ? 25   ALA A O     1 
ATOM   170   C  CB    . ALA A 1 24   ? -42.135 -57.549  26.748  1.00 2.54  ? 25   ALA A CB    1 
ATOM   171   N  N     . ALA A 1 25   ? -39.235 -55.679  26.704  1.00 3.22  ? 26   ALA A N     1 
ATOM   172   C  CA    . ALA A 1 25   ? -38.028 -55.427  25.915  1.00 3.60  ? 26   ALA A CA    1 
ATOM   173   C  C     . ALA A 1 25   ? -37.408 -56.806  26.047  1.00 4.26  ? 26   ALA A C     1 
ATOM   174   O  O     . ALA A 1 25   ? -37.213 -57.267  27.168  1.00 4.54  ? 26   ALA A O     1 
ATOM   175   C  CB    . ALA A 1 25   ? -37.189 -54.415  26.584  1.00 4.05  ? 26   ALA A CB    1 
ATOM   176   N  N     . ILE A 1 26   ? -37.022 -57.427  24.934  1.00 4.86  ? 27   ILE A N     1 
ATOM   177   C  CA    . ILE A 1 26   ? -36.574 -58.830  24.943  1.00 5.24  ? 27   ILE A CA    1 
ATOM   178   C  C     . ILE A 1 26   ? -35.258 -59.259  24.255  1.00 5.53  ? 27   ILE A C     1 
ATOM   179   O  O     . ILE A 1 26   ? -34.637 -58.456  23.557  1.00 5.85  ? 27   ILE A O     1 
ATOM   180   C  CB    . ILE A 1 26   ? -37.784 -59.640  24.395  1.00 5.43  ? 27   ILE A CB    1 
ATOM   181   C  CG1   . ILE A 1 26   ? -38.476 -60.369  25.515  1.00 6.45  ? 27   ILE A CG1   1 
ATOM   182   C  CG2   . ILE A 1 26   ? -37.462 -60.500  23.219  1.00 5.69  ? 27   ILE A CG2   1 
ATOM   183   C  CD1   . ILE A 1 26   ? -39.996 -60.232  25.421  1.00 7.77  ? 27   ILE A CD1   1 
ATOM   184   N  N     . TYR A 1 27   ? -34.837 -60.520  24.486  1.00 5.38  ? 28   TYR A N     1 
ATOM   185   C  CA    . TYR A 1 27   ? -33.616 -61.134  23.883  1.00 5.04  ? 28   TYR A CA    1 
ATOM   186   C  C     . TYR A 1 27   ? -33.549 -62.653  24.142  1.00 4.54  ? 28   TYR A C     1 
ATOM   187   O  O     . TYR A 1 27   ? -33.551 -63.095  25.296  1.00 5.07  ? 28   TYR A O     1 
ATOM   188   C  CB    . TYR A 1 27   ? -32.335 -60.488  24.409  1.00 5.55  ? 28   TYR A CB    1 
ATOM   189   C  CG    . TYR A 1 27   ? -31.128 -60.730  23.512  1.00 5.99  ? 28   TYR A CG    1 
ATOM   190   C  CD1   . TYR A 1 27   ? -30.993 -60.047  22.312  1.00 6.49  ? 28   TYR A CD1   1 
ATOM   191   C  CD2   . TYR A 1 27   ? -30.120 -61.616  23.867  1.00 5.29  ? 28   TYR A CD2   1 
ATOM   192   C  CE1   . TYR A 1 27   ? -29.898 -60.232  21.500  1.00 6.12  ? 28   TYR A CE1   1 
ATOM   193   C  CE2   . TYR A 1 27   ? -29.021 -61.808  23.053  1.00 5.21  ? 28   TYR A CE2   1 
ATOM   194   C  CZ    . TYR A 1 27   ? -28.923 -61.105  21.871  1.00 5.82  ? 28   TYR A CZ    1 
ATOM   195   O  OH    . TYR A 1 27   ? -27.854 -61.258  21.028  1.00 6.72  ? 28   TYR A OH    1 
ATOM   196   N  N     . PRO A 1 28   ? -33.378 -63.462  23.077  1.00 3.72  ? 29   PRO A N     1 
ATOM   197   C  CA    . PRO A 1 28   ? -33.316 -64.925  23.187  1.00 3.25  ? 29   PRO A CA    1 
ATOM   198   C  C     . PRO A 1 28   ? -32.123 -65.596  23.868  1.00 3.11  ? 29   PRO A C     1 
ATOM   199   O  O     . PRO A 1 28   ? -30.996 -65.436  23.441  1.00 3.70  ? 29   PRO A O     1 
ATOM   200   C  CB    . PRO A 1 28   ? -33.457 -65.366  21.739  1.00 2.59  ? 29   PRO A CB    1 
ATOM   201   C  CG    . PRO A 1 28   ? -32.764 -64.282  20.992  1.00 2.86  ? 29   PRO A CG    1 
ATOM   202   C  CD    . PRO A 1 28   ? -33.301 -63.051  21.662  1.00 3.37  ? 29   PRO A CD    1 
ATOM   203   N  N     . ILE A 1 29   ? -32.389 -66.369  24.918  1.00 3.16  ? 30   ILE A N     1 
ATOM   204   C  CA    . ILE A 1 29   ? -31.351 -67.107  25.635  1.00 2.56  ? 30   ILE A CA    1 
ATOM   205   C  C     . ILE A 1 29   ? -31.958 -68.405  26.206  1.00 2.59  ? 30   ILE A C     1 
ATOM   206   O  O     . ILE A 1 29   ? -32.910 -68.357  26.963  1.00 2.96  ? 30   ILE A O     1 
ATOM   207   C  CB    . ILE A 1 29   ? -30.623 -66.236  26.753  1.00 2.27  ? 30   ILE A CB    1 
ATOM   208   C  CG1   . ILE A 1 29   ? -29.435 -67.020  27.320  1.00 2.04  ? 30   ILE A CG1   1 
ATOM   209   C  CG2   . ILE A 1 29   ? -31.559 -65.870  27.892  1.00 2.00  ? 30   ILE A CG2   1 
ATOM   210   C  CD1   . ILE A 1 29   ? -28.635 -66.331  28.357  1.00 2.00  ? 30   ILE A CD1   1 
ATOM   211   N  N     . THR A 1 30   ? -31.442 -69.564  25.792  1.00 2.58  ? 31   THR A N     1 
ATOM   212   C  CA    . THR A 1 30   ? -31.930 -70.884  26.257  1.00 2.54  ? 31   THR A CA    1 
ATOM   213   C  C     . THR A 1 30   ? -31.691 -70.907  27.774  1.00 2.67  ? 31   THR A C     1 
ATOM   214   O  O     . THR A 1 30   ? -30.665 -70.443  28.224  1.00 3.67  ? 31   THR A O     1 
ATOM   215   C  CB    . THR A 1 30   ? -31.097 -72.052  25.616  1.00 2.05  ? 31   THR A CB    1 
ATOM   216   O  OG1   . THR A 1 30   ? -31.027 -71.903  24.193  1.00 2.00  ? 31   THR A OG1   1 
ATOM   217   C  CG2   . THR A 1 30   ? -31.690 -73.378  25.938  1.00 2.00  ? 31   THR A CG2   1 
ATOM   218   N  N     . PRO A 1 31   ? -32.581 -71.507  28.554  1.00 2.34  ? 32   PRO A N     1 
ATOM   219   C  CA    . PRO A 1 31   ? -33.803 -72.179  28.175  1.00 2.67  ? 32   PRO A CA    1 
ATOM   220   C  C     . PRO A 1 31   ? -34.995 -71.254  28.172  1.00 3.05  ? 32   PRO A C     1 
ATOM   221   O  O     . PRO A 1 31   ? -36.101 -71.704  27.867  1.00 4.38  ? 32   PRO A O     1 
ATOM   222   C  CB    . PRO A 1 31   ? -33.983 -73.226  29.280  1.00 2.50  ? 32   PRO A CB    1 
ATOM   223   C  CG    . PRO A 1 31   ? -32.946 -72.884  30.331  1.00 2.63  ? 32   PRO A CG    1 
ATOM   224   C  CD    . PRO A 1 31   ? -32.457 -71.524  30.017  1.00 2.26  ? 32   PRO A CD    1 
ATOM   225   N  N     . SER A 1 32   ? -34.793 -69.979  28.470  1.00 2.16  ? 33   SER A N     1 
ATOM   226   C  CA    . SER A 1 32   ? -35.907 -69.048  28.550  1.00 2.00  ? 33   SER A CA    1 
ATOM   227   C  C     . SER A 1 32   ? -36.441 -68.429  27.273  1.00 2.04  ? 33   SER A C     1 
ATOM   228   O  O     . SER A 1 32   ? -37.412 -67.665  27.324  1.00 2.00  ? 33   SER A O     1 
ATOM   229   C  CB    . SER A 1 32   ? -35.561 -67.931  29.501  1.00 2.00  ? 33   SER A CB    1 
ATOM   230   O  OG    . SER A 1 32   ? -34.684 -67.032  28.875  1.00 2.00  ? 33   SER A OG    1 
ATOM   231   N  N     . SER A 1 33   ? -35.864 -68.782  26.129  1.00 2.59  ? 34   SER A N     1 
ATOM   232   C  CA    . SER A 1 33   ? -36.292 -68.212  24.841  1.00 3.12  ? 34   SER A CA    1 
ATOM   233   C  C     . SER A 1 33   ? -37.771 -68.289  24.535  1.00 3.28  ? 34   SER A C     1 
ATOM   234   O  O     . SER A 1 33   ? -38.347 -67.332  24.039  1.00 3.77  ? 34   SER A O     1 
ATOM   235   C  CB    . SER A 1 33   ? -35.498 -68.817  23.700  1.00 3.10  ? 34   SER A CB    1 
ATOM   236   O  OG    . SER A 1 33   ? -34.114 -68.656  23.964  1.00 4.85  ? 34   SER A OG    1 
ATOM   237   N  N     . THR A 1 34   ? -38.387 -69.428  24.817  1.00 3.30  ? 35   THR A N     1 
ATOM   238   C  CA    . THR A 1 34   ? -39.815 -69.613  24.585  1.00 3.35  ? 35   THR A CA    1 
ATOM   239   C  C     . THR A 1 34   ? -40.642 -68.412  25.081  1.00 3.65  ? 35   THR A C     1 
ATOM   240   O  O     . THR A 1 34   ? -41.153 -67.657  24.270  1.00 4.55  ? 35   THR A O     1 
ATOM   241   C  CB    . THR A 1 34   ? -40.280 -70.882  25.271  1.00 3.10  ? 35   THR A CB    1 
ATOM   242   O  OG1   . THR A 1 34   ? -39.485 -71.965  24.803  1.00 3.42  ? 35   THR A OG1   1 
ATOM   243   C  CG2   . THR A 1 34   ? -41.695 -71.159  24.956  1.00 2.84  ? 35   THR A CG2   1 
ATOM   244   N  N     . MET A 1 35   ? -40.708 -68.206  26.396  1.00 3.48  ? 36   MET A N     1 
ATOM   245   C  CA    . MET A 1 35   ? -41.454 -67.108  27.001  1.00 3.27  ? 36   MET A CA    1 
ATOM   246   C  C     . MET A 1 35   ? -41.543 -65.867  26.126  1.00 3.44  ? 36   MET A C     1 
ATOM   247   O  O     . MET A 1 35   ? -42.630 -65.410  25.792  1.00 4.30  ? 36   MET A O     1 
ATOM   248   C  CB    . MET A 1 35   ? -40.858 -66.712  28.368  1.00 2.99  ? 36   MET A CB    1 
ATOM   249   C  CG    . MET A 1 35   ? -40.953 -67.783  29.470  1.00 2.63  ? 36   MET A CG    1 
ATOM   250   S  SD    . MET A 1 35   ? -40.713 -67.194  31.172  1.00 2.00  ? 36   MET A SD    1 
ATOM   251   C  CE    . MET A 1 35   ? -39.075 -67.191  31.317  1.00 2.00  ? 36   MET A CE    1 
ATOM   252   N  N     . GLY A 1 36   ? -40.406 -65.337  25.709  1.00 3.41  ? 37   GLY A N     1 
ATOM   253   C  CA    . GLY A 1 36   ? -40.429 -64.141  24.892  1.00 3.28  ? 37   GLY A CA    1 
ATOM   254   C  C     . GLY A 1 36   ? -41.124 -64.346  23.561  1.00 3.58  ? 37   GLY A C     1 
ATOM   255   O  O     . GLY A 1 36   ? -41.802 -63.452  23.073  1.00 4.21  ? 37   GLY A O     1 
ATOM   256   N  N     . GLU A 1 37   ? -40.950 -65.522  22.969  1.00 3.70  ? 38   GLU A N     1 
ATOM   257   C  CA    . GLU A 1 37   ? -41.540 -65.838  21.678  1.00 3.83  ? 38   GLU A CA    1 
ATOM   258   C  C     . GLU A 1 37   ? -43.044 -65.999  21.770  1.00 4.29  ? 38   GLU A C     1 
ATOM   259   O  O     . GLU A 1 37   ? -43.786 -65.593  20.873  1.00 4.44  ? 38   GLU A O     1 
ATOM   260   C  CB    . GLU A 1 37   ? -40.880 -67.080  21.121  1.00 3.78  ? 38   GLU A CB    1 
ATOM   261   C  CG    . GLU A 1 37   ? -39.392 -67.044  21.340  1.00 6.48  ? 38   GLU A CG    1 
ATOM   262   C  CD    . GLU A 1 37   ? -38.651 -68.218  20.739  1.00 8.26  ? 38   GLU A CD    1 
ATOM   263   O  OE1   . GLU A 1 37   ? -39.090 -68.718  19.680  1.00 8.90  ? 38   GLU A OE1   1 
ATOM   264   O  OE2   . GLU A 1 37   ? -37.606 -68.623  21.310  1.00 8.80  ? 38   GLU A OE2   1 
ATOM   265   N  N     . GLU A 1 38   ? -43.509 -66.589  22.858  1.00 4.43  ? 39   GLU A N     1 
ATOM   266   C  CA    . GLU A 1 38   ? -44.931 -66.752  23.047  1.00 5.21  ? 39   GLU A CA    1 
ATOM   267   C  C     . GLU A 1 38   ? -45.541 -65.372  23.335  1.00 6.39  ? 39   GLU A C     1 
ATOM   268   O  O     . GLU A 1 38   ? -46.612 -65.030  22.820  1.00 7.29  ? 39   GLU A O     1 
ATOM   269   C  CB    . GLU A 1 38   ? -45.191 -67.677  24.213  1.00 4.89  ? 39   GLU A CB    1 
ATOM   270   C  CG    . GLU A 1 38   ? -44.620 -69.040  24.064  1.00 4.29  ? 39   GLU A CG    1 
ATOM   271   C  CD    . GLU A 1 38   ? -45.138 -69.985  25.128  1.00 3.76  ? 39   GLU A CD    1 
ATOM   272   O  OE1   . GLU A 1 38   ? -45.301 -69.570  26.286  1.00 3.34  ? 39   GLU A OE1   1 
ATOM   273   O  OE2   . GLU A 1 38   ? -45.409 -71.145  24.793  1.00 3.81  ? 39   GLU A OE2   1 
ATOM   274   N  N     . ALA A 1 39   ? -44.855 -64.581  24.159  1.00 7.00  ? 40   ALA A N     1 
ATOM   275   C  CA    . ALA A 1 39   ? -45.317 -63.252  24.503  1.00 7.59  ? 40   ALA A CA    1 
ATOM   276   C  C     . ALA A 1 39   ? -45.554 -62.545  23.197  1.00 8.35  ? 40   ALA A C     1 
ATOM   277   O  O     . ALA A 1 39   ? -46.576 -61.924  23.002  1.00 8.67  ? 40   ALA A O     1 
ATOM   278   C  CB    . ALA A 1 39   ? -44.284 -62.547  25.311  1.00 6.74  ? 40   ALA A CB    1 
ATOM   279   N  N     . ASP A 1 40   ? -44.699 -62.846  22.232  1.00 10.01 ? 41   ASP A N     1 
ATOM   280   C  CA    . ASP A 1 40   ? -44.759 -62.246  20.900  1.00 11.83 ? 41   ASP A CA    1 
ATOM   281   C  C     . ASP A 1 40   ? -45.791 -62.800  19.897  1.00 12.27 ? 41   ASP A C     1 
ATOM   282   O  O     . ASP A 1 40   ? -46.361 -62.044  19.116  1.00 12.72 ? 41   ASP A O     1 
ATOM   283   C  CB    . ASP A 1 40   ? -43.365 -62.252  20.270  1.00 12.50 ? 41   ASP A CB    1 
ATOM   284   C  CG    . ASP A 1 40   ? -43.320 -61.489  18.987  1.00 13.30 ? 41   ASP A CG    1 
ATOM   285   O  OD1   . ASP A 1 40   ? -43.602 -60.277  19.031  1.00 14.35 ? 41   ASP A OD1   1 
ATOM   286   O  OD2   . ASP A 1 40   ? -43.031 -62.097  17.932  1.00 14.94 ? 41   ASP A OD2   1 
ATOM   287   N  N     . ASP A 1 41   ? -45.996 -64.111  19.872  1.00 12.44 ? 42   ASP A N     1 
ATOM   288   C  CA    . ASP A 1 41   ? -46.968 -64.689  18.961  1.00 11.87 ? 42   ASP A CA    1 
ATOM   289   C  C     . ASP A 1 41   ? -48.331 -64.297  19.417  1.00 11.23 ? 42   ASP A C     1 
ATOM   290   O  O     . ASP A 1 41   ? -49.206 -64.022  18.602  1.00 11.62 ? 42   ASP A O     1 
ATOM   291   C  CB    . ASP A 1 41   ? -46.891 -66.187  18.997  1.00 12.87 ? 42   ASP A CB    1 
ATOM   292   C  CG    . ASP A 1 41   ? -45.662 -66.704  18.343  1.00 14.69 ? 42   ASP A CG    1 
ATOM   293   O  OD1   . ASP A 1 41   ? -44.975 -65.915  17.638  1.00 15.11 ? 42   ASP A OD1   1 
ATOM   294   O  OD2   . ASP A 1 41   ? -45.396 -67.916  18.526  1.00 15.52 ? 42   ASP A OD2   1 
ATOM   295   N  N     . TRP A 1 42   ? -48.518 -64.350  20.730  1.00 10.11 ? 43   TRP A N     1 
ATOM   296   C  CA    . TRP A 1 42   ? -49.774 -63.987  21.342  1.00 9.34  ? 43   TRP A CA    1 
ATOM   297   C  C     . TRP A 1 42   ? -50.104 -62.556  21.009  1.00 9.62  ? 43   TRP A C     1 
ATOM   298   O  O     . TRP A 1 42   ? -51.222 -62.236  20.603  1.00 9.78  ? 43   TRP A O     1 
ATOM   299   C  CB    . TRP A 1 42   ? -49.663 -64.100  22.828  1.00 8.22  ? 43   TRP A CB    1 
ATOM   300   C  CG    . TRP A 1 42   ? -49.464 -65.455  23.283  1.00 7.28  ? 43   TRP A CG    1 
ATOM   301   C  CD1   . TRP A 1 42   ? -49.614 -66.596  22.561  1.00 6.81  ? 43   TRP A CD1   1 
ATOM   302   C  CD2   . TRP A 1 42   ? -49.149 -65.851  24.614  1.00 6.96  ? 43   TRP A CD2   1 
ATOM   303   N  NE1   . TRP A 1 42   ? -49.427 -67.694  23.376  1.00 6.47  ? 43   TRP A NE1   1 
ATOM   304   C  CE2   . TRP A 1 42   ? -49.141 -67.257  24.643  1.00 6.93  ? 43   TRP A CE2   1 
ATOM   305   C  CE3   . TRP A 1 42   ? -48.877 -65.148  25.792  1.00 6.21  ? 43   TRP A CE3   1 
ATOM   306   C  CZ2   . TRP A 1 42   ? -48.878 -67.972  25.809  1.00 6.95  ? 43   TRP A CZ2   1 
ATOM   307   C  CZ3   . TRP A 1 42   ? -48.618 -65.857  26.942  1.00 5.76  ? 43   TRP A CZ3   1 
ATOM   308   C  CH2   . TRP A 1 42   ? -48.620 -67.250  26.947  1.00 6.16  ? 43   TRP A CH2   1 
ATOM   309   N  N     . ALA A 1 43   ? -49.139 -61.675  21.199  1.00 9.68  ? 44   ALA A N     1 
ATOM   310   C  CA    . ALA A 1 43   ? -49.395 -60.289  20.877  1.00 10.11 ? 44   ALA A CA    1 
ATOM   311   C  C     . ALA A 1 43   ? -49.777 -60.215  19.420  1.00 10.56 ? 44   ALA A C     1 
ATOM   312   O  O     . ALA A 1 43   ? -50.738 -59.566  19.080  1.00 11.48 ? 44   ALA A O     1 
ATOM   313   C  CB    . ALA A 1 43   ? -48.203 -59.455  21.147  1.00 9.80  ? 44   ALA A CB    1 
ATOM   314   N  N     . ALA A 1 44   ? -49.107 -60.985  18.576  1.00 11.35 ? 45   ALA A N     1 
ATOM   315   C  CA    . ALA A 1 44   ? -49.409 -60.980  17.148  1.00 12.10 ? 45   ALA A CA    1 
ATOM   316   C  C     . ALA A 1 44   ? -50.787 -61.533  16.814  1.00 12.54 ? 45   ALA A C     1 
ATOM   317   O  O     . ALA A 1 44   ? -51.277 -61.359  15.696  1.00 12.73 ? 45   ALA A O     1 
ATOM   318   C  CB    . ALA A 1 44   ? -48.355 -61.724  16.390  1.00 11.89 ? 45   ALA A CB    1 
ATOM   319   N  N     . GLN A 1 45   ? -51.419 -62.177  17.787  1.00 13.37 ? 46   GLN A N     1 
ATOM   320   C  CA    . GLN A 1 45   ? -52.747 -62.743  17.588  1.00 14.76 ? 46   GLN A CA    1 
ATOM   321   C  C     . GLN A 1 45   ? -53.861 -61.920  18.283  1.00 14.90 ? 46   GLN A C     1 
ATOM   322   O  O     . GLN A 1 45   ? -54.944 -62.417  18.596  1.00 15.45 ? 46   GLN A O     1 
ATOM   323   C  CB    . GLN A 1 45   ? -52.740 -64.209  18.018  1.00 15.98 ? 46   GLN A CB    1 
ATOM   324   C  CG    . GLN A 1 45   ? -51.652 -65.012  17.292  1.00 18.35 ? 46   GLN A CG    1 
ATOM   325   C  CD    . GLN A 1 45   ? -51.364 -66.400  17.898  1.00 19.93 ? 46   GLN A CD    1 
ATOM   326   O  OE1   . GLN A 1 45   ? -50.484 -67.124  17.403  1.00 20.51 ? 46   GLN A OE1   1 
ATOM   327   N  NE2   . GLN A 1 45   ? -52.105 -66.781  18.957  1.00 19.99 ? 46   GLN A NE2   1 
ATOM   328   N  N     . GLY A 1 46   ? -53.572 -60.646  18.524  1.00 14.68 ? 47   GLY A N     1 
ATOM   329   C  CA    . GLY A 1 46   ? -54.543 -59.751  19.121  1.00 13.80 ? 47   GLY A CA    1 
ATOM   330   C  C     . GLY A 1 46   ? -54.810 -59.929  20.592  1.00 13.28 ? 47   GLY A C     1 
ATOM   331   O  O     . GLY A 1 46   ? -55.573 -59.153  21.178  1.00 14.22 ? 47   GLY A O     1 
ATOM   332   N  N     . ARG A 1 47   ? -54.167 -60.912  21.204  1.00 11.99 ? 48   ARG A N     1 
ATOM   333   C  CA    . ARG A 1 47   ? -54.363 -61.182  22.623  1.00 11.35 ? 48   ARG A CA    1 
ATOM   334   C  C     . ARG A 1 47   ? -54.236 -59.945  23.503  1.00 11.02 ? 48   ARG A C     1 
ATOM   335   O  O     . ARG A 1 47   ? -53.266 -59.179  23.395  1.00 10.85 ? 48   ARG A O     1 
ATOM   336   C  CB    . ARG A 1 47   ? -53.370 -62.237  23.076  1.00 11.42 ? 48   ARG A CB    1 
ATOM   337   C  CG    . ARG A 1 47   ? -53.656 -62.859  24.397  1.00 10.56 ? 48   ARG A CG    1 
ATOM   338   C  CD    . ARG A 1 47   ? -53.042 -64.212  24.378  1.00 10.81 ? 48   ARG A CD    1 
ATOM   339   N  NE    . ARG A 1 47   ? -52.642 -64.629  25.705  1.00 11.16 ? 48   ARG A NE    1 
ATOM   340   C  CZ    . ARG A 1 47   ? -52.439 -65.891  26.047  1.00 12.44 ? 48   ARG A CZ    1 
ATOM   341   N  NH1   . ARG A 1 47   ? -52.604 -66.866  25.164  1.00 13.58 ? 48   ARG A NH1   1 
ATOM   342   N  NH2   . ARG A 1 47   ? -52.076 -66.187  27.281  1.00 13.78 ? 48   ARG A NH2   1 
ATOM   343   N  N     . LYS A 1 48   ? -55.207 -59.766  24.396  1.00 10.48 ? 49   LYS A N     1 
ATOM   344   C  CA    . LYS A 1 48   ? -55.187 -58.609  25.277  1.00 9.24  ? 49   LYS A CA    1 
ATOM   345   C  C     . LYS A 1 48   ? -54.701 -58.871  26.710  1.00 7.67  ? 49   LYS A C     1 
ATOM   346   O  O     . LYS A 1 48   ? -54.908 -59.945  27.276  1.00 7.20  ? 49   LYS A O     1 
ATOM   347   C  CB    . LYS A 1 48   ? -56.570 -57.948  25.267  1.00 10.51 ? 49   LYS A CB    1 
ATOM   348   C  CG    . LYS A 1 48   ? -57.065 -57.513  23.848  1.00 12.47 ? 49   LYS A CG    1 
ATOM   349   C  CD    . LYS A 1 48   ? -56.009 -56.681  23.058  1.00 14.30 ? 49   LYS A CD    1 
ATOM   350   C  CE    . LYS A 1 48   ? -56.562 -55.947  21.792  1.00 15.29 ? 49   LYS A CE    1 
ATOM   351   N  NZ    . LYS A 1 48   ? -56.479 -54.405  21.799  1.00 15.88 ? 49   LYS A NZ    1 
ATOM   352   N  N     . ASN A 1 49   ? -53.977 -57.902  27.257  1.00 5.94  ? 50   ASN A N     1 
ATOM   353   C  CA    . ASN A 1 49   ? -53.484 -57.976  28.627  1.00 4.71  ? 50   ASN A CA    1 
ATOM   354   C  C     . ASN A 1 49   ? -54.625 -57.494  29.553  1.00 3.66  ? 50   ASN A C     1 
ATOM   355   O  O     . ASN A 1 49   ? -55.717 -57.225  29.089  1.00 3.28  ? 50   ASN A O     1 
ATOM   356   C  CB    . ASN A 1 49   ? -52.215 -57.111  28.788  1.00 3.97  ? 50   ASN A CB    1 
ATOM   357   C  CG    . ASN A 1 49   ? -52.459 -55.657  28.469  1.00 3.39  ? 50   ASN A CG    1 
ATOM   358   O  OD1   . ASN A 1 49   ? -53.598 -55.214  28.371  1.00 2.81  ? 50   ASN A OD1   1 
ATOM   359   N  ND2   . ASN A 1 49   ? -51.393 -54.910  28.288  1.00 3.47  ? 50   ASN A ND2   1 
ATOM   360   N  N     . ILE A 1 50   ? -54.387 -57.336  30.845  1.00 2.95  ? 51   ILE A N     1 
ATOM   361   C  CA    . ILE A 1 50   ? -55.473 -56.903  31.713  1.00 2.43  ? 51   ILE A CA    1 
ATOM   362   C  C     . ILE A 1 50   ? -56.060 -55.516  31.451  1.00 2.11  ? 51   ILE A C     1 
ATOM   363   O  O     . ILE A 1 50   ? -57.093 -55.169  31.999  1.00 2.20  ? 51   ILE A O     1 
ATOM   364   C  CB    . ILE A 1 50   ? -55.122 -57.046  33.212  1.00 2.00  ? 51   ILE A CB    1 
ATOM   365   C  CG1   . ILE A 1 50   ? -53.832 -56.290  33.539  1.00 2.00  ? 51   ILE A CG1   1 
ATOM   366   C  CG2   . ILE A 1 50   ? -55.059 -58.502  33.573  1.00 2.00  ? 51   ILE A CG2   1 
ATOM   367   C  CD1   . ILE A 1 50   ? -53.660 -55.966  35.007  1.00 2.00  ? 51   ILE A CD1   1 
ATOM   368   N  N     . PHE A 1 51   ? -55.395 -54.707  30.645  1.00 2.08  ? 52   PHE A N     1 
ATOM   369   C  CA    . PHE A 1 51   ? -55.892 -53.367  30.366  1.00 2.00  ? 52   PHE A CA    1 
ATOM   370   C  C     . PHE A 1 51   ? -56.574 -53.386  29.025  1.00 2.34  ? 52   PHE A C     1 
ATOM   371   O  O     . PHE A 1 51   ? -56.895 -52.343  28.470  1.00 2.99  ? 52   PHE A O     1 
ATOM   372   C  CB    . PHE A 1 51   ? -54.752 -52.358  30.313  1.00 2.00  ? 52   PHE A CB    1 
ATOM   373   C  CG    . PHE A 1 51   ? -53.843 -52.402  31.493  1.00 2.00  ? 52   PHE A CG    1 
ATOM   374   C  CD1   . PHE A 1 51   ? -52.738 -53.229  31.496  1.00 2.75  ? 52   PHE A CD1   1 
ATOM   375   C  CD2   . PHE A 1 51   ? -54.072 -51.599  32.587  1.00 2.00  ? 52   PHE A CD2   1 
ATOM   376   C  CE1   . PHE A 1 51   ? -51.872 -53.253  32.581  1.00 2.76  ? 52   PHE A CE1   1 
ATOM   377   C  CE2   . PHE A 1 51   ? -53.229 -51.605  33.666  1.00 2.00  ? 52   PHE A CE2   1 
ATOM   378   C  CZ    . PHE A 1 51   ? -52.120 -52.435  33.666  1.00 2.84  ? 52   PHE A CZ    1 
ATOM   379   N  N     . GLY A 1 52   ? -56.708 -54.575  28.461  1.00 2.44  ? 53   GLY A N     1 
ATOM   380   C  CA    . GLY A 1 52   ? -57.368 -54.721  27.186  1.00 2.42  ? 53   GLY A CA    1 
ATOM   381   C  C     . GLY A 1 52   ? -56.514 -54.390  25.988  1.00 3.27  ? 53   GLY A C     1 
ATOM   382   O  O     . GLY A 1 52   ? -57.048 -54.326  24.872  1.00 3.53  ? 53   GLY A O     1 
ATOM   383   N  N     . GLN A 1 53   ? -55.206 -54.205  26.199  1.00 3.60  ? 54   GLN A N     1 
ATOM   384   C  CA    . GLN A 1 53   ? -54.267 -53.887  25.124  1.00 3.87  ? 54   GLN A CA    1 
ATOM   385   C  C     . GLN A 1 53   ? -53.342 -55.026  24.765  1.00 3.72  ? 54   GLN A C     1 
ATOM   386   O  O     . GLN A 1 53   ? -53.034 -55.842  25.608  1.00 3.45  ? 54   GLN A O     1 
ATOM   387   C  CB    . GLN A 1 53   ? -53.380 -52.728  25.544  1.00 5.29  ? 54   GLN A CB    1 
ATOM   388   C  CG    . GLN A 1 53   ? -54.134 -51.539  25.978  1.00 7.31  ? 54   GLN A CG    1 
ATOM   389   C  CD    . GLN A 1 53   ? -55.227 -51.254  25.022  1.00 8.35  ? 54   GLN A CD    1 
ATOM   390   O  OE1   . GLN A 1 53   ? -55.000 -51.221  23.814  1.00 9.49  ? 54   GLN A OE1   1 
ATOM   391   N  NE2   . GLN A 1 53   ? -56.445 -51.120  25.533  1.00 9.09  ? 54   GLN A NE2   1 
ATOM   392   N  N     . THR A 1 54   ? -52.885 -55.073  23.517  1.00 4.40  ? 55   THR A N     1 
ATOM   393   C  CA    . THR A 1 54   ? -51.924 -56.106  23.127  1.00 5.75  ? 55   THR A CA    1 
ATOM   394   C  C     . THR A 1 54   ? -50.558 -55.630  23.644  1.00 5.84  ? 55   THR A C     1 
ATOM   395   O  O     . THR A 1 54   ? -50.332 -54.423  23.753  1.00 6.78  ? 55   THR A O     1 
ATOM   396   C  CB    . THR A 1 54   ? -51.817 -56.282  21.608  1.00 6.16  ? 55   THR A CB    1 
ATOM   397   O  OG1   . THR A 1 54   ? -51.409 -55.049  21.019  1.00 7.51  ? 55   THR A OG1   1 
ATOM   398   C  CG2   . THR A 1 54   ? -53.127 -56.702  21.025  1.00 6.31  ? 55   THR A CG2   1 
ATOM   399   N  N     . LEU A 1 55   ? -49.642 -56.561  23.913  1.00 5.63  ? 56   LEU A N     1 
ATOM   400   C  CA    . LEU A 1 55   ? -48.314 -56.241  24.452  1.00 5.28  ? 56   LEU A CA    1 
ATOM   401   C  C     . LEU A 1 55   ? -47.358 -55.631  23.455  1.00 5.18  ? 56   LEU A C     1 
ATOM   402   O  O     . LEU A 1 55   ? -47.389 -55.968  22.282  1.00 5.09  ? 56   LEU A O     1 
ATOM   403   C  CB    . LEU A 1 55   ? -47.676 -57.501  25.040  1.00 5.47  ? 56   LEU A CB    1 
ATOM   404   C  CG    . LEU A 1 55   ? -46.348 -57.351  25.784  1.00 5.46  ? 56   LEU A CG    1 
ATOM   405   C  CD1   . LEU A 1 55   ? -46.624 -56.543  27.019  1.00 6.08  ? 56   LEU A CD1   1 
ATOM   406   C  CD2   . LEU A 1 55   ? -45.741 -58.693  26.167  1.00 4.42  ? 56   LEU A CD2   1 
ATOM   407   N  N     . THR A 1 56   ? -46.515 -54.718  23.922  1.00 5.42  ? 57   THR A N     1 
ATOM   408   C  CA    . THR A 1 56   ? -45.527 -54.092  23.056  1.00 5.81  ? 57   THR A CA    1 
ATOM   409   C  C     . THR A 1 56   ? -44.227 -54.825  23.282  1.00 6.21  ? 57   THR A C     1 
ATOM   410   O  O     . THR A 1 56   ? -43.593 -54.648  24.310  1.00 6.80  ? 57   THR A O     1 
ATOM   411   C  CB    . THR A 1 56   ? -45.300 -52.616  23.408  1.00 5.75  ? 57   THR A CB    1 
ATOM   412   O  OG1   . THR A 1 56   ? -46.551 -51.942  23.496  1.00 6.32  ? 57   THR A OG1   1 
ATOM   413   C  CG2   . THR A 1 56   ? -44.503 -51.939  22.325  1.00 6.02  ? 57   THR A CG2   1 
ATOM   414   N  N     . ILE A 1 57   ? -43.836 -55.681  22.355  1.00 6.56  ? 58   ILE A N     1 
ATOM   415   C  CA    . ILE A 1 57   ? -42.590 -56.399  22.527  1.00 7.51  ? 58   ILE A CA    1 
ATOM   416   C  C     . ILE A 1 57   ? -41.637 -55.837  21.522  1.00 8.11  ? 58   ILE A C     1 
ATOM   417   O  O     . ILE A 1 57   ? -42.049 -55.459  20.440  1.00 9.21  ? 58   ILE A O     1 
ATOM   418   C  CB    . ILE A 1 57   ? -42.713 -57.882  22.156  1.00 8.37  ? 58   ILE A CB    1 
ATOM   419   C  CG1   . ILE A 1 57   ? -44.100 -58.413  22.487  1.00 10.03 ? 58   ILE A CG1   1 
ATOM   420   C  CG2   . ILE A 1 57   ? -41.722 -58.711  22.932  1.00 8.64  ? 58   ILE A CG2   1 
ATOM   421   C  CD1   . ILE A 1 57   ? -45.094 -58.202  21.374  1.00 11.50 ? 58   ILE A CD1   1 
ATOM   422   N  N     . ARG A 1 58   ? -40.370 -55.713  21.889  1.00 8.52  ? 59   ARG A N     1 
ATOM   423   C  CA    . ARG A 1 58   ? -39.341 -55.263  20.953  1.00 8.72  ? 59   ARG A CA    1 
ATOM   424   C  C     . ARG A 1 58   ? -38.114 -56.130  21.245  1.00 8.22  ? 59   ARG A C     1 
ATOM   425   O  O     . ARG A 1 58   ? -37.918 -56.561  22.383  1.00 8.33  ? 59   ARG A O     1 
ATOM   426   C  CB    . ARG A 1 58   ? -39.022 -53.785  21.153  1.00 9.85  ? 59   ARG A CB    1 
ATOM   427   C  CG    . ARG A 1 58   ? -40.210 -52.861  20.962  1.00 12.19 ? 59   ARG A CG    1 
ATOM   428   C  CD    . ARG A 1 58   ? -40.664 -52.723  19.510  1.00 13.25 ? 59   ARG A CD    1 
ATOM   429   N  NE    . ARG A 1 58   ? -41.992 -52.105  19.471  1.00 15.84 ? 59   ARG A NE    1 
ATOM   430   C  CZ    . ARG A 1 58   ? -43.003 -52.557  18.727  1.00 17.10 ? 59   ARG A CZ    1 
ATOM   431   N  NH1   . ARG A 1 58   ? -42.828 -53.615  17.934  1.00 17.91 ? 59   ARG A NH1   1 
ATOM   432   N  NH2   . ARG A 1 58   ? -44.219 -52.030  18.852  1.00 16.88 ? 59   ARG A NH2   1 
ATOM   433   N  N     . GLU A 1 59   ? -37.335 -56.463  20.223  1.00 7.62  ? 60   GLU A N     1 
ATOM   434   C  CA    . GLU A 1 59   ? -36.146 -57.277  20.452  1.00 6.91  ? 60   GLU A CA    1 
ATOM   435   C  C     . GLU A 1 59   ? -34.902 -56.412  20.456  1.00 7.02  ? 60   GLU A C     1 
ATOM   436   O  O     . GLU A 1 59   ? -34.650 -55.686  19.485  1.00 7.98  ? 60   GLU A O     1 
ATOM   437   C  CB    . GLU A 1 59   ? -35.982 -58.331  19.378  1.00 6.43  ? 60   GLU A CB    1 
ATOM   438   C  CG    . GLU A 1 59   ? -34.806 -59.246  19.641  1.00 5.20  ? 60   GLU A CG    1 
ATOM   439   C  CD    . GLU A 1 59   ? -34.638 -60.287  18.556  1.00 4.74  ? 60   GLU A CD    1 
ATOM   440   O  OE1   . GLU A 1 59   ? -34.832 -59.951  17.377  1.00 4.56  ? 60   GLU A OE1   1 
ATOM   441   O  OE2   . GLU A 1 59   ? -34.314 -61.444  18.876  1.00 5.08  ? 60   GLU A OE2   1 
ATOM   442   N  N     . MET A 1 60   ? -34.128 -56.476  21.537  1.00 5.72  ? 61   MET A N     1 
ATOM   443   C  CA    . MET A 1 60   ? -32.906 -55.697  21.628  1.00 4.24  ? 61   MET A CA    1 
ATOM   444   C  C     . MET A 1 60   ? -31.686 -56.422  21.027  1.00 3.80  ? 61   MET A C     1 
ATOM   445   O  O     . MET A 1 60   ? -31.801 -57.549  20.542  1.00 3.27  ? 61   MET A O     1 
ATOM   446   C  CB    . MET A 1 60   ? -32.662 -55.273  23.066  1.00 3.71  ? 61   MET A CB    1 
ATOM   447   C  CG    . MET A 1 60   ? -33.760 -54.402  23.595  1.00 3.33  ? 61   MET A CG    1 
ATOM   448   S  SD    . MET A 1 60   ? -34.302 -53.164  22.414  1.00 4.02  ? 61   MET A SD    1 
ATOM   449   C  CE    . MET A 1 60   ? -33.067 -51.800  22.601  1.00 2.18  ? 61   MET A CE    1 
ATOM   450   N  N     . GLN A 1 61   ? -30.541 -55.737  21.031  1.00 3.17  ? 62   GLN A N     1 
ATOM   451   C  CA    . GLN A 1 61   ? -29.289 -56.232  20.466  1.00 2.64  ? 62   GLN A CA    1 
ATOM   452   C  C     . GLN A 1 61   ? -28.548 -57.167  21.364  1.00 2.75  ? 62   GLN A C     1 
ATOM   453   O  O     . GLN A 1 61   ? -27.601 -57.822  20.937  1.00 2.52  ? 62   GLN A O     1 
ATOM   454   C  CB    . GLN A 1 61   ? -28.357 -55.080  20.136  1.00 2.30  ? 62   GLN A CB    1 
ATOM   455   C  CG    . GLN A 1 61   ? -27.508 -54.603  21.304  1.00 2.21  ? 62   GLN A CG    1 
ATOM   456   C  CD    . GLN A 1 61   ? -28.244 -53.703  22.267  1.00 2.00  ? 62   GLN A CD    1 
ATOM   457   O  OE1   . GLN A 1 61   ? -29.453 -53.750  22.377  1.00 2.19  ? 62   GLN A OE1   1 
ATOM   458   N  NE2   . GLN A 1 61   ? -27.509 -52.866  22.957  1.00 2.00  ? 62   GLN A NE2   1 
ATOM   459   N  N     . SER A 1 62   ? -28.926 -57.112  22.636  1.00 3.06  ? 63   SER A N     1 
ATOM   460   C  CA    . SER A 1 62   ? -28.356 -57.917  23.712  1.00 3.10  ? 63   SER A CA    1 
ATOM   461   C  C     . SER A 1 62   ? -29.293 -57.711  24.906  1.00 3.24  ? 63   SER A C     1 
ATOM   462   O  O     . SER A 1 62   ? -30.130 -56.799  24.916  1.00 2.86  ? 63   SER A O     1 
ATOM   463   C  CB    . SER A 1 62   ? -26.955 -57.416  24.076  1.00 3.12  ? 63   SER A CB    1 
ATOM   464   O  OG    . SER A 1 62   ? -27.024 -56.366  25.020  1.00 2.63  ? 63   SER A OG    1 
ATOM   465   N  N     . GLU A 1 63   ? -29.124 -58.523  25.937  1.00 3.23  ? 64   GLU A N     1 
ATOM   466   C  CA    . GLU A 1 63   ? -29.995 -58.411  27.081  1.00 4.06  ? 64   GLU A CA    1 
ATOM   467   C  C     . GLU A 1 63   ? -29.613 -57.301  28.027  1.00 4.37  ? 64   GLU A C     1 
ATOM   468   O  O     . GLU A 1 63   ? -30.284 -57.038  29.035  1.00 5.02  ? 64   GLU A O     1 
ATOM   469   C  CB    . GLU A 1 63   ? -30.113 -59.728  27.804  1.00 4.84  ? 64   GLU A CB    1 
ATOM   470   C  CG    . GLU A 1 63   ? -28.825 -60.397  27.932  1.00 6.13  ? 64   GLU A CG    1 
ATOM   471   C  CD    . GLU A 1 63   ? -28.672 -61.543  26.970  1.00 6.97  ? 64   GLU A CD    1 
ATOM   472   O  OE1   . GLU A 1 63   ? -29.574 -62.406  26.886  1.00 7.35  ? 64   GLU A OE1   1 
ATOM   473   O  OE2   . GLU A 1 63   ? -27.616 -61.632  26.338  1.00 8.75  ? 64   GLU A OE2   1 
ATOM   474   N  N     . ALA A 1 64   ? -28.532 -56.626  27.705  1.00 4.34  ? 65   ALA A N     1 
ATOM   475   C  CA    . ALA A 1 64   ? -28.129 -55.516  28.522  1.00 3.88  ? 65   ALA A CA    1 
ATOM   476   C  C     . ALA A 1 64   ? -28.946 -54.393  27.918  1.00 4.06  ? 65   ALA A C     1 
ATOM   477   O  O     . ALA A 1 64   ? -29.506 -53.574  28.627  1.00 4.00  ? 65   ALA A O     1 
ATOM   478   C  CB    . ALA A 1 64   ? -26.700 -55.279  28.360  1.00 4.22  ? 65   ALA A CB    1 
ATOM   479   N  N     . GLY A 1 65   ? -29.055 -54.407  26.590  1.00 3.83  ? 66   GLY A N     1 
ATOM   480   C  CA    . GLY A 1 65   ? -29.870 -53.435  25.894  1.00 2.74  ? 66   GLY A CA    1 
ATOM   481   C  C     . GLY A 1 65   ? -31.282 -53.653  26.415  1.00 2.23  ? 66   GLY A C     1 
ATOM   482   O  O     . GLY A 1 65   ? -31.902 -52.701  26.833  1.00 2.45  ? 66   GLY A O     1 
ATOM   483   N  N     . ALA A 1 66   ? -31.766 -54.897  26.441  1.00 2.00  ? 67   ALA A N     1 
ATOM   484   C  CA    . ALA A 1 66   ? -33.094 -55.212  26.977  1.00 2.00  ? 67   ALA A CA    1 
ATOM   485   C  C     . ALA A 1 66   ? -33.248 -54.755  28.435  1.00 2.13  ? 67   ALA A C     1 
ATOM   486   O  O     . ALA A 1 66   ? -34.330 -54.339  28.860  1.00 2.00  ? 67   ALA A O     1 
ATOM   487   C  CB    . ALA A 1 66   ? -33.367 -56.695  26.873  1.00 2.00  ? 67   ALA A CB    1 
ATOM   488   N  N     . ALA A 1 67   ? -32.172 -54.842  29.212  1.00 2.26  ? 68   ALA A N     1 
ATOM   489   C  CA    . ALA A 1 67   ? -32.232 -54.423  30.606  1.00 2.46  ? 68   ALA A CA    1 
ATOM   490   C  C     . ALA A 1 67   ? -32.456 -52.938  30.651  1.00 2.66  ? 68   ALA A C     1 
ATOM   491   O  O     . ALA A 1 67   ? -33.270 -52.453  31.414  1.00 3.65  ? 68   ALA A O     1 
ATOM   492   C  CB    . ALA A 1 67   ? -30.970 -54.744  31.298  1.00 2.42  ? 68   ALA A CB    1 
ATOM   493   N  N     . GLY A 1 68   ? -31.737 -52.212  29.812  1.00 2.44  ? 69   GLY A N     1 
ATOM   494   C  CA    . GLY A 1 68   ? -31.888 -50.774  29.776  1.00 2.29  ? 69   GLY A CA    1 
ATOM   495   C  C     . GLY A 1 68   ? -33.220 -50.319  29.213  1.00 2.14  ? 69   GLY A C     1 
ATOM   496   O  O     . GLY A 1 68   ? -33.738 -49.281  29.611  1.00 2.30  ? 69   GLY A O     1 
ATOM   497   N  N     . ALA A 1 69   ? -33.773 -51.089  28.285  1.00 2.00  ? 70   ALA A N     1 
ATOM   498   C  CA    . ALA A 1 69   ? -35.036 -50.743  27.681  1.00 2.00  ? 70   ALA A CA    1 
ATOM   499   C  C     . ALA A 1 69   ? -36.077 -50.953  28.739  1.00 2.23  ? 70   ALA A C     1 
ATOM   500   O  O     . ALA A 1 69   ? -36.957 -50.116  28.913  1.00 2.33  ? 70   ALA A O     1 
ATOM   501   C  CB    . ALA A 1 69   ? -35.299 -51.603  26.531  1.00 2.00  ? 70   ALA A CB    1 
ATOM   502   N  N     . VAL A 1 70   ? -35.959 -52.061  29.472  1.00 2.76  ? 71   VAL A N     1 
ATOM   503   C  CA    . VAL A 1 70   ? -36.887 -52.358  30.562  1.00 3.04  ? 71   VAL A CA    1 
ATOM   504   C  C     . VAL A 1 70   ? -36.832 -51.221  31.578  1.00 3.56  ? 71   VAL A C     1 
ATOM   505   O  O     . VAL A 1 70   ? -37.860 -50.796  32.092  1.00 4.57  ? 71   VAL A O     1 
ATOM   506   C  CB    . VAL A 1 70   ? -36.566 -53.689  31.246  1.00 2.83  ? 71   VAL A CB    1 
ATOM   507   C  CG1   . VAL A 1 70   ? -37.270 -53.791  32.555  1.00 2.51  ? 71   VAL A CG1   1 
ATOM   508   C  CG2   . VAL A 1 70   ? -37.036 -54.830  30.386  1.00 3.12  ? 71   VAL A CG2   1 
ATOM   509   N  N     . HIS A 1 71   ? -35.644 -50.684  31.820  1.00 3.68  ? 72   HIS A N     1 
ATOM   510   C  CA    . HIS A 1 71   ? -35.506 -49.577  32.764  1.00 3.76  ? 72   HIS A CA    1 
ATOM   511   C  C     . HIS A 1 71   ? -36.207 -48.287  32.289  1.00 3.87  ? 72   HIS A C     1 
ATOM   512   O  O     . HIS A 1 71   ? -36.979 -47.689  33.033  1.00 4.42  ? 72   HIS A O     1 
ATOM   513   C  CB    . HIS A 1 71   ? -34.028 -49.325  33.050  1.00 3.17  ? 72   HIS A CB    1 
ATOM   514   C  CG    . HIS A 1 71   ? -33.779 -48.176  33.975  1.00 2.80  ? 72   HIS A CG    1 
ATOM   515   N  ND1   . HIS A 1 71   ? -32.595 -47.475  33.976  1.00 2.00  ? 72   HIS A ND1   1 
ATOM   516   C  CD2   . HIS A 1 71   ? -34.562 -47.595  34.911  1.00 2.16  ? 72   HIS A CD2   1 
ATOM   517   C  CE1   . HIS A 1 71   ? -32.665 -46.503  34.866  1.00 2.00  ? 72   HIS A CE1   1 
ATOM   518   N  NE2   . HIS A 1 71   ? -33.847 -46.551  35.448  1.00 2.00  ? 72   HIS A NE2   1 
ATOM   519   N  N     . GLY A 1 72   ? -35.925 -47.851  31.065  1.00 4.20  ? 73   GLY A N     1 
ATOM   520   C  CA    . GLY A 1 72   ? -36.554 -46.648  30.536  1.00 4.22  ? 73   GLY A CA    1 
ATOM   521   C  C     . GLY A 1 72   ? -38.073 -46.701  30.447  1.00 4.48  ? 73   GLY A C     1 
ATOM   522   O  O     . GLY A 1 72   ? -38.738 -45.697  30.628  1.00 4.33  ? 73   GLY A O     1 
ATOM   523   N  N     . ALA A 1 73   ? -38.621 -47.883  30.193  1.00 4.66  ? 74   ALA A N     1 
ATOM   524   C  CA    . ALA A 1 73   ? -40.070 -48.065  30.086  1.00 4.28  ? 74   ALA A CA    1 
ATOM   525   C  C     . ALA A 1 73   ? -40.725 -47.807  31.424  1.00 3.81  ? 74   ALA A C     1 
ATOM   526   O  O     . ALA A 1 73   ? -41.620 -46.977  31.510  1.00 4.55  ? 74   ALA A O     1 
ATOM   527   C  CB    . ALA A 1 73   ? -40.396 -49.473  29.604  1.00 4.55  ? 74   ALA A CB    1 
ATOM   528   N  N     . LEU A 1 74   ? -40.272 -48.519  32.457  1.00 3.33  ? 75   LEU A N     1 
ATOM   529   C  CA    . LEU A 1 74   ? -40.784 -48.374  33.832  1.00 2.92  ? 75   LEU A CA    1 
ATOM   530   C  C     . LEU A 1 74   ? -40.680 -46.931  34.298  1.00 3.17  ? 75   LEU A C     1 
ATOM   531   O  O     . LEU A 1 74   ? -41.590 -46.373  34.917  1.00 3.04  ? 75   LEU A O     1 
ATOM   532   C  CB    . LEU A 1 74   ? -39.964 -49.242  34.781  1.00 2.34  ? 75   LEU A CB    1 
ATOM   533   C  CG    . LEU A 1 74   ? -40.311 -50.712  34.726  1.00 2.00  ? 75   LEU A CG    1 
ATOM   534   C  CD1   . LEU A 1 74   ? -39.232 -51.537  35.371  1.00 2.00  ? 75   LEU A CD1   1 
ATOM   535   C  CD2   . LEU A 1 74   ? -41.665 -50.896  35.370  1.00 2.00  ? 75   LEU A CD2   1 
ATOM   536   N  N     . ALA A 1 75   ? -39.519 -46.350  34.046  1.00 3.20  ? 76   ALA A N     1 
ATOM   537   C  CA    . ALA A 1 75   ? -39.290 -44.979  34.398  1.00 2.92  ? 76   ALA A CA    1 
ATOM   538   C  C     . ALA A 1 75   ? -40.429 -44.204  33.738  1.00 2.93  ? 76   ALA A C     1 
ATOM   539   O  O     . ALA A 1 75   ? -41.185 -43.528  34.415  1.00 3.22  ? 76   ALA A O     1 
ATOM   540   C  CB    . ALA A 1 75   ? -37.946 -44.541  33.862  1.00 2.71  ? 76   ALA A CB    1 
ATOM   541   N  N     . ALA A 1 76   ? -40.651 -44.452  32.448  1.00 2.94  ? 77   ALA A N     1 
ATOM   542   C  CA    . ALA A 1 76   ? -41.688 -43.771  31.687  1.00 2.56  ? 77   ALA A CA    1 
ATOM   543   C  C     . ALA A 1 76   ? -43.131 -44.178  31.968  1.00 3.15  ? 77   ALA A C     1 
ATOM   544   O  O     . ALA A 1 76   ? -44.008 -43.936  31.140  1.00 4.16  ? 77   ALA A O     1 
ATOM   545   C  CB    . ALA A 1 76   ? -41.409 -43.887  30.234  1.00 2.00  ? 77   ALA A CB    1 
ATOM   546   N  N     . GLY A 1 77   ? -43.399 -44.807  33.108  1.00 3.09  ? 78   GLY A N     1 
ATOM   547   C  CA    . GLY A 1 77   ? -44.766 -45.177  33.411  1.00 2.53  ? 78   GLY A CA    1 
ATOM   548   C  C     . GLY A 1 77   ? -45.343 -46.514  32.992  1.00 3.18  ? 78   GLY A C     1 
ATOM   549   O  O     . GLY A 1 77   ? -46.379 -46.885  33.535  1.00 4.13  ? 78   GLY A O     1 
ATOM   550   N  N     . ALA A 1 78   ? -44.776 -47.240  32.033  1.00 2.87  ? 79   ALA A N     1 
ATOM   551   C  CA    . ALA A 1 78   ? -45.390 -48.527  31.671  1.00 3.21  ? 79   ALA A CA    1 
ATOM   552   C  C     . ALA A 1 78   ? -44.965 -49.673  32.606  1.00 3.66  ? 79   ALA A C     1 
ATOM   553   O  O     . ALA A 1 78   ? -43.895 -49.596  33.187  1.00 5.31  ? 79   ALA A O     1 
ATOM   554   C  CB    . ALA A 1 78   ? -45.052 -48.868  30.255  1.00 2.52  ? 79   ALA A CB    1 
ATOM   555   N  N     . LEU A 1 79   ? -45.827 -50.663  32.862  1.00 3.18  ? 80   LEU A N     1 
ATOM   556   C  CA    . LEU A 1 79   ? -45.428 -51.813  33.693  1.00 2.92  ? 80   LEU A CA    1 
ATOM   557   C  C     . LEU A 1 79   ? -44.628 -52.676  32.691  1.00 2.85  ? 80   LEU A C     1 
ATOM   558   O  O     . LEU A 1 79   ? -45.087 -52.873  31.568  1.00 2.88  ? 80   LEU A O     1 
ATOM   559   C  CB    . LEU A 1 79   ? -46.641 -52.588  34.251  1.00 2.22  ? 80   LEU A CB    1 
ATOM   560   C  CG    . LEU A 1 79   ? -47.627 -51.963  35.243  1.00 2.00  ? 80   LEU A CG    1 
ATOM   561   C  CD1   . LEU A 1 79   ? -48.820 -52.875  35.388  1.00 2.00  ? 80   LEU A CD1   1 
ATOM   562   C  CD2   . LEU A 1 79   ? -46.989 -51.694  36.603  1.00 2.00  ? 80   LEU A CD2   1 
ATOM   563   N  N     . THR A 1 80   ? -43.497 -53.258  33.090  1.00 2.61  ? 81   THR A N     1 
ATOM   564   C  CA    . THR A 1 80   ? -42.676 -53.992  32.119  1.00 2.17  ? 81   THR A CA    1 
ATOM   565   C  C     . THR A 1 80   ? -42.131 -55.339  32.577  1.00 2.00  ? 81   THR A C     1 
ATOM   566   O  O     . THR A 1 80   ? -42.094 -55.597  33.760  1.00 2.00  ? 81   THR A O     1 
ATOM   567   C  CB    . THR A 1 80   ? -41.470 -53.100  31.731  1.00 2.13  ? 81   THR A CB    1 
ATOM   568   O  OG1   . THR A 1 80   ? -41.942 -51.817  31.311  1.00 2.00  ? 81   THR A OG1   1 
ATOM   569   C  CG2   . THR A 1 80   ? -40.680 -53.702  30.613  1.00 2.24  ? 81   THR A CG2   1 
ATOM   570   N  N     . THR A 1 81   ? -41.708 -56.184  31.631  1.00 2.00  ? 82   THR A N     1 
ATOM   571   C  CA    . THR A 1 81   ? -41.120 -57.501  31.941  1.00 2.16  ? 82   THR A CA    1 
ATOM   572   C  C     . THR A 1 81   ? -39.990 -57.867  31.016  1.00 2.73  ? 82   THR A C     1 
ATOM   573   O  O     . THR A 1 81   ? -39.754 -57.204  30.003  1.00 3.72  ? 82   THR A O     1 
ATOM   574   C  CB    . THR A 1 81   ? -42.032 -58.663  31.687  1.00 2.00  ? 82   THR A CB    1 
ATOM   575   O  OG1   . THR A 1 81   ? -43.390 -58.248  31.741  1.00 2.55  ? 82   THR A OG1   1 
ATOM   576   C  CG2   . THR A 1 81   ? -41.790 -59.710  32.728  1.00 2.00  ? 82   THR A CG2   1 
ATOM   577   N  N     . THR A 1 82   ? -39.362 -58.995  31.323  1.00 2.00  ? 83   THR A N     1 
ATOM   578   C  CA    . THR A 1 82   ? -38.300 -59.508  30.521  1.00 2.00  ? 83   THR A CA    1 
ATOM   579   C  C     . THR A 1 82   ? -38.032 -60.917  30.974  1.00 2.00  ? 83   THR A C     1 
ATOM   580   O  O     . THR A 1 82   ? -38.252 -61.277  32.107  1.00 2.00  ? 83   THR A O     1 
ATOM   581   C  CB    . THR A 1 82   ? -37.046 -58.662  30.612  1.00 2.00  ? 83   THR A CB    1 
ATOM   582   O  OG1   . THR A 1 82   ? -36.180 -58.986  29.525  1.00 2.00  ? 83   THR A OG1   1 
ATOM   583   C  CG2   . THR A 1 82   ? -36.324 -58.955  31.875  1.00 2.74  ? 83   THR A CG2   1 
ATOM   584   N  N     . PHE A 1 83   ? -37.536 -61.719  30.064  1.00 2.34  ? 84   PHE A N     1 
ATOM   585   C  CA    . PHE A 1 83   ? -37.273 -63.102  30.352  1.00 2.34  ? 84   PHE A CA    1 
ATOM   586   C  C     . PHE A 1 83   ? -35.803 -63.265  30.095  1.00 2.00  ? 84   PHE A C     1 
ATOM   587   O  O     . PHE A 1 83   ? -35.315 -62.744  29.102  1.00 2.00  ? 84   PHE A O     1 
ATOM   588   C  CB    . PHE A 1 83   ? -38.106 -63.943  29.380  1.00 2.77  ? 84   PHE A CB    1 
ATOM   589   C  CG    . PHE A 1 83   ? -39.548 -63.479  29.259  1.00 3.37  ? 84   PHE A CG    1 
ATOM   590   C  CD1   . PHE A 1 83   ? -40.511 -63.908  30.182  1.00 3.49  ? 84   PHE A CD1   1 
ATOM   591   C  CD2   . PHE A 1 83   ? -39.930 -62.592  28.265  1.00 2.39  ? 84   PHE A CD2   1 
ATOM   592   C  CE1   . PHE A 1 83   ? -41.826 -63.461  30.125  1.00 2.82  ? 84   PHE A CE1   1 
ATOM   593   C  CE2   . PHE A 1 83   ? -41.242 -62.144  28.201  1.00 3.28  ? 84   PHE A CE2   1 
ATOM   594   C  CZ    . PHE A 1 83   ? -42.199 -62.582  29.142  1.00 2.71  ? 84   PHE A CZ    1 
ATOM   595   N  N     . THR A 1 84   ? -35.099 -63.978  30.972  1.00 2.00  ? 85   THR A N     1 
ATOM   596   C  CA    . THR A 1 84   ? -33.662 -64.166  30.798  1.00 2.17  ? 85   THR A CA    1 
ATOM   597   C  C     . THR A 1 84   ? -33.079 -65.335  31.614  1.00 2.36  ? 85   THR A C     1 
ATOM   598   O  O     . THR A 1 84   ? -33.785 -65.956  32.386  1.00 2.26  ? 85   THR A O     1 
ATOM   599   C  CB    . THR A 1 84   ? -32.930 -62.861  31.154  1.00 2.33  ? 85   THR A CB    1 
ATOM   600   O  OG1   . THR A 1 84   ? -31.635 -62.861  30.549  1.00 2.95  ? 85   THR A OG1   1 
ATOM   601   C  CG2   . THR A 1 84   ? -32.808 -62.705  32.657  1.00 2.00  ? 85   THR A CG2   1 
ATOM   602   N  N     . ALA A 1 85   ? -31.807 -65.664  31.400  1.00 2.25  ? 86   ALA A N     1 
ATOM   603   C  CA    . ALA A 1 85   ? -31.153 -66.747  32.148  1.00 2.73  ? 86   ALA A CA    1 
ATOM   604   C  C     . ALA A 1 85   ? -29.639 -66.524  32.194  1.00 3.10  ? 86   ALA A C     1 
ATOM   605   O  O     . ALA A 1 85   ? -29.134 -65.624  31.538  1.00 3.86  ? 86   ALA A O     1 
ATOM   606   C  CB    . ALA A 1 85   ? -31.470 -68.089  31.534  1.00 3.05  ? 86   ALA A CB    1 
ATOM   607   N  N     . SER A 1 86   ? -28.916 -67.375  32.912  1.00 2.56  ? 87   SER A N     1 
ATOM   608   C  CA    . SER A 1 86   ? -27.474 -67.252  33.098  1.00 2.12  ? 87   SER A CA    1 
ATOM   609   C  C     . SER A 1 86   ? -26.761 -66.007  32.619  1.00 2.00  ? 87   SER A C     1 
ATOM   610   O  O     . SER A 1 86   ? -26.892 -64.979  33.260  1.00 2.00  ? 87   SER A O     1 
ATOM   611   C  CB    . SER A 1 86   ? -26.734 -68.501  32.647  1.00 2.49  ? 87   SER A CB    1 
ATOM   612   O  OG    . SER A 1 86   ? -26.780 -68.645  31.257  1.00 2.67  ? 87   SER A OG    1 
ATOM   613   N  N     . GLN A 1 87   ? -26.027 -66.060  31.506  1.00 2.23  ? 88   GLN A N     1 
ATOM   614   C  CA    . GLN A 1 87   ? -25.283 -64.869  31.071  1.00 3.30  ? 88   GLN A CA    1 
ATOM   615   C  C     . GLN A 1 87   ? -26.183 -63.673  30.777  1.00 3.15  ? 88   GLN A C     1 
ATOM   616   O  O     . GLN A 1 87   ? -25.829 -62.520  31.058  1.00 3.78  ? 88   GLN A O     1 
ATOM   617   C  CB    . GLN A 1 87   ? -24.352 -65.115  29.864  1.00 4.36  ? 88   GLN A CB    1 
ATOM   618   C  CG    . GLN A 1 87   ? -23.824 -66.555  29.594  1.00 6.22  ? 88   GLN A CG    1 
ATOM   619   C  CD    . GLN A 1 87   ? -23.004 -67.171  30.724  1.00 6.86  ? 88   GLN A CD    1 
ATOM   620   O  OE1   . GLN A 1 87   ? -23.177 -68.346  31.055  1.00 7.20  ? 88   GLN A OE1   1 
ATOM   621   N  NE2   . GLN A 1 87   ? -22.110 -66.389  31.312  1.00 7.58  ? 88   GLN A NE2   1 
ATOM   622   N  N     . GLY A 1 88   ? -27.358 -63.939  30.231  1.00 2.60  ? 89   GLY A N     1 
ATOM   623   C  CA    . GLY A 1 88   ? -28.278 -62.872  29.927  1.00 2.00  ? 89   GLY A CA    1 
ATOM   624   C  C     . GLY A 1 88   ? -28.560 -62.130  31.191  1.00 2.00  ? 89   GLY A C     1 
ATOM   625   O  O     . GLY A 1 88   ? -28.508 -60.919  31.228  1.00 2.00  ? 89   GLY A O     1 
ATOM   626   N  N     . LEU A 1 89   ? -28.773 -62.869  32.260  1.00 2.00  ? 90   LEU A N     1 
ATOM   627   C  CA    . LEU A 1 89   ? -29.062 -62.250  33.528  1.00 2.00  ? 90   LEU A CA    1 
ATOM   628   C  C     . LEU A 1 89   ? -27.907 -61.426  34.017  1.00 2.04  ? 90   LEU A C     1 
ATOM   629   O  O     . LEU A 1 89   ? -28.107 -60.284  34.404  1.00 2.00  ? 90   LEU A O     1 
ATOM   630   C  CB    . LEU A 1 89   ? -29.410 -63.285  34.544  1.00 2.00  ? 90   LEU A CB    1 
ATOM   631   C  CG    . LEU A 1 89   ? -29.897 -62.671  35.815  1.00 2.00  ? 90   LEU A CG    1 
ATOM   632   C  CD1   . LEU A 1 89   ? -31.221 -62.011  35.645  1.00 2.00  ? 90   LEU A CD1   1 
ATOM   633   C  CD2   . LEU A 1 89   ? -30.027 -63.805  36.727  1.00 2.63  ? 90   LEU A CD2   1 
ATOM   634   N  N     . LEU A 1 90   ? -26.698 -61.984  33.986  1.00 2.23  ? 91   LEU A N     1 
ATOM   635   C  CA    . LEU A 1 90   ? -25.510 -61.248  34.419  1.00 2.43  ? 91   LEU A CA    1 
ATOM   636   C  C     . LEU A 1 90   ? -25.426 -59.894  33.722  1.00 2.95  ? 91   LEU A C     1 
ATOM   637   O  O     . LEU A 1 90   ? -25.069 -58.892  34.346  1.00 4.18  ? 91   LEU A O     1 
ATOM   638   C  CB    . LEU A 1 90   ? -24.234 -62.034  34.133  1.00 2.14  ? 91   LEU A CB    1 
ATOM   639   C  CG    . LEU A 1 90   ? -23.967 -63.218  35.062  1.00 2.36  ? 91   LEU A CG    1 
ATOM   640   C  CD1   . LEU A 1 90   ? -22.743 -63.964  34.596  1.00 2.00  ? 91   LEU A CD1   1 
ATOM   641   C  CD2   . LEU A 1 90   ? -23.786 -62.737  36.477  1.00 2.00  ? 91   LEU A CD2   1 
ATOM   642   N  N     . LEU A 1 91   ? -25.775 -59.846  32.440  1.00 2.70  ? 92   LEU A N     1 
ATOM   643   C  CA    . LEU A 1 91   ? -25.740 -58.582  31.710  1.00 2.10  ? 92   LEU A CA    1 
ATOM   644   C  C     . LEU A 1 91   ? -26.789 -57.606  32.165  1.00 2.00  ? 92   LEU A C     1 
ATOM   645   O  O     . LEU A 1 91   ? -26.721 -56.431  31.840  1.00 2.00  ? 92   LEU A O     1 
ATOM   646   C  CB    . LEU A 1 91   ? -25.901 -58.788  30.208  1.00 2.00  ? 92   LEU A CB    1 
ATOM   647   C  CG    . LEU A 1 91   ? -24.814 -59.594  29.513  1.00 2.00  ? 92   LEU A CG    1 
ATOM   648   C  CD1   . LEU A 1 91   ? -24.793 -59.240  28.062  1.00 2.00  ? 92   LEU A CD1   1 
ATOM   649   C  CD2   . LEU A 1 91   ? -23.488 -59.244  30.115  1.00 2.36  ? 92   LEU A CD2   1 
ATOM   650   N  N     . MET A 1 92   ? -27.795 -58.080  32.878  1.00 2.00  ? 93   MET A N     1 
ATOM   651   C  CA    . MET A 1 92   ? -28.823 -57.171  33.332  1.00 2.03  ? 93   MET A CA    1 
ATOM   652   C  C     . MET A 1 92   ? -28.563 -56.656  34.721  1.00 2.40  ? 93   MET A C     1 
ATOM   653   O  O     . MET A 1 92   ? -29.331 -55.855  35.234  1.00 2.93  ? 93   MET A O     1 
ATOM   654   C  CB    . MET A 1 92   ? -30.193 -57.824  33.257  1.00 2.00  ? 93   MET A CB    1 
ATOM   655   C  CG    . MET A 1 92   ? -30.685 -58.014  31.851  1.00 2.00  ? 93   MET A CG    1 
ATOM   656   S  SD    . MET A 1 92   ? -32.244 -58.845  31.826  1.00 2.00  ? 93   MET A SD    1 
ATOM   657   C  CE    . MET A 1 92   ? -32.766 -58.635  30.075  1.00 2.37  ? 93   MET A CE    1 
ATOM   658   N  N     . ILE A 1 93   ? -27.474 -57.102  35.339  1.00 2.55  ? 94   ILE A N     1 
ATOM   659   C  CA    . ILE A 1 93   ? -27.143 -56.675  36.694  1.00 2.18  ? 94   ILE A CA    1 
ATOM   660   C  C     . ILE A 1 93   ? -26.967 -55.153  36.883  1.00 2.07  ? 94   ILE A C     1 
ATOM   661   O  O     . ILE A 1 93   ? -27.622 -54.574  37.732  1.00 2.00  ? 94   ILE A O     1 
ATOM   662   C  CB    . ILE A 1 93   ? -25.982 -57.542  37.296  1.00 2.00  ? 94   ILE A CB    1 
ATOM   663   C  CG1   . ILE A 1 93   ? -26.486 -58.991  37.419  1.00 2.00  ? 94   ILE A CG1   1 
ATOM   664   C  CG2   . ILE A 1 93   ? -25.523 -57.008  38.639  1.00 2.00  ? 94   ILE A CG2   1 
ATOM   665   C  CD1   . ILE A 1 93   ? -25.668 -59.905  38.313  1.00 2.72  ? 94   ILE A CD1   1 
ATOM   666   N  N     . PRO A 1 94   ? -26.170 -54.472  36.043  1.00 2.00  ? 95   PRO A N     1 
ATOM   667   C  CA    . PRO A 1 94   ? -26.053 -53.043  36.279  1.00 2.31  ? 95   PRO A CA    1 
ATOM   668   C  C     . PRO A 1 94   ? -27.368 -52.326  36.351  1.00 3.16  ? 95   PRO A C     1 
ATOM   669   O  O     . PRO A 1 94   ? -27.561 -51.559  37.292  1.00 4.42  ? 95   PRO A O     1 
ATOM   670   C  CB    . PRO A 1 94   ? -25.206 -52.584  35.118  1.00 2.00  ? 95   PRO A CB    1 
ATOM   671   C  CG    . PRO A 1 94   ? -24.264 -53.686  35.008  1.00 2.00  ? 95   PRO A CG    1 
ATOM   672   C  CD    . PRO A 1 94   ? -25.193 -54.880  35.027  1.00 2.25  ? 95   PRO A CD    1 
ATOM   673   N  N     . ASN A 1 95   ? -28.285 -52.600  35.420  1.00 3.33  ? 96   ASN A N     1 
ATOM   674   C  CA    . ASN A 1 95   ? -29.610 -51.955  35.417  1.00 3.59  ? 96   ASN A CA    1 
ATOM   675   C  C     . ASN A 1 95   ? -30.441 -52.324  36.606  1.00 3.61  ? 96   ASN A C     1 
ATOM   676   O  O     . ASN A 1 95   ? -31.021 -51.453  37.232  1.00 4.30  ? 96   ASN A O     1 
ATOM   677   C  CB    . ASN A 1 95   ? -30.397 -52.272  34.163  1.00 4.62  ? 96   ASN A CB    1 
ATOM   678   C  CG    . ASN A 1 95   ? -29.979 -51.413  33.015  1.00 6.37  ? 96   ASN A CG    1 
ATOM   679   O  OD1   . ASN A 1 95   ? -30.238 -50.210  33.009  1.00 7.27  ? 96   ASN A OD1   1 
ATOM   680   N  ND2   . ASN A 1 95   ? -29.267 -52.000  32.060  1.00 7.45  ? 96   ASN A ND2   1 
ATOM   681   N  N     . MET A 1 96   ? -30.516 -53.618  36.895  1.00 2.73  ? 97   MET A N     1 
ATOM   682   C  CA    . MET A 1 96   ? -31.246 -54.109  38.039  1.00 2.23  ? 97   MET A CA    1 
ATOM   683   C  C     . MET A 1 96   ? -30.993 -53.238  39.256  1.00 2.19  ? 97   MET A C     1 
ATOM   684   O  O     . MET A 1 96   ? -31.921 -52.927  39.972  1.00 3.30  ? 97   MET A O     1 
ATOM   685   C  CB    . MET A 1 96   ? -30.867 -55.557  38.321  1.00 2.33  ? 97   MET A CB    1 
ATOM   686   C  CG    . MET A 1 96   ? -31.411 -56.532  37.273  1.00 2.79  ? 97   MET A CG    1 
ATOM   687   S  SD    . MET A 1 96   ? -30.950 -58.269  37.492  1.00 2.12  ? 97   MET A SD    1 
ATOM   688   C  CE    . MET A 1 96   ? -31.551 -58.577  39.108  1.00 2.98  ? 97   MET A CE    1 
ATOM   689   N  N     . TYR A 1 97   ? -29.766 -52.783  39.471  1.00 2.01  ? 98   TYR A N     1 
ATOM   690   C  CA    . TYR A 1 97   ? -29.476 -51.894  40.616  1.00 2.35  ? 98   TYR A CA    1 
ATOM   691   C  C     . TYR A 1 97   ? -30.240 -50.567  40.450  1.00 2.54  ? 98   TYR A C     1 
ATOM   692   O  O     . TYR A 1 97   ? -30.724 -49.990  41.419  1.00 2.98  ? 98   TYR A O     1 
ATOM   693   C  CB    . TYR A 1 97   ? -27.982 -51.539  40.695  1.00 2.05  ? 98   TYR A CB    1 
ATOM   694   C  CG    . TYR A 1 97   ? -27.073 -52.613  41.233  1.00 2.00  ? 98   TYR A CG    1 
ATOM   695   C  CD1   . TYR A 1 97   ? -26.833 -52.717  42.593  1.00 2.00  ? 98   TYR A CD1   1 
ATOM   696   C  CD2   . TYR A 1 97   ? -26.408 -53.478  40.386  1.00 2.00  ? 98   TYR A CD2   1 
ATOM   697   C  CE1   . TYR A 1 97   ? -25.955 -53.649  43.100  1.00 2.00  ? 98   TYR A CE1   1 
ATOM   698   C  CE2   . TYR A 1 97   ? -25.530 -54.415  40.878  1.00 2.21  ? 98   TYR A CE2   1 
ATOM   699   C  CZ    . TYR A 1 97   ? -25.306 -54.502  42.244  1.00 2.37  ? 98   TYR A CZ    1 
ATOM   700   O  OH    . TYR A 1 97   ? -24.489 -55.488  42.769  1.00 2.67  ? 98   TYR A OH    1 
ATOM   701   N  N     . LYS A 1 98   ? -30.278 -50.056  39.226  1.00 2.00  ? 99   LYS A N     1 
ATOM   702   C  CA    . LYS A 1 98   ? -30.962 -48.816  38.962  1.00 2.00  ? 99   LYS A CA    1 
ATOM   703   C  C     . LYS A 1 98   ? -32.458 -49.022  39.074  1.00 2.20  ? 99   LYS A C     1 
ATOM   704   O  O     . LYS A 1 98   ? -33.175 -48.197  39.629  1.00 2.00  ? 99   LYS A O     1 
ATOM   705   C  CB    . LYS A 1 98   ? -30.624 -48.307  37.561  1.00 2.32  ? 99   LYS A CB    1 
ATOM   706   C  CG    . LYS A 1 98   ? -29.250 -47.609  37.407  1.00 2.75  ? 99   LYS A CG    1 
ATOM   707   C  CD    . LYS A 1 98   ? -29.168 -46.376  38.294  1.00 2.42  ? 99   LYS A CD    1 
ATOM   708   C  CE    . LYS A 1 98   ? -28.773 -45.103  37.562  1.00 2.00  ? 99   LYS A CE    1 
ATOM   709   N  NZ    . LYS A 1 98   ? -29.521 -43.959  38.200  1.00 2.00  ? 99   LYS A NZ    1 
ATOM   710   N  N     . ILE A 1 99   ? -32.923 -50.167  38.599  1.00 2.38  ? 100  ILE A N     1 
ATOM   711   C  CA    . ILE A 1 99   ? -34.342 -50.478  38.595  1.00 2.48  ? 100  ILE A CA    1 
ATOM   712   C  C     . ILE A 1 99   ? -34.972 -50.580  39.981  1.00 2.64  ? 100  ILE A C     1 
ATOM   713   O  O     . ILE A 1 99   ? -36.091 -50.126  40.185  1.00 3.13  ? 100  ILE A O     1 
ATOM   714   C  CB    . ILE A 1 99   ? -34.604 -51.736  37.773  1.00 2.60  ? 100  ILE A CB    1 
ATOM   715   C  CG1   . ILE A 1 99   ? -34.253 -51.470  36.313  1.00 2.00  ? 100  ILE A CG1   1 
ATOM   716   C  CG2   . ILE A 1 99   ? -36.065 -52.163  37.901  1.00 2.88  ? 100  ILE A CG2   1 
ATOM   717   C  CD1   . ILE A 1 99   ? -33.938 -52.699  35.572  1.00 2.00  ? 100  ILE A CD1   1 
ATOM   718   N  N     . SER A 1 100  ? -34.280 -51.186  40.930  1.00 2.41  ? 101  SER A N     1 
ATOM   719   C  CA    . SER A 1 100  ? -34.814 -51.282  42.276  1.00 2.34  ? 101  SER A CA    1 
ATOM   720   C  C     . SER A 1 100  ? -34.353 -50.051  43.026  1.00 2.44  ? 101  SER A C     1 
ATOM   721   O  O     . SER A 1 100  ? -34.957 -49.628  44.011  1.00 2.58  ? 101  SER A O     1 
ATOM   722   C  CB    . SER A 1 100  ? -34.269 -52.517  42.951  1.00 2.89  ? 101  SER A CB    1 
ATOM   723   O  OG    . SER A 1 100  ? -32.865 -52.540  42.806  1.00 3.77  ? 101  SER A OG    1 
ATOM   724   N  N     . GLY A 1 101  ? -33.244 -49.499  42.553  1.00 2.65  ? 102  GLY A N     1 
ATOM   725   C  CA    . GLY A 1 101  ? -32.683 -48.312  43.150  1.00 2.00  ? 102  GLY A CA    1 
ATOM   726   C  C     . GLY A 1 101  ? -33.705 -47.219  43.085  1.00 2.00  ? 102  GLY A C     1 
ATOM   727   O  O     . GLY A 1 101  ? -33.921 -46.569  44.083  1.00 2.13  ? 102  GLY A O     1 
ATOM   728   N  N     . GLU A 1 102  ? -34.361 -47.074  41.930  1.00 2.00  ? 103  GLU A N     1 
ATOM   729   C  CA    . GLU A 1 102  ? -35.400 -46.060  41.685  1.00 2.24  ? 103  GLU A CA    1 
ATOM   730   C  C     . GLU A 1 102  ? -36.849 -46.579  41.983  1.00 2.07  ? 103  GLU A C     1 
ATOM   731   O  O     . GLU A 1 102  ? -37.864 -45.978  41.561  1.00 2.00  ? 103  GLU A O     1 
ATOM   732   C  CB    . GLU A 1 102  ? -35.259 -45.507  40.244  1.00 2.00  ? 103  GLU A CB    1 
ATOM   733   C  CG    . GLU A 1 102  ? -33.845 -45.617  39.730  1.00 2.41  ? 103  GLU A CG    1 
ATOM   734   C  CD    . GLU A 1 102  ? -33.426 -44.609  38.662  1.00 3.93  ? 103  GLU A CD    1 
ATOM   735   O  OE1   . GLU A 1 102  ? -34.187 -44.362  37.685  1.00 3.75  ? 103  GLU A OE1   1 
ATOM   736   O  OE2   . GLU A 1 102  ? -32.273 -44.101  38.790  1.00 4.13  ? 103  GLU A OE2   1 
ATOM   737   N  N     . LEU A 1 103  ? -36.918 -47.677  42.737  1.00 2.00  ? 104  LEU A N     1 
ATOM   738   C  CA    . LEU A 1 103  ? -38.178 -48.303  43.133  1.00 2.22  ? 104  LEU A CA    1 
ATOM   739   C  C     . LEU A 1 103  ? -39.200 -48.410  42.017  1.00 2.55  ? 104  LEU A C     1 
ATOM   740   O  O     . LEU A 1 103  ? -40.196 -47.699  42.017  1.00 2.59  ? 104  LEU A O     1 
ATOM   741   C  CB    . LEU A 1 103  ? -38.783 -47.547  44.306  1.00 2.00  ? 104  LEU A CB    1 
ATOM   742   C  CG    . LEU A 1 103  ? -37.834 -47.532  45.497  1.00 2.26  ? 104  LEU A CG    1 
ATOM   743   C  CD1   . LEU A 1 103  ? -38.318 -46.600  46.596  1.00 2.00  ? 104  LEU A CD1   1 
ATOM   744   C  CD2   . LEU A 1 103  ? -37.657 -48.969  46.004  1.00 2.00  ? 104  LEU A CD2   1 
ATOM   745   N  N     . LEU A 1 104  ? -38.948 -49.281  41.051  1.00 2.37  ? 105  LEU A N     1 
ATOM   746   C  CA    . LEU A 1 104  ? -39.873 -49.454  39.936  1.00 2.31  ? 105  LEU A CA    1 
ATOM   747   C  C     . LEU A 1 104  ? -40.386 -50.883  39.990  1.00 2.47  ? 105  LEU A C     1 
ATOM   748   O  O     . LEU A 1 104  ? -39.656 -51.788  40.408  1.00 2.66  ? 105  LEU A O     1 
ATOM   749   C  CB    . LEU A 1 104  ? -39.152 -49.214  38.607  1.00 2.19  ? 105  LEU A CB    1 
ATOM   750   C  CG    . LEU A 1 104  ? -38.396 -47.897  38.521  1.00 2.00  ? 105  LEU A CG    1 
ATOM   751   C  CD1   . LEU A 1 104  ? -37.645 -47.794  37.238  1.00 2.00  ? 105  LEU A CD1   1 
ATOM   752   C  CD2   . LEU A 1 104  ? -39.380 -46.773  38.646  1.00 2.61  ? 105  LEU A CD2   1 
ATOM   753   N  N     . PRO A 1 105  ? -41.663 -51.099  39.618  1.00 2.21  ? 106  PRO A N     1 
ATOM   754   C  CA    . PRO A 1 105  ? -42.293 -52.423  39.620  1.00 2.14  ? 106  PRO A CA    1 
ATOM   755   C  C     . PRO A 1 105  ? -41.893 -53.373  38.469  1.00 2.69  ? 106  PRO A C     1 
ATOM   756   O  O     . PRO A 1 105  ? -42.756 -53.993  37.811  1.00 3.28  ? 106  PRO A O     1 
ATOM   757   C  CB    . PRO A 1 105  ? -43.771 -52.079  39.593  1.00 2.00  ? 106  PRO A CB    1 
ATOM   758   C  CG    . PRO A 1 105  ? -43.809 -50.808  38.814  1.00 2.00  ? 106  PRO A CG    1 
ATOM   759   C  CD    . PRO A 1 105  ? -42.667 -50.040  39.387  1.00 2.00  ? 106  PRO A CD    1 
ATOM   760   N  N     . GLY A 1 106  ? -40.592 -53.524  38.239  1.00 2.16  ? 107  GLY A N     1 
ATOM   761   C  CA    . GLY A 1 106  ? -40.148 -54.394  37.174  1.00 2.00  ? 107  GLY A CA    1 
ATOM   762   C  C     . GLY A 1 106  ? -40.352 -55.808  37.642  1.00 2.68  ? 107  GLY A C     1 
ATOM   763   O  O     . GLY A 1 106  ? -40.564 -56.045  38.826  1.00 3.10  ? 107  GLY A O     1 
ATOM   764   N  N     . VAL A 1 107  ? -40.337 -56.749  36.710  1.00 2.68  ? 108  VAL A N     1 
ATOM   765   C  CA    . VAL A 1 107  ? -40.499 -58.157  37.023  1.00 2.00  ? 108  VAL A CA    1 
ATOM   766   C  C     . VAL A 1 107  ? -39.703 -58.888  35.971  1.00 2.00  ? 108  VAL A C     1 
ATOM   767   O  O     . VAL A 1 107  ? -39.867 -58.642  34.782  1.00 2.00  ? 108  VAL A O     1 
ATOM   768   C  CB    . VAL A 1 107  ? -41.939 -58.580  36.961  1.00 2.00  ? 108  VAL A CB    1 
ATOM   769   C  CG1   . VAL A 1 107  ? -42.054 -60.053  37.184  1.00 2.00  ? 108  VAL A CG1   1 
ATOM   770   C  CG2   . VAL A 1 107  ? -42.717 -57.842  37.985  1.00 2.00  ? 108  VAL A CG2   1 
ATOM   771   N  N     . PHE A 1 108  ? -38.785 -59.720  36.436  1.00 2.00  ? 109  PHE A N     1 
ATOM   772   C  CA    . PHE A 1 108  ? -37.909 -60.499  35.605  1.00 2.00  ? 109  PHE A CA    1 
ATOM   773   C  C     . PHE A 1 108  ? -38.223 -61.917  35.872  1.00 2.00  ? 109  PHE A C     1 
ATOM   774   O  O     . PHE A 1 108  ? -38.224 -62.323  37.027  1.00 2.00  ? 109  PHE A O     1 
ATOM   775   C  CB    . PHE A 1 108  ? -36.473 -60.275  36.028  1.00 2.33  ? 109  PHE A CB    1 
ATOM   776   C  CG    . PHE A 1 108  ? -35.907 -58.994  35.544  1.00 2.64  ? 109  PHE A CG    1 
ATOM   777   C  CD1   . PHE A 1 108  ? -36.738 -57.964  35.124  1.00 2.72  ? 109  PHE A CD1   1 
ATOM   778   C  CD2   . PHE A 1 108  ? -34.544 -58.836  35.435  1.00 2.38  ? 109  PHE A CD2   1 
ATOM   779   C  CE1   . PHE A 1 108  ? -36.217 -56.794  34.590  1.00 2.80  ? 109  PHE A CE1   1 
ATOM   780   C  CE2   . PHE A 1 108  ? -34.023 -57.682  34.912  1.00 2.91  ? 109  PHE A CE2   1 
ATOM   781   C  CZ    . PHE A 1 108  ? -34.864 -56.653  34.483  1.00 2.70  ? 109  PHE A CZ    1 
ATOM   782   N  N     . HIS A 1 109  ? -38.495 -62.668  34.813  1.00 2.00  ? 110  HIS A N     1 
ATOM   783   C  CA    . HIS A 1 109  ? -38.794 -64.081  34.923  1.00 2.00  ? 110  HIS A CA    1 
ATOM   784   C  C     . HIS A 1 109  ? -37.553 -64.758  34.412  1.00 2.28  ? 110  HIS A C     1 
ATOM   785   O  O     . HIS A 1 109  ? -37.147 -64.511  33.284  1.00 3.03  ? 110  HIS A O     1 
ATOM   786   C  CB    . HIS A 1 109  ? -39.997 -64.432  34.049  1.00 2.00  ? 110  HIS A CB    1 
ATOM   787   C  CG    . HIS A 1 109  ? -41.298 -63.974  34.622  1.00 2.09  ? 110  HIS A CG    1 
ATOM   788   N  ND1   . HIS A 1 109  ? -41.743 -62.673  34.509  1.00 2.72  ? 110  HIS A ND1   1 
ATOM   789   C  CD2   . HIS A 1 109  ? -42.158 -64.591  35.461  1.00 2.02  ? 110  HIS A CD2   1 
ATOM   790   C  CE1   . HIS A 1 109  ? -42.803 -62.501  35.278  1.00 2.14  ? 110  HIS A CE1   1 
ATOM   791   N  NE2   . HIS A 1 109  ? -43.075 -63.651  35.868  1.00 2.34  ? 110  HIS A NE2   1 
ATOM   792   N  N     . VAL A 1 110  ? -36.867 -65.515  35.253  1.00 2.00  ? 111  VAL A N     1 
ATOM   793   C  CA    . VAL A 1 110  ? -35.672 -66.180  34.779  1.00 2.16  ? 111  VAL A CA    1 
ATOM   794   C  C     . VAL A 1 110  ? -35.746 -67.679  34.996  1.00 2.51  ? 111  VAL A C     1 
ATOM   795   O  O     . VAL A 1 110  ? -36.178 -68.141  36.050  1.00 2.94  ? 111  VAL A O     1 
ATOM   796   C  CB    . VAL A 1 110  ? -34.337 -65.612  35.395  1.00 2.00  ? 111  VAL A CB    1 
ATOM   797   C  CG1   . VAL A 1 110  ? -34.514 -64.229  35.908  1.00 2.30  ? 111  VAL A CG1   1 
ATOM   798   C  CG2   . VAL A 1 110  ? -33.769 -66.513  36.458  1.00 2.00  ? 111  VAL A CG2   1 
ATOM   799   N  N     . THR A 1 111  ? -35.406 -68.425  33.956  1.00 2.00  ? 112  THR A N     1 
ATOM   800   C  CA    . THR A 1 111  ? -35.360 -69.848  34.043  1.00 2.00  ? 112  THR A CA    1 
ATOM   801   C  C     . THR A 1 111  ? -33.926 -70.098  34.481  1.00 2.00  ? 112  THR A C     1 
ATOM   802   O  O     . THR A 1 111  ? -33.043 -70.258  33.652  1.00 2.00  ? 112  THR A O     1 
ATOM   803   C  CB    . THR A 1 111  ? -35.617 -70.452  32.685  1.00 2.00  ? 112  THR A CB    1 
ATOM   804   O  OG1   . THR A 1 111  ? -34.659 -69.955  31.756  1.00 2.00  ? 112  THR A OG1   1 
ATOM   805   C  CG2   . THR A 1 111  ? -36.990 -70.066  32.196  1.00 2.08  ? 112  THR A CG2   1 
ATOM   806   N  N     . ALA A 1 112  ? -33.698 -70.003  35.794  1.00 2.00  ? 113  ALA A N     1 
ATOM   807   C  CA    . ALA A 1 112  ? -32.394 -70.189  36.444  1.00 2.05  ? 113  ALA A CA    1 
ATOM   808   C  C     . ALA A 1 112  ? -31.540 -71.158  35.681  1.00 2.59  ? 113  ALA A C     1 
ATOM   809   O  O     . ALA A 1 112  ? -31.895 -72.322  35.565  1.00 2.90  ? 113  ALA A O     1 
ATOM   810   C  CB    . ALA A 1 112  ? -32.579 -70.688  37.833  1.00 2.00  ? 113  ALA A CB    1 
ATOM   811   N  N     . ARG A 1 113  ? -30.382 -70.693  35.226  1.00 2.82  ? 114  ARG A N     1 
ATOM   812   C  CA    . ARG A 1 113  ? -29.480 -71.504  34.421  1.00 3.31  ? 114  ARG A CA    1 
ATOM   813   C  C     . ARG A 1 113  ? -28.040 -71.313  34.859  1.00 3.84  ? 114  ARG A C     1 
ATOM   814   O  O     . ARG A 1 113  ? -27.683 -70.238  35.290  1.00 4.58  ? 114  ARG A O     1 
ATOM   815   C  CB    . ARG A 1 113  ? -29.614 -71.068  32.962  1.00 3.24  ? 114  ARG A CB    1 
ATOM   816   C  CG    . ARG A 1 113  ? -28.477 -71.505  32.073  1.00 3.98  ? 114  ARG A CG    1 
ATOM   817   C  CD    . ARG A 1 113  ? -28.601 -70.983  30.664  1.00 2.82  ? 114  ARG A CD    1 
ATOM   818   N  NE    . ARG A 1 113  ? -27.311 -71.007  29.993  1.00 2.00  ? 114  ARG A NE    1 
ATOM   819   C  CZ    . ARG A 1 113  ? -27.109 -70.550  28.772  1.00 2.00  ? 114  ARG A CZ    1 
ATOM   820   N  NH1   . ARG A 1 113  ? -28.122 -70.045  28.090  1.00 2.00  ? 114  ARG A NH1   1 
ATOM   821   N  NH2   . ARG A 1 113  ? -25.882 -70.495  28.274  1.00 2.00  ? 114  ARG A NH2   1 
ATOM   822   N  N     . ALA A 1 114  ? -27.206 -72.336  34.659  1.00 4.02  ? 115  ALA A N     1 
ATOM   823   C  CA    . ALA A 1 114  ? -25.781 -72.334  35.014  1.00 3.43  ? 115  ALA A CA    1 
ATOM   824   C  C     . ALA A 1 114  ? -24.945 -71.321  34.283  1.00 3.36  ? 115  ALA A C     1 
ATOM   825   O  O     . ALA A 1 114  ? -25.219 -71.000  33.138  1.00 2.80  ? 115  ALA A O     1 
ATOM   826   C  CB    . ALA A 1 114  ? -25.207 -73.694  34.763  1.00 3.29  ? 115  ALA A CB    1 
ATOM   827   N  N     . ILE A 1 115  ? -23.854 -70.912  34.924  1.00 4.08  ? 116  ILE A N     1 
ATOM   828   C  CA    . ILE A 1 115  ? -22.920 -69.932  34.358  1.00 4.72  ? 116  ILE A CA    1 
ATOM   829   C  C     . ILE A 1 115  ? -21.717 -70.605  33.706  1.00 5.16  ? 116  ILE A C     1 
ATOM   830   O  O     . ILE A 1 115  ? -21.217 -71.615  34.208  1.00 5.56  ? 116  ILE A O     1 
ATOM   831   C  CB    . ILE A 1 115  ? -22.361 -69.004  35.414  1.00 4.31  ? 116  ILE A CB    1 
ATOM   832   C  CG1   . ILE A 1 115  ? -23.477 -68.309  36.158  1.00 4.26  ? 116  ILE A CG1   1 
ATOM   833   C  CG2   . ILE A 1 115  ? -21.596 -67.928  34.752  1.00 5.04  ? 116  ILE A CG2   1 
ATOM   834   C  CD1   . ILE A 1 115  ? -24.150 -67.256  35.330  1.00 5.15  ? 116  ILE A CD1   1 
ATOM   835   N  N     . ALA A 1 116  ? -21.228 -70.011  32.618  1.00 5.61  ? 117  ALA A N     1 
ATOM   836   C  CA    . ALA A 1 116  ? -20.097 -70.570  31.897  1.00 6.23  ? 117  ALA A CA    1 
ATOM   837   C  C     . ALA A 1 116  ? -18.799 -70.254  32.589  1.00 6.97  ? 117  ALA A C     1 
ATOM   838   O  O     . ALA A 1 116  ? -18.407 -69.076  32.649  1.00 8.32  ? 117  ALA A O     1 
ATOM   839   C  CB    . ALA A 1 116  ? -20.063 -70.050  30.513  1.00 5.62  ? 117  ALA A CB    1 
ATOM   840   N  N     . ALA A 1 117  ? -18.169 -71.289  33.154  1.00 6.68  ? 118  ALA A N     1 
ATOM   841   C  CA    . ALA A 1 117  ? -16.877 -71.175  33.839  1.00 6.24  ? 118  ALA A CA    1 
ATOM   842   C  C     . ALA A 1 117  ? -15.886 -72.031  33.049  1.00 6.42  ? 118  ALA A C     1 
ATOM   843   O  O     . ALA A 1 117  ? -15.449 -71.648  31.975  1.00 6.69  ? 118  ALA A O     1 
ATOM   844   C  CB    . ALA A 1 117  ? -16.999 -71.675  35.237  1.00 5.83  ? 118  ALA A CB    1 
ATOM   845   N  N     . HIS A 1 118  ? -15.565 -73.225  33.521  1.00 6.84  ? 119  HIS A N     1 
ATOM   846   C  CA    . HIS A 1 118  ? -14.640 -74.068  32.768  1.00 6.99  ? 119  HIS A CA    1 
ATOM   847   C  C     . HIS A 1 118  ? -15.291 -74.481  31.441  1.00 7.13  ? 119  HIS A C     1 
ATOM   848   O  O     . HIS A 1 118  ? -14.594 -74.853  30.479  1.00 7.78  ? 119  HIS A O     1 
ATOM   849   C  CB    . HIS A 1 118  ? -14.354 -75.324  33.547  1.00 6.54  ? 119  HIS A CB    1 
ATOM   850   C  CG    . HIS A 1 118  ? -15.571 -76.154  33.750  1.00 6.59  ? 119  HIS A CG    1 
ATOM   851   N  ND1   . HIS A 1 118  ? -16.404 -75.991  34.831  1.00 6.64  ? 119  HIS A ND1   1 
ATOM   852   C  CD2   . HIS A 1 118  ? -16.117 -77.132  32.992  1.00 6.66  ? 119  HIS A CD2   1 
ATOM   853   C  CE1   . HIS A 1 118  ? -17.413 -76.837  34.732  1.00 7.07  ? 119  HIS A CE1   1 
ATOM   854   N  NE2   . HIS A 1 118  ? -17.264 -77.540  33.624  1.00 6.73  ? 119  HIS A NE2   1 
ATOM   855   N  N     . ALA A 1 119  ? -16.627 -74.520  31.460  1.00 6.55  ? 120  ALA A N     1 
ATOM   856   C  CA    . ALA A 1 119  ? -17.465 -74.886  30.323  1.00 5.85  ? 120  ALA A CA    1 
ATOM   857   C  C     . ALA A 1 119  ? -18.789 -74.144  30.421  1.00 5.96  ? 120  ALA A C     1 
ATOM   858   O  O     . ALA A 1 119  ? -19.160 -73.635  31.480  1.00 6.32  ? 120  ALA A O     1 
ATOM   859   C  CB    . ALA A 1 119  ? -17.722 -76.370  30.334  1.00 5.20  ? 120  ALA A CB    1 
ATOM   860   N  N     . LEU A 1 120  ? -19.511 -74.088  29.310  1.00 6.02  ? 121  LEU A N     1 
ATOM   861   C  CA    . LEU A 1 120  ? -20.823 -73.429  29.255  1.00 5.48  ? 121  LEU A CA    1 
ATOM   862   C  C     . LEU A 1 120  ? -21.927 -74.434  29.533  1.00 5.58  ? 121  LEU A C     1 
ATOM   863   O  O     . LEU A 1 120  ? -21.714 -75.643  29.424  1.00 6.01  ? 121  LEU A O     1 
ATOM   864   C  CB    . LEU A 1 120  ? -21.048 -72.836  27.867  1.00 4.17  ? 121  LEU A CB    1 
ATOM   865   C  CG    . LEU A 1 120  ? -22.463 -72.494  27.445  1.00 2.75  ? 121  LEU A CG    1 
ATOM   866   C  CD1   . LEU A 1 120  ? -22.399 -71.305  26.586  1.00 3.13  ? 121  LEU A CD1   1 
ATOM   867   C  CD2   . LEU A 1 120  ? -23.086 -73.620  26.720  1.00 2.00  ? 121  LEU A CD2   1 
ATOM   868   N  N     . SER A 1 121  ? -23.118 -73.942  29.839  1.00 5.31  ? 122  SER A N     1 
ATOM   869   C  CA    . SER A 1 121  ? -24.219 -74.852  30.075  1.00 5.90  ? 122  SER A CA    1 
ATOM   870   C  C     . SER A 1 121  ? -25.557 -74.171  29.902  1.00 5.52  ? 122  SER A C     1 
ATOM   871   O  O     . SER A 1 121  ? -25.764 -73.058  30.375  1.00 5.91  ? 122  SER A O     1 
ATOM   872   C  CB    . SER A 1 121  ? -24.108 -75.494  31.469  1.00 6.61  ? 122  SER A CB    1 
ATOM   873   O  OG    . SER A 1 121  ? -24.893 -76.681  31.572  1.00 7.49  ? 122  SER A OG    1 
ATOM   874   N  N     . ILE A 1 122  ? -26.444 -74.826  29.161  1.00 5.13  ? 123  ILE A N     1 
ATOM   875   C  CA    . ILE A 1 122  ? -27.795 -74.317  28.929  1.00 4.63  ? 123  ILE A CA    1 
ATOM   876   C  C     . ILE A 1 122  ? -28.730 -74.867  30.031  1.00 4.71  ? 123  ILE A C     1 
ATOM   877   O  O     . ILE A 1 122  ? -29.854 -74.397  30.210  1.00 4.92  ? 123  ILE A O     1 
ATOM   878   C  CB    . ILE A 1 122  ? -28.339 -74.777  27.560  1.00 3.96  ? 123  ILE A CB    1 
ATOM   879   C  CG1   . ILE A 1 122  ? -28.364 -76.293  27.493  1.00 4.15  ? 123  ILE A CG1   1 
ATOM   880   C  CG2   . ILE A 1 122  ? -27.468 -74.293  26.465  1.00 2.10  ? 123  ILE A CG2   1 
ATOM   881   C  CD1   . ILE A 1 122  ? -28.716 -76.823  26.137  1.00 4.90  ? 123  ILE A CD1   1 
ATOM   882   N  N     . PHE A 1 123  ? -28.220 -75.813  30.808  1.00 4.79  ? 124  PHE A N     1 
ATOM   883   C  CA    . PHE A 1 123  ? -28.994 -76.446  31.844  1.00 4.26  ? 124  PHE A CA    1 
ATOM   884   C  C     . PHE A 1 123  ? -29.281 -75.671  33.105  1.00 4.19  ? 124  PHE A C     1 
ATOM   885   O  O     . PHE A 1 123  ? -28.792 -74.543  33.278  1.00 3.91  ? 124  PHE A O     1 
ATOM   886   C  CB    . PHE A 1 123  ? -28.464 -77.831  32.067  1.00 4.80  ? 124  PHE A CB    1 
ATOM   887   C  CG    . PHE A 1 123  ? -28.540 -78.654  30.837  1.00 4.70  ? 124  PHE A CG    1 
ATOM   888   C  CD1   . PHE A 1 123  ? -29.740 -79.218  30.456  1.00 5.14  ? 124  PHE A CD1   1 
ATOM   889   C  CD2   . PHE A 1 123  ? -27.461 -78.741  29.986  1.00 4.75  ? 124  PHE A CD2   1 
ATOM   890   C  CE1   . PHE A 1 123  ? -29.863 -79.845  29.235  1.00 5.35  ? 124  PHE A CE1   1 
ATOM   891   C  CE2   . PHE A 1 123  ? -27.579 -79.365  28.769  1.00 5.16  ? 124  PHE A CE2   1 
ATOM   892   C  CZ    . PHE A 1 123  ? -28.774 -79.914  28.389  1.00 5.13  ? 124  PHE A CZ    1 
ATOM   893   N  N     . GLY A 1 124  ? -30.080 -76.267  33.987  1.00 3.23  ? 125  GLY A N     1 
ATOM   894   C  CA    . GLY A 1 124  ? -30.521 -75.521  35.147  1.00 2.94  ? 125  GLY A CA    1 
ATOM   895   C  C     . GLY A 1 124  ? -29.870 -75.534  36.493  1.00 3.15  ? 125  GLY A C     1 
ATOM   896   O  O     . GLY A 1 124  ? -29.548 -76.576  37.023  1.00 4.04  ? 125  GLY A O     1 
ATOM   897   N  N     . ASP A 1 125  ? -29.666 -74.353  37.037  1.00 2.93  ? 126  ASP A N     1 
ATOM   898   C  CA    . ASP A 1 125  ? -29.136 -74.220  38.372  1.00 3.09  ? 126  ASP A CA    1 
ATOM   899   C  C     . ASP A 1 125  ? -29.240 -72.770  38.852  1.00 3.56  ? 126  ASP A C     1 
ATOM   900   O  O     . ASP A 1 125  ? -29.700 -71.900  38.098  1.00 4.34  ? 126  ASP A O     1 
ATOM   901   C  CB    . ASP A 1 125  ? -27.769 -74.909  38.554  1.00 3.85  ? 126  ASP A CB    1 
ATOM   902   C  CG    . ASP A 1 125  ? -26.610 -74.159  37.947  1.00 4.51  ? 126  ASP A CG    1 
ATOM   903   O  OD1   . ASP A 1 125  ? -26.653 -72.912  37.925  1.00 5.87  ? 126  ASP A OD1   1 
ATOM   904   O  OD2   . ASP A 1 125  ? -25.615 -74.823  37.560  1.00 3.62  ? 126  ASP A OD2   1 
ATOM   905   N  N     . HIS A 1 126  ? -28.895 -72.498  40.105  1.00 3.46  ? 127  HIS A N     1 
ATOM   906   C  CA    . HIS A 1 126  ? -29.065 -71.147  40.620  1.00 3.19  ? 127  HIS A CA    1 
ATOM   907   C  C     . HIS A 1 126  ? -27.831 -70.281  40.598  1.00 3.65  ? 127  HIS A C     1 
ATOM   908   O  O     . HIS A 1 126  ? -27.750 -69.345  41.364  1.00 4.53  ? 127  HIS A O     1 
ATOM   909   C  CB    . HIS A 1 126  ? -29.601 -71.161  42.052  1.00 2.48  ? 127  HIS A CB    1 
ATOM   910   C  CG    . HIS A 1 126  ? -30.880 -71.913  42.236  1.00 2.10  ? 127  HIS A CG    1 
ATOM   911   N  ND1   . HIS A 1 126  ? -31.178 -72.590  43.398  1.00 2.00  ? 127  HIS A ND1   1 
ATOM   912   C  CD2   . HIS A 1 126  ? -31.936 -72.106  41.407  1.00 2.00  ? 127  HIS A CD2   1 
ATOM   913   C  CE1   . HIS A 1 126  ? -32.355 -73.174  43.274  1.00 2.00  ? 127  HIS A CE1   1 
ATOM   914   N  NE2   . HIS A 1 126  ? -32.835 -72.895  42.077  1.00 2.00  ? 127  HIS A NE2   1 
ATOM   915   N  N     . GLN A 1 127  ? -26.865 -70.561  39.742  1.00 4.01  ? 128  GLN A N     1 
ATOM   916   C  CA    . GLN A 1 127  ? -25.684 -69.718  39.707  1.00 4.85  ? 128  GLN A CA    1 
ATOM   917   C  C     . GLN A 1 127  ? -25.956 -68.298  39.248  1.00 5.79  ? 128  GLN A C     1 
ATOM   918   O  O     . GLN A 1 127  ? -25.296 -67.362  39.708  1.00 7.09  ? 128  GLN A O     1 
ATOM   919   C  CB    . GLN A 1 127  ? -24.604 -70.341  38.849  1.00 4.54  ? 128  GLN A CB    1 
ATOM   920   C  CG    . GLN A 1 127  ? -23.989 -71.505  39.530  1.00 4.98  ? 128  GLN A CG    1 
ATOM   921   C  CD    . GLN A 1 127  ? -23.039 -72.213  38.660  1.00 5.11  ? 128  GLN A CD    1 
ATOM   922   O  OE1   . GLN A 1 127  ? -23.053 -73.435  38.585  1.00 5.65  ? 128  GLN A OE1   1 
ATOM   923   N  NE2   . GLN A 1 127  ? -22.215 -71.459  37.956  1.00 5.48  ? 128  GLN A NE2   1 
ATOM   924   N  N     . ASP A 1 128  ? -26.952 -68.120  38.390  1.00 5.96  ? 129  ASP A N     1 
ATOM   925   C  CA    . ASP A 1 128  ? -27.274 -66.801  37.892  1.00 6.89  ? 129  ASP A CA    1 
ATOM   926   C  C     . ASP A 1 128  ? -28.184 -65.955  38.791  1.00 6.83  ? 129  ASP A C     1 
ATOM   927   O  O     . ASP A 1 128  ? -28.079 -64.730  38.805  1.00 7.35  ? 129  ASP A O     1 
ATOM   928   C  CB    . ASP A 1 128  ? -27.840 -66.892  36.480  1.00 9.00  ? 129  ASP A CB    1 
ATOM   929   C  CG    . ASP A 1 128  ? -29.076 -67.785  36.379  1.00 11.38 ? 129  ASP A CG    1 
ATOM   930   O  OD1   . ASP A 1 128  ? -29.672 -68.186  37.410  1.00 12.59 ? 129  ASP A OD1   1 
ATOM   931   O  OD2   . ASP A 1 128  ? -29.468 -68.090  35.235  1.00 12.46 ? 129  ASP A OD2   1 
ATOM   932   N  N     . ILE A 1 129  ? -29.100 -66.576  39.522  1.00 6.28  ? 130  ILE A N     1 
ATOM   933   C  CA    . ILE A 1 129  ? -29.965 -65.797  40.388  1.00 5.44  ? 130  ILE A CA    1 
ATOM   934   C  C     . ILE A 1 129  ? -29.120 -65.331  41.540  1.00 5.56  ? 130  ILE A C     1 
ATOM   935   O  O     . ILE A 1 129  ? -29.111 -64.154  41.876  1.00 5.90  ? 130  ILE A O     1 
ATOM   936   C  CB    . ILE A 1 129  ? -31.114 -66.612  40.927  1.00 4.65  ? 130  ILE A CB    1 
ATOM   937   C  CG1   . ILE A 1 129  ? -30.606 -67.787  41.744  1.00 4.53  ? 130  ILE A CG1   1 
ATOM   938   C  CG2   . ILE A 1 129  ? -31.921 -67.120  39.795  1.00 5.15  ? 130  ILE A CG2   1 
ATOM   939   C  CD1   . ILE A 1 129  ? -31.402 -68.041  42.965  1.00 4.63  ? 130  ILE A CD1   1 
ATOM   940   N  N     . TYR A 1 130  ? -28.319 -66.239  42.077  1.00 5.15  ? 131  TYR A N     1 
ATOM   941   C  CA    . TYR A 1 130  ? -27.490 -65.894  43.197  1.00 5.08  ? 131  TYR A CA    1 
ATOM   942   C  C     . TYR A 1 130  ? -26.510 -64.802  42.811  1.00 5.42  ? 131  TYR A C     1 
ATOM   943   O  O     . TYR A 1 130  ? -25.995 -64.091  43.674  1.00 6.12  ? 131  TYR A O     1 
ATOM   944   C  CB    . TYR A 1 130  ? -26.772 -67.119  43.715  1.00 4.25  ? 131  TYR A CB    1 
ATOM   945   C  CG    . TYR A 1 130  ? -27.622 -68.070  44.537  1.00 3.81  ? 131  TYR A CG    1 
ATOM   946   C  CD1   . TYR A 1 130  ? -28.506 -67.608  45.508  1.00 4.04  ? 131  TYR A CD1   1 
ATOM   947   C  CD2   . TYR A 1 130  ? -27.434 -69.438  44.436  1.00 3.92  ? 131  TYR A CD2   1 
ATOM   948   C  CE1   . TYR A 1 130  ? -29.177 -68.504  46.375  1.00 4.10  ? 131  TYR A CE1   1 
ATOM   949   C  CE2   . TYR A 1 130  ? -28.084 -70.330  45.282  1.00 4.38  ? 131  TYR A CE2   1 
ATOM   950   C  CZ    . TYR A 1 130  ? -28.956 -69.873  46.253  1.00 4.37  ? 131  TYR A CZ    1 
ATOM   951   O  OH    . TYR A 1 130  ? -29.586 -70.806  47.067  1.00 3.35  ? 131  TYR A OH    1 
ATOM   952   N  N     . ALA A 1 131  ? -26.257 -64.653  41.518  1.00 5.32  ? 132  ALA A N     1 
ATOM   953   C  CA    . ALA A 1 131  ? -25.351 -63.603  41.064  1.00 5.34  ? 132  ALA A CA    1 
ATOM   954   C  C     . ALA A 1 131  ? -25.997 -62.210  41.195  1.00 5.61  ? 132  ALA A C     1 
ATOM   955   O  O     . ALA A 1 131  ? -25.305 -61.207  41.341  1.00 5.72  ? 132  ALA A O     1 
ATOM   956   C  CB    . ALA A 1 131  ? -24.951 -63.853  39.638  1.00 4.92  ? 132  ALA A CB    1 
ATOM   957   N  N     . ALA A 1 132  ? -27.327 -62.177  41.141  1.00 5.78  ? 133  ALA A N     1 
ATOM   958   C  CA    . ALA A 1 132  ? -28.113 -60.952  41.236  1.00 5.91  ? 133  ALA A CA    1 
ATOM   959   C  C     . ALA A 1 132  ? -28.707 -60.747  42.642  1.00 6.10  ? 133  ALA A C     1 
ATOM   960   O  O     . ALA A 1 132  ? -29.570 -59.906  42.870  1.00 5.51  ? 133  ALA A O     1 
ATOM   961   C  CB    . ALA A 1 132  ? -29.201 -60.978  40.190  1.00 6.14  ? 133  ALA A CB    1 
ATOM   962   N  N     . ARG A 1 133  ? -28.214 -61.552  43.572  1.00 6.77  ? 134  ARG A N     1 
ATOM   963   C  CA    . ARG A 1 133  ? -28.575 -61.561  44.986  1.00 6.58  ? 134  ARG A CA    1 
ATOM   964   C  C     . ARG A 1 133  ? -28.585 -60.185  45.632  1.00 6.81  ? 134  ARG A C     1 
ATOM   965   O  O     . ARG A 1 133  ? -29.369 -59.922  46.545  1.00 6.94  ? 134  ARG A O     1 
ATOM   966   C  CB    . ARG A 1 133  ? -27.477 -62.328  45.699  1.00 6.48  ? 134  ARG A CB    1 
ATOM   967   C  CG    . ARG A 1 133  ? -27.882 -63.366  46.684  1.00 7.31  ? 134  ARG A CG    1 
ATOM   968   C  CD    . ARG A 1 133  ? -26.684 -63.653  47.564  1.00 7.49  ? 134  ARG A CD    1 
ATOM   969   N  NE    . ARG A 1 133  ? -25.483 -63.774  46.750  1.00 8.72  ? 134  ARG A NE    1 
ATOM   970   C  CZ    . ARG A 1 133  ? -24.402 -64.459  47.098  1.00 9.83  ? 134  ARG A CZ    1 
ATOM   971   N  NH1   . ARG A 1 133  ? -24.349 -65.082  48.265  1.00 10.11 ? 134  ARG A NH1   1 
ATOM   972   N  NH2   . ARG A 1 133  ? -23.412 -64.604  46.230  1.00 9.75  ? 134  ARG A NH2   1 
ATOM   973   N  N     . GLN A 1 134  ? -27.641 -59.342  45.222  1.00 7.15  ? 135  GLN A N     1 
ATOM   974   C  CA    . GLN A 1 134  ? -27.475 -58.017  45.823  1.00 7.59  ? 135  GLN A CA    1 
ATOM   975   C  C     . GLN A 1 134  ? -27.991 -56.826  45.073  1.00 7.06  ? 135  GLN A C     1 
ATOM   976   O  O     . GLN A 1 134  ? -27.976 -55.716  45.601  1.00 7.54  ? 135  GLN A O     1 
ATOM   977   C  CB    . GLN A 1 134  ? -26.011 -57.758  46.181  1.00 8.36  ? 135  GLN A CB    1 
ATOM   978   C  CG    . GLN A 1 134  ? -25.083 -57.635  45.001  1.00 10.93 ? 135  GLN A CG    1 
ATOM   979   C  CD    . GLN A 1 134  ? -24.622 -58.990  44.448  1.00 12.60 ? 135  GLN A CD    1 
ATOM   980   O  OE1   . GLN A 1 134  ? -24.085 -59.826  45.187  1.00 13.58 ? 135  GLN A OE1   1 
ATOM   981   N  NE2   . GLN A 1 134  ? -24.798 -59.194  43.137  1.00 13.06 ? 135  GLN A NE2   1 
ATOM   982   N  N     . THR A 1 135  ? -28.478 -57.040  43.865  1.00 6.43  ? 136  THR A N     1 
ATOM   983   C  CA    . THR A 1 135  ? -28.988 -55.944  43.080  1.00 5.56  ? 136  THR A CA    1 
ATOM   984   C  C     . THR A 1 135  ? -30.137 -55.209  43.728  1.00 5.46  ? 136  THR A C     1 
ATOM   985   O  O     . THR A 1 135  ? -30.412 -54.088  43.361  1.00 6.13  ? 136  THR A O     1 
ATOM   986   C  CB    . THR A 1 135  ? -29.415 -56.419  41.729  1.00 5.25  ? 136  THR A CB    1 
ATOM   987   O  OG1   . THR A 1 135  ? -30.234 -57.573  41.884  1.00 5.94  ? 136  THR A OG1   1 
ATOM   988   C  CG2   . THR A 1 135  ? -28.218 -56.801  40.932  1.00 5.65  ? 136  THR A CG2   1 
ATOM   989   N  N     . GLY A 1 136  ? -30.795 -55.814  44.709  1.00 5.52  ? 137  GLY A N     1 
ATOM   990   C  CA    . GLY A 1 136  ? -31.911 -55.134  45.349  1.00 5.31  ? 137  GLY A CA    1 
ATOM   991   C  C     . GLY A 1 136  ? -33.285 -55.644  44.928  1.00 5.11  ? 137  GLY A C     1 
ATOM   992   O  O     . GLY A 1 136  ? -34.297 -55.259  45.509  1.00 4.69  ? 137  GLY A O     1 
ATOM   993   N  N     . PHE A 1 137  ? -33.315 -56.488  43.896  1.00 4.92  ? 138  PHE A N     1 
ATOM   994   C  CA    . PHE A 1 137  ? -34.539 -57.110  43.389  1.00 4.36  ? 138  PHE A CA    1 
ATOM   995   C  C     . PHE A 1 137  ? -35.037 -58.109  44.434  1.00 4.42  ? 138  PHE A C     1 
ATOM   996   O  O     . PHE A 1 137  ? -34.230 -58.685  45.157  1.00 4.54  ? 138  PHE A O     1 
ATOM   997   C  CB    . PHE A 1 137  ? -34.216 -57.915  42.114  1.00 3.40  ? 138  PHE A CB    1 
ATOM   998   C  CG    . PHE A 1 137  ? -34.449 -57.171  40.838  1.00 3.00  ? 138  PHE A CG    1 
ATOM   999   C  CD1   . PHE A 1 137  ? -34.014 -55.866  40.678  1.00 2.80  ? 138  PHE A CD1   1 
ATOM   1000  C  CD2   . PHE A 1 137  ? -35.157 -57.766  39.805  1.00 3.28  ? 138  PHE A CD2   1 
ATOM   1001  C  CE1   . PHE A 1 137  ? -34.282 -55.158  39.513  1.00 2.72  ? 138  PHE A CE1   1 
ATOM   1002  C  CE2   . PHE A 1 137  ? -35.437 -57.068  38.620  1.00 3.34  ? 138  PHE A CE2   1 
ATOM   1003  C  CZ    . PHE A 1 137  ? -34.998 -55.761  38.479  1.00 3.18  ? 138  PHE A CZ    1 
ATOM   1004  N  N     . ALA A 1 138  ? -36.351 -58.298  44.529  1.00 4.46  ? 139  ALA A N     1 
ATOM   1005  C  CA    . ALA A 1 138  ? -36.911 -59.302  45.436  1.00 4.75  ? 139  ALA A CA    1 
ATOM   1006  C  C     . ALA A 1 138  ? -36.802 -60.612  44.636  1.00 5.41  ? 139  ALA A C     1 
ATOM   1007  O  O     . ALA A 1 138  ? -36.756 -60.578  43.395  1.00 6.45  ? 139  ALA A O     1 
ATOM   1008  C  CB    . ALA A 1 138  ? -38.351 -58.999  45.750  1.00 3.96  ? 139  ALA A CB    1 
ATOM   1009  N  N     . MET A 1 139  ? -36.735 -61.758  45.304  1.00 4.88  ? 140  MET A N     1 
ATOM   1010  C  CA    . MET A 1 139  ? -36.599 -63.009  44.584  1.00 4.76  ? 140  MET A CA    1 
ATOM   1011  C  C     . MET A 1 139  ? -37.615 -63.939  45.158  1.00 5.00  ? 140  MET A C     1 
ATOM   1012  O  O     . MET A 1 139  ? -37.763 -64.012  46.375  1.00 5.92  ? 140  MET A O     1 
ATOM   1013  C  CB    . MET A 1 139  ? -35.181 -63.535  44.740  1.00 4.83  ? 140  MET A CB    1 
ATOM   1014  C  CG    . MET A 1 139  ? -34.147 -62.510  44.293  1.00 5.59  ? 140  MET A CG    1 
ATOM   1015  S  SD    . MET A 1 139  ? -32.457 -63.014  44.490  1.00 5.98  ? 140  MET A SD    1 
ATOM   1016  C  CE    . MET A 1 139  ? -32.330 -64.248  43.214  1.00 6.06  ? 140  MET A CE    1 
ATOM   1017  N  N     . LEU A 1 140  ? -38.301 -64.661  44.282  1.00 4.43  ? 141  LEU A N     1 
ATOM   1018  C  CA    . LEU A 1 140  ? -39.396 -65.549  44.667  1.00 4.30  ? 141  LEU A CA    1 
ATOM   1019  C  C     . LEU A 1 140  ? -39.229 -66.767  43.810  1.00 4.59  ? 141  LEU A C     1 
ATOM   1020  O  O     . LEU A 1 140  ? -39.390 -66.679  42.595  1.00 5.96  ? 141  LEU A O     1 
ATOM   1021  C  CB    . LEU A 1 140  ? -40.712 -64.885  44.240  1.00 3.55  ? 141  LEU A CB    1 
ATOM   1022  C  CG    . LEU A 1 140  ? -42.024 -64.812  45.002  1.00 2.74  ? 141  LEU A CG    1 
ATOM   1023  C  CD1   . LEU A 1 140  ? -43.076 -64.922  43.962  1.00 2.18  ? 141  LEU A CD1   1 
ATOM   1024  C  CD2   . LEU A 1 140  ? -42.205 -65.912  46.016  1.00 2.68  ? 141  LEU A CD2   1 
ATOM   1025  N  N     . ALA A 1 141  ? -39.031 -67.924  44.408  1.00 4.30  ? 142  ALA A N     1 
ATOM   1026  C  CA    . ALA A 1 141  ? -38.826 -69.102  43.597  1.00 4.48  ? 142  ALA A CA    1 
ATOM   1027  C  C     . ALA A 1 141  ? -39.984 -70.075  43.472  1.00 4.85  ? 142  ALA A C     1 
ATOM   1028  O  O     . ALA A 1 141  ? -40.646 -70.411  44.456  1.00 6.08  ? 142  ALA A O     1 
ATOM   1029  C  CB    . ALA A 1 141  ? -37.604 -69.834  44.094  1.00 4.49  ? 142  ALA A CB    1 
ATOM   1030  N  N     . SER A 1 142  ? -40.231 -70.556  42.266  1.00 4.43  ? 143  SER A N     1 
ATOM   1031  C  CA    . SER A 1 142  ? -41.270 -71.556  42.109  1.00 4.58  ? 143  SER A CA    1 
ATOM   1032  C  C     . SER A 1 142  ? -40.564 -72.875  41.875  1.00 4.06  ? 143  SER A C     1 
ATOM   1033  O  O     . SER A 1 142  ? -39.516 -72.932  41.211  1.00 3.91  ? 143  SER A O     1 
ATOM   1034  C  CB    . SER A 1 142  ? -42.229 -71.219  40.974  1.00 5.72  ? 143  SER A CB    1 
ATOM   1035  O  OG    . SER A 1 142  ? -41.543 -70.866  39.790  1.00 7.84  ? 143  SER A OG    1 
ATOM   1036  N  N     . SER A 1 143  ? -41.120 -73.934  42.455  1.00 3.69  ? 144  SER A N     1 
ATOM   1037  C  CA    . SER A 1 143  ? -40.525 -75.260  42.356  1.00 2.99  ? 144  SER A CA    1 
ATOM   1038  C  C     . SER A 1 143  ? -41.354 -76.309  41.627  1.00 2.91  ? 144  SER A C     1 
ATOM   1039  O  O     . SER A 1 143  ? -41.272 -77.484  41.950  1.00 2.72  ? 144  SER A O     1 
ATOM   1040  C  CB    . SER A 1 143  ? -40.204 -75.768  43.755  1.00 2.54  ? 144  SER A CB    1 
ATOM   1041  O  OG    . SER A 1 143  ? -41.383 -76.063  44.480  1.00 3.04  ? 144  SER A OG    1 
ATOM   1042  N  N     . SER A 1 144  ? -42.150 -75.889  40.655  1.00 2.94  ? 145  SER A N     1 
ATOM   1043  C  CA    . SER A 1 144  ? -42.984 -76.800  39.886  1.00 3.39  ? 145  SER A CA    1 
ATOM   1044  C  C     . SER A 1 144  ? -43.780 -75.956  38.935  1.00 3.50  ? 145  SER A C     1 
ATOM   1045  O  O     . SER A 1 144  ? -44.117 -74.825  39.258  1.00 3.40  ? 145  SER A O     1 
ATOM   1046  C  CB    . SER A 1 144  ? -43.961 -77.548  40.787  1.00 4.09  ? 145  SER A CB    1 
ATOM   1047  O  OG    . SER A 1 144  ? -44.968 -76.681  41.300  1.00 5.51  ? 145  SER A OG    1 
ATOM   1048  N  N     . VAL A 1 145  ? -44.142 -76.532  37.795  1.00 3.53  ? 146  VAL A N     1 
ATOM   1049  C  CA    . VAL A 1 145  ? -44.917 -75.819  36.787  1.00 3.89  ? 146  VAL A CA    1 
ATOM   1050  C  C     . VAL A 1 145  ? -46.156 -75.113  37.355  1.00 4.59  ? 146  VAL A C     1 
ATOM   1051  O  O     . VAL A 1 145  ? -46.468 -73.996  36.979  1.00 5.11  ? 146  VAL A O     1 
ATOM   1052  C  CB    . VAL A 1 145  ? -45.345 -76.762  35.673  1.00 3.08  ? 146  VAL A CB    1 
ATOM   1053  C  CG1   . VAL A 1 145  ? -46.159 -76.021  34.669  1.00 3.29  ? 146  VAL A CG1   1 
ATOM   1054  C  CG2   . VAL A 1 145  ? -44.135 -77.376  35.025  1.00 2.66  ? 146  VAL A CG2   1 
ATOM   1055  N  N     . GLN A 1 146  ? -46.874 -75.758  38.261  1.00 5.57  ? 147  GLN A N     1 
ATOM   1056  C  CA    . GLN A 1 146  ? -48.047 -75.125  38.846  1.00 6.12  ? 147  GLN A CA    1 
ATOM   1057  C  C     . GLN A 1 146  ? -47.598 -73.906  39.592  1.00 6.25  ? 147  GLN A C     1 
ATOM   1058  O  O     . GLN A 1 146  ? -48.256 -72.875  39.566  1.00 7.15  ? 147  GLN A O     1 
ATOM   1059  C  CB    . GLN A 1 146  ? -48.715 -76.041  39.860  1.00 6.81  ? 147  GLN A CB    1 
ATOM   1060  C  CG    . GLN A 1 146  ? -49.874 -75.390  40.582  1.00 7.80  ? 147  GLN A CG    1 
ATOM   1061  C  CD    . GLN A 1 146  ? -51.042 -75.129  39.657  1.00 9.23  ? 147  GLN A CD    1 
ATOM   1062  O  OE1   . GLN A 1 146  ? -51.232 -74.004  39.195  1.00 9.40  ? 147  GLN A OE1   1 
ATOM   1063  N  NE2   . GLN A 1 146  ? -51.835 -76.173  39.377  1.00 9.28  ? 147  GLN A NE2   1 
ATOM   1064  N  N     . GLU A 1 147  ? -46.487 -74.040  40.299  1.00 5.77  ? 148  GLU A N     1 
ATOM   1065  C  CA    . GLU A 1 147  ? -45.978 -72.938  41.078  1.00 5.48  ? 148  GLU A CA    1 
ATOM   1066  C  C     . GLU A 1 147  ? -45.418 -71.765  40.273  1.00 5.04  ? 148  GLU A C     1 
ATOM   1067  O  O     . GLU A 1 147  ? -45.335 -70.664  40.793  1.00 5.34  ? 148  GLU A O     1 
ATOM   1068  C  CB    . GLU A 1 147  ? -44.981 -73.454  42.102  1.00 5.53  ? 148  GLU A CB    1 
ATOM   1069  C  CG    . GLU A 1 147  ? -45.491 -73.335  43.498  1.00 5.63  ? 148  GLU A CG    1 
ATOM   1070  C  CD    . GLU A 1 147  ? -44.657 -74.095  44.482  1.00 6.80  ? 148  GLU A CD    1 
ATOM   1071  O  OE1   . GLU A 1 147  ? -43.511 -73.678  44.776  1.00 7.18  ? 148  GLU A OE1   1 
ATOM   1072  O  OE2   . GLU A 1 147  ? -45.158 -75.131  44.962  1.00 8.15  ? 148  GLU A OE2   1 
ATOM   1073  N  N     . ALA A 1 148  ? -45.074 -71.998  39.007  1.00 4.38  ? 149  ALA A N     1 
ATOM   1074  C  CA    . ALA A 1 148  ? -44.536 -70.970  38.137  1.00 3.44  ? 149  ALA A CA    1 
ATOM   1075  C  C     . ALA A 1 148  ? -45.665 -70.019  37.793  1.00 4.14  ? 149  ALA A C     1 
ATOM   1076  O  O     . ALA A 1 148  ? -45.468 -68.805  37.715  1.00 4.64  ? 149  ALA A O     1 
ATOM   1077  C  CB    . ALA A 1 148  ? -43.993 -71.583  36.900  1.00 2.18  ? 149  ALA A CB    1 
ATOM   1078  N  N     . HIS A 1 149  ? -46.859 -70.560  37.588  1.00 4.45  ? 150  HIS A N     1 
ATOM   1079  C  CA    . HIS A 1 149  ? -48.006 -69.731  37.263  1.00 4.77  ? 150  HIS A CA    1 
ATOM   1080  C  C     . HIS A 1 149  ? -48.373 -68.836  38.456  1.00 5.64  ? 150  HIS A C     1 
ATOM   1081  O  O     . HIS A 1 149  ? -48.440 -67.604  38.326  1.00 6.22  ? 150  HIS A O     1 
ATOM   1082  C  CB    . HIS A 1 149  ? -49.213 -70.599  36.864  1.00 4.22  ? 150  HIS A CB    1 
ATOM   1083  C  CG    . HIS A 1 149  ? -50.524 -69.884  36.972  1.00 4.30  ? 150  HIS A CG    1 
ATOM   1084  N  ND1   . HIS A 1 149  ? -51.147 -69.661  38.179  1.00 3.90  ? 150  HIS A ND1   1 
ATOM   1085  C  CD2   . HIS A 1 149  ? -51.287 -69.265  36.040  1.00 4.33  ? 150  HIS A CD2   1 
ATOM   1086  C  CE1   . HIS A 1 149  ? -52.231 -68.933  37.991  1.00 3.56  ? 150  HIS A CE1   1 
ATOM   1087  N  NE2   . HIS A 1 149  ? -52.340 -68.679  36.701  1.00 3.87  ? 150  HIS A NE2   1 
ATOM   1088  N  N     . ASP A 1 150  ? -48.613 -69.459  39.611  1.00 5.84  ? 151  ASP A N     1 
ATOM   1089  C  CA    . ASP A 1 150  ? -48.998 -68.743  40.819  1.00 5.63  ? 151  ASP A CA    1 
ATOM   1090  C  C     . ASP A 1 150  ? -47.912 -67.741  41.182  1.00 6.16  ? 151  ASP A C     1 
ATOM   1091  O  O     . ASP A 1 150  ? -48.138 -66.534  41.156  1.00 6.59  ? 151  ASP A O     1 
ATOM   1092  C  CB    . ASP A 1 150  ? -49.172 -69.702  41.993  1.00 5.32  ? 151  ASP A CB    1 
ATOM   1093  C  CG    . ASP A 1 150  ? -50.209 -70.795  41.751  1.00 4.91  ? 151  ASP A CG    1 
ATOM   1094  O  OD1   . ASP A 1 150  ? -50.774 -70.948  40.653  1.00 4.31  ? 151  ASP A OD1   1 
ATOM   1095  O  OD2   . ASP A 1 150  ? -50.449 -71.538  42.713  1.00 5.31  ? 151  ASP A OD2   1 
ATOM   1096  N  N     . MET A 1 151  ? -46.723 -68.246  41.505  1.00 6.27  ? 152  MET A N     1 
ATOM   1097  C  CA    . MET A 1 151  ? -45.601 -67.391  41.883  1.00 6.55  ? 152  MET A CA    1 
ATOM   1098  C  C     . MET A 1 151  ? -45.330 -66.252  40.909  1.00 6.44  ? 152  MET A C     1 
ATOM   1099  O  O     . MET A 1 151  ? -44.802 -65.224  41.306  1.00 6.93  ? 152  MET A O     1 
ATOM   1100  C  CB    . MET A 1 151  ? -44.339 -68.220  42.079  1.00 7.45  ? 152  MET A CB    1 
ATOM   1101  C  CG    . MET A 1 151  ? -43.873 -68.289  43.522  1.00 9.78  ? 152  MET A CG    1 
ATOM   1102  S  SD    . MET A 1 151  ? -45.224 -68.555  44.714  1.00 12.04 ? 152  MET A SD    1 
ATOM   1103  C  CE    . MET A 1 151  ? -44.580 -69.809  45.759  1.00 12.08 ? 152  MET A CE    1 
ATOM   1104  N  N     . ALA A 1 152  ? -45.672 -66.426  39.636  1.00 5.58  ? 153  ALA A N     1 
ATOM   1105  C  CA    . ALA A 1 152  ? -45.451 -65.352  38.681  1.00 4.57  ? 153  ALA A CA    1 
ATOM   1106  C  C     . ALA A 1 152  ? -46.507 -64.307  38.948  1.00 4.00  ? 153  ALA A C     1 
ATOM   1107  O  O     . ALA A 1 152  ? -46.258 -63.109  38.847  1.00 3.93  ? 153  ALA A O     1 
ATOM   1108  C  CB    . ALA A 1 152  ? -45.557 -65.851  37.270  1.00 4.51  ? 153  ALA A CB    1 
ATOM   1109  N  N     . LEU A 1 153  ? -47.704 -64.768  39.273  1.00 3.23  ? 154  LEU A N     1 
ATOM   1110  C  CA    . LEU A 1 153  ? -48.781 -63.853  39.567  1.00 2.62  ? 154  LEU A CA    1 
ATOM   1111  C  C     . LEU A 1 153  ? -48.398 -63.068  40.822  1.00 2.39  ? 154  LEU A C     1 
ATOM   1112  O  O     . LEU A 1 153  ? -48.402 -61.838  40.801  1.00 2.49  ? 154  LEU A O     1 
ATOM   1113  C  CB    . LEU A 1 153  ? -50.074 -64.626  39.815  1.00 2.42  ? 154  LEU A CB    1 
ATOM   1114  C  CG    . LEU A 1 153  ? -51.419 -64.003  39.412  1.00 2.40  ? 154  LEU A CG    1 
ATOM   1115  C  CD1   . LEU A 1 153  ? -52.508 -64.626  40.250  1.00 2.00  ? 154  LEU A CD1   1 
ATOM   1116  C  CD2   . LEU A 1 153  ? -51.403 -62.486  39.551  1.00 2.00  ? 154  LEU A CD2   1 
ATOM   1117  N  N     . VAL A 1 154  ? -48.028 -63.776  41.892  1.00 2.00  ? 155  VAL A N     1 
ATOM   1118  C  CA    . VAL A 1 154  ? -47.662 -63.113  43.133  1.00 2.00  ? 155  VAL A CA    1 
ATOM   1119  C  C     . VAL A 1 154  ? -46.630 -62.050  42.921  1.00 2.00  ? 155  VAL A C     1 
ATOM   1120  O  O     . VAL A 1 154  ? -46.733 -60.968  43.436  1.00 2.13  ? 155  VAL A O     1 
ATOM   1121  C  CB    . VAL A 1 154  ? -47.065 -64.051  44.120  1.00 2.00  ? 155  VAL A CB    1 
ATOM   1122  C  CG1   . VAL A 1 154  ? -46.485 -63.257  45.253  1.00 2.00  ? 155  VAL A CG1   1 
ATOM   1123  C  CG2   . VAL A 1 154  ? -48.124 -65.014  44.620  1.00 2.31  ? 155  VAL A CG2   1 
ATOM   1124  N  N     . ALA A 1 155  ? -45.616 -62.392  42.149  1.00 2.79  ? 156  ALA A N     1 
ATOM   1125  C  CA    . ALA A 1 155  ? -44.510 -61.488  41.853  1.00 2.74  ? 156  ALA A CA    1 
ATOM   1126  C  C     . ALA A 1 155  ? -44.927 -60.206  41.147  1.00 2.57  ? 156  ALA A C     1 
ATOM   1127  O  O     . ALA A 1 155  ? -44.302 -59.170  41.337  1.00 2.38  ? 156  ALA A O     1 
ATOM   1128  C  CB    . ALA A 1 155  ? -43.433 -62.224  41.030  1.00 2.44  ? 156  ALA A CB    1 
ATOM   1129  N  N     . HIS A 1 156  ? -45.950 -60.288  40.305  1.00 2.65  ? 157  HIS A N     1 
ATOM   1130  C  CA    . HIS A 1 156  ? -46.420 -59.118  39.580  1.00 2.75  ? 157  HIS A CA    1 
ATOM   1131  C  C     . HIS A 1 156  ? -47.211 -58.184  40.461  1.00 2.68  ? 157  HIS A C     1 
ATOM   1132  O  O     . HIS A 1 156  ? -46.932 -57.001  40.548  1.00 3.07  ? 157  HIS A O     1 
ATOM   1133  C  CB    . HIS A 1 156  ? -47.259 -59.549  38.397  1.00 2.80  ? 157  HIS A CB    1 
ATOM   1134  C  CG    . HIS A 1 156  ? -46.460 -59.763  37.163  1.00 3.07  ? 157  HIS A CG    1 
ATOM   1135  N  ND1   . HIS A 1 156  ? -46.039 -58.716  36.372  1.00 3.46  ? 157  HIS A ND1   1 
ATOM   1136  C  CD2   . HIS A 1 156  ? -45.974 -60.889  36.600  1.00 3.15  ? 157  HIS A CD2   1 
ATOM   1137  C  CE1   . HIS A 1 156  ? -45.321 -59.189  35.372  1.00 3.81  ? 157  HIS A CE1   1 
ATOM   1138  N  NE2   . HIS A 1 156  ? -45.264 -60.506  35.487  1.00 4.00  ? 157  HIS A NE2   1 
ATOM   1139  N  N     . LEU A 1 157  ? -48.174 -58.742  41.161  1.00 2.48  ? 158  LEU A N     1 
ATOM   1140  C  CA    . LEU A 1 157  ? -49.002 -57.955  42.041  1.00 2.32  ? 158  LEU A CA    1 
ATOM   1141  C  C     . LEU A 1 157  ? -48.185 -57.300  43.155  1.00 2.19  ? 158  LEU A C     1 
ATOM   1142  O  O     . LEU A 1 157  ? -48.331 -56.115  43.422  1.00 2.84  ? 158  LEU A O     1 
ATOM   1143  C  CB    . LEU A 1 157  ? -50.080 -58.853  42.641  1.00 2.00  ? 158  LEU A CB    1 
ATOM   1144  C  CG    . LEU A 1 157  ? -50.966 -59.517  41.594  1.00 2.00  ? 158  LEU A CG    1 
ATOM   1145  C  CD1   . LEU A 1 157  ? -51.642 -60.733  42.172  1.00 2.00  ? 158  LEU A CD1   1 
ATOM   1146  C  CD2   . LEU A 1 157  ? -51.977 -58.520  41.063  1.00 2.00  ? 158  LEU A CD2   1 
ATOM   1147  N  N     . ALA A 1 158  ? -47.299 -58.072  43.767  1.00 2.00  ? 159  ALA A N     1 
ATOM   1148  C  CA    . ALA A 1 158  ? -46.509 -57.590  44.871  1.00 2.00  ? 159  ALA A CA    1 
ATOM   1149  C  C     . ALA A 1 158  ? -45.587 -56.488  44.462  1.00 2.44  ? 159  ALA A C     1 
ATOM   1150  O  O     . ALA A 1 158  ? -45.252 -55.632  45.280  1.00 2.95  ? 159  ALA A O     1 
ATOM   1151  C  CB    . ALA A 1 158  ? -45.730 -58.695  45.458  1.00 2.00  ? 159  ALA A CB    1 
ATOM   1152  N  N     . ALA A 1 159  ? -45.176 -56.510  43.193  1.00 2.72  ? 160  ALA A N     1 
ATOM   1153  C  CA    . ALA A 1 159  ? -44.239 -55.515  42.644  1.00 2.62  ? 160  ALA A CA    1 
ATOM   1154  C  C     . ALA A 1 159  ? -44.943 -54.211  42.483  1.00 3.06  ? 160  ALA A C     1 
ATOM   1155  O  O     . ALA A 1 159  ? -44.385 -53.160  42.751  1.00 3.40  ? 160  ALA A O     1 
ATOM   1156  C  CB    . ALA A 1 159  ? -43.717 -55.958  41.291  1.00 2.00  ? 160  ALA A CB    1 
ATOM   1157  N  N     . ILE A 1 160  ? -46.167 -54.299  41.976  1.00 3.56  ? 161  ILE A N     1 
ATOM   1158  C  CA    . ILE A 1 160  ? -47.000 -53.147  41.730  1.00 3.26  ? 161  ILE A CA    1 
ATOM   1159  C  C     . ILE A 1 160  ? -47.256 -52.422  43.023  1.00 3.56  ? 161  ILE A C     1 
ATOM   1160  O  O     . ILE A 1 160  ? -47.112 -51.221  43.103  1.00 3.54  ? 161  ILE A O     1 
ATOM   1161  C  CB    . ILE A 1 160  ? -48.329 -53.576  41.088  1.00 2.57  ? 161  ILE A CB    1 
ATOM   1162  C  CG1   . ILE A 1 160  ? -48.109 -54.021  39.647  1.00 2.00  ? 161  ILE A CG1   1 
ATOM   1163  C  CG2   . ILE A 1 160  ? -49.290 -52.437  41.114  1.00 2.58  ? 161  ILE A CG2   1 
ATOM   1164  C  CD1   . ILE A 1 160  ? -49.341 -54.525  38.989  1.00 2.00  ? 161  ILE A CD1   1 
ATOM   1165  N  N     . GLU A 1 161  ? -47.529 -53.177  44.062  1.00 4.55  ? 162  GLU A N     1 
ATOM   1166  C  CA    . GLU A 1 161  ? -47.838 -52.580  45.325  1.00 6.60  ? 162  GLU A CA    1 
ATOM   1167  C  C     . GLU A 1 161  ? -46.641 -52.118  46.125  1.00 7.61  ? 162  GLU A C     1 
ATOM   1168  O  O     . GLU A 1 161  ? -46.676 -51.042  46.721  1.00 8.28  ? 162  GLU A O     1 
ATOM   1169  C  CB    . GLU A 1 161  ? -48.641 -53.551  46.171  1.00 7.77  ? 162  GLU A CB    1 
ATOM   1170  C  CG    . GLU A 1 161  ? -49.575 -52.843  47.120  1.00 9.90  ? 162  GLU A CG    1 
ATOM   1171  C  CD    . GLU A 1 161  ? -50.113 -53.744  48.212  1.00 11.49 ? 162  GLU A CD    1 
ATOM   1172  O  OE1   . GLU A 1 161  ? -50.703 -54.802  47.889  1.00 11.41 ? 162  GLU A OE1   1 
ATOM   1173  O  OE2   . GLU A 1 161  ? -49.953 -53.378  49.408  1.00 13.16 ? 162  GLU A OE2   1 
ATOM   1174  N  N     . SER A 1 162  ? -45.580 -52.924  46.131  1.00 8.23  ? 163  SER A N     1 
ATOM   1175  C  CA    . SER A 1 162  ? -44.377 -52.650  46.912  1.00 8.33  ? 163  SER A CA    1 
ATOM   1176  C  C     . SER A 1 162  ? -43.349 -51.669  46.334  1.00 9.33  ? 163  SER A C     1 
ATOM   1177  O  O     . SER A 1 162  ? -42.601 -51.047  47.099  1.00 9.92  ? 163  SER A O     1 
ATOM   1178  C  CB    . SER A 1 162  ? -43.692 -53.966  47.201  1.00 8.04  ? 163  SER A CB    1 
ATOM   1179  O  OG    . SER A 1 162  ? -43.220 -54.509  45.992  1.00 7.72  ? 163  SER A OG    1 
ATOM   1180  N  N     . ASN A 1 163  ? -43.300 -51.571  44.996  1.00 9.47  ? 164  ASN A N     1 
ATOM   1181  C  CA    . ASN A 1 163  ? -42.392 -50.707  44.219  1.00 8.62  ? 164  ASN A CA    1 
ATOM   1182  C  C     . ASN A 1 163  ? -40.961 -51.194  44.254  1.00 7.62  ? 164  ASN A C     1 
ATOM   1183  O  O     . ASN A 1 163  ? -40.029 -50.452  43.913  1.00 7.97  ? 164  ASN A O     1 
ATOM   1184  C  CB    . ASN A 1 163  ? -42.484 -49.230  44.626  1.00 9.96  ? 164  ASN A CB    1 
ATOM   1185  C  CG    . ASN A 1 163  ? -43.599 -48.467  43.875  1.00 12.42 ? 164  ASN A CG    1 
ATOM   1186  O  OD1   . ASN A 1 163  ? -44.788 -48.786  44.015  1.00 14.02 ? 164  ASN A OD1   1 
ATOM   1187  N  ND2   . ASN A 1 163  ? -43.217 -47.434  43.094  1.00 12.87 ? 164  ASN A ND2   1 
ATOM   1188  N  N     . VAL A 1 164  ? -40.821 -52.460  44.648  1.00 5.71  ? 165  VAL A N     1 
ATOM   1189  C  CA    . VAL A 1 164  ? -39.562 -53.179  44.749  1.00 4.56  ? 165  VAL A CA    1 
ATOM   1190  C  C     . VAL A 1 164  ? -39.681 -54.209  43.622  1.00 4.62  ? 165  VAL A C     1 
ATOM   1191  O  O     . VAL A 1 164  ? -40.567 -55.058  43.641  1.00 5.08  ? 165  VAL A O     1 
ATOM   1192  C  CB    . VAL A 1 164  ? -39.502 -53.849  46.126  1.00 3.91  ? 165  VAL A CB    1 
ATOM   1193  C  CG1   . VAL A 1 164  ? -38.460 -54.933  46.186  1.00 3.49  ? 165  VAL A CG1   1 
ATOM   1194  C  CG2   . VAL A 1 164  ? -39.204 -52.812  47.142  1.00 3.65  ? 165  VAL A CG2   1 
ATOM   1195  N  N     . PRO A 1 165  ? -38.778 -54.166  42.632  1.00 4.30  ? 166  PRO A N     1 
ATOM   1196  C  CA    . PRO A 1 165  ? -38.847 -55.108  41.516  1.00 3.73  ? 166  PRO A CA    1 
ATOM   1197  C  C     . PRO A 1 165  ? -38.774 -56.503  42.007  1.00 3.24  ? 166  PRO A C     1 
ATOM   1198  O  O     . PRO A 1 165  ? -38.257 -56.744  43.087  1.00 2.83  ? 166  PRO A O     1 
ATOM   1199  C  CB    . PRO A 1 165  ? -37.600 -54.792  40.710  1.00 3.85  ? 166  PRO A CB    1 
ATOM   1200  C  CG    . PRO A 1 165  ? -37.259 -53.423  41.101  1.00 4.76  ? 166  PRO A CG    1 
ATOM   1201  C  CD    . PRO A 1 165  ? -37.519 -53.425  42.576  1.00 4.65  ? 166  PRO A CD    1 
ATOM   1202  N  N     . PHE A 1 166  ? -39.226 -57.422  41.165  1.00 3.05  ? 167  PHE A N     1 
ATOM   1203  C  CA    . PHE A 1 166  ? -39.234 -58.833  41.492  1.00 2.78  ? 167  PHE A CA    1 
ATOM   1204  C  C     . PHE A 1 166  ? -38.570 -59.680  40.421  1.00 2.91  ? 167  PHE A C     1 
ATOM   1205  O  O     . PHE A 1 166  ? -38.657 -59.373  39.251  1.00 3.36  ? 167  PHE A O     1 
ATOM   1206  C  CB    . PHE A 1 166  ? -40.680 -59.294  41.649  1.00 2.50  ? 167  PHE A CB    1 
ATOM   1207  C  CG    . PHE A 1 166  ? -41.104 -59.463  43.065  1.00 2.00  ? 167  PHE A CG    1 
ATOM   1208  C  CD1   . PHE A 1 166  ? -41.300 -58.354  43.874  1.00 2.00  ? 167  PHE A CD1   1 
ATOM   1209  C  CD2   . PHE A 1 166  ? -41.286 -60.733  43.594  1.00 2.00  ? 167  PHE A CD2   1 
ATOM   1210  C  CE1   . PHE A 1 166  ? -41.672 -58.495  45.198  1.00 2.00  ? 167  PHE A CE1   1 
ATOM   1211  C  CE2   . PHE A 1 166  ? -41.653 -60.899  44.899  1.00 2.01  ? 167  PHE A CE2   1 
ATOM   1212  C  CZ    . PHE A 1 166  ? -41.850 -59.763  45.718  1.00 2.24  ? 167  PHE A CZ    1 
ATOM   1213  N  N     . MET A 1 167  ? -37.824 -60.688  40.838  1.00 2.77  ? 168  MET A N     1 
ATOM   1214  C  CA    . MET A 1 167  ? -37.219 -61.624  39.909  1.00 3.06  ? 168  MET A CA    1 
ATOM   1215  C  C     . MET A 1 167  ? -37.875 -62.928  40.325  1.00 2.98  ? 168  MET A C     1 
ATOM   1216  O  O     . MET A 1 167  ? -37.804 -63.319  41.487  1.00 3.46  ? 168  MET A O     1 
ATOM   1217  C  CB    . MET A 1 167  ? -35.719 -61.741  40.112  1.00 3.89  ? 168  MET A CB    1 
ATOM   1218  C  CG    . MET A 1 167  ? -35.170 -63.102  39.669  1.00 4.82  ? 168  MET A CG    1 
ATOM   1219  S  SD    . MET A 1 167  ? -33.414 -63.332  39.986  1.00 6.57  ? 168  MET A SD    1 
ATOM   1220  C  CE    . MET A 1 167  ? -32.770 -62.256  38.694  1.00 6.13  ? 168  MET A CE    1 
ATOM   1221  N  N     . HIS A 1 168  ? -38.559 -63.576  39.402  1.00 2.30  ? 169  HIS A N     1 
ATOM   1222  C  CA    . HIS A 1 168  ? -39.242 -64.815  39.705  1.00 2.44  ? 169  HIS A CA    1 
ATOM   1223  C  C     . HIS A 1 168  ? -38.470 -65.834  38.921  1.00 2.59  ? 169  HIS A C     1 
ATOM   1224  O  O     . HIS A 1 168  ? -38.279 -65.653  37.723  1.00 2.95  ? 169  HIS A O     1 
ATOM   1225  C  CB    . HIS A 1 168  ? -40.689 -64.679  39.233  1.00 2.77  ? 169  HIS A CB    1 
ATOM   1226  C  CG    . HIS A 1 168  ? -41.345 -65.966  38.865  1.00 3.23  ? 169  HIS A CG    1 
ATOM   1227  N  ND1   . HIS A 1 168  ? -41.352 -67.069  39.686  1.00 4.28  ? 169  HIS A ND1   1 
ATOM   1228  C  CD2   . HIS A 1 168  ? -42.065 -66.310  37.775  1.00 3.75  ? 169  HIS A CD2   1 
ATOM   1229  C  CE1   . HIS A 1 168  ? -42.049 -68.037  39.118  1.00 4.15  ? 169  HIS A CE1   1 
ATOM   1230  N  NE2   . HIS A 1 168  ? -42.493 -67.600  37.955  1.00 4.05  ? 169  HIS A NE2   1 
ATOM   1231  N  N     . PHE A 1 169  ? -37.951 -66.859  39.590  1.00 2.51  ? 170  PHE A N     1 
ATOM   1232  C  CA    . PHE A 1 169  ? -37.156 -67.870  38.895  1.00 2.37  ? 170  PHE A CA    1 
ATOM   1233  C  C     . PHE A 1 169  ? -37.616 -69.274  39.173  1.00 2.61  ? 170  PHE A C     1 
ATOM   1234  O  O     . PHE A 1 169  ? -38.236 -69.541  40.193  1.00 3.98  ? 170  PHE A O     1 
ATOM   1235  C  CB    . PHE A 1 169  ? -35.676 -67.751  39.263  1.00 2.00  ? 170  PHE A CB    1 
ATOM   1236  C  CG    . PHE A 1 169  ? -35.365 -68.083  40.707  1.00 2.18  ? 170  PHE A CG    1 
ATOM   1237  C  CD1   . PHE A 1 169  ? -35.499 -67.125  41.703  1.00 2.02  ? 170  PHE A CD1   1 
ATOM   1238  C  CD2   . PHE A 1 169  ? -34.882 -69.338  41.060  1.00 2.00  ? 170  PHE A CD2   1 
ATOM   1239  C  CE1   . PHE A 1 169  ? -35.150 -67.407  43.011  1.00 2.00  ? 170  PHE A CE1   1 
ATOM   1240  C  CE2   . PHE A 1 169  ? -34.539 -69.620  42.355  1.00 2.00  ? 170  PHE A CE2   1 
ATOM   1241  C  CZ    . PHE A 1 169  ? -34.670 -68.647  43.334  1.00 2.00  ? 170  PHE A CZ    1 
ATOM   1242  N  N     . PHE A 1 170  ? -37.344 -70.161  38.238  1.00 2.00  ? 171  PHE A N     1 
ATOM   1243  C  CA    . PHE A 1 170  ? -37.689 -71.546  38.365  1.00 2.00  ? 171  PHE A CA    1 
ATOM   1244  C  C     . PHE A 1 170  ? -36.518 -72.275  37.700  1.00 2.07  ? 171  PHE A C     1 
ATOM   1245  O  O     . PHE A 1 170  ? -35.819 -71.687  36.911  1.00 2.53  ? 171  PHE A O     1 
ATOM   1246  C  CB    . PHE A 1 170  ? -39.083 -71.841  37.740  1.00 2.11  ? 171  PHE A CB    1 
ATOM   1247  C  CG    . PHE A 1 170  ? -39.378 -71.139  36.413  1.00 2.00  ? 171  PHE A CG    1 
ATOM   1248  C  CD1   . PHE A 1 170  ? -39.620 -69.770  36.352  1.00 2.43  ? 171  PHE A CD1   1 
ATOM   1249  C  CD2   . PHE A 1 170  ? -39.472 -71.863  35.234  1.00 2.00  ? 171  PHE A CD2   1 
ATOM   1250  C  CE1   . PHE A 1 170  ? -39.950 -69.147  35.139  1.00 2.00  ? 171  PHE A CE1   1 
ATOM   1251  C  CE2   . PHE A 1 170  ? -39.795 -71.251  34.033  1.00 2.00  ? 171  PHE A CE2   1 
ATOM   1252  C  CZ    . PHE A 1 170  ? -40.031 -69.906  33.988  1.00 2.00  ? 171  PHE A CZ    1 
ATOM   1253  N  N     . ASP A 1 171  ? -36.240 -73.518  38.049  1.00 2.00  ? 172  ASP A N     1 
ATOM   1254  C  CA    . ASP A 1 171  ? -35.109 -74.185  37.447  1.00 2.00  ? 172  ASP A CA    1 
ATOM   1255  C  C     . ASP A 1 171  ? -35.191 -74.334  35.956  1.00 2.00  ? 172  ASP A C     1 
ATOM   1256  O  O     . ASP A 1 171  ? -36.252 -74.600  35.423  1.00 2.39  ? 172  ASP A O     1 
ATOM   1257  C  CB    . ASP A 1 171  ? -34.889 -75.497  38.139  1.00 2.00  ? 172  ASP A CB    1 
ATOM   1258  C  CG    . ASP A 1 171  ? -34.623 -75.299  39.599  1.00 2.69  ? 172  ASP A CG    1 
ATOM   1259  O  OD1   . ASP A 1 171  ? -34.257 -74.158  39.968  1.00 2.17  ? 172  ASP A OD1   1 
ATOM   1260  O  OD2   . ASP A 1 171  ? -34.785 -76.251  40.391  1.00 3.15  ? 172  ASP A OD2   1 
ATOM   1261  N  N     . GLY A 1 172  ? -34.066 -74.099  35.280  1.00 2.31  ? 173  GLY A N     1 
ATOM   1262  C  CA    . GLY A 1 172  ? -33.988 -74.187  33.832  1.00 2.00  ? 173  GLY A CA    1 
ATOM   1263  C  C     . GLY A 1 172  ? -34.120 -75.610  33.373  1.00 2.00  ? 173  GLY A C     1 
ATOM   1264  O  O     . GLY A 1 172  ? -33.376 -76.461  33.797  1.00 2.00  ? 173  GLY A O     1 
ATOM   1265  N  N     . PHE A 1 173  ? -35.059 -75.841  32.470  1.00 2.44  ? 174  PHE A N     1 
ATOM   1266  C  CA    . PHE A 1 173  ? -35.369 -77.149  31.914  1.00 2.66  ? 174  PHE A CA    1 
ATOM   1267  C  C     . PHE A 1 173  ? -36.216 -78.050  32.829  1.00 3.49  ? 174  PHE A C     1 
ATOM   1268  O  O     . PHE A 1 173  ? -37.264 -78.535  32.402  1.00 4.06  ? 174  PHE A O     1 
ATOM   1269  C  CB    . PHE A 1 173  ? -34.113 -77.857  31.420  1.00 2.00  ? 174  PHE A CB    1 
ATOM   1270  C  CG    . PHE A 1 173  ? -33.565 -77.290  30.146  1.00 2.17  ? 174  PHE A CG    1 
ATOM   1271  C  CD1   . PHE A 1 173  ? -34.100 -77.660  28.908  1.00 3.06  ? 174  PHE A CD1   1 
ATOM   1272  C  CD2   . PHE A 1 173  ? -32.516 -76.398  30.161  1.00 2.00  ? 174  PHE A CD2   1 
ATOM   1273  C  CE1   . PHE A 1 173  ? -33.592 -77.143  27.712  1.00 2.00  ? 174  PHE A CE1   1 
ATOM   1274  C  CE2   . PHE A 1 173  ? -32.007 -75.888  28.984  1.00 2.00  ? 174  PHE A CE2   1 
ATOM   1275  C  CZ    . PHE A 1 173  ? -32.549 -76.263  27.763  1.00 2.00  ? 174  PHE A CZ    1 
ATOM   1276  N  N     . ARG A 1 174  ? -35.815 -78.227  34.091  1.00 3.49  ? 175  ARG A N     1 
ATOM   1277  C  CA    . ARG A 1 174  ? -36.558 -79.076  35.037  1.00 3.13  ? 175  ARG A CA    1 
ATOM   1278  C  C     . ARG A 1 174  ? -37.904 -78.502  35.456  1.00 2.97  ? 175  ARG A C     1 
ATOM   1279  O  O     . ARG A 1 174  ? -38.660 -79.125  36.199  1.00 3.91  ? 175  ARG A O     1 
ATOM   1280  C  CB    . ARG A 1 174  ? -35.729 -79.360  36.299  1.00 2.95  ? 175  ARG A CB    1 
ATOM   1281  C  CG    . ARG A 1 174  ? -35.566 -80.836  36.588  1.00 3.28  ? 175  ARG A CG    1 
ATOM   1282  C  CD    . ARG A 1 174  ? -36.909 -81.550  36.548  1.00 2.96  ? 175  ARG A CD    1 
ATOM   1283  N  NE    . ARG A 1 174  ? -36.814 -82.966  36.195  1.00 3.14  ? 175  ARG A NE    1 
ATOM   1284  C  CZ    . ARG A 1 174  ? -37.776 -83.614  35.557  1.00 3.45  ? 175  ARG A CZ    1 
ATOM   1285  N  NH1   . ARG A 1 174  ? -38.870 -82.959  35.209  1.00 3.05  ? 175  ARG A NH1   1 
ATOM   1286  N  NH2   . ARG A 1 174  ? -37.671 -84.911  35.298  1.00 3.95  ? 175  ARG A NH2   1 
ATOM   1287  N  N     . THR A 1 175  ? -38.194 -77.297  35.021  1.00 2.37  ? 176  THR A N     1 
ATOM   1288  C  CA    . THR A 1 175  ? -39.458 -76.694  35.358  1.00 2.46  ? 176  THR A CA    1 
ATOM   1289  C  C     . THR A 1 175  ? -39.880 -75.895  34.165  1.00 3.06  ? 176  THR A C     1 
ATOM   1290  O  O     . THR A 1 175  ? -41.003 -76.023  33.682  1.00 3.29  ? 176  THR A O     1 
ATOM   1291  C  CB    . THR A 1 175  ? -39.327 -75.829  36.575  1.00 2.00  ? 176  THR A CB    1 
ATOM   1292  O  OG1   . THR A 1 175  ? -39.130 -76.682  37.704  1.00 3.10  ? 176  THR A OG1   1 
ATOM   1293  C  CG2   . THR A 1 175  ? -40.564 -75.022  36.782  1.00 2.00  ? 176  THR A CG2   1 
ATOM   1294  N  N     . SER A 1 176  ? -38.927 -75.160  33.615  1.00 3.38  ? 177  SER A N     1 
ATOM   1295  C  CA    . SER A 1 176  ? -39.180 -74.347  32.458  1.00 3.37  ? 177  SER A CA    1 
ATOM   1296  C  C     . SER A 1 176  ? -39.663 -75.269  31.372  1.00 4.20  ? 177  SER A C     1 
ATOM   1297  O  O     . SER A 1 176  ? -40.677 -74.982  30.739  1.00 5.66  ? 177  SER A O     1 
ATOM   1298  C  CB    . SER A 1 176  ? -37.904 -73.680  32.002  1.00 2.60  ? 177  SER A CB    1 
ATOM   1299  O  OG    . SER A 1 176  ? -37.035 -74.625  31.446  1.00 2.00  ? 177  SER A OG    1 
ATOM   1300  N  N     . HIS A 1 177  ? -39.045 -76.440  31.264  1.00 3.72  ? 178  HIS A N     1 
ATOM   1301  C  CA    . HIS A 1 177  ? -39.396 -77.368  30.219  1.00 3.57  ? 178  HIS A CA    1 
ATOM   1302  C  C     . HIS A 1 177  ? -40.126 -78.618  30.634  1.00 4.20  ? 178  HIS A C     1 
ATOM   1303  O  O     . HIS A 1 177  ? -40.017 -79.644  29.964  1.00 5.08  ? 178  HIS A O     1 
ATOM   1304  C  CB    . HIS A 1 177  ? -38.139 -77.777  29.482  1.00 3.70  ? 178  HIS A CB    1 
ATOM   1305  C  CG    . HIS A 1 177  ? -37.658 -76.749  28.521  1.00 3.99  ? 178  HIS A CG    1 
ATOM   1306  N  ND1   . HIS A 1 177  ? -37.348 -75.461  28.901  1.00 4.52  ? 178  HIS A ND1   1 
ATOM   1307  C  CD2   . HIS A 1 177  ? -37.427 -76.811  27.190  1.00 4.19  ? 178  HIS A CD2   1 
ATOM   1308  C  CE1   . HIS A 1 177  ? -36.958 -74.765  27.846  1.00 4.76  ? 178  HIS A CE1   1 
ATOM   1309  N  NE2   . HIS A 1 177  ? -36.998 -75.567  26.795  1.00 5.36  ? 178  HIS A NE2   1 
ATOM   1310  N  N     . GLU A 1 178  ? -40.871 -78.576  31.722  1.00 4.52  ? 179  GLU A N     1 
ATOM   1311  C  CA    . GLU A 1 178  ? -41.574 -79.793  32.117  1.00 4.99  ? 179  GLU A CA    1 
ATOM   1312  C  C     . GLU A 1 178  ? -43.050 -79.648  31.862  1.00 5.20  ? 179  GLU A C     1 
ATOM   1313  O  O     . GLU A 1 178  ? -43.687 -78.757  32.435  1.00 5.48  ? 179  GLU A O     1 
ATOM   1314  C  CB    . GLU A 1 178  ? -41.331 -80.082  33.598  1.00 5.52  ? 179  GLU A CB    1 
ATOM   1315  C  CG    . GLU A 1 178  ? -42.030 -81.316  34.124  1.00 5.81  ? 179  GLU A CG    1 
ATOM   1316  C  CD    . GLU A 1 178  ? -41.872 -81.458  35.619  1.00 6.92  ? 179  GLU A CD    1 
ATOM   1317  O  OE1   . GLU A 1 178  ? -40.728 -81.467  36.122  1.00 6.48  ? 179  GLU A OE1   1 
ATOM   1318  O  OE2   . GLU A 1 178  ? -42.909 -81.537  36.301  1.00 8.15  ? 179  GLU A OE2   1 
ATOM   1319  N  N     . ILE A 1 179  ? -43.598 -80.484  30.982  1.00 5.14  ? 180  ILE A N     1 
ATOM   1320  C  CA    . ILE A 1 179  ? -45.034 -80.416  30.745  1.00 5.40  ? 180  ILE A CA    1 
ATOM   1321  C  C     . ILE A 1 179  ? -45.720 -81.036  31.995  1.00 5.62  ? 180  ILE A C     1 
ATOM   1322  O  O     . ILE A 1 179  ? -45.174 -81.922  32.638  1.00 5.84  ? 180  ILE A O     1 
ATOM   1323  C  CB    . ILE A 1 179  ? -45.494 -80.995  29.330  1.00 5.13  ? 180  ILE A CB    1 
ATOM   1324  C  CG1   . ILE A 1 179  ? -46.412 -82.185  29.476  1.00 5.96  ? 180  ILE A CG1   1 
ATOM   1325  C  CG2   . ILE A 1 179  ? -44.347 -81.330  28.414  1.00 4.30  ? 180  ILE A CG2   1 
ATOM   1326  C  CD1   . ILE A 1 179  ? -47.711 -81.969  28.719  1.00 6.23  ? 180  ILE A CD1   1 
ATOM   1327  N  N     . GLN A 1 180  ? -46.856 -80.493  32.406  1.00 5.55  ? 181  GLN A N     1 
ATOM   1328  C  CA    . GLN A 1 180  ? -47.525 -80.972  33.602  1.00 5.36  ? 181  GLN A CA    1 
ATOM   1329  C  C     . GLN A 1 180  ? -48.948 -80.412  33.552  1.00 5.48  ? 181  GLN A C     1 
ATOM   1330  O  O     . GLN A 1 180  ? -49.152 -79.333  33.017  1.00 6.23  ? 181  GLN A O     1 
ATOM   1331  C  CB    . GLN A 1 180  ? -46.755 -80.418  34.798  1.00 5.64  ? 181  GLN A CB    1 
ATOM   1332  C  CG    . GLN A 1 180  ? -47.256 -80.822  36.171  1.00 6.60  ? 181  GLN A CG    1 
ATOM   1333  C  CD    . GLN A 1 180  ? -46.636 -82.115  36.691  1.00 7.34  ? 181  GLN A CD    1 
ATOM   1334  O  OE1   . GLN A 1 180  ? -45.411 -82.316  36.616  1.00 6.55  ? 181  GLN A OE1   1 
ATOM   1335  N  NE2   . GLN A 1 180  ? -47.484 -82.995  37.250  1.00 7.53  ? 181  GLN A NE2   1 
ATOM   1336  N  N     . LYS A 1 181  ? -49.932 -81.139  34.078  1.00 5.76  ? 182  LYS A N     1 
ATOM   1337  C  CA    . LYS A 1 181  ? -51.339 -80.700  34.052  1.00 5.72  ? 182  LYS A CA    1 
ATOM   1338  C  C     . LYS A 1 181  ? -51.591 -79.723  35.185  1.00 5.55  ? 182  LYS A C     1 
ATOM   1339  O  O     . LYS A 1 181  ? -51.613 -80.117  36.354  1.00 5.89  ? 182  LYS A O     1 
ATOM   1340  C  CB    . LYS A 1 181  ? -52.259 -81.915  34.216  1.00 6.38  ? 182  LYS A CB    1 
ATOM   1341  C  CG    . LYS A 1 181  ? -53.571 -81.825  33.462  1.00 7.00  ? 182  LYS A CG    1 
ATOM   1342  C  CD    . LYS A 1 181  ? -54.704 -82.378  34.291  1.00 7.16  ? 182  LYS A CD    1 
ATOM   1343  C  CE    . LYS A 1 181  ? -55.051 -83.788  33.896  1.00 7.90  ? 182  LYS A CE    1 
ATOM   1344  N  NZ    . LYS A 1 181  ? -56.027 -84.393  34.859  1.00 8.34  ? 182  LYS A NZ    1 
ATOM   1345  N  N     . ILE A 1 182  ? -51.787 -78.451  34.847  1.00 4.98  ? 183  ILE A N     1 
ATOM   1346  C  CA    . ILE A 1 182  ? -51.996 -77.416  35.857  1.00 4.54  ? 183  ILE A CA    1 
ATOM   1347  C  C     . ILE A 1 182  ? -53.298 -76.664  35.708  1.00 4.72  ? 183  ILE A C     1 
ATOM   1348  O  O     . ILE A 1 182  ? -54.024 -76.859  34.746  1.00 4.26  ? 183  ILE A O     1 
ATOM   1349  C  CB    . ILE A 1 182  ? -50.836 -76.386  35.870  1.00 3.78  ? 183  ILE A CB    1 
ATOM   1350  C  CG1   . ILE A 1 182  ? -50.774 -75.627  34.544  1.00 3.05  ? 183  ILE A CG1   1 
ATOM   1351  C  CG2   . ILE A 1 182  ? -49.521 -77.087  36.130  1.00 3.78  ? 183  ILE A CG2   1 
ATOM   1352  C  CD1   . ILE A 1 182  ? -49.560 -74.782  34.391  1.00 2.00  ? 183  ILE A CD1   1 
ATOM   1353  N  N     . GLU A 1 183  ? -53.548 -75.770  36.658  1.00 5.41  ? 184  GLU A N     1 
ATOM   1354  C  CA    . GLU A 1 183  ? -54.757 -74.964  36.695  1.00 6.23  ? 184  GLU A CA    1 
ATOM   1355  C  C     . GLU A 1 183  ? -54.314 -73.538  36.553  1.00 5.96  ? 184  GLU A C     1 
ATOM   1356  O  O     . GLU A 1 183  ? -53.541 -73.057  37.366  1.00 6.26  ? 184  GLU A O     1 
ATOM   1357  C  CB    . GLU A 1 183  ? -55.438 -75.165  38.062  1.00 7.81  ? 184  GLU A CB    1 
ATOM   1358  C  CG    . GLU A 1 183  ? -56.682 -74.309  38.350  1.00 10.31 ? 184  GLU A CG    1 
ATOM   1359  C  CD    . GLU A 1 183  ? -56.455 -73.207  39.415  1.00 12.13 ? 184  GLU A CD    1 
ATOM   1360  O  OE1   . GLU A 1 183  ? -55.935 -72.096  39.083  1.00 12.36 ? 184  GLU A OE1   1 
ATOM   1361  O  OE2   . GLU A 1 183  ? -56.854 -73.439  40.591  1.00 13.24 ? 184  GLU A OE2   1 
ATOM   1362  N  N     . VAL A 1 184  ? -54.757 -72.858  35.512  1.00 5.84  ? 185  VAL A N     1 
ATOM   1363  C  CA    . VAL A 1 184  ? -54.381 -71.468  35.329  1.00 6.61  ? 185  VAL A CA    1 
ATOM   1364  C  C     . VAL A 1 184  ? -55.481 -70.495  35.753  1.00 7.09  ? 185  VAL A C     1 
ATOM   1365  O  O     . VAL A 1 184  ? -56.461 -70.885  36.378  1.00 7.48  ? 185  VAL A O     1 
ATOM   1366  C  CB    . VAL A 1 184  ? -53.933 -71.208  33.891  1.00 6.60  ? 185  VAL A CB    1 
ATOM   1367  C  CG1   . VAL A 1 184  ? -52.569 -71.849  33.652  1.00 6.44  ? 185  VAL A CG1   1 
ATOM   1368  C  CG2   . VAL A 1 184  ? -54.944 -71.769  32.922  1.00 6.35  ? 185  VAL A CG2   1 
ATOM   1369  N  N     . LEU A 1 185  ? -55.281 -69.209  35.514  1.00 7.39  ? 186  LEU A N     1 
ATOM   1370  C  CA    . LEU A 1 185  ? -56.293 -68.224  35.887  1.00 7.69  ? 186  LEU A CA    1 
ATOM   1371  C  C     . LEU A 1 185  ? -56.588 -67.317  34.716  1.00 8.53  ? 186  LEU A C     1 
ATOM   1372  O  O     . LEU A 1 185  ? -55.757 -67.121  33.830  1.00 9.34  ? 186  LEU A O     1 
ATOM   1373  C  CB    . LEU A 1 185  ? -55.863 -67.371  37.086  1.00 6.82  ? 186  LEU A CB    1 
ATOM   1374  C  CG    . LEU A 1 185  ? -56.022 -67.911  38.501  1.00 6.47  ? 186  LEU A CG    1 
ATOM   1375  C  CD1   . LEU A 1 185  ? -55.518 -66.911  39.475  1.00 6.58  ? 186  LEU A CD1   1 
ATOM   1376  C  CD2   . LEU A 1 185  ? -57.445 -68.192  38.807  1.00 6.88  ? 186  LEU A CD2   1 
ATOM   1377  N  N     . ASP A 1 186  ? -57.783 -66.760  34.721  1.00 8.78  ? 187  ASP A N     1 
ATOM   1378  C  CA    . ASP A 1 186  ? -58.191 -65.878  33.674  1.00 8.92  ? 187  ASP A CA    1 
ATOM   1379  C  C     . ASP A 1 186  ? -57.629 -64.555  33.971  1.00 8.20  ? 187  ASP A C     1 
ATOM   1380  O  O     . ASP A 1 186  ? -57.457 -64.196  35.137  1.00 8.34  ? 187  ASP A O     1 
ATOM   1381  C  CB    . ASP A 1 186  ? -59.693 -65.803  33.628  1.00 11.06 ? 187  ASP A CB    1 
ATOM   1382  C  CG    . ASP A 1 186  ? -60.293 -67.094  33.183  1.00 13.77 ? 187  ASP A CG    1 
ATOM   1383  O  OD1   . ASP A 1 186  ? -59.546 -67.939  32.628  1.00 15.64 ? 187  ASP A OD1   1 
ATOM   1384  O  OD2   . ASP A 1 186  ? -61.507 -67.283  33.390  1.00 15.94 ? 187  ASP A OD2   1 
ATOM   1385  N  N     . TYR A 1 187  ? -57.379 -63.809  32.912  1.00 7.24  ? 188  TYR A N     1 
ATOM   1386  C  CA    . TYR A 1 187  ? -56.808 -62.498  33.061  1.00 7.02  ? 188  TYR A CA    1 
ATOM   1387  C  C     . TYR A 1 187  ? -57.665 -61.616  33.955  1.00 7.06  ? 188  TYR A C     1 
ATOM   1388  O  O     . TYR A 1 187  ? -57.140 -60.911  34.808  1.00 7.68  ? 188  TYR A O     1 
ATOM   1389  C  CB    . TYR A 1 187  ? -56.520 -61.888  31.681  1.00 6.54  ? 188  TYR A CB    1 
ATOM   1390  C  CG    . TYR A 1 187  ? -55.334 -62.545  30.982  1.00 6.68  ? 188  TYR A CG    1 
ATOM   1391  C  CD1   . TYR A 1 187  ? -54.771 -63.718  31.486  1.00 7.08  ? 188  TYR A CD1   1 
ATOM   1392  C  CD2   . TYR A 1 187  ? -54.722 -61.959  29.871  1.00 7.44  ? 188  TYR A CD2   1 
ATOM   1393  C  CE1   . TYR A 1 187  ? -53.637 -64.285  30.925  1.00 6.75  ? 188  TYR A CE1   1 
ATOM   1394  C  CE2   . TYR A 1 187  ? -53.568 -62.531  29.293  1.00 7.03  ? 188  TYR A CE2   1 
ATOM   1395  C  CZ    . TYR A 1 187  ? -53.039 -63.692  29.835  1.00 6.86  ? 188  TYR A CZ    1 
ATOM   1396  O  OH    . TYR A 1 187  ? -51.907 -64.269  29.315  1.00 6.52  ? 188  TYR A OH    1 
ATOM   1397  N  N     . ALA A 1 188  ? -58.982 -61.769  33.862  1.00 6.99  ? 189  ALA A N     1 
ATOM   1398  C  CA    . ALA A 1 188  ? -59.899 -60.977  34.658  1.00 7.30  ? 189  ALA A CA    1 
ATOM   1399  C  C     . ALA A 1 188  ? -59.673 -61.162  36.127  1.00 8.21  ? 189  ALA A C     1 
ATOM   1400  O  O     . ALA A 1 188  ? -59.919 -60.241  36.911  1.00 9.47  ? 189  ALA A O     1 
ATOM   1401  C  CB    . ALA A 1 188  ? -61.303 -61.319  34.329  1.00 6.89  ? 189  ALA A CB    1 
ATOM   1402  N  N     . ASP A 1 189  ? -59.240 -62.357  36.511  1.00 8.54  ? 190  ASP A N     1 
ATOM   1403  C  CA    . ASP A 1 189  ? -58.987 -62.655  37.911  1.00 8.85  ? 190  ASP A CA    1 
ATOM   1404  C  C     . ASP A 1 189  ? -57.676 -62.023  38.353  1.00 8.29  ? 190  ASP A C     1 
ATOM   1405  O  O     . ASP A 1 189  ? -57.551 -61.511  39.470  1.00 8.86  ? 190  ASP A O     1 
ATOM   1406  C  CB    . ASP A 1 189  ? -58.983 -64.162  38.120  1.00 10.90 ? 190  ASP A CB    1 
ATOM   1407  C  CG    . ASP A 1 189  ? -60.358 -64.771  37.926  1.00 12.99 ? 190  ASP A CG    1 
ATOM   1408  O  OD1   . ASP A 1 189  ? -61.145 -64.197  37.144  1.00 13.92 ? 190  ASP A OD1   1 
ATOM   1409  O  OD2   . ASP A 1 189  ? -60.675 -65.812  38.556  1.00 14.65 ? 190  ASP A OD2   1 
ATOM   1410  N  N     . MET A 1 190  ? -56.690 -62.061  37.472  1.00 6.83  ? 191  MET A N     1 
ATOM   1411  C  CA    . MET A 1 190  ? -55.422 -61.452  37.768  1.00 4.99  ? 191  MET A CA    1 
ATOM   1412  C  C     . MET A 1 190  ? -55.699 -59.970  37.903  1.00 4.45  ? 191  MET A C     1 
ATOM   1413  O  O     . MET A 1 190  ? -55.349 -59.351  38.901  1.00 4.51  ? 191  MET A O     1 
ATOM   1414  C  CB    . MET A 1 190  ? -54.459 -61.721  36.635  1.00 4.23  ? 191  MET A CB    1 
ATOM   1415  C  CG    . MET A 1 190  ? -53.982 -63.148  36.606  1.00 3.26  ? 191  MET A CG    1 
ATOM   1416  S  SD    . MET A 1 190  ? -53.218 -63.447  35.053  1.00 2.00  ? 191  MET A SD    1 
ATOM   1417  C  CE    . MET A 1 190  ? -53.459 -65.184  34.881  1.00 2.06  ? 191  MET A CE    1 
ATOM   1418  N  N     . ALA A 1 191  ? -56.453 -59.434  36.956  1.00 3.97  ? 192  ALA A N     1 
ATOM   1419  C  CA    . ALA A 1 191  ? -56.803 -58.020  36.957  1.00 3.41  ? 192  ALA A CA    1 
ATOM   1420  C  C     . ALA A 1 191  ? -57.468 -57.613  38.229  1.00 3.29  ? 192  ALA A C     1 
ATOM   1421  O  O     . ALA A 1 191  ? -57.245 -56.523  38.736  1.00 3.50  ? 192  ALA A O     1 
ATOM   1422  C  CB    . ALA A 1 191  ? -57.712 -57.725  35.837  1.00 3.33  ? 192  ALA A CB    1 
ATOM   1423  N  N     . SER A 1 192  ? -58.267 -58.510  38.772  1.00 3.44  ? 193  SER A N     1 
ATOM   1424  C  CA    . SER A 1 192  ? -58.986 -58.195  39.971  1.00 4.22  ? 193  SER A CA    1 
ATOM   1425  C  C     . SER A 1 192  ? -58.173 -58.109  41.238  1.00 5.10  ? 193  SER A C     1 
ATOM   1426  O  O     . SER A 1 192  ? -58.701 -57.664  42.243  1.00 6.54  ? 193  SER A O     1 
ATOM   1427  C  CB    . SER A 1 192  ? -60.138 -59.160  40.165  1.00 4.27  ? 193  SER A CB    1 
ATOM   1428  O  OG    . SER A 1 192  ? -59.718 -60.374  40.750  1.00 5.55  ? 193  SER A OG    1 
ATOM   1429  N  N     . LEU A 1 193  ? -56.912 -58.539  41.227  1.00 5.60  ? 194  LEU A N     1 
ATOM   1430  C  CA    . LEU A 1 193  ? -56.077 -58.492  42.440  1.00 5.36  ? 194  LEU A CA    1 
ATOM   1431  C  C     . LEU A 1 193  ? -55.179 -57.267  42.503  1.00 5.58  ? 194  LEU A C     1 
ATOM   1432  O  O     . LEU A 1 193  ? -54.503 -57.051  43.511  1.00 5.74  ? 194  LEU A O     1 
ATOM   1433  C  CB    . LEU A 1 193  ? -55.181 -59.734  42.539  1.00 5.40  ? 194  LEU A CB    1 
ATOM   1434  C  CG    . LEU A 1 193  ? -55.610 -61.073  43.151  1.00 5.85  ? 194  LEU A CG    1 
ATOM   1435  C  CD1   . LEU A 1 193  ? -56.936 -60.949  43.809  1.00 5.91  ? 194  LEU A CD1   1 
ATOM   1436  C  CD2   . LEU A 1 193  ? -55.660 -62.160  42.115  1.00 6.02  ? 194  LEU A CD2   1 
ATOM   1437  N  N     . VAL A 1 194  ? -55.164 -56.487  41.419  1.00 5.85  ? 195  VAL A N     1 
ATOM   1438  C  CA    . VAL A 1 194  ? -54.317 -55.295  41.298  1.00 6.20  ? 195  VAL A CA    1 
ATOM   1439  C  C     . VAL A 1 194  ? -54.680 -54.083  42.131  1.00 6.93  ? 195  VAL A C     1 
ATOM   1440  O  O     . VAL A 1 194  ? -55.742 -53.484  41.974  1.00 7.96  ? 195  VAL A O     1 
ATOM   1441  C  CB    . VAL A 1 194  ? -54.226 -54.774  39.845  1.00 5.38  ? 195  VAL A CB    1 
ATOM   1442  C  CG1   . VAL A 1 194  ? -53.339 -53.548  39.783  1.00 4.26  ? 195  VAL A CG1   1 
ATOM   1443  C  CG2   . VAL A 1 194  ? -53.703 -55.835  38.933  1.00 5.76  ? 195  VAL A CG2   1 
ATOM   1444  N  N     . ASN A 1 195  ? -53.729 -53.659  42.936  1.00 7.35  ? 196  ASN A N     1 
ATOM   1445  C  CA    . ASN A 1 195  ? -53.892 -52.478  43.758  1.00 7.49  ? 196  ASN A CA    1 
ATOM   1446  C  C     . ASN A 1 195  ? -53.913 -51.312  42.762  1.00 8.12  ? 196  ASN A C     1 
ATOM   1447  O  O     . ASN A 1 195  ? -52.898 -50.993  42.145  1.00 8.18  ? 196  ASN A O     1 
ATOM   1448  C  CB    . ASN A 1 195  ? -52.676 -52.375  44.653  1.00 7.23  ? 196  ASN A CB    1 
ATOM   1449  C  CG    . ASN A 1 195  ? -52.906 -51.532  45.826  1.00 6.28  ? 196  ASN A CG    1 
ATOM   1450  O  OD1   . ASN A 1 195  ? -53.255 -50.377  45.703  1.00 6.38  ? 196  ASN A OD1   1 
ATOM   1451  N  ND2   . ASN A 1 195  ? -52.687 -52.097  47.000  1.00 6.70  ? 196  ASN A ND2   1 
ATOM   1452  N  N     . GLN A 1 196  ? -55.082 -50.715  42.573  1.00 8.55  ? 197  GLN A N     1 
ATOM   1453  C  CA    . GLN A 1 196  ? -55.244 -49.610  41.643  1.00 8.39  ? 197  GLN A CA    1 
ATOM   1454  C  C     . GLN A 1 196  ? -54.694 -48.301  42.169  1.00 8.66  ? 197  GLN A C     1 
ATOM   1455  O  O     . GLN A 1 196  ? -54.258 -47.455  41.400  1.00 8.23  ? 197  GLN A O     1 
ATOM   1456  C  CB    . GLN A 1 196  ? -56.700 -49.425  41.397  1.00 8.46  ? 197  GLN A CB    1 
ATOM   1457  C  CG    . GLN A 1 196  ? -57.386 -50.713  41.299  1.00 9.28  ? 197  GLN A CG    1 
ATOM   1458  C  CD    . GLN A 1 196  ? -57.345 -51.238  39.914  1.00 10.43 ? 197  GLN A CD    1 
ATOM   1459  O  OE1   . GLN A 1 196  ? -57.210 -50.470  38.945  1.00 10.05 ? 197  GLN A OE1   1 
ATOM   1460  N  NE2   . GLN A 1 196  ? -57.505 -52.560  39.782  1.00 11.73 ? 197  GLN A NE2   1 
ATOM   1461  N  N     . LYS A 1 197  ? -54.782 -48.102  43.475  1.00 9.19  ? 198  LYS A N     1 
ATOM   1462  C  CA    . LYS A 1 197  ? -54.285 -46.869  44.057  1.00 10.61 ? 198  LYS A CA    1 
ATOM   1463  C  C     . LYS A 1 197  ? -52.792 -46.874  43.857  1.00 10.86 ? 198  LYS A C     1 
ATOM   1464  O  O     . LYS A 1 197  ? -52.186 -45.831  43.675  1.00 11.89 ? 198  LYS A O     1 
ATOM   1465  C  CB    . LYS A 1 197  ? -54.561 -46.782  45.565  1.00 11.63 ? 198  LYS A CB    1 
ATOM   1466  C  CG    . LYS A 1 197  ? -55.917 -47.311  46.017  1.00 14.05 ? 198  LYS A CG    1 
ATOM   1467  C  CD    . LYS A 1 197  ? -55.827 -48.747  46.580  1.00 15.22 ? 198  LYS A CD    1 
ATOM   1468  C  CE    . LYS A 1 197  ? -57.149 -49.504  46.453  1.00 15.45 ? 198  LYS A CE    1 
ATOM   1469  N  NZ    . LYS A 1 197  ? -57.478 -49.701  45.002  1.00 15.95 ? 198  LYS A NZ    1 
ATOM   1470  N  N     . ALA A 1 198  ? -52.197 -48.062  43.908  1.00 10.59 ? 199  ALA A N     1 
ATOM   1471  C  CA    . ALA A 1 198  ? -50.756 -48.192  43.776  1.00 9.40  ? 199  ALA A CA    1 
ATOM   1472  C  C     . ALA A 1 198  ? -50.403 -48.021  42.344  1.00 8.57  ? 199  ALA A C     1 
ATOM   1473  O  O     . ALA A 1 198  ? -49.456 -47.340  42.018  1.00 9.55  ? 199  ALA A O     1 
ATOM   1474  C  CB    . ALA A 1 198  ? -50.283 -49.544  44.284  1.00 9.20  ? 199  ALA A CB    1 
ATOM   1475  N  N     . LEU A 1 199  ? -51.214 -48.591  41.475  1.00 7.72  ? 200  LEU A N     1 
ATOM   1476  C  CA    . LEU A 1 199  ? -50.950 -48.509  40.055  1.00 6.77  ? 200  LEU A CA    1 
ATOM   1477  C  C     . LEU A 1 199  ? -51.159 -47.116  39.539  1.00 7.31  ? 200  LEU A C     1 
ATOM   1478  O  O     . LEU A 1 199  ? -50.452 -46.680  38.659  1.00 8.21  ? 200  LEU A O     1 
ATOM   1479  C  CB    . LEU A 1 199  ? -51.846 -49.478  39.298  1.00 5.22  ? 200  LEU A CB    1 
ATOM   1480  C  CG    . LEU A 1 199  ? -51.843 -49.515  37.783  1.00 3.75  ? 200  LEU A CG    1 
ATOM   1481  C  CD1   . LEU A 1 199  ? -50.459 -49.672  37.226  1.00 2.87  ? 200  LEU A CD1   1 
ATOM   1482  C  CD2   . LEU A 1 199  ? -52.698 -50.679  37.372  1.00 3.37  ? 200  LEU A CD2   1 
ATOM   1483  N  N     . ALA A 1 200  ? -52.111 -46.386  40.089  1.00 7.65  ? 201  ALA A N     1 
ATOM   1484  C  CA    . ALA A 1 200  ? -52.352 -45.052  39.575  1.00 7.69  ? 201  ALA A CA    1 
ATOM   1485  C  C     . ALA A 1 200  ? -51.240 -44.122  40.025  1.00 8.02  ? 201  ALA A C     1 
ATOM   1486  O  O     . ALA A 1 200  ? -50.959 -43.100  39.392  1.00 8.53  ? 201  ALA A O     1 
ATOM   1487  C  CB    . ALA A 1 200  ? -53.700 -44.567  40.023  1.00 7.29  ? 201  ALA A CB    1 
ATOM   1488  N  N     . GLU A 1 201  ? -50.560 -44.532  41.087  1.00 8.29  ? 202  GLU A N     1 
ATOM   1489  C  CA    . GLU A 1 201  ? -49.468 -43.760  41.661  1.00 8.38  ? 202  GLU A CA    1 
ATOM   1490  C  C     . GLU A 1 201  ? -48.165 -44.004  40.912  1.00 7.23  ? 202  GLU A C     1 
ATOM   1491  O  O     . GLU A 1 201  ? -47.332 -43.107  40.780  1.00 7.94  ? 202  GLU A O     1 
ATOM   1492  C  CB    . GLU A 1 201  ? -49.353 -44.056  43.164  1.00 9.57  ? 202  GLU A CB    1 
ATOM   1493  C  CG    . GLU A 1 201  ? -50.547 -43.472  43.926  1.00 11.99 ? 202  GLU A CG    1 
ATOM   1494  C  CD    . GLU A 1 201  ? -50.557 -43.742  45.425  1.00 13.62 ? 202  GLU A CD    1 
ATOM   1495  O  OE1   . GLU A 1 201  ? -49.828 -44.666  45.895  1.00 13.86 ? 202  GLU A OE1   1 
ATOM   1496  O  OE2   . GLU A 1 201  ? -51.332 -43.016  46.117  1.00 14.16 ? 202  GLU A OE2   1 
ATOM   1497  N  N     . PHE A 1 202  ? -47.996 -45.225  40.436  1.00 5.49  ? 203  PHE A N     1 
ATOM   1498  C  CA    . PHE A 1 202  ? -46.844 -45.587  39.652  1.00 4.37  ? 203  PHE A CA    1 
ATOM   1499  C  C     . PHE A 1 202  ? -46.918 -44.635  38.455  1.00 4.08  ? 203  PHE A C     1 
ATOM   1500  O  O     . PHE A 1 202  ? -45.975 -43.954  38.111  1.00 4.21  ? 203  PHE A O     1 
ATOM   1501  C  CB    . PHE A 1 202  ? -47.010 -47.048  39.252  1.00 3.84  ? 203  PHE A CB    1 
ATOM   1502  C  CG    . PHE A 1 202  ? -46.142 -47.478  38.131  1.00 3.48  ? 203  PHE A CG    1 
ATOM   1503  C  CD1   . PHE A 1 202  ? -44.766 -47.259  38.172  1.00 3.03  ? 203  PHE A CD1   1 
ATOM   1504  C  CD2   . PHE A 1 202  ? -46.699 -48.096  37.035  1.00 3.09  ? 203  PHE A CD2   1 
ATOM   1505  C  CE1   . PHE A 1 202  ? -43.959 -47.640  37.142  1.00 2.86  ? 203  PHE A CE1   1 
ATOM   1506  C  CE2   . PHE A 1 202  ? -45.903 -48.489  35.983  1.00 3.59  ? 203  PHE A CE2   1 
ATOM   1507  C  CZ    . PHE A 1 202  ? -44.522 -48.258  36.031  1.00 3.66  ? 203  PHE A CZ    1 
ATOM   1508  N  N     . ARG A 1 203  ? -48.112 -44.455  37.940  1.00 4.17  ? 204  ARG A N     1 
ATOM   1509  C  CA    . ARG A 1 203  ? -48.330 -43.563  36.817  1.00 4.22  ? 204  ARG A CA    1 
ATOM   1510  C  C     . ARG A 1 203  ? -47.924 -42.130  37.085  1.00 4.07  ? 204  ARG A C     1 
ATOM   1511  O  O     . ARG A 1 203  ? -47.400 -41.469  36.194  1.00 4.85  ? 204  ARG A O     1 
ATOM   1512  C  CB    . ARG A 1 203  ? -49.817 -43.539  36.425  1.00 4.65  ? 204  ARG A CB    1 
ATOM   1513  C  CG    . ARG A 1 203  ? -50.173 -44.273  35.140  1.00 4.56  ? 204  ARG A CG    1 
ATOM   1514  C  CD    . ARG A 1 203  ? -50.440 -45.745  35.355  1.00 3.32  ? 204  ARG A CD    1 
ATOM   1515  N  NE    . ARG A 1 203  ? -49.880 -46.475  34.233  1.00 2.68  ? 204  ARG A NE    1 
ATOM   1516  C  CZ    . ARG A 1 203  ? -50.246 -47.692  33.879  1.00 3.04  ? 204  ARG A CZ    1 
ATOM   1517  N  NH1   . ARG A 1 203  ? -51.171 -48.336  34.558  1.00 3.75  ? 204  ARG A NH1   1 
ATOM   1518  N  NH2   . ARG A 1 203  ? -49.691 -48.260  32.836  1.00 2.56  ? 204  ARG A NH2   1 
ATOM   1519  N  N     . ALA A 1 204  ? -48.230 -41.616  38.271  1.00 3.46  ? 205  ALA A N     1 
ATOM   1520  C  CA    . ALA A 1 204  ? -47.926 -40.223  38.558  1.00 3.17  ? 205  ALA A CA    1 
ATOM   1521  C  C     . ALA A 1 204  ? -46.512 -39.975  38.951  1.00 3.60  ? 205  ALA A C     1 
ATOM   1522  O  O     . ALA A 1 204  ? -46.004 -38.885  38.736  1.00 3.93  ? 205  ALA A O     1 
ATOM   1523  C  CB    . ALA A 1 204  ? -48.823 -39.699  39.603  1.00 3.69  ? 205  ALA A CB    1 
ATOM   1524  N  N     . LYS A 1 205  ? -45.883 -40.977  39.557  1.00 3.67  ? 206  LYS A N     1 
ATOM   1525  C  CA    . LYS A 1 205  ? -44.494 -40.882  39.984  1.00 3.08  ? 206  LYS A CA    1 
ATOM   1526  C  C     . LYS A 1 205  ? -43.557 -40.875  38.781  1.00 2.82  ? 206  LYS A C     1 
ATOM   1527  O  O     . LYS A 1 205  ? -42.447 -40.373  38.866  1.00 2.69  ? 206  LYS A O     1 
ATOM   1528  C  CB    . LYS A 1 205  ? -44.175 -42.037  40.964  1.00 3.27  ? 206  LYS A CB    1 
ATOM   1529  C  CG    . LYS A 1 205  ? -43.134 -43.086  40.549  1.00 3.87  ? 206  LYS A CG    1 
ATOM   1530  C  CD    . LYS A 1 205  ? -42.841 -44.051  41.715  1.00 3.97  ? 206  LYS A CD    1 
ATOM   1531  C  CE    . LYS A 1 205  ? -41.555 -44.891  41.524  1.00 5.47  ? 206  LYS A CE    1 
ATOM   1532  N  NZ    . LYS A 1 205  ? -40.244 -44.146  41.224  1.00 5.59  ? 206  LYS A NZ    1 
ATOM   1533  N  N     . SER A 1 206  ? -44.066 -41.341  37.639  1.00 2.81  ? 207  SER A N     1 
ATOM   1534  C  CA    . SER A 1 206  ? -43.316 -41.456  36.397  1.00 2.89  ? 207  SER A CA    1 
ATOM   1535  C  C     . SER A 1 206  ? -42.837 -40.202  35.719  1.00 3.49  ? 207  SER A C     1 
ATOM   1536  O  O     . SER A 1 206  ? -43.245 -39.093  36.055  1.00 4.50  ? 207  SER A O     1 
ATOM   1537  C  CB    . SER A 1 206  ? -44.098 -42.274  35.392  1.00 2.37  ? 207  SER A CB    1 
ATOM   1538  O  OG    . SER A 1 206  ? -43.970 -43.641  35.692  1.00 2.21  ? 207  SER A OG    1 
ATOM   1539  N  N     . MET A 1 207  ? -41.963 -40.393  34.741  1.00 3.38  ? 208  MET A N     1 
ATOM   1540  C  CA    . MET A 1 207  ? -41.415 -39.291  33.993  1.00 3.88  ? 208  MET A CA    1 
ATOM   1541  C  C     . MET A 1 207  ? -42.490 -38.749  33.077  1.00 4.41  ? 208  MET A C     1 
ATOM   1542  O  O     . MET A 1 207  ? -43.325 -39.506  32.604  1.00 5.42  ? 208  MET A O     1 
ATOM   1543  C  CB    . MET A 1 207  ? -40.252 -39.798  33.154  1.00 4.05  ? 208  MET A CB    1 
ATOM   1544  C  CG    . MET A 1 207  ? -38.997 -40.105  33.940  1.00 4.21  ? 208  MET A CG    1 
ATOM   1545  S  SD    . MET A 1 207  ? -37.657 -40.783  32.925  1.00 5.73  ? 208  MET A SD    1 
ATOM   1546  C  CE    . MET A 1 207  ? -37.534 -39.639  31.628  1.00 4.19  ? 208  MET A CE    1 
ATOM   1547  N  N     . ASN A 1 208  ? -42.505 -37.439  32.860  1.00 4.68  ? 209  ASN A N     1 
ATOM   1548  C  CA    . ASN A 1 208  ? -43.467 -36.815  31.947  1.00 4.44  ? 209  ASN A CA    1 
ATOM   1549  C  C     . ASN A 1 208  ? -43.115 -35.356  31.866  1.00 5.12  ? 209  ASN A C     1 
ATOM   1550  O  O     . ASN A 1 208  ? -43.049 -34.697  32.890  1.00 5.56  ? 209  ASN A O     1 
ATOM   1551  C  CB    . ASN A 1 208  ? -44.863 -36.933  32.489  1.00 3.96  ? 209  ASN A CB    1 
ATOM   1552  C  CG    . ASN A 1 208  ? -45.878 -36.801  31.427  1.00 3.48  ? 209  ASN A CG    1 
ATOM   1553  O  OD1   . ASN A 1 208  ? -46.271 -35.708  31.062  1.00 3.62  ? 209  ASN A OD1   1 
ATOM   1554  N  ND2   . ASN A 1 208  ? -46.309 -37.924  30.899  1.00 3.64  ? 209  ASN A ND2   1 
ATOM   1555  N  N     . PRO A 1 209  ? -42.966 -34.803  30.657  1.00 5.71  ? 210  PRO A N     1 
ATOM   1556  C  CA    . PRO A 1 209  ? -42.606 -33.396  30.475  1.00 6.47  ? 210  PRO A CA    1 
ATOM   1557  C  C     . PRO A 1 209  ? -43.643 -32.428  30.970  1.00 7.60  ? 210  PRO A C     1 
ATOM   1558  O  O     . PRO A 1 209  ? -43.399 -31.237  31.035  1.00 8.27  ? 210  PRO A O     1 
ATOM   1559  C  CB    . PRO A 1 209  ? -42.459 -33.273  28.974  1.00 6.27  ? 210  PRO A CB    1 
ATOM   1560  C  CG    . PRO A 1 209  ? -42.214 -34.653  28.525  1.00 6.78  ? 210  PRO A CG    1 
ATOM   1561  C  CD    . PRO A 1 209  ? -43.178 -35.435  29.354  1.00 6.03  ? 210  PRO A CD    1 
ATOM   1562  N  N     . GLU A 1 210  ? -44.822 -32.937  31.285  1.00 8.88  ? 211  GLU A N     1 
ATOM   1563  C  CA    . GLU A 1 210  ? -45.893 -32.094  31.783  1.00 10.08 ? 211  GLU A CA    1 
ATOM   1564  C  C     . GLU A 1 210  ? -45.663 -31.778  33.269  1.00 9.85  ? 211  GLU A C     1 
ATOM   1565  O  O     . GLU A 1 210  ? -46.069 -30.728  33.770  1.00 10.57 ? 211  GLU A O     1 
ATOM   1566  C  CB    . GLU A 1 210  ? -47.232 -32.790  31.577  1.00 11.20 ? 211  GLU A CB    1 
ATOM   1567  C  CG    . GLU A 1 210  ? -48.262 -31.902  30.903  1.00 14.49 ? 211  GLU A CG    1 
ATOM   1568  C  CD    . GLU A 1 210  ? -48.202 -31.901  29.369  1.00 15.76 ? 211  GLU A CD    1 
ATOM   1569  O  OE1   . GLU A 1 210  ? -47.250 -32.463  28.771  1.00 16.56 ? 211  GLU A OE1   1 
ATOM   1570  O  OE2   . GLU A 1 210  ? -49.137 -31.317  28.759  1.00 17.11 ? 211  GLU A OE2   1 
ATOM   1571  N  N     . HIS A 1 211  ? -45.001 -32.699  33.955  1.00 8.73  ? 212  HIS A N     1 
ATOM   1572  C  CA    . HIS A 1 211  ? -44.678 -32.556  35.360  1.00 8.16  ? 212  HIS A CA    1 
ATOM   1573  C  C     . HIS A 1 211  ? -43.381 -33.342  35.522  1.00 8.22  ? 212  HIS A C     1 
ATOM   1574  O  O     . HIS A 1 211  ? -43.385 -34.495  35.977  1.00 9.26  ? 212  HIS A O     1 
ATOM   1575  C  CB    . HIS A 1 211  ? -45.787 -33.133  36.216  1.00 6.99  ? 212  HIS A CB    1 
ATOM   1576  C  CG    . HIS A 1 211  ? -46.108 -34.560  35.919  1.00 6.95  ? 212  HIS A CG    1 
ATOM   1577  N  ND1   . HIS A 1 211  ? -46.903 -34.937  34.861  1.00 7.85  ? 212  HIS A ND1   1 
ATOM   1578  C  CD2   . HIS A 1 211  ? -45.809 -35.698  36.583  1.00 7.40  ? 212  HIS A CD2   1 
ATOM   1579  C  CE1   . HIS A 1 211  ? -47.090 -36.245  34.891  1.00 7.03  ? 212  HIS A CE1   1 
ATOM   1580  N  NE2   . HIS A 1 211  ? -46.437 -36.731  35.926  1.00 6.94  ? 212  HIS A NE2   1 
ATOM   1581  N  N     . PRO A 1 212  ? -42.249 -32.716  35.155  1.00 7.22  ? 213  PRO A N     1 
ATOM   1582  C  CA    . PRO A 1 212  ? -40.916 -33.293  35.206  1.00 6.37  ? 213  PRO A CA    1 
ATOM   1583  C  C     . PRO A 1 212  ? -40.253 -33.313  36.549  1.00 6.34  ? 213  PRO A C     1 
ATOM   1584  O  O     . PRO A 1 212  ? -40.679 -32.620  37.469  1.00 6.81  ? 213  PRO A O     1 
ATOM   1585  C  CB    . PRO A 1 212  ? -40.160 -32.393  34.252  1.00 5.82  ? 213  PRO A CB    1 
ATOM   1586  C  CG    . PRO A 1 212  ? -40.670 -31.081  34.644  1.00 6.42  ? 213  PRO A CG    1 
ATOM   1587  C  CD    . PRO A 1 212  ? -42.168 -31.311  34.727  1.00 7.18  ? 213  PRO A CD    1 
ATOM   1588  N  N     . HIS A 1 213  ? -39.188 -34.118  36.616  1.00 5.97  ? 214  HIS A N     1 
ATOM   1589  C  CA    . HIS A 1 213  ? -38.324 -34.310  37.769  1.00 5.77  ? 214  HIS A CA    1 
ATOM   1590  C  C     . HIS A 1 213  ? -37.059 -34.939  37.204  1.00 6.06  ? 214  HIS A C     1 
ATOM   1591  O  O     . HIS A 1 213  ? -37.077 -35.509  36.108  1.00 6.37  ? 214  HIS A O     1 
ATOM   1592  C  CB    . HIS A 1 213  ? -38.945 -35.258  38.783  1.00 5.96  ? 214  HIS A CB    1 
ATOM   1593  C  CG    . HIS A 1 213  ? -38.991 -36.687  38.343  1.00 6.72  ? 214  HIS A CG    1 
ATOM   1594  N  ND1   . HIS A 1 213  ? -39.975 -37.184  37.516  1.00 7.43  ? 214  HIS A ND1   1 
ATOM   1595  C  CD2   . HIS A 1 213  ? -38.207 -37.746  38.662  1.00 7.08  ? 214  HIS A CD2   1 
ATOM   1596  C  CE1   . HIS A 1 213  ? -39.806 -38.484  37.348  1.00 7.08  ? 214  HIS A CE1   1 
ATOM   1597  N  NE2   . HIS A 1 213  ? -38.738 -38.847  38.035  1.00 7.38  ? 214  HIS A NE2   1 
ATOM   1598  N  N     . VAL A 1 214  ? -35.953 -34.820  37.924  1.00 5.90  ? 215  VAL A N     1 
ATOM   1599  C  CA    . VAL A 1 214  ? -34.711 -35.406  37.464  1.00 5.48  ? 215  VAL A CA    1 
ATOM   1600  C  C     . VAL A 1 214  ? -34.313 -36.567  38.348  1.00 5.54  ? 215  VAL A C     1 
ATOM   1601  O  O     . VAL A 1 214  ? -34.351 -36.475  39.567  1.00 5.89  ? 215  VAL A O     1 
ATOM   1602  C  CB    . VAL A 1 214  ? -33.570 -34.351  37.306  1.00 5.22  ? 215  VAL A CB    1 
ATOM   1603  C  CG1   . VAL A 1 214  ? -33.772 -33.205  38.239  1.00 4.98  ? 215  VAL A CG1   1 
ATOM   1604  C  CG2   . VAL A 1 214  ? -32.194 -34.980  37.533  1.00 5.17  ? 215  VAL A CG2   1 
ATOM   1605  N  N     . ARG A 1 215  ? -33.975 -37.674  37.701  1.00 5.62  ? 216  ARG A N     1 
ATOM   1606  C  CA    . ARG A 1 215  ? -33.553 -38.905  38.361  1.00 6.01  ? 216  ARG A CA    1 
ATOM   1607  C  C     . ARG A 1 215  ? -32.187 -39.359  37.815  1.00 6.09  ? 216  ARG A C     1 
ATOM   1608  O  O     . ARG A 1 215  ? -31.836 -39.060  36.668  1.00 6.04  ? 216  ARG A O     1 
ATOM   1609  C  CB    . ARG A 1 215  ? -34.583 -40.001  38.079  1.00 6.28  ? 216  ARG A CB    1 
ATOM   1610  C  CG    . ARG A 1 215  ? -34.652 -40.406  36.596  1.00 5.69  ? 216  ARG A CG    1 
ATOM   1611  C  CD    . ARG A 1 215  ? -35.955 -41.094  36.224  1.00 5.02  ? 216  ARG A CD    1 
ATOM   1612  N  NE    . ARG A 1 215  ? -36.196 -42.353  36.933  1.00 4.10  ? 216  ARG A NE    1 
ATOM   1613  C  CZ    . ARG A 1 215  ? -37.347 -42.657  37.524  1.00 3.03  ? 216  ARG A CZ    1 
ATOM   1614  N  NH1   . ARG A 1 215  ? -38.350 -41.787  37.515  1.00 2.00  ? 216  ARG A NH1   1 
ATOM   1615  N  NH2   . ARG A 1 215  ? -37.524 -43.863  38.035  1.00 2.34  ? 216  ARG A NH2   1 
ATOM   1616  N  N     . GLY A 1 216  ? -31.460 -40.142  38.603  1.00 5.55  ? 217  GLY A N     1 
ATOM   1617  C  CA    . GLY A 1 216  ? -30.172 -40.612  38.149  1.00 5.71  ? 217  GLY A CA    1 
ATOM   1618  C  C     . GLY A 1 216  ? -29.000 -39.788  38.669  1.00 6.40  ? 217  GLY A C     1 
ATOM   1619  O  O     . GLY A 1 216  ? -27.846 -40.246  38.617  1.00 6.96  ? 217  GLY A O     1 
ATOM   1620  N  N     . THR A 1 217  ? -29.283 -38.588  39.165  1.00 6.01  ? 218  THR A N     1 
ATOM   1621  C  CA    . THR A 1 217  ? -28.275 -37.682  39.733  1.00 6.09  ? 218  THR A CA    1 
ATOM   1622  C  C     . THR A 1 217  ? -27.000 -38.323  40.295  1.00 5.77  ? 218  THR A C     1 
ATOM   1623  O  O     . THR A 1 217  ? -27.020 -39.444  40.810  1.00 5.55  ? 218  THR A O     1 
ATOM   1624  C  CB    . THR A 1 217  ? -28.876 -36.853  40.899  1.00 6.66  ? 218  THR A CB    1 
ATOM   1625  O  OG1   . THR A 1 217  ? -28.687 -37.543  42.148  1.00 7.10  ? 218  THR A OG1   1 
ATOM   1626  C  CG2   . THR A 1 217  ? -30.366 -36.655  40.687  1.00 7.41  ? 218  THR A CG2   1 
ATOM   1627  N  N     . ALA A 1 218  ? -25.904 -37.569  40.231  1.00 5.72  ? 219  ALA A N     1 
ATOM   1628  C  CA    . ALA A 1 218  ? -24.604 -37.996  40.735  1.00 5.11  ? 219  ALA A CA    1 
ATOM   1629  C  C     . ALA A 1 218  ? -24.542 -37.361  42.112  1.00 5.22  ? 219  ALA A C     1 
ATOM   1630  O  O     . ALA A 1 218  ? -24.736 -36.156  42.220  1.00 5.28  ? 219  ALA A O     1 
ATOM   1631  C  CB    . ALA A 1 218  ? -23.511 -37.443  39.857  1.00 4.59  ? 219  ALA A CB    1 
ATOM   1632  N  N     . GLN A 1 219  ? -24.311 -38.164  43.154  1.00 5.36  ? 220  GLN A N     1 
ATOM   1633  C  CA    . GLN A 1 219  ? -24.253 -37.652  44.516  1.00 5.45  ? 220  GLN A CA    1 
ATOM   1634  C  C     . GLN A 1 219  ? -22.888 -37.848  45.132  1.00 6.09  ? 220  GLN A C     1 
ATOM   1635  O  O     . GLN A 1 219  ? -22.196 -38.832  44.846  1.00 6.06  ? 220  GLN A O     1 
ATOM   1636  C  CB    . GLN A 1 219  ? -25.336 -38.297  45.379  1.00 5.44  ? 220  GLN A CB    1 
ATOM   1637  C  CG    . GLN A 1 219  ? -26.748 -38.074  44.810  1.00 6.45  ? 220  GLN A CG    1 
ATOM   1638  C  CD    . GLN A 1 219  ? -27.880 -38.656  45.648  1.00 6.68  ? 220  GLN A CD    1 
ATOM   1639  O  OE1   . GLN A 1 219  ? -29.030 -38.210  45.553  1.00 6.57  ? 220  GLN A OE1   1 
ATOM   1640  N  NE2   . GLN A 1 219  ? -27.571 -39.664  46.449  1.00 6.83  ? 220  GLN A NE2   1 
ATOM   1641  N  N     . ASN A 1 220  ? -22.495 -36.884  45.969  1.00 6.76  ? 221  ASN A N     1 
ATOM   1642  C  CA    . ASN A 1 220  ? -21.194 -36.893  46.648  1.00 6.48  ? 221  ASN A CA    1 
ATOM   1643  C  C     . ASN A 1 220  ? -21.179 -37.714  47.936  1.00 5.83  ? 221  ASN A C     1 
ATOM   1644  O  O     . ASN A 1 220  ? -21.979 -38.627  48.088  1.00 5.96  ? 221  ASN A O     1 
ATOM   1645  C  CB    . ASN A 1 220  ? -20.697 -35.460  46.848  1.00 7.27  ? 221  ASN A CB    1 
ATOM   1646  C  CG    . ASN A 1 220  ? -19.976 -34.928  45.610  1.00 9.11  ? 221  ASN A CG    1 
ATOM   1647  O  OD1   . ASN A 1 220  ? -20.617 -34.449  44.664  1.00 9.67  ? 221  ASN A OD1   1 
ATOM   1648  N  ND2   . ASN A 1 220  ? -18.639 -35.067  45.582  1.00 9.52  ? 221  ASN A ND2   1 
ATOM   1649  N  N     . PRO A 1 221  ? -20.186 -37.517  48.812  1.00 5.22  ? 222  PRO A N     1 
ATOM   1650  C  CA    . PRO A 1 221  ? -20.294 -38.370  49.994  1.00 4.86  ? 222  PRO A CA    1 
ATOM   1651  C  C     . PRO A 1 221  ? -21.226 -37.846  51.079  1.00 5.13  ? 222  PRO A C     1 
ATOM   1652  O  O     . PRO A 1 221  ? -21.739 -38.632  51.911  1.00 5.84  ? 222  PRO A O     1 
ATOM   1653  C  CB    . PRO A 1 221  ? -18.852 -38.450  50.472  1.00 4.47  ? 222  PRO A CB    1 
ATOM   1654  C  CG    . PRO A 1 221  ? -18.089 -38.309  49.236  1.00 3.81  ? 222  PRO A CG    1 
ATOM   1655  C  CD    . PRO A 1 221  ? -18.776 -37.160  48.600  1.00 4.82  ? 222  PRO A CD    1 
ATOM   1656  N  N     . ASP A 1 222  ? -21.481 -36.542  51.049  1.00 4.22  ? 223  ASP A N     1 
ATOM   1657  C  CA    . ASP A 1 222  ? -22.329 -35.909  52.033  1.00 3.71  ? 223  ASP A CA    1 
ATOM   1658  C  C     . ASP A 1 222  ? -23.756 -36.435  52.073  1.00 3.72  ? 223  ASP A C     1 
ATOM   1659  O  O     . ASP A 1 222  ? -24.361 -36.516  53.146  1.00 3.82  ? 223  ASP A O     1 
ATOM   1660  C  CB    . ASP A 1 222  ? -22.323 -34.406  51.809  1.00 4.30  ? 223  ASP A CB    1 
ATOM   1661  C  CG    . ASP A 1 222  ? -22.613 -34.027  50.380  1.00 4.99  ? 223  ASP A CG    1 
ATOM   1662  O  OD1   . ASP A 1 222  ? -23.119 -34.886  49.613  1.00 4.74  ? 223  ASP A OD1   1 
ATOM   1663  O  OD2   . ASP A 1 222  ? -22.325 -32.852  50.027  1.00 5.89  ? 223  ASP A OD2   1 
ATOM   1664  N  N     . ILE A 1 223  ? -24.297 -36.806  50.913  1.00 2.96  ? 224  ILE A N     1 
ATOM   1665  C  CA    . ILE A 1 223  ? -25.652 -37.313  50.848  1.00 2.00  ? 224  ILE A CA    1 
ATOM   1666  C  C     . ILE A 1 223  ? -25.850 -38.711  50.236  1.00 2.15  ? 224  ILE A C     1 
ATOM   1667  O  O     . ILE A 1 223  ? -26.954 -39.237  50.293  1.00 2.72  ? 224  ILE A O     1 
ATOM   1668  C  CB    . ILE A 1 223  ? -26.568 -36.329  50.117  1.00 2.00  ? 224  ILE A CB    1 
ATOM   1669  C  CG1   . ILE A 1 223  ? -26.130 -36.170  48.662  1.00 2.00  ? 224  ILE A CG1   1 
ATOM   1670  C  CG2   . ILE A 1 223  ? -26.540 -35.000  50.810  1.00 2.00  ? 224  ILE A CG2   1 
ATOM   1671  C  CD1   . ILE A 1 223  ? -27.158 -35.542  47.775  1.00 2.00  ? 224  ILE A CD1   1 
ATOM   1672  N  N     . TYR A 1 224  ? -24.825 -39.335  49.661  1.00 2.17  ? 225  TYR A N     1 
ATOM   1673  C  CA    . TYR A 1 224  ? -25.032 -40.653  49.073  1.00 2.00  ? 225  TYR A CA    1 
ATOM   1674  C  C     . TYR A 1 224  ? -25.486 -41.625  50.122  1.00 2.24  ? 225  TYR A C     1 
ATOM   1675  O  O     . TYR A 1 224  ? -26.606 -42.109  50.057  1.00 2.65  ? 225  TYR A O     1 
ATOM   1676  C  CB    . TYR A 1 224  ? -23.783 -41.210  48.421  1.00 2.00  ? 225  TYR A CB    1 
ATOM   1677  C  CG    . TYR A 1 224  ? -24.006 -42.512  47.674  1.00 2.00  ? 225  TYR A CG    1 
ATOM   1678  C  CD1   . TYR A 1 224  ? -24.483 -42.503  46.387  1.00 2.00  ? 225  TYR A CD1   1 
ATOM   1679  C  CD2   . TYR A 1 224  ? -23.733 -43.748  48.263  1.00 2.00  ? 225  TYR A CD2   1 
ATOM   1680  C  CE1   . TYR A 1 224  ? -24.694 -43.673  45.680  1.00 2.10  ? 225  TYR A CE1   1 
ATOM   1681  C  CE2   . TYR A 1 224  ? -23.943 -44.932  47.574  1.00 2.00  ? 225  TYR A CE2   1 
ATOM   1682  C  CZ    . TYR A 1 224  ? -24.428 -44.886  46.269  1.00 2.02  ? 225  TYR A CZ    1 
ATOM   1683  O  OH    . TYR A 1 224  ? -24.641 -46.028  45.522  1.00 2.00  ? 225  TYR A OH    1 
ATOM   1684  N  N     . PHE A 1 225  ? -24.650 -41.879  51.122  1.00 2.30  ? 226  PHE A N     1 
ATOM   1685  C  CA    . PHE A 1 225  ? -25.017 -42.849  52.156  1.00 2.14  ? 226  PHE A CA    1 
ATOM   1686  C  C     . PHE A 1 225  ? -26.456 -42.752  52.657  1.00 2.00  ? 226  PHE A C     1 
ATOM   1687  O  O     . PHE A 1 225  ? -27.122 -43.776  52.754  1.00 2.00  ? 226  PHE A O     1 
ATOM   1688  C  CB    . PHE A 1 225  ? -24.008 -42.841  53.312  1.00 2.04  ? 226  PHE A CB    1 
ATOM   1689  C  CG    . PHE A 1 225  ? -24.063 -44.068  54.183  1.00 2.02  ? 226  PHE A CG    1 
ATOM   1690  C  CD1   . PHE A 1 225  ? -25.057 -45.018  54.021  1.00 2.00  ? 226  PHE A CD1   1 
ATOM   1691  C  CD2   . PHE A 1 225  ? -23.187 -44.206  55.244  1.00 2.25  ? 226  PHE A CD2   1 
ATOM   1692  C  CE1   . PHE A 1 225  ? -25.186 -46.051  54.892  1.00 2.00  ? 226  PHE A CE1   1 
ATOM   1693  C  CE2   . PHE A 1 225  ? -23.309 -45.242  56.128  1.00 2.00  ? 226  PHE A CE2   1 
ATOM   1694  C  CZ    . PHE A 1 225  ? -24.315 -46.161  55.949  1.00 2.00  ? 226  PHE A CZ    1 
ATOM   1695  N  N     . GLN A 1 226  ? -26.948 -41.538  52.918  1.00 2.00  ? 227  GLN A N     1 
ATOM   1696  C  CA    . GLN A 1 226  ? -28.329 -41.339  53.377  1.00 2.00  ? 227  GLN A CA    1 
ATOM   1697  C  C     . GLN A 1 226  ? -29.373 -41.770  52.336  1.00 2.00  ? 227  GLN A C     1 
ATOM   1698  O  O     . GLN A 1 226  ? -30.169 -42.679  52.569  1.00 2.00  ? 227  GLN A O     1 
ATOM   1699  C  CB    . GLN A 1 226  ? -28.574 -39.875  53.693  1.00 2.00  ? 227  GLN A CB    1 
ATOM   1700  C  CG    . GLN A 1 226  ? -27.760 -39.331  54.797  1.00 2.00  ? 227  GLN A CG    1 
ATOM   1701  C  CD    . GLN A 1 226  ? -26.620 -38.537  54.298  1.00 2.00  ? 227  GLN A CD    1 
ATOM   1702  O  OE1   . GLN A 1 226  ? -26.690 -37.318  54.186  1.00 2.41  ? 227  GLN A OE1   1 
ATOM   1703  N  NE2   . GLN A 1 226  ? -25.545 -39.216  53.984  1.00 2.12  ? 227  GLN A NE2   1 
ATOM   1704  N  N     . GLY A 1 227  ? -29.352 -41.117  51.179  1.00 2.00  ? 228  GLY A N     1 
ATOM   1705  C  CA    . GLY A 1 227  ? -30.282 -41.430  50.111  1.00 2.01  ? 228  GLY A CA    1 
ATOM   1706  C  C     . GLY A 1 227  ? -30.371 -42.902  49.769  1.00 2.37  ? 228  GLY A C     1 
ATOM   1707  O  O     . GLY A 1 227  ? -31.349 -43.340  49.195  1.00 2.63  ? 228  GLY A O     1 
ATOM   1708  N  N     . ARG A 1 228  ? -29.333 -43.659  50.112  1.00 2.74  ? 229  ARG A N     1 
ATOM   1709  C  CA    . ARG A 1 228  ? -29.263 -45.105  49.877  1.00 2.45  ? 229  ARG A CA    1 
ATOM   1710  C  C     . ARG A 1 228  ? -30.115 -45.851  50.911  1.00 2.05  ? 229  ARG A C     1 
ATOM   1711  O  O     . ARG A 1 228  ? -30.728 -46.869  50.612  1.00 2.00  ? 229  ARG A O     1 
ATOM   1712  C  CB    . ARG A 1 228  ? -27.804 -45.577  49.978  1.00 2.24  ? 229  ARG A CB    1 
ATOM   1713  C  CG    . ARG A 1 228  ? -27.534 -47.028  49.556  1.00 2.58  ? 229  ARG A CG    1 
ATOM   1714  C  CD    . ARG A 1 228  ? -27.394 -47.180  48.042  1.00 3.23  ? 229  ARG A CD    1 
ATOM   1715  N  NE    . ARG A 1 228  ? -26.838 -48.481  47.664  1.00 4.54  ? 229  ARG A NE    1 
ATOM   1716  C  CZ    . ARG A 1 228  ? -27.530 -49.466  47.096  1.00 5.32  ? 229  ARG A CZ    1 
ATOM   1717  N  NH1   . ARG A 1 228  ? -28.808 -49.306  46.842  1.00 6.62  ? 229  ARG A NH1   1 
ATOM   1718  N  NH2   . ARG A 1 228  ? -26.944 -50.593  46.721  1.00 6.43  ? 229  ARG A NH2   1 
ATOM   1719  N  N     . GLU A 1 229  ? -30.114 -45.363  52.140  1.00 2.36  ? 230  GLU A N     1 
ATOM   1720  C  CA    . GLU A 1 229  ? -30.888 -45.996  53.180  1.00 3.00  ? 230  GLU A CA    1 
ATOM   1721  C  C     . GLU A 1 229  ? -32.335 -45.511  53.126  1.00 3.64  ? 230  GLU A C     1 
ATOM   1722  O  O     . GLU A 1 229  ? -33.214 -46.096  53.750  1.00 3.97  ? 230  GLU A O     1 
ATOM   1723  C  CB    . GLU A 1 229  ? -30.270 -45.703  54.543  1.00 2.76  ? 230  GLU A CB    1 
ATOM   1724  C  CG    . GLU A 1 229  ? -28.897 -46.309  54.764  1.00 2.77  ? 230  GLU A CG    1 
ATOM   1725  C  CD    . GLU A 1 229  ? -28.919 -47.804  55.109  1.00 4.03  ? 230  GLU A CD    1 
ATOM   1726  O  OE1   . GLU A 1 229  ? -29.821 -48.302  55.830  1.00 4.09  ? 230  GLU A OE1   1 
ATOM   1727  O  OE2   . GLU A 1 229  ? -27.983 -48.498  54.682  1.00 4.26  ? 230  GLU A OE2   1 
ATOM   1728  N  N     . ALA A 1 230  ? -32.599 -44.482  52.329  1.00 3.98  ? 231  ALA A N     1 
ATOM   1729  C  CA    . ALA A 1 230  ? -33.954 -43.943  52.244  1.00 4.38  ? 231  ALA A CA    1 
ATOM   1730  C  C     . ALA A 1 230  ? -35.036 -44.882  51.762  1.00 4.85  ? 231  ALA A C     1 
ATOM   1731  O  O     . ALA A 1 230  ? -36.221 -44.562  51.932  1.00 5.41  ? 231  ALA A O     1 
ATOM   1732  C  CB    . ALA A 1 230  ? -33.990 -42.669  51.418  1.00 4.47  ? 231  ALA A CB    1 
ATOM   1733  N  N     . ALA A 1 231  ? -34.663 -46.021  51.176  1.00 4.87  ? 232  ALA A N     1 
ATOM   1734  C  CA    . ALA A 1 231  ? -35.666 -46.983  50.680  1.00 5.25  ? 232  ALA A CA    1 
ATOM   1735  C  C     . ALA A 1 231  ? -36.046 -48.096  51.655  1.00 5.29  ? 232  ALA A C     1 
ATOM   1736  O  O     . ALA A 1 231  ? -36.879 -48.939  51.341  1.00 5.57  ? 232  ALA A O     1 
ATOM   1737  C  CB    . ALA A 1 231  ? -35.214 -47.596  49.367  1.00 5.11  ? 232  ALA A CB    1 
ATOM   1738  N  N     . ASN A 1 232  ? -35.440 -48.094  52.833  1.00 5.26  ? 233  ASN A N     1 
ATOM   1739  C  CA    . ASN A 1 232  ? -35.707 -49.114  53.825  1.00 5.42  ? 233  ASN A CA    1 
ATOM   1740  C  C     . ASN A 1 232  ? -37.167 -49.473  54.089  1.00 5.11  ? 233  ASN A C     1 
ATOM   1741  O  O     . ASN A 1 232  ? -37.553 -50.631  53.956  1.00 5.55  ? 233  ASN A O     1 
ATOM   1742  C  CB    . ASN A 1 232  ? -35.072 -48.739  55.157  1.00 6.56  ? 233  ASN A CB    1 
ATOM   1743  C  CG    . ASN A 1 232  ? -33.578 -48.593  55.082  1.00 7.55  ? 233  ASN A CG    1 
ATOM   1744  O  OD1   . ASN A 1 232  ? -32.956 -48.120  56.041  1.00 8.09  ? 233  ASN A OD1   1 
ATOM   1745  N  ND2   . ASN A 1 232  ? -32.979 -49.011  53.962  1.00 7.96  ? 233  ASN A ND2   1 
ATOM   1746  N  N     . PRO A 1 233  ? -38.004 -48.489  54.432  1.00 4.51  ? 234  PRO A N     1 
ATOM   1747  C  CA    . PRO A 1 233  ? -39.413 -48.777  54.708  1.00 4.52  ? 234  PRO A CA    1 
ATOM   1748  C  C     . PRO A 1 233  ? -40.036 -49.707  53.659  1.00 4.75  ? 234  PRO A C     1 
ATOM   1749  O  O     . PRO A 1 233  ? -40.835 -50.564  53.994  1.00 5.37  ? 234  PRO A O     1 
ATOM   1750  C  CB    . PRO A 1 233  ? -40.059 -47.396  54.669  1.00 4.76  ? 234  PRO A CB    1 
ATOM   1751  C  CG    . PRO A 1 233  ? -38.928 -46.459  54.943  1.00 4.73  ? 234  PRO A CG    1 
ATOM   1752  C  CD    . PRO A 1 233  ? -37.817 -47.052  54.172  1.00 4.13  ? 234  PRO A CD    1 
ATOM   1753  N  N     . TYR A 1 234  ? -39.626 -49.569  52.400  1.00 4.33  ? 235  TYR A N     1 
ATOM   1754  C  CA    . TYR A 1 234  ? -40.137 -50.408  51.332  1.00 3.81  ? 235  TYR A CA    1 
ATOM   1755  C  C     . TYR A 1 234  ? -39.724 -51.855  51.477  1.00 4.22  ? 235  TYR A C     1 
ATOM   1756  O  O     . TYR A 1 234  ? -40.561 -52.761  51.404  1.00 4.09  ? 235  TYR A O     1 
ATOM   1757  C  CB    . TYR A 1 234  ? -39.665 -49.894  49.994  1.00 3.36  ? 235  TYR A CB    1 
ATOM   1758  C  CG    . TYR A 1 234  ? -40.265 -48.580  49.683  1.00 3.38  ? 235  TYR A CG    1 
ATOM   1759  C  CD1   . TYR A 1 234  ? -39.881 -47.435  50.375  1.00 3.92  ? 235  TYR A CD1   1 
ATOM   1760  C  CD2   . TYR A 1 234  ? -41.250 -48.467  48.734  1.00 3.52  ? 235  TYR A CD2   1 
ATOM   1761  C  CE1   . TYR A 1 234  ? -40.474 -46.209  50.118  1.00 3.62  ? 235  TYR A CE1   1 
ATOM   1762  C  CE2   . TYR A 1 234  ? -41.850 -47.252  48.477  1.00 3.67  ? 235  TYR A CE2   1 
ATOM   1763  C  CZ    . TYR A 1 234  ? -41.458 -46.135  49.169  1.00 3.46  ? 235  TYR A CZ    1 
ATOM   1764  O  OH    . TYR A 1 234  ? -42.065 -44.946  48.902  1.00 4.81  ? 235  TYR A OH    1 
ATOM   1765  N  N     . TYR A 1 235  ? -38.436 -52.092  51.668  1.00 4.42  ? 236  TYR A N     1 
ATOM   1766  C  CA    . TYR A 1 235  ? -37.994 -53.471  51.802  1.00 4.82  ? 236  TYR A CA    1 
ATOM   1767  C  C     . TYR A 1 235  ? -38.522 -54.109  53.059  1.00 5.61  ? 236  TYR A C     1 
ATOM   1768  O  O     . TYR A 1 235  ? -38.562 -55.329  53.186  1.00 5.82  ? 236  TYR A O     1 
ATOM   1769  C  CB    . TYR A 1 235  ? -36.493 -53.559  51.730  1.00 3.80  ? 236  TYR A CB    1 
ATOM   1770  C  CG    . TYR A 1 235  ? -35.996 -53.289  50.342  1.00 2.79  ? 236  TYR A CG    1 
ATOM   1771  C  CD1   . TYR A 1 235  ? -35.878 -51.991  49.871  1.00 2.20  ? 236  TYR A CD1   1 
ATOM   1772  C  CD2   . TYR A 1 235  ? -35.661 -54.338  49.494  1.00 2.55  ? 236  TYR A CD2   1 
ATOM   1773  C  CE1   . TYR A 1 235  ? -35.444 -51.750  48.607  1.00 2.51  ? 236  TYR A CE1   1 
ATOM   1774  C  CE2   . TYR A 1 235  ? -35.228 -54.111  48.228  1.00 2.18  ? 236  TYR A CE2   1 
ATOM   1775  C  CZ    . TYR A 1 235  ? -35.121 -52.819  47.782  1.00 2.73  ? 236  TYR A CZ    1 
ATOM   1776  O  OH    . TYR A 1 235  ? -34.698 -52.597  46.493  1.00 4.59  ? 236  TYR A OH    1 
ATOM   1777  N  N     . LEU A 1 236  ? -38.943 -53.270  53.991  1.00 6.26  ? 237  LEU A N     1 
ATOM   1778  C  CA    . LEU A 1 236  ? -39.516 -53.770  55.215  1.00 7.19  ? 237  LEU A CA    1 
ATOM   1779  C  C     . LEU A 1 236  ? -40.911 -54.281  54.880  1.00 8.40  ? 237  LEU A C     1 
ATOM   1780  O  O     . LEU A 1 236  ? -41.328 -55.325  55.390  1.00 9.43  ? 237  LEU A O     1 
ATOM   1781  C  CB    . LEU A 1 236  ? -39.595 -52.662  56.251  1.00 6.25  ? 237  LEU A CB    1 
ATOM   1782  C  CG    . LEU A 1 236  ? -38.213 -52.261  56.735  1.00 5.33  ? 237  LEU A CG    1 
ATOM   1783  C  CD1   . LEU A 1 236  ? -38.208 -50.813  57.155  1.00 5.98  ? 237  LEU A CD1   1 
ATOM   1784  C  CD2   . LEU A 1 236  ? -37.814 -53.178  57.845  1.00 4.95  ? 237  LEU A CD2   1 
ATOM   1785  N  N     . LYS A 1 237  ? -41.596 -53.597  53.961  1.00 8.94  ? 238  LYS A N     1 
ATOM   1786  C  CA    . LYS A 1 237  ? -42.953 -53.982  53.578  1.00 9.04  ? 238  LYS A CA    1 
ATOM   1787  C  C     . LYS A 1 237  ? -43.060 -54.968  52.431  1.00 9.09  ? 238  LYS A C     1 
ATOM   1788  O  O     . LYS A 1 237  ? -44.133 -55.519  52.211  1.00 9.70  ? 238  LYS A O     1 
ATOM   1789  C  CB    . LYS A 1 237  ? -43.809 -52.749  53.264  1.00 9.21  ? 238  LYS A CB    1 
ATOM   1790  C  CG    . LYS A 1 237  ? -44.016 -51.822  54.451  1.00 10.44 ? 238  LYS A CG    1 
ATOM   1791  C  CD    . LYS A 1 237  ? -44.067 -50.351  54.011  1.00 11.82 ? 238  LYS A CD    1 
ATOM   1792  C  CE    . LYS A 1 237  ? -43.551 -49.392  55.106  1.00 12.67 ? 238  LYS A CE    1 
ATOM   1793  N  NZ    . LYS A 1 237  ? -43.630 -47.946  54.704  1.00 13.51 ? 238  LYS A NZ    1 
ATOM   1794  N  N     . VAL A 1 238  ? -41.982 -55.233  51.701  1.00 8.86  ? 239  VAL A N     1 
ATOM   1795  C  CA    . VAL A 1 238  ? -42.139 -56.172  50.603  1.00 8.63  ? 239  VAL A CA    1 
ATOM   1796  C  C     . VAL A 1 238  ? -42.518 -57.619  51.017  1.00 8.52  ? 239  VAL A C     1 
ATOM   1797  O  O     . VAL A 1 238  ? -43.232 -58.288  50.278  1.00 9.49  ? 239  VAL A O     1 
ATOM   1798  C  CB    . VAL A 1 238  ? -41.048 -56.003  49.487  1.00 8.57  ? 239  VAL A CB    1 
ATOM   1799  C  CG1   . VAL A 1 238  ? -39.673 -56.034  50.055  1.00 9.51  ? 239  VAL A CG1   1 
ATOM   1800  C  CG2   . VAL A 1 238  ? -41.208 -57.024  48.398  1.00 8.58  ? 239  VAL A CG2   1 
ATOM   1801  N  N     . PRO A 1 239  ? -42.174 -58.072  52.248  1.00 8.00  ? 240  PRO A N     1 
ATOM   1802  C  CA    . PRO A 1 239  ? -42.537 -59.438  52.668  1.00 7.22  ? 240  PRO A CA    1 
ATOM   1803  C  C     . PRO A 1 239  ? -44.029 -59.604  52.965  1.00 6.82  ? 240  PRO A C     1 
ATOM   1804  O  O     . PRO A 1 239  ? -44.648 -60.570  52.533  1.00 7.54  ? 240  PRO A O     1 
ATOM   1805  C  CB    . PRO A 1 239  ? -41.742 -59.628  53.947  1.00 6.79  ? 240  PRO A CB    1 
ATOM   1806  C  CG    . PRO A 1 239  ? -40.589 -58.811  53.742  1.00 8.11  ? 240  PRO A CG    1 
ATOM   1807  C  CD    . PRO A 1 239  ? -41.165 -57.537  53.172  1.00 8.31  ? 240  PRO A CD    1 
ATOM   1808  N  N     . GLY A 1 240  ? -44.587 -58.698  53.758  1.00 6.49  ? 241  GLY A N     1 
ATOM   1809  C  CA    . GLY A 1 240  ? -45.998 -58.767  54.093  1.00 5.39  ? 241  GLY A CA    1 
ATOM   1810  C  C     . GLY A 1 240  ? -46.803 -58.666  52.818  1.00 5.56  ? 241  GLY A C     1 
ATOM   1811  O  O     . GLY A 1 240  ? -47.803 -59.379  52.653  1.00 5.67  ? 241  GLY A O     1 
ATOM   1812  N  N     . ILE A 1 241  ? -46.340 -57.810  51.901  1.00 4.95  ? 242  ILE A N     1 
ATOM   1813  C  CA    . ILE A 1 241  ? -47.003 -57.635  50.613  1.00 3.73  ? 242  ILE A CA    1 
ATOM   1814  C  C     . ILE A 1 241  ? -46.987 -58.929  49.830  1.00 3.54  ? 242  ILE A C     1 
ATOM   1815  O  O     . ILE A 1 241  ? -47.953 -59.243  49.145  1.00 3.86  ? 242  ILE A O     1 
ATOM   1816  C  CB    . ILE A 1 241  ? -46.389 -56.518  49.789  1.00 2.84  ? 242  ILE A CB    1 
ATOM   1817  C  CG1   . ILE A 1 241  ? -46.638 -55.188  50.490  1.00 2.00  ? 242  ILE A CG1   1 
ATOM   1818  C  CG2   . ILE A 1 241  ? -46.998 -56.508  48.421  1.00 3.01  ? 242  ILE A CG2   1 
ATOM   1819  C  CD1   . ILE A 1 241  ? -46.339 -54.007  49.689  1.00 2.00  ? 242  ILE A CD1   1 
ATOM   1820  N  N     . VAL A 1 242  ? -45.903 -59.692  49.937  1.00 3.09  ? 243  VAL A N     1 
ATOM   1821  C  CA    . VAL A 1 242  ? -45.830 -60.976  49.253  1.00 2.87  ? 243  VAL A CA    1 
ATOM   1822  C  C     . VAL A 1 242  ? -46.785 -61.934  49.935  1.00 3.14  ? 243  VAL A C     1 
ATOM   1823  O  O     . VAL A 1 242  ? -47.508 -62.652  49.270  1.00 3.27  ? 243  VAL A O     1 
ATOM   1824  C  CB    . VAL A 1 242  ? -44.431 -61.580  49.290  1.00 2.19  ? 243  VAL A CB    1 
ATOM   1825  C  CG1   . VAL A 1 242  ? -44.477 -63.048  48.885  1.00 2.40  ? 243  VAL A CG1   1 
ATOM   1826  C  CG2   . VAL A 1 242  ? -43.520 -60.818  48.358  1.00 2.00  ? 243  VAL A CG2   1 
ATOM   1827  N  N     . ALA A 1 243  ? -46.790 -61.928  51.262  1.00 3.43  ? 244  ALA A N     1 
ATOM   1828  C  CA    . ALA A 1 243  ? -47.651 -62.803  52.035  1.00 3.99  ? 244  ALA A CA    1 
ATOM   1829  C  C     . ALA A 1 243  ? -49.100 -62.458  51.752  1.00 5.27  ? 244  ALA A C     1 
ATOM   1830  O  O     . ALA A 1 243  ? -49.943 -63.348  51.608  1.00 5.91  ? 244  ALA A O     1 
ATOM   1831  C  CB    . ALA A 1 243  ? -47.361 -62.659  53.496  1.00 2.99  ? 244  ALA A CB    1 
ATOM   1832  N  N     . GLU A 1 244  ? -49.386 -61.165  51.619  1.00 6.17  ? 245  GLU A N     1 
ATOM   1833  C  CA    . GLU A 1 244  ? -50.755 -60.692  51.348  1.00 6.78  ? 245  GLU A CA    1 
ATOM   1834  C  C     . GLU A 1 244  ? -51.280 -61.273  50.048  1.00 6.44  ? 245  GLU A C     1 
ATOM   1835  O  O     . GLU A 1 244  ? -52.422 -61.694  49.958  1.00 6.28  ? 245  GLU A O     1 
ATOM   1836  C  CB    . GLU A 1 244  ? -50.757 -59.165  51.228  1.00 8.22  ? 245  GLU A CB    1 
ATOM   1837  C  CG    . GLU A 1 244  ? -52.035 -58.550  50.640  1.00 9.29  ? 245  GLU A CG    1 
ATOM   1838  C  CD    . GLU A 1 244  ? -51.909 -57.041  50.385  1.00 10.35 ? 245  GLU A CD    1 
ATOM   1839  O  OE1   . GLU A 1 244  ? -50.854 -56.447  50.739  1.00 10.51 ? 245  GLU A OE1   1 
ATOM   1840  O  OE2   . GLU A 1 244  ? -52.867 -56.450  49.824  1.00 10.32 ? 245  GLU A OE2   1 
ATOM   1841  N  N     . TYR A 1 245  ? -50.423 -61.276  49.034  1.00 6.45  ? 246  TYR A N     1 
ATOM   1842  C  CA    . TYR A 1 245  ? -50.788 -61.786  47.738  1.00 5.72  ? 246  TYR A CA    1 
ATOM   1843  C  C     . TYR A 1 245  ? -50.751 -63.281  47.620  1.00 5.99  ? 246  TYR A C     1 
ATOM   1844  O  O     . TYR A 1 245  ? -51.505 -63.837  46.839  1.00 6.98  ? 246  TYR A O     1 
ATOM   1845  C  CB    . TYR A 1 245  ? -49.950 -61.132  46.666  1.00 4.93  ? 246  TYR A CB    1 
ATOM   1846  C  CG    . TYR A 1 245  ? -50.422 -59.742  46.378  1.00 4.40  ? 246  TYR A CG    1 
ATOM   1847  C  CD1   . TYR A 1 245  ? -51.676 -59.519  45.824  1.00 4.11  ? 246  TYR A CD1   1 
ATOM   1848  C  CD2   . TYR A 1 245  ? -49.619 -58.657  46.636  1.00 4.40  ? 246  TYR A CD2   1 
ATOM   1849  C  CE1   . TYR A 1 245  ? -52.118 -58.252  45.528  1.00 4.15  ? 246  TYR A CE1   1 
ATOM   1850  C  CE2   . TYR A 1 245  ? -50.043 -57.381  46.340  1.00 4.77  ? 246  TYR A CE2   1 
ATOM   1851  C  CZ    . TYR A 1 245  ? -51.290 -57.180  45.777  1.00 4.61  ? 246  TYR A CZ    1 
ATOM   1852  O  OH    . TYR A 1 245  ? -51.646 -55.912  45.365  1.00 5.51  ? 246  TYR A OH    1 
ATOM   1853  N  N     . MET A 1 246  ? -49.883 -63.956  48.363  1.00 5.95  ? 247  MET A N     1 
ATOM   1854  C  CA    . MET A 1 246  ? -49.872 -65.409  48.282  1.00 6.40  ? 247  MET A CA    1 
ATOM   1855  C  C     . MET A 1 246  ? -51.229 -65.821  48.828  1.00 6.77  ? 247  MET A C     1 
ATOM   1856  O  O     . MET A 1 246  ? -51.827 -66.785  48.364  1.00 6.67  ? 247  MET A O     1 
ATOM   1857  C  CB    . MET A 1 246  ? -48.762 -66.023  49.136  1.00 6.65  ? 247  MET A CB    1 
ATOM   1858  C  CG    . MET A 1 246  ? -47.348 -65.823  48.617  1.00 6.10  ? 247  MET A CG    1 
ATOM   1859  S  SD    . MET A 1 246  ? -46.212 -66.737  49.662  1.00 6.48  ? 247  MET A SD    1 
ATOM   1860  C  CE    . MET A 1 246  ? -44.794 -66.840  48.682  1.00 6.07  ? 247  MET A CE    1 
ATOM   1861  N  N     . GLN A 1 247  ? -51.741 -65.005  49.746  1.00 7.43  ? 248  GLN A N     1 
ATOM   1862  C  CA    . GLN A 1 247  ? -53.035 -65.219  50.380  1.00 8.18  ? 248  GLN A CA    1 
ATOM   1863  C  C     . GLN A 1 247  ? -54.226 -64.919  49.503  1.00 7.85  ? 248  GLN A C     1 
ATOM   1864  O  O     . GLN A 1 247  ? -55.201 -65.670  49.538  1.00 7.91  ? 248  GLN A O     1 
ATOM   1865  C  CB    . GLN A 1 247  ? -53.141 -64.404  51.655  1.00 9.69  ? 248  GLN A CB    1 
ATOM   1866  C  CG    . GLN A 1 247  ? -52.820 -65.210  52.887  1.00 12.44 ? 248  GLN A CG    1 
ATOM   1867  C  CD    . GLN A 1 247  ? -51.698 -64.621  53.731  1.00 13.43 ? 248  GLN A CD    1 
ATOM   1868  O  OE1   . GLN A 1 247  ? -51.902 -63.623  54.436  1.00 14.37 ? 248  GLN A OE1   1 
ATOM   1869  N  NE2   . GLN A 1 247  ? -50.511 -65.255  53.688  1.00 14.36 ? 248  GLN A NE2   1 
ATOM   1870  N  N     . LYS A 1 248  ? -54.187 -63.792  48.787  1.00 7.49  ? 249  LYS A N     1 
ATOM   1871  C  CA    . LYS A 1 248  ? -55.272 -63.428  47.871  1.00 7.67  ? 249  LYS A CA    1 
ATOM   1872  C  C     . LYS A 1 248  ? -55.377 -64.456  46.759  1.00 8.35  ? 249  LYS A C     1 
ATOM   1873  O  O     . LYS A 1 248  ? -56.443 -65.000  46.520  1.00 9.24  ? 249  LYS A O     1 
ATOM   1874  C  CB    . LYS A 1 248  ? -55.059 -62.052  47.241  1.00 6.76  ? 249  LYS A CB    1 
ATOM   1875  C  CG    . LYS A 1 248  ? -55.315 -60.923  48.181  1.00 5.36  ? 249  LYS A CG    1 
ATOM   1876  C  CD    . LYS A 1 248  ? -55.122 -59.585  47.556  1.00 3.80  ? 249  LYS A CD    1 
ATOM   1877  C  CE    . LYS A 1 248  ? -55.569 -58.589  48.578  1.00 5.12  ? 249  LYS A CE    1 
ATOM   1878  N  NZ    . LYS A 1 248  ? -55.125 -57.191  48.387  1.00 6.37  ? 249  LYS A NZ    1 
ATOM   1879  N  N     . VAL A 1 249  ? -54.270 -64.738  46.086  1.00 8.43  ? 250  VAL A N     1 
ATOM   1880  C  CA    . VAL A 1 249  ? -54.292 -65.717  45.018  1.00 9.11  ? 250  VAL A CA    1 
ATOM   1881  C  C     . VAL A 1 249  ? -54.809 -67.062  45.523  1.00 9.73  ? 250  VAL A C     1 
ATOM   1882  O  O     . VAL A 1 249  ? -55.575 -67.750  44.835  1.00 10.11 ? 250  VAL A O     1 
ATOM   1883  C  CB    . VAL A 1 249  ? -52.902 -65.898  44.396  1.00 8.94  ? 250  VAL A CB    1 
ATOM   1884  C  CG1   . VAL A 1 249  ? -52.884 -67.119  43.445  1.00 8.39  ? 250  VAL A CG1   1 
ATOM   1885  C  CG2   . VAL A 1 249  ? -52.512 -64.618  43.666  1.00 8.86  ? 250  VAL A CG2   1 
ATOM   1886  N  N     . ALA A 1 250  ? -54.407 -67.436  46.730  1.00 10.00 ? 251  ALA A N     1 
ATOM   1887  C  CA    . ALA A 1 250  ? -54.850 -68.708  47.261  1.00 10.18 ? 251  ALA A CA    1 
ATOM   1888  C  C     . ALA A 1 250  ? -56.346 -68.663  47.430  1.00 10.20 ? 251  ALA A C     1 
ATOM   1889  O  O     . ALA A 1 250  ? -57.021 -69.669  47.259  1.00 10.73 ? 251  ALA A O     1 
ATOM   1890  C  CB    . ALA A 1 250  ? -54.173 -69.009  48.567  1.00 10.54 ? 251  ALA A CB    1 
ATOM   1891  N  N     . SER A 1 251  ? -56.867 -67.483  47.741  1.00 9.83  ? 252  SER A N     1 
ATOM   1892  C  CA    . SER A 1 251  ? -58.299 -67.317  47.912  1.00 9.35  ? 252  SER A CA    1 
ATOM   1893  C  C     . SER A 1 251  ? -59.029 -67.729  46.636  1.00 8.67  ? 252  SER A C     1 
ATOM   1894  O  O     . SER A 1 251  ? -60.036 -68.416  46.694  1.00 8.66  ? 252  SER A O     1 
ATOM   1895  C  CB    . SER A 1 251  ? -58.611 -65.876  48.270  1.00 9.93  ? 252  SER A CB    1 
ATOM   1896  O  OG    . SER A 1 251  ? -59.998 -65.643  48.221  1.00 11.61 ? 252  SER A OG    1 
ATOM   1897  N  N     . LEU A 1 252  ? -58.498 -67.346  45.481  1.00 8.03  ? 253  LEU A N     1 
ATOM   1898  C  CA    . LEU A 1 252  ? -59.107 -67.724  44.211  1.00 7.39  ? 253  LEU A CA    1 
ATOM   1899  C  C     . LEU A 1 252  ? -58.668 -69.104  43.741  1.00 7.48  ? 253  LEU A C     1 
ATOM   1900  O  O     . LEU A 1 252  ? -59.374 -69.733  42.965  1.00 7.79  ? 253  LEU A O     1 
ATOM   1901  C  CB    . LEU A 1 252  ? -58.686 -66.787  43.086  1.00 6.79  ? 253  LEU A CB    1 
ATOM   1902  C  CG    . LEU A 1 252  ? -58.768 -65.278  43.071  1.00 6.85  ? 253  LEU A CG    1 
ATOM   1903  C  CD1   . LEU A 1 252  ? -57.848 -64.749  41.962  1.00 6.78  ? 253  LEU A CD1   1 
ATOM   1904  C  CD2   . LEU A 1 252  ? -60.190 -64.878  42.828  1.00 6.61  ? 253  LEU A CD2   1 
ATOM   1905  N  N     . THR A 1 253  ? -57.479 -69.557  44.129  1.00 7.57  ? 254  THR A N     1 
ATOM   1906  C  CA    . THR A 1 253  ? -56.989 -70.838  43.614  1.00 7.56  ? 254  THR A CA    1 
ATOM   1907  C  C     . THR A 1 253  ? -57.109 -72.081  44.470  1.00 7.23  ? 254  THR A C     1 
ATOM   1908  O  O     . THR A 1 253  ? -57.359 -73.173  43.942  1.00 7.70  ? 254  THR A O     1 
ATOM   1909  C  CB    . THR A 1 253  ? -55.533 -70.725  43.115  1.00 7.73  ? 254  THR A CB    1 
ATOM   1910  O  OG1   . THR A 1 253  ? -54.641 -70.629  44.233  1.00 7.53  ? 254  THR A OG1   1 
ATOM   1911  C  CG2   . THR A 1 253  ? -55.382 -69.498  42.227  1.00 7.47  ? 254  THR A CG2   1 
ATOM   1912  N  N     . GLY A 1 254  ? -56.928 -71.923  45.773  1.00 6.11  ? 255  GLY A N     1 
ATOM   1913  C  CA    . GLY A 1 254  ? -56.998 -73.057  46.664  1.00 5.48  ? 255  GLY A CA    1 
ATOM   1914  C  C     . GLY A 1 254  ? -55.584 -73.516  46.939  1.00 5.53  ? 255  GLY A C     1 
ATOM   1915  O  O     . GLY A 1 254  ? -55.339 -74.384  47.784  1.00 6.18  ? 255  GLY A O     1 
ATOM   1916  N  N     . ARG A 1 255  ? -54.642 -72.975  46.178  1.00 5.12  ? 256  ARG A N     1 
ATOM   1917  C  CA    . ARG A 1 255  ? -53.253 -73.307  46.371  1.00 4.56  ? 256  ARG A CA    1 
ATOM   1918  C  C     . ARG A 1 255  ? -52.658 -72.207  47.239  1.00 5.57  ? 256  ARG A C     1 
ATOM   1919  O  O     . ARG A 1 255  ? -52.515 -71.074  46.778  1.00 5.98  ? 256  ARG A O     1 
ATOM   1920  C  CB    . ARG A 1 255  ? -52.562 -73.372  45.030  1.00 3.53  ? 256  ARG A CB    1 
ATOM   1921  C  CG    . ARG A 1 255  ? -52.990 -74.563  44.211  1.00 2.86  ? 256  ARG A CG    1 
ATOM   1922  C  CD    . ARG A 1 255  ? -52.150 -74.702  42.966  1.00 2.64  ? 256  ARG A CD    1 
ATOM   1923  N  NE    . ARG A 1 255  ? -52.228 -73.516  42.133  1.00 2.91  ? 256  ARG A NE    1 
ATOM   1924  C  CZ    . ARG A 1 255  ? -53.323 -73.156  41.481  1.00 3.54  ? 256  ARG A CZ    1 
ATOM   1925  N  NH1   . ARG A 1 255  ? -54.396 -73.920  41.550  1.00 3.09  ? 256  ARG A NH1   1 
ATOM   1926  N  NH2   . ARG A 1 255  ? -53.396 -71.964  40.890  1.00 4.14  ? 256  ARG A NH2   1 
ATOM   1927  N  N     . SER A 1 256  ? -52.359 -72.544  48.502  1.00 6.24  ? 257  SER A N     1 
ATOM   1928  C  CA    . SER A 1 256  ? -51.786 -71.625  49.509  1.00 6.72  ? 257  SER A CA    1 
ATOM   1929  C  C     . SER A 1 256  ? -50.255 -71.630  49.686  1.00 6.54  ? 257  SER A C     1 
ATOM   1930  O  O     . SER A 1 256  ? -49.611 -72.674  49.669  1.00 7.31  ? 257  SER A O     1 
ATOM   1931  C  CB    . SER A 1 256  ? -52.436 -71.891  50.853  1.00 7.74  ? 257  SER A CB    1 
ATOM   1932  O  OG    . SER A 1 256  ? -53.423 -70.907  51.131  1.00 10.43 ? 257  SER A OG    1 
ATOM   1933  N  N     . TYR A 1 257  ? -49.676 -70.463  49.919  1.00 6.30  ? 258  TYR A N     1 
ATOM   1934  C  CA    . TYR A 1 257  ? -48.228 -70.354  50.058  1.00 5.73  ? 258  TYR A CA    1 
ATOM   1935  C  C     . TYR A 1 257  ? -47.792 -69.481  51.228  1.00 5.94  ? 258  TYR A C     1 
ATOM   1936  O  O     . TYR A 1 257  ? -48.520 -68.580  51.674  1.00 6.57  ? 258  TYR A O     1 
ATOM   1937  C  CB    . TYR A 1 257  ? -47.618 -69.772  48.775  1.00 5.10  ? 258  TYR A CB    1 
ATOM   1938  C  CG    . TYR A 1 257  ? -47.811 -70.620  47.544  1.00 4.81  ? 258  TYR A CG    1 
ATOM   1939  C  CD1   . TYR A 1 257  ? -47.122 -71.820  47.394  1.00 5.14  ? 258  TYR A CD1   1 
ATOM   1940  C  CD2   . TYR A 1 257  ? -48.731 -70.264  46.559  1.00 4.90  ? 258  TYR A CD2   1 
ATOM   1941  C  CE1   . TYR A 1 257  ? -47.354 -72.663  46.305  1.00 4.91  ? 258  TYR A CE1   1 
ATOM   1942  C  CE2   . TYR A 1 257  ? -48.973 -71.106  45.456  1.00 4.54  ? 258  TYR A CE2   1 
ATOM   1943  C  CZ    . TYR A 1 257  ? -48.284 -72.302  45.349  1.00 4.38  ? 258  TYR A CZ    1 
ATOM   1944  O  OH    . TYR A 1 257  ? -48.559 -73.181  44.341  1.00 3.62  ? 258  TYR A OH    1 
ATOM   1945  N  N     . LYS A 1 258  ? -46.569 -69.718  51.677  1.00 5.52  ? 259  LYS A N     1 
ATOM   1946  C  CA    . LYS A 1 258  ? -45.970 -68.962  52.760  1.00 5.59  ? 259  LYS A CA    1 
ATOM   1947  C  C     . LYS A 1 258  ? -44.587 -68.576  52.300  1.00 5.09  ? 259  LYS A C     1 
ATOM   1948  O  O     . LYS A 1 258  ? -44.065 -69.198  51.387  1.00 5.45  ? 259  LYS A O     1 
ATOM   1949  C  CB    . LYS A 1 258  ? -45.848 -69.826  53.999  1.00 6.49  ? 259  LYS A CB    1 
ATOM   1950  C  CG    . LYS A 1 258  ? -47.043 -69.773  54.883  1.00 7.52  ? 259  LYS A CG    1 
ATOM   1951  C  CD    . LYS A 1 258  ? -46.865 -70.640  56.090  1.00 8.79  ? 259  LYS A CD    1 
ATOM   1952  C  CE    . LYS A 1 258  ? -48.082 -70.521  56.996  1.00 10.82 ? 259  LYS A CE    1 
ATOM   1953  N  NZ    . LYS A 1 258  ? -49.392 -70.793  56.287  1.00 13.12 ? 259  LYS A NZ    1 
ATOM   1954  N  N     . LEU A 1 259  ? -44.004 -67.547  52.913  1.00 4.20  ? 260  LEU A N     1 
ATOM   1955  C  CA    . LEU A 1 259  ? -42.655 -67.107  52.560  1.00 3.35  ? 260  LEU A CA    1 
ATOM   1956  C  C     . LEU A 1 259  ? -41.696 -68.291  52.581  1.00 3.47  ? 260  LEU A C     1 
ATOM   1957  O  O     . LEU A 1 259  ? -40.888 -68.429  51.686  1.00 3.79  ? 260  LEU A O     1 
ATOM   1958  C  CB    . LEU A 1 259  ? -42.184 -65.996  53.494  1.00 2.32  ? 260  LEU A CB    1 
ATOM   1959  C  CG    . LEU A 1 259  ? -42.441 -64.539  53.081  1.00 2.09  ? 260  LEU A CG    1 
ATOM   1960  C  CD1   . LEU A 1 259  ? -43.746 -64.355  52.383  1.00 2.00  ? 260  LEU A CD1   1 
ATOM   1961  C  CD2   . LEU A 1 259  ? -42.370 -63.650  54.282  1.00 2.00  ? 260  LEU A CD2   1 
ATOM   1962  N  N     . PHE A 1 260  ? -41.800 -69.141  53.601  1.00 3.90  ? 261  PHE A N     1 
ATOM   1963  C  CA    . PHE A 1 260  ? -41.012 -70.383  53.745  1.00 4.43  ? 261  PHE A CA    1 
ATOM   1964  C  C     . PHE A 1 260  ? -42.070 -71.371  54.262  1.00 5.28  ? 261  PHE A C     1 
ATOM   1965  O  O     . PHE A 1 260  ? -42.812 -71.042  55.187  1.00 5.72  ? 261  PHE A O     1 
ATOM   1966  C  CB    . PHE A 1 260  ? -39.922 -70.277  54.808  1.00 3.97  ? 261  PHE A CB    1 
ATOM   1967  C  CG    . PHE A 1 260  ? -38.800 -69.361  54.468  1.00 3.58  ? 261  PHE A CG    1 
ATOM   1968  C  CD1   . PHE A 1 260  ? -38.931 -67.984  54.641  1.00 3.26  ? 261  PHE A CD1   1 
ATOM   1969  C  CD2   . PHE A 1 260  ? -37.575 -69.873  54.070  1.00 3.62  ? 261  PHE A CD2   1 
ATOM   1970  C  CE1   . PHE A 1 260  ? -37.866 -67.128  54.436  1.00 2.98  ? 261  PHE A CE1   1 
ATOM   1971  C  CE2   . PHE A 1 260  ? -36.491 -69.015  53.861  1.00 3.72  ? 261  PHE A CE2   1 
ATOM   1972  C  CZ    . PHE A 1 260  ? -36.641 -67.637  54.049  1.00 3.11  ? 261  PHE A CZ    1 
ATOM   1973  N  N     . ASP A 1 261  ? -42.093 -72.583  53.721  1.00 6.06  ? 262  ASP A N     1 
ATOM   1974  C  CA    . ASP A 1 261  ? -43.094 -73.573  54.084  1.00 7.06  ? 262  ASP A CA    1 
ATOM   1975  C  C     . ASP A 1 261  ? -42.553 -74.901  54.515  1.00 7.67  ? 262  ASP A C     1 
ATOM   1976  O  O     . ASP A 1 261  ? -41.753 -75.493  53.803  1.00 7.95  ? 262  ASP A O     1 
ATOM   1977  C  CB    . ASP A 1 261  ? -43.979 -73.849  52.883  1.00 8.26  ? 262  ASP A CB    1 
ATOM   1978  C  CG    . ASP A 1 261  ? -45.245 -73.052  52.909  1.00 9.74  ? 262  ASP A CG    1 
ATOM   1979  O  OD1   . ASP A 1 261  ? -46.039 -73.217  53.872  1.00 10.49 ? 262  ASP A OD1   1 
ATOM   1980  O  OD2   . ASP A 1 261  ? -45.437 -72.257  51.968  1.00 10.48 ? 262  ASP A OD2   1 
ATOM   1981  N  N     . TYR A 1 262  ? -43.099 -75.439  55.602  1.00 8.09  ? 263  TYR A N     1 
ATOM   1982  C  CA    . TYR A 1 262  ? -42.661 -76.740  56.105  1.00 8.70  ? 263  TYR A CA    1 
ATOM   1983  C  C     . TYR A 1 262  ? -43.478 -77.905  55.558  1.00 9.42  ? 263  TYR A C     1 
ATOM   1984  O  O     . TYR A 1 262  ? -44.690 -77.816  55.394  1.00 10.38 ? 263  TYR A O     1 
ATOM   1985  C  CB    . TYR A 1 262  ? -42.732 -76.787  57.626  1.00 8.53  ? 263  TYR A CB    1 
ATOM   1986  C  CG    . TYR A 1 262  ? -42.070 -78.013  58.199  1.00 8.25  ? 263  TYR A CG    1 
ATOM   1987  C  CD1   . TYR A 1 262  ? -40.699 -78.195  58.092  1.00 8.13  ? 263  TYR A CD1   1 
ATOM   1988  C  CD2   . TYR A 1 262  ? -42.818 -79.000  58.816  1.00 8.37  ? 263  TYR A CD2   1 
ATOM   1989  C  CE1   . TYR A 1 262  ? -40.093 -79.329  58.587  1.00 8.97  ? 263  TYR A CE1   1 
ATOM   1990  C  CE2   . TYR A 1 262  ? -42.222 -80.151  59.315  1.00 8.93  ? 263  TYR A CE2   1 
ATOM   1991  C  CZ    . TYR A 1 262  ? -40.860 -80.313  59.202  1.00 9.19  ? 263  TYR A CZ    1 
ATOM   1992  O  OH    . TYR A 1 262  ? -40.264 -81.442  59.728  1.00 9.45  ? 263  TYR A OH    1 
ATOM   1993  N  N     . VAL A 1 263  ? -42.814 -79.019  55.311  1.00 9.54  ? 264  VAL A N     1 
ATOM   1994  C  CA    . VAL A 1 263  ? -43.473 -80.203  54.825  1.00 9.30  ? 264  VAL A CA    1 
ATOM   1995  C  C     . VAL A 1 263  ? -42.770 -81.321  55.562  1.00 9.90  ? 264  VAL A C     1 
ATOM   1996  O  O     . VAL A 1 263  ? -41.566 -81.225  55.841  1.00 10.60 ? 264  VAL A O     1 
ATOM   1997  C  CB    . VAL A 1 263  ? -43.290 -80.336  53.333  1.00 9.34  ? 264  VAL A CB    1 
ATOM   1998  C  CG1   . VAL A 1 263  ? -43.767 -81.680  52.858  1.00 9.84  ? 264  VAL A CG1   1 
ATOM   1999  C  CG2   . VAL A 1 263  ? -44.072 -79.272  52.650  1.00 9.41  ? 264  VAL A CG2   1 
ATOM   2000  N  N     . GLY A 1 264  ? -43.525 -82.350  55.937  1.00 10.02 ? 265  GLY A N     1 
ATOM   2001  C  CA    . GLY A 1 264  ? -42.939 -83.455  56.671  1.00 10.49 ? 265  GLY A CA    1 
ATOM   2002  C  C     . GLY A 1 264  ? -43.460 -83.571  58.094  1.00 10.96 ? 265  GLY A C     1 
ATOM   2003  O  O     . GLY A 1 264  ? -44.422 -82.911  58.474  1.00 11.35 ? 265  GLY A O     1 
ATOM   2004  N  N     . ALA A 1 265  ? -42.775 -84.379  58.893  1.00 11.13 ? 266  ALA A N     1 
ATOM   2005  C  CA    . ALA A 1 265  ? -43.130 -84.660  60.285  1.00 11.20 ? 266  ALA A CA    1 
ATOM   2006  C  C     . ALA A 1 265  ? -43.025 -83.508  61.253  1.00 11.32 ? 266  ALA A C     1 
ATOM   2007  O  O     . ALA A 1 265  ? -42.019 -82.817  61.294  1.00 11.33 ? 266  ALA A O     1 
ATOM   2008  C  CB    . ALA A 1 265  ? -42.264 -85.798  60.797  1.00 11.72 ? 266  ALA A CB    1 
ATOM   2009  N  N     . PRO A 1 266  ? -44.037 -83.336  62.113  1.00 11.66 ? 267  PRO A N     1 
ATOM   2010  C  CA    . PRO A 1 266  ? -44.053 -82.262  63.104  1.00 12.02 ? 267  PRO A CA    1 
ATOM   2011  C  C     . PRO A 1 266  ? -42.953 -82.429  64.120  1.00 12.79 ? 267  PRO A C     1 
ATOM   2012  O  O     . PRO A 1 266  ? -42.485 -81.443  64.683  1.00 13.63 ? 267  PRO A O     1 
ATOM   2013  C  CB    . PRO A 1 266  ? -45.414 -82.424  63.741  1.00 11.38 ? 267  PRO A CB    1 
ATOM   2014  C  CG    . PRO A 1 266  ? -46.222 -82.858  62.612  1.00 11.35 ? 267  PRO A CG    1 
ATOM   2015  C  CD    . PRO A 1 266  ? -45.366 -83.949  62.032  1.00 11.45 ? 267  PRO A CD    1 
ATOM   2016  N  N     . ASP A 1 267  ? -42.539 -83.672  64.358  1.00 13.16 ? 268  ASP A N     1 
ATOM   2017  C  CA    . ASP A 1 267  ? -41.462 -83.966  65.310  1.00 13.53 ? 268  ASP A CA    1 
ATOM   2018  C  C     . ASP A 1 267  ? -40.223 -84.518  64.578  1.00 13.84 ? 268  ASP A C     1 
ATOM   2019  O  O     . ASP A 1 267  ? -39.522 -85.413  65.071  1.00 14.06 ? 268  ASP A O     1 
ATOM   2020  C  CB    . ASP A 1 267  ? -41.946 -84.978  66.353  1.00 13.93 ? 268  ASP A CB    1 
ATOM   2021  C  CG    . ASP A 1 267  ? -42.326 -86.320  65.733  1.00 14.09 ? 268  ASP A CG    1 
ATOM   2022  O  OD1   . ASP A 1 267  ? -42.476 -86.383  64.498  1.00 13.99 ? 268  ASP A OD1   1 
ATOM   2023  O  OD2   . ASP A 1 267  ? -42.478 -87.315  66.475  1.00 14.33 ? 268  ASP A OD2   1 
ATOM   2024  N  N     . ALA A 1 268  ? -40.003 -84.029  63.362  1.00 13.72 ? 269  ALA A N     1 
ATOM   2025  C  CA    . ALA A 1 268  ? -38.860 -84.451  62.575  1.00 13.19 ? 269  ALA A CA    1 
ATOM   2026  C  C     . ALA A 1 268  ? -37.626 -83.999  63.322  1.00 13.09 ? 269  ALA A C     1 
ATOM   2027  O  O     . ALA A 1 268  ? -37.631 -82.946  63.968  1.00 12.98 ? 269  ALA A O     1 
ATOM   2028  C  CB    . ALA A 1 268  ? -38.894 -83.802  61.210  1.00 13.01 ? 269  ALA A CB    1 
ATOM   2029  N  N     . GLU A 1 269  ? -36.580 -84.808  63.276  1.00 12.69 ? 270  GLU A N     1 
ATOM   2030  C  CA    . GLU A 1 269  ? -35.344 -84.450  63.941  1.00 12.24 ? 270  GLU A CA    1 
ATOM   2031  C  C     . GLU A 1 269  ? -34.330 -83.945  62.935  1.00 11.04 ? 270  GLU A C     1 
ATOM   2032  O  O     . GLU A 1 269  ? -33.422 -83.190  63.267  1.00 10.97 ? 270  GLU A O     1 
ATOM   2033  C  CB    . GLU A 1 269  ? -34.779 -85.663  64.629  1.00 13.50 ? 270  GLU A CB    1 
ATOM   2034  C  CG    . GLU A 1 269  ? -35.718 -86.298  65.592  1.00 16.46 ? 270  GLU A CG    1 
ATOM   2035  C  CD    . GLU A 1 269  ? -35.161 -87.594  66.105  1.00 18.71 ? 270  GLU A CD    1 
ATOM   2036  O  OE1   . GLU A 1 269  ? -34.548 -88.334  65.288  1.00 20.24 ? 270  GLU A OE1   1 
ATOM   2037  O  OE2   . GLU A 1 269  ? -35.318 -87.869  67.320  1.00 20.20 ? 270  GLU A OE2   1 
ATOM   2038  N  N     . ARG A 1 270  ? -34.480 -84.412  61.703  1.00 9.52  ? 271  ARG A N     1 
ATOM   2039  C  CA    . ARG A 1 270  ? -33.601 -84.068  60.605  1.00 8.04  ? 271  ARG A CA    1 
ATOM   2040  C  C     . ARG A 1 270  ? -34.416 -83.301  59.590  1.00 7.51  ? 271  ARG A C     1 
ATOM   2041  O  O     . ARG A 1 270  ? -35.261 -83.896  58.922  1.00 8.44  ? 271  ARG A O     1 
ATOM   2042  C  CB    . ARG A 1 270  ? -33.113 -85.353  59.954  1.00 7.46  ? 271  ARG A CB    1 
ATOM   2043  C  CG    . ARG A 1 270  ? -32.474 -86.321  60.905  1.00 7.00  ? 271  ARG A CG    1 
ATOM   2044  C  CD    . ARG A 1 270  ? -32.151 -87.611  60.202  1.00 7.24  ? 271  ARG A CD    1 
ATOM   2045  N  NE    . ARG A 1 270  ? -33.038 -88.678  60.625  1.00 7.58  ? 271  ARG A NE    1 
ATOM   2046  C  CZ    . ARG A 1 270  ? -33.345 -89.735  59.883  1.00 8.02  ? 271  ARG A CZ    1 
ATOM   2047  N  NH1   . ARG A 1 270  ? -32.842 -89.873  58.665  1.00 8.17  ? 271  ARG A NH1   1 
ATOM   2048  N  NH2   . ARG A 1 270  ? -34.154 -90.665  60.371  1.00 8.67  ? 271  ARG A NH2   1 
ATOM   2049  N  N     . VAL A 1 271  ? -34.180 -82.000  59.458  1.00 6.41  ? 272  VAL A N     1 
ATOM   2050  C  CA    . VAL A 1 271  ? -34.927 -81.180  58.498  1.00 5.71  ? 272  VAL A CA    1 
ATOM   2051  C  C     . VAL A 1 271  ? -34.000 -80.726  57.369  1.00 5.14  ? 272  VAL A C     1 
ATOM   2052  O  O     . VAL A 1 271  ? -32.797 -80.677  57.573  1.00 6.25  ? 272  VAL A O     1 
ATOM   2053  C  CB    . VAL A 1 271  ? -35.525 -79.952  59.192  1.00 5.35  ? 272  VAL A CB    1 
ATOM   2054  C  CG1   . VAL A 1 271  ? -36.331 -79.153  58.226  1.00 5.98  ? 272  VAL A CG1   1 
ATOM   2055  C  CG2   . VAL A 1 271  ? -36.407 -80.379  60.345  1.00 5.54  ? 272  VAL A CG2   1 
ATOM   2056  N  N     . ILE A 1 272  ? -34.537 -80.474  56.173  1.00 3.78  ? 273  ILE A N     1 
ATOM   2057  C  CA    . ILE A 1 272  ? -33.743 -80.017  55.019  1.00 2.88  ? 273  ILE A CA    1 
ATOM   2058  C  C     . ILE A 1 272  ? -34.309 -78.683  54.555  1.00 3.09  ? 273  ILE A C     1 
ATOM   2059  O  O     . ILE A 1 272  ? -35.536 -78.501  54.556  1.00 3.80  ? 273  ILE A O     1 
ATOM   2060  C  CB    . ILE A 1 272  ? -33.895 -80.944  53.800  1.00 2.40  ? 273  ILE A CB    1 
ATOM   2061  C  CG1   . ILE A 1 272  ? -32.873 -82.051  53.771  1.00 2.24  ? 273  ILE A CG1   1 
ATOM   2062  C  CG2   . ILE A 1 272  ? -33.600 -80.216  52.551  1.00 2.40  ? 273  ILE A CG2   1 
ATOM   2063  C  CD1   . ILE A 1 272  ? -32.899 -82.739  52.401  1.00 2.00  ? 273  ILE A CD1   1 
ATOM   2064  N  N     . VAL A 1 273  ? -33.436 -77.771  54.122  1.00 2.57  ? 274  VAL A N     1 
ATOM   2065  C  CA    . VAL A 1 273  ? -33.878 -76.485  53.605  1.00 2.23  ? 274  VAL A CA    1 
ATOM   2066  C  C     . VAL A 1 273  ? -33.512 -76.500  52.148  1.00 2.40  ? 274  VAL A C     1 
ATOM   2067  O  O     . VAL A 1 273  ? -32.350 -76.605  51.819  1.00 3.63  ? 274  VAL A O     1 
ATOM   2068  C  CB    . VAL A 1 273  ? -33.162 -75.332  54.270  1.00 2.00  ? 274  VAL A CB    1 
ATOM   2069  C  CG1   . VAL A 1 273  ? -33.615 -74.011  53.668  1.00 2.00  ? 274  VAL A CG1   1 
ATOM   2070  C  CG2   . VAL A 1 273  ? -33.449 -75.347  55.742  1.00 2.00  ? 274  VAL A CG2   1 
ATOM   2071  N  N     . SER A 1 274  ? -34.480 -76.437  51.255  1.00 2.25  ? 275  SER A N     1 
ATOM   2072  C  CA    . SER A 1 274  ? -34.144 -76.469  49.841  1.00 2.33  ? 275  SER A CA    1 
ATOM   2073  C  C     . SER A 1 274  ? -34.873 -75.339  49.135  1.00 2.13  ? 275  SER A C     1 
ATOM   2074  O  O     . SER A 1 274  ? -35.625 -74.620  49.768  1.00 2.82  ? 275  SER A O     1 
ATOM   2075  C  CB    . SER A 1 274  ? -34.518 -77.831  49.255  1.00 2.83  ? 275  SER A CB    1 
ATOM   2076  O  OG    . SER A 1 274  ? -33.810 -78.108  48.051  1.00 3.76  ? 275  SER A OG    1 
ATOM   2077  N  N     . MET A 1 275  ? -34.613 -75.153  47.847  1.00 2.00  ? 276  MET A N     1 
ATOM   2078  C  CA    . MET A 1 275  ? -35.246 -74.089  47.074  1.00 2.00  ? 276  MET A CA    1 
ATOM   2079  C  C     . MET A 1 275  ? -35.190 -74.459  45.611  1.00 2.00  ? 276  MET A C     1 
ATOM   2080  O  O     . MET A 1 275  ? -34.133 -74.830  45.096  1.00 2.19  ? 276  MET A O     1 
ATOM   2081  C  CB    . MET A 1 275  ? -34.527 -72.753  47.285  1.00 2.00  ? 276  MET A CB    1 
ATOM   2082  C  CG    . MET A 1 275  ? -34.986 -71.649  46.338  1.00 2.00  ? 276  MET A CG    1 
ATOM   2083  S  SD    . MET A 1 275  ? -34.322 -70.052  46.741  1.00 2.00  ? 276  MET A SD    1 
ATOM   2084  C  CE    . MET A 1 275  ? -32.624 -70.546  46.827  1.00 2.00  ? 276  MET A CE    1 
ATOM   2085  N  N     . GLY A 1 276  ? -36.299 -74.283  44.917  1.00 2.00  ? 277  GLY A N     1 
ATOM   2086  C  CA    . GLY A 1 276  ? -36.321 -74.663  43.525  1.00 2.67  ? 277  GLY A CA    1 
ATOM   2087  C  C     . GLY A 1 276  ? -36.992 -76.022  43.455  1.00 3.70  ? 277  GLY A C     1 
ATOM   2088  O  O     . GLY A 1 276  ? -37.554 -76.482  44.453  1.00 4.21  ? 277  GLY A O     1 
ATOM   2089  N  N     . SER A 1 277  ? -36.872 -76.721  42.330  1.00 3.44  ? 278  SER A N     1 
ATOM   2090  C  CA    . SER A 1 277  ? -37.557 -77.998  42.183  1.00 3.04  ? 278  SER A CA    1 
ATOM   2091  C  C     . SER A 1 277  ? -37.109 -79.164  43.014  1.00 3.28  ? 278  SER A C     1 
ATOM   2092  O  O     . SER A 1 277  ? -37.763 -80.205  43.009  1.00 3.91  ? 278  SER A O     1 
ATOM   2093  C  CB    . SER A 1 277  ? -37.583 -78.425  40.730  1.00 3.12  ? 278  SER A CB    1 
ATOM   2094  O  OG    . SER A 1 277  ? -36.288 -78.387  40.186  1.00 3.63  ? 278  SER A OG    1 
ATOM   2095  N  N     . SER A 1 278  ? -36.005 -79.033  43.727  1.00 3.45  ? 279  SER A N     1 
ATOM   2096  C  CA    . SER A 1 278  ? -35.565 -80.168  44.506  1.00 3.57  ? 279  SER A CA    1 
ATOM   2097  C  C     . SER A 1 278  ? -36.655 -80.485  45.489  1.00 3.96  ? 279  SER A C     1 
ATOM   2098  O  O     . SER A 1 278  ? -36.966 -81.653  45.709  1.00 4.74  ? 279  SER A O     1 
ATOM   2099  C  CB    . SER A 1 278  ? -34.255 -79.885  45.236  1.00 3.50  ? 279  SER A CB    1 
ATOM   2100  O  OG    . SER A 1 278  ? -33.887 -78.521  45.161  1.00 3.82  ? 279  SER A OG    1 
ATOM   2101  N  N     . CYS A 1 279  ? -37.318 -79.448  45.989  1.00 3.51  ? 280  CYS A N     1 
ATOM   2102  C  CA    . CYS A 1 279  ? -38.369 -79.643  46.974  1.00 4.49  ? 280  CYS A CA    1 
ATOM   2103  C  C     . CYS A 1 279  ? -39.423 -80.698  46.601  1.00 4.47  ? 280  CYS A C     1 
ATOM   2104  O  O     . CYS A 1 279  ? -39.809 -81.496  47.441  1.00 4.52  ? 280  CYS A O     1 
ATOM   2105  C  CB    . CYS A 1 279  ? -39.056 -78.315  47.300  1.00 5.31  ? 280  CYS A CB    1 
ATOM   2106  S  SG    . CYS A 1 279  ? -38.011 -77.067  48.097  1.00 7.94  ? 280  CYS A SG    1 
ATOM   2107  N  N     . GLU A 1 280  ? -39.866 -80.713  45.348  1.00 4.09  ? 281  GLU A N     1 
ATOM   2108  C  CA    . GLU A 1 280  ? -40.870 -81.651  44.929  1.00 4.01  ? 281  GLU A CA    1 
ATOM   2109  C  C     . GLU A 1 280  ? -40.379 -83.051  45.166  1.00 4.62  ? 281  GLU A C     1 
ATOM   2110  O  O     . GLU A 1 280  ? -41.019 -83.835  45.876  1.00 5.46  ? 281  GLU A O     1 
ATOM   2111  C  CB    . GLU A 1 280  ? -41.180 -81.451  43.472  1.00 5.06  ? 281  GLU A CB    1 
ATOM   2112  C  CG    . GLU A 1 280  ? -41.743 -80.082  43.163  1.00 6.56  ? 281  GLU A CG    1 
ATOM   2113  C  CD    . GLU A 1 280  ? -42.924 -79.750  44.035  1.00 8.11  ? 281  GLU A CD    1 
ATOM   2114  O  OE1   . GLU A 1 280  ? -43.977 -80.411  43.871  1.00 7.46  ? 281  GLU A OE1   1 
ATOM   2115  O  OE2   . GLU A 1 280  ? -42.793 -78.846  44.905  1.00 9.80  ? 281  GLU A OE2   1 
ATOM   2116  N  N     . THR A 1 281  ? -39.213 -83.363  44.621  1.00 4.38  ? 282  THR A N     1 
ATOM   2117  C  CA    . THR A 1 281  ? -38.639 -84.689  44.807  1.00 3.94  ? 282  THR A CA    1 
ATOM   2118  C  C     . THR A 1 281  ? -38.337 -84.973  46.273  1.00 3.57  ? 282  THR A C     1 
ATOM   2119  O  O     . THR A 1 281  ? -38.507 -86.089  46.737  1.00 3.49  ? 282  THR A O     1 
ATOM   2120  C  CB    . THR A 1 281  ? -37.365 -84.845  44.007  1.00 4.03  ? 282  THR A CB    1 
ATOM   2121  O  OG1   . THR A 1 281  ? -37.687 -84.866  42.611  1.00 4.50  ? 282  THR A OG1   1 
ATOM   2122  C  CG2   . THR A 1 281  ? -36.676 -86.128  44.383  1.00 4.35  ? 282  THR A CG2   1 
ATOM   2123  N  N     . ILE A 1 282  ? -37.884 -83.970  47.009  1.00 3.31  ? 283  ILE A N     1 
ATOM   2124  C  CA    . ILE A 1 282  ? -37.596 -84.188  48.415  1.00 3.73  ? 283  ILE A CA    1 
ATOM   2125  C  C     . ILE A 1 282  ? -38.889 -84.526  49.135  1.00 4.23  ? 283  ILE A C     1 
ATOM   2126  O  O     . ILE A 1 282  ? -38.917 -85.456  49.931  1.00 4.68  ? 283  ILE A O     1 
ATOM   2127  C  CB    . ILE A 1 282  ? -36.978 -82.955  49.068  1.00 2.95  ? 283  ILE A CB    1 
ATOM   2128  C  CG1   . ILE A 1 282  ? -35.665 -82.627  48.374  1.00 3.00  ? 283  ILE A CG1   1 
ATOM   2129  C  CG2   . ILE A 1 282  ? -36.803 -83.169  50.558  1.00 2.00  ? 283  ILE A CG2   1 
ATOM   2130  C  CD1   . ILE A 1 282  ? -35.184 -81.220  48.603  1.00 3.08  ? 283  ILE A CD1   1 
ATOM   2131  N  N     . GLU A 1 283  ? -39.966 -83.818  48.783  1.00 4.58  ? 284  GLU A N     1 
ATOM   2132  C  CA    . GLU A 1 283  ? -41.282 -84.004  49.413  1.00 4.89  ? 284  GLU A CA    1 
ATOM   2133  C  C     . GLU A 1 283  ? -41.774 -85.388  49.150  1.00 4.16  ? 284  GLU A C     1 
ATOM   2134  O  O     . GLU A 1 283  ? -42.275 -86.063  50.040  1.00 4.27  ? 284  GLU A O     1 
ATOM   2135  C  CB    . GLU A 1 283  ? -42.318 -82.995  48.890  1.00 5.96  ? 284  GLU A CB    1 
ATOM   2136  C  CG    . GLU A 1 283  ? -43.737 -83.176  49.465  1.00 7.93  ? 284  GLU A CG    1 
ATOM   2137  C  CD    . GLU A 1 283  ? -44.579 -81.885  49.490  1.00 9.02  ? 284  GLU A CD    1 
ATOM   2138  O  OE1   . GLU A 1 283  ? -44.285 -80.951  48.727  1.00 9.70  ? 284  GLU A OE1   1 
ATOM   2139  O  OE2   . GLU A 1 283  ? -45.543 -81.797  50.284  1.00 10.01 ? 284  GLU A OE2   1 
ATOM   2140  N  N     . GLU A 1 284  ? -41.585 -85.820  47.922  1.00 3.42  ? 285  GLU A N     1 
ATOM   2141  C  CA    . GLU A 1 284  ? -42.003 -87.134  47.526  1.00 3.02  ? 285  GLU A CA    1 
ATOM   2142  C  C     . GLU A 1 284  ? -41.330 -88.224  48.330  1.00 3.63  ? 285  GLU A C     1 
ATOM   2143  O  O     . GLU A 1 284  ? -41.934 -89.275  48.565  1.00 4.72  ? 285  GLU A O     1 
ATOM   2144  C  CB    . GLU A 1 284  ? -41.676 -87.317  46.073  1.00 2.13  ? 285  GLU A CB    1 
ATOM   2145  C  CG    . GLU A 1 284  ? -41.865 -88.670  45.582  1.00 2.00  ? 285  GLU A CG    1 
ATOM   2146  C  CD    . GLU A 1 284  ? -41.847 -88.677  44.109  1.00 2.52  ? 285  GLU A CD    1 
ATOM   2147  O  OE1   . GLU A 1 284  ? -42.633 -87.896  43.504  1.00 3.09  ? 285  GLU A OE1   1 
ATOM   2148  O  OE2   . GLU A 1 284  ? -41.030 -89.427  43.556  1.00 2.01  ? 285  GLU A OE2   1 
ATOM   2149  N  N     . VAL A 1 285  ? -40.076 -88.002  48.723  1.00 3.68  ? 286  VAL A N     1 
ATOM   2150  C  CA    . VAL A 1 285  ? -39.335 -89.004  49.489  1.00 3.41  ? 286  VAL A CA    1 
ATOM   2151  C  C     . VAL A 1 285  ? -39.728 -88.909  50.935  1.00 4.16  ? 286  VAL A C     1 
ATOM   2152  O  O     . VAL A 1 285  ? -39.786 -89.885  51.665  1.00 4.55  ? 286  VAL A O     1 
ATOM   2153  C  CB    . VAL A 1 285  ? -37.848 -88.798  49.369  1.00 2.13  ? 286  VAL A CB    1 
ATOM   2154  C  CG1   . VAL A 1 285  ? -37.113 -89.807  50.219  1.00 2.00  ? 286  VAL A CG1   1 
ATOM   2155  C  CG2   . VAL A 1 285  ? -37.455 -88.960  47.953  1.00 2.32  ? 286  VAL A CG2   1 
ATOM   2156  N  N     . ILE A 1 286  ? -39.986 -87.692  51.347  1.00 5.07  ? 287  ILE A N     1 
ATOM   2157  C  CA    . ILE A 1 286  ? -40.383 -87.449  52.688  1.00 5.58  ? 287  ILE A CA    1 
ATOM   2158  C  C     . ILE A 1 286  ? -41.580 -88.331  52.949  1.00 6.60  ? 287  ILE A C     1 
ATOM   2159  O  O     . ILE A 1 286  ? -41.531 -89.138  53.856  1.00 7.84  ? 287  ILE A O     1 
ATOM   2160  C  CB    . ILE A 1 286  ? -40.683 -85.988  52.865  1.00 5.15  ? 287  ILE A CB    1 
ATOM   2161  C  CG1   . ILE A 1 286  ? -39.361 -85.250  53.069  1.00 5.32  ? 287  ILE A CG1   1 
ATOM   2162  C  CG2   . ILE A 1 286  ? -41.704 -85.779  53.947  1.00 5.65  ? 287  ILE A CG2   1 
ATOM   2163  C  CD1   . ILE A 1 286  ? -39.496 -83.869  53.686  1.00 5.90  ? 287  ILE A CD1   1 
ATOM   2164  N  N     . ASN A 1 287  ? -42.588 -88.290  52.081  1.00 7.18  ? 288  ASN A N     1 
ATOM   2165  C  CA    . ASN A 1 287  ? -43.783 -89.113  52.285  1.00 7.98  ? 288  ASN A CA    1 
ATOM   2166  C  C     . ASN A 1 287  ? -43.447 -90.581  52.462  1.00 8.93  ? 288  ASN A C     1 
ATOM   2167  O  O     . ASN A 1 287  ? -43.868 -91.209  53.430  1.00 9.52  ? 288  ASN A O     1 
ATOM   2168  C  CB    . ASN A 1 287  ? -44.763 -88.980  51.128  1.00 7.39  ? 288  ASN A CB    1 
ATOM   2169  C  CG    . ASN A 1 287  ? -45.278 -87.579  50.955  1.00 7.86  ? 288  ASN A CG    1 
ATOM   2170  O  OD1   . ASN A 1 287  ? -45.614 -87.167  49.844  1.00 9.02  ? 288  ASN A OD1   1 
ATOM   2171  N  ND2   . ASN A 1 287  ? -45.340 -86.825  52.046  1.00 8.40  ? 288  ASN A ND2   1 
ATOM   2172  N  N     . HIS A 1 288  ? -42.672 -91.113  51.527  1.00 9.47  ? 289  HIS A N     1 
ATOM   2173  C  CA    . HIS A 1 288  ? -42.276 -92.505  51.539  1.00 9.90  ? 289  HIS A CA    1 
ATOM   2174  C  C     . HIS A 1 288  ? -41.649 -92.846  52.880  1.00 10.16 ? 289  HIS A C     1 
ATOM   2175  O  O     . HIS A 1 288  ? -42.237 -93.584  53.679  1.00 10.95 ? 289  HIS A O     1 
ATOM   2176  C  CB    . HIS A 1 288  ? -41.303 -92.738  50.395  1.00 10.76 ? 289  HIS A CB    1 
ATOM   2177  C  CG    . HIS A 1 288  ? -40.771 -94.128  50.318  1.00 12.38 ? 289  HIS A CG    1 
ATOM   2178  N  ND1   . HIS A 1 288  ? -39.674 -94.538  51.045  1.00 13.09 ? 289  HIS A ND1   1 
ATOM   2179  C  CD2   . HIS A 1 288  ? -41.127 -95.179  49.546  1.00 13.33 ? 289  HIS A CD2   1 
ATOM   2180  C  CE1   . HIS A 1 288  ? -39.371 -95.782  50.718  1.00 14.07 ? 289  HIS A CE1   1 
ATOM   2181  N  NE2   . HIS A 1 288  ? -40.237 -96.196  49.811  1.00 14.15 ? 289  HIS A NE2   1 
ATOM   2182  N  N     . LEU A 1 289  ? -40.502 -92.235  53.159  1.00 9.83  ? 290  LEU A N     1 
ATOM   2183  C  CA    . LEU A 1 289  ? -39.773 -92.445  54.396  1.00 8.75  ? 290  LEU A CA    1 
ATOM   2184  C  C     . LEU A 1 289  ? -40.629 -92.232  55.637  1.00 8.85  ? 290  LEU A C     1 
ATOM   2185  O  O     . LEU A 1 289  ? -40.624 -93.045  56.540  1.00 8.96  ? 290  LEU A O     1 
ATOM   2186  C  CB    . LEU A 1 289  ? -38.550 -91.530  54.422  1.00 7.51  ? 290  LEU A CB    1 
ATOM   2187  C  CG    . LEU A 1 289  ? -37.254 -92.182  53.940  1.00 6.87  ? 290  LEU A CG    1 
ATOM   2188  C  CD1   . LEU A 1 289  ? -37.511 -93.178  52.878  1.00 6.29  ? 290  LEU A CD1   1 
ATOM   2189  C  CD2   . LEU A 1 289  ? -36.294 -91.144  53.465  1.00 7.16  ? 290  LEU A CD2   1 
ATOM   2190  N  N     . ALA A 1 290  ? -41.431 -91.185  55.651  1.00 9.23  ? 291  ALA A N     1 
ATOM   2191  C  CA    . ALA A 1 290  ? -42.255 -90.895  56.811  1.00 10.20 ? 291  ALA A CA    1 
ATOM   2192  C  C     . ALA A 1 290  ? -43.312 -91.955  57.080  1.00 10.75 ? 291  ALA A C     1 
ATOM   2193  O  O     . ALA A 1 290  ? -43.633 -92.244  58.237  1.00 11.43 ? 291  ALA A O     1 
ATOM   2194  C  CB    . ALA A 1 290  ? -42.895 -89.544  56.666  1.00 10.59 ? 291  ALA A CB    1 
ATOM   2195  N  N     . ALA A 1 291  ? -43.863 -92.523  56.014  1.00 10.74 ? 292  ALA A N     1 
ATOM   2196  C  CA    . ALA A 1 291  ? -44.864 -93.573  56.135  1.00 10.49 ? 292  ALA A CA    1 
ATOM   2197  C  C     . ALA A 1 291  ? -44.244 -94.736  56.917  1.00 10.59 ? 292  ALA A C     1 
ATOM   2198  O  O     . ALA A 1 291  ? -44.949 -95.574  57.479  1.00 11.03 ? 292  ALA A O     1 
ATOM   2199  C  CB    . ALA A 1 291  ? -45.279 -94.038  54.752  1.00 10.23 ? 292  ALA A CB    1 
ATOM   2200  N  N     . LYS A 1 292  ? -42.912 -94.769  56.927  1.00 10.54 ? 293  LYS A N     1 
ATOM   2201  C  CA    . LYS A 1 292  ? -42.125 -95.782  57.614  1.00 10.28 ? 293  LYS A CA    1 
ATOM   2202  C  C     . LYS A 1 292  ? -41.691 -95.396  59.013  1.00 10.50 ? 293  LYS A C     1 
ATOM   2203  O  O     . LYS A 1 292  ? -40.868 -96.082  59.589  1.00 10.11 ? 293  LYS A O     1 
ATOM   2204  C  CB    . LYS A 1 292  ? -40.856 -96.064  56.839  1.00 10.14 ? 293  LYS A CB    1 
ATOM   2205  C  CG    . LYS A 1 292  ? -41.040 -96.785  55.568  1.00 10.97 ? 293  LYS A CG    1 
ATOM   2206  C  CD    . LYS A 1 292  ? -39.712 -97.372  55.184  1.00 12.64 ? 293  LYS A CD    1 
ATOM   2207  C  CE    . LYS A 1 292  ? -39.857 -98.345  54.050  1.00 13.68 ? 293  LYS A CE    1 
ATOM   2208  N  NZ    . LYS A 1 292  ? -40.338 -97.640  52.836  1.00 14.41 ? 293  LYS A NZ    1 
ATOM   2209  N  N     . GLY A 1 293  ? -42.175 -94.274  59.531  1.00 11.02 ? 294  GLY A N     1 
ATOM   2210  C  CA    . GLY A 1 293  ? -41.784 -93.854  60.873  1.00 12.10 ? 294  GLY A CA    1 
ATOM   2211  C  C     . GLY A 1 293  ? -40.603 -92.874  61.053  1.00 12.88 ? 294  GLY A C     1 
ATOM   2212  O  O     . GLY A 1 293  ? -40.240 -92.511  62.207  1.00 13.35 ? 294  GLY A O     1 
ATOM   2213  N  N     . GLU A 1 294  ? -40.012 -92.418  59.943  1.00 12.42 ? 295  GLU A N     1 
ATOM   2214  C  CA    . GLU A 1 294  ? -38.886 -91.499  60.026  1.00 11.58 ? 295  GLU A CA    1 
ATOM   2215  C  C     . GLU A 1 294  ? -39.260 -90.050  60.361  1.00 11.04 ? 295  GLU A C     1 
ATOM   2216  O  O     . GLU A 1 294  ? -40.275 -89.510  59.901  1.00 10.46 ? 295  GLU A O     1 
ATOM   2217  C  CB    . GLU A 1 294  ? -38.034 -91.591  58.763  1.00 11.59 ? 295  GLU A CB    1 
ATOM   2218  C  CG    . GLU A 1 294  ? -36.820 -92.500  58.913  1.00 12.30 ? 295  GLU A CG    1 
ATOM   2219  C  CD    . GLU A 1 294  ? -35.889 -92.434  57.710  1.00 13.18 ? 295  GLU A CD    1 
ATOM   2220  O  OE1   . GLU A 1 294  ? -36.300 -92.947  56.659  1.00 13.95 ? 295  GLU A OE1   1 
ATOM   2221  O  OE2   . GLU A 1 294  ? -34.758 -91.876  57.789  1.00 13.05 ? 295  GLU A OE2   1 
ATOM   2222  N  N     . LYS A 1 295  ? -38.450 -89.459  61.229  1.00 10.33 ? 296  LYS A N     1 
ATOM   2223  C  CA    . LYS A 1 295  ? -38.659 -88.092  61.664  1.00 10.04 ? 296  LYS A CA    1 
ATOM   2224  C  C     . LYS A 1 295  ? -37.863 -87.128  60.818  1.00 9.20  ? 296  LYS A C     1 
ATOM   2225  O  O     . LYS A 1 295  ? -36.899 -86.545  61.290  1.00 9.21  ? 296  LYS A O     1 
ATOM   2226  C  CB    . LYS A 1 295  ? -38.257 -87.936  63.128  1.00 10.89 ? 296  LYS A CB    1 
ATOM   2227  C  CG    . LYS A 1 295  ? -38.989 -88.875  64.051  1.00 11.98 ? 296  LYS A CG    1 
ATOM   2228  C  CD    . LYS A 1 295  ? -40.404 -88.426  64.195  1.00 13.48 ? 296  LYS A CD    1 
ATOM   2229  C  CE    . LYS A 1 295  ? -41.371 -89.594  64.354  1.00 15.60 ? 296  LYS A CE    1 
ATOM   2230  N  NZ    . LYS A 1 295  ? -42.824 -89.163  64.292  1.00 16.46 ? 296  LYS A NZ    1 
ATOM   2231  N  N     . ILE A 1 296  ? -38.308 -86.921  59.585  1.00 8.02  ? 297  ILE A N     1 
ATOM   2232  C  CA    . ILE A 1 296  ? -37.632 -86.022  58.668  1.00 6.53  ? 297  ILE A CA    1 
ATOM   2233  C  C     . ILE A 1 296  ? -38.560 -84.921  58.173  1.00 6.02  ? 297  ILE A C     1 
ATOM   2234  O  O     . ILE A 1 296  ? -39.766 -85.095  58.168  1.00 6.37  ? 297  ILE A O     1 
ATOM   2235  C  CB    . ILE A 1 296  ? -37.091 -86.820  57.496  1.00 6.26  ? 297  ILE A CB    1 
ATOM   2236  C  CG1   . ILE A 1 296  ? -38.217 -87.475  56.703  1.00 6.01  ? 297  ILE A CG1   1 
ATOM   2237  C  CG2   . ILE A 1 296  ? -36.221 -87.924  58.018  1.00 6.50  ? 297  ILE A CG2   1 
ATOM   2238  C  CD1   . ILE A 1 296  ? -37.694 -88.432  55.615  1.00 6.32  ? 297  ILE A CD1   1 
ATOM   2239  N  N     . GLY A 1 297  ? -38.009 -83.770  57.796  1.00 5.67  ? 298  GLY A N     1 
ATOM   2240  C  CA    . GLY A 1 297  ? -38.846 -82.686  57.298  1.00 4.88  ? 298  GLY A CA    1 
ATOM   2241  C  C     . GLY A 1 297  ? -38.188 -81.890  56.177  1.00 4.53  ? 298  GLY A C     1 
ATOM   2242  O  O     . GLY A 1 297  ? -37.106 -82.256  55.714  1.00 3.94  ? 298  GLY A O     1 
ATOM   2243  N  N     . LEU A 1 298  ? -38.845 -80.802  55.753  1.00 4.12  ? 299  LEU A N     1 
ATOM   2244  C  CA    . LEU A 1 298  ? -38.340 -79.920  54.692  1.00 3.56  ? 299  LEU A CA    1 
ATOM   2245  C  C     . LEU A 1 298  ? -38.950 -78.529  54.761  1.00 3.27  ? 299  LEU A C     1 
ATOM   2246  O  O     . LEU A 1 298  ? -40.131 -78.389  55.049  1.00 3.44  ? 299  LEU A O     1 
ATOM   2247  C  CB    . LEU A 1 298  ? -38.664 -80.510  53.320  1.00 3.78  ? 299  LEU A CB    1 
ATOM   2248  C  CG    . LEU A 1 298  ? -38.658 -79.624  52.064  1.00 3.98  ? 299  LEU A CG    1 
ATOM   2249  C  CD1   . LEU A 1 298  ? -37.255 -79.120  51.746  1.00 4.07  ? 299  LEU A CD1   1 
ATOM   2250  C  CD2   . LEU A 1 298  ? -39.207 -80.411  50.878  1.00 3.39  ? 299  LEU A CD2   1 
ATOM   2251  N  N     . ILE A 1 299  ? -38.131 -77.500  54.571  1.00 2.67  ? 300  ILE A N     1 
ATOM   2252  C  CA    . ILE A 1 299  ? -38.629 -76.130  54.535  1.00 2.41  ? 300  ILE A CA    1 
ATOM   2253  C  C     . ILE A 1 299  ? -38.334 -75.737  53.103  1.00 2.70  ? 300  ILE A C     1 
ATOM   2254  O  O     . ILE A 1 299  ? -37.189 -75.751  52.668  1.00 3.06  ? 300  ILE A O     1 
ATOM   2255  C  CB    . ILE A 1 299  ? -37.865 -75.179  55.448  1.00 2.00  ? 300  ILE A CB    1 
ATOM   2256  C  CG1   . ILE A 1 299  ? -38.170 -75.462  56.895  1.00 2.00  ? 300  ILE A CG1   1 
ATOM   2257  C  CG2   . ILE A 1 299  ? -38.255 -73.770  55.174  1.00 2.00  ? 300  ILE A CG2   1 
ATOM   2258  C  CD1   . ILE A 1 299  ? -37.349 -74.634  57.835  1.00 2.00  ? 300  ILE A CD1   1 
ATOM   2259  N  N     . LYS A 1 300  ? -39.375 -75.497  52.329  1.00 2.70  ? 301  LYS A N     1 
ATOM   2260  C  CA    . LYS A 1 300  ? -39.191 -75.112  50.945  1.00 2.76  ? 301  LYS A CA    1 
ATOM   2261  C  C     . LYS A 1 300  ? -39.113 -73.590  51.013  1.00 2.65  ? 301  LYS A C     1 
ATOM   2262  O  O     . LYS A 1 300  ? -39.988 -72.970  51.623  1.00 3.02  ? 301  LYS A O     1 
ATOM   2263  C  CB    . LYS A 1 300  ? -40.428 -75.514  50.118  1.00 2.99  ? 301  LYS A CB    1 
ATOM   2264  C  CG    . LYS A 1 300  ? -40.881 -76.984  50.160  1.00 2.00  ? 301  LYS A CG    1 
ATOM   2265  C  CD    . LYS A 1 300  ? -42.382 -77.032  49.902  1.00 2.00  ? 301  LYS A CD    1 
ATOM   2266  C  CE    . LYS A 1 300  ? -42.909 -78.382  49.528  1.00 2.00  ? 301  LYS A CE    1 
ATOM   2267  N  NZ    . LYS A 1 300  ? -43.042 -78.481  48.061  1.00 2.00  ? 301  LYS A NZ    1 
ATOM   2268  N  N     . VAL A 1 301  ? -38.078 -72.973  50.449  1.00 2.07  ? 302  VAL A N     1 
ATOM   2269  C  CA    . VAL A 1 301  ? -38.051 -71.519  50.507  1.00 2.12  ? 302  VAL A CA    1 
ATOM   2270  C  C     . VAL A 1 301  ? -38.768 -70.936  49.294  1.00 2.02  ? 302  VAL A C     1 
ATOM   2271  O  O     . VAL A 1 301  ? -38.669 -71.462  48.187  1.00 2.40  ? 302  VAL A O     1 
ATOM   2272  C  CB    . VAL A 1 301  ? -36.602 -70.869  50.751  1.00 2.00  ? 302  VAL A CB    1 
ATOM   2273  C  CG1   . VAL A 1 301  ? -35.590 -71.857  51.288  1.00 2.00  ? 302  VAL A CG1   1 
ATOM   2274  C  CG2   . VAL A 1 301  ? -36.084 -70.205  49.535  1.00 2.03  ? 302  VAL A CG2   1 
ATOM   2275  N  N     . ARG A 1 302  ? -39.594 -69.924  49.539  1.00 2.27  ? 303  ARG A N     1 
ATOM   2276  C  CA    . ARG A 1 302  ? -40.341 -69.228  48.499  1.00 2.00  ? 303  ARG A CA    1 
ATOM   2277  C  C     . ARG A 1 302  ? -39.701 -67.883  48.295  1.00 2.00  ? 303  ARG A C     1 
ATOM   2278  O  O     . ARG A 1 302  ? -39.141 -67.612  47.252  1.00 2.00  ? 303  ARG A O     1 
ATOM   2279  C  CB    . ARG A 1 302  ? -41.790 -69.001  48.925  1.00 2.30  ? 303  ARG A CB    1 
ATOM   2280  C  CG    . ARG A 1 302  ? -42.772 -70.117  48.587  1.00 3.10  ? 303  ARG A CG    1 
ATOM   2281  C  CD    . ARG A 1 302  ? -42.558 -71.391  49.367  1.00 3.29  ? 303  ARG A CD    1 
ATOM   2282  N  NE    . ARG A 1 302  ? -42.845 -72.513  48.493  1.00 4.34  ? 303  ARG A NE    1 
ATOM   2283  C  CZ    . ARG A 1 302  ? -43.902 -73.303  48.614  1.00 5.05  ? 303  ARG A CZ    1 
ATOM   2284  N  NH1   . ARG A 1 302  ? -44.764 -73.091  49.593  1.00 5.33  ? 303  ARG A NH1   1 
ATOM   2285  N  NH2   . ARG A 1 302  ? -44.115 -74.282  47.736  1.00 4.23  ? 303  ARG A NH2   1 
ATOM   2286  N  N     . LEU A 1 303  ? -39.791 -67.034  49.308  1.00 2.00  ? 304  LEU A N     1 
ATOM   2287  C  CA    . LEU A 1 303  ? -39.228 -65.708  49.224  1.00 2.00  ? 304  LEU A CA    1 
ATOM   2288  C  C     . LEU A 1 303  ? -37.836 -65.643  49.830  1.00 2.42  ? 304  LEU A C     1 
ATOM   2289  O  O     . LEU A 1 303  ? -37.659 -65.413  51.042  1.00 2.38  ? 304  LEU A O     1 
ATOM   2290  C  CB    . LEU A 1 303  ? -40.143 -64.675  49.871  1.00 2.00  ? 304  LEU A CB    1 
ATOM   2291  C  CG    . LEU A 1 303  ? -39.659 -63.239  49.656  1.00 2.00  ? 304  LEU A CG    1 
ATOM   2292  C  CD1   . LEU A 1 303  ? -40.026 -62.744  48.279  1.00 2.00  ? 304  LEU A CD1   1 
ATOM   2293  C  CD2   . LEU A 1 303  ? -40.256 -62.343  50.701  1.00 2.00  ? 304  LEU A CD2   1 
ATOM   2294  N  N     . TYR A 1 304  ? -36.860 -65.782  48.931  1.00 2.54  ? 305  TYR A N     1 
ATOM   2295  C  CA    . TYR A 1 304  ? -35.416 -65.762  49.211  1.00 2.34  ? 305  TYR A CA    1 
ATOM   2296  C  C     . TYR A 1 304  ? -34.868 -64.366  49.526  1.00 2.31  ? 305  TYR A C     1 
ATOM   2297  O  O     . TYR A 1 304  ? -33.827 -64.215  50.172  1.00 2.59  ? 305  TYR A O     1 
ATOM   2298  C  CB    . TYR A 1 304  ? -34.678 -66.346  48.001  1.00 2.03  ? 305  TYR A CB    1 
ATOM   2299  C  CG    . TYR A 1 304  ? -33.188 -66.368  48.143  1.00 2.00  ? 305  TYR A CG    1 
ATOM   2300  C  CD1   . TYR A 1 304  ? -32.593 -67.005  49.225  1.00 2.61  ? 305  TYR A CD1   1 
ATOM   2301  C  CD2   . TYR A 1 304  ? -32.370 -65.674  47.252  1.00 2.20  ? 305  TYR A CD2   1 
ATOM   2302  C  CE1   . TYR A 1 304  ? -31.223 -66.932  49.430  1.00 2.44  ? 305  TYR A CE1   1 
ATOM   2303  C  CE2   . TYR A 1 304  ? -31.001 -65.599  47.449  1.00 2.02  ? 305  TYR A CE2   1 
ATOM   2304  C  CZ    . TYR A 1 304  ? -30.448 -66.223  48.545  1.00 2.15  ? 305  TYR A CZ    1 
ATOM   2305  O  OH    . TYR A 1 304  ? -29.134 -66.084  48.830  1.00 2.82  ? 305  TYR A OH    1 
ATOM   2306  N  N     . ARG A 1 305  ? -35.541 -63.344  49.020  1.00 2.46  ? 306  ARG A N     1 
ATOM   2307  C  CA    . ARG A 1 305  ? -35.129 -61.976  49.262  1.00 2.30  ? 306  ARG A CA    1 
ATOM   2308  C  C     . ARG A 1 305  ? -36.333 -61.086  49.137  1.00 2.53  ? 306  ARG A C     1 
ATOM   2309  O  O     . ARG A 1 305  ? -37.061 -61.174  48.147  1.00 2.73  ? 306  ARG A O     1 
ATOM   2310  C  CB    . ARG A 1 305  ? -34.061 -61.543  48.274  1.00 2.00  ? 306  ARG A CB    1 
ATOM   2311  C  CG    . ARG A 1 305  ? -32.682 -62.097  48.567  1.00 3.34  ? 306  ARG A CG    1 
ATOM   2312  C  CD    . ARG A 1 305  ? -32.176 -61.631  49.914  1.00 4.23  ? 306  ARG A CD    1 
ATOM   2313  N  NE    . ARG A 1 305  ? -30.725 -61.491  49.922  1.00 5.44  ? 306  ARG A NE    1 
ATOM   2314  C  CZ    . ARG A 1 305  ? -29.885 -62.474  50.224  1.00 6.59  ? 306  ARG A CZ    1 
ATOM   2315  N  NH1   . ARG A 1 305  ? -30.365 -63.674  50.534  1.00 6.86  ? 306  ARG A NH1   1 
ATOM   2316  N  NH2   . ARG A 1 305  ? -28.570 -62.251  50.243  1.00 6.45  ? 306  ARG A NH2   1 
ATOM   2317  N  N     . PRO A 1 306  ? -36.639 -60.321  50.194  1.00 2.20  ? 307  PRO A N     1 
ATOM   2318  C  CA    . PRO A 1 306  ? -35.913 -60.281  51.461  1.00 2.52  ? 307  PRO A CA    1 
ATOM   2319  C  C     . PRO A 1 306  ? -35.997 -61.591  52.257  1.00 2.99  ? 307  PRO A C     1 
ATOM   2320  O  O     . PRO A 1 306  ? -36.967 -62.358  52.133  1.00 3.76  ? 307  PRO A O     1 
ATOM   2321  C  CB    . PRO A 1 306  ? -36.585 -59.127  52.181  1.00 2.00  ? 307  PRO A CB    1 
ATOM   2322  C  CG    . PRO A 1 306  ? -36.929 -58.251  51.097  1.00 2.00  ? 307  PRO A CG    1 
ATOM   2323  C  CD    . PRO A 1 306  ? -37.536 -59.167  50.105  1.00 2.00  ? 307  PRO A CD    1 
ATOM   2324  N  N     . PHE A 1 307  ? -34.975 -61.855  53.063  1.00 2.91  ? 308  PHE A N     1 
ATOM   2325  C  CA    . PHE A 1 307  ? -34.931 -63.082  53.843  1.00 3.53  ? 308  PHE A CA    1 
ATOM   2326  C  C     . PHE A 1 307  ? -35.493 -62.835  55.224  1.00 4.82  ? 308  PHE A C     1 
ATOM   2327  O  O     . PHE A 1 307  ? -34.782 -62.383  56.111  1.00 6.31  ? 308  PHE A O     1 
ATOM   2328  C  CB    . PHE A 1 307  ? -33.493 -63.579  53.945  1.00 2.53  ? 308  PHE A CB    1 
ATOM   2329  C  CG    . PHE A 1 307  ? -33.374 -64.986  54.412  1.00 2.15  ? 308  PHE A CG    1 
ATOM   2330  C  CD1   . PHE A 1 307  ? -33.428 -66.035  53.502  1.00 2.00  ? 308  PHE A CD1   1 
ATOM   2331  C  CD2   . PHE A 1 307  ? -33.192 -65.276  55.753  1.00 2.00  ? 308  PHE A CD2   1 
ATOM   2332  C  CE1   . PHE A 1 307  ? -33.303 -67.341  53.907  1.00 2.00  ? 308  PHE A CE1   1 
ATOM   2333  C  CE2   . PHE A 1 307  ? -33.064 -66.578  56.174  1.00 2.00  ? 308  PHE A CE2   1 
ATOM   2334  C  CZ    . PHE A 1 307  ? -33.121 -67.618  55.238  1.00 2.00  ? 308  PHE A CZ    1 
ATOM   2335  N  N     . VAL A 1 308  ? -36.769 -63.131  55.419  1.00 5.72  ? 309  VAL A N     1 
ATOM   2336  C  CA    . VAL A 1 308  ? -37.390 -62.905  56.711  1.00 6.20  ? 309  VAL A CA    1 
ATOM   2337  C  C     . VAL A 1 308  ? -37.066 -64.050  57.639  1.00 7.26  ? 309  VAL A C     1 
ATOM   2338  O  O     . VAL A 1 308  ? -37.601 -65.134  57.483  1.00 7.46  ? 309  VAL A O     1 
ATOM   2339  C  CB    . VAL A 1 308  ? -38.883 -62.807  56.545  1.00 5.52  ? 309  VAL A CB    1 
ATOM   2340  C  CG1   . VAL A 1 308  ? -39.525 -62.335  57.796  1.00 5.70  ? 309  VAL A CG1   1 
ATOM   2341  C  CG2   . VAL A 1 308  ? -39.185 -61.870  55.430  1.00 6.43  ? 309  VAL A CG2   1 
ATOM   2342  N  N     . SER A 1 309  ? -36.168 -63.815  58.590  1.00 9.06  ? 310  SER A N     1 
ATOM   2343  C  CA    . SER A 1 309  ? -35.765 -64.836  59.566  1.00 10.88 ? 310  SER A CA    1 
ATOM   2344  C  C     . SER A 1 309  ? -36.962 -65.288  60.357  1.00 11.57 ? 310  SER A C     1 
ATOM   2345  O  O     . SER A 1 309  ? -37.127 -66.486  60.604  1.00 11.85 ? 310  SER A O     1 
ATOM   2346  C  CB    . SER A 1 309  ? -34.723 -64.294  60.550  1.00 11.85 ? 310  SER A CB    1 
ATOM   2347  O  OG    . SER A 1 309  ? -33.419 -64.225  59.967  1.00 14.08 ? 310  SER A OG    1 
ATOM   2348  N  N     . GLU A 1 310  ? -37.780 -64.315  60.765  1.00 12.28 ? 311  GLU A N     1 
ATOM   2349  C  CA    . GLU A 1 310  ? -38.995 -64.568  61.526  1.00 13.01 ? 311  GLU A CA    1 
ATOM   2350  C  C     . GLU A 1 310  ? -39.846 -65.670  60.893  1.00 11.92 ? 311  GLU A C     1 
ATOM   2351  O  O     . GLU A 1 310  ? -40.365 -66.551  61.593  1.00 11.96 ? 311  GLU A O     1 
ATOM   2352  C  CB    . GLU A 1 310  ? -39.812 -63.281  61.647  1.00 15.68 ? 311  GLU A CB    1 
ATOM   2353  C  CG    . GLU A 1 310  ? -41.346 -63.497  61.599  1.00 20.58 ? 311  GLU A CG    1 
ATOM   2354  C  CD    . GLU A 1 310  ? -42.144 -62.285  62.107  1.00 23.65 ? 311  GLU A CD    1 
ATOM   2355  O  OE1   . GLU A 1 310  ? -42.053 -61.999  63.334  1.00 25.16 ? 311  GLU A OE1   1 
ATOM   2356  O  OE2   . GLU A 1 310  ? -42.868 -61.630  61.296  1.00 25.14 ? 311  GLU A OE2   1 
ATOM   2357  N  N     . ALA A 1 311  ? -39.992 -65.606  59.573  1.00 10.31 ? 312  ALA A N     1 
ATOM   2358  C  CA    . ALA A 1 311  ? -40.764 -66.592  58.838  1.00 8.43  ? 312  ALA A CA    1 
ATOM   2359  C  C     . ALA A 1 311  ? -39.979 -67.850  58.651  1.00 7.45  ? 312  ALA A C     1 
ATOM   2360  O  O     . ALA A 1 311  ? -40.569 -68.904  58.445  1.00 7.78  ? 312  ALA A O     1 
ATOM   2361  C  CB    . ALA A 1 311  ? -41.167 -66.071  57.509  1.00 8.07  ? 312  ALA A CB    1 
ATOM   2362  N  N     . PHE A 1 312  ? -38.652 -67.745  58.628  1.00 6.28  ? 313  PHE A N     1 
ATOM   2363  C  CA    . PHE A 1 312  ? -37.838 -68.937  58.455  1.00 5.13  ? 313  PHE A CA    1 
ATOM   2364  C  C     . PHE A 1 312  ? -38.167 -69.802  59.630  1.00 4.91  ? 313  PHE A C     1 
ATOM   2365  O  O     . PHE A 1 312  ? -38.681 -70.909  59.496  1.00 5.24  ? 313  PHE A O     1 
ATOM   2366  C  CB    . PHE A 1 312  ? -36.343 -68.639  58.506  1.00 4.34  ? 313  PHE A CB    1 
ATOM   2367  C  CG    . PHE A 1 312  ? -35.506 -69.875  58.520  1.00 3.22  ? 313  PHE A CG    1 
ATOM   2368  C  CD1   . PHE A 1 312  ? -35.339 -70.615  57.375  1.00 2.99  ? 313  PHE A CD1   1 
ATOM   2369  C  CD2   . PHE A 1 312  ? -35.007 -70.378  59.702  1.00 3.43  ? 313  PHE A CD2   1 
ATOM   2370  C  CE1   . PHE A 1 312  ? -34.703 -71.844  57.412  1.00 2.99  ? 313  PHE A CE1   1 
ATOM   2371  C  CE2   . PHE A 1 312  ? -34.366 -71.616  59.740  1.00 3.00  ? 313  PHE A CE2   1 
ATOM   2372  C  CZ    . PHE A 1 312  ? -34.222 -72.343  58.597  1.00 2.29  ? 313  PHE A CZ    1 
ATOM   2373  N  N     . PHE A 1 313  ? -37.984 -69.229  60.802  1.00 4.72  ? 314  PHE A N     1 
ATOM   2374  C  CA    . PHE A 1 313  ? -38.230 -69.978  61.991  1.00 4.63  ? 314  PHE A CA    1 
ATOM   2375  C  C     . PHE A 1 313  ? -39.589 -70.521  62.131  1.00 5.31  ? 314  PHE A C     1 
ATOM   2376  O  O     . PHE A 1 313  ? -39.723 -71.704  62.396  1.00 6.22  ? 314  PHE A O     1 
ATOM   2377  C  CB    . PHE A 1 313  ? -37.753 -69.241  63.198  1.00 3.44  ? 314  PHE A CB    1 
ATOM   2378  C  CG    . PHE A 1 313  ? -36.291 -69.327  63.333  1.00 3.52  ? 314  PHE A CG    1 
ATOM   2379  C  CD1   . PHE A 1 313  ? -35.694 -70.555  63.520  1.00 3.38  ? 314  PHE A CD1   1 
ATOM   2380  C  CD2   . PHE A 1 313  ? -35.491 -68.214  63.178  1.00 3.79  ? 314  PHE A CD2   1 
ATOM   2381  C  CE1   . PHE A 1 313  ? -34.341 -70.674  63.546  1.00 3.68  ? 314  PHE A CE1   1 
ATOM   2382  C  CE2   . PHE A 1 313  ? -34.108 -68.322  63.205  1.00 3.55  ? 314  PHE A CE2   1 
ATOM   2383  C  CZ    . PHE A 1 313  ? -33.539 -69.547  63.387  1.00 3.87  ? 314  PHE A CZ    1 
ATOM   2384  N  N     . ALA A 1 314  ? -40.597 -69.732  61.782  1.00 6.05  ? 315  ALA A N     1 
ATOM   2385  C  CA    . ALA A 1 314  ? -41.977 -70.205  61.879  1.00 6.46  ? 315  ALA A CA    1 
ATOM   2386  C  C     . ALA A 1 314  ? -42.247 -71.442  61.029  1.00 6.58  ? 315  ALA A C     1 
ATOM   2387  O  O     . ALA A 1 314  ? -43.374 -71.917  61.003  1.00 7.51  ? 315  ALA A O     1 
ATOM   2388  C  CB    . ALA A 1 314  ? -42.957 -69.099  61.515  1.00 5.70  ? 315  ALA A CB    1 
ATOM   2389  N  N     . ALA A 1 315  ? -41.233 -71.964  60.344  1.00 6.31  ? 316  ALA A N     1 
ATOM   2390  C  CA    . ALA A 1 315  ? -41.421 -73.142  59.517  1.00 6.88  ? 316  ALA A CA    1 
ATOM   2391  C  C     . ALA A 1 315  ? -40.517 -74.287  59.950  1.00 7.60  ? 316  ALA A C     1 
ATOM   2392  O  O     . ALA A 1 315  ? -40.655 -75.416  59.483  1.00 8.18  ? 316  ALA A O     1 
ATOM   2393  C  CB    . ALA A 1 315  ? -41.155 -72.803  58.079  1.00 6.87  ? 316  ALA A CB    1 
ATOM   2394  N  N     . LEU A 1 316  ? -39.594 -74.010  60.855  1.00 7.77  ? 317  LEU A N     1 
ATOM   2395  C  CA    . LEU A 1 316  ? -38.670 -75.027  61.319  1.00 7.83  ? 317  LEU A CA    1 
ATOM   2396  C  C     . LEU A 1 316  ? -39.164 -75.668  62.595  1.00 8.16  ? 317  LEU A C     1 
ATOM   2397  O  O     . LEU A 1 316  ? -39.281 -74.986  63.598  1.00 9.08  ? 317  LEU A O     1 
ATOM   2398  C  CB    . LEU A 1 316  ? -37.324 -74.351  61.544  1.00 7.58  ? 317  LEU A CB    1 
ATOM   2399  C  CG    . LEU A 1 316  ? -36.130 -74.960  62.254  1.00 7.60  ? 317  LEU A CG    1 
ATOM   2400  C  CD1   . LEU A 1 316  ? -36.026 -74.401  63.649  1.00 8.41  ? 317  LEU A CD1   1 
ATOM   2401  C  CD2   . LEU A 1 316  ? -36.207 -76.432  62.256  1.00 7.20  ? 317  LEU A CD2   1 
ATOM   2402  N  N     . PRO A 1 317  ? -39.474 -76.984  62.581  1.00 8.56  ? 318  PRO A N     1 
ATOM   2403  C  CA    . PRO A 1 317  ? -39.952 -77.689  63.777  1.00 9.18  ? 318  PRO A CA    1 
ATOM   2404  C  C     . PRO A 1 317  ? -38.988 -77.489  64.919  1.00 9.98  ? 318  PRO A C     1 
ATOM   2405  O  O     . PRO A 1 317  ? -37.785 -77.388  64.696  1.00 11.59 ? 318  PRO A O     1 
ATOM   2406  C  CB    . PRO A 1 317  ? -39.932 -79.141  63.335  1.00 9.15  ? 318  PRO A CB    1 
ATOM   2407  C  CG    . PRO A 1 317  ? -40.350 -79.037  61.927  1.00 8.84  ? 318  PRO A CG    1 
ATOM   2408  C  CD    . PRO A 1 317  ? -39.518 -77.887  61.418  1.00 8.95  ? 318  PRO A CD    1 
ATOM   2409  N  N     . ALA A 1 318  ? -39.501 -77.432  66.141  1.00 10.27 ? 319  ALA A N     1 
ATOM   2410  C  CA    . ALA A 1 318  ? -38.662 -77.233  67.319  1.00 9.76  ? 319  ALA A CA    1 
ATOM   2411  C  C     . ALA A 1 318  ? -37.772 -78.430  67.626  1.00 9.90  ? 319  ALA A C     1 
ATOM   2412  O  O     . ALA A 1 318  ? -36.789 -78.298  68.362  1.00 9.59  ? 319  ALA A O     1 
ATOM   2413  C  CB    . ALA A 1 318  ? -39.519 -76.920  68.508  1.00 9.58  ? 319  ALA A CB    1 
ATOM   2414  N  N     . SER A 1 319  ? -38.109 -79.590  67.061  1.00 10.14 ? 320  SER A N     1 
ATOM   2415  C  CA    . SER A 1 319  ? -37.338 -80.799  67.298  1.00 10.98 ? 320  SER A CA    1 
ATOM   2416  C  C     . SER A 1 319  ? -36.201 -80.998  66.313  1.00 11.73 ? 320  SER A C     1 
ATOM   2417  O  O     . SER A 1 319  ? -35.471 -81.987  66.385  1.00 12.51 ? 320  SER A O     1 
ATOM   2418  C  CB    . SER A 1 319  ? -38.255 -82.004  67.262  1.00 10.64 ? 320  SER A CB    1 
ATOM   2419  O  OG    . SER A 1 319  ? -39.145 -81.864  66.170  1.00 12.26 ? 320  SER A OG    1 
ATOM   2420  N  N     . ALA A 1 320  ? -36.045 -80.087  65.367  1.00 12.14 ? 321  ALA A N     1 
ATOM   2421  C  CA    . ALA A 1 320  ? -34.967 -80.249  64.421  1.00 12.36 ? 321  ALA A CA    1 
ATOM   2422  C  C     . ALA A 1 320  ? -33.675 -80.297  65.212  1.00 12.78 ? 321  ALA A C     1 
ATOM   2423  O  O     . ALA A 1 320  ? -33.356 -79.392  65.975  1.00 12.59 ? 321  ALA A O     1 
ATOM   2424  C  CB    . ALA A 1 320  ? -34.948 -79.122  63.457  1.00 11.98 ? 321  ALA A CB    1 
ATOM   2425  N  N     . LYS A 1 321  ? -32.999 -81.426  65.137  1.00 13.61 ? 322  LYS A N     1 
ATOM   2426  C  CA    . LYS A 1 321  ? -31.730 -81.567  65.834  1.00 14.69 ? 322  LYS A CA    1 
ATOM   2427  C  C     . LYS A 1 321  ? -30.466 -81.432  64.936  1.00 13.80 ? 322  LYS A C     1 
ATOM   2428  O  O     . LYS A 1 321  ? -29.343 -81.230  65.428  1.00 13.43 ? 322  LYS A O     1 
ATOM   2429  C  CB    . LYS A 1 321  ? -31.735 -82.853  66.672  1.00 16.50 ? 322  LYS A CB    1 
ATOM   2430  C  CG    . LYS A 1 321  ? -32.409 -82.642  68.051  1.00 19.17 ? 322  LYS A CG    1 
ATOM   2431  C  CD    . LYS A 1 321  ? -32.222 -83.837  69.027  1.00 21.64 ? 322  LYS A CD    1 
ATOM   2432  C  CE    . LYS A 1 321  ? -32.230 -83.366  70.521  1.00 23.37 ? 322  LYS A CE    1 
ATOM   2433  N  NZ    . LYS A 1 321  ? -32.206 -84.461  71.592  1.00 24.19 ? 322  LYS A NZ    1 
ATOM   2434  N  N     . VAL A 1 322  ? -30.675 -81.506  63.623  1.00 12.32 ? 323  VAL A N     1 
ATOM   2435  C  CA    . VAL A 1 322  ? -29.618 -81.390  62.624  1.00 10.73 ? 323  VAL A CA    1 
ATOM   2436  C  C     . VAL A 1 322  ? -30.367 -80.837  61.411  1.00 9.26  ? 323  VAL A C     1 
ATOM   2437  O  O     . VAL A 1 322  ? -31.512 -81.207  61.196  1.00 8.98  ? 323  VAL A O     1 
ATOM   2438  C  CB    . VAL A 1 322  ? -29.049 -82.790  62.224  1.00 11.42 ? 323  VAL A CB    1 
ATOM   2439  C  CG1   . VAL A 1 322  ? -28.031 -82.625  61.145  1.00 11.88 ? 323  VAL A CG1   1 
ATOM   2440  C  CG2   . VAL A 1 322  ? -28.419 -83.531  63.417  1.00 11.24 ? 323  VAL A CG2   1 
ATOM   2441  N  N     . ILE A 1 323  ? -29.776 -79.919  60.653  1.00 7.45  ? 324  ILE A N     1 
ATOM   2442  C  CA    . ILE A 1 323  ? -30.472 -79.401  59.480  1.00 5.64  ? 324  ILE A CA    1 
ATOM   2443  C  C     . ILE A 1 323  ? -29.505 -79.124  58.364  1.00 4.79  ? 324  ILE A C     1 
ATOM   2444  O  O     . ILE A 1 323  ? -28.506 -78.474  58.583  1.00 5.13  ? 324  ILE A O     1 
ATOM   2445  C  CB    . ILE A 1 323  ? -31.313 -78.137  59.783  1.00 5.63  ? 324  ILE A CB    1 
ATOM   2446  C  CG1   . ILE A 1 323  ? -30.951 -77.032  58.830  1.00 5.75  ? 324  ILE A CG1   1 
ATOM   2447  C  CG2   . ILE A 1 323  ? -31.130 -77.619  61.176  1.00 5.40  ? 324  ILE A CG2   1 
ATOM   2448  C  CD1   . ILE A 1 323  ? -32.153 -76.349  58.347  1.00 7.25  ? 324  ILE A CD1   1 
ATOM   2449  N  N     . THR A 1 324  ? -29.744 -79.672  57.181  1.00 4.01  ? 325  THR A N     1 
ATOM   2450  C  CA    . THR A 1 324  ? -28.828 -79.422  56.077  1.00 3.50  ? 325  THR A CA    1 
ATOM   2451  C  C     . THR A 1 324  ? -29.475 -78.583  55.015  1.00 3.46  ? 325  THR A C     1 
ATOM   2452  O  O     . THR A 1 324  ? -30.560 -78.912  54.520  1.00 3.03  ? 325  THR A O     1 
ATOM   2453  C  CB    . THR A 1 324  ? -28.200 -80.704  55.437  1.00 3.59  ? 325  THR A CB    1 
ATOM   2454  O  OG1   . THR A 1 324  ? -28.495 -80.767  54.034  1.00 3.53  ? 325  THR A OG1   1 
ATOM   2455  C  CG2   . THR A 1 324  ? -28.662 -81.945  56.097  1.00 2.58  ? 325  THR A CG2   1 
ATOM   2456  N  N     . VAL A 1 325  ? -28.763 -77.522  54.641  1.00 3.14  ? 326  VAL A N     1 
ATOM   2457  C  CA    . VAL A 1 325  ? -29.218 -76.559  53.653  1.00 2.96  ? 326  VAL A CA    1 
ATOM   2458  C  C     . VAL A 1 325  ? -28.688 -76.892  52.282  1.00 2.95  ? 326  VAL A C     1 
ATOM   2459  O  O     . VAL A 1 325  ? -27.496 -76.792  52.070  1.00 4.69  ? 326  VAL A O     1 
ATOM   2460  C  CB    . VAL A 1 325  ? -28.722 -75.151  54.015  1.00 2.29  ? 326  VAL A CB    1 
ATOM   2461  C  CG1   . VAL A 1 325  ? -29.339 -74.131  53.080  1.00 2.00  ? 326  VAL A CG1   1 
ATOM   2462  C  CG2   . VAL A 1 325  ? -29.035 -74.822  55.473  1.00 2.00  ? 326  VAL A CG2   1 
ATOM   2463  N  N     . LEU A 1 326  ? -29.546 -77.277  51.347  1.00 2.65  ? 327  LEU A N     1 
ATOM   2464  C  CA    . LEU A 1 326  ? -29.102 -77.608  49.996  1.00 2.86  ? 327  LEU A CA    1 
ATOM   2465  C  C     . LEU A 1 326  ? -29.072 -76.392  49.055  1.00 3.31  ? 327  LEU A C     1 
ATOM   2466  O  O     . LEU A 1 326  ? -30.046 -75.635  48.945  1.00 3.44  ? 327  LEU A O     1 
ATOM   2467  C  CB    . LEU A 1 326  ? -29.941 -78.743  49.431  1.00 2.96  ? 327  LEU A CB    1 
ATOM   2468  C  CG    . LEU A 1 326  ? -29.381 -80.159  49.619  1.00 3.70  ? 327  LEU A CG    1 
ATOM   2469  C  CD1   . LEU A 1 326  ? -28.704 -80.368  50.988  1.00 3.52  ? 327  LEU A CD1   1 
ATOM   2470  C  CD2   . LEU A 1 326  ? -30.503 -81.179  49.402  1.00 3.49  ? 327  LEU A CD2   1 
ATOM   2471  N  N     . ASP A 1 327  ? -27.924 -76.201  48.402  1.00 3.54  ? 328  ASP A N     1 
ATOM   2472  C  CA    . ASP A 1 327  ? -27.692 -75.085  47.486  1.00 3.40  ? 328  ASP A CA    1 
ATOM   2473  C  C     . ASP A 1 327  ? -27.419 -75.592  46.084  1.00 3.16  ? 328  ASP A C     1 
ATOM   2474  O  O     . ASP A 1 327  ? -26.579 -76.461  45.901  1.00 3.76  ? 328  ASP A O     1 
ATOM   2475  C  CB    . ASP A 1 327  ? -26.472 -74.302  47.930  1.00 3.53  ? 328  ASP A CB    1 
ATOM   2476  C  CG    . ASP A 1 327  ? -26.816 -73.076  48.712  1.00 4.27  ? 328  ASP A CG    1 
ATOM   2477  O  OD1   . ASP A 1 327  ? -27.329 -72.115  48.115  1.00 5.19  ? 328  ASP A OD1   1 
ATOM   2478  O  OD2   . ASP A 1 327  ? -26.526 -73.043  49.918  1.00 4.75  ? 328  ASP A OD2   1 
ATOM   2479  N  N     . ARG A 1 328  ? -28.104 -75.033  45.095  1.00 2.79  ? 329  ARG A N     1 
ATOM   2480  C  CA    . ARG A 1 328  ? -27.917 -75.445  43.718  1.00 2.27  ? 329  ARG A CA    1 
ATOM   2481  C  C     . ARG A 1 328  ? -26.919 -74.523  43.054  1.00 2.79  ? 329  ARG A C     1 
ATOM   2482  O  O     . ARG A 1 328  ? -27.237 -73.911  42.034  1.00 3.20  ? 329  ARG A O     1 
ATOM   2483  C  CB    . ARG A 1 328  ? -29.235 -75.370  42.973  1.00 2.00  ? 329  ARG A CB    1 
ATOM   2484  C  CG    . ARG A 1 328  ? -29.217 -76.177  41.726  1.00 2.00  ? 329  ARG A CG    1 
ATOM   2485  C  CD    . ARG A 1 328  ? -30.464 -76.036  40.865  1.00 2.33  ? 329  ARG A CD    1 
ATOM   2486  N  NE    . ARG A 1 328  ? -30.485 -77.095  39.854  1.00 2.11  ? 329  ARG A NE    1 
ATOM   2487  C  CZ    . ARG A 1 328  ? -31.277 -78.163  39.903  1.00 2.10  ? 329  ARG A CZ    1 
ATOM   2488  N  NH1   . ARG A 1 328  ? -32.141 -78.288  40.898  1.00 2.96  ? 329  ARG A NH1   1 
ATOM   2489  N  NH2   . ARG A 1 328  ? -31.109 -79.171  39.047  1.00 2.00  ? 329  ARG A NH2   1 
ATOM   2490  N  N     . THR A 1 329  ? -25.703 -74.448  43.596  1.00 2.75  ? 330  THR A N     1 
ATOM   2491  C  CA    . THR A 1 329  ? -24.681 -73.548  43.052  1.00 3.31  ? 330  THR A CA    1 
ATOM   2492  C  C     . THR A 1 329  ? -23.341 -73.819  43.721  1.00 3.54  ? 330  THR A C     1 
ATOM   2493  O  O     . THR A 1 329  ? -23.273 -74.580  44.690  1.00 4.29  ? 330  THR A O     1 
ATOM   2494  C  CB    . THR A 1 329  ? -25.047 -72.102  43.379  1.00 3.82  ? 330  THR A CB    1 
ATOM   2495  O  OG1   . THR A 1 329  ? -24.130 -71.205  42.755  1.00 4.28  ? 330  THR A OG1   1 
ATOM   2496  C  CG2   . THR A 1 329  ? -24.966 -71.886  44.880  1.00 4.63  ? 330  THR A CG2   1 
ATOM   2497  N  N     . LYS A 1 330  ? -22.286 -73.148  43.261  1.00 3.05  ? 331  LYS A N     1 
ATOM   2498  C  CA    . LYS A 1 330  ? -20.948 -73.315  43.842  1.00 2.50  ? 331  LYS A CA    1 
ATOM   2499  C  C     . LYS A 1 330  ? -20.176 -72.006  43.767  1.00 2.41  ? 331  LYS A C     1 
ATOM   2500  O  O     . LYS A 1 330  ? -19.874 -71.535  42.680  1.00 3.51  ? 331  LYS A O     1 
ATOM   2501  C  CB    . LYS A 1 330  ? -20.215 -74.480  43.150  1.00 2.00  ? 331  LYS A CB    1 
ATOM   2502  C  CG    . LYS A 1 330  ? -18.865 -74.188  42.540  1.00 2.10  ? 331  LYS A CG    1 
ATOM   2503  C  CD    . LYS A 1 330  ? -17.698 -74.411  43.511  1.00 3.47  ? 331  LYS A CD    1 
ATOM   2504  C  CE    . LYS A 1 330  ? -17.161 -75.841  43.499  1.00 2.98  ? 331  LYS A CE    1 
ATOM   2505  N  NZ    . LYS A 1 330  ? -16.721 -76.237  42.141  1.00 3.75  ? 331  LYS A NZ    1 
ATOM   2506  N  N     . GLU A 1 331  ? -19.991 -71.340  44.906  1.00 2.27  ? 332  GLU A N     1 
ATOM   2507  C  CA    . GLU A 1 331  ? -19.253 -70.081  44.938  1.00 2.10  ? 332  GLU A CA    1 
ATOM   2508  C  C     . GLU A 1 331  ? -17.878 -70.488  45.375  1.00 2.59  ? 332  GLU A C     1 
ATOM   2509  O  O     . GLU A 1 331  ? -17.636 -70.655  46.563  1.00 3.05  ? 332  GLU A O     1 
ATOM   2510  C  CB    . GLU A 1 331  ? -19.824 -69.142  45.970  1.00 2.00  ? 332  GLU A CB    1 
ATOM   2511  C  CG    . GLU A 1 331  ? -21.265 -68.867  45.804  1.00 2.58  ? 332  GLU A CG    1 
ATOM   2512  C  CD    . GLU A 1 331  ? -21.637 -67.458  46.202  1.00 3.61  ? 332  GLU A CD    1 
ATOM   2513  O  OE1   . GLU A 1 331  ? -21.054 -66.892  47.173  1.00 3.83  ? 332  GLU A OE1   1 
ATOM   2514  O  OE2   . GLU A 1 331  ? -22.525 -66.913  45.510  1.00 3.60  ? 332  GLU A OE2   1 
ATOM   2515  N  N     . PRO A 1 332  ? -16.945 -70.611  44.429  1.00 2.86  ? 333  PRO A N     1 
ATOM   2516  C  CA    . PRO A 1 332  ? -15.564 -71.014  44.668  1.00 3.61  ? 333  PRO A CA    1 
ATOM   2517  C  C     . PRO A 1 332  ? -14.898 -70.135  45.711  1.00 4.60  ? 333  PRO A C     1 
ATOM   2518  O  O     . PRO A 1 332  ? -14.860 -68.920  45.549  1.00 5.95  ? 333  PRO A O     1 
ATOM   2519  C  CB    . PRO A 1 332  ? -14.916 -70.794  43.304  1.00 3.09  ? 333  PRO A CB    1 
ATOM   2520  C  CG    . PRO A 1 332  ? -16.030 -70.794  42.364  1.00 3.20  ? 333  PRO A CG    1 
ATOM   2521  C  CD    . PRO A 1 332  ? -17.064 -70.029  43.089  1.00 3.04  ? 333  PRO A CD    1 
ATOM   2522  N  N     . GLY A 1 333  ? -14.395 -70.720  46.797  1.00 5.10  ? 334  GLY A N     1 
ATOM   2523  C  CA    . GLY A 1 333  ? -13.724 -69.898  47.809  1.00 5.26  ? 334  GLY A CA    1 
ATOM   2524  C  C     . GLY A 1 333  ? -14.506 -69.208  48.937  1.00 5.18  ? 334  GLY A C     1 
ATOM   2525  O  O     . GLY A 1 333  ? -13.885 -68.549  49.783  1.00 5.14  ? 334  GLY A O     1 
ATOM   2526  N  N     . ALA A 1 334  ? -15.840 -69.293  48.932  1.00 4.44  ? 335  ALA A N     1 
ATOM   2527  C  CA    . ALA A 1 334  ? -16.644 -68.699  49.992  1.00 3.64  ? 335  ALA A CA    1 
ATOM   2528  C  C     . ALA A 1 334  ? -16.604 -69.740  51.087  1.00 3.97  ? 335  ALA A C     1 
ATOM   2529  O  O     . ALA A 1 334  ? -16.161 -70.863  50.857  1.00 4.32  ? 335  ALA A O     1 
ATOM   2530  C  CB    . ALA A 1 334  ? -18.056 -68.503  49.529  1.00 3.43  ? 335  ALA A CB    1 
ATOM   2531  N  N     . PRO A 1 335  ? -17.055 -69.396  52.294  1.00 3.99  ? 336  PRO A N     1 
ATOM   2532  C  CA    . PRO A 1 335  ? -17.020 -70.395  53.350  1.00 3.82  ? 336  PRO A CA    1 
ATOM   2533  C  C     . PRO A 1 335  ? -18.298 -71.182  53.344  1.00 4.30  ? 336  PRO A C     1 
ATOM   2534  O  O     . PRO A 1 335  ? -18.544 -71.955  54.262  1.00 5.38  ? 336  PRO A O     1 
ATOM   2535  C  CB    . PRO A 1 335  ? -16.933 -69.539  54.594  1.00 4.09  ? 336  PRO A CB    1 
ATOM   2536  C  CG    . PRO A 1 335  ? -17.838 -68.417  54.258  1.00 4.15  ? 336  PRO A CG    1 
ATOM   2537  C  CD    . PRO A 1 335  ? -17.463 -68.087  52.830  1.00 4.46  ? 336  PRO A CD    1 
ATOM   2538  N  N     . GLY A 1 336  ? -19.129 -70.960  52.334  1.00 4.23  ? 337  GLY A N     1 
ATOM   2539  C  CA    . GLY A 1 336  ? -20.389 -71.671  52.240  1.00 4.38  ? 337  GLY A CA    1 
ATOM   2540  C  C     . GLY A 1 336  ? -21.225 -71.007  51.179  1.00 4.53  ? 337  GLY A C     1 
ATOM   2541  O  O     . GLY A 1 336  ? -20.938 -69.874  50.780  1.00 4.91  ? 337  GLY A O     1 
ATOM   2542  N  N     . ASP A 1 337  ? -22.250 -71.691  50.703  1.00 4.37  ? 338  ASP A N     1 
ATOM   2543  C  CA    . ASP A 1 337  ? -23.089 -71.113  49.675  1.00 4.85  ? 338  ASP A CA    1 
ATOM   2544  C  C     . ASP A 1 337  ? -24.131 -70.150  50.273  1.00 4.99  ? 338  ASP A C     1 
ATOM   2545  O  O     . ASP A 1 337  ? -24.333 -70.131  51.493  1.00 5.24  ? 338  ASP A O     1 
ATOM   2546  C  CB    . ASP A 1 337  ? -23.637 -72.216  48.793  1.00 6.19  ? 338  ASP A CB    1 
ATOM   2547  C  CG    . ASP A 1 337  ? -22.514 -73.059  48.158  1.00 7.84  ? 338  ASP A CG    1 
ATOM   2548  O  OD1   . ASP A 1 337  ? -21.481 -72.457  47.742  1.00 7.62  ? 338  ASP A OD1   1 
ATOM   2549  O  OD2   . ASP A 1 337  ? -22.652 -74.319  48.111  1.00 7.82  ? 338  ASP A OD2   1 
ATOM   2550  N  N     . PRO A 1 338  ? -24.800 -69.329  49.433  1.00 4.74  ? 339  PRO A N     1 
ATOM   2551  C  CA    . PRO A 1 338  ? -25.790 -68.343  49.890  1.00 4.02  ? 339  PRO A CA    1 
ATOM   2552  C  C     . PRO A 1 338  ? -26.894 -68.814  50.789  1.00 3.91  ? 339  PRO A C     1 
ATOM   2553  O  O     . PRO A 1 338  ? -27.028 -68.298  51.877  1.00 4.54  ? 339  PRO A O     1 
ATOM   2554  C  CB    . PRO A 1 338  ? -26.335 -67.779  48.588  1.00 4.05  ? 339  PRO A CB    1 
ATOM   2555  C  CG    . PRO A 1 338  ? -25.232 -68.030  47.610  1.00 4.56  ? 339  PRO A CG    1 
ATOM   2556  C  CD    . PRO A 1 338  ? -24.843 -69.419  47.967  1.00 4.60  ? 339  PRO A CD    1 
ATOM   2557  N  N     . LEU A 1 339  ? -27.678 -69.798  50.369  1.00 3.64  ? 340  LEU A N     1 
ATOM   2558  C  CA    . LEU A 1 339  ? -28.756 -70.248  51.230  1.00 3.56  ? 340  LEU A CA    1 
ATOM   2559  C  C     . LEU A 1 339  ? -28.207 -70.663  52.597  1.00 3.87  ? 340  LEU A C     1 
ATOM   2560  O  O     . LEU A 1 339  ? -28.639 -70.144  53.622  1.00 4.45  ? 340  LEU A O     1 
ATOM   2561  C  CB    . LEU A 1 339  ? -29.573 -71.354  50.572  1.00 2.65  ? 340  LEU A CB    1 
ATOM   2562  C  CG    . LEU A 1 339  ? -30.847 -71.713  51.329  1.00 2.60  ? 340  LEU A CG    1 
ATOM   2563  C  CD1   . LEU A 1 339  ? -31.738 -70.511  51.512  1.00 2.32  ? 340  LEU A CD1   1 
ATOM   2564  C  CD2   . LEU A 1 339  ? -31.580 -72.790  50.597  1.00 2.29  ? 340  LEU A CD2   1 
ATOM   2565  N  N     . TYR A 1 340  ? -27.179 -71.505  52.600  1.00 4.13  ? 341  TYR A N     1 
ATOM   2566  C  CA    . TYR A 1 340  ? -26.557 -71.965  53.834  1.00 3.93  ? 341  TYR A CA    1 
ATOM   2567  C  C     . TYR A 1 340  ? -26.079 -70.792  54.631  1.00 3.69  ? 341  TYR A C     1 
ATOM   2568  O  O     . TYR A 1 340  ? -26.259 -70.755  55.847  1.00 4.22  ? 341  TYR A O     1 
ATOM   2569  C  CB    . TYR A 1 340  ? -25.365 -72.872  53.534  1.00 4.94  ? 341  TYR A CB    1 
ATOM   2570  C  CG    . TYR A 1 340  ? -24.425 -73.104  54.706  1.00 6.03  ? 341  TYR A CG    1 
ATOM   2571  C  CD1   . TYR A 1 340  ? -24.852 -73.777  55.837  1.00 6.54  ? 341  TYR A CD1   1 
ATOM   2572  C  CD2   . TYR A 1 340  ? -23.091 -72.690  54.657  1.00 6.56  ? 341  TYR A CD2   1 
ATOM   2573  C  CE1   . TYR A 1 340  ? -23.984 -74.038  56.883  1.00 7.23  ? 341  TYR A CE1   1 
ATOM   2574  C  CE2   . TYR A 1 340  ? -22.213 -72.950  55.698  1.00 6.69  ? 341  TYR A CE2   1 
ATOM   2575  C  CZ    . TYR A 1 340  ? -22.667 -73.630  56.810  1.00 7.09  ? 341  TYR A CZ    1 
ATOM   2576  O  OH    . TYR A 1 340  ? -21.812 -73.948  57.847  1.00 7.77  ? 341  TYR A OH    1 
ATOM   2577  N  N     . LEU A 1 341  ? -25.454 -69.830  53.968  1.00 2.95  ? 342  LEU A N     1 
ATOM   2578  C  CA    . LEU A 1 341  ? -24.955 -68.680  54.696  1.00 2.27  ? 342  LEU A CA    1 
ATOM   2579  C  C     . LEU A 1 341  ? -26.074 -67.918  55.368  1.00 2.06  ? 342  LEU A C     1 
ATOM   2580  O  O     . LEU A 1 341  ? -25.958 -67.595  56.545  1.00 2.03  ? 342  LEU A O     1 
ATOM   2581  C  CB    . LEU A 1 341  ? -24.126 -67.785  53.803  1.00 2.00  ? 342  LEU A CB    1 
ATOM   2582  C  CG    . LEU A 1 341  ? -22.630 -67.924  53.982  1.00 2.00  ? 342  LEU A CG    1 
ATOM   2583  C  CD1   . LEU A 1 341  ? -22.220 -69.301  54.375  1.00 2.00  ? 342  LEU A CD1   1 
ATOM   2584  C  CD2   . LEU A 1 341  ? -21.989 -67.552  52.697  1.00 2.00  ? 342  LEU A CD2   1 
ATOM   2585  N  N     . ASP A 1 342  ? -27.197 -67.753  54.669  1.00 2.21  ? 343  ASP A N     1 
ATOM   2586  C  CA    . ASP A 1 342  ? -28.356 -67.034  55.201  1.00 2.20  ? 343  ASP A CA    1 
ATOM   2587  C  C     . ASP A 1 342  ? -28.933 -67.737  56.442  1.00 2.43  ? 343  ASP A C     1 
ATOM   2588  O  O     . ASP A 1 342  ? -28.993 -67.142  57.529  1.00 2.48  ? 343  ASP A O     1 
ATOM   2589  C  CB    . ASP A 1 342  ? -29.431 -66.868  54.123  1.00 2.12  ? 343  ASP A CB    1 
ATOM   2590  C  CG    . ASP A 1 342  ? -29.031 -65.882  53.031  1.00 3.46  ? 343  ASP A CG    1 
ATOM   2591  O  OD1   . ASP A 1 342  ? -27.995 -66.049  52.373  1.00 4.84  ? 343  ASP A OD1   1 
ATOM   2592  O  OD2   . ASP A 1 342  ? -29.772 -64.922  52.788  1.00 4.58  ? 343  ASP A OD2   1 
ATOM   2593  N  N     . VAL A 1 343  ? -29.308 -69.004  56.301  1.00 2.00  ? 344  VAL A N     1 
ATOM   2594  C  CA    . VAL A 1 343  ? -29.855 -69.755  57.413  1.00 2.00  ? 344  VAL A CA    1 
ATOM   2595  C  C     . VAL A 1 343  ? -29.006 -69.602  58.671  1.00 2.94  ? 344  VAL A C     1 
ATOM   2596  O  O     . VAL A 1 343  ? -29.534 -69.366  59.740  1.00 2.65  ? 344  VAL A O     1 
ATOM   2597  C  CB    . VAL A 1 343  ? -29.928 -71.228  57.065  1.00 2.09  ? 344  VAL A CB    1 
ATOM   2598  C  CG1   . VAL A 1 343  ? -30.459 -72.040  58.232  1.00 2.00  ? 344  VAL A CG1   1 
ATOM   2599  C  CG2   . VAL A 1 343  ? -30.764 -71.416  55.834  1.00 2.11  ? 344  VAL A CG2   1 
ATOM   2600  N  N     . CYS A 1 344  ? -27.683 -69.699  58.526  1.00 3.91  ? 345  CYS A N     1 
ATOM   2601  C  CA    . CYS A 1 344  ? -26.755 -69.584  59.653  1.00 4.21  ? 345  CYS A CA    1 
ATOM   2602  C  C     . CYS A 1 344  ? -26.930 -68.285  60.422  1.00 4.33  ? 345  CYS A C     1 
ATOM   2603  O  O     . CYS A 1 344  ? -27.092 -68.287  61.642  1.00 3.75  ? 345  CYS A O     1 
ATOM   2604  C  CB    . CYS A 1 344  ? -25.307 -69.660  59.165  1.00 4.63  ? 345  CYS A CB    1 
ATOM   2605  S  SG    . CYS A 1 344  ? -24.694 -71.287  58.630  1.00 7.41  ? 345  CYS A SG    1 
ATOM   2606  N  N     . SER A 1 345  ? -26.897 -67.176  59.692  1.00 5.01  ? 346  SER A N     1 
ATOM   2607  C  CA    . SER A 1 345  ? -27.030 -65.859  60.291  1.00 6.30  ? 346  SER A CA    1 
ATOM   2608  C  C     . SER A 1 345  ? -28.307 -65.747  61.097  1.00 6.83  ? 346  SER A C     1 
ATOM   2609  O  O     . SER A 1 345  ? -28.382 -64.940  62.013  1.00 6.72  ? 346  SER A O     1 
ATOM   2610  C  CB    . SER A 1 345  ? -27.009 -64.773  59.218  1.00 6.99  ? 346  SER A CB    1 
ATOM   2611  O  OG    . SER A 1 345  ? -28.257 -64.691  58.550  1.00 7.48  ? 346  SER A OG    1 
ATOM   2612  N  N     . ALA A 1 346  ? -29.321 -66.526  60.710  1.00 7.45  ? 347  ALA A N     1 
ATOM   2613  C  CA    . ALA A 1 346  ? -30.612 -66.547  61.404  1.00 7.53  ? 347  ALA A CA    1 
ATOM   2614  C  C     . ALA A 1 346  ? -30.430 -67.280  62.731  1.00 7.66  ? 347  ALA A C     1 
ATOM   2615  O  O     . ALA A 1 346  ? -30.763 -66.773  63.789  1.00 8.06  ? 347  ALA A O     1 
ATOM   2616  C  CB    . ALA A 1 346  ? -31.650 -67.244  60.550  1.00 6.64  ? 347  ALA A CB    1 
ATOM   2617  N  N     . PHE A 1 347  ? -29.819 -68.446  62.662  1.00 7.98  ? 348  PHE A N     1 
ATOM   2618  C  CA    . PHE A 1 347  ? -29.562 -69.240  63.836  1.00 8.99  ? 348  PHE A CA    1 
ATOM   2619  C  C     . PHE A 1 347  ? -28.696 -68.536  64.891  1.00 10.28 ? 348  PHE A C     1 
ATOM   2620  O  O     . PHE A 1 347  ? -28.955 -68.664  66.094  1.00 10.26 ? 348  PHE A O     1 
ATOM   2621  C  CB    . PHE A 1 347  ? -28.932 -70.561  63.418  1.00 8.28  ? 348  PHE A CB    1 
ATOM   2622  C  CG    . PHE A 1 347  ? -29.931 -71.595  63.019  1.00 7.62  ? 348  PHE A CG    1 
ATOM   2623  C  CD1   . PHE A 1 347  ? -30.785 -72.141  63.966  1.00 7.19  ? 348  PHE A CD1   1 
ATOM   2624  C  CD2   . PHE A 1 347  ? -30.036 -72.011  61.704  1.00 7.24  ? 348  PHE A CD2   1 
ATOM   2625  C  CE1   . PHE A 1 347  ? -31.722 -73.076  63.613  1.00 7.24  ? 348  PHE A CE1   1 
ATOM   2626  C  CE2   . PHE A 1 347  ? -30.978 -72.949  61.341  1.00 7.20  ? 348  PHE A CE2   1 
ATOM   2627  C  CZ    . PHE A 1 347  ? -31.823 -73.484  62.295  1.00 7.61  ? 348  PHE A CZ    1 
ATOM   2628  N  N     . VAL A 1 348  ? -27.676 -67.800  64.453  1.00 11.62 ? 349  VAL A N     1 
ATOM   2629  C  CA    . VAL A 1 348  ? -26.807 -67.106  65.407  1.00 13.05 ? 349  VAL A CA    1 
ATOM   2630  C  C     . VAL A 1 348  ? -27.533 -65.894  65.915  1.00 14.44 ? 349  VAL A C     1 
ATOM   2631  O  O     . VAL A 1 348  ? -27.657 -65.672  67.126  1.00 14.89 ? 349  VAL A O     1 
ATOM   2632  C  CB    . VAL A 1 348  ? -25.446 -66.688  64.780  1.00 12.55 ? 349  VAL A CB    1 
ATOM   2633  C  CG1   . VAL A 1 348  ? -25.034 -67.720  63.777  1.00 12.83 ? 349  VAL A CG1   1 
ATOM   2634  C  CG2   . VAL A 1 348  ? -25.488 -65.314  64.152  1.00 11.52 ? 349  VAL A CG2   1 
ATOM   2635  N  N     . GLU A 1 349  ? -28.089 -65.158  64.966  1.00 15.85 ? 350  GLU A N     1 
ATOM   2636  C  CA    . GLU A 1 349  ? -28.823 -63.963  65.270  1.00 17.28 ? 350  GLU A CA    1 
ATOM   2637  C  C     . GLU A 1 349  ? -30.002 -64.282  66.179  1.00 17.56 ? 350  GLU A C     1 
ATOM   2638  O  O     . GLU A 1 349  ? -30.510 -63.389  66.847  1.00 18.17 ? 350  GLU A O     1 
ATOM   2639  C  CB    . GLU A 1 349  ? -29.289 -63.331  63.975  1.00 18.63 ? 350  GLU A CB    1 
ATOM   2640  C  CG    . GLU A 1 349  ? -30.194 -62.150  64.140  1.00 21.15 ? 350  GLU A CG    1 
ATOM   2641  C  CD    . GLU A 1 349  ? -29.783 -60.992  63.268  1.00 22.41 ? 350  GLU A CD    1 
ATOM   2642  O  OE1   . GLU A 1 349  ? -29.198 -61.241  62.167  1.00 22.23 ? 350  GLU A OE1   1 
ATOM   2643  O  OE2   . GLU A 1 349  ? -30.046 -59.839  63.712  1.00 22.82 ? 350  GLU A OE2   1 
ATOM   2644  N  N     . ARG A 1 350  ? -30.427 -65.548  66.214  1.00 17.25 ? 351  ARG A N     1 
ATOM   2645  C  CA    . ARG A 1 350  ? -31.544 -65.954  67.069  1.00 16.64 ? 351  ARG A CA    1 
ATOM   2646  C  C     . ARG A 1 350  ? -31.125 -66.097  68.539  1.00 17.04 ? 351  ARG A C     1 
ATOM   2647  O  O     . ARG A 1 350  ? -31.916 -65.833  69.454  1.00 16.98 ? 351  ARG A O     1 
ATOM   2648  C  CB    . ARG A 1 350  ? -32.148 -67.260  66.571  1.00 15.55 ? 351  ARG A CB    1 
ATOM   2649  C  CG    . ARG A 1 350  ? -33.447 -67.614  67.242  1.00 13.93 ? 351  ARG A CG    1 
ATOM   2650  C  CD    . ARG A 1 350  ? -33.300 -68.924  67.937  1.00 13.43 ? 351  ARG A CD    1 
ATOM   2651  N  NE    . ARG A 1 350  ? -34.066 -69.983  67.304  1.00 12.44 ? 351  ARG A NE    1 
ATOM   2652  C  CZ    . ARG A 1 350  ? -33.635 -71.225  67.155  1.00 12.06 ? 351  ARG A CZ    1 
ATOM   2653  N  NH1   . ARG A 1 350  ? -32.427 -71.575  67.579  1.00 11.52 ? 351  ARG A NH1   1 
ATOM   2654  N  NH2   . ARG A 1 350  ? -34.438 -72.130  66.617  1.00 13.04 ? 351  ARG A NH2   1 
ATOM   2655  N  N     . GLY A 1 351  ? -29.890 -66.555  68.744  1.00 17.39 ? 352  GLY A N     1 
ATOM   2656  C  CA    . GLY A 1 351  ? -29.334 -66.722  70.078  1.00 18.07 ? 352  GLY A CA    1 
ATOM   2657  C  C     . GLY A 1 351  ? -30.041 -67.666  71.023  1.00 18.59 ? 352  GLY A C     1 
ATOM   2658  O  O     . GLY A 1 351  ? -30.350 -67.287  72.136  1.00 18.91 ? 352  GLY A O     1 
ATOM   2659  N  N     . GLU A 1 352  ? -30.280 -68.897  70.592  1.00 19.37 ? 353  GLU A N     1 
ATOM   2660  C  CA    . GLU A 1 352  ? -30.962 -69.908  71.413  1.00 20.61 ? 353  GLU A CA    1 
ATOM   2661  C  C     . GLU A 1 352  ? -30.419 -71.264  70.957  1.00 20.54 ? 353  GLU A C     1 
ATOM   2662  O  O     . GLU A 1 352  ? -29.221 -71.522  71.049  1.00 21.20 ? 353  GLU A O     1 
ATOM   2663  C  CB    . GLU A 1 352  ? -32.505 -69.897  71.198  1.00 21.59 ? 353  GLU A CB    1 
ATOM   2664  C  CG    . GLU A 1 352  ? -33.341 -68.769  71.836  1.00 23.15 ? 353  GLU A CG    1 
ATOM   2665  C  CD    . GLU A 1 352  ? -34.764 -68.658  71.240  1.00 24.38 ? 353  GLU A CD    1 
ATOM   2666  O  OE1   . GLU A 1 352  ? -35.343 -69.696  70.797  1.00 24.63 ? 353  GLU A OE1   1 
ATOM   2667  O  OE2   . GLU A 1 352  ? -35.292 -67.512  71.211  1.00 24.93 ? 353  GLU A OE2   1 
ATOM   2668  N  N     . ALA A 1 353  ? -31.300 -72.116  70.441  1.00 20.24 ? 354  ALA A N     1 
ATOM   2669  C  CA    . ALA A 1 353  ? -30.912 -73.416  69.958  1.00 19.60 ? 354  ALA A CA    1 
ATOM   2670  C  C     . ALA A 1 353  ? -29.975 -73.245  68.787  1.00 19.57 ? 354  ALA A C     1 
ATOM   2671  O  O     . ALA A 1 353  ? -29.932 -72.186  68.157  1.00 19.95 ? 354  ALA A O     1 
ATOM   2672  C  CB    . ALA A 1 353  ? -32.136 -74.168  69.517  1.00 19.65 ? 354  ALA A CB    1 
ATOM   2673  N  N     . MET A 1 354  ? -29.222 -74.299  68.504  1.00 19.53 ? 355  MET A N     1 
ATOM   2674  C  CA    . MET A 1 354  ? -28.277 -74.335  67.393  1.00 19.31 ? 355  MET A CA    1 
ATOM   2675  C  C     . MET A 1 354  ? -28.151 -75.771  66.849  1.00 18.85 ? 355  MET A C     1 
ATOM   2676  O  O     . MET A 1 354  ? -27.117 -76.408  67.025  1.00 19.49 ? 355  MET A O     1 
ATOM   2677  C  CB    . MET A 1 354  ? -26.910 -73.836  67.856  1.00 19.64 ? 355  MET A CB    1 
ATOM   2678  C  CG    . MET A 1 354  ? -26.817 -72.339  68.064  1.00 20.15 ? 355  MET A CG    1 
ATOM   2679  S  SD    . MET A 1 354  ? -26.400 -71.416  66.577  1.00 20.06 ? 355  MET A SD    1 
ATOM   2680  C  CE    . MET A 1 354  ? -26.271 -69.795  67.356  1.00 19.75 ? 355  MET A CE    1 
ATOM   2681  N  N     . PRO A 1 355  ? -29.166 -76.249  66.106  1.00 17.70 ? 356  PRO A N     1 
ATOM   2682  C  CA    . PRO A 1 355  ? -29.313 -77.566  65.477  1.00 16.99 ? 356  PRO A CA    1 
ATOM   2683  C  C     . PRO A 1 355  ? -28.141 -78.202  64.709  1.00 16.34 ? 356  PRO A C     1 
ATOM   2684  O  O     . PRO A 1 355  ? -28.254 -79.359  64.260  1.00 16.69 ? 356  PRO A O     1 
ATOM   2685  C  CB    . PRO A 1 355  ? -30.485 -77.348  64.521  1.00 16.91 ? 356  PRO A CB    1 
ATOM   2686  C  CG    . PRO A 1 355  ? -31.277 -76.355  65.181  1.00 17.89 ? 356  PRO A CG    1 
ATOM   2687  C  CD    . PRO A 1 355  ? -30.255 -75.370  65.665  1.00 17.72 ? 356  PRO A CD    1 
ATOM   2688  N  N     . LYS A 1 356  ? -27.021 -77.506  64.562  1.00 14.64 ? 357  LYS A N     1 
ATOM   2689  C  CA    . LYS A 1 356  ? -25.914 -78.070  63.787  1.00 13.90 ? 357  LYS A CA    1 
ATOM   2690  C  C     . LYS A 1 356  ? -26.423 -78.049  62.371  1.00 13.13 ? 357  LYS A C     1 
ATOM   2691  O  O     . LYS A 1 356  ? -27.253 -78.874  61.960  1.00 13.22 ? 357  LYS A O     1 
ATOM   2692  C  CB    . LYS A 1 356  ? -25.541 -79.516  64.178  1.00 13.45 ? 357  LYS A CB    1 
ATOM   2693  C  CG    . LYS A 1 356  ? -24.900 -80.322  63.045  1.00 13.75 ? 357  LYS A CG    1 
ATOM   2694  C  CD    . LYS A 1 356  ? -23.359 -80.460  63.060  1.00 15.06 ? 357  LYS A CD    1 
ATOM   2695  C  CE    . LYS A 1 356  ? -22.529 -79.129  63.009  1.00 17.24 ? 357  LYS A CE    1 
ATOM   2696  N  NZ    . LYS A 1 356  ? -22.915 -77.951  62.114  1.00 17.69 ? 357  LYS A NZ    1 
ATOM   2697  N  N     . ILE A 1 357  ? -25.974 -77.031  61.661  1.00 11.87 ? 358  ILE A N     1 
ATOM   2698  C  CA    . ILE A 1 357  ? -26.351 -76.831  60.296  1.00 10.51 ? 358  ILE A CA    1 
ATOM   2699  C  C     . ILE A 1 357  ? -25.260 -77.418  59.412  1.00 9.71  ? 358  ILE A C     1 
ATOM   2700  O  O     . ILE A 1 357  ? -24.071 -77.190  59.657  1.00 10.66 ? 358  ILE A O     1 
ATOM   2701  C  CB    . ILE A 1 357  ? -26.535 -75.336  60.076  1.00 10.24 ? 358  ILE A CB    1 
ATOM   2702  C  CG1   . ILE A 1 357  ? -27.626 -74.844  60.994  1.00 9.91  ? 358  ILE A CG1   1 
ATOM   2703  C  CG2   . ILE A 1 357  ? -26.918 -75.029  58.658  1.00 10.78 ? 358  ILE A CG2   1 
ATOM   2704  C  CD1   . ILE A 1 357  ? -27.099 -74.099  62.124  1.00 10.38 ? 358  ILE A CD1   1 
ATOM   2705  N  N     . LEU A 1 358  ? -25.659 -78.260  58.469  1.00 8.15  ? 359  LEU A N     1 
ATOM   2706  C  CA    . LEU A 1 358  ? -24.736 -78.884  57.538  1.00 7.69  ? 359  LEU A CA    1 
ATOM   2707  C  C     . LEU A 1 358  ? -25.063 -78.264  56.200  1.00 7.68  ? 359  LEU A C     1 
ATOM   2708  O  O     . LEU A 1 358  ? -26.223 -77.954  55.939  1.00 8.61  ? 359  LEU A O     1 
ATOM   2709  C  CB    . LEU A 1 358  ? -24.984 -80.382  57.469  1.00 7.90  ? 359  LEU A CB    1 
ATOM   2710  C  CG    . LEU A 1 358  ? -24.122 -81.310  58.321  1.00 7.70  ? 359  LEU A CG    1 
ATOM   2711  C  CD1   . LEU A 1 358  ? -23.856 -80.719  59.662  1.00 7.41  ? 359  LEU A CD1   1 
ATOM   2712  C  CD2   . LEU A 1 358  ? -24.817 -82.639  58.453  1.00 7.10  ? 359  LEU A CD2   1 
ATOM   2713  N  N     . ALA A 1 359  ? -24.073 -78.122  55.330  1.00 6.64  ? 360  ALA A N     1 
ATOM   2714  C  CA    . ALA A 1 359  ? -24.311 -77.492  54.051  1.00 5.82  ? 360  ALA A CA    1 
ATOM   2715  C  C     . ALA A 1 359  ? -24.049 -78.480  52.957  1.00 5.77  ? 360  ALA A C     1 
ATOM   2716  O  O     . ALA A 1 359  ? -23.042 -79.167  52.999  1.00 6.12  ? 360  ALA A O     1 
ATOM   2717  C  CB    . ALA A 1 359  ? -23.411 -76.304  53.901  1.00 5.48  ? 360  ALA A CB    1 
ATOM   2718  N  N     . GLY A 1 360  ? -24.910 -78.505  51.940  1.00 5.30  ? 361  GLY A N     1 
ATOM   2719  C  CA    . GLY A 1 360  ? -24.740 -79.451  50.841  1.00 4.99  ? 361  GLY A CA    1 
ATOM   2720  C  C     . GLY A 1 360  ? -25.070 -78.906  49.464  1.00 4.58  ? 361  GLY A C     1 
ATOM   2721  O  O     . GLY A 1 360  ? -25.891 -77.998  49.317  1.00 5.17  ? 361  GLY A O     1 
ATOM   2722  N  N     . ARG A 1 361  ? -24.460 -79.481  48.436  1.00 3.79  ? 362  ARG A N     1 
ATOM   2723  C  CA    . ARG A 1 361  ? -24.694 -78.997  47.090  1.00 2.76  ? 362  ARG A CA    1 
ATOM   2724  C  C     . ARG A 1 361  ? -25.144 -80.081  46.120  1.00 2.37  ? 362  ARG A C     1 
ATOM   2725  O  O     . ARG A 1 361  ? -24.628 -81.198  46.105  1.00 2.00  ? 362  ARG A O     1 
ATOM   2726  C  CB    . ARG A 1 361  ? -23.460 -78.264  46.590  1.00 3.27  ? 362  ARG A CB    1 
ATOM   2727  C  CG    . ARG A 1 361  ? -23.390 -78.152  45.100  1.00 3.12  ? 362  ARG A CG    1 
ATOM   2728  C  CD    . ARG A 1 361  ? -22.351 -77.177  44.690  1.00 3.09  ? 362  ARG A CD    1 
ATOM   2729  N  NE    . ARG A 1 361  ? -21.058 -77.459  45.284  1.00 3.97  ? 362  ARG A NE    1 
ATOM   2730  C  CZ    . ARG A 1 361  ? -20.493 -76.691  46.211  1.00 4.72  ? 362  ARG A CZ    1 
ATOM   2731  N  NH1   . ARG A 1 361  ? -21.141 -75.618  46.653  1.00 4.11  ? 362  ARG A NH1   1 
ATOM   2732  N  NH2   . ARG A 1 361  ? -19.245 -76.938  46.621  1.00 4.02  ? 362  ARG A NH2   1 
ATOM   2733  N  N     . TYR A 1 362  ? -26.093 -79.711  45.277  1.00 2.10  ? 363  TYR A N     1 
ATOM   2734  C  CA    . TYR A 1 362  ? -26.672 -80.642  44.334  1.00 2.31  ? 363  TYR A CA    1 
ATOM   2735  C  C     . TYR A 1 362  ? -27.027 -79.981  43.016  1.00 2.04  ? 363  TYR A C     1 
ATOM   2736  O  O     . TYR A 1 362  ? -26.854 -78.791  42.846  1.00 2.14  ? 363  TYR A O     1 
ATOM   2737  C  CB    . TYR A 1 362  ? -27.960 -81.189  44.935  1.00 2.03  ? 363  TYR A CB    1 
ATOM   2738  C  CG    . TYR A 1 362  ? -29.040 -80.154  44.972  1.00 2.00  ? 363  TYR A CG    1 
ATOM   2739  C  CD1   . TYR A 1 362  ? -28.942 -79.064  45.817  1.00 2.00  ? 363  TYR A CD1   1 
ATOM   2740  C  CD2   . TYR A 1 362  ? -30.121 -80.223  44.111  1.00 2.00  ? 363  TYR A CD2   1 
ATOM   2741  C  CE1   . TYR A 1 362  ? -29.896 -78.062  45.807  1.00 2.28  ? 363  TYR A CE1   1 
ATOM   2742  C  CE2   . TYR A 1 362  ? -31.076 -79.229  44.086  1.00 2.00  ? 363  TYR A CE2   1 
ATOM   2743  C  CZ    . TYR A 1 362  ? -30.957 -78.154  44.931  1.00 2.50  ? 363  TYR A CZ    1 
ATOM   2744  O  OH    . TYR A 1 362  ? -31.903 -77.171  44.926  1.00 3.57  ? 363  TYR A OH    1 
ATOM   2745  N  N     . GLY A 1 363  ? -27.433 -80.810  42.068  1.00 2.00  ? 364  GLY A N     1 
ATOM   2746  C  CA    . GLY A 1 363  ? -27.901 -80.361  40.775  1.00 2.00  ? 364  GLY A CA    1 
ATOM   2747  C  C     . GLY A 1 363  ? -27.235 -79.382  39.849  1.00 2.17  ? 364  GLY A C     1 
ATOM   2748  O  O     . GLY A 1 363  ? -27.850 -79.012  38.869  1.00 2.56  ? 364  GLY A O     1 
ATOM   2749  N  N     . LEU A 1 364  ? -26.032 -78.918  40.138  1.00 2.65  ? 365  LEU A N     1 
ATOM   2750  C  CA    . LEU A 1 364  ? -25.351 -78.012  39.220  1.00 2.26  ? 365  LEU A CA    1 
ATOM   2751  C  C     . LEU A 1 364  ? -25.485 -78.504  37.778  1.00 2.77  ? 365  LEU A C     1 
ATOM   2752  O  O     . LEU A 1 364  ? -25.415 -79.697  37.498  1.00 3.17  ? 365  LEU A O     1 
ATOM   2753  C  CB    . LEU A 1 364  ? -23.870 -78.011  39.538  1.00 2.02  ? 365  LEU A CB    1 
ATOM   2754  C  CG    . LEU A 1 364  ? -23.312 -76.779  40.187  1.00 2.24  ? 365  LEU A CG    1 
ATOM   2755  C  CD1   . LEU A 1 364  ? -24.180 -76.426  41.363  1.00 3.58  ? 365  LEU A CD1   1 
ATOM   2756  C  CD2   . LEU A 1 364  ? -21.901 -77.036  40.613  1.00 2.00  ? 365  LEU A CD2   1 
ATOM   2757  N  N     . GLY A 1 365  ? -25.725 -77.581  36.868  1.00 3.21  ? 366  GLY A N     1 
ATOM   2758  C  CA    . GLY A 1 365  ? -25.805 -77.928  35.466  1.00 3.17  ? 366  GLY A CA    1 
ATOM   2759  C  C     . GLY A 1 365  ? -26.837 -78.929  35.059  1.00 3.34  ? 366  GLY A C     1 
ATOM   2760  O  O     . GLY A 1 365  ? -26.700 -79.541  34.014  1.00 4.03  ? 366  GLY A O     1 
ATOM   2761  N  N     . SER A 1 366  ? -27.886 -79.038  35.862  1.00 3.73  ? 367  SER A N     1 
ATOM   2762  C  CA    . SER A 1 366  ? -29.011 -79.950  35.656  1.00 3.68  ? 367  SER A CA    1 
ATOM   2763  C  C     . SER A 1 366  ? -28.694 -81.363  36.014  1.00 3.31  ? 367  SER A C     1 
ATOM   2764  O  O     . SER A 1 366  ? -29.291 -82.270  35.481  1.00 2.93  ? 367  SER A O     1 
ATOM   2765  C  CB    . SER A 1 366  ? -29.564 -79.903  34.237  1.00 3.92  ? 367  SER A CB    1 
ATOM   2766  O  OG    . SER A 1 366  ? -30.936 -79.548  34.241  1.00 4.97  ? 367  SER A OG    1 
ATOM   2767  N  N     . LYS A 1 367  ? -27.733 -81.546  36.908  1.00 3.53  ? 368  LYS A N     1 
ATOM   2768  C  CA    . LYS A 1 367  ? -27.386 -82.876  37.373  1.00 4.06  ? 368  LYS A CA    1 
ATOM   2769  C  C     . LYS A 1 367  ? -28.629 -83.369  38.085  1.00 4.61  ? 368  LYS A C     1 
ATOM   2770  O  O     . LYS A 1 367  ? -29.410 -82.576  38.608  1.00 4.84  ? 368  LYS A O     1 
ATOM   2771  C  CB    . LYS A 1 367  ? -26.222 -82.824  38.360  1.00 3.77  ? 368  LYS A CB    1 
ATOM   2772  C  CG    . LYS A 1 367  ? -25.776 -84.168  38.854  1.00 2.29  ? 368  LYS A CG    1 
ATOM   2773  C  CD    . LYS A 1 367  ? -25.230 -85.002  37.714  1.00 2.94  ? 368  LYS A CD    1 
ATOM   2774  C  CE    . LYS A 1 367  ? -23.773 -84.679  37.374  1.00 2.31  ? 368  LYS A CE    1 
ATOM   2775  N  NZ    . LYS A 1 367  ? -23.310 -85.534  36.237  1.00 2.00  ? 368  LYS A NZ    1 
ATOM   2776  N  N     . GLU A 1 368  ? -28.834 -84.674  38.080  1.00 5.02  ? 369  GLU A N     1 
ATOM   2777  C  CA    . GLU A 1 368  ? -30.008 -85.239  38.720  1.00 5.12  ? 369  GLU A CA    1 
ATOM   2778  C  C     . GLU A 1 368  ? -30.043 -85.122  40.249  1.00 4.78  ? 369  GLU A C     1 
ATOM   2779  O  O     . GLU A 1 368  ? -29.002 -85.134  40.920  1.00 4.79  ? 369  GLU A O     1 
ATOM   2780  C  CB    . GLU A 1 368  ? -30.169 -86.711  38.318  1.00 5.72  ? 369  GLU A CB    1 
ATOM   2781  C  CG    . GLU A 1 368  ? -30.945 -86.959  37.015  1.00 7.19  ? 369  GLU A CG    1 
ATOM   2782  C  CD    . GLU A 1 368  ? -32.463 -87.014  37.208  1.00 7.97  ? 369  GLU A CD    1 
ATOM   2783  O  OE1   . GLU A 1 368  ? -32.939 -88.074  37.678  1.00 8.24  ? 369  GLU A OE1   1 
ATOM   2784  O  OE2   . GLU A 1 368  ? -33.168 -86.013  36.892  1.00 8.09  ? 369  GLU A OE2   1 
ATOM   2785  N  N     . PHE A 1 369  ? -31.257 -84.919  40.761  1.00 3.72  ? 370  PHE A N     1 
ATOM   2786  C  CA    . PHE A 1 369  ? -31.512 -84.871  42.183  1.00 2.56  ? 370  PHE A CA    1 
ATOM   2787  C  C     . PHE A 1 369  ? -32.671 -85.858  42.352  1.00 2.20  ? 370  PHE A C     1 
ATOM   2788  O  O     . PHE A 1 369  ? -33.819 -85.502  42.579  1.00 2.00  ? 370  PHE A O     1 
ATOM   2789  C  CB    . PHE A 1 369  ? -31.858 -83.459  42.691  1.00 2.65  ? 370  PHE A CB    1 
ATOM   2790  C  CG    . PHE A 1 369  ? -31.851 -83.346  44.206  1.00 2.47  ? 370  PHE A CG    1 
ATOM   2791  C  CD1   . PHE A 1 369  ? -30.740 -83.762  44.946  1.00 2.03  ? 370  PHE A CD1   1 
ATOM   2792  C  CD2   . PHE A 1 369  ? -32.974 -82.935  44.895  1.00 2.07  ? 370  PHE A CD2   1 
ATOM   2793  C  CE1   . PHE A 1 369  ? -30.772 -83.772  46.333  1.00 2.00  ? 370  PHE A CE1   1 
ATOM   2794  C  CE2   . PHE A 1 369  ? -32.994 -82.950  46.289  1.00 2.00  ? 370  PHE A CE2   1 
ATOM   2795  C  CZ    . PHE A 1 369  ? -31.897 -83.369  47.000  1.00 2.00  ? 370  PHE A CZ    1 
ATOM   2796  N  N     . SER A 1 370  ? -32.341 -87.122  42.159  1.00 2.00  ? 371  SER A N     1 
ATOM   2797  C  CA    . SER A 1 370  ? -33.274 -88.212  42.280  1.00 2.55  ? 371  SER A CA    1 
ATOM   2798  C  C     . SER A 1 370  ? -33.537 -88.497  43.758  1.00 2.68  ? 371  SER A C     1 
ATOM   2799  O  O     . SER A 1 370  ? -33.023 -87.819  44.636  1.00 2.00  ? 371  SER A O     1 
ATOM   2800  C  CB    . SER A 1 370  ? -32.708 -89.451  41.571  1.00 2.80  ? 371  SER A CB    1 
ATOM   2801  O  OG    . SER A 1 370  ? -31.473 -89.850  42.141  1.00 4.97  ? 371  SER A OG    1 
ATOM   2802  N  N     . PRO A 1 371  ? -34.375 -89.495  44.049  1.00 3.31  ? 372  PRO A N     1 
ATOM   2803  C  CA    . PRO A 1 371  ? -34.692 -89.837  45.434  1.00 3.82  ? 372  PRO A CA    1 
ATOM   2804  C  C     . PRO A 1 371  ? -33.556 -90.469  46.220  1.00 4.39  ? 372  PRO A C     1 
ATOM   2805  O  O     . PRO A 1 371  ? -33.348 -90.141  47.392  1.00 4.79  ? 372  PRO A O     1 
ATOM   2806  C  CB    . PRO A 1 371  ? -35.852 -90.800  45.270  1.00 3.70  ? 372  PRO A CB    1 
ATOM   2807  C  CG    . PRO A 1 371  ? -36.517 -90.289  44.046  1.00 3.22  ? 372  PRO A CG    1 
ATOM   2808  C  CD    . PRO A 1 371  ? -35.338 -90.147  43.148  1.00 3.15  ? 372  PRO A CD    1 
ATOM   2809  N  N     . ALA A 1 372  ? -32.839 -91.387  45.585  1.00 4.25  ? 373  ALA A N     1 
ATOM   2810  C  CA    . ALA A 1 372  ? -31.732 -92.045  46.245  1.00 4.49  ? 373  ALA A CA    1 
ATOM   2811  C  C     . ALA A 1 372  ? -30.800 -90.995  46.853  1.00 4.75  ? 373  ALA A C     1 
ATOM   2812  O  O     . ALA A 1 372  ? -30.416 -91.101  48.028  1.00 4.80  ? 373  ALA A O     1 
ATOM   2813  C  CB    . ALA A 1 372  ? -30.998 -92.928  45.274  1.00 4.25  ? 373  ALA A CB    1 
ATOM   2814  N  N     . MET A 1 373  ? -30.525 -89.942  46.078  1.00 5.19  ? 374  MET A N     1 
ATOM   2815  C  CA    . MET A 1 373  ? -29.644 -88.846  46.505  1.00 5.11  ? 374  MET A CA    1 
ATOM   2816  C  C     . MET A 1 373  ? -30.189 -88.147  47.746  1.00 4.88  ? 374  MET A C     1 
ATOM   2817  O  O     . MET A 1 373  ? -29.424 -87.802  48.644  1.00 4.96  ? 374  MET A O     1 
ATOM   2818  C  CB    . MET A 1 373  ? -29.439 -87.831  45.368  1.00 4.86  ? 374  MET A CB    1 
ATOM   2819  C  CG    . MET A 1 373  ? -28.832 -88.430  44.111  1.00 5.25  ? 374  MET A CG    1 
ATOM   2820  S  SD    . MET A 1 373  ? -28.535 -87.196  42.818  1.00 6.61  ? 374  MET A SD    1 
ATOM   2821  C  CE    . MET A 1 373  ? -28.633 -88.199  41.313  1.00 4.69  ? 374  MET A CE    1 
ATOM   2822  N  N     . VAL A 1 374  ? -31.510 -87.988  47.814  1.00 4.81  ? 375  VAL A N     1 
ATOM   2823  C  CA    . VAL A 1 374  ? -32.154 -87.328  48.953  1.00 4.60  ? 375  VAL A CA    1 
ATOM   2824  C  C     . VAL A 1 374  ? -32.066 -88.221  50.143  1.00 5.17  ? 375  VAL A C     1 
ATOM   2825  O  O     . VAL A 1 374  ? -31.917 -87.758  51.273  1.00 4.96  ? 375  VAL A O     1 
ATOM   2826  C  CB    . VAL A 1 374  ? -33.617 -87.062  48.711  1.00 3.79  ? 375  VAL A CB    1 
ATOM   2827  C  CG1   . VAL A 1 374  ? -34.178 -86.348  49.888  1.00 3.26  ? 375  VAL A CG1   1 
ATOM   2828  C  CG2   . VAL A 1 374  ? -33.784 -86.237  47.467  1.00 3.71  ? 375  VAL A CG2   1 
ATOM   2829  N  N     . LYS A 1 375  ? -32.227 -89.514  49.878  1.00 6.00  ? 376  LYS A N     1 
ATOM   2830  C  CA    . LYS A 1 375  ? -32.134 -90.525  50.913  1.00 6.74  ? 376  LYS A CA    1 
ATOM   2831  C  C     . LYS A 1 375  ? -30.754 -90.337  51.513  1.00 7.23  ? 376  LYS A C     1 
ATOM   2832  O  O     . LYS A 1 375  ? -30.584 -90.255  52.728  1.00 7.57  ? 376  LYS A O     1 
ATOM   2833  C  CB    . LYS A 1 375  ? -32.255 -91.910  50.297  1.00 6.30  ? 376  LYS A CB    1 
ATOM   2834  C  CG    . LYS A 1 375  ? -32.067 -93.034  51.285  1.00 7.80  ? 376  LYS A CG    1 
ATOM   2835  C  CD    . LYS A 1 375  ? -32.911 -92.872  52.541  1.00 8.24  ? 376  LYS A CD    1 
ATOM   2836  C  CE    . LYS A 1 375  ? -33.144 -94.210  53.236  1.00 8.94  ? 376  LYS A CE    1 
ATOM   2837  N  NZ    . LYS A 1 375  ? -31.913 -94.779  53.825  1.00 9.55  ? 376  LYS A NZ    1 
ATOM   2838  N  N     . SER A 1 376  ? -29.795 -90.122  50.624  1.00 7.52  ? 377  SER A N     1 
ATOM   2839  C  CA    . SER A 1 376  ? -28.415 -89.918  50.992  1.00 7.82  ? 377  SER A CA    1 
ATOM   2840  C  C     . SER A 1 376  ? -28.167 -88.645  51.806  1.00 7.64  ? 377  SER A C     1 
ATOM   2841  O  O     . SER A 1 376  ? -27.336 -88.631  52.716  1.00 7.39  ? 377  SER A O     1 
ATOM   2842  C  CB    . SER A 1 376  ? -27.578 -89.928  49.719  1.00 8.85  ? 377  SER A CB    1 
ATOM   2843  O  OG    . SER A 1 376  ? -26.324 -89.326  49.947  1.00 10.89 ? 377  SER A OG    1 
ATOM   2844  N  N     . VAL A 1 377  ? -28.864 -87.570  51.453  1.00 7.83  ? 378  VAL A N     1 
ATOM   2845  C  CA    . VAL A 1 377  ? -28.714 -86.309  52.167  1.00 7.93  ? 378  VAL A CA    1 
ATOM   2846  C  C     . VAL A 1 377  ? -29.152 -86.588  53.588  1.00 8.95  ? 378  VAL A C     1 
ATOM   2847  O  O     . VAL A 1 377  ? -28.452 -86.244  54.550  1.00 9.86  ? 378  VAL A O     1 
ATOM   2848  C  CB    . VAL A 1 377  ? -29.611 -85.194  51.581  1.00 6.98  ? 378  VAL A CB    1 
ATOM   2849  C  CG1   . VAL A 1 377  ? -29.558 -83.965  52.439  1.00 5.94  ? 378  VAL A CG1   1 
ATOM   2850  C  CG2   . VAL A 1 377  ? -29.171 -84.840  50.186  1.00 6.55  ? 378  VAL A CG2   1 
ATOM   2851  N  N     . TYR A 1 378  ? -30.278 -87.288  53.698  1.00 9.44  ? 379  TYR A N     1 
ATOM   2852  C  CA    . TYR A 1 378  ? -30.870 -87.639  54.981  1.00 9.75  ? 379  TYR A CA    1 
ATOM   2853  C  C     . TYR A 1 378  ? -30.016 -88.553  55.828  1.00 10.27 ? 379  TYR A C     1 
ATOM   2854  O  O     . TYR A 1 378  ? -29.732 -88.239  56.979  1.00 10.34 ? 379  TYR A O     1 
ATOM   2855  C  CB    . TYR A 1 378  ? -32.237 -88.285  54.772  1.00 8.76  ? 379  TYR A CB    1 
ATOM   2856  C  CG    . TYR A 1 378  ? -33.333 -87.288  54.656  1.00 8.48  ? 379  TYR A CG    1 
ATOM   2857  C  CD1   . TYR A 1 378  ? -33.543 -86.365  55.667  1.00 7.86  ? 379  TYR A CD1   1 
ATOM   2858  C  CD2   . TYR A 1 378  ? -34.118 -87.207  53.502  1.00 8.90  ? 379  TYR A CD2   1 
ATOM   2859  C  CE1   . TYR A 1 378  ? -34.497 -85.372  55.542  1.00 7.98  ? 379  TYR A CE1   1 
ATOM   2860  C  CE2   . TYR A 1 378  ? -35.093 -86.210  53.366  1.00 8.51  ? 379  TYR A CE2   1 
ATOM   2861  C  CZ    . TYR A 1 378  ? -35.265 -85.293  54.396  1.00 8.17  ? 379  TYR A CZ    1 
ATOM   2862  O  OH    . TYR A 1 378  ? -36.200 -84.294  54.296  1.00 8.80  ? 379  TYR A OH    1 
ATOM   2863  N  N     . ASP A 1 379  ? -29.598 -89.670  55.238  1.00 10.86 ? 380  ASP A N     1 
ATOM   2864  C  CA    . ASP A 1 379  ? -28.797 -90.670  55.931  1.00 11.47 ? 380  ASP A CA    1 
ATOM   2865  C  C     . ASP A 1 379  ? -27.550 -90.047  56.519  1.00 11.41 ? 380  ASP A C     1 
ATOM   2866  O  O     . ASP A 1 379  ? -26.990 -90.528  57.522  1.00 11.44 ? 380  ASP A O     1 
ATOM   2867  C  CB    . ASP A 1 379  ? -28.389 -91.767  54.964  1.00 12.44 ? 380  ASP A CB    1 
ATOM   2868  C  CG    . ASP A 1 379  ? -29.526 -92.706  54.631  1.00 14.19 ? 380  ASP A CG    1 
ATOM   2869  O  OD1   . ASP A 1 379  ? -30.601 -92.628  55.293  1.00 15.15 ? 380  ASP A OD1   1 
ATOM   2870  O  OD2   . ASP A 1 379  ? -29.333 -93.537  53.705  1.00 14.76 ? 380  ASP A OD2   1 
ATOM   2871  N  N     . ASN A 1 380  ? -27.111 -88.980  55.865  1.00 10.62 ? 381  ASN A N     1 
ATOM   2872  C  CA    . ASN A 1 380  ? -25.938 -88.284  56.286  1.00 9.32  ? 381  ASN A CA    1 
ATOM   2873  C  C     . ASN A 1 380  ? -26.265 -87.554  57.548  1.00 8.73  ? 381  ASN A C     1 
ATOM   2874  O  O     . ASN A 1 380  ? -25.494 -87.553  58.478  1.00 8.95  ? 381  ASN A O     1 
ATOM   2875  C  CB    . ASN A 1 380  ? -25.527 -87.298  55.229  1.00 9.36  ? 381  ASN A CB    1 
ATOM   2876  C  CG    . ASN A 1 380  ? -24.284 -86.576  55.602  1.00 10.02 ? 381  ASN A CG    1 
ATOM   2877  O  OD1   . ASN A 1 380  ? -23.244 -87.197  55.776  1.00 11.43 ? 381  ASN A OD1   1 
ATOM   2878  N  ND2   . ASN A 1 380  ? -24.371 -85.264  55.754  1.00 10.08 ? 381  ASN A ND2   1 
ATOM   2879  N  N     . MET A 1 381  ? -27.433 -86.950  57.604  1.00 8.47  ? 382  MET A N     1 
ATOM   2880  C  CA    . MET A 1 381  ? -27.794 -86.205  58.791  1.00 8.47  ? 382  MET A CA    1 
ATOM   2881  C  C     . MET A 1 381  ? -27.774 -87.095  60.005  1.00 8.65  ? 382  MET A C     1 
ATOM   2882  O  O     . MET A 1 381  ? -27.415 -86.660  61.100  1.00 9.26  ? 382  MET A O     1 
ATOM   2883  C  CB    . MET A 1 381  ? -29.153 -85.521  58.629  1.00 8.54  ? 382  MET A CB    1 
ATOM   2884  C  CG    . MET A 1 381  ? -29.006 -84.074  58.311  1.00 8.50  ? 382  MET A CG    1 
ATOM   2885  S  SD    . MET A 1 381  ? -30.510 -83.169  57.935  1.00 9.83  ? 382  MET A SD    1 
ATOM   2886  C  CE    . MET A 1 381  ? -31.085 -83.958  56.431  1.00 9.26  ? 382  MET A CE    1 
ATOM   2887  N  N     . SER A 1 382  ? -28.122 -88.353  59.819  1.00 8.52  ? 383  SER A N     1 
ATOM   2888  C  CA    . SER A 1 382  ? -28.113 -89.247  60.947  1.00 9.21  ? 383  SER A CA    1 
ATOM   2889  C  C     . SER A 1 382  ? -26.810 -90.044  61.074  1.00 9.54  ? 383  SER A C     1 
ATOM   2890  O  O     . SER A 1 382  ? -26.498 -90.526  62.154  1.00 10.38 ? 383  SER A O     1 
ATOM   2891  C  CB    . SER A 1 382  ? -29.339 -90.161  60.933  1.00 9.47  ? 383  SER A CB    1 
ATOM   2892  O  OG    . SER A 1 382  ? -29.362 -91.006  59.803  1.00 10.20 ? 383  SER A OG    1 
ATOM   2893  N  N     . GLY A 1 383  ? -26.032 -90.178  60.005  1.00 8.87  ? 384  GLY A N     1 
ATOM   2894  C  CA    . GLY A 1 383  ? -24.789 -90.922  60.121  1.00 8.25  ? 384  GLY A CA    1 
ATOM   2895  C  C     . GLY A 1 383  ? -23.537 -90.074  60.315  1.00 8.49  ? 384  GLY A C     1 
ATOM   2896  O  O     . GLY A 1 383  ? -23.308 -89.460  61.375  1.00 8.78  ? 384  GLY A O     1 
ATOM   2897  N  N     . ALA A 1 384  ? -22.733 -90.025  59.259  1.00 8.12  ? 385  ALA A N     1 
ATOM   2898  C  CA    . ALA A 1 384  ? -21.491 -89.279  59.229  1.00 7.59  ? 385  ALA A CA    1 
ATOM   2899  C  C     . ALA A 1 384  ? -21.563 -87.786  59.522  1.00 7.73  ? 385  ALA A C     1 
ATOM   2900  O  O     . ALA A 1 384  ? -20.656 -87.252  60.148  1.00 8.66  ? 385  ALA A O     1 
ATOM   2901  C  CB    . ALA A 1 384  ? -20.841 -89.477  57.914  1.00 7.32  ? 385  ALA A CB    1 
ATOM   2902  N  N     . LYS A 1 385  ? -22.608 -87.107  59.058  1.00 7.52  ? 386  LYS A N     1 
ATOM   2903  C  CA    . LYS A 1 385  ? -22.742 -85.659  59.236  1.00 7.30  ? 386  LYS A CA    1 
ATOM   2904  C  C     . LYS A 1 385  ? -21.620 -84.905  58.519  1.00 7.10  ? 386  LYS A C     1 
ATOM   2905  O  O     . LYS A 1 385  ? -21.042 -83.941  59.046  1.00 7.43  ? 386  LYS A O     1 
ATOM   2906  C  CB    . LYS A 1 385  ? -22.777 -85.268  60.702  1.00 7.68  ? 386  LYS A CB    1 
ATOM   2907  C  CG    . LYS A 1 385  ? -24.072 -85.569  61.360  1.00 9.80  ? 386  LYS A CG    1 
ATOM   2908  C  CD    . LYS A 1 385  ? -23.979 -85.302  62.846  1.00 11.52 ? 386  LYS A CD    1 
ATOM   2909  C  CE    . LYS A 1 385  ? -25.106 -86.007  63.585  1.00 13.10 ? 386  LYS A CE    1 
ATOM   2910  N  NZ    . LYS A 1 385  ? -25.166 -87.489  63.278  1.00 14.40 ? 386  LYS A NZ    1 
ATOM   2911  N  N     . LYS A 1 386  ? -21.291 -85.388  57.323  1.00 6.39  ? 387  LYS A N     1 
ATOM   2912  C  CA    . LYS A 1 386  ? -20.271 -84.775  56.478  1.00 5.27  ? 387  LYS A CA    1 
ATOM   2913  C  C     . LYS A 1 386  ? -20.791 -83.392  56.173  1.00 4.07  ? 387  LYS A C     1 
ATOM   2914  O  O     . LYS A 1 386  ? -21.940 -83.230  55.803  1.00 4.44  ? 387  LYS A O     1 
ATOM   2915  C  CB    . LYS A 1 386  ? -20.146 -85.571  55.169  1.00 6.00  ? 387  LYS A CB    1 
ATOM   2916  C  CG    . LYS A 1 386  ? -19.122 -85.049  54.159  1.00 6.55  ? 387  LYS A CG    1 
ATOM   2917  C  CD    . LYS A 1 386  ? -19.288 -85.736  52.808  1.00 7.03  ? 387  LYS A CD    1 
ATOM   2918  C  CE    . LYS A 1 386  ? -17.970 -86.250  52.295  1.00 8.12  ? 387  LYS A CE    1 
ATOM   2919  N  NZ    . LYS A 1 386  ? -16.856 -85.288  52.598  1.00 10.33 ? 387  LYS A NZ    1 
ATOM   2920  N  N     . ASN A 1 387  ? -19.989 -82.385  56.400  1.00 3.07  ? 388  ASN A N     1 
ATOM   2921  C  CA    . ASN A 1 387  ? -20.453 -81.052  56.104  1.00 2.48  ? 388  ASN A CA    1 
ATOM   2922  C  C     . ASN A 1 387  ? -19.902 -80.707  54.744  1.00 2.43  ? 388  ASN A C     1 
ATOM   2923  O  O     . ASN A 1 387  ? -19.015 -81.390  54.241  1.00 2.48  ? 388  ASN A O     1 
ATOM   2924  C  CB    . ASN A 1 387  ? -19.922 -80.082  57.145  1.00 2.63  ? 388  ASN A CB    1 
ATOM   2925  C  CG    . ASN A 1 387  ? -20.638 -78.776  57.132  1.00 2.52  ? 388  ASN A CG    1 
ATOM   2926  O  OD1   . ASN A 1 387  ? -21.318 -78.445  56.175  1.00 3.36  ? 388  ASN A OD1   1 
ATOM   2927  N  ND2   . ASN A 1 387  ? -20.483 -78.007  58.197  1.00 2.61  ? 388  ASN A ND2   1 
ATOM   2928  N  N     . HIS A 1 388  ? -20.464 -79.678  54.126  1.00 2.83  ? 389  HIS A N     1 
ATOM   2929  C  CA    . HIS A 1 388  ? -20.037 -79.212  52.810  1.00 2.92  ? 389  HIS A CA    1 
ATOM   2930  C  C     . HIS A 1 388  ? -19.773 -80.349  51.831  1.00 2.89  ? 389  HIS A C     1 
ATOM   2931  O  O     . HIS A 1 388  ? -18.651 -80.539  51.369  1.00 3.21  ? 389  HIS A O     1 
ATOM   2932  C  CB    . HIS A 1 388  ? -18.787 -78.360  52.939  1.00 2.17  ? 389  HIS A CB    1 
ATOM   2933  C  CG    . HIS A 1 388  ? -18.981 -77.107  53.727  1.00 2.06  ? 389  HIS A CG    1 
ATOM   2934  N  ND1   . HIS A 1 388  ? -18.447 -76.936  54.985  1.00 2.45  ? 389  HIS A ND1   1 
ATOM   2935  C  CD2   . HIS A 1 388  ? -19.500 -75.909  53.376  1.00 2.65  ? 389  HIS A CD2   1 
ATOM   2936  C  CE1   . HIS A 1 388  ? -18.604 -75.686  55.365  1.00 2.30  ? 389  HIS A CE1   1 
ATOM   2937  N  NE2   . HIS A 1 388  ? -19.239 -75.041  54.411  1.00 3.11  ? 389  HIS A NE2   1 
ATOM   2938  N  N     . PHE A 1 389  ? -20.804 -81.125  51.547  1.00 2.75  ? 390  PHE A N     1 
ATOM   2939  C  CA    . PHE A 1 389  ? -20.665 -82.238  50.639  1.00 2.74  ? 390  PHE A CA    1 
ATOM   2940  C  C     . PHE A 1 389  ? -21.261 -81.912  49.273  1.00 3.60  ? 390  PHE A C     1 
ATOM   2941  O  O     . PHE A 1 389  ? -21.736 -80.801  49.029  1.00 5.26  ? 390  PHE A O     1 
ATOM   2942  C  CB    . PHE A 1 389  ? -21.393 -83.441  51.220  1.00 2.00  ? 390  PHE A CB    1 
ATOM   2943  C  CG    . PHE A 1 389  ? -22.842 -83.196  51.491  1.00 2.00  ? 390  PHE A CG    1 
ATOM   2944  C  CD1   . PHE A 1 389  ? -23.243 -82.594  52.656  1.00 2.00  ? 390  PHE A CD1   1 
ATOM   2945  C  CD2   . PHE A 1 389  ? -23.807 -83.555  50.560  1.00 2.18  ? 390  PHE A CD2   1 
ATOM   2946  C  CE1   . PHE A 1 389  ? -24.561 -82.348  52.898  1.00 2.00  ? 390  PHE A CE1   1 
ATOM   2947  C  CE2   . PHE A 1 389  ? -25.137 -83.312  50.793  1.00 2.00  ? 390  PHE A CE2   1 
ATOM   2948  C  CZ    . PHE A 1 389  ? -25.511 -82.709  51.963  1.00 2.45  ? 390  PHE A CZ    1 
ATOM   2949  N  N     . THR A 1 390  ? -21.215 -82.880  48.369  1.00 3.48  ? 391  THR A N     1 
ATOM   2950  C  CA    . THR A 1 390  ? -21.821 -82.744  47.054  1.00 2.60  ? 391  THR A CA    1 
ATOM   2951  C  C     . THR A 1 390  ? -22.641 -84.022  46.924  1.00 2.41  ? 391  THR A C     1 
ATOM   2952  O  O     . THR A 1 390  ? -22.395 -84.976  47.669  1.00 2.00  ? 391  THR A O     1 
ATOM   2953  C  CB    . THR A 1 390  ? -20.761 -82.650  45.974  1.00 2.00  ? 391  THR A CB    1 
ATOM   2954  O  OG1   . THR A 1 390  ? -19.656 -83.482  46.311  1.00 2.00  ? 391  THR A OG1   1 
ATOM   2955  C  CG2   . THR A 1 390  ? -20.272 -81.259  45.880  1.00 2.00  ? 391  THR A CG2   1 
ATOM   2956  N  N     . VAL A 1 391  ? -23.707 -83.995  46.130  1.00 2.23  ? 392  VAL A N     1 
ATOM   2957  C  CA    . VAL A 1 391  ? -24.517 -85.199  45.936  1.00 2.19  ? 392  VAL A CA    1 
ATOM   2958  C  C     . VAL A 1 391  ? -24.813 -85.290  44.485  1.00 2.24  ? 392  VAL A C     1 
ATOM   2959  O  O     . VAL A 1 391  ? -25.359 -84.358  43.909  1.00 2.65  ? 392  VAL A O     1 
ATOM   2960  C  CB    . VAL A 1 391  ? -25.908 -85.175  46.594  1.00 2.00  ? 392  VAL A CB    1 
ATOM   2961  C  CG1   . VAL A 1 391  ? -26.099 -86.420  47.451  1.00 2.00  ? 392  VAL A CG1   1 
ATOM   2962  C  CG2   . VAL A 1 391  ? -26.165 -83.879  47.336  1.00 2.00  ? 392  VAL A CG2   1 
ATOM   2963  N  N     . GLY A 1 392  ? -24.462 -86.404  43.878  1.00 2.37  ? 393  GLY A N     1 
ATOM   2964  C  CA    . GLY A 1 392  ? -24.770 -86.535  42.479  1.00 2.65  ? 393  GLY A CA    1 
ATOM   2965  C  C     . GLY A 1 392  ? -23.530 -86.792  41.693  1.00 2.98  ? 393  GLY A C     1 
ATOM   2966  O  O     . GLY A 1 392  ? -23.594 -87.208  40.528  1.00 3.71  ? 393  GLY A O     1 
ATOM   2967  N  N     . ILE A 1 393  ? -22.393 -86.549  42.324  1.00 2.69  ? 394  ILE A N     1 
ATOM   2968  C  CA    . ILE A 1 393  ? -21.119 -86.794  41.664  1.00 3.15  ? 394  ILE A CA    1 
ATOM   2969  C  C     . ILE A 1 393  ? -20.211 -87.679  42.509  1.00 3.61  ? 394  ILE A C     1 
ATOM   2970  O  O     . ILE A 1 393  ? -20.459 -87.869  43.703  1.00 4.26  ? 394  ILE A O     1 
ATOM   2971  C  CB    . ILE A 1 393  ? -20.365 -85.476  41.401  1.00 2.00  ? 394  ILE A CB    1 
ATOM   2972  C  CG1   . ILE A 1 393  ? -19.909 -84.830  42.709  1.00 2.00  ? 394  ILE A CG1   1 
ATOM   2973  C  CG2   . ILE A 1 393  ? -21.241 -84.563  40.692  1.00 2.18  ? 394  ILE A CG2   1 
ATOM   2974  C  CD1   . ILE A 1 393  ? -19.276 -83.491  42.544  1.00 2.00  ? 394  ILE A CD1   1 
ATOM   2975  N  N     . GLU A 1 394  ? -19.228 -88.304  41.876  1.00 3.46  ? 395  GLU A N     1 
ATOM   2976  C  CA    . GLU A 1 394  ? -18.275 -89.027  42.670  1.00 3.70  ? 395  GLU A CA    1 
ATOM   2977  C  C     . GLU A 1 394  ? -17.084 -88.100  42.713  1.00 3.32  ? 395  GLU A C     1 
ATOM   2978  O  O     . GLU A 1 394  ? -16.380 -87.900  41.714  1.00 3.19  ? 395  GLU A O     1 
ATOM   2979  C  CB    . GLU A 1 394  ? -17.849 -90.336  42.065  1.00 5.63  ? 395  GLU A CB    1 
ATOM   2980  C  CG    . GLU A 1 394  ? -16.664 -90.909  42.822  1.00 8.71  ? 395  GLU A CG    1 
ATOM   2981  C  CD    . GLU A 1 394  ? -16.290 -92.302  42.380  1.00 11.20 ? 395  GLU A CD    1 
ATOM   2982  O  OE1   . GLU A 1 394  ? -16.781 -92.760  41.319  1.00 12.15 ? 395  GLU A OE1   1 
ATOM   2983  O  OE2   . GLU A 1 394  ? -15.501 -92.944  43.111  1.00 13.06 ? 395  GLU A OE2   1 
ATOM   2984  N  N     . ASP A 1 395  ? -16.901 -87.456  43.847  1.00 2.54  ? 396  ASP A N     1 
ATOM   2985  C  CA    . ASP A 1 395  ? -15.796 -86.575  43.938  1.00 2.29  ? 396  ASP A CA    1 
ATOM   2986  C  C     . ASP A 1 395  ? -14.655 -87.309  44.518  1.00 2.40  ? 396  ASP A C     1 
ATOM   2987  O  O     . ASP A 1 395  ? -14.514 -87.400  45.734  1.00 2.00  ? 396  ASP A O     1 
ATOM   2988  C  CB    . ASP A 1 395  ? -16.105 -85.378  44.787  1.00 2.19  ? 396  ASP A CB    1 
ATOM   2989  C  CG    . ASP A 1 395  ? -14.895 -84.523  44.994  1.00 2.56  ? 396  ASP A CG    1 
ATOM   2990  O  OD1   . ASP A 1 395  ? -13.971 -84.580  44.145  1.00 2.25  ? 396  ASP A OD1   1 
ATOM   2991  O  OD2   . ASP A 1 395  ? -14.856 -83.821  46.023  1.00 2.95  ? 396  ASP A OD2   1 
ATOM   2992  N  N     . ASP A 1 396  ? -13.828 -87.839  43.638  1.00 2.76  ? 397  ASP A N     1 
ATOM   2993  C  CA    . ASP A 1 396  ? -12.663 -88.556  44.090  1.00 3.36  ? 397  ASP A CA    1 
ATOM   2994  C  C     . ASP A 1 396  ? -11.427 -87.687  44.243  1.00 4.15  ? 397  ASP A C     1 
ATOM   2995  O  O     . ASP A 1 396  ? -10.405 -88.186  44.685  1.00 5.09  ? 397  ASP A O     1 
ATOM   2996  C  CB    . ASP A 1 396  ? -12.381 -89.801  43.231  1.00 2.69  ? 397  ASP A CB    1 
ATOM   2997  C  CG    . ASP A 1 396  ? -12.277 -89.505  41.735  1.00 3.15  ? 397  ASP A CG    1 
ATOM   2998  O  OD1   . ASP A 1 396  ? -12.320 -88.329  41.321  1.00 3.25  ? 397  ASP A OD1   1 
ATOM   2999  O  OD2   . ASP A 1 396  ? -12.149 -90.475  40.955  1.00 2.78  ? 397  ASP A OD2   1 
ATOM   3000  N  N     . VAL A 1 397  ? -11.473 -86.401  43.893  1.00 4.94  ? 398  VAL A N     1 
ATOM   3001  C  CA    . VAL A 1 397  ? -10.258 -85.619  44.093  1.00 5.70  ? 398  VAL A CA    1 
ATOM   3002  C  C     . VAL A 1 397  ? -10.286 -84.898  45.435  1.00 6.88  ? 398  VAL A C     1 
ATOM   3003  O  O     . VAL A 1 397  ? -9.374  -85.052  46.228  1.00 8.42  ? 398  VAL A O     1 
ATOM   3004  C  CB    . VAL A 1 397  ? -9.869  -84.671  42.909  1.00 4.54  ? 398  VAL A CB    1 
ATOM   3005  C  CG1   . VAL A 1 397  ? -10.199 -85.285  41.607  1.00 3.90  ? 398  VAL A CG1   1 
ATOM   3006  C  CG2   . VAL A 1 397  ? -10.494 -83.347  43.029  1.00 4.96  ? 398  VAL A CG2   1 
ATOM   3007  N  N     . THR A 1 398  ? -11.355 -84.177  45.734  1.00 7.59  ? 399  THR A N     1 
ATOM   3008  C  CA    . THR A 1 398  ? -11.436 -83.472  46.998  1.00 8.12  ? 399  THR A CA    1 
ATOM   3009  C  C     . THR A 1 398  ? -12.111 -84.356  48.050  1.00 8.59  ? 399  THR A C     1 
ATOM   3010  O  O     . THR A 1 398  ? -11.882 -84.190  49.246  1.00 9.43  ? 399  THR A O     1 
ATOM   3011  C  CB    . THR A 1 398  ? -12.223 -82.163  46.862  1.00 8.65  ? 399  THR A CB    1 
ATOM   3012  O  OG1   . THR A 1 398  ? -12.456 -81.850  45.477  1.00 8.61  ? 399  THR A OG1   1 
ATOM   3013  C  CG2   . THR A 1 398  ? -11.437 -81.041  47.491  1.00 9.75  ? 399  THR A CG2   1 
ATOM   3014  N  N     . GLY A 1 399  ? -12.979 -85.263  47.603  1.00 8.44  ? 400  GLY A N     1 
ATOM   3015  C  CA    . GLY A 1 399  ? -13.659 -86.182  48.497  1.00 7.38  ? 400  GLY A CA    1 
ATOM   3016  C  C     . GLY A 1 399  ? -14.720 -85.525  49.328  1.00 7.48  ? 400  GLY A C     1 
ATOM   3017  O  O     . GLY A 1 399  ? -14.740 -85.649  50.551  1.00 8.46  ? 400  GLY A O     1 
ATOM   3018  N  N     . THR A 1 400  ? -15.620 -84.830  48.651  1.00 7.22  ? 401  THR A N     1 
ATOM   3019  C  CA    . THR A 1 400  ? -16.718 -84.123  49.289  1.00 6.30  ? 401  THR A CA    1 
ATOM   3020  C  C     . THR A 1 400  ? -18.073 -84.699  48.977  1.00 6.44  ? 401  THR A C     1 
ATOM   3021  O  O     . THR A 1 400  ? -19.053 -84.254  49.521  1.00 7.15  ? 401  THR A O     1 
ATOM   3022  C  CB    . THR A 1 400  ? -16.780 -82.703  48.797  1.00 5.95  ? 401  THR A CB    1 
ATOM   3023  O  OG1   . THR A 1 400  ? -16.825 -82.698  47.360  1.00 5.32  ? 401  THR A OG1   1 
ATOM   3024  C  CG2   . THR A 1 400  ? -15.595 -81.943  49.274  1.00 6.12  ? 401  THR A CG2   1 
ATOM   3025  N  N     . SER A 1 401  ? -18.150 -85.641  48.053  1.00 6.61  ? 402  SER A N     1 
ATOM   3026  C  CA    . SER A 1 401  ? -19.427 -86.215  47.673  1.00 6.43  ? 402  SER A CA    1 
ATOM   3027  C  C     . SER A 1 401  ? -19.943 -87.291  48.605  1.00 6.79  ? 402  SER A C     1 
ATOM   3028  O  O     . SER A 1 401  ? -19.187 -88.008  49.256  1.00 7.21  ? 402  SER A O     1 
ATOM   3029  C  CB    . SER A 1 401  ? -19.377 -86.736  46.236  1.00 6.28  ? 402  SER A CB    1 
ATOM   3030  O  OG    . SER A 1 401  ? -18.429 -87.769  46.110  1.00 5.54  ? 402  SER A OG    1 
ATOM   3031  N  N     . LEU A 1 402  ? -21.264 -87.351  48.688  1.00 7.18  ? 403  LEU A N     1 
ATOM   3032  C  CA    . LEU A 1 402  ? -21.995 -88.302  49.509  1.00 7.18  ? 403  LEU A CA    1 
ATOM   3033  C  C     . LEU A 1 402  ? -22.152 -89.566  48.688  1.00 8.23  ? 403  LEU A C     1 
ATOM   3034  O  O     . LEU A 1 402  ? -22.274 -89.508  47.456  1.00 9.29  ? 403  LEU A O     1 
ATOM   3035  C  CB    . LEU A 1 402  ? -23.380 -87.726  49.770  1.00 5.80  ? 403  LEU A CB    1 
ATOM   3036  C  CG    . LEU A 1 402  ? -23.795 -87.312  51.165  1.00 5.53  ? 403  LEU A CG    1 
ATOM   3037  C  CD1   . LEU A 1 402  ? -22.727 -86.489  51.866  1.00 4.93  ? 403  LEU A CD1   1 
ATOM   3038  C  CD2   . LEU A 1 402  ? -25.110 -86.579  51.054  1.00 5.38  ? 403  LEU A CD2   1 
ATOM   3039  N  N     . PRO A 1 403  ? -22.139 -90.729  49.338  1.00 8.82  ? 404  PRO A N     1 
ATOM   3040  C  CA    . PRO A 1 403  ? -22.303 -91.940  48.548  1.00 9.80  ? 404  PRO A CA    1 
ATOM   3041  C  C     . PRO A 1 403  ? -23.772 -92.029  48.190  1.00 10.83 ? 404  PRO A C     1 
ATOM   3042  O  O     . PRO A 1 403  ? -24.627 -91.464  48.871  1.00 10.96 ? 404  PRO A O     1 
ATOM   3043  C  CB    . PRO A 1 403  ? -21.941 -93.021  49.543  1.00 9.58  ? 404  PRO A CB    1 
ATOM   3044  C  CG    . PRO A 1 403  ? -22.526 -92.484  50.797  1.00 9.60  ? 404  PRO A CG    1 
ATOM   3045  C  CD    . PRO A 1 403  ? -22.023 -91.061  50.763  1.00 9.42  ? 404  PRO A CD    1 
ATOM   3046  N  N     . VAL A 1 404  ? -24.076 -92.699  47.094  1.00 11.87 ? 405  VAL A N     1 
ATOM   3047  C  CA    . VAL A 1 404  ? -25.469 -92.841  46.711  1.00 12.73 ? 405  VAL A CA    1 
ATOM   3048  C  C     . VAL A 1 404  ? -25.730 -94.295  46.418  1.00 13.17 ? 405  VAL A C     1 
ATOM   3049  O  O     . VAL A 1 404  ? -24.937 -94.975  45.767  1.00 13.54 ? 405  VAL A O     1 
ATOM   3050  C  CB    . VAL A 1 404  ? -25.844 -91.985  45.510  1.00 12.71 ? 405  VAL A CB    1 
ATOM   3051  C  CG1   . VAL A 1 404  ? -27.322 -92.072  45.286  1.00 12.66 ? 405  VAL A CG1   1 
ATOM   3052  C  CG2   . VAL A 1 404  ? -25.417 -90.537  45.741  1.00 13.19 ? 405  VAL A CG2   1 
ATOM   3053  N  N     . ASP A 1 405  ? -26.869 -94.742  46.908  1.00 14.00 ? 406  ASP A N     1 
ATOM   3054  C  CA    . ASP A 1 405  ? -27.322 -96.106  46.803  1.00 14.58 ? 406  ASP A CA    1 
ATOM   3055  C  C     . ASP A 1 405  ? -28.556 -96.158  45.918  1.00 14.95 ? 406  ASP A C     1 
ATOM   3056  O  O     . ASP A 1 405  ? -29.648 -95.746  46.331  1.00 14.98 ? 406  ASP A O     1 
ATOM   3057  C  CB    . ASP A 1 405  ? -27.658 -96.548  48.215  1.00 15.47 ? 406  ASP A CB    1 
ATOM   3058  C  CG    . ASP A 1 405  ? -28.250 -97.913  48.287  1.00 16.50 ? 406  ASP A CG    1 
ATOM   3059  O  OD1   . ASP A 1 405  ? -28.154 -98.672  47.293  1.00 17.13 ? 406  ASP A OD1   1 
ATOM   3060  O  OD2   . ASP A 1 405  ? -28.798 -98.219  49.376  1.00 17.15 ? 406  ASP A OD2   1 
ATOM   3061  N  N     . ASN A 1 406  ? -28.375 -96.663  44.703  1.00 15.33 ? 407  ASN A N     1 
ATOM   3062  C  CA    . ASN A 1 406  ? -29.460 -96.777  43.751  1.00 16.05 ? 407  ASN A CA    1 
ATOM   3063  C  C     . ASN A 1 406  ? -30.426 -97.901  44.048  1.00 16.25 ? 407  ASN A C     1 
ATOM   3064  O  O     . ASN A 1 406  ? -31.472 -97.994  43.422  1.00 17.37 ? 407  ASN A O     1 
ATOM   3065  C  CB    . ASN A 1 406  ? -28.929 -96.931  42.342  1.00 17.23 ? 407  ASN A CB    1 
ATOM   3066  C  CG    . ASN A 1 406  ? -28.354 -95.650  41.803  1.00 18.50 ? 407  ASN A CG    1 
ATOM   3067  O  OD1   . ASN A 1 406  ? -28.525 -94.573  42.396  1.00 18.35 ? 407  ASN A OD1   1 
ATOM   3068  N  ND2   . ASN A 1 406  ? -27.682 -95.746  40.649  1.00 19.11 ? 407  ASN A ND2   1 
ATOM   3069  N  N     . ALA A 1 407  ? -30.088 -98.778  44.977  1.00 15.76 ? 408  ALA A N     1 
ATOM   3070  C  CA    . ALA A 1 407  ? -31.024 -99.828  45.324  1.00 15.43 ? 408  ALA A CA    1 
ATOM   3071  C  C     . ALA A 1 407  ? -32.254 -99.197  46.001  1.00 14.91 ? 408  ALA A C     1 
ATOM   3072  O  O     . ALA A 1 407  ? -33.256 -99.867  46.199  1.00 15.27 ? 408  ALA A O     1 
ATOM   3073  C  CB    . ALA A 1 407  ? -30.367 -100.845 46.243  1.00 16.05 ? 408  ALA A CB    1 
ATOM   3074  N  N     . PHE A 1 408  ? -32.178 -97.911  46.342  1.00 14.27 ? 409  PHE A N     1 
ATOM   3075  C  CA    . PHE A 1 408  ? -33.291 -97.216  46.977  1.00 14.27 ? 409  PHE A CA    1 
ATOM   3076  C  C     . PHE A 1 408  ? -34.547 -97.508  46.183  1.00 14.60 ? 409  PHE A C     1 
ATOM   3077  O  O     . PHE A 1 408  ? -34.519 -97.556  44.962  1.00 15.16 ? 409  PHE A O     1 
ATOM   3078  C  CB    . PHE A 1 408  ? -33.053 -95.702  47.026  1.00 13.65 ? 409  PHE A CB    1 
ATOM   3079  C  CG    . PHE A 1 408  ? -34.079 -94.939  47.855  1.00 13.62 ? 409  PHE A CG    1 
ATOM   3080  C  CD1   . PHE A 1 408  ? -34.217 -95.174  49.227  1.00 13.43 ? 409  PHE A CD1   1 
ATOM   3081  C  CD2   . PHE A 1 408  ? -34.879 -93.952  47.275  1.00 13.67 ? 409  PHE A CD2   1 
ATOM   3082  C  CE1   . PHE A 1 408  ? -35.128 -94.437  50.001  1.00 12.62 ? 409  PHE A CE1   1 
ATOM   3083  C  CE2   . PHE A 1 408  ? -35.794 -93.209  48.047  1.00 12.57 ? 409  PHE A CE2   1 
ATOM   3084  C  CZ    . PHE A 1 408  ? -35.912 -93.455  49.405  1.00 12.36 ? 409  PHE A CZ    1 
ATOM   3085  N  N     . ALA A 1 409  ? -35.633 -97.762  46.894  1.00 14.70 ? 410  ALA A N     1 
ATOM   3086  C  CA    . ALA A 1 409  ? -36.911 -98.075  46.289  1.00 14.76 ? 410  ALA A CA    1 
ATOM   3087  C  C     . ALA A 1 409  ? -37.477 -96.936  45.434  1.00 15.12 ? 410  ALA A C     1 
ATOM   3088  O  O     . ALA A 1 409  ? -36.910 -95.829  45.404  1.00 15.55 ? 410  ALA A O     1 
ATOM   3089  C  CB    . ALA A 1 409  ? -37.871 -98.402  47.380  1.00 15.34 ? 410  ALA A CB    1 
ATOM   3090  N  N     . ASP A 1 410  ? -38.589 -97.225  44.739  1.00 14.80 ? 411  ASP A N     1 
ATOM   3091  C  CA    . ASP A 1 410  ? -39.292 -96.254  43.890  1.00 14.62 ? 411  ASP A CA    1 
ATOM   3092  C  C     . ASP A 1 410  ? -40.172 -95.524  44.875  1.00 13.97 ? 411  ASP A C     1 
ATOM   3093  O  O     . ASP A 1 410  ? -40.779 -96.155  45.727  1.00 14.82 ? 411  ASP A O     1 
ATOM   3094  C  CB    . ASP A 1 410  ? -40.164 -96.968  42.842  1.00 15.56 ? 411  ASP A CB    1 
ATOM   3095  C  CG    . ASP A 1 410  ? -40.779 -96.006  41.806  1.00 16.81 ? 411  ASP A CG    1 
ATOM   3096  O  OD1   . ASP A 1 410  ? -41.724 -95.260  42.164  1.00 16.55 ? 411  ASP A OD1   1 
ATOM   3097  O  OD2   . ASP A 1 410  ? -40.331 -96.012  40.627  1.00 17.47 ? 411  ASP A OD2   1 
ATOM   3098  N  N     . THR A 1 411  ? -40.296 -94.215  44.744  1.00 12.86 ? 412  THR A N     1 
ATOM   3099  C  CA    . THR A 1 411  ? -41.084 -93.476  45.698  1.00 11.92 ? 412  THR A CA    1 
ATOM   3100  C  C     . THR A 1 411  ? -42.248 -92.711  45.117  1.00 12.18 ? 412  THR A C     1 
ATOM   3101  O  O     . THR A 1 411  ? -42.843 -91.870  45.813  1.00 12.74 ? 412  THR A O     1 
ATOM   3102  C  CB    . THR A 1 411  ? -40.218 -92.500  46.447  1.00 11.52 ? 412  THR A CB    1 
ATOM   3103  O  OG1   . THR A 1 411  ? -39.749 -91.503  45.536  1.00 11.75 ? 412  THR A OG1   1 
ATOM   3104  C  CG2   . THR A 1 411  ? -39.033 -93.209  47.048  1.00 11.85 ? 412  THR A CG2   1 
ATOM   3105  N  N     . THR A 1 412  ? -42.577 -92.965  43.852  1.00 11.93 ? 413  THR A N     1 
ATOM   3106  C  CA    . THR A 1 412  ? -43.695 -92.264  43.240  1.00 11.83 ? 413  THR A CA    1 
ATOM   3107  C  C     . THR A 1 412  ? -44.987 -92.741  43.922  1.00 12.58 ? 413  THR A C     1 
ATOM   3108  O  O     . THR A 1 412  ? -45.035 -93.825  44.521  1.00 12.47 ? 413  THR A O     1 
ATOM   3109  C  CB    . THR A 1 412  ? -43.724 -92.463  41.715  1.00 11.36 ? 413  THR A CB    1 
ATOM   3110  O  OG1   . THR A 1 412  ? -43.981 -93.822  41.401  1.00 11.05 ? 413  THR A OG1   1 
ATOM   3111  C  CG2   . THR A 1 412  ? -42.387 -92.141  41.134  1.00 11.77 ? 413  THR A CG2   1 
ATOM   3112  N  N     . PRO A 1 413  ? -46.042 -91.917  43.896  1.00 13.11 ? 414  PRO A N     1 
ATOM   3113  C  CA    . PRO A 1 413  ? -47.264 -92.375  44.554  1.00 13.35 ? 414  PRO A CA    1 
ATOM   3114  C  C     . PRO A 1 413  ? -47.787 -93.707  44.036  1.00 13.42 ? 414  PRO A C     1 
ATOM   3115  O  O     . PRO A 1 413  ? -47.390 -94.191  42.979  1.00 13.05 ? 414  PRO A O     1 
ATOM   3116  C  CB    . PRO A 1 413  ? -48.243 -91.230  44.272  1.00 12.97 ? 414  PRO A CB    1 
ATOM   3117  C  CG    . PRO A 1 413  ? -47.372 -90.059  44.258  1.00 12.93 ? 414  PRO A CG    1 
ATOM   3118  C  CD    . PRO A 1 413  ? -46.228 -90.548  43.390  1.00 13.41 ? 414  PRO A CD    1 
ATOM   3119  N  N     . LYS A 1 414  ? -48.664 -94.308  44.819  1.00 13.90 ? 415  LYS A N     1 
ATOM   3120  C  CA    . LYS A 1 414  ? -49.257 -95.552  44.414  1.00 14.84 ? 415  LYS A CA    1 
ATOM   3121  C  C     . LYS A 1 414  ? -50.154 -95.265  43.210  1.00 14.89 ? 415  LYS A C     1 
ATOM   3122  O  O     . LYS A 1 414  ? -50.879 -94.262  43.178  1.00 14.85 ? 415  LYS A O     1 
ATOM   3123  C  CB    . LYS A 1 414  ? -50.084 -96.139  45.559  1.00 16.03 ? 415  LYS A CB    1 
ATOM   3124  C  CG    . LYS A 1 414  ? -49.534 -97.439  46.159  1.00 17.45 ? 415  LYS A CG    1 
ATOM   3125  C  CD    . LYS A 1 414  ? -50.698 -98.362  46.595  1.00 18.97 ? 415  LYS A CD    1 
ATOM   3126  C  CE    . LYS A 1 414  ? -50.239 -99.645  47.347  1.00 20.15 ? 415  LYS A CE    1 
ATOM   3127  N  NZ    . LYS A 1 414  ? -49.939 -99.450  48.809  1.00 20.07 ? 415  LYS A NZ    1 
ATOM   3128  N  N     . GLY A 1 415  ? -50.088 -96.148  42.219  1.00 14.95 ? 416  GLY A N     1 
ATOM   3129  C  CA    . GLY A 1 415  ? -50.909 -96.017  41.026  1.00 15.01 ? 416  GLY A CA    1 
ATOM   3130  C  C     . GLY A 1 415  ? -50.349 -94.992  40.067  1.00 14.83 ? 416  GLY A C     1 
ATOM   3131  O  O     . GLY A 1 415  ? -51.025 -94.020  39.703  1.00 15.51 ? 416  GLY A O     1 
ATOM   3132  N  N     . THR A 1 416  ? -49.113 -95.213  39.643  1.00 13.88 ? 417  THR A N     1 
ATOM   3133  C  CA    . THR A 1 416  ? -48.467 -94.282  38.749  1.00 12.72 ? 417  THR A CA    1 
ATOM   3134  C  C     . THR A 1 416  ? -47.697 -95.054  37.695  1.00 12.09 ? 417  THR A C     1 
ATOM   3135  O  O     . THR A 1 416  ? -46.852 -95.902  38.014  1.00 12.01 ? 417  THR A O     1 
ATOM   3136  C  CB    . THR A 1 416  ? -47.493 -93.334  39.505  1.00 12.64 ? 417  THR A CB    1 
ATOM   3137  O  OG1   . THR A 1 416  ? -48.150 -92.739  40.633  1.00 12.93 ? 417  THR A OG1   1 
ATOM   3138  C  CG2   . THR A 1 416  ? -47.043 -92.226  38.602  1.00 12.52 ? 417  THR A CG2   1 
ATOM   3139  N  N     . ILE A 1 417  ? -48.067 -94.817  36.442  1.00 10.94 ? 418  ILE A N     1 
ATOM   3140  C  CA    . ILE A 1 417  ? -47.399 -95.428  35.322  1.00 9.98  ? 418  ILE A CA    1 
ATOM   3141  C  C     . ILE A 1 417  ? -46.227 -94.503  34.972  1.00 10.19 ? 418  ILE A C     1 
ATOM   3142  O  O     . ILE A 1 417  ? -46.368 -93.279  34.963  1.00 10.84 ? 418  ILE A O     1 
ATOM   3143  C  CB    . ILE A 1 417  ? -48.331 -95.539  34.122  1.00 9.27  ? 418  ILE A CB    1 
ATOM   3144  C  CG1   . ILE A 1 417  ? -49.563 -96.333  34.506  1.00 8.93  ? 418  ILE A CG1   1 
ATOM   3145  C  CG2   . ILE A 1 417  ? -47.632 -96.214  32.951  1.00 9.09  ? 418  ILE A CG2   1 
ATOM   3146  C  CD1   . ILE A 1 417  ? -50.750 -95.467  34.865  1.00 9.58  ? 418  ILE A CD1   1 
ATOM   3147  N  N     . GLN A 1 418  ? -45.051 -95.079  34.776  1.00 9.59  ? 419  GLN A N     1 
ATOM   3148  C  CA    . GLN A 1 418  ? -43.889 -94.305  34.405  1.00 9.02  ? 419  GLN A CA    1 
ATOM   3149  C  C     . GLN A 1 418  ? -43.479 -94.863  33.056  1.00 9.38  ? 419  GLN A C     1 
ATOM   3150  O  O     . GLN A 1 418  ? -43.389 -96.076  32.895  1.00 9.60  ? 419  GLN A O     1 
ATOM   3151  C  CB    . GLN A 1 418  ? -42.790 -94.494  35.439  1.00 8.37  ? 419  GLN A CB    1 
ATOM   3152  C  CG    . GLN A 1 418  ? -43.136 -93.872  36.762  1.00 8.20  ? 419  GLN A CG    1 
ATOM   3153  C  CD    . GLN A 1 418  ? -42.111 -94.127  37.832  1.00 8.25  ? 419  GLN A CD    1 
ATOM   3154  O  OE1   . GLN A 1 418  ? -40.907 -93.949  37.631  1.00 8.28  ? 419  GLN A OE1   1 
ATOM   3155  N  NE2   . GLN A 1 418  ? -42.587 -94.533  38.996  1.00 8.67  ? 419  GLN A NE2   1 
ATOM   3156  N  N     . CYS A 1 419  ? -43.272 -93.984  32.080  1.00 9.36  ? 420  CYS A N     1 
ATOM   3157  C  CA    . CYS A 1 419  ? -42.893 -94.403  30.744  1.00 9.31  ? 420  CYS A CA    1 
ATOM   3158  C  C     . CYS A 1 419  ? -41.623 -93.736  30.264  1.00 9.53  ? 420  CYS A C     1 
ATOM   3159  O  O     . CYS A 1 419  ? -41.227 -92.701  30.809  1.00 10.35 ? 420  CYS A O     1 
ATOM   3160  C  CB    . CYS A 1 419  ? -44.022 -94.081  29.795  1.00 9.05  ? 420  CYS A CB    1 
ATOM   3161  S  SG    . CYS A 1 419  ? -45.563 -94.670  30.447  1.00 10.56 ? 420  CYS A SG    1 
ATOM   3162  N  N     . GLN A 1 420  ? -40.957 -94.374  29.291  1.00 9.15  ? 421  GLN A N     1 
ATOM   3163  C  CA    . GLN A 1 420  ? -39.730 -93.863  28.665  1.00 8.11  ? 421  GLN A CA    1 
ATOM   3164  C  C     . GLN A 1 420  ? -39.763 -94.301  27.228  1.00 7.80  ? 421  GLN A C     1 
ATOM   3165  O  O     . GLN A 1 420  ? -40.102 -95.446  26.937  1.00 8.04  ? 421  GLN A O     1 
ATOM   3166  C  CB    . GLN A 1 420  ? -38.483 -94.456  29.269  1.00 7.84  ? 421  GLN A CB    1 
ATOM   3167  C  CG    . GLN A 1 420  ? -38.482 -94.478  30.731  1.00 8.71  ? 421  GLN A CG    1 
ATOM   3168  C  CD    . GLN A 1 420  ? -37.192 -95.014  31.260  1.00 10.00 ? 421  GLN A CD    1 
ATOM   3169  O  OE1   . GLN A 1 420  ? -36.414 -94.269  31.853  1.00 11.46 ? 421  GLN A OE1   1 
ATOM   3170  N  NE2   . GLN A 1 420  ? -36.935 -96.311  31.040  1.00 10.64 ? 421  GLN A NE2   1 
ATOM   3171  N  N     . PHE A 1 421  ? -39.368 -93.399  26.341  1.00 7.09  ? 422  PHE A N     1 
ATOM   3172  C  CA    . PHE A 1 421  ? -39.346 -93.663  24.917  1.00 6.47  ? 422  PHE A CA    1 
ATOM   3173  C  C     . PHE A 1 421  ? -38.005 -93.271  24.341  1.00 5.93  ? 422  PHE A C     1 
ATOM   3174  O  O     . PHE A 1 421  ? -37.507 -92.171  24.546  1.00 6.24  ? 422  PHE A O     1 
ATOM   3175  C  CB    . PHE A 1 421  ? -40.405 -92.839  24.209  1.00 7.32  ? 422  PHE A CB    1 
ATOM   3176  C  CG    . PHE A 1 421  ? -41.763 -92.967  24.789  1.00 8.18  ? 422  PHE A CG    1 
ATOM   3177  C  CD1   . PHE A 1 421  ? -42.134 -92.202  25.871  1.00 8.51  ? 422  PHE A CD1   1 
ATOM   3178  C  CD2   . PHE A 1 421  ? -42.708 -93.789  24.199  1.00 9.06  ? 422  PHE A CD2   1 
ATOM   3179  C  CE1   . PHE A 1 421  ? -43.434 -92.239  26.360  1.00 9.11  ? 422  PHE A CE1   1 
ATOM   3180  C  CE2   . PHE A 1 421  ? -44.018 -93.838  24.682  1.00 9.87  ? 422  PHE A CE2   1 
ATOM   3181  C  CZ    . PHE A 1 421  ? -44.378 -93.054  25.765  1.00 9.36  ? 422  PHE A CZ    1 
ATOM   3182  N  N     . TRP A 1 422  ? -37.448 -94.152  23.548  1.00 5.18  ? 423  TRP A N     1 
ATOM   3183  C  CA    . TRP A 1 422  ? -36.180 -93.893  22.939  1.00 4.67  ? 423  TRP A CA    1 
ATOM   3184  C  C     . TRP A 1 422  ? -36.425 -93.663  21.450  1.00 4.74  ? 423  TRP A C     1 
ATOM   3185  O  O     . TRP A 1 422  ? -36.932 -94.531  20.775  1.00 5.02  ? 423  TRP A O     1 
ATOM   3186  C  CB    . TRP A 1 422  ? -35.300 -95.114  23.150  1.00 4.02  ? 423  TRP A CB    1 
ATOM   3187  C  CG    . TRP A 1 422  ? -34.795 -95.310  24.545  1.00 2.64  ? 423  TRP A CG    1 
ATOM   3188  C  CD1   . TRP A 1 422  ? -35.487 -95.790  25.619  1.00 2.05  ? 423  TRP A CD1   1 
ATOM   3189  C  CD2   . TRP A 1 422  ? -33.456 -95.078  24.999  1.00 2.61  ? 423  TRP A CD2   1 
ATOM   3190  N  NE1   . TRP A 1 422  ? -34.658 -95.879  26.717  1.00 2.12  ? 423  TRP A NE1   1 
ATOM   3191  C  CE2   . TRP A 1 422  ? -33.406 -95.442  26.366  1.00 2.47  ? 423  TRP A CE2   1 
ATOM   3192  C  CE3   . TRP A 1 422  ? -32.293 -94.587  24.383  1.00 2.00  ? 423  TRP A CE3   1 
ATOM   3193  C  CZ2   . TRP A 1 422  ? -32.233 -95.326  27.134  1.00 2.12  ? 423  TRP A CZ2   1 
ATOM   3194  C  CZ3   . TRP A 1 422  ? -31.130 -94.468  25.147  1.00 2.08  ? 423  TRP A CZ3   1 
ATOM   3195  C  CH2   . TRP A 1 422  ? -31.109 -94.835  26.507  1.00 2.00  ? 423  TRP A CH2   1 
ATOM   3196  N  N     . GLY A 1 423  ? -36.037 -92.517  20.920  1.00 5.08  ? 424  GLY A N     1 
ATOM   3197  C  CA    . GLY A 1 423  ? -36.269 -92.279  19.509  1.00 5.79  ? 424  GLY A CA    1 
ATOM   3198  C  C     . GLY A 1 423  ? -35.169 -91.550  18.771  1.00 6.15  ? 424  GLY A C     1 
ATOM   3199  O  O     . GLY A 1 423  ? -34.215 -91.095  19.365  1.00 6.17  ? 424  GLY A O     1 
ATOM   3200  N  N     . LEU A 1 424  ? -35.299 -91.485  17.456  1.00 6.74  ? 425  LEU A N     1 
ATOM   3201  C  CA    . LEU A 1 424  ? -34.347 -90.800  16.593  1.00 7.42  ? 425  LEU A CA    1 
ATOM   3202  C  C     . LEU A 1 424  ? -34.903 -89.405  16.354  1.00 8.11  ? 425  LEU A C     1 
ATOM   3203  O  O     . LEU A 1 424  ? -36.122 -89.208  16.386  1.00 8.45  ? 425  LEU A O     1 
ATOM   3204  C  CB    . LEU A 1 424  ? -34.272 -91.519  15.263  1.00 7.52  ? 425  LEU A CB    1 
ATOM   3205  C  CG    . LEU A 1 424  ? -33.256 -91.032  14.257  1.00 7.15  ? 425  LEU A CG    1 
ATOM   3206  C  CD1   . LEU A 1 424  ? -31.861 -91.399  14.743  1.00 7.34  ? 425  LEU A CD1   1 
ATOM   3207  C  CD2   . LEU A 1 424  ? -33.573 -91.712  12.944  1.00 7.06  ? 425  LEU A CD2   1 
ATOM   3208  N  N     . GLY A 1 425  ? -34.035 -88.432  16.112  1.00 8.57  ? 426  GLY A N     1 
ATOM   3209  C  CA    . GLY A 1 425  ? -34.536 -87.091  15.887  1.00 9.40  ? 426  GLY A CA    1 
ATOM   3210  C  C     . GLY A 1 425  ? -35.467 -87.044  14.686  1.00 10.29 ? 426  GLY A C     1 
ATOM   3211  O  O     . GLY A 1 425  ? -35.222 -87.737  13.694  1.00 10.58 ? 426  GLY A O     1 
ATOM   3212  N  N     . ALA A 1 426  ? -36.565 -86.298  14.802  1.00 10.46 ? 427  ALA A N     1 
ATOM   3213  C  CA    . ALA A 1 426  ? -37.521 -86.122  13.706  1.00 10.89 ? 427  ALA A CA    1 
ATOM   3214  C  C     . ALA A 1 426  ? -38.310 -87.352  13.199  1.00 11.34 ? 427  ALA A C     1 
ATOM   3215  O  O     . ALA A 1 426  ? -38.596 -87.508  11.983  1.00 11.44 ? 427  ALA A O     1 
ATOM   3216  C  CB    . ALA A 1 426  ? -36.873 -85.350  12.546  1.00 10.31 ? 427  ALA A CB    1 
ATOM   3217  N  N     . ASP A 1 427  ? -38.620 -88.244  14.142  1.00 11.30 ? 428  ASP A N     1 
ATOM   3218  C  CA    . ASP A 1 427  ? -39.460 -89.397  13.864  1.00 10.98 ? 428  ASP A CA    1 
ATOM   3219  C  C     . ASP A 1 427  ? -40.817 -89.110  14.521  1.00 10.96 ? 428  ASP A C     1 
ATOM   3220  O  O     . ASP A 1 427  ? -41.721 -89.940  14.519  1.00 11.87 ? 428  ASP A O     1 
ATOM   3221  C  CB    . ASP A 1 427  ? -38.842 -90.727  14.342  1.00 11.18 ? 428  ASP A CB    1 
ATOM   3222  C  CG    . ASP A 1 427  ? -38.534 -90.774  15.833  1.00 11.74 ? 428  ASP A CG    1 
ATOM   3223  O  OD1   . ASP A 1 427  ? -38.834 -89.818  16.575  1.00 12.81 ? 428  ASP A OD1   1 
ATOM   3224  O  OD2   . ASP A 1 427  ? -37.951 -91.798  16.264  1.00 12.35 ? 428  ASP A OD2   1 
ATOM   3225  N  N     . GLY A 1 428  ? -40.954 -87.910  15.075  1.00 10.43 ? 429  GLY A N     1 
ATOM   3226  C  CA    . GLY A 1 428  ? -42.197 -87.530  15.709  1.00 9.30  ? 429  GLY A CA    1 
ATOM   3227  C  C     . GLY A 1 428  ? -42.448 -88.121  17.080  1.00 8.41  ? 429  GLY A C     1 
ATOM   3228  O  O     . GLY A 1 428  ? -43.513 -87.903  17.643  1.00 8.76  ? 429  GLY A O     1 
ATOM   3229  N  N     . THR A 1 429  ? -41.486 -88.839  17.646  1.00 7.53  ? 430  THR A N     1 
ATOM   3230  C  CA    . THR A 1 429  ? -41.696 -89.424  18.963  1.00 6.42  ? 430  THR A CA    1 
ATOM   3231  C  C     . THR A 1 429  ? -42.115 -88.383  19.989  1.00 6.07  ? 430  THR A C     1 
ATOM   3232  O  O     . THR A 1 429  ? -43.198 -88.477  20.560  1.00 6.12  ? 430  THR A O     1 
ATOM   3233  C  CB    . THR A 1 429  ? -40.462 -90.160  19.459  1.00 6.17  ? 430  THR A CB    1 
ATOM   3234  O  OG1   . THR A 1 429  ? -40.293 -91.370  18.705  1.00 6.07  ? 430  THR A OG1   1 
ATOM   3235  C  CG2   . THR A 1 429  ? -40.610 -90.500  20.924  1.00 6.27  ? 430  THR A CG2   1 
ATOM   3236  N  N     . VAL A 1 430  ? -41.273 -87.372  20.192  1.00 5.42  ? 431  VAL A N     1 
ATOM   3237  C  CA    . VAL A 1 430  ? -41.554 -86.313  21.152  1.00 4.25  ? 431  VAL A CA    1 
ATOM   3238  C  C     . VAL A 1 430  ? -42.921 -85.681  20.868  1.00 4.12  ? 431  VAL A C     1 
ATOM   3239  O  O     . VAL A 1 430  ? -43.745 -85.520  21.767  1.00 3.92  ? 431  VAL A O     1 
ATOM   3240  C  CB    . VAL A 1 430  ? -40.425 -85.273  21.153  1.00 3.74  ? 431  VAL A CB    1 
ATOM   3241  C  CG1   . VAL A 1 430  ? -40.920 -83.964  21.667  1.00 4.77  ? 431  VAL A CG1   1 
ATOM   3242  C  CG2   . VAL A 1 430  ? -39.273 -85.743  22.026  1.00 2.78  ? 431  VAL A CG2   1 
ATOM   3243  N  N     . GLY A 1 431  ? -43.193 -85.376  19.609  1.00 4.17  ? 432  GLY A N     1 
ATOM   3244  C  CA    . GLY A 1 431  ? -44.481 -84.800  19.291  1.00 4.51  ? 432  GLY A CA    1 
ATOM   3245  C  C     . GLY A 1 431  ? -45.562 -85.707  19.834  1.00 5.10  ? 432  GLY A C     1 
ATOM   3246  O  O     . GLY A 1 431  ? -46.307 -85.315  20.724  1.00 5.51  ? 432  GLY A O     1 
ATOM   3247  N  N     . ALA A 1 432  ? -45.566 -86.963  19.387  1.00 5.52  ? 433  ALA A N     1 
ATOM   3248  C  CA    . ALA A 1 432  ? -46.559 -87.939  19.824  1.00 5.90  ? 433  ALA A CA    1 
ATOM   3249  C  C     . ALA A 1 432  ? -46.679 -87.919  21.336  1.00 6.32  ? 433  ALA A C     1 
ATOM   3250  O  O     . ALA A 1 432  ? -47.788 -87.821  21.853  1.00 6.89  ? 433  ALA A O     1 
ATOM   3251  C  CB    . ALA A 1 432  ? -46.224 -89.333  19.326  1.00 5.18  ? 433  ALA A CB    1 
ATOM   3252  N  N     . ASN A 1 433  ? -45.541 -87.880  22.033  1.00 6.11  ? 434  ASN A N     1 
ATOM   3253  C  CA    . ASN A 1 433  ? -45.543 -87.858  23.484  1.00 5.43  ? 434  ASN A CA    1 
ATOM   3254  C  C     . ASN A 1 433  ? -46.309 -86.684  23.980  1.00 5.72  ? 434  ASN A C     1 
ATOM   3255  O  O     . ASN A 1 433  ? -47.175 -86.868  24.805  1.00 6.12  ? 434  ASN A O     1 
ATOM   3256  C  CB    . ASN A 1 433  ? -44.141 -87.799  24.064  1.00 4.94  ? 434  ASN A CB    1 
ATOM   3257  C  CG    . ASN A 1 433  ? -43.355 -89.038  23.788  1.00 4.38  ? 434  ASN A CG    1 
ATOM   3258  O  OD1   . ASN A 1 433  ? -43.917 -90.096  23.493  1.00 4.53  ? 434  ASN A OD1   1 
ATOM   3259  N  ND2   . ASN A 1 433  ? -42.035 -88.923  23.873  1.00 3.68  ? 434  ASN A ND2   1 
ATOM   3260  N  N     . LYS A 1 434  ? -46.017 -85.482  23.482  1.00 6.15  ? 435  LYS A N     1 
ATOM   3261  C  CA    . LYS A 1 434  ? -46.739 -84.278  23.927  1.00 6.94  ? 435  LYS A CA    1 
ATOM   3262  C  C     . LYS A 1 434  ? -48.220 -84.386  23.629  1.00 7.96  ? 435  LYS A C     1 
ATOM   3263  O  O     . LYS A 1 434  ? -49.044 -83.842  24.356  1.00 8.38  ? 435  LYS A O     1 
ATOM   3264  C  CB    . LYS A 1 434  ? -46.191 -83.013  23.268  1.00 5.95  ? 435  LYS A CB    1 
ATOM   3265  C  CG    . LYS A 1 434  ? -44.784 -82.683  23.689  1.00 6.13  ? 435  LYS A CG    1 
ATOM   3266  C  CD    . LYS A 1 434  ? -44.240 -81.460  23.004  1.00 5.16  ? 435  LYS A CD    1 
ATOM   3267  C  CE    . LYS A 1 434  ? -42.771 -81.366  23.323  1.00 6.76  ? 435  LYS A CE    1 
ATOM   3268  N  NZ    . LYS A 1 434  ? -41.976 -80.302  22.632  1.00 8.03  ? 435  LYS A NZ    1 
ATOM   3269  N  N     . GLN A 1 435  ? -48.549 -85.108  22.567  1.00 9.09  ? 436  GLN A N     1 
ATOM   3270  C  CA    . GLN A 1 435  ? -49.923 -85.304  22.181  1.00 10.66 ? 436  GLN A CA    1 
ATOM   3271  C  C     . GLN A 1 435  ? -50.606 -86.232  23.182  1.00 10.69 ? 436  GLN A C     1 
ATOM   3272  O  O     . GLN A 1 435  ? -51.624 -85.892  23.757  1.00 11.13 ? 436  GLN A O     1 
ATOM   3273  C  CB    . GLN A 1 435  ? -49.978 -85.904  20.781  1.00 13.25 ? 436  GLN A CB    1 
ATOM   3274  C  CG    . GLN A 1 435  ? -50.411 -84.956  19.646  1.00 16.39 ? 436  GLN A CG    1 
ATOM   3275  C  CD    . GLN A 1 435  ? -51.918 -84.647  19.652  1.00 18.74 ? 436  GLN A CD    1 
ATOM   3276  O  OE1   . GLN A 1 435  ? -52.735 -85.446  20.133  1.00 19.94 ? 436  GLN A OE1   1 
ATOM   3277  N  NE2   . GLN A 1 435  ? -52.289 -83.484  19.106  1.00 20.36 ? 436  GLN A NE2   1 
ATOM   3278  N  N     . ALA A 1 436  ? -50.019 -87.390  23.436  1.00 10.45 ? 437  ALA A N     1 
ATOM   3279  C  CA    . ALA A 1 436  ? -50.592 -88.345  24.367  1.00 10.19 ? 437  ALA A CA    1 
ATOM   3280  C  C     . ALA A 1 436  ? -50.823 -87.730  25.724  1.00 10.77 ? 437  ALA A C     1 
ATOM   3281  O  O     . ALA A 1 436  ? -51.567 -88.266  26.529  1.00 10.97 ? 437  ALA A O     1 
ATOM   3282  C  CB    . ALA A 1 436  ? -49.693 -89.531  24.501  1.00 9.77  ? 437  ALA A CB    1 
ATOM   3283  N  N     . ILE A 1 437  ? -50.181 -86.605  25.993  1.00 11.64 ? 438  ILE A N     1 
ATOM   3284  C  CA    . ILE A 1 437  ? -50.346 -85.984  27.286  1.00 12.69 ? 438  ILE A CA    1 
ATOM   3285  C  C     . ILE A 1 437  ? -51.574 -85.109  27.246  1.00 13.33 ? 438  ILE A C     1 
ATOM   3286  O  O     . ILE A 1 437  ? -52.384 -85.154  28.162  1.00 14.33 ? 438  ILE A O     1 
ATOM   3287  C  CB    . ILE A 1 437  ? -49.083 -85.212  27.733  1.00 12.90 ? 438  ILE A CB    1 
ATOM   3288  C  CG1   . ILE A 1 437  ? -47.863 -86.130  27.653  1.00 12.82 ? 438  ILE A CG1   1 
ATOM   3289  C  CG2   . ILE A 1 437  ? -49.186 -84.831  29.189  1.00 13.03 ? 438  ILE A CG2   1 
ATOM   3290  C  CD1   . ILE A 1 437  ? -46.589 -85.514  28.174  1.00 12.76 ? 438  ILE A CD1   1 
ATOM   3291  N  N     . LYS A 1 438  ? -51.744 -84.342  26.173  1.00 13.86 ? 439  LYS A N     1 
ATOM   3292  C  CA    . LYS A 1 438  ? -52.934 -83.488  26.029  1.00 13.95 ? 439  LYS A CA    1 
ATOM   3293  C  C     . LYS A 1 438  ? -54.154 -84.418  26.049  1.00 13.22 ? 439  LYS A C     1 
ATOM   3294  O  O     . LYS A 1 438  ? -55.075 -84.238  26.842  1.00 13.01 ? 439  LYS A O     1 
ATOM   3295  C  CB    . LYS A 1 438  ? -52.895 -82.721  24.696  1.00 14.86 ? 439  LYS A CB    1 
ATOM   3296  C  CG    . LYS A 1 438  ? -52.982 -81.204  24.827  1.00 16.98 ? 439  LYS A CG    1 
ATOM   3297  C  CD    . LYS A 1 438  ? -51.707 -80.465  24.312  1.00 18.96 ? 439  LYS A CD    1 
ATOM   3298  C  CE    . LYS A 1 438  ? -50.469 -80.613  25.249  1.00 19.91 ? 439  LYS A CE    1 
ATOM   3299  N  NZ    . LYS A 1 438  ? -49.257 -79.774  24.881  1.00 20.71 ? 439  LYS A NZ    1 
ATOM   3300  N  N     . ILE A 1 439  ? -54.090 -85.471  25.236  1.00 11.99 ? 440  ILE A N     1 
ATOM   3301  C  CA    . ILE A 1 439  ? -55.159 -86.452  25.127  1.00 10.93 ? 440  ILE A CA    1 
ATOM   3302  C  C     . ILE A 1 439  ? -55.529 -87.104  26.464  1.00 11.06 ? 440  ILE A C     1 
ATOM   3303  O  O     . ILE A 1 439  ? -56.700 -87.115  26.859  1.00 10.98 ? 440  ILE A O     1 
ATOM   3304  C  CB    . ILE A 1 439  ? -54.782 -87.546  24.118  1.00 9.91  ? 440  ILE A CB    1 
ATOM   3305  C  CG1   . ILE A 1 439  ? -54.745 -86.974  22.709  1.00 9.49  ? 440  ILE A CG1   1 
ATOM   3306  C  CG2   . ILE A 1 439  ? -55.767 -88.662  24.173  1.00 9.47  ? 440  ILE A CG2   1 
ATOM   3307  C  CD1   . ILE A 1 439  ? -54.424 -87.994  21.672  1.00 9.22  ? 440  ILE A CD1   1 
ATOM   3308  N  N     . ILE A 1 440  ? -54.538 -87.663  27.153  1.00 10.78 ? 441  ILE A N     1 
ATOM   3309  C  CA    . ILE A 1 440  ? -54.793 -88.307  28.422  1.00 10.57 ? 441  ILE A CA    1 
ATOM   3310  C  C     . ILE A 1 440  ? -55.259 -87.234  29.386  1.00 11.65 ? 441  ILE A C     1 
ATOM   3311  O  O     . ILE A 1 440  ? -56.436 -87.184  29.723  1.00 12.48 ? 441  ILE A O     1 
ATOM   3312  C  CB    . ILE A 1 440  ? -53.555 -89.087  28.896  1.00 9.66  ? 441  ILE A CB    1 
ATOM   3313  C  CG1   . ILE A 1 440  ? -53.287 -90.209  27.897  1.00 8.98  ? 441  ILE A CG1   1 
ATOM   3314  C  CG2   . ILE A 1 440  ? -53.761 -89.655  30.285  1.00 8.64  ? 441  ILE A CG2   1 
ATOM   3315  C  CD1   . ILE A 1 440  ? -52.098 -90.995  28.195  1.00 8.85  ? 441  ILE A CD1   1 
ATOM   3316  N  N     . GLY A 1 441  ? -54.394 -86.289  29.716  1.00 12.26 ? 442  GLY A N     1 
ATOM   3317  C  CA    . GLY A 1 441  ? -54.791 -85.222  30.621  1.00 13.37 ? 442  GLY A CA    1 
ATOM   3318  C  C     . GLY A 1 441  ? -56.129 -84.518  30.397  1.00 14.20 ? 442  GLY A C     1 
ATOM   3319  O  O     . GLY A 1 441  ? -56.750 -84.102  31.367  1.00 14.41 ? 442  GLY A O     1 
ATOM   3320  N  N     . ASP A 1 442  ? -56.591 -84.405  29.152  1.00 15.10 ? 443  ASP A N     1 
ATOM   3321  C  CA    . ASP A 1 442  ? -57.855 -83.721  28.841  1.00 16.33 ? 443  ASP A CA    1 
ATOM   3322  C  C     . ASP A 1 442  ? -59.100 -84.608  28.847  1.00 16.91 ? 443  ASP A C     1 
ATOM   3323  O  O     . ASP A 1 442  ? -60.224 -84.095  28.820  1.00 17.05 ? 443  ASP A O     1 
ATOM   3324  C  CB    . ASP A 1 442  ? -57.818 -83.093  27.435  1.00 17.69 ? 443  ASP A CB    1 
ATOM   3325  C  CG    . ASP A 1 442  ? -56.773 -81.986  27.264  1.00 19.52 ? 443  ASP A CG    1 
ATOM   3326  O  OD1   . ASP A 1 442  ? -55.938 -81.717  28.166  1.00 20.30 ? 443  ASP A OD1   1 
ATOM   3327  O  OD2   . ASP A 1 442  ? -56.784 -81.391  26.157  1.00 20.04 ? 443  ASP A OD2   1 
ATOM   3328  N  N     . ASN A 1 443  ? -58.912 -85.926  28.806  1.00 17.38 ? 444  ASN A N     1 
ATOM   3329  C  CA    . ASN A 1 443  ? -60.042 -86.860  28.730  1.00 17.57 ? 444  ASN A CA    1 
ATOM   3330  C  C     . ASN A 1 443  ? -60.091 -87.873  29.869  1.00 17.42 ? 444  ASN A C     1 
ATOM   3331  O  O     . ASN A 1 443  ? -60.828 -88.880  29.822  1.00 17.05 ? 444  ASN A O     1 
ATOM   3332  C  CB    . ASN A 1 443  ? -60.007 -87.584  27.383  1.00 18.01 ? 444  ASN A CB    1 
ATOM   3333  C  CG    . ASN A 1 443  ? -60.163 -86.635  26.204  1.00 18.33 ? 444  ASN A CG    1 
ATOM   3334  O  OD1   . ASN A 1 443  ? -61.266 -86.197  25.893  1.00 19.14 ? 444  ASN A OD1   1 
ATOM   3335  N  ND2   . ASN A 1 443  ? -59.062 -86.330  25.535  1.00 18.24 ? 444  ASN A ND2   1 
ATOM   3336  N  N     . THR A 1 444  ? -59.254 -87.619  30.863  1.00 16.65 ? 445  THR A N     1 
ATOM   3337  C  CA    . THR A 1 444  ? -59.167 -88.445  32.052  1.00 16.49 ? 445  THR A CA    1 
ATOM   3338  C  C     . THR A 1 444  ? -58.840 -87.405  33.104  1.00 17.17 ? 445  THR A C     1 
ATOM   3339  O  O     . THR A 1 444  ? -58.568 -86.261  32.745  1.00 17.79 ? 445  THR A O     1 
ATOM   3340  C  CB    . THR A 1 444  ? -57.987 -89.418  31.977  1.00 15.74 ? 445  THR A CB    1 
ATOM   3341  O  OG1   . THR A 1 444  ? -56.759 -88.681  32.045  1.00 15.23 ? 445  THR A OG1   1 
ATOM   3342  C  CG2   . THR A 1 444  ? -58.035 -90.234  30.698  1.00 14.62 ? 445  THR A CG2   1 
ATOM   3343  N  N     . ASP A 1 445  ? -58.932 -87.740  34.389  1.00 17.41 ? 446  ASP A N     1 
ATOM   3344  C  CA    . ASP A 1 445  ? -58.549 -86.744  35.380  1.00 17.75 ? 446  ASP A CA    1 
ATOM   3345  C  C     . ASP A 1 445  ? -57.345 -87.202  36.236  1.00 16.11 ? 446  ASP A C     1 
ATOM   3346  O  O     . ASP A 1 445  ? -57.255 -87.000  37.438  1.00 16.18 ? 446  ASP A O     1 
ATOM   3347  C  CB    . ASP A 1 445  ? -59.767 -86.104  36.118  1.00 20.77 ? 446  ASP A CB    1 
ATOM   3348  C  CG    . ASP A 1 445  ? -60.336 -86.958  37.262  1.00 23.50 ? 446  ASP A CG    1 
ATOM   3349  O  OD1   . ASP A 1 445  ? -60.077 -88.186  37.319  1.00 25.80 ? 446  ASP A OD1   1 
ATOM   3350  O  OD2   . ASP A 1 445  ? -61.055 -86.376  38.120  1.00 24.38 ? 446  ASP A OD2   1 
ATOM   3351  N  N     . LEU A 1 446  ? -56.384 -87.761  35.508  1.00 14.24 ? 447  LEU A N     1 
ATOM   3352  C  CA    . LEU A 1 446  ? -55.110 -88.262  36.003  1.00 12.12 ? 447  LEU A CA    1 
ATOM   3353  C  C     . LEU A 1 446  ? -54.101 -87.155  35.764  1.00 11.86 ? 447  LEU A C     1 
ATOM   3354  O  O     . LEU A 1 446  ? -54.227 -86.411  34.791  1.00 12.09 ? 447  LEU A O     1 
ATOM   3355  C  CB    . LEU A 1 446  ? -54.643 -89.415  35.118  1.00 10.45 ? 447  LEU A CB    1 
ATOM   3356  C  CG    . LEU A 1 446  ? -55.235 -90.805  35.144  1.00 8.70  ? 447  LEU A CG    1 
ATOM   3357  C  CD1   . LEU A 1 446  ? -54.583 -91.629  34.066  1.00 8.07  ? 447  LEU A CD1   1 
ATOM   3358  C  CD2   . LEU A 1 446  ? -54.963 -91.392  36.489  1.00 8.69  ? 447  LEU A CD2   1 
ATOM   3359  N  N     . PHE A 1 447  ? -53.049 -87.101  36.574  1.00 11.18 ? 448  PHE A N     1 
ATOM   3360  C  CA    . PHE A 1 447  ? -52.011 -86.091  36.389  1.00 10.19 ? 448  PHE A CA    1 
ATOM   3361  C  C     . PHE A 1 447  ? -51.026 -86.613  35.362  1.00 9.98  ? 448  PHE A C     1 
ATOM   3362  O  O     . PHE A 1 447  ? -50.722 -87.792  35.343  1.00 10.82 ? 448  PHE A O     1 
ATOM   3363  C  CB    . PHE A 1 447  ? -51.326 -85.790  37.698  1.00 8.94  ? 448  PHE A CB    1 
ATOM   3364  C  CG    . PHE A 1 447  ? -52.247 -85.263  38.733  1.00 8.40  ? 448  PHE A CG    1 
ATOM   3365  C  CD1   . PHE A 1 447  ? -52.948 -86.126  39.563  1.00 8.58  ? 448  PHE A CD1   1 
ATOM   3366  C  CD2   . PHE A 1 447  ? -52.401 -83.907  38.903  1.00 8.22  ? 448  PHE A CD2   1 
ATOM   3367  C  CE1   . PHE A 1 447  ? -53.787 -85.640  40.555  1.00 8.03  ? 448  PHE A CE1   1 
ATOM   3368  C  CE2   . PHE A 1 447  ? -53.238 -83.404  39.895  1.00 8.02  ? 448  PHE A CE2   1 
ATOM   3369  C  CZ    . PHE A 1 447  ? -53.928 -84.275  40.722  1.00 7.96  ? 448  PHE A CZ    1 
ATOM   3370  N  N     . ALA A 1 448  ? -50.573 -85.745  34.472  1.00 9.33  ? 449  ALA A N     1 
ATOM   3371  C  CA    . ALA A 1 448  ? -49.662 -86.155  33.426  1.00 8.37  ? 449  ALA A CA    1 
ATOM   3372  C  C     . ALA A 1 448  ? -48.404 -85.339  33.553  1.00 8.02  ? 449  ALA A C     1 
ATOM   3373  O  O     . ALA A 1 448  ? -48.461 -84.160  33.893  1.00 9.17  ? 449  ALA A O     1 
ATOM   3374  C  CB    . ALA A 1 448  ? -50.288 -85.917  32.096  1.00 8.00  ? 449  ALA A CB    1 
ATOM   3375  N  N     . GLN A 1 449  ? -47.258 -85.950  33.311  1.00 6.28  ? 450  GLN A N     1 
ATOM   3376  C  CA    . GLN A 1 449  ? -46.028 -85.204  33.407  1.00 4.41  ? 450  GLN A CA    1 
ATOM   3377  C  C     . GLN A 1 449  ? -45.189 -85.674  32.282  1.00 4.16  ? 450  GLN A C     1 
ATOM   3378  O  O     . GLN A 1 449  ? -45.238 -86.840  31.933  1.00 4.42  ? 450  GLN A O     1 
ATOM   3379  C  CB    . GLN A 1 449  ? -45.312 -85.502  34.696  1.00 3.45  ? 450  GLN A CB    1 
ATOM   3380  C  CG    . GLN A 1 449  ? -44.131 -84.638  34.861  1.00 2.27  ? 450  GLN A CG    1 
ATOM   3381  C  CD    . GLN A 1 449  ? -43.162 -85.197  35.818  1.00 2.09  ? 450  GLN A CD    1 
ATOM   3382  O  OE1   . GLN A 1 449  ? -42.752 -86.346  35.694  1.00 2.00  ? 450  GLN A OE1   1 
ATOM   3383  N  NE2   . GLN A 1 449  ? -42.748 -84.383  36.777  1.00 2.26  ? 450  GLN A NE2   1 
ATOM   3384  N  N     . GLY A 1 450  ? -44.403 -84.773  31.721  1.00 3.83  ? 451  GLY A N     1 
ATOM   3385  C  CA    . GLY A 1 450  ? -43.557 -85.139  30.613  1.00 3.87  ? 451  GLY A CA    1 
ATOM   3386  C  C     . GLY A 1 450  ? -42.269 -84.349  30.622  1.00 3.75  ? 451  GLY A C     1 
ATOM   3387  O  O     . GLY A 1 450  ? -42.291 -83.142  30.798  1.00 3.97  ? 451  GLY A O     1 
ATOM   3388  N  N     . TYR A 1 451  ? -41.154 -85.041  30.423  1.00 3.55  ? 452  TYR A N     1 
ATOM   3389  C  CA    . TYR A 1 451  ? -39.846 -84.427  30.406  1.00 3.62  ? 452  TYR A CA    1 
ATOM   3390  C  C     . TYR A 1 451  ? -39.111 -85.100  29.277  1.00 3.82  ? 452  TYR A C     1 
ATOM   3391  O  O     . TYR A 1 451  ? -39.177 -86.314  29.137  1.00 3.18  ? 452  TYR A O     1 
ATOM   3392  C  CB    . TYR A 1 451  ? -39.145 -84.675  31.731  1.00 3.84  ? 452  TYR A CB    1 
ATOM   3393  C  CG    . TYR A 1 451  ? -37.847 -83.944  31.837  1.00 4.17  ? 452  TYR A CG    1 
ATOM   3394  C  CD1   . TYR A 1 451  ? -37.811 -82.564  31.991  1.00 3.88  ? 452  TYR A CD1   1 
ATOM   3395  C  CD2   . TYR A 1 451  ? -36.650 -84.625  31.753  1.00 4.61  ? 452  TYR A CD2   1 
ATOM   3396  C  CE1   . TYR A 1 451  ? -36.607 -81.877  32.055  1.00 4.10  ? 452  TYR A CE1   1 
ATOM   3397  C  CE2   . TYR A 1 451  ? -35.438 -83.953  31.813  1.00 5.14  ? 452  TYR A CE2   1 
ATOM   3398  C  CZ    . TYR A 1 451  ? -35.420 -82.581  31.961  1.00 4.50  ? 452  TYR A CZ    1 
ATOM   3399  O  OH    . TYR A 1 451  ? -34.201 -81.942  31.968  1.00 4.13  ? 452  TYR A OH    1 
ATOM   3400  N  N     . PHE A 1 452  ? -38.384 -84.320  28.489  1.00 5.03  ? 453  PHE A N     1 
ATOM   3401  C  CA    . PHE A 1 452  ? -37.687 -84.865  27.327  1.00 6.77  ? 453  PHE A CA    1 
ATOM   3402  C  C     . PHE A 1 452  ? -36.163 -84.639  27.270  1.00 7.81  ? 453  PHE A C     1 
ATOM   3403  O  O     . PHE A 1 452  ? -35.698 -83.512  27.222  1.00 7.95  ? 453  PHE A O     1 
ATOM   3404  C  CB    . PHE A 1 452  ? -38.329 -84.305  26.043  1.00 7.24  ? 453  PHE A CB    1 
ATOM   3405  C  CG    . PHE A 1 452  ? -39.818 -84.597  25.904  1.00 8.60  ? 453  PHE A CG    1 
ATOM   3406  C  CD1   . PHE A 1 452  ? -40.262 -85.830  25.431  1.00 8.90  ? 453  PHE A CD1   1 
ATOM   3407  C  CD2   . PHE A 1 452  ? -40.778 -83.645  26.266  1.00 9.03  ? 453  PHE A CD2   1 
ATOM   3408  C  CE1   . PHE A 1 452  ? -41.636 -86.108  25.325  1.00 9.34  ? 453  PHE A CE1   1 
ATOM   3409  C  CE2   . PHE A 1 452  ? -42.166 -83.915  26.161  1.00 8.95  ? 453  PHE A CE2   1 
ATOM   3410  C  CZ    . PHE A 1 452  ? -42.591 -85.138  25.695  1.00 8.99  ? 453  PHE A CZ    1 
ATOM   3411  N  N     . SER A 1 453  ? -35.391 -85.721  27.323  1.00 9.10  ? 454  SER A N     1 
ATOM   3412  C  CA    . SER A 1 453  ? -33.938 -85.639  27.217  1.00 10.71 ? 454  SER A CA    1 
ATOM   3413  C  C     . SER A 1 453  ? -33.647 -85.517  25.747  1.00 11.68 ? 454  SER A C     1 
ATOM   3414  O  O     . SER A 1 453  ? -34.243 -86.222  24.922  1.00 12.03 ? 454  SER A O     1 
ATOM   3415  C  CB    . SER A 1 453  ? -33.278 -86.907  27.721  1.00 11.35 ? 454  SER A CB    1 
ATOM   3416  O  OG    . SER A 1 453  ? -32.896 -86.749  29.064  1.00 12.97 ? 454  SER A OG    1 
ATOM   3417  N  N     . TYR A 1 454  ? -32.712 -84.655  25.399  1.00 12.88 ? 455  TYR A N     1 
ATOM   3418  C  CA    . TYR A 1 454  ? -32.419 -84.474  24.003  1.00 14.42 ? 455  TYR A CA    1 
ATOM   3419  C  C     . TYR A 1 454  ? -31.056 -84.968  23.602  1.00 15.98 ? 455  TYR A C     1 
ATOM   3420  O  O     . TYR A 1 454  ? -30.509 -85.892  24.233  1.00 16.69 ? 455  TYR A O     1 
ATOM   3421  C  CB    . TYR A 1 454  ? -32.631 -83.030  23.593  1.00 14.10 ? 455  TYR A CB    1 
ATOM   3422  C  CG    . TYR A 1 454  ? -34.073 -82.694  23.334  1.00 14.17 ? 455  TYR A CG    1 
ATOM   3423  C  CD1   . TYR A 1 454  ? -34.615 -82.830  22.068  1.00 14.35 ? 455  TYR A CD1   1 
ATOM   3424  C  CD2   . TYR A 1 454  ? -34.894 -82.201  24.355  1.00 14.89 ? 455  TYR A CD2   1 
ATOM   3425  C  CE1   . TYR A 1 454  ? -35.940 -82.480  21.808  1.00 15.06 ? 455  TYR A CE1   1 
ATOM   3426  C  CE2   . TYR A 1 454  ? -36.233 -81.850  24.113  1.00 14.99 ? 455  TYR A CE2   1 
ATOM   3427  C  CZ    . TYR A 1 454  ? -36.747 -81.989  22.833  1.00 15.30 ? 455  TYR A CZ    1 
ATOM   3428  O  OH    . TYR A 1 454  ? -38.061 -81.649  22.573  1.00 16.36 ? 455  TYR A OH    1 
ATOM   3429  N  N     . ASP A 1 455  ? -30.520 -84.370  22.537  1.00 17.23 ? 456  ASP A N     1 
ATOM   3430  C  CA    . ASP A 1 455  ? -29.226 -84.759  21.986  1.00 18.20 ? 456  ASP A CA    1 
ATOM   3431  C  C     . ASP A 1 455  ? -28.484 -83.503  21.533  1.00 18.12 ? 456  ASP A C     1 
ATOM   3432  O  O     . ASP A 1 455  ? -29.106 -82.565  21.009  1.00 18.09 ? 456  ASP A O     1 
ATOM   3433  C  CB    . ASP A 1 455  ? -29.492 -85.690  20.785  1.00 19.57 ? 456  ASP A CB    1 
ATOM   3434  C  CG    . ASP A 1 455  ? -28.253 -86.436  20.313  1.00 20.65 ? 456  ASP A CG    1 
ATOM   3435  O  OD1   . ASP A 1 455  ? -27.444 -85.801  19.637  1.00 21.07 ? 456  ASP A OD1   1 
ATOM   3436  O  OD2   . ASP A 1 455  ? -28.101 -87.660  20.564  1.00 21.07 ? 456  ASP A OD2   1 
ATOM   3437  N  N     . SER A 1 456  ? -27.168 -83.465  21.748  1.00 17.79 ? 457  SER A N     1 
ATOM   3438  C  CA    . SER A 1 456  ? -26.388 -82.308  21.312  1.00 17.29 ? 457  SER A CA    1 
ATOM   3439  C  C     . SER A 1 456  ? -26.170 -82.360  19.793  1.00 16.65 ? 457  SER A C     1 
ATOM   3440  O  O     . SER A 1 456  ? -25.921 -81.313  19.168  1.00 16.37 ? 457  SER A O     1 
ATOM   3441  C  CB    . SER A 1 456  ? -25.052 -82.197  22.055  1.00 17.37 ? 457  SER A CB    1 
ATOM   3442  O  OG    . SER A 1 456  ? -24.648 -80.826  22.114  1.00 18.75 ? 457  SER A OG    1 
ATOM   3443  N  N     . LYS A 1 457  ? -26.259 -83.573  19.220  1.00 15.65 ? 458  LYS A N     1 
ATOM   3444  C  CA    . LYS A 1 457  ? -26.123 -83.785  17.773  1.00 15.21 ? 458  LYS A CA    1 
ATOM   3445  C  C     . LYS A 1 457  ? -27.376 -83.286  17.121  1.00 15.23 ? 458  LYS A C     1 
ATOM   3446  O  O     . LYS A 1 457  ? -28.477 -83.780  17.403  1.00 15.06 ? 458  LYS A O     1 
ATOM   3447  C  CB    . LYS A 1 457  ? -25.977 -85.252  17.383  1.00 14.93 ? 458  LYS A CB    1 
ATOM   3448  C  CG    . LYS A 1 457  ? -24.760 -85.928  17.939  1.00 15.18 ? 458  LYS A CG    1 
ATOM   3449  C  CD    . LYS A 1 457  ? -23.547 -85.429  17.235  1.00 14.55 ? 458  LYS A CD    1 
ATOM   3450  C  CE    . LYS A 1 457  ? -22.400 -85.315  18.168  1.00 14.32 ? 458  LYS A CE    1 
ATOM   3451  N  NZ    . LYS A 1 457  ? -21.286 -85.969  17.465  1.00 15.40 ? 458  LYS A NZ    1 
ATOM   3452  N  N     . LYS A 1 458  ? -27.182 -82.348  16.199  1.00 15.21 ? 459  LYS A N     1 
ATOM   3453  C  CA    . LYS A 1 458  ? -28.270 -81.718  15.470  1.00 15.08 ? 459  LYS A CA    1 
ATOM   3454  C  C     . LYS A 1 458  ? -28.937 -82.631  14.428  1.00 15.03 ? 459  LYS A C     1 
ATOM   3455  O  O     . LYS A 1 458  ? -30.155 -82.561  14.209  1.00 15.48 ? 459  LYS A O     1 
ATOM   3456  C  CB    . LYS A 1 458  ? -27.765 -80.404  14.867  1.00 14.78 ? 459  LYS A CB    1 
ATOM   3457  C  CG    . LYS A 1 458  ? -27.445 -79.357  15.932  1.00 14.85 ? 459  LYS A CG    1 
ATOM   3458  C  CD    . LYS A 1 458  ? -26.522 -78.251  15.408  1.00 15.19 ? 459  LYS A CD    1 
ATOM   3459  C  CE    . LYS A 1 458  ? -26.387 -77.080  16.393  1.00 14.05 ? 459  LYS A CE    1 
ATOM   3460  N  NZ    . LYS A 1 458  ? -27.184 -75.895  15.989  1.00 13.69 ? 459  LYS A NZ    1 
ATOM   3461  N  N     . SER A 1 459  ? -28.166 -83.501  13.794  1.00 14.49 ? 460  SER A N     1 
ATOM   3462  C  CA    . SER A 1 459  ? -28.791 -84.384  12.839  1.00 14.02 ? 460  SER A CA    1 
ATOM   3463  C  C     . SER A 1 459  ? -28.674 -85.802  13.361  1.00 13.51 ? 460  SER A C     1 
ATOM   3464  O  O     . SER A 1 459  ? -27.642 -86.170  13.922  1.00 13.28 ? 460  SER A O     1 
ATOM   3465  C  CB    . SER A 1 459  ? -28.170 -84.220  11.450  1.00 14.42 ? 460  SER A CB    1 
ATOM   3466  O  OG    . SER A 1 459  ? -29.171 -84.301  10.442  1.00 14.41 ? 460  SER A OG    1 
ATOM   3467  N  N     . GLY A 1 460  ? -29.802 -86.518  13.316  1.00 13.02 ? 461  GLY A N     1 
ATOM   3468  C  CA    . GLY A 1 460  ? -29.888 -87.908  13.747  1.00 12.04 ? 461  GLY A CA    1 
ATOM   3469  C  C     . GLY A 1 460  ? -29.601 -88.205  15.201  1.00 11.30 ? 461  GLY A C     1 
ATOM   3470  O  O     . GLY A 1 460  ? -29.346 -89.352  15.558  1.00 11.42 ? 461  GLY A O     1 
ATOM   3471  N  N     . GLY A 1 461  ? -29.637 -87.175  16.034  1.00 10.89 ? 462  GLY A N     1 
ATOM   3472  C  CA    . GLY A 1 461  ? -29.365 -87.343  17.447  1.00 10.76 ? 462  GLY A CA    1 
ATOM   3473  C  C     . GLY A 1 461  ? -30.445 -88.143  18.137  1.00 11.00 ? 462  GLY A C     1 
ATOM   3474  O  O     . GLY A 1 461  ? -31.595 -88.150  17.687  1.00 11.40 ? 462  GLY A O     1 
ATOM   3475  N  N     . ILE A 1 462  ? -30.088 -88.828  19.224  1.00 10.88 ? 463  ILE A N     1 
ATOM   3476  C  CA    . ILE A 1 462  ? -31.064 -89.629  19.958  1.00 10.72 ? 463  ILE A CA    1 
ATOM   3477  C  C     . ILE A 1 462  ? -31.945 -88.708  20.770  1.00 10.91 ? 463  ILE A C     1 
ATOM   3478  O  O     . ILE A 1 462  ? -31.736 -87.496  20.800  1.00 11.40 ? 463  ILE A O     1 
ATOM   3479  C  CB    . ILE A 1 462  ? -30.423 -90.726  20.859  1.00 10.35 ? 463  ILE A CB    1 
ATOM   3480  C  CG1   . ILE A 1 462  ? -30.367 -90.293  22.310  1.00 10.40 ? 463  ILE A CG1   1 
ATOM   3481  C  CG2   . ILE A 1 462  ? -28.992 -91.003  20.444  1.00 11.26 ? 463  ILE A CG2   1 
ATOM   3482  C  CD1   . ILE A 1 462  ? -29.742 -91.343  23.172  1.00 10.86 ? 463  ILE A CD1   1 
ATOM   3483  N  N     . THR A 1 463  ? -32.953 -89.274  21.412  1.00 10.99 ? 464  THR A N     1 
ATOM   3484  C  CA    . THR A 1 463  ? -33.880 -88.488  22.197  1.00 10.24 ? 464  THR A CA    1 
ATOM   3485  C  C     . THR A 1 463  ? -34.646 -89.463  23.042  1.00 9.60  ? 464  THR A C     1 
ATOM   3486  O  O     . THR A 1 463  ? -35.230 -90.414  22.528  1.00 9.82  ? 464  THR A O     1 
ATOM   3487  C  CB    . THR A 1 463  ? -34.840 -87.716  21.281  1.00 10.54 ? 464  THR A CB    1 
ATOM   3488  O  OG1   . THR A 1 463  ? -34.162 -86.573  20.722  1.00 10.80 ? 464  THR A OG1   1 
ATOM   3489  C  CG2   . THR A 1 463  ? -36.058 -87.265  22.049  1.00 11.19 ? 464  THR A CG2   1 
ATOM   3490  N  N     . ILE A 1 464  ? -34.597 -89.254  24.350  1.00 8.47  ? 465  ILE A N     1 
ATOM   3491  C  CA    . ILE A 1 464  ? -35.298 -90.132  25.267  1.00 7.24  ? 465  ILE A CA    1 
ATOM   3492  C  C     . ILE A 1 464  ? -36.292 -89.297  26.041  1.00 6.39  ? 465  ILE A C     1 
ATOM   3493  O  O     . ILE A 1 464  ? -35.937 -88.248  26.558  1.00 6.38  ? 465  ILE A O     1 
ATOM   3494  C  CB    . ILE A 1 464  ? -34.317 -90.876  26.185  1.00 6.92  ? 465  ILE A CB    1 
ATOM   3495  C  CG1   . ILE A 1 464  ? -34.874 -90.967  27.593  1.00 7.26  ? 465  ILE A CG1   1 
ATOM   3496  C  CG2   . ILE A 1 464  ? -32.968 -90.211  26.180  1.00 7.13  ? 465  ILE A CG2   1 
ATOM   3497  C  CD1   . ILE A 1 464  ? -36.069 -91.852  27.725  1.00 7.73  ? 465  ILE A CD1   1 
ATOM   3498  N  N     . SER A 1 465  ? -37.531 -89.777  26.104  1.00 5.16  ? 466  SER A N     1 
ATOM   3499  C  CA    . SER A 1 465  ? -38.627 -89.090  26.768  1.00 4.50  ? 466  SER A CA    1 
ATOM   3500  C  C     . SER A 1 465  ? -39.039 -89.749  28.078  1.00 4.63  ? 466  SER A C     1 
ATOM   3501  O  O     . SER A 1 465  ? -38.942 -90.959  28.217  1.00 5.75  ? 466  SER A O     1 
ATOM   3502  C  CB    . SER A 1 465  ? -39.850 -89.122  25.858  1.00 3.78  ? 466  SER A CB    1 
ATOM   3503  O  OG    . SER A 1 465  ? -39.563 -88.639  24.571  1.00 3.68  ? 466  SER A OG    1 
ATOM   3504  N  N     . HIS A 1 466  ? -39.539 -88.981  29.035  1.00 3.81  ? 467  HIS A N     1 
ATOM   3505  C  CA    . HIS A 1 466  ? -39.999 -89.588  30.259  1.00 3.18  ? 467  HIS A CA    1 
ATOM   3506  C  C     . HIS A 1 466  ? -41.368 -89.072  30.505  1.00 3.60  ? 467  HIS A C     1 
ATOM   3507  O  O     . HIS A 1 466  ? -41.523 -87.872  30.697  1.00 3.96  ? 467  HIS A O     1 
ATOM   3508  C  CB    . HIS A 1 466  ? -39.122 -89.188  31.410  1.00 2.60  ? 467  HIS A CB    1 
ATOM   3509  C  CG    . HIS A 1 466  ? -37.717 -89.606  31.229  1.00 2.00  ? 467  HIS A CG    1 
ATOM   3510  N  ND1   . HIS A 1 466  ? -36.920 -89.066  30.254  1.00 2.00  ? 467  HIS A ND1   1 
ATOM   3511  C  CD2   . HIS A 1 466  ? -36.994 -90.584  31.812  1.00 2.04  ? 467  HIS A CD2   1 
ATOM   3512  C  CE1   . HIS A 1 466  ? -35.766 -89.701  30.230  1.00 2.00  ? 467  HIS A CE1   1 
ATOM   3513  N  NE2   . HIS A 1 466  ? -35.784 -90.629  31.166  1.00 2.31  ? 467  HIS A NE2   1 
ATOM   3514  N  N     . LEU A 1 467  ? -42.366 -89.949  30.455  1.00 3.61  ? 468  LEU A N     1 
ATOM   3515  C  CA    . LEU A 1 467  ? -43.751 -89.546  30.706  1.00 3.80  ? 468  LEU A CA    1 
ATOM   3516  C  C     . LEU A 1 467  ? -44.248 -90.191  31.989  1.00 4.12  ? 468  LEU A C     1 
ATOM   3517  O  O     . LEU A 1 467  ? -43.733 -91.214  32.399  1.00 4.67  ? 468  LEU A O     1 
ATOM   3518  C  CB    . LEU A 1 467  ? -44.661 -89.969  29.568  1.00 3.46  ? 468  LEU A CB    1 
ATOM   3519  C  CG    . LEU A 1 467  ? -44.447 -89.438  28.166  1.00 3.41  ? 468  LEU A CG    1 
ATOM   3520  C  CD1   . LEU A 1 467  ? -45.786 -89.073  27.602  1.00 3.48  ? 468  LEU A CD1   1 
ATOM   3521  C  CD2   . LEU A 1 467  ? -43.588 -88.236  28.208  1.00 4.34  ? 468  LEU A CD2   1 
ATOM   3522  N  N     . ARG A 1 468  ? -45.253 -89.610  32.618  1.00 4.46  ? 469  ARG A N     1 
ATOM   3523  C  CA    . ARG A 1 468  ? -45.779 -90.178  33.846  1.00 5.83  ? 469  ARG A CA    1 
ATOM   3524  C  C     . ARG A 1 468  ? -47.216 -89.806  34.034  1.00 6.88  ? 469  ARG A C     1 
ATOM   3525  O  O     . ARG A 1 468  ? -47.592 -88.642  33.875  1.00 7.92  ? 469  ARG A O     1 
ATOM   3526  C  CB    . ARG A 1 468  ? -45.017 -89.696  35.070  1.00 5.64  ? 469  ARG A CB    1 
ATOM   3527  C  CG    . ARG A 1 468  ? -43.753 -90.444  35.344  1.00 5.91  ? 469  ARG A CG    1 
ATOM   3528  C  CD    . ARG A 1 468  ? -43.218 -90.024  36.676  1.00 6.17  ? 469  ARG A CD    1 
ATOM   3529  N  NE    . ARG A 1 468  ? -41.920 -89.374  36.577  1.00 6.34  ? 469  ARG A NE    1 
ATOM   3530  C  CZ    . ARG A 1 468  ? -40.807 -89.906  37.047  1.00 7.38  ? 469  ARG A CZ    1 
ATOM   3531  N  NH1   . ARG A 1 468  ? -40.847 -91.098  37.621  1.00 9.25  ? 469  ARG A NH1   1 
ATOM   3532  N  NH2   . ARG A 1 468  ? -39.681 -89.220  37.044  1.00 7.28  ? 469  ARG A NH2   1 
ATOM   3533  N  N     . PHE A 1 469  ? -48.014 -90.789  34.418  1.00 7.00  ? 470  PHE A N     1 
ATOM   3534  C  CA    . PHE A 1 469  ? -49.419 -90.584  34.634  1.00 7.47  ? 470  PHE A CA    1 
ATOM   3535  C  C     . PHE A 1 469  ? -49.719 -91.214  35.969  1.00 8.97  ? 470  PHE A C     1 
ATOM   3536  O  O     . PHE A 1 469  ? -49.042 -92.150  36.383  1.00 9.56  ? 470  PHE A O     1 
ATOM   3537  C  CB    . PHE A 1 469  ? -50.202 -91.259  33.517  1.00 6.00  ? 470  PHE A CB    1 
ATOM   3538  C  CG    . PHE A 1 469  ? -49.730 -90.881  32.157  1.00 5.30  ? 470  PHE A CG    1 
ATOM   3539  C  CD1   . PHE A 1 469  ? -48.647 -91.522  31.581  1.00 5.11  ? 470  PHE A CD1   1 
ATOM   3540  C  CD2   . PHE A 1 469  ? -50.334 -89.855  31.459  1.00 5.25  ? 470  PHE A CD2   1 
ATOM   3541  C  CE1   . PHE A 1 469  ? -48.177 -91.139  30.341  1.00 4.82  ? 470  PHE A CE1   1 
ATOM   3542  C  CE2   . PHE A 1 469  ? -49.866 -89.463  30.206  1.00 4.70  ? 470  PHE A CE2   1 
ATOM   3543  C  CZ    . PHE A 1 469  ? -48.788 -90.105  29.651  1.00 4.48  ? 470  PHE A CZ    1 
ATOM   3544  N  N     . GLY A 1 470  ? -50.700 -90.668  36.668  1.00 10.35 ? 471  GLY A N     1 
ATOM   3545  C  CA    . GLY A 1 470  ? -51.065 -91.204  37.961  1.00 12.52 ? 471  GLY A CA    1 
ATOM   3546  C  C     . GLY A 1 470  ? -52.261 -90.478  38.537  1.00 13.94 ? 471  GLY A C     1 
ATOM   3547  O  O     . GLY A 1 470  ? -52.555 -89.345  38.160  1.00 13.93 ? 471  GLY A O     1 
ATOM   3548  N  N     . GLU A 1 471  ? -52.961 -91.147  39.445  1.00 15.29 ? 472  GLU A N     1 
ATOM   3549  C  CA    . GLU A 1 471  ? -54.124 -90.561  40.082  1.00 16.36 ? 472  GLU A CA    1 
ATOM   3550  C  C     . GLU A 1 471  ? -53.743 -89.430  41.050  1.00 15.60 ? 472  GLU A C     1 
ATOM   3551  O  O     . GLU A 1 471  ? -54.538 -88.510  41.288  1.00 15.98 ? 472  GLU A O     1 
ATOM   3552  C  CB    . GLU A 1 471  ? -54.969 -91.653  40.754  1.00 18.58 ? 472  GLU A CB    1 
ATOM   3553  C  CG    . GLU A 1 471  ? -54.185 -92.883  41.225  1.00 22.19 ? 472  GLU A CG    1 
ATOM   3554  C  CD    . GLU A 1 471  ? -55.009 -94.185  41.195  1.00 24.66 ? 472  GLU A CD    1 
ATOM   3555  O  OE1   . GLU A 1 471  ? -55.669 -94.470  40.150  1.00 25.34 ? 472  GLU A OE1   1 
ATOM   3556  O  OE2   . GLU A 1 471  ? -54.971 -94.940  42.211  1.00 25.66 ? 472  GLU A OE2   1 
ATOM   3557  N  N     . LYS A 1 472  ? -52.499 -89.453  41.525  1.00 14.41 ? 473  LYS A N     1 
ATOM   3558  C  CA    . LYS A 1 472  ? -51.995 -88.435  42.452  1.00 13.40 ? 473  LYS A CA    1 
ATOM   3559  C  C     . LYS A 1 472  ? -51.078 -87.415  41.777  1.00 11.85 ? 473  LYS A C     1 
ATOM   3560  O  O     . LYS A 1 472  ? -50.451 -87.718  40.768  1.00 11.58 ? 473  LYS A O     1 
ATOM   3561  C  CB    . LYS A 1 472  ? -51.251 -89.103  43.602  1.00 14.71 ? 473  LYS A CB    1 
ATOM   3562  C  CG    . LYS A 1 472  ? -52.157 -89.828  44.570  1.00 16.66 ? 473  LYS A CG    1 
ATOM   3563  C  CD    . LYS A 1 472  ? -51.853 -89.414  46.017  1.00 18.49 ? 473  LYS A CD    1 
ATOM   3564  C  CE    . LYS A 1 472  ? -52.854 -90.014  47.013  1.00 19.39 ? 473  LYS A CE    1 
ATOM   3565  N  NZ    . LYS A 1 472  ? -54.233 -89.423  46.892  1.00 19.58 ? 473  LYS A NZ    1 
ATOM   3566  N  N     . PRO A 1 473  ? -50.999 -86.183  42.319  1.00 10.51 ? 474  PRO A N     1 
ATOM   3567  C  CA    . PRO A 1 473  ? -50.138 -85.176  41.712  1.00 9.21  ? 474  PRO A CA    1 
ATOM   3568  C  C     . PRO A 1 473  ? -48.731 -85.695  41.741  1.00 8.35  ? 474  PRO A C     1 
ATOM   3569  O  O     . PRO A 1 473  ? -48.304 -86.326  42.718  1.00 7.66  ? 474  PRO A O     1 
ATOM   3570  C  CB    . PRO A 1 473  ? -50.334 -83.967  42.612  1.00 8.95  ? 474  PRO A CB    1 
ATOM   3571  C  CG    . PRO A 1 473  ? -50.617 -84.561  43.911  1.00 9.99  ? 474  PRO A CG    1 
ATOM   3572  C  CD    . PRO A 1 473  ? -51.592 -85.647  43.553  1.00 10.74 ? 474  PRO A CD    1 
ATOM   3573  N  N     . ILE A 1 474  ? -48.069 -85.487  40.605  1.00 7.56  ? 475  ILE A N     1 
ATOM   3574  C  CA    . ILE A 1 474  ? -46.716 -85.950  40.336  1.00 6.33  ? 475  ILE A CA    1 
ATOM   3575  C  C     . ILE A 1 474  ? -45.624 -84.968  40.729  1.00 6.08  ? 475  ILE A C     1 
ATOM   3576  O  O     . ILE A 1 474  ? -45.363 -83.983  40.028  1.00 6.15  ? 475  ILE A O     1 
ATOM   3577  C  CB    . ILE A 1 474  ? -46.606 -86.372  38.846  1.00 5.47  ? 475  ILE A CB    1 
ATOM   3578  C  CG1   . ILE A 1 474  ? -47.637 -87.461  38.570  1.00 4.52  ? 475  ILE A CG1   1 
ATOM   3579  C  CG2   . ILE A 1 474  ? -45.217 -86.910  38.516  1.00 5.59  ? 475  ILE A CG2   1 
ATOM   3580  C  CD1   . ILE A 1 474  ? -47.598 -87.988  37.193  1.00 4.97  ? 475  ILE A CD1   1 
ATOM   3581  N  N     . GLN A 1 475  ? -44.970 -85.271  41.849  1.00 5.92  ? 476  GLN A N     1 
ATOM   3582  C  CA    . GLN A 1 475  ? -43.901 -84.438  42.383  1.00 5.27  ? 476  GLN A CA    1 
ATOM   3583  C  C     . GLN A 1 475  ? -42.544 -84.968  42.022  1.00 5.29  ? 476  GLN A C     1 
ATOM   3584  O  O     . GLN A 1 475  ? -41.554 -84.585  42.629  1.00 5.66  ? 476  GLN A O     1 
ATOM   3585  C  CB    . GLN A 1 475  ? -43.978 -84.400  43.895  1.00 4.58  ? 476  GLN A CB    1 
ATOM   3586  C  CG    . GLN A 1 475  ? -45.240 -83.847  44.430  1.00 4.45  ? 476  GLN A CG    1 
ATOM   3587  C  CD    . GLN A 1 475  ? -45.090 -83.463  45.861  1.00 4.77  ? 476  GLN A CD    1 
ATOM   3588  O  OE1   . GLN A 1 475  ? -45.077 -84.315  46.734  1.00 5.86  ? 476  GLN A OE1   1 
ATOM   3589  N  NE2   . GLN A 1 475  ? -44.916 -82.174  46.117  1.00 5.19  ? 476  GLN A NE2   1 
ATOM   3590  N  N     . SER A 1 476  ? -42.484 -85.857  41.048  1.00 5.16  ? 477  SER A N     1 
ATOM   3591  C  CA    . SER A 1 476  ? -41.214 -86.442  40.673  1.00 5.35  ? 477  SER A CA    1 
ATOM   3592  C  C     . SER A 1 476  ? -40.471 -85.590  39.668  1.00 5.09  ? 477  SER A C     1 
ATOM   3593  O  O     . SER A 1 476  ? -40.621 -85.749  38.452  1.00 5.04  ? 477  SER A O     1 
ATOM   3594  C  CB    . SER A 1 476  ? -41.431 -87.842  40.124  1.00 5.85  ? 477  SER A CB    1 
ATOM   3595  O  OG    . SER A 1 476  ? -42.475 -88.470  40.837  1.00 6.25  ? 477  SER A OG    1 
ATOM   3596  N  N     . THR A 1 477  ? -39.690 -84.652  40.180  1.00 4.80  ? 478  THR A N     1 
ATOM   3597  C  CA    . THR A 1 477  ? -38.910 -83.804  39.301  1.00 4.74  ? 478  THR A CA    1 
ATOM   3598  C  C     . THR A 1 477  ? -37.542 -84.450  39.128  1.00 4.59  ? 478  THR A C     1 
ATOM   3599  O  O     . THR A 1 477  ? -36.535 -83.966  39.649  1.00 4.09  ? 478  THR A O     1 
ATOM   3600  C  CB    . THR A 1 477  ? -38.804 -82.354  39.826  1.00 4.17  ? 478  THR A CB    1 
ATOM   3601  O  OG1   . THR A 1 477  ? -38.166 -82.332  41.101  1.00 4.96  ? 478  THR A OG1   1 
ATOM   3602  C  CG2   . THR A 1 477  ? -40.169 -81.754  39.964  1.00 3.69  ? 478  THR A CG2   1 
ATOM   3603  N  N     . TYR A 1 478  ? -37.560 -85.611  38.479  1.00 4.59  ? 479  TYR A N     1 
ATOM   3604  C  CA    . TYR A 1 478  ? -36.364 -86.397  38.189  1.00 5.15  ? 479  TYR A CA    1 
ATOM   3605  C  C     . TYR A 1 478  ? -36.716 -87.361  37.054  1.00 6.13  ? 479  TYR A C     1 
ATOM   3606  O  O     . TYR A 1 478  ? -37.888 -87.519  36.726  1.00 6.32  ? 479  TYR A O     1 
ATOM   3607  C  CB    . TYR A 1 478  ? -35.844 -87.136  39.435  1.00 4.04  ? 479  TYR A CB    1 
ATOM   3608  C  CG    . TYR A 1 478  ? -36.820 -88.076  40.116  1.00 3.30  ? 479  TYR A CG    1 
ATOM   3609  C  CD1   . TYR A 1 478  ? -37.683 -87.624  41.128  1.00 2.91  ? 479  TYR A CD1   1 
ATOM   3610  C  CD2   . TYR A 1 478  ? -36.881 -89.410  39.753  1.00 2.34  ? 479  TYR A CD2   1 
ATOM   3611  C  CE1   . TYR A 1 478  ? -38.587 -88.491  41.748  1.00 2.92  ? 479  TYR A CE1   1 
ATOM   3612  C  CE2   . TYR A 1 478  ? -37.769 -90.271  40.354  1.00 2.46  ? 479  TYR A CE2   1 
ATOM   3613  C  CZ    . TYR A 1 478  ? -38.621 -89.818  41.350  1.00 3.00  ? 479  TYR A CZ    1 
ATOM   3614  O  OH    . TYR A 1 478  ? -39.492 -90.728  41.910  1.00 2.99  ? 479  TYR A OH    1 
ATOM   3615  N  N     . LEU A 1 479  ? -35.707 -87.931  36.400  1.00 7.14  ? 480  LEU A N     1 
ATOM   3616  C  CA    . LEU A 1 479  ? -35.930 -88.823  35.267  1.00 7.89  ? 480  LEU A CA    1 
ATOM   3617  C  C     . LEU A 1 479  ? -36.545 -90.113  35.728  1.00 9.08  ? 480  LEU A C     1 
ATOM   3618  O  O     . LEU A 1 479  ? -36.477 -90.431  36.908  1.00 9.84  ? 480  LEU A O     1 
ATOM   3619  C  CB    . LEU A 1 479  ? -34.621 -89.089  34.533  1.00 7.46  ? 480  LEU A CB    1 
ATOM   3620  C  CG    . LEU A 1 479  ? -33.982 -87.875  33.861  1.00 7.31  ? 480  LEU A CG    1 
ATOM   3621  C  CD1   . LEU A 1 479  ? -32.598 -88.239  33.420  1.00 7.06  ? 480  LEU A CD1   1 
ATOM   3622  C  CD2   . LEU A 1 479  ? -34.821 -87.393  32.671  1.00 7.49  ? 480  LEU A CD2   1 
ATOM   3623  N  N     . VAL A 1 480  ? -37.155 -90.855  34.811  1.00 9.95  ? 481  VAL A N     1 
ATOM   3624  C  CA    . VAL A 1 480  ? -37.795 -92.115  35.179  1.00 11.45 ? 481  VAL A CA    1 
ATOM   3625  C  C     . VAL A 1 480  ? -36.753 -93.210  35.284  1.00 12.61 ? 481  VAL A C     1 
ATOM   3626  O  O     . VAL A 1 480  ? -35.934 -93.315  34.384  1.00 13.25 ? 481  VAL A O     1 
ATOM   3627  C  CB    . VAL A 1 480  ? -38.829 -92.550  34.113  1.00 10.73 ? 481  VAL A CB    1 
ATOM   3628  C  CG1   . VAL A 1 480  ? -39.519 -93.807  34.530  1.00 10.52 ? 481  VAL A CG1   1 
ATOM   3629  C  CG2   . VAL A 1 480  ? -39.849 -91.478  33.898  1.00 10.83 ? 481  VAL A CG2   1 
ATOM   3630  N  N     . ASN A 1 481  ? -36.722 -93.967  36.390  1.00 14.08 ? 482  ASN A N     1 
ATOM   3631  C  CA    . ASN A 1 481  ? -35.778 -95.100  36.502  1.00 15.44 ? 482  ASN A CA    1 
ATOM   3632  C  C     . ASN A 1 481  ? -36.448 -96.460  36.523  1.00 15.42 ? 482  ASN A C     1 
ATOM   3633  O  O     . ASN A 1 481  ? -35.961 -97.401  35.931  1.00 15.85 ? 482  ASN A O     1 
ATOM   3634  C  CB    . ASN A 1 481  ? -34.788 -94.988  37.669  1.00 16.94 ? 482  ASN A CB    1 
ATOM   3635  C  CG    . ASN A 1 481  ? -35.354 -94.259  38.859  1.00 18.67 ? 482  ASN A CG    1 
ATOM   3636  O  OD1   . ASN A 1 481  ? -36.432 -94.593  39.367  1.00 19.92 ? 482  ASN A OD1   1 
ATOM   3637  N  ND2   . ASN A 1 481  ? -34.622 -93.242  39.319  1.00 19.27 ? 482  ASN A ND2   1 
ATOM   3638  N  N     . ARG A 1 482  ? -37.558 -96.581  37.213  1.00 15.59 ? 483  ARG A N     1 
ATOM   3639  C  CA    . ARG A 1 482  ? -38.251 -97.848  37.237  1.00 16.23 ? 483  ARG A CA    1 
ATOM   3640  C  C     . ARG A 1 482  ? -39.385 -97.725  36.229  1.00 15.81 ? 483  ARG A C     1 
ATOM   3641  O  O     . ARG A 1 482  ? -40.522 -97.404  36.611  1.00 16.53 ? 483  ARG A O     1 
ATOM   3642  C  CB    . ARG A 1 482  ? -38.851 -98.102  38.615  1.00 18.12 ? 483  ARG A CB    1 
ATOM   3643  C  CG    . ARG A 1 482  ? -37.929 -97.821  39.777  1.00 20.58 ? 483  ARG A CG    1 
ATOM   3644  C  CD    . ARG A 1 482  ? -36.813 -98.838  39.880  1.00 22.60 ? 483  ARG A CD    1 
ATOM   3645  N  NE    . ARG A 1 482  ? -36.244 -98.790  41.222  1.00 23.71 ? 483  ARG A NE    1 
ATOM   3646  C  CZ    . ARG A 1 482  ? -35.084 -99.328  41.572  1.00 24.39 ? 483  ARG A CZ    1 
ATOM   3647  N  NH1   . ARG A 1 482  ? -34.326 -99.955  40.678  1.00 24.97 ? 483  ARG A NH1   1 
ATOM   3648  N  NH2   . ARG A 1 482  ? -34.719 -99.296  42.846  1.00 25.70 ? 483  ARG A NH2   1 
ATOM   3649  N  N     . ALA A 1 483  ? -39.090 -97.972  34.954  1.00 14.60 ? 484  ALA A N     1 
ATOM   3650  C  CA    . ALA A 1 483  ? -40.099 -97.879  33.899  1.00 12.99 ? 484  ALA A CA    1 
ATOM   3651  C  C     . ALA A 1 483  ? -41.093 -99.019  33.862  1.00 12.07 ? 484  ALA A C     1 
ATOM   3652  O  O     . ALA A 1 483  ? -40.742 -100.183 34.059  1.00 11.70 ? 484  ALA A O     1 
ATOM   3653  C  CB    . ALA A 1 483  ? -39.433 -97.758  32.556  1.00 12.84 ? 484  ALA A CB    1 
ATOM   3654  N  N     . ASP A 1 484  ? -42.349 -98.665  33.619  1.00 11.51 ? 485  ASP A N     1 
ATOM   3655  C  CA    . ASP A 1 484  ? -43.428 -99.638  33.487  1.00 10.32 ? 485  ASP A CA    1 
ATOM   3656  C  C     . ASP A 1 484  ? -43.468 -100.059 32.022  1.00 9.18  ? 485  ASP A C     1 
ATOM   3657  O  O     . ASP A 1 484  ? -43.553 -101.244 31.722  1.00 9.53  ? 485  ASP A O     1 
ATOM   3658  C  CB    . ASP A 1 484  ? -44.772 -99.027  33.873  1.00 10.92 ? 485  ASP A CB    1 
ATOM   3659  C  CG    . ASP A 1 484  ? -44.978 -98.966  35.373  1.00 11.78 ? 485  ASP A CG    1 
ATOM   3660  O  OD1   . ASP A 1 484  ? -45.360 -99.994  35.988  1.00 12.29 ? 485  ASP A OD1   1 
ATOM   3661  O  OD2   . ASP A 1 484  ? -44.773 -97.878  35.948  1.00 12.80 ? 485  ASP A OD2   1 
ATOM   3662  N  N     . TYR A 1 485  ? -43.327 -99.085  31.122  1.00 7.60  ? 486  TYR A N     1 
ATOM   3663  C  CA    . TYR A 1 485  ? -43.350 -99.302  29.677  1.00 6.31  ? 486  TYR A CA    1 
ATOM   3664  C  C     . TYR A 1 485  ? -42.169 -98.569  29.034  1.00 5.87  ? 486  TYR A C     1 
ATOM   3665  O  O     . TYR A 1 485  ? -42.047 -97.364  29.187  1.00 6.69  ? 486  TYR A O     1 
ATOM   3666  C  CB    . TYR A 1 485  ? -44.681 -98.767  29.131  1.00 5.73  ? 486  TYR A CB    1 
ATOM   3667  C  CG    . TYR A 1 485  ? -44.795 -98.657  27.632  1.00 5.03  ? 486  TYR A CG    1 
ATOM   3668  C  CD1   . TYR A 1 485  ? -44.330 -97.533  26.975  1.00 5.31  ? 486  TYR A CD1   1 
ATOM   3669  C  CD2   . TYR A 1 485  ? -45.411 -99.647  26.876  1.00 4.85  ? 486  TYR A CD2   1 
ATOM   3670  C  CE1   . TYR A 1 485  ? -44.473 -97.383  25.603  1.00 5.74  ? 486  TYR A CE1   1 
ATOM   3671  C  CE2   . TYR A 1 485  ? -45.561 -99.511  25.499  1.00 4.89  ? 486  TYR A CE2   1 
ATOM   3672  C  CZ    . TYR A 1 485  ? -45.089 -98.371  24.867  1.00 5.73  ? 486  TYR A CZ    1 
ATOM   3673  O  OH    . TYR A 1 485  ? -45.218 -98.173  23.506  1.00 6.00  ? 486  TYR A OH    1 
ATOM   3674  N  N     . VAL A 1 486  ? -41.276 -99.286  28.360  1.00 5.03  ? 487  VAL A N     1 
ATOM   3675  C  CA    . VAL A 1 486  ? -40.130 -98.651  27.703  1.00 4.58  ? 487  VAL A CA    1 
ATOM   3676  C  C     . VAL A 1 486  ? -40.317 -98.956  26.245  1.00 5.14  ? 487  VAL A C     1 
ATOM   3677  O  O     . VAL A 1 486  ? -40.536 -100.109 25.909  1.00 5.37  ? 487  VAL A O     1 
ATOM   3678  C  CB    . VAL A 1 486  ? -38.792 -99.286  28.121  1.00 3.53  ? 487  VAL A CB    1 
ATOM   3679  C  CG1   . VAL A 1 486  ? -37.642 -98.648  27.380  1.00 2.79  ? 487  VAL A CG1   1 
ATOM   3680  C  CG2   . VAL A 1 486  ? -38.576 -99.135  29.576  1.00 3.03  ? 487  VAL A CG2   1 
ATOM   3681  N  N     . ALA A 1 487  ? -40.228 -97.954  25.377  1.00 5.26  ? 488  ALA A N     1 
ATOM   3682  C  CA    . ALA A 1 487  ? -40.402 -98.182  23.944  1.00 6.02  ? 488  ALA A CA    1 
ATOM   3683  C  C     . ALA A 1 487  ? -39.168 -97.734  23.187  1.00 6.88  ? 488  ALA A C     1 
ATOM   3684  O  O     . ALA A 1 487  ? -38.605 -96.698  23.511  1.00 7.74  ? 488  ALA A O     1 
ATOM   3685  C  CB    . ALA A 1 487  ? -41.595 -97.437  23.452  1.00 6.20  ? 488  ALA A CB    1 
ATOM   3686  N  N     . CYS A 1 488  ? -38.759 -98.491  22.173  1.00 7.50  ? 489  CYS A N     1 
ATOM   3687  C  CA    . CYS A 1 488  ? -37.570 -98.158  21.392  1.00 8.21  ? 489  CYS A CA    1 
ATOM   3688  C  C     . CYS A 1 488  ? -37.882 -97.957  19.897  1.00 8.70  ? 489  CYS A C     1 
ATOM   3689  O  O     . CYS A 1 488  ? -37.926 -98.903  19.132  1.00 9.47  ? 489  CYS A O     1 
ATOM   3690  C  CB    . CYS A 1 488  ? -36.541 -99.256  21.580  1.00 7.44  ? 489  CYS A CB    1 
ATOM   3691  S  SG    . CYS A 1 488  ? -35.059 -98.945  20.651  1.00 10.06 ? 489  CYS A SG    1 
ATOM   3692  N  N     . HIS A 1 489  ? -38.005 -96.713  19.468  1.00 9.05  ? 490  HIS A N     1 
ATOM   3693  C  CA    . HIS A 1 489  ? -38.377 -96.395  18.088  1.00 9.96  ? 490  HIS A CA    1 
ATOM   3694  C  C     . HIS A 1 489  ? -37.307 -96.384  16.993  1.00 10.62 ? 490  HIS A C     1 
ATOM   3695  O  O     . HIS A 1 489  ? -37.561 -95.936  15.868  1.00 10.81 ? 490  HIS A O     1 
ATOM   3696  C  CB    . HIS A 1 489  ? -39.145 -95.073  18.084  1.00 10.53 ? 490  HIS A CB    1 
ATOM   3697  C  CG    . HIS A 1 489  ? -40.226 -95.003  19.121  1.00 10.68 ? 490  HIS A CG    1 
ATOM   3698  N  ND1   . HIS A 1 489  ? -40.927 -93.852  19.387  1.00 10.08 ? 490  HIS A ND1   1 
ATOM   3699  C  CD2   . HIS A 1 489  ? -40.712 -95.943  19.973  1.00 10.77 ? 490  HIS A CD2   1 
ATOM   3700  C  CE1   . HIS A 1 489  ? -41.796 -94.078  20.358  1.00 10.73 ? 490  HIS A CE1   1 
ATOM   3701  N  NE2   . HIS A 1 489  ? -41.684 -95.341  20.730  1.00 10.56 ? 490  HIS A NE2   1 
ATOM   3702  N  N     . ASN A 1 490  ? -36.097 -96.807  17.338  1.00 11.08 ? 491  ASN A N     1 
ATOM   3703  C  CA    . ASN A 1 490  ? -35.014 -96.888  16.375  1.00 10.88 ? 491  ASN A CA    1 
ATOM   3704  C  C     . ASN A 1 490  ? -34.303 -98.151  16.760  1.00 11.27 ? 491  ASN A C     1 
ATOM   3705  O  O     . ASN A 1 490  ? -33.646 -98.218  17.800  1.00 11.74 ? 491  ASN A O     1 
ATOM   3706  C  CB    . ASN A 1 490  ? -34.045 -95.726  16.504  1.00 10.96 ? 491  ASN A CB    1 
ATOM   3707  C  CG    . ASN A 1 490  ? -32.946 -95.741  15.427  1.00 11.38 ? 491  ASN A CG    1 
ATOM   3708  O  OD1   . ASN A 1 490  ? -32.301 -94.715  15.189  1.00 11.87 ? 491  ASN A OD1   1 
ATOM   3709  N  ND2   . ASN A 1 490  ? -32.744 -96.883  14.763  1.00 11.29 ? 491  ASN A ND2   1 
ATOM   3710  N  N     . PRO A 1 491  ? -34.469 -99.194  15.955  1.00 11.22 ? 492  PRO A N     1 
ATOM   3711  C  CA    . PRO A 1 491  ? -33.853 -100.496 16.169  1.00 11.37 ? 492  PRO A CA    1 
ATOM   3712  C  C     . PRO A 1 491  ? -32.346 -100.423 16.464  1.00 11.82 ? 492  PRO A C     1 
ATOM   3713  O  O     . PRO A 1 491  ? -31.841 -101.176 17.276  1.00 12.28 ? 492  PRO A O     1 
ATOM   3714  C  CB    . PRO A 1 491  ? -34.164 -101.222 14.861  1.00 11.47 ? 492  PRO A CB    1 
ATOM   3715  C  CG    . PRO A 1 491  ? -34.477 -100.106 13.887  1.00 11.39 ? 492  PRO A CG    1 
ATOM   3716  C  CD    . PRO A 1 491  ? -35.275 -99.205  14.729  1.00 11.25 ? 492  PRO A CD    1 
ATOM   3717  N  N     . ALA A 1 492  ? -31.633 -99.485  15.854  1.00 12.30 ? 493  ALA A N     1 
ATOM   3718  C  CA    . ALA A 1 492  ? -30.195 -99.359  16.105  1.00 12.63 ? 493  ALA A CA    1 
ATOM   3719  C  C     . ALA A 1 492  ? -29.803 -99.198  17.581  1.00 12.78 ? 493  ALA A C     1 
ATOM   3720  O  O     . ALA A 1 492  ? -28.688 -99.505  17.964  1.00 13.12 ? 493  ALA A O     1 
ATOM   3721  C  CB    . ALA A 1 492  ? -29.613 -98.209  15.282  1.00 12.66 ? 493  ALA A CB    1 
ATOM   3722  N  N     . TYR A 1 493  ? -30.720 -98.741  18.414  1.00 13.14 ? 494  TYR A N     1 
ATOM   3723  C  CA    . TYR A 1 493  ? -30.410 -98.540  19.825  1.00 14.09 ? 494  TYR A CA    1 
ATOM   3724  C  C     . TYR A 1 493  ? -30.139 -99.812  20.615  1.00 14.51 ? 494  TYR A C     1 
ATOM   3725  O  O     . TYR A 1 493  ? -29.186 -99.861  21.390  1.00 14.54 ? 494  TYR A O     1 
ATOM   3726  C  CB    . TYR A 1 493  ? -31.523 -97.729  20.502  1.00 14.13 ? 494  TYR A CB    1 
ATOM   3727  C  CG    . TYR A 1 493  ? -31.659 -96.352  19.922  1.00 13.55 ? 494  TYR A CG    1 
ATOM   3728  C  CD1   . TYR A 1 493  ? -30.751 -95.904  18.970  1.00 13.22 ? 494  TYR A CD1   1 
ATOM   3729  C  CD2   . TYR A 1 493  ? -32.692 -95.508  20.304  1.00 13.26 ? 494  TYR A CD2   1 
ATOM   3730  C  CE1   . TYR A 1 493  ? -30.858 -94.656  18.406  1.00 13.89 ? 494  TYR A CE1   1 
ATOM   3731  C  CE2   . TYR A 1 493  ? -32.815 -94.239  19.745  1.00 14.10 ? 494  TYR A CE2   1 
ATOM   3732  C  CZ    . TYR A 1 493  ? -31.887 -93.820  18.786  1.00 14.13 ? 494  TYR A CZ    1 
ATOM   3733  O  OH    . TYR A 1 493  ? -31.978 -92.582  18.181  1.00 14.38 ? 494  TYR A OH    1 
ATOM   3734  N  N     . VAL A 1 494  ? -30.998 -100.815 20.430  1.00 14.94 ? 495  VAL A N     1 
ATOM   3735  C  CA    . VAL A 1 494  ? -30.909 -102.102 21.114  1.00 14.97 ? 495  VAL A CA    1 
ATOM   3736  C  C     . VAL A 1 494  ? -29.468 -102.544 21.354  1.00 15.73 ? 495  VAL A C     1 
ATOM   3737  O  O     . VAL A 1 494  ? -29.045 -102.776 22.505  1.00 15.96 ? 495  VAL A O     1 
ATOM   3738  C  CB    . VAL A 1 494  ? -31.651 -103.194 20.313  1.00 14.42 ? 495  VAL A CB    1 
ATOM   3739  C  CG1   . VAL A 1 494  ? -31.167 -103.241 18.902  1.00 13.89 ? 495  VAL A CG1   1 
ATOM   3740  C  CG2   . VAL A 1 494  ? -31.414 -104.543 20.934  1.00 14.93 ? 495  VAL A CG2   1 
ATOM   3741  N  N     . GLY A 1 495  ? -28.699 -102.598 20.271  1.00 16.12 ? 496  GLY A N     1 
ATOM   3742  C  CA    . GLY A 1 495  ? -27.318 -103.005 20.384  1.00 16.60 ? 496  GLY A CA    1 
ATOM   3743  C  C     . GLY A 1 495  ? -26.461 -102.090 21.240  1.00 17.07 ? 496  GLY A C     1 
ATOM   3744  O  O     . GLY A 1 495  ? -25.945 -102.536 22.266  1.00 17.70 ? 496  GLY A O     1 
ATOM   3745  N  N     . ILE A 1 496  ? -26.441 -100.797 20.909  1.00 16.84 ? 497  ILE A N     1 
ATOM   3746  C  CA    . ILE A 1 496  ? -25.606 -99.793  21.584  1.00 16.60 ? 497  ILE A CA    1 
ATOM   3747  C  C     . ILE A 1 496  ? -25.902 -99.163  22.957  1.00 16.47 ? 497  ILE A C     1 
ATOM   3748  O  O     . ILE A 1 496  ? -24.982 -98.987  23.761  1.00 16.52 ? 497  ILE A O     1 
ATOM   3749  C  CB    . ILE A 1 496  ? -25.301 -98.688  20.603  1.00 16.42 ? 497  ILE A CB    1 
ATOM   3750  C  CG1   . ILE A 1 496  ? -26.588 -98.017  20.161  1.00 16.63 ? 497  ILE A CG1   1 
ATOM   3751  C  CG2   . ILE A 1 496  ? -24.687 -99.299  19.365  1.00 17.16 ? 497  ILE A CG2   1 
ATOM   3752  C  CD1   . ILE A 1 496  ? -26.449 -97.233  18.846  1.00 17.10 ? 497  ILE A CD1   1 
ATOM   3753  N  N     . TYR A 1 497  ? -27.157 -98.813  23.223  1.00 15.98 ? 498  TYR A N     1 
ATOM   3754  C  CA    . TYR A 1 497  ? -27.541 -98.185  24.488  1.00 15.17 ? 498  TYR A CA    1 
ATOM   3755  C  C     . TYR A 1 497  ? -28.208 -99.113  25.493  1.00 15.21 ? 498  TYR A C     1 
ATOM   3756  O  O     . TYR A 1 497  ? -28.735 -100.156 25.135  1.00 15.12 ? 498  TYR A O     1 
ATOM   3757  C  CB    . TYR A 1 497  ? -28.493 -97.042  24.208  1.00 14.69 ? 498  TYR A CB    1 
ATOM   3758  C  CG    . TYR A 1 497  ? -27.894 -95.909  23.426  1.00 14.46 ? 498  TYR A CG    1 
ATOM   3759  C  CD1   . TYR A 1 497  ? -27.071 -94.969  24.046  1.00 14.82 ? 498  TYR A CD1   1 
ATOM   3760  C  CD2   . TYR A 1 497  ? -28.174 -95.748  22.079  1.00 14.21 ? 498  TYR A CD2   1 
ATOM   3761  C  CE1   . TYR A 1 497  ? -26.548 -93.899  23.337  1.00 14.52 ? 498  TYR A CE1   1 
ATOM   3762  C  CE2   . TYR A 1 497  ? -27.654 -94.680  21.364  1.00 14.10 ? 498  TYR A CE2   1 
ATOM   3763  C  CZ    . TYR A 1 497  ? -26.845 -93.765  21.994  1.00 13.90 ? 498  TYR A CZ    1 
ATOM   3764  O  OH    . TYR A 1 497  ? -26.323 -92.716  21.283  1.00 14.31 ? 498  TYR A OH    1 
ATOM   3765  N  N     . ASP A 1 498  ? -28.244 -98.689  26.749  1.00 15.89 ? 499  ASP A N     1 
ATOM   3766  C  CA    . ASP A 1 498  ? -28.858 -99.486  27.818  1.00 16.67 ? 499  ASP A CA    1 
ATOM   3767  C  C     . ASP A 1 498  ? -30.383 -99.272  27.879  1.00 16.32 ? 499  ASP A C     1 
ATOM   3768  O  O     . ASP A 1 498  ? -30.910 -98.773  28.879  1.00 15.69 ? 499  ASP A O     1 
ATOM   3769  C  CB    . ASP A 1 498  ? -28.211 -99.113  29.166  1.00 18.36 ? 499  ASP A CB    1 
ATOM   3770  C  CG    . ASP A 1 498  ? -28.579 -100.084 30.314  1.00 20.28 ? 499  ASP A CG    1 
ATOM   3771  O  OD1   . ASP A 1 498  ? -29.538 -100.895 30.174  1.00 21.70 ? 499  ASP A OD1   1 
ATOM   3772  O  OD2   . ASP A 1 498  ? -27.902 -100.023 31.377  1.00 20.73 ? 499  ASP A OD2   1 
ATOM   3773  N  N     . ILE A 1 499  ? -31.084 -99.693  26.831  1.00 15.78 ? 500  ILE A N     1 
ATOM   3774  C  CA    . ILE A 1 499  ? -32.534 -99.523  26.748  1.00 15.94 ? 500  ILE A CA    1 
ATOM   3775  C  C     . ILE A 1 499  ? -33.381 -99.994  27.952  1.00 16.28 ? 500  ILE A C     1 
ATOM   3776  O  O     . ILE A 1 499  ? -34.325 -99.306  28.353  1.00 16.92 ? 500  ILE A O     1 
ATOM   3777  C  CB    . ILE A 1 499  ? -33.116 -100.213 25.477  1.00 15.39 ? 500  ILE A CB    1 
ATOM   3778  C  CG1   . ILE A 1 499  ? -32.193 -100.023 24.279  1.00 15.40 ? 500  ILE A CG1   1 
ATOM   3779  C  CG2   . ILE A 1 499  ? -34.468 -99.600  25.122  1.00 15.53 ? 500  ILE A CG2   1 
ATOM   3780  C  CD1   . ILE A 1 499  ? -32.072 -98.586  23.831  1.00 15.99 ? 500  ILE A CD1   1 
ATOM   3781  N  N     . LEU A 1 500  ? -33.053 -101.141 28.536  1.00 16.35 ? 501  LEU A N     1 
ATOM   3782  C  CA    . LEU A 1 500  ? -33.871 -101.665 29.626  1.00 16.54 ? 501  LEU A CA    1 
ATOM   3783  C  C     . LEU A 1 500  ? -33.466 -101.390 31.066  1.00 16.82 ? 501  LEU A C     1 
ATOM   3784  O  O     . LEU A 1 500  ? -33.953 -102.072 31.982  1.00 17.10 ? 501  LEU A O     1 
ATOM   3785  C  CB    . LEU A 1 500  ? -34.072 -103.171 29.454  1.00 16.34 ? 501  LEU A CB    1 
ATOM   3786  C  CG    . LEU A 1 500  ? -35.036 -103.674 28.391  1.00 16.21 ? 501  LEU A CG    1 
ATOM   3787  C  CD1   . LEU A 1 500  ? -35.637 -102.523 27.640  1.00 16.47 ? 501  LEU A CD1   1 
ATOM   3788  C  CD2   . LEU A 1 500  ? -34.311 -104.592 27.453  1.00 15.83 ? 501  LEU A CD2   1 
ATOM   3789  N  N     . GLU A 1 501  ? -32.614 -100.395 31.284  1.00 16.85 ? 502  GLU A N     1 
ATOM   3790  C  CA    . GLU A 1 501  ? -32.157 -100.083 32.636  1.00 16.92 ? 502  GLU A CA    1 
ATOM   3791  C  C     . GLU A 1 501  ? -33.312 -99.799  33.555  1.00 16.34 ? 502  GLU A C     1 
ATOM   3792  O  O     . GLU A 1 501  ? -34.167 -98.973  33.256  1.00 16.53 ? 502  GLU A O     1 
ATOM   3793  C  CB    . GLU A 1 501  ? -31.218 -98.882  32.643  1.00 17.75 ? 502  GLU A CB    1 
ATOM   3794  C  CG    . GLU A 1 501  ? -30.119 -98.994  33.673  1.00 19.65 ? 502  GLU A CG    1 
ATOM   3795  C  CD    . GLU A 1 501  ? -29.527 -97.654  34.084  1.00 20.78 ? 502  GLU A CD    1 
ATOM   3796  O  OE1   . GLU A 1 501  ? -29.500 -96.709  33.256  1.00 21.83 ? 502  GLU A OE1   1 
ATOM   3797  O  OE2   . GLU A 1 501  ? -29.088 -97.544  35.256  1.00 21.48 ? 502  GLU A OE2   1 
ATOM   3798  N  N     . GLY A 1 502  ? -33.375 -100.549 34.645  1.00 16.29 ? 503  GLY A N     1 
ATOM   3799  C  CA    . GLY A 1 502  ? -34.437 -100.346 35.614  1.00 15.65 ? 503  GLY A CA    1 
ATOM   3800  C  C     . GLY A 1 502  ? -35.873 -100.761 35.327  1.00 15.01 ? 503  GLY A C     1 
ATOM   3801  O  O     . GLY A 1 502  ? -36.693 -100.657 36.238  1.00 15.68 ? 503  GLY A O     1 
ATOM   3802  N  N     . ILE A 1 503  ? -36.192 -101.242 34.125  1.00 13.90 ? 504  ILE A N     1 
ATOM   3803  C  CA    . ILE A 1 503  ? -37.563 -101.644 33.822  1.00 12.84 ? 504  ILE A CA    1 
ATOM   3804  C  C     . ILE A 1 503  ? -38.108 -102.581 34.881  1.00 13.27 ? 504  ILE A C     1 
ATOM   3805  O  O     . ILE A 1 503  ? -37.395 -103.430 35.396  1.00 13.36 ? 504  ILE A O     1 
ATOM   3806  C  CB    . ILE A 1 503  ? -37.702 -102.255 32.438  1.00 11.50 ? 504  ILE A CB    1 
ATOM   3807  C  CG1   . ILE A 1 503  ? -39.165 -102.512 32.150  1.00 10.36 ? 504  ILE A CG1   1 
ATOM   3808  C  CG2   . ILE A 1 503  ? -36.885 -103.504 32.314  1.00 11.50 ? 504  ILE A CG2   1 
ATOM   3809  C  CD1   . ILE A 1 503  ? -39.442 -102.666 30.698  1.00 10.32 ? 504  ILE A CD1   1 
ATOM   3810  N  N     . LYS A 1 504  ? -39.351 -102.346 35.273  1.00 13.92 ? 505  LYS A N     1 
ATOM   3811  C  CA    . LYS A 1 504  ? -40.004 -103.123 36.309  1.00 14.75 ? 505  LYS A CA    1 
ATOM   3812  C  C     . LYS A 1 504  ? -40.295 -104.533 35.850  1.00 15.89 ? 505  LYS A C     1 
ATOM   3813  O  O     . LYS A 1 504  ? -40.359 -104.812 34.657  1.00 16.18 ? 505  LYS A O     1 
ATOM   3814  C  CB    . LYS A 1 504  ? -41.294 -102.423 36.726  1.00 14.72 ? 505  LYS A CB    1 
ATOM   3815  C  CG    . LYS A 1 504  ? -41.038 -101.029 37.282  1.00 15.48 ? 505  LYS A CG    1 
ATOM   3816  C  CD    . LYS A 1 504  ? -42.225 -100.059 37.165  1.00 15.96 ? 505  LYS A CD    1 
ATOM   3817  C  CE    . LYS A 1 504  ? -43.252 -100.238 38.288  1.00 17.02 ? 505  LYS A CE    1 
ATOM   3818  N  NZ    . LYS A 1 504  ? -44.169 -99.047  38.461  1.00 17.28 ? 505  LYS A NZ    1 
ATOM   3819  N  N     . ASP A 1 505  ? -40.435 -105.442 36.801  1.00 16.94 ? 506  ASP A N     1 
ATOM   3820  C  CA    . ASP A 1 505  ? -40.736 -106.822 36.466  1.00 17.72 ? 506  ASP A CA    1 
ATOM   3821  C  C     . ASP A 1 505  ? -42.041 -106.903 35.690  1.00 17.44 ? 506  ASP A C     1 
ATOM   3822  O  O     . ASP A 1 505  ? -43.028 -106.248 36.029  1.00 17.56 ? 506  ASP A O     1 
ATOM   3823  C  CB    . ASP A 1 505  ? -40.822 -107.663 37.733  1.00 19.56 ? 506  ASP A CB    1 
ATOM   3824  C  CG    . ASP A 1 505  ? -39.473 -108.220 38.157  1.00 21.27 ? 506  ASP A CG    1 
ATOM   3825  O  OD1   . ASP A 1 505  ? -38.422 -107.582 37.895  1.00 22.96 ? 506  ASP A OD1   1 
ATOM   3826  O  OD2   . ASP A 1 505  ? -39.461 -109.320 38.748  1.00 22.67 ? 506  ASP A OD2   1 
ATOM   3827  N  N     . GLY A 1 506  ? -42.037 -107.697 34.629  1.00 17.03 ? 507  GLY A N     1 
ATOM   3828  C  CA    . GLY A 1 506  ? -43.227 -107.825 33.819  1.00 16.04 ? 507  GLY A CA    1 
ATOM   3829  C  C     . GLY A 1 506  ? -43.581 -106.491 33.194  1.00 15.51 ? 507  GLY A C     1 
ATOM   3830  O  O     . GLY A 1 506  ? -44.738 -106.230 32.913  1.00 15.87 ? 507  GLY A O     1 
ATOM   3831  N  N     . GLY A 1 507  ? -42.599 -105.620 33.009  1.00 14.81 ? 508  GLY A N     1 
ATOM   3832  C  CA    . GLY A 1 507  ? -42.883 -104.331 32.405  1.00 14.23 ? 508  GLY A CA    1 
ATOM   3833  C  C     . GLY A 1 507  ? -42.920 -104.522 30.908  1.00 13.77 ? 508  GLY A C     1 
ATOM   3834  O  O     . GLY A 1 507  ? -41.991 -105.100 30.353  1.00 14.17 ? 508  GLY A O     1 
ATOM   3835  N  N     . THR A 1 508  ? -43.983 -104.082 30.246  1.00 12.77 ? 509  THR A N     1 
ATOM   3836  C  CA    . THR A 1 508  ? -44.057 -104.257 28.799  1.00 11.51 ? 509  THR A CA    1 
ATOM   3837  C  C     . THR A 1 508  ? -42.900 -103.505 28.171  1.00 10.76 ? 509  THR A C     1 
ATOM   3838  O  O     . THR A 1 508  ? -42.348 -102.619 28.797  1.00 11.08 ? 509  THR A O     1 
ATOM   3839  C  CB    . THR A 1 508  ? -45.400 -103.796 28.226  1.00 11.61 ? 509  THR A CB    1 
ATOM   3840  O  OG1   . THR A 1 508  ? -45.179 -102.874 27.156  1.00 11.95 ? 509  THR A OG1   1 
ATOM   3841  C  CG2   . THR A 1 508  ? -46.276 -103.169 29.309  1.00 11.99 ? 509  THR A CG2   1 
ATOM   3842  N  N     . PHE A 1 509  ? -42.516 -103.876 26.956  1.00 9.80  ? 510  PHE A N     1 
ATOM   3843  C  CA    . PHE A 1 509  ? -41.385 -103.264 26.254  1.00 8.98  ? 510  PHE A CA    1 
ATOM   3844  C  C     . PHE A 1 509  ? -41.652 -103.486 24.790  1.00 8.93  ? 510  PHE A C     1 
ATOM   3845  O  O     . PHE A 1 509  ? -41.843 -104.617 24.355  1.00 9.37  ? 510  PHE A O     1 
ATOM   3846  C  CB    . PHE A 1 509  ? -40.070 -103.966 26.674  1.00 8.93  ? 510  PHE A CB    1 
ATOM   3847  C  CG    . PHE A 1 509  ? -38.852 -103.700 25.763  1.00 8.48  ? 510  PHE A CG    1 
ATOM   3848  C  CD1   . PHE A 1 509  ? -38.750 -102.564 24.955  1.00 8.49  ? 510  PHE A CD1   1 
ATOM   3849  C  CD2   . PHE A 1 509  ? -37.806 -104.613 25.724  1.00 7.58  ? 510  PHE A CD2   1 
ATOM   3850  C  CE1   . PHE A 1 509  ? -37.629 -102.360 24.123  1.00 7.68  ? 510  PHE A CE1   1 
ATOM   3851  C  CE2   . PHE A 1 509  ? -36.694 -104.408 24.893  1.00 7.60  ? 510  PHE A CE2   1 
ATOM   3852  C  CZ    . PHE A 1 509  ? -36.605 -103.285 24.096  1.00 7.04  ? 510  PHE A CZ    1 
ATOM   3853  N  N     . VAL A 1 510  ? -41.727 -102.408 24.028  1.00 8.54  ? 511  VAL A N     1 
ATOM   3854  C  CA    . VAL A 1 510  ? -41.965 -102.544 22.607  1.00 8.28  ? 511  VAL A CA    1 
ATOM   3855  C  C     . VAL A 1 510  ? -40.735 -102.069 21.877  1.00 8.56  ? 511  VAL A C     1 
ATOM   3856  O  O     . VAL A 1 510  ? -39.974 -101.246 22.371  1.00 8.28  ? 511  VAL A O     1 
ATOM   3857  C  CB    . VAL A 1 510  ? -43.274 -101.868 22.129  1.00 7.74  ? 511  VAL A CB    1 
ATOM   3858  C  CG1   . VAL A 1 510  ? -43.930 -101.095 23.259  1.00 8.12  ? 511  VAL A CG1   1 
ATOM   3859  C  CG2   . VAL A 1 510  ? -43.035 -100.998 20.925  1.00 7.31  ? 511  VAL A CG2   1 
ATOM   3860  N  N     . LEU A 1 511  ? -40.527 -102.651 20.709  1.00 9.09  ? 512  LEU A N     1 
ATOM   3861  C  CA    . LEU A 1 511  ? -39.376 -102.365 19.903  1.00 9.35  ? 512  LEU A CA    1 
ATOM   3862  C  C     . LEU A 1 511  ? -39.796 -102.203 18.485  1.00 9.53  ? 512  LEU A C     1 
ATOM   3863  O  O     . LEU A 1 511  ? -40.609 -102.964 17.989  1.00 10.14 ? 512  LEU A O     1 
ATOM   3864  C  CB    . LEU A 1 511  ? -38.407 -103.545 20.007  1.00 9.23  ? 512  LEU A CB    1 
ATOM   3865  C  CG    . LEU A 1 511  ? -37.297 -103.812 18.981  1.00 9.48  ? 512  LEU A CG    1 
ATOM   3866  C  CD1   . LEU A 1 511  ? -36.582 -102.536 18.605  1.00 9.27  ? 512  LEU A CD1   1 
ATOM   3867  C  CD2   . LEU A 1 511  ? -36.313 -104.842 19.551  1.00 8.96  ? 512  LEU A CD2   1 
ATOM   3868  N  N     . ASN A 1 512  ? -39.329 -101.147 17.859  1.00 9.64  ? 513  ASN A N     1 
ATOM   3869  C  CA    . ASN A 1 512  ? -39.615 -100.978 16.469  1.00 10.68 ? 513  ASN A CA    1 
ATOM   3870  C  C     . ASN A 1 512  ? -38.436 -101.705 15.828  1.00 11.67 ? 513  ASN A C     1 
ATOM   3871  O  O     . ASN A 1 512  ? -37.279 -101.330 16.069  1.00 12.02 ? 513  ASN A O     1 
ATOM   3872  C  CB    . ASN A 1 512  ? -39.582 -99.516  16.088  1.00 10.96 ? 513  ASN A CB    1 
ATOM   3873  C  CG    . ASN A 1 512  ? -39.544 -99.313  14.585  1.00 10.98 ? 513  ASN A CG    1 
ATOM   3874  O  OD1   . ASN A 1 512  ? -39.088 -98.274  14.107  1.00 11.33 ? 513  ASN A OD1   1 
ATOM   3875  N  ND2   . ASN A 1 512  ? -40.017 -100.310 13.829  1.00 10.93 ? 513  ASN A ND2   1 
ATOM   3876  N  N     . SER A 1 513  ? -38.726 -102.751 15.044  1.00 12.06 ? 514  SER A N     1 
ATOM   3877  C  CA    . SER A 1 513  ? -37.706 -103.561 14.357  1.00 11.75 ? 514  SER A CA    1 
ATOM   3878  C  C     . SER A 1 513  ? -38.353 -104.589 13.435  1.00 12.21 ? 514  SER A C     1 
ATOM   3879  O  O     . SER A 1 513  ? -39.379 -105.174 13.776  1.00 12.74 ? 514  SER A O     1 
ATOM   3880  C  CB    . SER A 1 513  ? -36.850 -104.298 15.372  1.00 11.27 ? 514  SER A CB    1 
ATOM   3881  O  OG    . SER A 1 513  ? -36.613 -105.622 14.945  1.00 11.03 ? 514  SER A OG    1 
ATOM   3882  N  N     . PRO A 1 514  ? -37.712 -104.893 12.296  1.00 12.16 ? 515  PRO A N     1 
ATOM   3883  C  CA    . PRO A 1 514  ? -38.223 -105.862 11.321  1.00 12.42 ? 515  PRO A CA    1 
ATOM   3884  C  C     . PRO A 1 514  ? -37.877 -107.328 11.616  1.00 13.16 ? 515  PRO A C     1 
ATOM   3885  O  O     . PRO A 1 514  ? -38.213 -108.222 10.842  1.00 13.54 ? 515  PRO A O     1 
ATOM   3886  C  CB    . PRO A 1 514  ? -37.573 -105.396 10.037  1.00 11.89 ? 515  PRO A CB    1 
ATOM   3887  C  CG    . PRO A 1 514  ? -36.250 -105.005 10.511  1.00 12.17 ? 515  PRO A CG    1 
ATOM   3888  C  CD    . PRO A 1 514  ? -36.511 -104.227 11.776  1.00 11.86 ? 515  PRO A CD    1 
ATOM   3889  N  N     . TRP A 1 515  ? -37.200 -107.569 12.734  1.00 14.03 ? 516  TRP A N     1 
ATOM   3890  C  CA    . TRP A 1 515  ? -36.814 -108.918 13.152  1.00 14.13 ? 516  TRP A CA    1 
ATOM   3891  C  C     . TRP A 1 515  ? -38.051 -109.560 13.731  1.00 14.71 ? 516  TRP A C     1 
ATOM   3892  O  O     . TRP A 1 515  ? -38.088 -109.826 14.922  1.00 14.97 ? 516  TRP A O     1 
ATOM   3893  C  CB    . TRP A 1 515  ? -35.745 -108.826 14.241  1.00 13.49 ? 516  TRP A CB    1 
ATOM   3894  C  CG    . TRP A 1 515  ? -34.713 -107.770 13.960  1.00 13.36 ? 516  TRP A CG    1 
ATOM   3895  C  CD1   . TRP A 1 515  ? -34.192 -107.429 12.737  1.00 13.50 ? 516  TRP A CD1   1 
ATOM   3896  C  CD2   . TRP A 1 515  ? -34.107 -106.900 14.904  1.00 12.84 ? 516  TRP A CD2   1 
ATOM   3897  N  NE1   . TRP A 1 515  ? -33.303 -106.396 12.870  1.00 12.86 ? 516  TRP A NE1   1 
ATOM   3898  C  CE2   . TRP A 1 515  ? -33.231 -106.050 14.191  1.00 12.94 ? 516  TRP A CE2   1 
ATOM   3899  C  CE3   . TRP A 1 515  ? -34.219 -106.747 16.286  1.00 12.88 ? 516  TRP A CE3   1 
ATOM   3900  C  CZ2   . TRP A 1 515  ? -32.479 -105.065 14.815  1.00 12.85 ? 516  TRP A CZ2   1 
ATOM   3901  C  CZ3   . TRP A 1 515  ? -33.472 -105.768 16.907  1.00 13.03 ? 516  TRP A CZ3   1 
ATOM   3902  C  CH2   . TRP A 1 515  ? -32.612 -104.938 16.171  1.00 12.95 ? 516  TRP A CH2   1 
ATOM   3903  N  N     . SER A 1 516  ? -39.046 -109.818 12.882  1.00 15.58 ? 517  SER A N     1 
ATOM   3904  C  CA    . SER A 1 516  ? -40.345 -110.410 13.287  1.00 16.84 ? 517  SER A CA    1 
ATOM   3905  C  C     . SER A 1 516  ? -40.295 -111.865 13.795  1.00 17.08 ? 517  SER A C     1 
ATOM   3906  O  O     . SER A 1 516  ? -41.120 -112.293 14.628  1.00 16.63 ? 517  SER A O     1 
ATOM   3907  C  CB    . SER A 1 516  ? -41.337 -110.333 12.112  1.00 17.03 ? 517  SER A CB    1 
ATOM   3908  O  OG    . SER A 1 516  ? -41.084 -109.194 11.291  1.00 17.53 ? 517  SER A OG    1 
ATOM   3909  N  N     . SER A 1 517  ? -39.305 -112.597 13.288  1.00 17.58 ? 518  SER A N     1 
ATOM   3910  C  CA    . SER A 1 517  ? -39.099 -113.997 13.616  1.00 18.06 ? 518  SER A CA    1 
ATOM   3911  C  C     . SER A 1 517  ? -38.061 -114.178 14.686  1.00 18.43 ? 518  SER A C     1 
ATOM   3912  O  O     . SER A 1 517  ? -37.079 -113.432 14.751  1.00 17.87 ? 518  SER A O     1 
ATOM   3913  C  CB    . SER A 1 517  ? -38.638 -114.764 12.380  1.00 18.39 ? 518  SER A CB    1 
ATOM   3914  O  OG    . SER A 1 517  ? -37.285 -114.467 12.083  1.00 18.78 ? 518  SER A OG    1 
ATOM   3915  N  N     . LEU A 1 518  ? -38.237 -115.258 15.442  1.00 19.05 ? 519  LEU A N     1 
ATOM   3916  C  CA    . LEU A 1 518  ? -37.340 -115.599 16.524  1.00 19.64 ? 519  LEU A CA    1 
ATOM   3917  C  C     . LEU A 1 518  ? -35.941 -115.713 15.985  1.00 20.46 ? 519  LEU A C     1 
ATOM   3918  O  O     . LEU A 1 518  ? -34.977 -115.469 16.699  1.00 20.63 ? 519  LEU A O     1 
ATOM   3919  C  CB    . LEU A 1 518  ? -37.749 -116.915 17.146  1.00 19.05 ? 519  LEU A CB    1 
ATOM   3920  C  CG    . LEU A 1 518  ? -36.840 -117.337 18.286  1.00 19.45 ? 519  LEU A CG    1 
ATOM   3921  C  CD1   . LEU A 1 518  ? -36.780 -116.251 19.342  1.00 19.76 ? 519  LEU A CD1   1 
ATOM   3922  C  CD2   . LEU A 1 518  ? -37.356 -118.631 18.879  1.00 19.88 ? 519  LEU A CD2   1 
ATOM   3923  N  N     . GLU A 1 519  ? -35.846 -116.049 14.703  1.00 21.55 ? 520  GLU A N     1 
ATOM   3924  C  CA    . GLU A 1 519  ? -34.564 -116.205 14.030  1.00 22.57 ? 520  GLU A CA    1 
ATOM   3925  C  C     . GLU A 1 519  ? -33.812 -114.897 13.952  1.00 22.72 ? 520  GLU A C     1 
ATOM   3926  O  O     . GLU A 1 519  ? -32.705 -114.769 14.493  1.00 22.71 ? 520  GLU A O     1 
ATOM   3927  C  CB    . GLU A 1 519  ? -34.782 -116.741 12.619  1.00 23.74 ? 520  GLU A CB    1 
ATOM   3928  C  CG    . GLU A 1 519  ? -33.530 -116.771 11.775  1.00 25.40 ? 520  GLU A CG    1 
ATOM   3929  C  CD    . GLU A 1 519  ? -33.555 -117.901 10.777  1.00 26.77 ? 520  GLU A CD    1 
ATOM   3930  O  OE1   . GLU A 1 519  ? -34.537 -117.974 10.001  1.00 27.70 ? 520  GLU A OE1   1 
ATOM   3931  O  OE2   . GLU A 1 519  ? -32.603 -118.722 10.774  1.00 27.59 ? 520  GLU A OE2   1 
ATOM   3932  N  N     . ASP A 1 520  ? -34.402 -113.943 13.237  1.00 22.70 ? 521  ASP A N     1 
ATOM   3933  C  CA    . ASP A 1 520  ? -33.797 -112.633 13.079  1.00 22.31 ? 521  ASP A CA    1 
ATOM   3934  C  C     . ASP A 1 520  ? -33.692 -111.998 14.437  1.00 21.92 ? 521  ASP A C     1 
ATOM   3935  O  O     . ASP A 1 520  ? -32.628 -111.533 14.820  1.00 21.84 ? 521  ASP A O     1 
ATOM   3936  C  CB    . ASP A 1 520  ? -34.639 -111.778 12.155  1.00 22.73 ? 521  ASP A CB    1 
ATOM   3937  C  CG    . ASP A 1 520  ? -34.781 -112.394 10.776  1.00 23.58 ? 521  ASP A CG    1 
ATOM   3938  O  OD1   . ASP A 1 520  ? -33.918 -113.235 10.412  1.00 23.55 ? 521  ASP A OD1   1 
ATOM   3939  O  OD2   . ASP A 1 520  ? -35.758 -112.038 10.065  1.00 23.65 ? 521  ASP A OD2   1 
ATOM   3940  N  N     . MET A 1 521  ? -34.773 -112.056 15.201  1.00 21.18 ? 522  MET A N     1 
ATOM   3941  C  CA    . MET A 1 521  ? -34.739 -111.484 16.520  1.00 20.92 ? 522  MET A CA    1 
ATOM   3942  C  C     . MET A 1 521  ? -33.515 -112.007 17.237  1.00 21.18 ? 522  MET A C     1 
ATOM   3943  O  O     . MET A 1 521  ? -32.709 -111.229 17.740  1.00 21.19 ? 522  MET A O     1 
ATOM   3944  C  CB    . MET A 1 521  ? -35.996 -111.819 17.311  1.00 20.55 ? 522  MET A CB    1 
ATOM   3945  C  CG    . MET A 1 521  ? -36.085 -111.045 18.629  1.00 19.79 ? 522  MET A CG    1 
ATOM   3946  S  SD    . MET A 1 521  ? -35.870 -109.253 18.402  1.00 19.64 ? 522  MET A SD    1 
ATOM   3947  C  CE    . MET A 1 521  ? -37.597 -108.697 18.387  1.00 18.18 ? 522  MET A CE    1 
ATOM   3948  N  N     . ASP A 1 522  ? -33.323 -113.318 17.206  1.00 21.73 ? 523  ASP A N     1 
ATOM   3949  C  CA    . ASP A 1 522  ? -32.171 -113.905 17.877  1.00 22.78 ? 523  ASP A CA    1 
ATOM   3950  C  C     . ASP A 1 522  ? -30.853 -113.430 17.283  1.00 23.20 ? 523  ASP A C     1 
ATOM   3951  O  O     . ASP A 1 522  ? -29.871 -113.252 18.001  1.00 23.41 ? 523  ASP A O     1 
ATOM   3952  C  CB    . ASP A 1 522  ? -32.215 -115.436 17.838  1.00 23.63 ? 523  ASP A CB    1 
ATOM   3953  C  CG    . ASP A 1 522  ? -32.851 -116.051 19.085  1.00 25.18 ? 523  ASP A CG    1 
ATOM   3954  O  OD1   . ASP A 1 522  ? -33.824 -115.483 19.643  1.00 25.98 ? 523  ASP A OD1   1 
ATOM   3955  O  OD2   . ASP A 1 522  ? -32.383 -117.136 19.501  1.00 25.93 ? 523  ASP A OD2   1 
ATOM   3956  N  N     . LYS A 1 523  ? -30.829 -113.183 15.978  1.00 23.56 ? 524  LYS A N     1 
ATOM   3957  C  CA    . LYS A 1 523  ? -29.593 -112.761 15.344  1.00 23.61 ? 524  LYS A CA    1 
ATOM   3958  C  C     . LYS A 1 523  ? -29.298 -111.243 15.387  1.00 23.43 ? 524  LYS A C     1 
ATOM   3959  O  O     . LYS A 1 523  ? -28.440 -110.758 14.649  1.00 23.57 ? 524  LYS A O     1 
ATOM   3960  C  CB    . LYS A 1 523  ? -29.499 -113.404 13.937  1.00 24.56 ? 524  LYS A CB    1 
ATOM   3961  C  CG    . LYS A 1 523  ? -29.764 -112.540 12.685  1.00 26.30 ? 524  LYS A CG    1 
ATOM   3962  C  CD    . LYS A 1 523  ? -30.099 -113.402 11.401  1.00 27.69 ? 524  LYS A CD    1 
ATOM   3963  C  CE    . LYS A 1 523  ? -29.013 -114.445 10.995  1.00 28.11 ? 524  LYS A CE    1 
ATOM   3964  N  NZ    . LYS A 1 523  ? -29.501 -115.541 10.058  1.00 28.13 ? 524  LYS A NZ    1 
ATOM   3965  N  N     . HIS A 1 524  ? -29.949 -110.518 16.313  1.00 22.89 ? 525  HIS A N     1 
ATOM   3966  C  CA    . HIS A 1 524  ? -29.770 -109.056 16.482  1.00 21.99 ? 525  HIS A CA    1 
ATOM   3967  C  C     . HIS A 1 524  ? -29.685 -108.583 17.935  1.00 21.74 ? 525  HIS A C     1 
ATOM   3968  O  O     . HIS A 1 524  ? -28.728 -107.898 18.311  1.00 22.39 ? 525  HIS A O     1 
ATOM   3969  C  CB    . HIS A 1 524  ? -30.891 -108.285 15.798  1.00 21.49 ? 525  HIS A CB    1 
ATOM   3970  C  CG    . HIS A 1 524  ? -30.817 -108.322 14.310  1.00 21.32 ? 525  HIS A CG    1 
ATOM   3971  N  ND1   . HIS A 1 524  ? -31.605 -109.156 13.547  1.00 21.16 ? 525  HIS A ND1   1 
ATOM   3972  C  CD2   . HIS A 1 524  ? -30.032 -107.648 13.440  1.00 21.35 ? 525  HIS A CD2   1 
ATOM   3973  C  CE1   . HIS A 1 524  ? -31.307 -108.999 12.270  1.00 21.14 ? 525  HIS A CE1   1 
ATOM   3974  N  NE2   . HIS A 1 524  ? -30.355 -108.089 12.178  1.00 21.39 ? 525  HIS A NE2   1 
ATOM   3975  N  N     . LEU A 1 525  ? -30.716 -108.876 18.726  1.00 21.18 ? 526  LEU A N     1 
ATOM   3976  C  CA    . LEU A 1 525  ? -30.742 -108.497 20.141  1.00 21.05 ? 526  LEU A CA    1 
ATOM   3977  C  C     . LEU A 1 525  ? -29.501 -109.033 20.871  1.00 21.19 ? 526  LEU A C     1 
ATOM   3978  O  O     . LEU A 1 525  ? -29.093 -110.171 20.645  1.00 21.82 ? 526  LEU A O     1 
ATOM   3979  C  CB    . LEU A 1 525  ? -31.992 -109.090 20.812  1.00 20.76 ? 526  LEU A CB    1 
ATOM   3980  C  CG    . LEU A 1 525  ? -33.194 -108.219 21.198  1.00 20.58 ? 526  LEU A CG    1 
ATOM   3981  C  CD1   . LEU A 1 525  ? -33.704 -107.453 19.981  1.00 20.24 ? 526  LEU A CD1   1 
ATOM   3982  C  CD2   . LEU A 1 525  ? -34.294 -109.109 21.798  1.00 19.78 ? 526  LEU A CD2   1 
ATOM   3983  N  N     . PRO A 1 526  ? -28.843 -108.204 21.699  1.00 21.07 ? 527  PRO A N     1 
ATOM   3984  C  CA    . PRO A 1 526  ? -27.657 -108.697 22.418  1.00 21.15 ? 527  PRO A CA    1 
ATOM   3985  C  C     . PRO A 1 526  ? -27.993 -109.653 23.575  1.00 21.12 ? 527  PRO A C     1 
ATOM   3986  O  O     . PRO A 1 526  ? -29.140 -109.735 24.031  1.00 21.17 ? 527  PRO A O     1 
ATOM   3987  C  CB    . PRO A 1 526  ? -27.001 -107.410 22.924  1.00 21.38 ? 527  PRO A CB    1 
ATOM   3988  C  CG    . PRO A 1 526  ? -27.400 -106.405 21.890  1.00 21.56 ? 527  PRO A CG    1 
ATOM   3989  C  CD    . PRO A 1 526  ? -28.865 -106.735 21.692  1.00 21.22 ? 527  PRO A CD    1 
ATOM   3990  N  N     . SER A 1 527  ? -26.985 -110.369 24.060  1.00 21.12 ? 528  SER A N     1 
ATOM   3991  C  CA    . SER A 1 527  ? -27.210 -111.313 25.142  1.00 21.31 ? 528  SER A CA    1 
ATOM   3992  C  C     . SER A 1 527  ? -27.928 -110.644 26.300  1.00 21.16 ? 528  SER A C     1 
ATOM   3993  O  O     . SER A 1 527  ? -29.039 -111.050 26.661  1.00 21.87 ? 528  SER A O     1 
ATOM   3994  C  CB    . SER A 1 527  ? -25.890 -111.947 25.634  1.00 22.08 ? 528  SER A CB    1 
ATOM   3995  O  OG    . SER A 1 527  ? -24.968 -110.999 26.169  1.00 22.23 ? 528  SER A OG    1 
ATOM   3996  N  N     . GLY A 1 528  ? -27.321 -109.570 26.808  1.00 20.34 ? 529  GLY A N     1 
ATOM   3997  C  CA    . GLY A 1 528  ? -27.853 -108.844 27.945  1.00 19.19 ? 529  GLY A CA    1 
ATOM   3998  C  C     . GLY A 1 528  ? -29.323 -108.542 27.892  1.00 18.81 ? 529  GLY A C     1 
ATOM   3999  O  O     . GLY A 1 528  ? -30.004 -108.641 28.914  1.00 18.88 ? 529  GLY A O     1 
ATOM   4000  N  N     . ILE A 1 529  ? -29.812 -108.193 26.705  1.00 18.26 ? 530  ILE A N     1 
ATOM   4001  C  CA    . ILE A 1 529  ? -31.212 -107.855 26.514  1.00 17.63 ? 530  ILE A CA    1 
ATOM   4002  C  C     . ILE A 1 529  ? -32.129 -109.057 26.540  1.00 17.78 ? 530  ILE A C     1 
ATOM   4003  O  O     . ILE A 1 529  ? -33.144 -109.021 27.226  1.00 17.73 ? 530  ILE A O     1 
ATOM   4004  C  CB    . ILE A 1 529  ? -31.436 -106.993 25.236  1.00 17.57 ? 530  ILE A CB    1 
ATOM   4005  C  CG1   . ILE A 1 529  ? -31.132 -105.517 25.537  1.00 17.14 ? 530  ILE A CG1   1 
ATOM   4006  C  CG2   . ILE A 1 529  ? -32.863 -107.125 24.721  1.00 17.85 ? 530  ILE A CG2   1 
ATOM   4007  C  CD1   . ILE A 1 529  ? -31.632 -104.556 24.479  1.00 16.11 ? 530  ILE A CD1   1 
ATOM   4008  N  N     . LYS A 1 530  ? -31.786 -110.122 25.819  1.00 17.86 ? 531  LYS A N     1 
ATOM   4009  C  CA    . LYS A 1 530  ? -32.630 -111.324 25.813  1.00 18.16 ? 531  LYS A CA    1 
ATOM   4010  C  C     . LYS A 1 530  ? -32.795 -111.786 27.241  1.00 18.31 ? 531  LYS A C     1 
ATOM   4011  O  O     . LYS A 1 530  ? -33.883 -112.118 27.697  1.00 18.85 ? 531  LYS A O     1 
ATOM   4012  C  CB    . LYS A 1 530  ? -31.972 -112.443 25.027  1.00 17.75 ? 531  LYS A CB    1 
ATOM   4013  C  CG    . LYS A 1 530  ? -31.341 -111.967 23.758  1.00 18.41 ? 531  LYS A CG    1 
ATOM   4014  C  CD    . LYS A 1 530  ? -31.295 -113.060 22.730  1.00 18.38 ? 531  LYS A CD    1 
ATOM   4015  C  CE    . LYS A 1 530  ? -30.706 -112.529 21.454  1.00 17.94 ? 531  LYS A CE    1 
ATOM   4016  N  NZ    . LYS A 1 530  ? -30.914 -113.497 20.373  1.00 18.67 ? 531  LYS A NZ    1 
ATOM   4017  N  N     . ARG A 1 531  ? -31.678 -111.792 27.942  1.00 18.45 ? 532  ARG A N     1 
ATOM   4018  C  CA    . ARG A 1 531  ? -31.623 -112.170 29.331  1.00 18.21 ? 532  ARG A CA    1 
ATOM   4019  C  C     . ARG A 1 531  ? -32.524 -111.264 30.156  1.00 17.41 ? 532  ARG A C     1 
ATOM   4020  O  O     . ARG A 1 531  ? -33.370 -111.741 30.903  1.00 17.30 ? 532  ARG A O     1 
ATOM   4021  C  CB    . ARG A 1 531  ? -30.199 -111.992 29.799  1.00 19.45 ? 532  ARG A CB    1 
ATOM   4022  C  CG    . ARG A 1 531  ? -29.694 -113.157 30.554  1.00 21.89 ? 532  ARG A CG    1 
ATOM   4023  C  CD    . ARG A 1 531  ? -28.418 -113.624 29.933  1.00 23.77 ? 532  ARG A CD    1 
ATOM   4024  N  NE    . ARG A 1 531  ? -27.463 -112.533 29.814  1.00 25.51 ? 532  ARG A NE    1 
ATOM   4025  C  CZ    . ARG A 1 531  ? -26.149 -112.693 29.887  1.00 26.64 ? 532  ARG A CZ    1 
ATOM   4026  N  NH1   . ARG A 1 531  ? -25.648 -113.911 30.083  1.00 26.21 ? 532  ARG A NH1   1 
ATOM   4027  N  NH2   . ARG A 1 531  ? -25.343 -111.638 29.750  1.00 27.75 ? 532  ARG A NH2   1 
ATOM   4028  N  N     . THR A 1 532  ? -32.314 -109.955 30.017  1.00 16.43 ? 533  THR A N     1 
ATOM   4029  C  CA    . THR A 1 532  ? -33.074 -108.944 30.731  1.00 15.37 ? 533  THR A CA    1 
ATOM   4030  C  C     . THR A 1 532  ? -34.533 -109.178 30.490  1.00 14.68 ? 533  THR A C     1 
ATOM   4031  O  O     . THR A 1 532  ? -35.320 -109.261 31.424  1.00 15.07 ? 533  THR A O     1 
ATOM   4032  C  CB    . THR A 1 532  ? -32.726 -107.542 30.236  1.00 15.60 ? 533  THR A CB    1 
ATOM   4033  O  OG1   . THR A 1 532  ? -31.497 -107.117 30.830  1.00 15.56 ? 533  THR A OG1   1 
ATOM   4034  C  CG2   . THR A 1 532  ? -33.822 -106.547 30.577  1.00 15.83 ? 533  THR A CG2   1 
ATOM   4035  N  N     . ILE A 1 533  ? -34.888 -109.312 29.224  1.00 13.84 ? 534  ILE A N     1 
ATOM   4036  C  CA    . ILE A 1 533  ? -36.264 -109.553 28.831  1.00 13.62 ? 534  ILE A CA    1 
ATOM   4037  C  C     . ILE A 1 533  ? -36.786 -110.801 29.539  1.00 13.45 ? 534  ILE A C     1 
ATOM   4038  O  O     . ILE A 1 533  ? -37.897 -110.815 30.036  1.00 13.46 ? 534  ILE A O     1 
ATOM   4039  C  CB    . ILE A 1 533  ? -36.352 -109.705 27.293  1.00 13.33 ? 534  ILE A CB    1 
ATOM   4040  C  CG1   . ILE A 1 533  ? -36.019 -108.367 26.626  1.00 12.82 ? 534  ILE A CG1   1 
ATOM   4041  C  CG2   . ILE A 1 533  ? -37.709 -110.227 26.867  1.00 12.63 ? 534  ILE A CG2   1 
ATOM   4042  C  CD1   . ILE A 1 533  ? -35.810 -108.475 25.141  1.00 12.68 ? 534  ILE A CD1   1 
ATOM   4043  N  N     . ALA A 1 534  ? -35.908 -111.775 29.720  1.00 13.97 ? 535  ALA A N     1 
ATOM   4044  C  CA    . ALA A 1 534  ? -36.254 -113.039 30.347  1.00 14.42 ? 535  ALA A CA    1 
ATOM   4045  C  C     . ALA A 1 534  ? -36.408 -113.104 31.871  1.00 14.75 ? 535  ALA A C     1 
ATOM   4046  O  O     . ALA A 1 534  ? -37.501 -113.353 32.352  1.00 14.83 ? 535  ALA A O     1 
ATOM   4047  C  CB    . ALA A 1 534  ? -35.302 -114.114 29.872  1.00 14.84 ? 535  ALA A CB    1 
ATOM   4048  N  N     . ASN A 1 535  ? -35.333 -112.903 32.634  1.00 15.00 ? 536  ASN A N     1 
ATOM   4049  C  CA    . ASN A 1 535  ? -35.417 -112.997 34.101  1.00 15.24 ? 536  ASN A CA    1 
ATOM   4050  C  C     . ASN A 1 535  ? -36.394 -112.007 34.713  1.00 15.57 ? 536  ASN A C     1 
ATOM   4051  O  O     . ASN A 1 535  ? -36.987 -112.280 35.770  1.00 16.52 ? 536  ASN A O     1 
ATOM   4052  C  CB    . ASN A 1 535  ? -34.051 -112.811 34.754  1.00 15.52 ? 536  ASN A CB    1 
ATOM   4053  C  CG    . ASN A 1 535  ? -32.936 -113.440 33.959  1.00 16.24 ? 536  ASN A CG    1 
ATOM   4054  O  OD1   . ASN A 1 535  ? -32.259 -112.746 33.204  1.00 16.77 ? 536  ASN A OD1   1 
ATOM   4055  N  ND2   . ASN A 1 535  ? -32.730 -114.755 34.116  1.00 16.16 ? 536  ASN A ND2   1 
ATOM   4056  N  N     . LYS A 1 536  ? -36.533 -110.841 34.086  1.00 15.00 ? 537  LYS A N     1 
ATOM   4057  C  CA    . LYS A 1 536  ? -37.460 -109.835 34.582  1.00 14.19 ? 537  LYS A CA    1 
ATOM   4058  C  C     . LYS A 1 536  ? -38.900 -110.131 34.134  1.00 14.07 ? 537  LYS A C     1 
ATOM   4059  O  O     . LYS A 1 536  ? -39.841 -109.424 34.491  1.00 14.04 ? 537  LYS A O     1 
ATOM   4060  C  CB    . LYS A 1 536  ? -37.011 -108.450 34.140  1.00 13.88 ? 537  LYS A CB    1 
ATOM   4061  C  CG    . LYS A 1 536  ? -36.016 -107.792 35.070  1.00 13.13 ? 537  LYS A CG    1 
ATOM   4062  C  CD    . LYS A 1 536  ? -35.690 -106.402 34.575  1.00 12.72 ? 537  LYS A CD    1 
ATOM   4063  C  CE    . LYS A 1 536  ? -35.109 -105.525 35.668  1.00 12.92 ? 537  LYS A CE    1 
ATOM   4064  N  NZ    . LYS A 1 536  ? -34.626 -104.201 35.145  1.00 13.27 ? 537  LYS A NZ    1 
ATOM   4065  N  N     . LYS A 1 537  ? -39.054 -111.190 33.346  1.00 13.79 ? 538  LYS A N     1 
ATOM   4066  C  CA    . LYS A 1 537  ? -40.351 -111.627 32.854  1.00 13.61 ? 538  LYS A CA    1 
ATOM   4067  C  C     . LYS A 1 537  ? -41.147 -110.610 32.050  1.00 13.22 ? 538  LYS A C     1 
ATOM   4068  O  O     . LYS A 1 537  ? -42.373 -110.637 32.056  1.00 13.69 ? 538  LYS A O     1 
ATOM   4069  C  CB    . LYS A 1 537  ? -41.184 -112.181 34.006  1.00 14.18 ? 538  LYS A CB    1 
ATOM   4070  C  CG    . LYS A 1 537  ? -40.867 -113.654 34.349  1.00 16.22 ? 538  LYS A CG    1 
ATOM   4071  C  CD    . LYS A 1 537  ? -39.922 -113.842 35.567  1.00 17.82 ? 538  LYS A CD    1 
ATOM   4072  C  CE    . LYS A 1 537  ? -38.669 -114.719 35.249  1.00 18.57 ? 538  LYS A CE    1 
ATOM   4073  N  NZ    . LYS A 1 537  ? -38.907 -116.069 34.594  1.00 19.24 ? 538  LYS A NZ    1 
ATOM   4074  N  N     . LEU A 1 538  ? -40.444 -109.775 31.287  1.00 12.54 ? 539  LEU A N     1 
ATOM   4075  C  CA    . LEU A 1 538  ? -41.064 -108.726 30.459  1.00 11.70 ? 539  LEU A CA    1 
ATOM   4076  C  C     . LEU A 1 538  ? -42.157 -109.181 29.490  1.00 11.68 ? 539  LEU A C     1 
ATOM   4077  O  O     . LEU A 1 538  ? -42.351 -110.364 29.250  1.00 12.00 ? 539  LEU A O     1 
ATOM   4078  C  CB    . LEU A 1 538  ? -40.009 -107.995 29.615  1.00 9.76  ? 539  LEU A CB    1 
ATOM   4079  C  CG    . LEU A 1 538  ? -38.793 -107.359 30.246  1.00 7.93  ? 539  LEU A CG    1 
ATOM   4080  C  CD1   . LEU A 1 538  ? -38.403 -106.193 29.402  1.00 6.86  ? 539  LEU A CD1   1 
ATOM   4081  C  CD2   . LEU A 1 538  ? -39.115 -106.906 31.629  1.00 7.65  ? 539  LEU A CD2   1 
ATOM   4082  N  N     . LYS A 1 539  ? -42.896 -108.209 28.981  1.00 11.41 ? 540  LYS A N     1 
ATOM   4083  C  CA    . LYS A 1 539  ? -43.912 -108.468 27.996  1.00 11.27 ? 540  LYS A CA    1 
ATOM   4084  C  C     . LYS A 1 539  ? -43.302 -107.825 26.776  1.00 11.25 ? 540  LYS A C     1 
ATOM   4085  O  O     . LYS A 1 539  ? -43.484 -106.652 26.508  1.00 12.06 ? 540  LYS A O     1 
ATOM   4086  C  CB    . LYS A 1 539  ? -45.217 -107.783 28.353  1.00 11.42 ? 540  LYS A CB    1 
ATOM   4087  C  CG    . LYS A 1 539  ? -46.090 -108.557 29.279  1.00 11.87 ? 540  LYS A CG    1 
ATOM   4088  C  CD    . LYS A 1 539  ? -47.466 -107.944 29.268  1.00 12.47 ? 540  LYS A CD    1 
ATOM   4089  C  CE    . LYS A 1 539  ? -48.350 -108.561 30.336  1.00 13.00 ? 540  LYS A CE    1 
ATOM   4090  N  NZ    . LYS A 1 539  ? -49.676 -107.867 30.459  1.00 13.42 ? 540  LYS A NZ    1 
ATOM   4091  N  N     . PHE A 1 540  ? -42.509 -108.583 26.063  1.00 11.13 ? 541  PHE A N     1 
ATOM   4092  C  CA    . PHE A 1 540  ? -41.854 -108.053 24.904  1.00 11.27 ? 541  PHE A CA    1 
ATOM   4093  C  C     . PHE A 1 540  ? -42.801 -108.031 23.721  1.00 11.79 ? 541  PHE A C     1 
ATOM   4094  O  O     . PHE A 1 540  ? -43.425 -109.049 23.450  1.00 12.40 ? 541  PHE A O     1 
ATOM   4095  C  CB    . PHE A 1 540  ? -40.672 -108.959 24.600  1.00 10.91 ? 541  PHE A CB    1 
ATOM   4096  C  CG    . PHE A 1 540  ? -39.751 -108.432 23.572  1.00 11.55 ? 541  PHE A CG    1 
ATOM   4097  C  CD1   . PHE A 1 540  ? -39.718 -107.081 23.265  1.00 11.18 ? 541  PHE A CD1   1 
ATOM   4098  C  CD2   . PHE A 1 540  ? -38.880 -109.282 22.925  1.00 11.50 ? 541  PHE A CD2   1 
ATOM   4099  C  CE1   . PHE A 1 540  ? -38.828 -106.592 22.337  1.00 10.78 ? 541  PHE A CE1   1 
ATOM   4100  C  CE2   . PHE A 1 540  ? -37.991 -108.791 21.996  1.00 11.51 ? 541  PHE A CE2   1 
ATOM   4101  C  CZ    . PHE A 1 540  ? -37.966 -107.440 21.704  1.00 10.87 ? 541  PHE A CZ    1 
ATOM   4102  N  N     . TYR A 1 541  ? -42.962 -106.871 23.072  1.00 11.81 ? 542  TYR A N     1 
ATOM   4103  C  CA    . TYR A 1 541  ? -43.784 -106.749 21.856  1.00 12.20 ? 542  TYR A CA    1 
ATOM   4104  C  C     . TYR A 1 541  ? -42.901 -106.188 20.773  1.00 12.69 ? 542  TYR A C     1 
ATOM   4105  O  O     . TYR A 1 541  ? -42.372 -105.111 20.953  1.00 13.60 ? 542  TYR A O     1 
ATOM   4106  C  CB    . TYR A 1 541  ? -44.922 -105.739 21.994  1.00 11.81 ? 542  TYR A CB    1 
ATOM   4107  C  CG    . TYR A 1 541  ? -45.925 -106.088 23.026  1.00 12.00 ? 542  TYR A CG    1 
ATOM   4108  C  CD1   . TYR A 1 541  ? -45.621 -105.905 24.357  1.00 12.91 ? 542  TYR A CD1   1 
ATOM   4109  C  CD2   . TYR A 1 541  ? -47.155 -106.643 22.690  1.00 11.28 ? 542  TYR A CD2   1 
ATOM   4110  C  CE1   . TYR A 1 541  ? -46.506 -106.263 25.348  1.00 13.17 ? 542  TYR A CE1   1 
ATOM   4111  C  CE2   . TYR A 1 541  ? -48.052 -107.011 23.671  1.00 12.01 ? 542  TYR A CE2   1 
ATOM   4112  C  CZ    . TYR A 1 541  ? -47.710 -106.817 25.013  1.00 12.84 ? 542  TYR A CZ    1 
ATOM   4113  O  OH    . TYR A 1 541  ? -48.520 -107.168 26.066  1.00 13.33 ? 542  TYR A OH    1 
ATOM   4114  N  N     . ASN A 1 542  ? -42.700 -106.900 19.670  1.00 13.27 ? 543  ASN A N     1 
ATOM   4115  C  CA    . ASN A 1 542  ? -41.900 -106.330 18.596  1.00 13.86 ? 543  ASN A CA    1 
ATOM   4116  C  C     . ASN A 1 542  ? -42.870 -105.850 17.535  1.00 14.59 ? 543  ASN A C     1 
ATOM   4117  O  O     . ASN A 1 542  ? -43.920 -106.472 17.319  1.00 15.58 ? 543  ASN A O     1 
ATOM   4118  C  CB    . ASN A 1 542  ? -40.929 -107.338 17.978  1.00 13.83 ? 543  ASN A CB    1 
ATOM   4119  C  CG    . ASN A 1 542  ? -40.318 -106.833 16.649  1.00 14.88 ? 543  ASN A CG    1 
ATOM   4120  O  OD1   . ASN A 1 542  ? -39.190 -106.319 16.601  1.00 14.41 ? 543  ASN A OD1   1 
ATOM   4121  N  ND2   . ASN A 1 542  ? -41.082 -106.973 15.567  1.00 15.35 ? 543  ASN A ND2   1 
ATOM   4122  N  N     . ILE A 1 543  ? -42.550 -104.725 16.904  1.00 14.64 ? 544  ILE A N     1 
ATOM   4123  C  CA    . ILE A 1 543  ? -43.388 -104.192 15.844  1.00 14.64 ? 544  ILE A CA    1 
ATOM   4124  C  C     . ILE A 1 543  ? -42.533 -103.548 14.756  1.00 14.85 ? 544  ILE A C     1 
ATOM   4125  O  O     . ILE A 1 543  ? -41.580 -102.813 15.037  1.00 14.40 ? 544  ILE A O     1 
ATOM   4126  C  CB    . ILE A 1 543  ? -44.476 -103.210 16.370  1.00 14.52 ? 544  ILE A CB    1 
ATOM   4127  C  CG1   . ILE A 1 543  ? -45.321 -102.701 15.208  1.00 14.90 ? 544  ILE A CG1   1 
ATOM   4128  C  CG2   . ILE A 1 543  ? -43.861 -102.033 17.039  1.00 14.06 ? 544  ILE A CG2   1 
ATOM   4129  C  CD1   . ILE A 1 543  ? -46.468 -101.829 15.635  1.00 15.31 ? 544  ILE A CD1   1 
ATOM   4130  N  N     . ASP A 1 544  ? -42.851 -103.903 13.514  1.00 15.08 ? 545  ASP A N     1 
ATOM   4131  C  CA    . ASP A 1 544  ? -42.161 -103.408 12.336  1.00 15.26 ? 545  ASP A CA    1 
ATOM   4132  C  C     . ASP A 1 544  ? -42.940 -102.199 11.847  1.00 15.24 ? 545  ASP A C     1 
ATOM   4133  O  O     . ASP A 1 544  ? -43.532 -102.205 10.767  1.00 14.83 ? 545  ASP A O     1 
ATOM   4134  C  CB    . ASP A 1 544  ? -42.129 -104.504 11.273  1.00 16.02 ? 545  ASP A CB    1 
ATOM   4135  C  CG    . ASP A 1 544  ? -41.372 -104.105 10.012  1.00 17.01 ? 545  ASP A CG    1 
ATOM   4136  O  OD1   . ASP A 1 544  ? -41.123 -102.906 9.745   1.00 18.01 ? 545  ASP A OD1   1 
ATOM   4137  O  OD2   . ASP A 1 544  ? -41.030 -105.030 9.250   1.00 18.07 ? 545  ASP A OD2   1 
ATOM   4138  N  N     . ALA A 1 545  ? -42.935 -101.160 12.670  1.00 15.37 ? 546  ALA A N     1 
ATOM   4139  C  CA    . ALA A 1 545  ? -43.616 -99.909  12.367  1.00 15.43 ? 546  ALA A CA    1 
ATOM   4140  C  C     . ALA A 1 545  ? -43.338 -99.377  10.953  1.00 15.35 ? 546  ALA A C     1 
ATOM   4141  O  O     . ALA A 1 545  ? -44.259 -98.960  10.258  1.00 15.49 ? 546  ALA A O     1 
ATOM   4142  C  CB    . ALA A 1 545  ? -43.243 -98.855  13.418  1.00 14.95 ? 546  ALA A CB    1 
ATOM   4143  N  N     . VAL A 1 546  ? -42.090 -99.462  10.508  1.00 15.28 ? 547  VAL A N     1 
ATOM   4144  C  CA    . VAL A 1 546  ? -41.714 -98.941  9.201   1.00 15.82 ? 547  VAL A CA    1 
ATOM   4145  C  C     . VAL A 1 546  ? -42.599 -99.456  8.087   1.00 16.42 ? 547  VAL A C     1 
ATOM   4146  O  O     . VAL A 1 546  ? -43.176 -98.682  7.318   1.00 16.44 ? 547  VAL A O     1 
ATOM   4147  C  CB    . VAL A 1 546  ? -40.289 -99.304  8.845   1.00 15.89 ? 547  VAL A CB    1 
ATOM   4148  C  CG1   . VAL A 1 546  ? -39.830 -98.446  7.679   1.00 15.28 ? 547  VAL A CG1   1 
ATOM   4149  C  CG2   . VAL A 1 546  ? -39.382 -99.176  10.068  1.00 16.00 ? 547  VAL A CG2   1 
ATOM   4150  N  N     . LYS A 1 547  ? -42.681 -100.779 8.012   1.00 16.91 ? 548  LYS A N     1 
ATOM   4151  C  CA    . LYS A 1 547  ? -43.491 -101.490 7.027   1.00 17.30 ? 548  LYS A CA    1 
ATOM   4152  C  C     . LYS A 1 547  ? -44.996 -101.229 7.178   1.00 16.80 ? 548  LYS A C     1 
ATOM   4153  O  O     . LYS A 1 547  ? -45.669 -100.956 6.201   1.00 16.79 ? 548  LYS A O     1 
ATOM   4154  C  CB    . LYS A 1 547  ? -43.209 -102.992 7.135   1.00 18.52 ? 548  LYS A CB    1 
ATOM   4155  C  CG    . LYS A 1 547  ? -44.218 -103.882 6.443   1.00 19.38 ? 548  LYS A CG    1 
ATOM   4156  C  CD    . LYS A 1 547  ? -44.083 -105.297 6.955   1.00 21.01 ? 548  LYS A CD    1 
ATOM   4157  C  CE    . LYS A 1 547  ? -45.085 -106.216 6.303   1.00 21.97 ? 548  LYS A CE    1 
ATOM   4158  N  NZ    . LYS A 1 547  ? -44.864 -106.139 4.836   1.00 24.05 ? 548  LYS A NZ    1 
ATOM   4159  N  N     . ILE A 1 548  ? -45.542 -101.356 8.380   1.00 15.98 ? 549  ILE A N     1 
ATOM   4160  C  CA    . ILE A 1 548  ? -46.958 -101.086 8.544   1.00 15.52 ? 549  ILE A CA    1 
ATOM   4161  C  C     . ILE A 1 548  ? -47.261 -99.653  8.088   1.00 16.14 ? 549  ILE A C     1 
ATOM   4162  O  O     . ILE A 1 548  ? -48.313 -99.373  7.523   1.00 16.31 ? 549  ILE A O     1 
ATOM   4163  C  CB    . ILE A 1 548  ? -47.402 -101.226 9.991   1.00 14.20 ? 549  ILE A CB    1 
ATOM   4164  C  CG1   . ILE A 1 548  ? -46.960 -102.566 10.559  1.00 13.11 ? 549  ILE A CG1   1 
ATOM   4165  C  CG2   . ILE A 1 548  ? -48.899 -101.160 10.054  1.00 14.12 ? 549  ILE A CG2   1 
ATOM   4166  C  CD1   . ILE A 1 548  ? -47.373 -102.770 11.987  1.00 11.83 ? 549  ILE A CD1   1 
ATOM   4167  N  N     . ALA A 1 549  ? -46.321 -98.748  8.316   1.00 16.68 ? 550  ALA A N     1 
ATOM   4168  C  CA    . ALA A 1 549  ? -46.513 -97.367  7.920   1.00 17.28 ? 550  ALA A CA    1 
ATOM   4169  C  C     . ALA A 1 549  ? -46.467 -97.268  6.412   1.00 17.78 ? 550  ALA A C     1 
ATOM   4170  O  O     . ALA A 1 549  ? -47.230 -96.527  5.798   1.00 17.95 ? 550  ALA A O     1 
ATOM   4171  C  CB    . ALA A 1 549  ? -45.454 -96.499  8.531   1.00 17.22 ? 550  ALA A CB    1 
ATOM   4172  N  N     . THR A 1 550  ? -45.564 -98.013  5.802   1.00 18.53 ? 551  THR A N     1 
ATOM   4173  C  CA    . THR A 1 550  ? -45.452 -97.969  4.354   1.00 19.77 ? 551  THR A CA    1 
ATOM   4174  C  C     . THR A 1 550  ? -46.692 -98.606  3.759   1.00 20.34 ? 551  THR A C     1 
ATOM   4175  O  O     . THR A 1 550  ? -47.304 -98.075  2.837   1.00 20.30 ? 551  THR A O     1 
ATOM   4176  C  CB    . THR A 1 550  ? -44.256 -98.752  3.868   1.00 19.83 ? 551  THR A CB    1 
ATOM   4177  O  OG1   . THR A 1 550  ? -43.163 -98.563  4.774   1.00 20.51 ? 551  THR A OG1   1 
ATOM   4178  C  CG2   . THR A 1 550  ? -43.868 -98.288  2.487   1.00 19.90 ? 551  THR A CG2   1 
ATOM   4179  N  N     . ASP A 1 551  ? -47.054 -99.748  4.332   1.00 20.88 ? 552  ASP A N     1 
ATOM   4180  C  CA    . ASP A 1 551  ? -48.201 -100.520 3.917   1.00 21.31 ? 552  ASP A CA    1 
ATOM   4181  C  C     . ASP A 1 551  ? -49.450 -99.655  3.931   1.00 21.47 ? 552  ASP A C     1 
ATOM   4182  O  O     . ASP A 1 551  ? -50.059 -99.400  2.878   1.00 21.61 ? 552  ASP A O     1 
ATOM   4183  C  CB    . ASP A 1 551  ? -48.389 -101.725 4.845   1.00 21.83 ? 552  ASP A CB    1 
ATOM   4184  C  CG    . ASP A 1 551  ? -47.485 -102.908 4.488   1.00 23.24 ? 552  ASP A CG    1 
ATOM   4185  O  OD1   . ASP A 1 551  ? -46.708 -102.829 3.505   1.00 23.54 ? 552  ASP A OD1   1 
ATOM   4186  O  OD2   . ASP A 1 551  ? -47.566 -103.943 5.192   1.00 24.34 ? 552  ASP A OD2   1 
ATOM   4187  N  N     . VAL A 1 552  ? -49.800 -99.146  5.109   1.00 21.42 ? 553  VAL A N     1 
ATOM   4188  C  CA    . VAL A 1 552  ? -50.991 -98.321  5.231   1.00 21.51 ? 553  VAL A CA    1 
ATOM   4189  C  C     . VAL A 1 552  ? -50.877 -97.003  4.469   1.00 21.80 ? 553  VAL A C     1 
ATOM   4190  O  O     . VAL A 1 552  ? -51.766 -96.149  4.531   1.00 22.19 ? 553  VAL A O     1 
ATOM   4191  C  CB    . VAL A 1 552  ? -51.437 -98.127  6.696   1.00 21.19 ? 553  VAL A CB    1 
ATOM   4192  C  CG1   . VAL A 1 552  ? -51.689 -99.484  7.331   1.00 21.45 ? 553  VAL A CG1   1 
ATOM   4193  C  CG2   . VAL A 1 552  ? -50.423 -97.322  7.482   1.00 21.18 ? 553  VAL A CG2   1 
ATOM   4194  N  N     . GLY A 1 553  ? -49.778 -96.851  3.737   1.00 21.86 ? 554  GLY A N     1 
ATOM   4195  C  CA    . GLY A 1 553  ? -49.598 -95.671  2.918   1.00 21.95 ? 554  GLY A CA    1 
ATOM   4196  C  C     . GLY A 1 553  ? -48.844 -94.506  3.494   1.00 21.92 ? 554  GLY A C     1 
ATOM   4197  O  O     . GLY A 1 553  ? -48.481 -93.606  2.751   1.00 22.17 ? 554  GLY A O     1 
ATOM   4198  N  N     . LEU A 1 554  ? -48.591 -94.518  4.798   1.00 21.84 ? 555  LEU A N     1 
ATOM   4199  C  CA    . LEU A 1 554  ? -47.895 -93.420  5.451   1.00 21.50 ? 555  LEU A CA    1 
ATOM   4200  C  C     . LEU A 1 554  ? -46.409 -93.333  5.159   1.00 21.70 ? 555  LEU A C     1 
ATOM   4201  O  O     . LEU A 1 554  ? -45.652 -92.799  5.966   1.00 22.41 ? 555  LEU A O     1 
ATOM   4202  C  CB    . LEU A 1 554  ? -48.141 -93.455  6.952   1.00 20.89 ? 555  LEU A CB    1 
ATOM   4203  C  CG    . LEU A 1 554  ? -49.590 -93.173  7.322   1.00 21.12 ? 555  LEU A CG    1 
ATOM   4204  C  CD1   . LEU A 1 554  ? -49.750 -93.227  8.820   1.00 21.70 ? 555  LEU A CD1   1 
ATOM   4205  C  CD2   . LEU A 1 554  ? -50.014 -91.819  6.800   1.00 21.12 ? 555  LEU A CD2   1 
ATOM   4206  N  N     . GLY A 1 555  ? -45.995 -93.844  4.005   1.00 21.42 ? 556  GLY A N     1 
ATOM   4207  C  CA    . GLY A 1 555  ? -44.590 -93.793  3.629   1.00 21.13 ? 556  GLY A CA    1 
ATOM   4208  C  C     . GLY A 1 555  ? -43.583 -94.026  4.740   1.00 20.67 ? 556  GLY A C     1 
ATOM   4209  O  O     . GLY A 1 555  ? -42.860 -93.115  5.114   1.00 20.67 ? 556  GLY A O     1 
ATOM   4210  N  N     . GLY A 1 556  ? -43.576 -95.227  5.301   1.00 20.48 ? 557  GLY A N     1 
ATOM   4211  C  CA    . GLY A 1 556  ? -42.641 -95.546  6.360   1.00 20.38 ? 557  GLY A CA    1 
ATOM   4212  C  C     . GLY A 1 556  ? -42.470 -94.541  7.488   1.00 20.28 ? 557  GLY A C     1 
ATOM   4213  O  O     . GLY A 1 556  ? -41.345 -94.337  7.942   1.00 21.00 ? 557  GLY A O     1 
ATOM   4214  N  N     . ARG A 1 557  ? -43.533 -93.855  7.896   1.00 20.06 ? 558  ARG A N     1 
ATOM   4215  C  CA    . ARG A 1 557  ? -43.410 -92.927  9.014   1.00 19.82 ? 558  ARG A CA    1 
ATOM   4216  C  C     . ARG A 1 557  ? -44.047 -93.541  10.248  1.00 18.77 ? 558  ARG A C     1 
ATOM   4217  O  O     . ARG A 1 557  ? -45.259 -93.491  10.446  1.00 18.88 ? 558  ARG A O     1 
ATOM   4218  C  CB    . ARG A 1 557  ? -43.969 -91.534  8.700   1.00 21.53 ? 558  ARG A CB    1 
ATOM   4219  C  CG    . ARG A 1 557  ? -42.850 -90.548  8.324   1.00 24.16 ? 558  ARG A CG    1 
ATOM   4220  C  CD    . ARG A 1 557  ? -43.177 -89.072  8.600   1.00 26.86 ? 558  ARG A CD    1 
ATOM   4221  N  NE    . ARG A 1 557  ? -42.084 -88.202  8.139   1.00 29.37 ? 558  ARG A NE    1 
ATOM   4222  C  CZ    . ARG A 1 557  ? -42.249 -86.993  7.594   1.00 30.58 ? 558  ARG A CZ    1 
ATOM   4223  N  NH1   . ARG A 1 557  ? -43.474 -86.477  7.455   1.00 31.63 ? 558  ARG A NH1   1 
ATOM   4224  N  NH2   . ARG A 1 557  ? -41.202 -86.342  7.085   1.00 30.98 ? 558  ARG A NH2   1 
ATOM   4225  N  N     . ILE A 1 558  ? -43.182 -94.107  11.080  1.00 17.21 ? 559  ILE A N     1 
ATOM   4226  C  CA    . ILE A 1 558  ? -43.546 -94.809  12.304  1.00 15.76 ? 559  ILE A CA    1 
ATOM   4227  C  C     . ILE A 1 558  ? -44.244 -94.103  13.454  1.00 15.92 ? 559  ILE A C     1 
ATOM   4228  O  O     . ILE A 1 558  ? -44.703 -94.767  14.381  1.00 15.69 ? 559  ILE A O     1 
ATOM   4229  C  CB    . ILE A 1 558  ? -42.310 -95.411  12.918  1.00 14.79 ? 559  ILE A CB    1 
ATOM   4230  C  CG1   . ILE A 1 558  ? -41.459 -94.313  13.562  1.00 13.31 ? 559  ILE A CG1   1 
ATOM   4231  C  CG2   . ILE A 1 558  ? -41.539 -96.133  11.853  1.00 14.89 ? 559  ILE A CG2   1 
ATOM   4232  C  CD1   . ILE A 1 558  ? -40.452 -94.816  14.530  1.00 12.15 ? 559  ILE A CD1   1 
ATOM   4233  N  N     . ASN A 1 559  ? -44.325 -92.783  13.437  1.00 16.08 ? 560  ASN A N     1 
ATOM   4234  C  CA    . ASN A 1 559  ? -44.929 -92.118  14.578  1.00 16.62 ? 560  ASN A CA    1 
ATOM   4235  C  C     . ASN A 1 559  ? -46.310 -92.555  15.060  1.00 16.68 ? 560  ASN A C     1 
ATOM   4236  O  O     . ASN A 1 559  ? -46.471 -92.946  16.216  1.00 16.78 ? 560  ASN A O     1 
ATOM   4237  C  CB    . ASN A 1 559  ? -44.840 -90.594  14.462  1.00 17.04 ? 560  ASN A CB    1 
ATOM   4238  C  CG    . ASN A 1 559  ? -45.361 -90.064  13.157  1.00 17.30 ? 560  ASN A CG    1 
ATOM   4239  O  OD1   . ASN A 1 559  ? -46.432 -89.463  13.110  1.00 17.10 ? 560  ASN A OD1   1 
ATOM   4240  N  ND2   . ASN A 1 559  ? -44.572 -90.215  12.096  1.00 17.69 ? 560  ASN A ND2   1 
ATOM   4241  N  N     . MET A 1 560  ? -47.287 -92.559  14.172  1.00 16.84 ? 561  MET A N     1 
ATOM   4242  C  CA    . MET A 1 560  ? -48.652 -92.914  14.552  1.00 16.66 ? 561  MET A CA    1 
ATOM   4243  C  C     . MET A 1 560  ? -48.802 -94.356  15.045  1.00 16.43 ? 561  MET A C     1 
ATOM   4244  O  O     . MET A 1 560  ? -49.708 -94.662  15.827  1.00 16.54 ? 561  MET A O     1 
ATOM   4245  C  CB    . MET A 1 560  ? -49.577 -92.648  13.364  1.00 17.39 ? 561  MET A CB    1 
ATOM   4246  C  CG    . MET A 1 560  ? -51.047 -92.532  13.697  1.00 18.27 ? 561  MET A CG    1 
ATOM   4247  S  SD    . MET A 1 560  ? -51.416 -91.314  14.983  1.00 19.91 ? 561  MET A SD    1 
ATOM   4248  C  CE    . MET A 1 560  ? -52.109 -92.435  16.215  1.00 19.47 ? 561  MET A CE    1 
ATOM   4249  N  N     . ILE A 1 561  ? -47.935 -95.245  14.559  1.00 15.73 ? 562  ILE A N     1 
ATOM   4250  C  CA    . ILE A 1 561  ? -47.967 -96.647  14.957  1.00 14.41 ? 562  ILE A CA    1 
ATOM   4251  C  C     . ILE A 1 561  ? -47.392 -96.777  16.359  1.00 14.32 ? 562  ILE A C     1 
ATOM   4252  O  O     . ILE A 1 561  ? -48.047 -97.335  17.229  1.00 15.08 ? 562  ILE A O     1 
ATOM   4253  C  CB    . ILE A 1 561  ? -47.160 -97.526  13.992  1.00 13.79 ? 562  ILE A CB    1 
ATOM   4254  C  CG1   . ILE A 1 561  ? -47.747 -97.409  12.591  1.00 13.99 ? 562  ILE A CG1   1 
ATOM   4255  C  CG2   . ILE A 1 561  ? -47.168 -98.967  14.455  1.00 12.86 ? 562  ILE A CG2   1 
ATOM   4256  C  CD1   . ILE A 1 561  ? -46.767 -97.708  11.503  1.00 14.46 ? 562  ILE A CD1   1 
ATOM   4257  N  N     . MET A 1 562  ? -46.192 -96.237  16.590  1.00 13.34 ? 563  MET A N     1 
ATOM   4258  C  CA    . MET A 1 562  ? -45.564 -96.314  17.906  1.00 12.25 ? 563  MET A CA    1 
ATOM   4259  C  C     . MET A 1 562  ? -46.378 -95.544  18.930  1.00 12.30 ? 563  MET A C     1 
ATOM   4260  O  O     . MET A 1 562  ? -46.117 -95.626  20.141  1.00 12.29 ? 563  MET A O     1 
ATOM   4261  C  CB    . MET A 1 562  ? -44.133 -95.773  17.882  1.00 11.82 ? 563  MET A CB    1 
ATOM   4262  C  CG    . MET A 1 562  ? -43.207 -96.429  16.887  1.00 10.20 ? 563  MET A CG    1 
ATOM   4263  S  SD    . MET A 1 562  ? -43.192 -98.216  17.039  1.00 9.75  ? 563  MET A SD    1 
ATOM   4264  C  CE    . MET A 1 562  ? -43.320 -98.454  18.825  1.00 8.94  ? 563  MET A CE    1 
ATOM   4265  N  N     . GLN A 1 563  ? -47.314 -94.740  18.428  1.00 12.24 ? 564  GLN A N     1 
ATOM   4266  C  CA    . GLN A 1 563  ? -48.222 -93.955  19.265  1.00 12.42 ? 564  GLN A CA    1 
ATOM   4267  C  C     . GLN A 1 563  ? -49.339 -94.907  19.686  1.00 12.48 ? 564  GLN A C     1 
ATOM   4268  O  O     . GLN A 1 563  ? -49.833 -94.861  20.815  1.00 12.82 ? 564  GLN A O     1 
ATOM   4269  C  CB    . GLN A 1 563  ? -48.822 -92.805  18.458  1.00 12.35 ? 564  GLN A CB    1 
ATOM   4270  C  CG    . GLN A 1 563  ? -49.984 -92.123  19.137  1.00 13.30 ? 564  GLN A CG    1 
ATOM   4271  C  CD    . GLN A 1 563  ? -49.549 -91.188  20.233  1.00 14.87 ? 564  GLN A CD    1 
ATOM   4272  O  OE1   . GLN A 1 563  ? -48.896 -91.601  21.202  1.00 15.70 ? 564  GLN A OE1   1 
ATOM   4273  N  NE2   . GLN A 1 563  ? -49.890 -89.903  20.084  1.00 14.92 ? 564  GLN A NE2   1 
ATOM   4274  N  N     . THR A 1 564  ? -49.727 -95.776  18.757  1.00 11.90 ? 565  THR A N     1 
ATOM   4275  C  CA    . THR A 1 564  ? -50.759 -96.749  19.002  1.00 11.19 ? 565  THR A CA    1 
ATOM   4276  C  C     . THR A 1 564  ? -50.286 -97.673  20.106  1.00 10.99 ? 565  THR A C     1 
ATOM   4277  O  O     . THR A 1 564  ? -50.940 -97.780  21.132  1.00 11.39 ? 565  THR A O     1 
ATOM   4278  C  CB    . THR A 1 564  ? -51.084 -97.515  17.724  1.00 11.18 ? 565  THR A CB    1 
ATOM   4279  O  OG1   . THR A 1 564  ? -51.612 -96.604  16.750  1.00 11.08 ? 565  THR A OG1   1 
ATOM   4280  C  CG2   . THR A 1 564  ? -52.096 -98.589  17.995  1.00 11.48 ? 565  THR A CG2   1 
ATOM   4281  N  N     . ALA A 1 565  ? -49.101 -98.249  19.949  1.00 10.92 ? 566  ALA A N     1 
ATOM   4282  C  CA    . ALA A 1 565  ? -48.543 -99.149  20.964  1.00 11.34 ? 566  ALA A CA    1 
ATOM   4283  C  C     . ALA A 1 565  ? -48.598 -98.557  22.377  1.00 11.65 ? 566  ALA A C     1 
ATOM   4284  O  O     . ALA A 1 565  ? -48.926 -99.255  23.340  1.00 11.94 ? 566  ALA A O     1 
ATOM   4285  C  CB    . ALA A 1 565  ? -47.108 -99.548  20.611  1.00 11.58 ? 566  ALA A CB    1 
ATOM   4286  N  N     . PHE A 1 566  ? -48.294 -97.269  22.506  1.00 11.67 ? 567  PHE A N     1 
ATOM   4287  C  CA    . PHE A 1 566  ? -48.344 -96.649  23.813  1.00 11.23 ? 567  PHE A CA    1 
ATOM   4288  C  C     . PHE A 1 566  ? -49.766 -96.799  24.325  1.00 11.35 ? 567  PHE A C     1 
ATOM   4289  O  O     . PHE A 1 566  ? -50.004 -97.632  25.176  1.00 11.31 ? 567  PHE A O     1 
ATOM   4290  C  CB    . PHE A 1 566  ? -47.914 -95.174  23.742  1.00 11.07 ? 567  PHE A CB    1 
ATOM   4291  C  CG    . PHE A 1 566  ? -48.291 -94.371  24.954  1.00 10.50 ? 567  PHE A CG    1 
ATOM   4292  C  CD1   . PHE A 1 566  ? -47.570 -94.484  26.120  1.00 10.19 ? 567  PHE A CD1   1 
ATOM   4293  C  CD2   . PHE A 1 566  ? -49.433 -93.566  24.943  1.00 10.41 ? 567  PHE A CD2   1 
ATOM   4294  C  CE1   . PHE A 1 566  ? -47.980 -93.825  27.262  1.00 10.29 ? 567  PHE A CE1   1 
ATOM   4295  C  CE2   . PHE A 1 566  ? -49.852 -92.906  26.074  1.00 9.94  ? 567  PHE A CE2   1 
ATOM   4296  C  CZ    . PHE A 1 566  ? -49.128 -93.036  27.236  1.00 10.04 ? 567  PHE A CZ    1 
ATOM   4297  N  N     . PHE A 1 567  ? -50.725 -96.116  23.693  1.00 11.60 ? 568  PHE A N     1 
ATOM   4298  C  CA    . PHE A 1 567  ? -52.132 -96.147  24.125  1.00 11.35 ? 568  PHE A CA    1 
ATOM   4299  C  C     . PHE A 1 567  ? -52.658 -97.506  24.464  1.00 11.91 ? 568  PHE A C     1 
ATOM   4300  O  O     . PHE A 1 567  ? -53.321 -97.682  25.485  1.00 12.78 ? 568  PHE A O     1 
ATOM   4301  C  CB    . PHE A 1 567  ? -53.040 -95.524  23.077  1.00 10.20 ? 568  PHE A CB    1 
ATOM   4302  C  CG    . PHE A 1 567  ? -53.075 -94.041  23.136  1.00 9.53  ? 568  PHE A CG    1 
ATOM   4303  C  CD1   . PHE A 1 567  ? -52.114 -93.287  22.500  1.00 9.58  ? 568  PHE A CD1   1 
ATOM   4304  C  CD2   . PHE A 1 567  ? -54.063 -93.386  23.853  1.00 9.32  ? 568  PHE A CD2   1 
ATOM   4305  C  CE1   . PHE A 1 567  ? -52.137 -91.907  22.575  1.00 9.32  ? 568  PHE A CE1   1 
ATOM   4306  C  CE2   . PHE A 1 567  ? -54.095 -91.996  23.932  1.00 8.83  ? 568  PHE A CE2   1 
ATOM   4307  C  CZ    . PHE A 1 567  ? -53.136 -91.258  23.294  1.00 8.97  ? 568  PHE A CZ    1 
ATOM   4308  N  N     . LYS A 1 568  ? -52.292 -98.476  23.640  1.00 11.87 ? 569  LYS A N     1 
ATOM   4309  C  CA    . LYS A 1 568  ? -52.740 -99.839  23.802  1.00 12.50 ? 569  LYS A CA    1 
ATOM   4310  C  C     . LYS A 1 568  ? -52.080 -100.606 24.964  1.00 14.01 ? 569  LYS A C     1 
ATOM   4311  O  O     . LYS A 1 568  ? -52.781 -101.072 25.876  1.00 14.84 ? 569  LYS A O     1 
ATOM   4312  C  CB    . LYS A 1 568  ? -52.525 -100.581 22.482  1.00 11.48 ? 569  LYS A CB    1 
ATOM   4313  C  CG    . LYS A 1 568  ? -53.468 -101.724 22.257  1.00 9.96  ? 569  LYS A CG    1 
ATOM   4314  C  CD    . LYS A 1 568  ? -52.938 -102.681 21.235  1.00 8.94  ? 569  LYS A CD    1 
ATOM   4315  C  CE    . LYS A 1 568  ? -53.571 -104.024 21.470  1.00 8.64  ? 569  LYS A CE    1 
ATOM   4316  N  NZ    . LYS A 1 568  ? -53.020 -105.077 20.603  1.00 8.80  ? 569  LYS A NZ    1 
ATOM   4317  N  N     . LEU A 1 569  ? -50.741 -100.692 24.942  1.00 14.81 ? 570  LEU A N     1 
ATOM   4318  C  CA    . LEU A 1 569  ? -49.928 -101.421 25.927  1.00 14.95 ? 570  LEU A CA    1 
ATOM   4319  C  C     . LEU A 1 569  ? -49.413 -100.653 27.151  1.00 16.03 ? 570  LEU A C     1 
ATOM   4320  O  O     . LEU A 1 569  ? -48.877 -101.271 28.068  1.00 16.34 ? 570  LEU A O     1 
ATOM   4321  C  CB    . LEU A 1 569  ? -48.685 -101.977 25.229  1.00 14.31 ? 570  LEU A CB    1 
ATOM   4322  C  CG    . LEU A 1 569  ? -48.674 -102.972 24.068  1.00 14.30 ? 570  LEU A CG    1 
ATOM   4323  C  CD1   . LEU A 1 569  ? -49.997 -103.026 23.394  1.00 14.64 ? 570  LEU A CD1   1 
ATOM   4324  C  CD2   . LEU A 1 569  ? -47.593 -102.602 23.067  1.00 14.42 ? 570  LEU A CD2   1 
ATOM   4325  N  N     . ALA A 1 570  ? -49.542 -99.324  27.153  1.00 17.33 ? 571  ALA A N     1 
ATOM   4326  C  CA    . ALA A 1 570  ? -49.016 -98.447  28.227  1.00 18.16 ? 571  ALA A CA    1 
ATOM   4327  C  C     . ALA A 1 570  ? -49.545 -98.646  29.619  1.00 18.89 ? 571  ALA A C     1 
ATOM   4328  O  O     . ALA A 1 570  ? -48.863 -98.325  30.600  1.00 19.16 ? 571  ALA A O     1 
ATOM   4329  C  CB    . ALA A 1 570  ? -49.181 -96.991  27.859  1.00 17.98 ? 571  ALA A CB    1 
ATOM   4330  N  N     . GLY A 1 571  ? -50.798 -99.083  29.694  1.00 19.56 ? 572  GLY A N     1 
ATOM   4331  C  CA    . GLY A 1 571  ? -51.431 -99.313  30.974  1.00 19.90 ? 572  GLY A CA    1 
ATOM   4332  C  C     . GLY A 1 571  ? -52.020 -98.087  31.651  1.00 20.79 ? 572  GLY A C     1 
ATOM   4333  O  O     . GLY A 1 571  ? -52.321 -98.176  32.837  1.00 20.95 ? 572  GLY A O     1 
ATOM   4334  N  N     . VAL A 1 572  ? -52.211 -96.973  30.931  1.00 21.18 ? 573  VAL A N     1 
ATOM   4335  C  CA    . VAL A 1 572  ? -52.772 -95.750  31.531  1.00 21.22 ? 573  VAL A CA    1 
ATOM   4336  C  C     . VAL A 1 572  ? -54.265 -95.673  31.333  1.00 21.82 ? 573  VAL A C     1 
ATOM   4337  O  O     . VAL A 1 572  ? -54.969 -95.031  32.104  1.00 21.72 ? 573  VAL A O     1 
ATOM   4338  C  CB    . VAL A 1 572  ? -52.194 -94.461  30.909  1.00 20.56 ? 573  VAL A CB    1 
ATOM   4339  C  CG1   . VAL A 1 572  ? -50.702 -94.429  31.035  1.00 20.19 ? 573  VAL A CG1   1 
ATOM   4340  C  CG2   . VAL A 1 572  ? -52.598 -94.351  29.462  1.00 20.33 ? 573  VAL A CG2   1 
ATOM   4341  N  N     . LEU A 1 573  ? -54.733 -96.326  30.277  1.00 22.82 ? 574  LEU A N     1 
ATOM   4342  C  CA    . LEU A 1 573  ? -56.133 -96.307  29.913  1.00 24.01 ? 574  LEU A CA    1 
ATOM   4343  C  C     . LEU A 1 573  ? -56.687 -97.655  29.497  1.00 25.48 ? 574  LEU A C     1 
ATOM   4344  O  O     . LEU A 1 573  ? -55.973 -98.463  28.899  1.00 26.06 ? 574  LEU A O     1 
ATOM   4345  C  CB    . LEU A 1 573  ? -56.319 -95.385  28.717  1.00 23.35 ? 574  LEU A CB    1 
ATOM   4346  C  CG    . LEU A 1 573  ? -56.272 -93.895  28.928  1.00 23.18 ? 574  LEU A CG    1 
ATOM   4347  C  CD1   . LEU A 1 573  ? -56.755 -93.233  27.660  1.00 23.30 ? 574  LEU A CD1   1 
ATOM   4348  C  CD2   . LEU A 1 573  ? -57.173 -93.537  30.087  1.00 23.33 ? 574  LEU A CD2   1 
ATOM   4349  N  N     . PRO A 1 574  ? -57.992 -97.889  29.754  1.00 26.62 ? 575  PRO A N     1 
ATOM   4350  C  CA    . PRO A 1 574  ? -58.644 -99.144  29.383  1.00 27.53 ? 575  PRO A CA    1 
ATOM   4351  C  C     . PRO A 1 574  ? -58.806 -99.146  27.865  1.00 28.13 ? 575  PRO A C     1 
ATOM   4352  O  O     . PRO A 1 574  ? -59.239 -98.159  27.266  1.00 27.85 ? 575  PRO A O     1 
ATOM   4353  C  CB    . PRO A 1 574  ? -59.993 -99.060  30.108  1.00 27.67 ? 575  PRO A CB    1 
ATOM   4354  C  CG    . PRO A 1 574  ? -60.274 -97.597  30.125  1.00 27.46 ? 575  PRO A CG    1 
ATOM   4355  C  CD    . PRO A 1 574  ? -58.922 -97.042  30.521  1.00 27.16 ? 575  PRO A CD    1 
ATOM   4356  N  N     . PHE A 1 575  ? -58.404 -100.266 27.270  1.00 29.43 ? 576  PHE A N     1 
ATOM   4357  C  CA    . PHE A 1 575  ? -58.426 -100.510 25.829  1.00 30.11 ? 576  PHE A CA    1 
ATOM   4358  C  C     . PHE A 1 575  ? -59.411 -99.737  24.963  1.00 30.20 ? 576  PHE A C     1 
ATOM   4359  O  O     . PHE A 1 575  ? -59.004 -99.082  24.019  1.00 30.21 ? 576  PHE A O     1 
ATOM   4360  C  CB    . PHE A 1 575  ? -58.585 -102.011 25.558  1.00 30.59 ? 576  PHE A CB    1 
ATOM   4361  C  CG    . PHE A 1 575  ? -58.662 -102.351 24.104  1.00 30.88 ? 576  PHE A CG    1 
ATOM   4362  C  CD1   . PHE A 1 575  ? -57.503 -102.436 23.341  1.00 31.20 ? 576  PHE A CD1   1 
ATOM   4363  C  CD2   . PHE A 1 575  ? -59.896 -102.509 23.481  1.00 31.01 ? 576  PHE A CD2   1 
ATOM   4364  C  CE1   . PHE A 1 575  ? -57.570 -102.662 21.968  1.00 31.59 ? 576  PHE A CE1   1 
ATOM   4365  C  CE2   . PHE A 1 575  ? -59.980 -102.735 22.110  1.00 31.42 ? 576  PHE A CE2   1 
ATOM   4366  C  CZ    . PHE A 1 575  ? -58.817 -102.811 21.349  1.00 31.67 ? 576  PHE A CZ    1 
ATOM   4367  N  N     . GLU A 1 576  ? -60.696 -99.817  25.268  1.00 30.66 ? 577  GLU A N     1 
ATOM   4368  C  CA    . GLU A 1 576  ? -61.687 -99.137  24.453  1.00 31.37 ? 577  GLU A CA    1 
ATOM   4369  C  C     . GLU A 1 576  ? -61.614 -97.618  24.430  1.00 31.06 ? 577  GLU A C     1 
ATOM   4370  O  O     . GLU A 1 576  ? -61.869 -97.006  23.390  1.00 31.24 ? 577  GLU A O     1 
ATOM   4371  C  CB    . GLU A 1 576  ? -63.082 -99.616  24.816  1.00 32.79 ? 577  GLU A CB    1 
ATOM   4372  C  CG    . GLU A 1 576  ? -63.246 -101.101 24.589  1.00 35.31 ? 577  GLU A CG    1 
ATOM   4373  C  CD    . GLU A 1 576  ? -64.671 -101.487 24.253  1.00 37.24 ? 577  GLU A CD    1 
ATOM   4374  O  OE1   . GLU A 1 576  ? -65.562 -101.276 25.114  1.00 38.13 ? 577  GLU A OE1   1 
ATOM   4375  O  OE2   . GLU A 1 576  ? -64.898 -102.007 23.124  1.00 38.50 ? 577  GLU A OE2   1 
ATOM   4376  N  N     . LYS A 1 577  ? -61.255 -97.019  25.565  1.00 30.50 ? 578  LYS A N     1 
ATOM   4377  C  CA    . LYS A 1 577  ? -61.129 -95.567  25.689  1.00 29.64 ? 578  LYS A CA    1 
ATOM   4378  C  C     . LYS A 1 577  ? -59.815 -95.143  25.021  1.00 28.75 ? 578  LYS A C     1 
ATOM   4379  O  O     . LYS A 1 577  ? -59.758 -94.139  24.319  1.00 28.22 ? 578  LYS A O     1 
ATOM   4380  C  CB    . LYS A 1 577  ? -61.164 -95.176  27.183  1.00 30.23 ? 578  LYS A CB    1 
ATOM   4381  C  CG    . LYS A 1 577  ? -60.927 -93.689  27.546  1.00 30.86 ? 578  LYS A CG    1 
ATOM   4382  C  CD    . LYS A 1 577  ? -62.147 -92.783  27.365  1.00 31.77 ? 578  LYS A CD    1 
ATOM   4383  C  CE    . LYS A 1 577  ? -61.874 -91.372  27.938  1.00 32.92 ? 578  LYS A CE    1 
ATOM   4384  N  NZ    . LYS A 1 577  ? -63.050 -90.413  27.974  1.00 33.54 ? 578  LYS A NZ    1 
ATOM   4385  N  N     . ALA A 1 578  ? -58.772 -95.939  25.220  1.00 28.09 ? 579  ALA A N     1 
ATOM   4386  C  CA    . ALA A 1 578  ? -57.463 -95.669  24.636  1.00 27.64 ? 579  ALA A CA    1 
ATOM   4387  C  C     . ALA A 1 578  ? -57.588 -95.537  23.131  1.00 27.33 ? 579  ALA A C     1 
ATOM   4388  O  O     . ALA A 1 578  ? -57.377 -94.472  22.577  1.00 27.39 ? 579  ALA A O     1 
ATOM   4389  C  CB    . ALA A 1 578  ? -56.498 -96.793  24.977  1.00 28.05 ? 579  ALA A CB    1 
ATOM   4390  N  N     . VAL A 1 579  ? -57.985 -96.615  22.472  1.00 27.43 ? 580  VAL A N     1 
ATOM   4391  C  CA    . VAL A 1 579  ? -58.146 -96.590  21.029  1.00 27.54 ? 580  VAL A CA    1 
ATOM   4392  C  C     . VAL A 1 579  ? -59.246 -95.606  20.611  1.00 28.15 ? 580  VAL A C     1 
ATOM   4393  O  O     . VAL A 1 579  ? -59.267 -95.136  19.471  1.00 28.26 ? 580  VAL A O     1 
ATOM   4394  C  CB    . VAL A 1 579  ? -58.412 -97.989  20.472  1.00 26.74 ? 580  VAL A CB    1 
ATOM   4395  C  CG1   . VAL A 1 579  ? -58.229 -97.979  18.984  1.00 26.53 ? 580  VAL A CG1   1 
ATOM   4396  C  CG2   . VAL A 1 579  ? -57.447 -98.977  21.080  1.00 26.59 ? 580  VAL A CG2   1 
ATOM   4397  N  N     . ASP A 1 580  ? -60.138 -95.265  21.540  1.00 28.80 ? 581  ASP A N     1 
ATOM   4398  C  CA    . ASP A 1 580  ? -61.196 -94.294  21.262  1.00 29.31 ? 581  ASP A CA    1 
ATOM   4399  C  C     . ASP A 1 580  ? -60.515 -92.939  21.154  1.00 28.78 ? 581  ASP A C     1 
ATOM   4400  O  O     . ASP A 1 580  ? -60.396 -92.364  20.071  1.00 28.63 ? 581  ASP A O     1 
ATOM   4401  C  CB    . ASP A 1 580  ? -62.219 -94.273  22.415  1.00 31.15 ? 581  ASP A CB    1 
ATOM   4402  C  CG    . ASP A 1 580  ? -63.205 -93.084  22.339  1.00 32.91 ? 581  ASP A CG    1 
ATOM   4403  O  OD1   . ASP A 1 580  ? -63.706 -92.776  21.224  1.00 33.97 ? 581  ASP A OD1   1 
ATOM   4404  O  OD2   . ASP A 1 580  ? -63.498 -92.476  23.406  1.00 33.51 ? 581  ASP A OD2   1 
ATOM   4405  N  N     . LEU A 1 581  ? -60.035 -92.472  22.299  1.00 28.13 ? 582  LEU A N     1 
ATOM   4406  C  CA    . LEU A 1 581  ? -59.352 -91.205  22.432  1.00 28.08 ? 582  LEU A CA    1 
ATOM   4407  C  C     . LEU A 1 581  ? -58.345 -90.916  21.338  1.00 28.09 ? 582  LEU A C     1 
ATOM   4408  O  O     . LEU A 1 581  ? -58.214 -89.778  20.876  1.00 28.13 ? 582  LEU A O     1 
ATOM   4409  C  CB    . LEU A 1 581  ? -58.663 -91.167  23.781  1.00 27.84 ? 582  LEU A CB    1 
ATOM   4410  C  CG    . LEU A 1 581  ? -59.357 -90.358  24.868  1.00 28.06 ? 582  LEU A CG    1 
ATOM   4411  C  CD1   . LEU A 1 581  ? -60.881 -90.330  24.703  1.00 28.35 ? 582  LEU A CD1   1 
ATOM   4412  C  CD2   . LEU A 1 581  ? -58.944 -90.924  26.206  1.00 28.15 ? 582  LEU A CD2   1 
ATOM   4413  N  N     . LEU A 1 582  ? -57.656 -91.956  20.902  1.00 28.26 ? 583  LEU A N     1 
ATOM   4414  C  CA    . LEU A 1 582  ? -56.655 -91.802  19.872  1.00 29.05 ? 583  LEU A CA    1 
ATOM   4415  C  C     . LEU A 1 582  ? -57.272 -91.392  18.549  1.00 29.98 ? 583  LEU A C     1 
ATOM   4416  O  O     . LEU A 1 582  ? -56.789 -90.472  17.894  1.00 30.04 ? 583  LEU A O     1 
ATOM   4417  C  CB    . LEU A 1 582  ? -55.875 -93.096  19.686  1.00 28.54 ? 583  LEU A CB    1 
ATOM   4418  C  CG    . LEU A 1 582  ? -54.375 -92.881  19.530  1.00 28.11 ? 583  LEU A CG    1 
ATOM   4419  C  CD1   . LEU A 1 582  ? -53.743 -94.144  19.019  1.00 28.42 ? 583  LEU A CD1   1 
ATOM   4420  C  CD2   . LEU A 1 582  ? -54.107 -91.739  18.585  1.00 27.76 ? 583  LEU A CD2   1 
ATOM   4421  N  N     . LYS A 1 583  ? -58.342 -92.070  18.152  1.00 30.99 ? 584  LYS A N     1 
ATOM   4422  C  CA    . LYS A 1 583  ? -58.968 -91.748  16.886  1.00 31.97 ? 584  LYS A CA    1 
ATOM   4423  C  C     . LYS A 1 583  ? -59.579 -90.365  16.871  1.00 32.56 ? 584  LYS A C     1 
ATOM   4424  O  O     . LYS A 1 583  ? -59.449 -89.646  15.869  1.00 33.05 ? 584  LYS A O     1 
ATOM   4425  C  CB    . LYS A 1 583  ? -59.995 -92.801  16.495  1.00 32.48 ? 584  LYS A CB    1 
ATOM   4426  C  CG    . LYS A 1 583  ? -59.351 -94.100  16.056  1.00 33.76 ? 584  LYS A CG    1 
ATOM   4427  C  CD    . LYS A 1 583  ? -60.377 -95.125  15.579  1.00 35.33 ? 584  LYS A CD    1 
ATOM   4428  C  CE    . LYS A 1 583  ? -59.708 -96.469  15.245  1.00 36.06 ? 584  LYS A CE    1 
ATOM   4429  N  NZ    . LYS A 1 583  ? -60.612 -97.485  14.606  1.00 36.12 ? 584  LYS A NZ    1 
ATOM   4430  N  N     . LYS A 1 584  ? -60.174 -89.957  17.993  1.00 32.81 ? 585  LYS A N     1 
ATOM   4431  C  CA    . LYS A 1 584  ? -60.807 -88.643  18.064  1.00 33.21 ? 585  LYS A CA    1 
ATOM   4432  C  C     . LYS A 1 584  ? -59.794 -87.550  17.740  1.00 33.45 ? 585  LYS A C     1 
ATOM   4433  O  O     . LYS A 1 584  ? -60.123 -86.570  17.056  1.00 33.67 ? 585  LYS A O     1 
ATOM   4434  C  CB    . LYS A 1 584  ? -61.439 -88.404  19.443  1.00 33.69 ? 585  LYS A CB    1 
ATOM   4435  C  CG    . LYS A 1 584  ? -62.535 -89.418  19.861  1.00 34.21 ? 585  LYS A CG    1 
ATOM   4436  C  CD    . LYS A 1 584  ? -63.878 -88.745  20.219  1.00 33.88 ? 585  LYS A CD    1 
ATOM   4437  C  CE    . LYS A 1 584  ? -64.777 -89.636  21.088  1.00 33.60 ? 585  LYS A CE    1 
ATOM   4438  N  NZ    . LYS A 1 584  ? -64.546 -89.436  22.561  1.00 34.42 ? 585  LYS A NZ    1 
ATOM   4439  N  N     . SER A 1 585  ? -58.550 -87.762  18.172  1.00 33.35 ? 586  SER A N     1 
ATOM   4440  C  CA    . SER A 1 585  ? -57.476 -86.803  17.934  1.00 33.31 ? 586  SER A CA    1 
ATOM   4441  C  C     . SER A 1 585  ? -56.948 -86.857  16.491  1.00 33.19 ? 586  SER A C     1 
ATOM   4442  O  O     . SER A 1 585  ? -56.496 -85.847  15.937  1.00 33.17 ? 586  SER A O     1 
ATOM   4443  C  CB    . SER A 1 585  ? -56.334 -87.030  18.927  1.00 33.30 ? 586  SER A CB    1 
ATOM   4444  O  OG    . SER A 1 585  ? -55.624 -88.225  18.655  1.00 33.16 ? 586  SER A OG    1 
ATOM   4445  N  N     . ILE A 1 586  ? -57.014 -88.033  15.883  1.00 32.86 ? 587  ILE A N     1 
ATOM   4446  C  CA    . ILE A 1 586  ? -56.551 -88.188  14.522  1.00 32.62 ? 587  ILE A CA    1 
ATOM   4447  C  C     . ILE A 1 586  ? -57.338 -87.233  13.651  1.00 33.47 ? 587  ILE A C     1 
ATOM   4448  O  O     . ILE A 1 586  ? -56.835 -86.762  12.644  1.00 33.77 ? 587  ILE A O     1 
ATOM   4449  C  CB    . ILE A 1 586  ? -56.783 -89.596  14.000  1.00 31.83 ? 587  ILE A CB    1 
ATOM   4450  C  CG1   . ILE A 1 586  ? -56.131 -90.626  14.913  1.00 31.05 ? 587  ILE A CG1   1 
ATOM   4451  C  CG2   . ILE A 1 586  ? -56.226 -89.715  12.606  1.00 31.73 ? 587  ILE A CG2   1 
ATOM   4452  C  CD1   . ILE A 1 586  ? -54.688 -90.838  14.646  1.00 30.95 ? 587  ILE A CD1   1 
ATOM   4453  N  N     . HIS A 1 587  ? -58.582 -86.950  14.026  1.00 34.33 ? 588  HIS A N     1 
ATOM   4454  C  CA    . HIS A 1 587  ? -59.396 -86.032  13.237  1.00 35.53 ? 588  HIS A CA    1 
ATOM   4455  C  C     . HIS A 1 587  ? -59.182 -84.552  13.574  1.00 36.30 ? 588  HIS A C     1 
ATOM   4456  O  O     . HIS A 1 587  ? -59.082 -83.720  12.662  1.00 36.56 ? 588  HIS A O     1 
ATOM   4457  C  CB    . HIS A 1 587  ? -60.874 -86.389  13.337  1.00 35.96 ? 588  HIS A CB    1 
ATOM   4458  C  CG    . HIS A 1 587  ? -61.280 -87.524  12.448  1.00 36.39 ? 588  HIS A CG    1 
ATOM   4459  N  ND1   . HIS A 1 587  ? -61.272 -88.838  12.864  1.00 36.53 ? 588  HIS A ND1   1 
ATOM   4460  C  CD2   . HIS A 1 587  ? -61.726 -87.538  11.169  1.00 36.55 ? 588  HIS A CD2   1 
ATOM   4461  C  CE1   . HIS A 1 587  ? -61.694 -89.615  11.883  1.00 36.75 ? 588  HIS A CE1   1 
ATOM   4462  N  NE2   . HIS A 1 587  ? -61.977 -88.851  10.844  1.00 36.94 ? 588  HIS A NE2   1 
ATOM   4463  N  N     . LYS A 1 588  ? -59.106 -84.222  14.866  1.00 36.80 ? 589  LYS A N     1 
ATOM   4464  C  CA    . LYS A 1 588  ? -58.888 -82.833  15.285  1.00 37.14 ? 589  LYS A CA    1 
ATOM   4465  C  C     . LYS A 1 588  ? -57.610 -82.352  14.593  1.00 37.32 ? 589  LYS A C     1 
ATOM   4466  O  O     . LYS A 1 588  ? -57.658 -81.432  13.768  1.00 37.16 ? 589  LYS A O     1 
ATOM   4467  C  CB    . LYS A 1 588  ? -58.763 -82.753  16.802  1.00 37.60 ? 589  LYS A CB    1 
ATOM   4468  C  CG    . LYS A 1 588  ? -59.040 -81.372  17.379  1.00 38.07 ? 589  LYS A CG    1 
ATOM   4469  C  CD    . LYS A 1 588  ? -58.801 -81.359  18.885  1.00 38.92 ? 589  LYS A CD    1 
ATOM   4470  C  CE    . LYS A 1 588  ? -57.364 -81.786  19.235  1.00 39.33 ? 589  LYS A CE    1 
ATOM   4471  N  NZ    . LYS A 1 588  ? -57.076 -81.752  20.704  1.00 39.51 ? 589  LYS A NZ    1 
ATOM   4472  N  N     . ALA A 1 589  ? -56.471 -82.950  14.960  1.00 37.69 ? 590  ALA A N     1 
ATOM   4473  C  CA    . ALA A 1 589  ? -55.196 -82.664  14.284  1.00 38.38 ? 590  ALA A CA    1 
ATOM   4474  C  C     . ALA A 1 589  ? -55.519 -83.354  12.948  1.00 38.74 ? 590  ALA A C     1 
ATOM   4475  O  O     . ALA A 1 589  ? -56.401 -84.221  12.924  1.00 39.06 ? 590  ALA A O     1 
ATOM   4476  C  CB    . ALA A 1 589  ? -54.029 -83.364  14.994  1.00 38.32 ? 590  ALA A CB    1 
ATOM   4477  N  N     . TYR A 1 590  ? -54.827 -83.039  11.854  1.00 38.86 ? 591  TYR A N     1 
ATOM   4478  C  CA    . TYR A 1 590  ? -55.222 -83.630  10.554  1.00 39.10 ? 591  TYR A CA    1 
ATOM   4479  C  C     . TYR A 1 590  ? -56.600 -82.983  10.233  1.00 39.56 ? 591  TYR A C     1 
ATOM   4480  O  O     . TYR A 1 590  ? -57.162 -82.267  11.071  1.00 40.21 ? 591  TYR A O     1 
ATOM   4481  C  CB    . TYR A 1 590  ? -55.295 -85.180  10.591  1.00 38.29 ? 591  TYR A CB    1 
ATOM   4482  C  CG    . TYR A 1 590  ? -53.985 -85.850  10.969  1.00 37.64 ? 591  TYR A CG    1 
ATOM   4483  C  CD1   . TYR A 1 590  ? -52.885 -85.789  10.119  1.00 37.52 ? 591  TYR A CD1   1 
ATOM   4484  C  CD2   . TYR A 1 590  ? -53.813 -86.447  12.224  1.00 37.58 ? 591  TYR A CD2   1 
ATOM   4485  C  CE1   . TYR A 1 590  ? -51.637 -86.286  10.507  1.00 37.62 ? 591  TYR A CE1   1 
ATOM   4486  C  CE2   . TYR A 1 590  ? -52.564 -86.949  12.630  1.00 37.69 ? 591  TYR A CE2   1 
ATOM   4487  C  CZ    . TYR A 1 590  ? -51.477 -86.855  11.766  1.00 37.67 ? 591  TYR A CZ    1 
ATOM   4488  O  OH    . TYR A 1 590  ? -50.214 -87.240  12.175  1.00 37.44 ? 591  TYR A OH    1 
ATOM   4489  N  N     . GLY A 1 591  ? -57.206 -83.290  9.094   1.00 39.86 ? 592  GLY A N     1 
ATOM   4490  C  CA    . GLY A 1 591  ? -58.429 -82.577  8.750   1.00 40.14 ? 592  GLY A CA    1 
ATOM   4491  C  C     . GLY A 1 591  ? -57.815 -81.378  8.030   1.00 40.79 ? 592  GLY A C     1 
ATOM   4492  O  O     . GLY A 1 591  ? -58.378 -80.279  7.911   1.00 40.11 ? 592  GLY A O     1 
ATOM   4493  N  N     . LYS A 1 592  ? -56.574 -81.641  7.611   1.00 41.57 ? 593  LYS A N     1 
ATOM   4494  C  CA    . LYS A 1 592  ? -55.672 -80.762  6.871   1.00 42.02 ? 593  LYS A CA    1 
ATOM   4495  C  C     . LYS A 1 592  ? -56.080 -80.984  5.407   1.00 42.53 ? 593  LYS A C     1 
ATOM   4496  O  O     . LYS A 1 592  ? -57.104 -80.435  4.952   1.00 42.53 ? 593  LYS A O     1 
ATOM   4497  C  CB    . LYS A 1 592  ? -54.233 -81.270  7.092   1.00 41.64 ? 593  LYS A CB    1 
ATOM   4498  C  CG    . LYS A 1 592  ? -54.115 -82.812  7.077   1.00 40.17 ? 593  LYS A CG    1 
ATOM   4499  C  CD    . LYS A 1 592  ? -52.989 -83.308  6.185   1.00 39.58 ? 593  LYS A CD    1 
ATOM   4500  C  CE    . LYS A 1 592  ? -51.666 -83.423  6.929   1.00 39.05 ? 593  LYS A CE    1 
ATOM   4501  N  NZ    . LYS A 1 592  ? -51.087 -82.121  7.327   1.00 38.49 ? 593  LYS A NZ    1 
ATOM   4502  N  N     . LYS A 1 593  ? -55.254 -81.730  4.661   1.00 42.55 ? 594  LYS A N     1 
ATOM   4503  C  CA    . LYS A 1 593  ? -55.599 -82.078  3.296   1.00 42.63 ? 594  LYS A CA    1 
ATOM   4504  C  C     . LYS A 1 593  ? -56.571 -83.233  3.563   1.00 42.26 ? 594  LYS A C     1 
ATOM   4505  O  O     . LYS A 1 593  ? -56.179 -84.273  4.094   1.00 42.22 ? 594  LYS A O     1 
ATOM   4506  C  CB    . LYS A 1 593  ? -54.372 -82.541  2.482   1.00 42.76 ? 594  LYS A CB    1 
ATOM   4507  C  CG    . LYS A 1 593  ? -54.012 -81.630  1.266   1.00 42.98 ? 594  LYS A CG    1 
ATOM   4508  C  CD    . LYS A 1 593  ? -52.969 -82.291  0.316   1.00 43.35 ? 594  LYS A CD    1 
ATOM   4509  C  CE    . LYS A 1 593  ? -52.449 -81.343  -0.807  1.00 43.44 ? 594  LYS A CE    1 
ATOM   4510  N  NZ    . LYS A 1 593  ? -51.447 -81.972  -1.769  1.00 43.19 ? 594  LYS A NZ    1 
ATOM   4511  N  N     . GLY A 1 594  ? -57.854 -82.903  3.413   1.00 41.93 ? 595  GLY A N     1 
ATOM   4512  C  CA    . GLY A 1 594  ? -58.980 -83.814  3.590   1.00 41.20 ? 595  GLY A CA    1 
ATOM   4513  C  C     . GLY A 1 594  ? -58.935 -85.136  4.336   1.00 40.71 ? 595  GLY A C     1 
ATOM   4514  O  O     . GLY A 1 594  ? -58.171 -85.327  5.285   1.00 40.86 ? 595  GLY A O     1 
ATOM   4515  N  N     . GLU A 1 595  ? -59.803 -86.042  3.888   1.00 39.98 ? 596  GLU A N     1 
ATOM   4516  C  CA    . GLU A 1 595  ? -59.965 -87.367  4.469   1.00 39.20 ? 596  GLU A CA    1 
ATOM   4517  C  C     . GLU A 1 595  ? -58.846 -88.352  4.246   1.00 38.25 ? 596  GLU A C     1 
ATOM   4518  O  O     . GLU A 1 595  ? -58.429 -89.017  5.187   1.00 38.04 ? 596  GLU A O     1 
ATOM   4519  C  CB    . GLU A 1 595  ? -61.267 -88.015  3.981   1.00 40.07 ? 596  GLU A CB    1 
ATOM   4520  C  CG    . GLU A 1 595  ? -62.485 -87.839  4.908   1.00 41.70 ? 596  GLU A CG    1 
ATOM   4521  C  CD    . GLU A 1 595  ? -62.322 -88.507  6.289   1.00 42.62 ? 596  GLU A CD    1 
ATOM   4522  O  OE1   . GLU A 1 595  ? -61.425 -89.379  6.443   1.00 43.13 ? 596  GLU A OE1   1 
ATOM   4523  O  OE2   . GLU A 1 595  ? -63.099 -88.154  7.221   1.00 42.82 ? 596  GLU A OE2   1 
ATOM   4524  N  N     . LYS A 1 596  ? -58.412 -88.496  2.997   1.00 37.25 ? 597  LYS A N     1 
ATOM   4525  C  CA    . LYS A 1 596  ? -57.364 -89.453  2.666   1.00 36.63 ? 597  LYS A CA    1 
ATOM   4526  C  C     . LYS A 1 596  ? -56.299 -89.563  3.769   1.00 36.06 ? 597  LYS A C     1 
ATOM   4527  O  O     . LYS A 1 596  ? -56.203 -90.603  4.431   1.00 36.15 ? 597  LYS A O     1 
ATOM   4528  C  CB    . LYS A 1 596  ? -56.747 -89.138  1.296   1.00 37.17 ? 597  LYS A CB    1 
ATOM   4529  C  CG    . LYS A 1 596  ? -55.672 -90.148  0.851   1.00 37.83 ? 597  LYS A CG    1 
ATOM   4530  C  CD    . LYS A 1 596  ? -55.189 -89.907  -0.589  1.00 38.67 ? 597  LYS A CD    1 
ATOM   4531  C  CE    . LYS A 1 596  ? -53.645 -89.905  -0.722  1.00 38.93 ? 597  LYS A CE    1 
ATOM   4532  N  NZ    . LYS A 1 596  ? -52.972 -88.683  -0.142  1.00 39.33 ? 597  LYS A NZ    1 
ATOM   4533  N  N     . ILE A 1 597  ? -55.569 -88.476  4.026   1.00 35.02 ? 598  ILE A N     1 
ATOM   4534  C  CA    . ILE A 1 597  ? -54.550 -88.467  5.071   1.00 33.78 ? 598  ILE A CA    1 
ATOM   4535  C  C     . ILE A 1 597  ? -55.150 -89.047  6.340   1.00 33.35 ? 598  ILE A C     1 
ATOM   4536  O  O     . ILE A 1 597  ? -54.700 -90.071  6.834   1.00 33.19 ? 598  ILE A O     1 
ATOM   4537  C  CB    . ILE A 1 597  ? -54.080 -87.050  5.375   1.00 33.43 ? 598  ILE A CB    1 
ATOM   4538  C  CG1   . ILE A 1 597  ? -53.476 -86.423  4.120   1.00 33.39 ? 598  ILE A CG1   1 
ATOM   4539  C  CG2   . ILE A 1 597  ? -53.066 -87.075  6.493   1.00 33.18 ? 598  ILE A CG2   1 
ATOM   4540  C  CD1   . ILE A 1 597  ? -52.245 -87.157  3.587   1.00 33.75 ? 598  ILE A CD1   1 
ATOM   4541  N  N     . VAL A 1 598  ? -56.212 -88.412  6.819   1.00 32.86 ? 599  VAL A N     1 
ATOM   4542  C  CA    . VAL A 1 598  ? -56.922 -88.855  8.015   1.00 32.50 ? 599  VAL A CA    1 
ATOM   4543  C  C     . VAL A 1 598  ? -57.090 -90.377  8.076   1.00 32.01 ? 599  VAL A C     1 
ATOM   4544  O  O     . VAL A 1 598  ? -56.474 -91.043  8.905   1.00 31.80 ? 599  VAL A O     1 
ATOM   4545  C  CB    . VAL A 1 598  ? -58.318 -88.217  8.068   1.00 32.58 ? 599  VAL A CB    1 
ATOM   4546  C  CG1   . VAL A 1 598  ? -59.110 -88.773  9.233   1.00 32.82 ? 599  VAL A CG1   1 
ATOM   4547  C  CG2   . VAL A 1 598  ? -58.197 -86.712  8.163   1.00 32.48 ? 599  VAL A CG2   1 
ATOM   4548  N  N     . LYS A 1 599  ? -57.931 -90.904  7.194   1.00 31.69 ? 600  LYS A N     1 
ATOM   4549  C  CA    . LYS A 1 599  ? -58.201 -92.334  7.117   1.00 31.77 ? 600  LYS A CA    1 
ATOM   4550  C  C     . LYS A 1 599  ? -56.927 -93.185  7.077   1.00 31.51 ? 600  LYS A C     1 
ATOM   4551  O  O     . LYS A 1 599  ? -56.824 -94.211  7.754   1.00 31.82 ? 600  LYS A O     1 
ATOM   4552  C  CB    . LYS A 1 599  ? -59.064 -92.621  5.886   1.00 32.29 ? 600  LYS A CB    1 
ATOM   4553  C  CG    . LYS A 1 599  ? -59.043 -94.077  5.400   1.00 33.46 ? 600  LYS A CG    1 
ATOM   4554  C  CD    . LYS A 1 599  ? -59.524 -95.089  6.466   1.00 34.48 ? 600  LYS A CD    1 
ATOM   4555  C  CE    . LYS A 1 599  ? -61.038 -95.039  6.761   1.00 34.98 ? 600  LYS A CE    1 
ATOM   4556  N  NZ    . LYS A 1 599  ? -61.442 -95.933  7.914   1.00 35.18 ? 600  LYS A NZ    1 
ATOM   4557  N  N     . MET A 1 600  ? -55.956 -92.756  6.283   1.00 30.75 ? 601  MET A N     1 
ATOM   4558  C  CA    . MET A 1 600  ? -54.694 -93.469  6.145   1.00 29.82 ? 601  MET A CA    1 
ATOM   4559  C  C     . MET A 1 600  ? -53.941 -93.535  7.476   1.00 29.11 ? 601  MET A C     1 
ATOM   4560  O  O     . MET A 1 600  ? -53.002 -94.313  7.638   1.00 28.95 ? 601  MET A O     1 
ATOM   4561  C  CB    . MET A 1 600  ? -53.867 -92.750  5.101   1.00 29.84 ? 601  MET A CB    1 
ATOM   4562  C  CG    . MET A 1 600  ? -52.527 -93.308  4.877   1.00 30.34 ? 601  MET A CG    1 
ATOM   4563  S  SD    . MET A 1 600  ? -51.717 -92.191  3.773   1.00 31.50 ? 601  MET A SD    1 
ATOM   4564  C  CE    . MET A 1 600  ? -51.708 -93.153  2.258   1.00 31.51 ? 601  MET A CE    1 
ATOM   4565  N  N     . ASN A 1 601  ? -54.358 -92.690  8.413   1.00 28.34 ? 602  ASN A N     1 
ATOM   4566  C  CA    . ASN A 1 601  ? -53.763 -92.624  9.737   1.00 27.52 ? 602  ASN A CA    1 
ATOM   4567  C  C     . ASN A 1 601  ? -54.558 -93.522  10.643  1.00 27.08 ? 602  ASN A C     1 
ATOM   4568  O  O     . ASN A 1 601  ? -54.009 -94.202  11.498  1.00 27.05 ? 602  ASN A O     1 
ATOM   4569  C  CB    . ASN A 1 601  ? -53.801 -91.199  10.266  1.00 27.15 ? 602  ASN A CB    1 
ATOM   4570  C  CG    . ASN A 1 601  ? -52.861 -90.288  9.525   1.00 26.97 ? 602  ASN A CG    1 
ATOM   4571  O  OD1   . ASN A 1 601  ? -53.286 -89.406  8.785   1.00 26.65 ? 602  ASN A OD1   1 
ATOM   4572  N  ND2   . ASN A 1 601  ? -51.567 -90.503  9.714   1.00 26.92 ? 602  ASN A ND2   1 
ATOM   4573  N  N     . THR A 1 602  ? -55.869 -93.486  10.458  1.00 26.86 ? 603  THR A N     1 
ATOM   4574  C  CA    . THR A 1 602  ? -56.800 -94.312  11.218  1.00 26.99 ? 603  THR A CA    1 
ATOM   4575  C  C     . THR A 1 602  ? -56.418 -95.802  11.017  1.00 27.01 ? 603  THR A C     1 
ATOM   4576  O  O     . THR A 1 602  ? -56.190 -96.545  11.985  1.00 26.51 ? 603  THR A O     1 
ATOM   4577  C  CB    . THR A 1 602  ? -58.253 -93.994  10.759  1.00 27.22 ? 603  THR A CB    1 
ATOM   4578  O  OG1   . THR A 1 602  ? -58.689 -92.756  11.359  1.00 26.80 ? 603  THR A OG1   1 
ATOM   4579  C  CG2   . THR A 1 602  ? -59.209 -95.130  11.104  1.00 27.19 ? 603  THR A CG2   1 
ATOM   4580  N  N     . ASP A 1 603  ? -56.279 -96.199  9.753   1.00 27.01 ? 604  ASP A N     1 
ATOM   4581  C  CA    . ASP A 1 603  ? -55.866 -97.550  9.381   1.00 26.91 ? 604  ASP A CA    1 
ATOM   4582  C  C     . ASP A 1 603  ? -54.556 -97.953  10.064  1.00 26.66 ? 604  ASP A C     1 
ATOM   4583  O  O     . ASP A 1 603  ? -54.306 -99.138  10.302  1.00 27.12 ? 604  ASP A O     1 
ATOM   4584  C  CB    . ASP A 1 603  ? -55.611 -97.632  7.875   1.00 27.41 ? 604  ASP A CB    1 
ATOM   4585  C  CG    . ASP A 1 603  ? -56.864 -97.528  7.060   1.00 27.81 ? 604  ASP A CG    1 
ATOM   4586  O  OD1   . ASP A 1 603  ? -57.961 -97.785  7.611   1.00 28.34 ? 604  ASP A OD1   1 
ATOM   4587  O  OD2   . ASP A 1 603  ? -56.736 -97.205  5.856   1.00 28.31 ? 604  ASP A OD2   1 
ATOM   4588  N  N     . ALA A 1 604  ? -53.674 -96.983  10.277  1.00 25.99 ? 605  ALA A N     1 
ATOM   4589  C  CA    . ALA A 1 604  ? -52.398 -97.270  10.909  1.00 25.19 ? 605  ALA A CA    1 
ATOM   4590  C  C     . ALA A 1 604  ? -52.666 -97.674  12.342  1.00 24.53 ? 605  ALA A C     1 
ATOM   4591  O  O     . ALA A 1 604  ? -52.108 -98.654  12.819  1.00 23.82 ? 605  ALA A O     1 
ATOM   4592  C  CB    . ALA A 1 604  ? -51.484 -96.057  10.846  1.00 25.22 ? 605  ALA A CB    1 
ATOM   4593  N  N     . VAL A 1 605  ? -53.593 -96.964  12.980  1.00 24.20 ? 606  VAL A N     1 
ATOM   4594  C  CA    . VAL A 1 605  ? -53.955 -97.241  14.355  1.00 24.59 ? 606  VAL A CA    1 
ATOM   4595  C  C     . VAL A 1 605  ? -54.474 -98.653  14.406  1.00 25.12 ? 606  VAL A C     1 
ATOM   4596  O  O     . VAL A 1 605  ? -54.091 -99.425  15.286  1.00 25.40 ? 606  VAL A O     1 
ATOM   4597  C  CB    . VAL A 1 605  ? -55.098 -96.334  14.875  1.00 24.54 ? 606  VAL A CB    1 
ATOM   4598  C  CG1   . VAL A 1 605  ? -55.304 -96.584  16.376  1.00 23.93 ? 606  VAL A CG1   1 
ATOM   4599  C  CG2   . VAL A 1 605  ? -54.810 -94.856  14.587  1.00 24.04 ? 606  VAL A CG2   1 
ATOM   4600  N  N     . ASP A 1 606  ? -55.341 -98.983  13.446  1.00 25.61 ? 607  ASP A N     1 
ATOM   4601  C  CA    . ASP A 1 606  ? -55.958 -100.319 13.354  1.00 25.87 ? 607  ASP A CA    1 
ATOM   4602  C  C     . ASP A 1 606  ? -54.917 -101.433 13.268  1.00 25.47 ? 607  ASP A C     1 
ATOM   4603  O  O     . ASP A 1 606  ? -54.759 -102.226 14.205  1.00 25.79 ? 607  ASP A O     1 
ATOM   4604  C  CB    . ASP A 1 606  ? -56.913 -100.427 12.138  1.00 26.51 ? 607  ASP A CB    1 
ATOM   4605  C  CG    . ASP A 1 606  ? -58.355 -99.949  12.434  1.00 27.23 ? 607  ASP A CG    1 
ATOM   4606  O  OD1   . ASP A 1 606  ? -58.675 -99.547  13.584  1.00 27.39 ? 607  ASP A OD1   1 
ATOM   4607  O  OD2   . ASP A 1 606  ? -59.184 -99.993  11.490  1.00 27.36 ? 607  ASP A OD2   1 
ATOM   4608  N  N     . GLN A 1 607  ? -54.185 -101.477 12.161  1.00 24.43 ? 608  GLN A N     1 
ATOM   4609  C  CA    . GLN A 1 607  ? -53.196 -102.511 12.000  1.00 23.38 ? 608  GLN A CA    1 
ATOM   4610  C  C     . GLN A 1 607  ? -52.158 -102.432 13.087  1.00 22.17 ? 608  GLN A C     1 
ATOM   4611  O  O     . GLN A 1 607  ? -51.578 -103.442 13.459  1.00 21.95 ? 608  GLN A O     1 
ATOM   4612  C  CB    . GLN A 1 607  ? -52.551 -102.441 10.634  1.00 24.30 ? 608  GLN A CB    1 
ATOM   4613  C  CG    . GLN A 1 607  ? -52.002 -103.785 10.193  1.00 25.36 ? 608  GLN A CG    1 
ATOM   4614  C  CD    . GLN A 1 607  ? -51.835 -103.837 8.703   1.00 26.28 ? 608  GLN A CD    1 
ATOM   4615  O  OE1   . GLN A 1 607  ? -52.785 -103.557 7.955   1.00 27.13 ? 608  GLN A OE1   1 
ATOM   4616  N  NE2   . GLN A 1 607  ? -50.618 -104.141 8.247   1.00 26.63 ? 608  GLN A NE2   1 
ATOM   4617  N  N     . ALA A 1 608  ? -51.940 -101.237 13.617  1.00 20.86 ? 609  ALA A N     1 
ATOM   4618  C  CA    . ALA A 1 608  ? -50.981 -101.093 14.687  1.00 19.81 ? 609  ALA A CA    1 
ATOM   4619  C  C     . ALA A 1 608  ? -51.472 -101.954 15.841  1.00 19.48 ? 609  ALA A C     1 
ATOM   4620  O  O     . ALA A 1 608  ? -50.731 -102.783 16.361  1.00 19.58 ? 609  ALA A O     1 
ATOM   4621  C  CB    . ALA A 1 608  ? -50.874 -99.672  15.106  1.00 19.50 ? 609  ALA A CB    1 
ATOM   4622  N  N     . VAL A 1 609  ? -52.745 -101.814 16.181  1.00 18.93 ? 610  VAL A N     1 
ATOM   4623  C  CA    . VAL A 1 609  ? -53.331 -102.580 17.271  1.00 18.69 ? 610  VAL A CA    1 
ATOM   4624  C  C     . VAL A 1 609  ? -53.370 -104.064 16.980  1.00 19.03 ? 610  VAL A C     1 
ATOM   4625  O  O     . VAL A 1 609  ? -53.200 -104.882 17.885  1.00 18.54 ? 610  VAL A O     1 
ATOM   4626  C  CB    . VAL A 1 609  ? -54.746 -102.103 17.552  1.00 18.33 ? 610  VAL A CB    1 
ATOM   4627  C  CG1   . VAL A 1 609  ? -55.463 -103.046 18.498  1.00 18.06 ? 610  VAL A CG1   1 
ATOM   4628  C  CG2   . VAL A 1 609  ? -54.689 -100.728 18.134  1.00 18.29 ? 610  VAL A CG2   1 
ATOM   4629  N  N     . THR A 1 610  ? -53.565 -104.396 15.700  1.00 19.70 ? 611  THR A N     1 
ATOM   4630  C  CA    . THR A 1 610  ? -53.666 -105.792 15.209  1.00 19.70 ? 611  THR A CA    1 
ATOM   4631  C  C     . THR A 1 610  ? -52.358 -106.578 15.184  1.00 19.12 ? 611  THR A C     1 
ATOM   4632  O  O     . THR A 1 610  ? -52.327 -107.767 15.511  1.00 19.35 ? 611  THR A O     1 
ATOM   4633  C  CB    . THR A 1 610  ? -54.208 -105.851 13.757  1.00 19.82 ? 611  THR A CB    1 
ATOM   4634  O  OG1   . THR A 1 610  ? -55.413 -105.070 13.642  1.00 20.09 ? 611  THR A OG1   1 
ATOM   4635  C  CG2   . THR A 1 610  ? -54.485 -107.298 13.372  1.00 19.58 ? 611  THR A CG2   1 
ATOM   4636  N  N     . SER A 1 611  ? -51.313 -105.917 14.699  1.00 18.19 ? 612  SER A N     1 
ATOM   4637  C  CA    . SER A 1 611  ? -49.997 -106.500 14.583  1.00 17.30 ? 612  SER A CA    1 
ATOM   4638  C  C     . SER A 1 611  ? -49.243 -106.435 15.898  1.00 16.88 ? 612  SER A C     1 
ATOM   4639  O  O     . SER A 1 611  ? -48.141 -106.970 16.010  1.00 17.41 ? 612  SER A O     1 
ATOM   4640  C  CB    . SER A 1 611  ? -49.212 -105.742 13.524  1.00 17.23 ? 612  SER A CB    1 
ATOM   4641  O  OG    . SER A 1 611  ? -49.977 -105.553 12.344  1.00 17.27 ? 612  SER A OG    1 
ATOM   4642  N  N     . LEU A 1 612  ? -49.853 -105.807 16.899  1.00 16.20 ? 613  LEU A N     1 
ATOM   4643  C  CA    . LEU A 1 612  ? -49.238 -105.605 18.216  1.00 15.49 ? 613  LEU A CA    1 
ATOM   4644  C  C     . LEU A 1 612  ? -49.499 -106.741 19.212  1.00 15.43 ? 613  LEU A C     1 
ATOM   4645  O  O     . LEU A 1 612  ? -50.299 -106.615 20.140  1.00 15.23 ? 613  LEU A O     1 
ATOM   4646  C  CB    . LEU A 1 612  ? -49.734 -104.264 18.770  1.00 14.71 ? 613  LEU A CB    1 
ATOM   4647  C  CG    . LEU A 1 612  ? -48.845 -103.131 19.274  1.00 13.77 ? 613  LEU A CG    1 
ATOM   4648  C  CD1   . LEU A 1 612  ? -47.507 -103.037 18.585  1.00 13.55 ? 613  LEU A CD1   1 
ATOM   4649  C  CD2   . LEU A 1 612  ? -49.628 -101.863 19.090  1.00 13.70 ? 613  LEU A CD2   1 
ATOM   4650  N  N     . GLN A 1 613  ? -48.804 -107.852 19.023  1.00 15.65 ? 614  GLN A N     1 
ATOM   4651  C  CA    . GLN A 1 613  ? -48.970 -108.998 19.906  1.00 16.37 ? 614  GLN A CA    1 
ATOM   4652  C  C     . GLN A 1 613  ? -47.629 -109.392 20.548  1.00 16.83 ? 614  GLN A C     1 
ATOM   4653  O  O     . GLN A 1 613  ? -46.546 -109.172 19.992  1.00 17.13 ? 614  GLN A O     1 
ATOM   4654  C  CB    . GLN A 1 613  ? -49.555 -110.191 19.134  1.00 16.46 ? 614  GLN A CB    1 
ATOM   4655  C  CG    . GLN A 1 613  ? -50.675 -109.866 18.144  1.00 16.15 ? 614  GLN A CG    1 
ATOM   4656  C  CD    . GLN A 1 613  ? -51.934 -109.413 18.829  1.00 16.28 ? 614  GLN A CD    1 
ATOM   4657  O  OE1   . GLN A 1 613  ? -52.380 -110.047 19.773  1.00 16.08 ? 614  GLN A OE1   1 
ATOM   4658  N  NE2   . GLN A 1 613  ? -52.492 -108.287 18.388  1.00 16.19 ? 614  GLN A NE2   1 
ATOM   4659  N  N     . GLU A 1 614  ? -47.707 -110.034 21.697  1.00 17.22 ? 615  GLU A N     1 
ATOM   4660  C  CA    . GLU A 1 614  ? -46.524 -110.437 22.423  1.00 18.05 ? 615  GLU A CA    1 
ATOM   4661  C  C     . GLU A 1 614  ? -45.583 -111.321 21.649  1.00 18.32 ? 615  GLU A C     1 
ATOM   4662  O  O     . GLU A 1 614  ? -46.014 -112.290 21.036  1.00 18.85 ? 615  GLU A O     1 
ATOM   4663  C  CB    . GLU A 1 614  ? -46.946 -111.184 23.658  1.00 18.52 ? 615  GLU A CB    1 
ATOM   4664  C  CG    . GLU A 1 614  ? -45.984 -111.135 24.789  1.00 20.17 ? 615  GLU A CG    1 
ATOM   4665  C  CD    . GLU A 1 614  ? -46.743 -111.122 26.095  1.00 21.91 ? 615  GLU A CD    1 
ATOM   4666  O  OE1   . GLU A 1 614  ? -47.776 -110.404 26.143  1.00 22.30 ? 615  GLU A OE1   1 
ATOM   4667  O  OE2   . GLU A 1 614  ? -46.341 -111.839 27.054  1.00 23.12 ? 615  GLU A OE2   1 
ATOM   4668  N  N     . PHE A 1 615  ? -44.306 -110.949 21.634  1.00 18.68 ? 616  PHE A N     1 
ATOM   4669  C  CA    . PHE A 1 615  ? -43.279 -111.754 20.988  1.00 18.80 ? 616  PHE A CA    1 
ATOM   4670  C  C     . PHE A 1 615  ? -42.994 -112.797 22.059  1.00 19.68 ? 616  PHE A C     1 
ATOM   4671  O  O     . PHE A 1 615  ? -42.585 -112.426 23.169  1.00 20.41 ? 616  PHE A O     1 
ATOM   4672  C  CB    . PHE A 1 615  ? -42.007 -110.930 20.733  1.00 17.69 ? 616  PHE A CB    1 
ATOM   4673  C  CG    . PHE A 1 615  ? -40.876 -111.723 20.116  1.00 16.55 ? 616  PHE A CG    1 
ATOM   4674  C  CD1   . PHE A 1 615  ? -40.016 -112.486 20.914  1.00 15.91 ? 616  PHE A CD1   1 
ATOM   4675  C  CD2   . PHE A 1 615  ? -40.676 -111.718 18.736  1.00 16.01 ? 616  PHE A CD2   1 
ATOM   4676  C  CE1   . PHE A 1 615  ? -38.975 -113.233 20.344  1.00 15.60 ? 616  PHE A CE1   1 
ATOM   4677  C  CE2   . PHE A 1 615  ? -39.633 -112.460 18.155  1.00 15.72 ? 616  PHE A CE2   1 
ATOM   4678  C  CZ    . PHE A 1 615  ? -38.785 -113.219 18.963  1.00 15.33 ? 616  PHE A CZ    1 
ATOM   4679  N  N     . LYS A 1 616  ? -43.271 -114.073 21.764  1.00 20.24 ? 617  LYS A N     1 
ATOM   4680  C  CA    . LYS A 1 616  ? -43.032 -115.135 22.735  1.00 20.47 ? 617  LYS A CA    1 
ATOM   4681  C  C     . LYS A 1 616  ? -41.623 -115.651 22.587  1.00 20.41 ? 617  LYS A C     1 
ATOM   4682  O  O     . LYS A 1 616  ? -41.158 -115.930 21.479  1.00 20.83 ? 617  LYS A O     1 
ATOM   4683  C  CB    . LYS A 1 616  ? -44.041 -116.269 22.616  1.00 21.18 ? 617  LYS A CB    1 
ATOM   4684  C  CG    . LYS A 1 616  ? -44.022 -117.172 23.854  1.00 23.21 ? 617  LYS A CG    1 
ATOM   4685  C  CD    . LYS A 1 616  ? -44.075 -116.341 25.159  1.00 25.00 ? 617  LYS A CD    1 
ATOM   4686  C  CE    . LYS A 1 616  ? -45.499 -115.823 25.467  1.00 25.97 ? 617  LYS A CE    1 
ATOM   4687  N  NZ    . LYS A 1 616  ? -46.287 -115.359 24.253  1.00 26.85 ? 617  LYS A NZ    1 
ATOM   4688  N  N     . TYR A 1 617  ? -40.979 -115.877 23.721  1.00 20.12 ? 618  TYR A N     1 
ATOM   4689  C  CA    . TYR A 1 617  ? -39.597 -116.278 23.685  1.00 20.00 ? 618  TYR A CA    1 
ATOM   4690  C  C     . TYR A 1 617  ? -39.137 -117.410 24.563  1.00 20.58 ? 618  TYR A C     1 
ATOM   4691  O  O     . TYR A 1 617  ? -39.593 -117.585 25.700  1.00 20.40 ? 618  TYR A O     1 
ATOM   4692  C  CB    . TYR A 1 617  ? -38.749 -115.066 24.017  1.00 19.89 ? 618  TYR A CB    1 
ATOM   4693  C  CG    . TYR A 1 617  ? -39.211 -114.374 25.279  1.00 19.40 ? 618  TYR A CG    1 
ATOM   4694  C  CD1   . TYR A 1 617  ? -38.796 -114.815 26.532  1.00 18.61 ? 618  TYR A CD1   1 
ATOM   4695  C  CD2   . TYR A 1 617  ? -40.085 -113.286 25.215  1.00 19.18 ? 618  TYR A CD2   1 
ATOM   4696  C  CE1   . TYR A 1 617  ? -39.236 -114.198 27.671  1.00 18.49 ? 618  TYR A CE1   1 
ATOM   4697  C  CE2   . TYR A 1 617  ? -40.529 -112.664 26.351  1.00 18.58 ? 618  TYR A CE2   1 
ATOM   4698  C  CZ    . TYR A 1 617  ? -40.104 -113.122 27.571  1.00 18.51 ? 618  TYR A CZ    1 
ATOM   4699  O  OH    . TYR A 1 617  ? -40.556 -112.503 28.704  1.00 19.76 ? 618  TYR A OH    1 
ATOM   4700  N  N     . PRO A 1 618  ? -38.097 -118.101 24.086  1.00 21.24 ? 619  PRO A N     1 
ATOM   4701  C  CA    . PRO A 1 618  ? -37.419 -119.241 24.700  1.00 22.01 ? 619  PRO A CA    1 
ATOM   4702  C  C     . PRO A 1 618  ? -36.844 -118.938 26.082  1.00 22.80 ? 619  PRO A C     1 
ATOM   4703  O  O     . PRO A 1 618  ? -36.233 -117.886 26.291  1.00 23.12 ? 619  PRO A O     1 
ATOM   4704  C  CB    . PRO A 1 618  ? -36.304 -119.543 23.686  1.00 21.89 ? 619  PRO A CB    1 
ATOM   4705  C  CG    . PRO A 1 618  ? -36.104 -118.242 22.957  1.00 20.82 ? 619  PRO A CG    1 
ATOM   4706  C  CD    . PRO A 1 618  ? -37.510 -117.812 22.766  1.00 21.36 ? 619  PRO A CD    1 
ATOM   4707  N  N     . ASP A 1 619  ? -36.996 -119.882 27.013  1.00 23.64 ? 620  ASP A N     1 
ATOM   4708  C  CA    . ASP A 1 619  ? -36.462 -119.704 28.361  1.00 23.88 ? 620  ASP A CA    1 
ATOM   4709  C  C     . ASP A 1 619  ? -34.967 -119.508 28.210  1.00 23.50 ? 620  ASP A C     1 
ATOM   4710  O  O     . ASP A 1 619  ? -34.347 -118.858 29.031  1.00 23.72 ? 620  ASP A O     1 
ATOM   4711  C  CB    . ASP A 1 619  ? -36.751 -120.924 29.236  1.00 24.74 ? 620  ASP A CB    1 
ATOM   4712  C  CG    . ASP A 1 619  ? -37.030 -120.550 30.687  1.00 26.06 ? 620  ASP A CG    1 
ATOM   4713  O  OD1   . ASP A 1 619  ? -36.064 -120.321 31.458  1.00 26.44 ? 620  ASP A OD1   1 
ATOM   4714  O  OD2   . ASP A 1 619  ? -38.228 -120.494 31.061  1.00 27.17 ? 620  ASP A OD2   1 
ATOM   4715  N  N     . SER A 1 620  ? -34.411 -120.055 27.129  1.00 23.27 ? 621  SER A N     1 
ATOM   4716  C  CA    . SER A 1 620  ? -32.988 -119.945 26.786  1.00 23.36 ? 621  SER A CA    1 
ATOM   4717  C  C     . SER A 1 620  ? -32.451 -118.523 27.002  1.00 23.35 ? 621  SER A C     1 
ATOM   4718  O  O     . SER A 1 620  ? -31.306 -118.323 27.440  1.00 23.21 ? 621  SER A O     1 
ATOM   4719  C  CB    . SER A 1 620  ? -32.796 -120.367 25.311  1.00 23.40 ? 621  SER A CB    1 
ATOM   4720  O  OG    . SER A 1 620  ? -31.803 -119.598 24.622  1.00 24.20 ? 621  SER A OG    1 
ATOM   4721  N  N     . TRP A 1 621  ? -33.295 -117.542 26.695  1.00 23.19 ? 622  TRP A N     1 
ATOM   4722  C  CA    . TRP A 1 621  ? -32.930 -116.153 26.840  1.00 23.22 ? 622  TRP A CA    1 
ATOM   4723  C  C     . TRP A 1 621  ? -32.360 -115.914 28.233  1.00 23.59 ? 622  TRP A C     1 
ATOM   4724  O  O     . TRP A 1 621  ? -31.356 -115.215 28.374  1.00 23.22 ? 622  TRP A O     1 
ATOM   4725  C  CB    . TRP A 1 621  ? -34.134 -115.246 26.507  1.00 22.60 ? 622  TRP A CB    1 
ATOM   4726  C  CG    . TRP A 1 621  ? -34.347 -115.083 24.981  1.00 22.09 ? 622  TRP A CG    1 
ATOM   4727  C  CD1   . TRP A 1 621  ? -33.898 -115.925 23.994  1.00 22.05 ? 622  TRP A CD1   1 
ATOM   4728  C  CD2   . TRP A 1 621  ? -35.018 -114.006 24.298  1.00 21.65 ? 622  TRP A CD2   1 
ATOM   4729  N  NE1   . TRP A 1 621  ? -34.241 -115.442 22.753  1.00 21.85 ? 622  TRP A NE1   1 
ATOM   4730  C  CE2   . TRP A 1 621  ? -34.930 -114.270 22.909  1.00 21.72 ? 622  TRP A CE2   1 
ATOM   4731  C  CE3   . TRP A 1 621  ? -35.675 -112.846 24.723  1.00 21.36 ? 622  TRP A CE3   1 
ATOM   4732  C  CZ2   . TRP A 1 621  ? -35.481 -113.412 21.942  1.00 21.48 ? 622  TRP A CZ2   1 
ATOM   4733  C  CZ3   . TRP A 1 621  ? -36.220 -111.995 23.763  1.00 21.38 ? 622  TRP A CZ3   1 
ATOM   4734  C  CH2   . TRP A 1 621  ? -36.120 -112.283 22.390  1.00 21.39 ? 622  TRP A CH2   1 
ATOM   4735  N  N     . LYS A 1 622  ? -32.907 -116.626 29.224  1.00 24.26 ? 623  LYS A N     1 
ATOM   4736  C  CA    . LYS A 1 622  ? -32.462 -116.509 30.613  1.00 25.27 ? 623  LYS A CA    1 
ATOM   4737  C  C     . LYS A 1 622  ? -30.960 -116.598 30.768  1.00 26.51 ? 623  LYS A C     1 
ATOM   4738  O  O     . LYS A 1 622  ? -30.394 -116.093 31.747  1.00 26.60 ? 623  LYS A O     1 
ATOM   4739  C  CB    . LYS A 1 622  ? -33.146 -117.517 31.527  1.00 24.23 ? 623  LYS A CB    1 
ATOM   4740  C  CG    . LYS A 1 622  ? -34.320 -116.912 32.265  1.00 24.18 ? 623  LYS A CG    1 
ATOM   4741  C  CD    . LYS A 1 622  ? -34.930 -117.843 33.311  1.00 23.82 ? 623  LYS A CD    1 
ATOM   4742  C  CE    . LYS A 1 622  ? -35.740 -117.053 34.362  1.00 24.01 ? 623  LYS A CE    1 
ATOM   4743  N  NZ    . LYS A 1 622  ? -34.950 -116.120 35.280  1.00 23.74 ? 623  LYS A NZ    1 
ATOM   4744  N  N     . ASP A 1 623  ? -30.324 -117.281 29.826  1.00 27.91 ? 624  ASP A N     1 
ATOM   4745  C  CA    . ASP A 1 623  ? -28.880 -117.384 29.832  1.00 29.88 ? 624  ASP A CA    1 
ATOM   4746  C  C     . ASP A 1 623  ? -28.290 -117.392 28.435  1.00 30.57 ? 624  ASP A C     1 
ATOM   4747  O  O     . ASP A 1 623  ? -27.518 -118.274 28.056  1.00 30.42 ? 624  ASP A O     1 
ATOM   4748  C  CB    . ASP A 1 623  ? -28.326 -118.511 30.744  1.00 31.15 ? 624  ASP A CB    1 
ATOM   4749  C  CG    . ASP A 1 623  ? -29.076 -119.830 30.608  1.00 32.22 ? 624  ASP A CG    1 
ATOM   4750  O  OD1   . ASP A 1 623  ? -28.930 -120.489 29.547  1.00 32.81 ? 624  ASP A OD1   1 
ATOM   4751  O  OD2   . ASP A 1 623  ? -29.778 -120.223 31.585  1.00 32.36 ? 624  ASP A OD2   1 
ATOM   4752  N  N     . ALA A 1 624  ? -28.725 -116.403 27.659  1.00 31.47 ? 625  ALA A N     1 
ATOM   4753  C  CA    . ALA A 1 624  ? -28.213 -116.190 26.317  1.00 32.46 ? 625  ALA A CA    1 
ATOM   4754  C  C     . ALA A 1 624  ? -26.810 -115.691 26.660  1.00 33.36 ? 625  ALA A C     1 
ATOM   4755  O  O     . ALA A 1 624  ? -26.645 -114.920 27.608  1.00 33.79 ? 625  ALA A O     1 
ATOM   4756  C  CB    . ALA A 1 624  ? -29.015 -115.113 25.639  1.00 32.47 ? 625  ALA A CB    1 
ATOM   4757  N  N     . PRO A 1 625  ? -25.785 -116.093 25.905  1.00 34.15 ? 626  PRO A N     1 
ATOM   4758  C  CA    . PRO A 1 625  ? -24.519 -115.541 26.393  1.00 35.02 ? 626  PRO A CA    1 
ATOM   4759  C  C     . PRO A 1 625  ? -23.563 -114.778 25.474  1.00 36.07 ? 626  PRO A C     1 
ATOM   4760  O  O     . PRO A 1 625  ? -23.269 -115.216 24.361  1.00 36.13 ? 626  PRO A O     1 
ATOM   4761  C  CB    . PRO A 1 625  ? -23.842 -116.775 26.984  1.00 35.06 ? 626  PRO A CB    1 
ATOM   4762  C  CG    . PRO A 1 625  ? -24.542 -118.007 26.204  1.00 34.69 ? 626  PRO A CG    1 
ATOM   4763  C  CD    . PRO A 1 625  ? -25.557 -117.387 25.256  1.00 34.24 ? 626  PRO A CD    1 
ATOM   4764  N  N     . ALA A 1 626  ? -23.036 -113.679 26.039  1.00 37.25 ? 627  ALA A N     1 
ATOM   4765  C  CA    . ALA A 1 626  ? -22.059 -112.696 25.486  1.00 38.20 ? 627  ALA A CA    1 
ATOM   4766  C  C     . ALA A 1 626  ? -21.563 -112.641 24.019  1.00 38.96 ? 627  ALA A C     1 
ATOM   4767  O  O     . ALA A 1 626  ? -21.445 -113.664 23.350  1.00 39.15 ? 627  ALA A O     1 
ATOM   4768  C  CB    . ALA A 1 626  ? -20.845 -112.646 26.424  1.00 38.28 ? 627  ALA A CB    1 
ATOM   4769  N  N     . GLU A 1 627  ? -21.186 -111.439 23.563  1.00 39.97 ? 628  GLU A N     1 
ATOM   4770  C  CA    . GLU A 1 627  ? -20.670 -111.252 22.186  1.00 40.97 ? 628  GLU A CA    1 
ATOM   4771  C  C     . GLU A 1 627  ? -19.194 -110.799 22.096  1.00 41.22 ? 628  GLU A C     1 
ATOM   4772  O  O     . GLU A 1 627  ? -18.523 -110.548 23.114  1.00 41.08 ? 628  GLU A O     1 
ATOM   4773  C  CB    . GLU A 1 627  ? -21.583 -110.314 21.330  1.00 41.61 ? 628  GLU A CB    1 
ATOM   4774  C  CG    . GLU A 1 627  ? -21.105 -108.829 21.137  1.00 42.49 ? 628  GLU A CG    1 
ATOM   4775  C  CD    . GLU A 1 627  ? -21.792 -108.097 19.955  1.00 42.95 ? 628  GLU A CD    1 
ATOM   4776  O  OE1   . GLU A 1 627  ? -22.966 -107.669 20.106  1.00 43.29 ? 628  GLU A OE1   1 
ATOM   4777  O  OE2   . GLU A 1 627  ? -21.151 -107.938 18.880  1.00 42.77 ? 628  GLU A OE2   1 
ATOM   4778  N  N     . THR A 1 628  ? -18.705 -110.709 20.857  1.00 41.53 ? 629  THR A N     1 
ATOM   4779  C  CA    . THR A 1 628  ? -17.331 -110.307 20.586  1.00 42.09 ? 629  THR A CA    1 
ATOM   4780  C  C     . THR A 1 628  ? -17.223 -108.869 20.078  1.00 42.47 ? 629  THR A C     1 
ATOM   4781  O  O     . THR A 1 628  ? -18.028 -108.405 19.257  1.00 42.65 ? 629  THR A O     1 
ATOM   4782  C  CB    . THR A 1 628  ? -16.637 -111.270 19.565  1.00 42.22 ? 629  THR A CB    1 
ATOM   4783  O  OG1   . THR A 1 628  ? -16.802 -110.775 18.222  1.00 42.50 ? 629  THR A OG1   1 
ATOM   4784  C  CG2   . THR A 1 628  ? -17.220 -112.704 19.675  1.00 42.12 ? 629  THR A CG2   1 
ATOM   4785  N  N     . LYS A 1 629  ? -16.174 -108.193 20.528  1.00 42.89 ? 630  LYS A N     1 
ATOM   4786  C  CA    . LYS A 1 629  ? -15.924 -106.808 20.153  1.00 43.24 ? 630  LYS A CA    1 
ATOM   4787  C  C     . LYS A 1 629  ? -15.175 -106.540 18.831  1.00 43.52 ? 630  LYS A C     1 
ATOM   4788  O  O     . LYS A 1 629  ? -13.930 -106.634 18.761  1.00 43.14 ? 630  LYS A O     1 
ATOM   4789  C  CB    . LYS A 1 629  ? -15.224 -106.086 21.310  1.00 43.29 ? 630  LYS A CB    1 
ATOM   4790  C  CG    . LYS A 1 629  ? -14.295 -106.979 22.145  1.00 43.50 ? 630  LYS A CG    1 
ATOM   4791  C  CD    . LYS A 1 629  ? -12.828 -106.548 22.071  1.00 43.91 ? 630  LYS A CD    1 
ATOM   4792  C  CE    . LYS A 1 629  ? -12.065 -107.204 20.917  1.00 43.79 ? 630  LYS A CE    1 
ATOM   4793  N  NZ    . LYS A 1 629  ? -10.938 -108.058 21.410  1.00 43.87 ? 630  LYS A NZ    1 
ATOM   4794  N  N     . ALA A 1 630  ? -15.949 -106.248 17.778  1.00 43.66 ? 631  ALA A N     1 
ATOM   4795  C  CA    . ALA A 1 630  ? -15.383 -105.878 16.474  1.00 43.64 ? 631  ALA A CA    1 
ATOM   4796  C  C     . ALA A 1 630  ? -15.148 -104.383 16.683  1.00 43.52 ? 631  ALA A C     1 
ATOM   4797  O  O     . ALA A 1 630  ? -15.845 -103.529 16.121  1.00 43.33 ? 631  ALA A O     1 
ATOM   4798  C  CB    . ALA A 1 630  ? -16.391 -106.116 15.342  1.00 43.70 ? 631  ALA A CB    1 
ATOM   4799  N  N     . GLU A 1 631  ? -14.212 -104.107 17.590  1.00 43.47 ? 632  GLU A N     1 
ATOM   4800  C  CA    . GLU A 1 631  ? -13.848 -102.762 17.992  1.00 43.56 ? 632  GLU A CA    1 
ATOM   4801  C  C     . GLU A 1 631  ? -12.577 -102.299 17.301  1.00 43.28 ? 632  GLU A C     1 
ATOM   4802  O  O     . GLU A 1 631  ? -11.642 -103.090 17.103  1.00 43.59 ? 632  GLU A O     1 
ATOM   4803  C  CB    . GLU A 1 631  ? -13.671 -102.714 19.515  1.00 43.85 ? 632  GLU A CB    1 
ATOM   4804  C  CG    . GLU A 1 631  ? -12.676 -103.740 20.088  1.00 44.23 ? 632  GLU A CG    1 
ATOM   4805  C  CD    . GLU A 1 631  ? -11.220 -103.267 20.073  1.00 44.66 ? 632  GLU A CD    1 
ATOM   4806  O  OE1   . GLU A 1 631  ? -10.976 -102.035 20.037  1.00 44.57 ? 632  GLU A OE1   1 
ATOM   4807  O  OE2   . GLU A 1 631  ? -10.313 -104.135 20.113  1.00 45.15 ? 632  GLU A OE2   1 
ATOM   4808  N  N     . PRO A 1 632  ? -12.547 -101.020 16.875  1.00 42.73 ? 633  PRO A N     1 
ATOM   4809  C  CA    . PRO A 1 632  ? -11.386 -100.423 16.192  1.00 41.95 ? 633  PRO A CA    1 
ATOM   4810  C  C     . PRO A 1 632  ? -10.421 -99.791  17.191  1.00 40.95 ? 633  PRO A C     1 
ATOM   4811  O  O     . PRO A 1 632  ? -10.642 -99.867  18.409  1.00 41.02 ? 633  PRO A O     1 
ATOM   4812  C  CB    . PRO A 1 632  ? -12.036 -99.341  15.336  1.00 42.29 ? 633  PRO A CB    1 
ATOM   4813  C  CG    . PRO A 1 632  ? -13.143 -98.843  16.248  1.00 42.46 ? 633  PRO A CG    1 
ATOM   4814  C  CD    . PRO A 1 632  ? -13.730 -100.135 16.789  1.00 42.20 ? 633  PRO A CD    1 
ATOM   4815  N  N     . MET A 1 633  ? -9.308  -99.250  16.700  1.00 39.61 ? 634  MET A N     1 
ATOM   4816  C  CA    . MET A 1 633  ? -8.434  -98.561  17.629  1.00 38.14 ? 634  MET A CA    1 
ATOM   4817  C  C     . MET A 1 633  ? -9.116  -97.223  17.791  1.00 36.29 ? 634  MET A C     1 
ATOM   4818  O  O     . MET A 1 633  ? -9.618  -96.606  16.832  1.00 35.98 ? 634  MET A O     1 
ATOM   4819  C  CB    . MET A 1 633  ? -6.999  -98.352  17.143  1.00 39.73 ? 634  MET A CB    1 
ATOM   4820  C  CG    . MET A 1 633  ? -6.158  -97.448  18.111  1.00 41.25 ? 634  MET A CG    1 
ATOM   4821  S  SD    . MET A 1 633  ? -6.128  -97.925  19.923  1.00 43.32 ? 634  MET A SD    1 
ATOM   4822  C  CE    . MET A 1 633  ? -4.592  -97.018  20.534  1.00 42.33 ? 634  MET A CE    1 
ATOM   4823  N  N     . THR A 1 634  ? -9.168  -96.824  19.042  1.00 33.77 ? 635  THR A N     1 
ATOM   4824  C  CA    . THR A 1 634  ? -9.796  -95.602  19.436  1.00 31.28 ? 635  THR A CA    1 
ATOM   4825  C  C     . THR A 1 634  ? -8.796  -95.188  20.534  1.00 29.80 ? 635  THR A C     1 
ATOM   4826  O  O     . THR A 1 634  ? -8.054  -96.038  21.038  1.00 29.62 ? 635  THR A O     1 
ATOM   4827  C  CB    . THR A 1 634  ? -11.269 -95.972  19.846  1.00 31.00 ? 635  THR A CB    1 
ATOM   4828  O  OG1   . THR A 1 634  ? -12.147 -94.877  19.579  1.00 30.97 ? 635  THR A OG1   1 
ATOM   4829  C  CG2   . THR A 1 634  ? -11.383 -96.450  21.280  1.00 30.80 ? 635  THR A CG2   1 
ATOM   4830  N  N     . ASN A 1 635  ? -8.675  -93.902  20.833  1.00 27.98 ? 636  ASN A N     1 
ATOM   4831  C  CA    . ASN A 1 635  ? -7.696  -93.453  21.835  1.00 26.33 ? 636  ASN A CA    1 
ATOM   4832  C  C     . ASN A 1 635  ? -7.795  -93.913  23.276  1.00 24.61 ? 636  ASN A C     1 
ATOM   4833  O  O     . ASN A 1 635  ? -8.814  -94.388  23.752  1.00 24.00 ? 636  ASN A O     1 
ATOM   4834  C  CB    . ASN A 1 635  ? -7.683  -91.939  21.932  1.00 27.54 ? 636  ASN A CB    1 
ATOM   4835  C  CG    . ASN A 1 635  ? -7.474  -91.288  20.632  1.00 28.60 ? 636  ASN A CG    1 
ATOM   4836  O  OD1   . ASN A 1 635  ? -6.752  -91.803  19.775  1.00 30.28 ? 636  ASN A OD1   1 
ATOM   4837  N  ND2   . ASN A 1 635  ? -8.110  -90.135  20.448  1.00 29.18 ? 636  ASN A ND2   1 
ATOM   4838  N  N     . GLU A 1 636  ? -6.735  -93.605  24.002  1.00 22.68 ? 637  GLU A N     1 
ATOM   4839  C  CA    . GLU A 1 636  ? -6.686  -93.891  25.405  1.00 21.17 ? 637  GLU A CA    1 
ATOM   4840  C  C     . GLU A 1 636  ? -7.808  -93.043  26.013  1.00 19.64 ? 637  GLU A C     1 
ATOM   4841  O  O     . GLU A 1 636  ? -8.422  -93.440  26.987  1.00 20.38 ? 637  GLU A O     1 
ATOM   4842  C  CB    . GLU A 1 636  ? -5.310  -93.486  25.987  1.00 22.27 ? 637  GLU A CB    1 
ATOM   4843  C  CG    . GLU A 1 636  ? -5.032  -91.941  26.223  1.00 24.40 ? 637  GLU A CG    1 
ATOM   4844  C  CD    . GLU A 1 636  ? -4.654  -91.107  24.963  1.00 25.16 ? 637  GLU A CD    1 
ATOM   4845  O  OE1   . GLU A 1 636  ? -5.560  -90.694  24.191  1.00 25.30 ? 637  GLU A OE1   1 
ATOM   4846  O  OE2   . GLU A 1 636  ? -3.445  -90.811  24.779  1.00 25.63 ? 637  GLU A OE2   1 
ATOM   4847  N  N     . PHE A 1 637  ? -8.112  -91.909  25.388  1.00 17.61 ? 638  PHE A N     1 
ATOM   4848  C  CA    . PHE A 1 637  ? -9.132  -90.981  25.870  1.00 16.27 ? 638  PHE A CA    1 
ATOM   4849  C  C     . PHE A 1 637  ? -10.548 -91.283  25.398  1.00 15.84 ? 638  PHE A C     1 
ATOM   4850  O  O     . PHE A 1 637  ? -11.522 -91.083  26.134  1.00 15.99 ? 638  PHE A O     1 
ATOM   4851  C  CB    . PHE A 1 637  ? -8.763  -89.572  25.443  1.00 15.88 ? 638  PHE A CB    1 
ATOM   4852  C  CG    . PHE A 1 637  ? -9.663  -88.500  25.995  1.00 15.49 ? 638  PHE A CG    1 
ATOM   4853  C  CD1   . PHE A 1 637  ? -9.466  -88.005  27.282  1.00 14.84 ? 638  PHE A CD1   1 
ATOM   4854  C  CD2   . PHE A 1 637  ? -10.641 -87.916  25.196  1.00 15.31 ? 638  PHE A CD2   1 
ATOM   4855  C  CE1   . PHE A 1 637  ? -10.219 -86.939  27.757  1.00 14.91 ? 638  PHE A CE1   1 
ATOM   4856  C  CE2   . PHE A 1 637  ? -11.407 -86.841  25.665  1.00 15.06 ? 638  PHE A CE2   1 
ATOM   4857  C  CZ    . PHE A 1 637  ? -11.192 -86.352  26.946  1.00 14.96 ? 638  PHE A CZ    1 
ATOM   4858  N  N     . PHE A 1 638  ? -10.674 -91.681  24.138  1.00 14.92 ? 639  PHE A N     1 
ATOM   4859  C  CA    . PHE A 1 638  ? -11.977 -92.004  23.588  1.00 13.73 ? 639  PHE A CA    1 
ATOM   4860  C  C     . PHE A 1 638  ? -12.490 -93.181  24.387  1.00 13.77 ? 639  PHE A C     1 
ATOM   4861  O  O     . PHE A 1 638  ? -13.609 -93.184  24.872  1.00 14.37 ? 639  PHE A O     1 
ATOM   4862  C  CB    . PHE A 1 638  ? -11.834 -92.386  22.132  1.00 12.25 ? 639  PHE A CB    1 
ATOM   4863  C  CG    . PHE A 1 638  ? -13.119 -92.492  21.429  1.00 11.12 ? 639  PHE A CG    1 
ATOM   4864  C  CD1   . PHE A 1 638  ? -13.897 -93.623  21.555  1.00 10.30 ? 639  PHE A CD1   1 
ATOM   4865  C  CD2   . PHE A 1 638  ? -13.559 -91.460  20.635  1.00 11.03 ? 639  PHE A CD2   1 
ATOM   4866  C  CE1   . PHE A 1 638  ? -15.092 -93.731  20.904  1.00 9.90  ? 639  PHE A CE1   1 
ATOM   4867  C  CE2   . PHE A 1 638  ? -14.764 -91.558  19.975  1.00 11.10 ? 639  PHE A CE2   1 
ATOM   4868  C  CZ    . PHE A 1 638  ? -15.531 -92.701  20.111  1.00 10.45 ? 639  PHE A CZ    1 
ATOM   4869  N  N     . LYS A 1 639  ? -11.627 -94.172  24.532  1.00 13.92 ? 640  LYS A N     1 
ATOM   4870  C  CA    . LYS A 1 639  ? -11.906 -95.377  25.290  1.00 13.89 ? 640  LYS A CA    1 
ATOM   4871  C  C     . LYS A 1 639  ? -12.390 -94.986  26.676  1.00 13.54 ? 640  LYS A C     1 
ATOM   4872  O  O     . LYS A 1 639  ? -13.462 -95.407  27.113  1.00 14.04 ? 640  LYS A O     1 
ATOM   4873  C  CB    . LYS A 1 639  ? -10.595 -96.162  25.463  1.00 14.76 ? 640  LYS A CB    1 
ATOM   4874  C  CG    . LYS A 1 639  ? -10.696 -97.650  25.814  1.00 15.73 ? 640  LYS A CG    1 
ATOM   4875  C  CD    . LYS A 1 639  ? -10.422 -98.515  24.559  1.00 16.26 ? 640  LYS A CD    1 
ATOM   4876  C  CE    . LYS A 1 639  ? -9.004  -98.338  23.997  1.00 15.89 ? 640  LYS A CE    1 
ATOM   4877  N  NZ    . LYS A 1 639  ? -8.965  -98.741  22.559  1.00 16.38 ? 640  LYS A NZ    1 
ATOM   4878  N  N     . ASN A 1 640  ? -11.645 -94.098  27.318  1.00 12.37 ? 641  ASN A N     1 
ATOM   4879  C  CA    . ASN A 1 640  ? -11.943 -93.725  28.676  1.00 12.06 ? 641  ASN A CA    1 
ATOM   4880  C  C     . ASN A 1 640  ? -12.880 -92.603  29.022  1.00 12.24 ? 641  ASN A C     1 
ATOM   4881  O  O     . ASN A 1 640  ? -13.309 -92.521  30.186  1.00 13.09 ? 641  ASN A O     1 
ATOM   4882  C  CB    . ASN A 1 640  ? -10.652 -93.511  29.428  1.00 12.36 ? 641  ASN A CB    1 
ATOM   4883  C  CG    . ASN A 1 640  ? -9.807  -94.741  29.452  1.00 12.94 ? 641  ASN A CG    1 
ATOM   4884  O  OD1   . ASN A 1 640  ? -10.296 -95.840  29.209  1.00 13.49 ? 641  ASN A OD1   1 
ATOM   4885  N  ND2   . ASN A 1 640  ? -8.515  -94.569  29.718  1.00 13.26 ? 641  ASN A ND2   1 
ATOM   4886  N  N     . VAL A 1 641  ? -13.191 -91.724  28.074  1.00 11.56 ? 642  VAL A N     1 
ATOM   4887  C  CA    . VAL A 1 641  ? -14.071 -90.605  28.386  1.00 10.93 ? 642  VAL A CA    1 
ATOM   4888  C  C     . VAL A 1 641  ? -15.123 -90.303  27.336  1.00 11.28 ? 642  VAL A C     1 
ATOM   4889  O  O     . VAL A 1 641  ? -16.318 -90.239  27.643  1.00 11.04 ? 642  VAL A O     1 
ATOM   4890  C  CB    . VAL A 1 641  ? -13.271 -89.322  28.659  1.00 10.43 ? 642  VAL A CB    1 
ATOM   4891  C  CG1   . VAL A 1 641  ? -14.209 -88.152  28.877  1.00 10.44 ? 642  VAL A CG1   1 
ATOM   4892  C  CG2   . VAL A 1 641  ? -12.403 -89.493  29.872  1.00 10.44 ? 642  VAL A CG2   1 
ATOM   4893  N  N     . VAL A 1 642  ? -14.699 -90.139  26.090  1.00 11.52 ? 643  VAL A N     1 
ATOM   4894  C  CA    . VAL A 1 642  ? -15.669 -89.803  25.068  1.00 11.69 ? 643  VAL A CA    1 
ATOM   4895  C  C     . VAL A 1 642  ? -16.632 -90.909  24.690  1.00 11.59 ? 643  VAL A C     1 
ATOM   4896  O  O     . VAL A 1 642  ? -17.755 -90.620  24.329  1.00 11.93 ? 643  VAL A O     1 
ATOM   4897  C  CB    . VAL A 1 642  ? -15.049 -89.047  23.848  1.00 12.05 ? 643  VAL A CB    1 
ATOM   4898  C  CG1   . VAL A 1 642  ? -13.561 -88.948  23.989  1.00 12.24 ? 643  VAL A CG1   1 
ATOM   4899  C  CG2   . VAL A 1 642  ? -15.454 -89.669  22.524  1.00 12.27 ? 643  VAL A CG2   1 
ATOM   4900  N  N     . LYS A 1 643  ? -16.244 -92.173  24.819  1.00 11.50 ? 644  LYS A N     1 
ATOM   4901  C  CA    . LYS A 1 643  ? -17.197 -93.221  24.491  1.00 11.71 ? 644  LYS A CA    1 
ATOM   4902  C  C     . LYS A 1 643  ? -18.232 -93.343  25.619  1.00 11.17 ? 644  LYS A C     1 
ATOM   4903  O  O     . LYS A 1 643  ? -19.438 -93.380  25.367  1.00 11.13 ? 644  LYS A O     1 
ATOM   4904  C  CB    . LYS A 1 643  ? -16.520 -94.558  24.184  1.00 12.88 ? 644  LYS A CB    1 
ATOM   4905  C  CG    . LYS A 1 643  ? -17.490 -95.546  23.490  1.00 15.60 ? 644  LYS A CG    1 
ATOM   4906  C  CD    . LYS A 1 643  ? -16.827 -96.792  22.859  1.00 17.41 ? 644  LYS A CD    1 
ATOM   4907  C  CE    . LYS A 1 643  ? -17.888 -97.742  22.233  1.00 19.05 ? 644  LYS A CE    1 
ATOM   4908  N  NZ    . LYS A 1 643  ? -17.314 -98.950  21.497  1.00 20.75 ? 644  LYS A NZ    1 
ATOM   4909  N  N     . PRO A 1 644  ? -17.775 -93.365  26.880  1.00 10.50 ? 645  PRO A N     1 
ATOM   4910  C  CA    . PRO A 1 644  ? -18.679 -93.471  28.026  1.00 10.30 ? 645  PRO A CA    1 
ATOM   4911  C  C     . PRO A 1 644  ? -19.751 -92.395  28.009  1.00 10.51 ? 645  PRO A C     1 
ATOM   4912  O  O     . PRO A 1 644  ? -20.896 -92.659  28.340  1.00 10.87 ? 645  PRO A O     1 
ATOM   4913  C  CB    . PRO A 1 644  ? -17.749 -93.263  29.200  1.00 10.43 ? 645  PRO A CB    1 
ATOM   4914  C  CG    . PRO A 1 644  ? -16.495 -93.897  28.724  1.00 10.88 ? 645  PRO A CG    1 
ATOM   4915  C  CD    . PRO A 1 644  ? -16.372 -93.420  27.317  1.00 10.31 ? 645  PRO A CD    1 
ATOM   4916  N  N     . ILE A 1 645  ? -19.384 -91.174  27.641  1.00 10.44 ? 646  ILE A N     1 
ATOM   4917  C  CA    . ILE A 1 645  ? -20.367 -90.098  27.588  1.00 10.69 ? 646  ILE A CA    1 
ATOM   4918  C  C     . ILE A 1 645  ? -21.360 -90.321  26.449  1.00 11.16 ? 646  ILE A C     1 
ATOM   4919  O  O     . ILE A 1 645  ? -22.575 -90.230  26.631  1.00 11.62 ? 646  ILE A O     1 
ATOM   4920  C  CB    . ILE A 1 645  ? -19.699 -88.742  27.384  1.00 10.31 ? 646  ILE A CB    1 
ATOM   4921  C  CG1   . ILE A 1 645  ? -18.833 -88.391  28.589  1.00 9.86  ? 646  ILE A CG1   1 
ATOM   4922  C  CG2   . ILE A 1 645  ? -20.752 -87.678  27.176  1.00 9.92  ? 646  ILE A CG2   1 
ATOM   4923  C  CD1   . ILE A 1 645  ? -17.810 -87.324  28.290  1.00 9.99  ? 646  ILE A CD1   1 
ATOM   4924  N  N     . LEU A 1 646  ? -20.837 -90.611  25.271  1.00 11.41 ? 647  LEU A N     1 
ATOM   4925  C  CA    . LEU A 1 646  ? -21.672 -90.847  24.111  1.00 11.73 ? 647  LEU A CA    1 
ATOM   4926  C  C     . LEU A 1 646  ? -22.633 -92.039  24.299  1.00 12.75 ? 647  LEU A C     1 
ATOM   4927  O  O     . LEU A 1 646  ? -23.651 -92.139  23.606  1.00 12.85 ? 647  LEU A O     1 
ATOM   4928  C  CB    . LEU A 1 646  ? -20.780 -91.088  22.901  1.00 11.09 ? 647  LEU A CB    1 
ATOM   4929  C  CG    . LEU A 1 646  ? -19.759 -90.018  22.543  1.00 10.62 ? 647  LEU A CG    1 
ATOM   4930  C  CD1   . LEU A 1 646  ? -18.867 -90.528  21.438  1.00 10.21 ? 647  LEU A CD1   1 
ATOM   4931  C  CD2   . LEU A 1 646  ? -20.437 -88.730  22.145  1.00 10.91 ? 647  LEU A CD2   1 
ATOM   4932  N  N     . THR A 1 647  ? -22.314 -92.954  25.211  1.00 13.51 ? 648  THR A N     1 
ATOM   4933  C  CA    . THR A 1 647  ? -23.201 -94.087  25.409  1.00 14.66 ? 648  THR A CA    1 
ATOM   4934  C  C     . THR A 1 647  ? -24.034 -93.894  26.642  1.00 15.32 ? 648  THR A C     1 
ATOM   4935  O  O     . THR A 1 647  ? -24.431 -94.852  27.294  1.00 15.42 ? 648  THR A O     1 
ATOM   4936  C  CB    . THR A 1 647  ? -22.451 -95.403  25.505  1.00 14.89 ? 648  THR A CB    1 
ATOM   4937  O  OG1   . THR A 1 647  ? -21.567 -95.373  26.628  1.00 15.51 ? 648  THR A OG1   1 
ATOM   4938  C  CG2   . THR A 1 647  ? -21.662 -95.632  24.248  1.00 15.44 ? 648  THR A CG2   1 
ATOM   4939  N  N     . GLN A 1 648  ? -24.242 -92.628  26.979  1.00 16.40 ? 649  GLN A N     1 
ATOM   4940  C  CA    . GLN A 1 648  ? -25.060 -92.203  28.115  1.00 17.47 ? 649  GLN A CA    1 
ATOM   4941  C  C     . GLN A 1 648  ? -24.599 -92.654  29.518  1.00 17.03 ? 649  GLN A C     1 
ATOM   4942  O  O     . GLN A 1 648  ? -25.407 -92.931  30.414  1.00 17.35 ? 649  GLN A O     1 
ATOM   4943  C  CB    . GLN A 1 648  ? -26.536 -92.562  27.842  1.00 19.18 ? 649  GLN A CB    1 
ATOM   4944  C  CG    . GLN A 1 648  ? -27.080 -92.112  26.433  1.00 21.72 ? 649  GLN A CG    1 
ATOM   4945  C  CD    . GLN A 1 648  ? -27.132 -90.566  26.206  1.00 23.45 ? 649  GLN A CD    1 
ATOM   4946  O  OE1   . GLN A 1 648  ? -27.275 -89.781  27.161  1.00 24.01 ? 649  GLN A OE1   1 
ATOM   4947  N  NE2   . GLN A 1 648  ? -27.039 -90.141  24.928  1.00 23.79 ? 649  GLN A NE2   1 
ATOM   4948  N  N     . GLN A 1 649  ? -23.289 -92.631  29.721  1.00 16.65 ? 650  GLN A N     1 
ATOM   4949  C  CA    . GLN A 1 649  ? -22.687 -93.016  30.983  1.00 16.12 ? 650  GLN A CA    1 
ATOM   4950  C  C     . GLN A 1 649  ? -21.651 -91.964  31.364  1.00 15.97 ? 650  GLN A C     1 
ATOM   4951  O  O     . GLN A 1 649  ? -20.521 -92.311  31.695  1.00 16.37 ? 650  GLN A O     1 
ATOM   4952  C  CB    . GLN A 1 649  ? -21.981 -94.356  30.817  1.00 16.03 ? 650  GLN A CB    1 
ATOM   4953  C  CG    . GLN A 1 649  ? -22.776 -95.393  30.068  1.00 16.51 ? 650  GLN A CG    1 
ATOM   4954  C  CD    . GLN A 1 649  ? -23.702 -96.159  30.972  1.00 16.69 ? 650  GLN A CD    1 
ATOM   4955  O  OE1   . GLN A 1 649  ? -24.871 -95.794  31.151  1.00 16.87 ? 650  GLN A OE1   1 
ATOM   4956  N  NE2   . GLN A 1 649  ? -23.179 -97.233  31.571  1.00 17.25 ? 650  GLN A NE2   1 
ATOM   4957  N  N     . GLY A 1 650  ? -22.004 -90.686  31.265  1.00 15.22 ? 651  GLY A N     1 
ATOM   4958  C  CA    . GLY A 1 650  ? -21.062 -89.640  31.622  1.00 14.42 ? 651  GLY A CA    1 
ATOM   4959  C  C     . GLY A 1 650  ? -21.211 -89.246  33.074  1.00 14.09 ? 651  GLY A C     1 
ATOM   4960  O  O     . GLY A 1 650  ? -20.310 -88.678  33.688  1.00 14.02 ? 651  GLY A O     1 
ATOM   4961  N  N     . ASP A 1 651  ? -22.384 -89.514  33.623  1.00 14.16 ? 652  ASP A N     1 
ATOM   4962  C  CA    . ASP A 1 651  ? -22.643 -89.194  35.006  1.00 14.43 ? 652  ASP A CA    1 
ATOM   4963  C  C     . ASP A 1 651  ? -21.730 -90.073  35.791  1.00 13.88 ? 652  ASP A C     1 
ATOM   4964  O  O     . ASP A 1 651  ? -21.296 -89.710  36.870  1.00 14.80 ? 652  ASP A O     1 
ATOM   4965  C  CB    . ASP A 1 651  ? -24.071 -89.536  35.393  1.00 16.51 ? 652  ASP A CB    1 
ATOM   4966  C  CG    . ASP A 1 651  ? -25.094 -88.706  34.644  1.00 19.29 ? 652  ASP A CG    1 
ATOM   4967  O  OD1   . ASP A 1 651  ? -25.344 -89.021  33.451  1.00 20.55 ? 652  ASP A OD1   1 
ATOM   4968  O  OD2   . ASP A 1 651  ? -25.662 -87.747  35.241  1.00 21.25 ? 652  ASP A OD2   1 
ATOM   4969  N  N     . LYS A 1 652  ? -21.419 -91.238  35.245  1.00 12.75 ? 653  LYS A N     1 
ATOM   4970  C  CA    . LYS A 1 652  ? -20.554 -92.163  35.944  1.00 11.43 ? 653  LYS A CA    1 
ATOM   4971  C  C     . LYS A 1 652  ? -19.098 -91.785  36.130  1.00 9.64  ? 653  LYS A C     1 
ATOM   4972  O  O     . LYS A 1 652  ? -18.472 -92.276  37.061  1.00 9.24  ? 653  LYS A O     1 
ATOM   4973  C  CB    . LYS A 1 652  ? -20.738 -93.567  35.394  1.00 13.06 ? 653  LYS A CB    1 
ATOM   4974  C  CG    . LYS A 1 652  ? -21.946 -94.229  36.058  1.00 15.22 ? 653  LYS A CG    1 
ATOM   4975  C  CD    . LYS A 1 652  ? -22.372 -95.538  35.423  1.00 16.72 ? 653  LYS A CD    1 
ATOM   4976  C  CE    . LYS A 1 652  ? -23.420 -95.311  34.336  1.00 17.99 ? 653  LYS A CE    1 
ATOM   4977  N  NZ    . LYS A 1 652  ? -24.073 -96.613  34.002  1.00 19.18 ? 653  LYS A NZ    1 
ATOM   4978  N  N     . LEU A 1 653  ? -18.587 -90.896  35.275  1.00 8.03  ? 654  LEU A N     1 
ATOM   4979  C  CA    . LEU A 1 653  ? -17.209 -90.388  35.344  1.00 6.73  ? 654  LEU A CA    1 
ATOM   4980  C  C     . LEU A 1 653  ? -17.048 -89.523  36.617  1.00 6.38  ? 654  LEU A C     1 
ATOM   4981  O  O     . LEU A 1 653  ? -17.799 -88.557  36.828  1.00 7.06  ? 654  LEU A O     1 
ATOM   4982  C  CB    . LEU A 1 653  ? -16.922 -89.493  34.140  1.00 6.28  ? 654  LEU A CB    1 
ATOM   4983  C  CG    . LEU A 1 653  ? -16.321 -89.895  32.791  1.00 5.92  ? 654  LEU A CG    1 
ATOM   4984  C  CD1   . LEU A 1 653  ? -16.209 -91.357  32.641  1.00 5.72  ? 654  LEU A CD1   1 
ATOM   4985  C  CD2   . LEU A 1 653  ? -17.137 -89.293  31.663  1.00 5.57  ? 654  LEU A CD2   1 
ATOM   4986  N  N     . PRO A 1 654  ? -16.046 -89.825  37.458  1.00 5.09  ? 655  PRO A N     1 
ATOM   4987  C  CA    . PRO A 1 654  ? -15.783 -89.086  38.701  1.00 4.21  ? 655  PRO A CA    1 
ATOM   4988  C  C     . PRO A 1 654  ? -15.111 -87.763  38.356  1.00 3.48  ? 655  PRO A C     1 
ATOM   4989  O  O     . PRO A 1 654  ? -14.805 -87.543  37.190  1.00 3.99  ? 655  PRO A O     1 
ATOM   4990  C  CB    . PRO A 1 654  ? -14.838 -90.016  39.414  1.00 4.54  ? 655  PRO A CB    1 
ATOM   4991  C  CG    . PRO A 1 654  ? -13.984 -90.498  38.278  1.00 4.68  ? 655  PRO A CG    1 
ATOM   4992  C  CD    . PRO A 1 654  ? -14.986 -90.816  37.203  1.00 4.70  ? 655  PRO A CD    1 
ATOM   4993  N  N     . VAL A 1 655  ? -14.824 -86.898  39.326  1.00 2.43  ? 656  VAL A N     1 
ATOM   4994  C  CA    . VAL A 1 655  ? -14.213 -85.613  38.959  1.00 2.31  ? 656  VAL A CA    1 
ATOM   4995  C  C     . VAL A 1 655  ? -12.775 -85.733  38.432  1.00 2.80  ? 656  VAL A C     1 
ATOM   4996  O  O     . VAL A 1 655  ? -12.310 -84.919  37.629  1.00 3.30  ? 656  VAL A O     1 
ATOM   4997  C  CB    . VAL A 1 655  ? -14.340 -84.524  40.074  1.00 2.00  ? 656  VAL A CB    1 
ATOM   4998  C  CG1   . VAL A 1 655  ? -15.590 -84.737  40.906  1.00 2.23  ? 656  VAL A CG1   1 
ATOM   4999  C  CG2   . VAL A 1 655  ? -13.159 -84.495  40.942  1.00 2.00  ? 656  VAL A CG2   1 
ATOM   5000  N  N     . SER A 1 656  ? -12.093 -86.801  38.808  1.00 3.10  ? 657  SER A N     1 
ATOM   5001  C  CA    . SER A 1 656  ? -10.725 -87.013  38.360  1.00 3.02  ? 657  SER A CA    1 
ATOM   5002  C  C     . SER A 1 656  ? -10.616 -87.273  36.862  1.00 3.52  ? 657  SER A C     1 
ATOM   5003  O  O     . SER A 1 656  ? -9.521  -87.298  36.302  1.00 4.85  ? 657  SER A O     1 
ATOM   5004  C  CB    . SER A 1 656  ? -10.167 -88.201  39.092  1.00 2.36  ? 657  SER A CB    1 
ATOM   5005  O  OG    . SER A 1 656  ? -11.101 -89.256  39.006  1.00 2.43  ? 657  SER A OG    1 
ATOM   5006  N  N     . ALA A 1 657  ? -11.729 -87.523  36.203  1.00 3.28  ? 658  ALA A N     1 
ATOM   5007  C  CA    . ALA A 1 657  ? -11.672 -87.782  34.780  1.00 3.37  ? 658  ALA A CA    1 
ATOM   5008  C  C     . ALA A 1 657  ? -11.563 -86.498  34.002  1.00 4.01  ? 658  ALA A C     1 
ATOM   5009  O  O     . ALA A 1 657  ? -11.224 -86.499  32.823  1.00 4.46  ? 658  ALA A O     1 
ATOM   5010  C  CB    . ALA A 1 657  ? -12.912 -88.504  34.360  1.00 3.90  ? 658  ALA A CB    1 
ATOM   5011  N  N     . PHE A 1 658  ? -11.878 -85.392  34.653  1.00 4.38  ? 659  PHE A N     1 
ATOM   5012  C  CA    . PHE A 1 658  ? -11.885 -84.121  33.972  1.00 4.58  ? 659  PHE A CA    1 
ATOM   5013  C  C     . PHE A 1 658  ? -10.794 -83.216  34.456  1.00 5.16  ? 659  PHE A C     1 
ATOM   5014  O  O     . PHE A 1 658  ? -10.514 -83.161  35.649  1.00 5.82  ? 659  PHE A O     1 
ATOM   5015  C  CB    . PHE A 1 658  ? -13.238 -83.432  34.178  1.00 3.97  ? 659  PHE A CB    1 
ATOM   5016  C  CG    . PHE A 1 658  ? -14.415 -84.329  33.944  1.00 3.44  ? 659  PHE A CG    1 
ATOM   5017  C  CD1   . PHE A 1 658  ? -14.881 -84.550  32.674  1.00 3.09  ? 659  PHE A CD1   1 
ATOM   5018  C  CD2   . PHE A 1 658  ? -15.014 -85.000  35.005  1.00 3.81  ? 659  PHE A CD2   1 
ATOM   5019  C  CE1   . PHE A 1 658  ? -15.902 -85.415  32.456  1.00 3.01  ? 659  PHE A CE1   1 
ATOM   5020  C  CE2   . PHE A 1 658  ? -16.045 -85.879  34.796  1.00 3.08  ? 659  PHE A CE2   1 
ATOM   5021  C  CZ    . PHE A 1 658  ? -16.487 -86.089  33.522  1.00 3.63  ? 659  PHE A CZ    1 
ATOM   5022  N  N     . GLU A 1 659  ? -10.304 -82.413  33.517  1.00 5.52  ? 660  GLU A N     1 
ATOM   5023  C  CA    . GLU A 1 659  ? -9.243  -81.442  33.703  1.00 5.77  ? 660  GLU A CA    1 
ATOM   5024  C  C     . GLU A 1 659  ? -9.699  -80.230  34.496  1.00 5.44  ? 660  GLU A C     1 
ATOM   5025  O  O     . GLU A 1 659  ? -10.705 -79.619  34.189  1.00 5.42  ? 660  GLU A O     1 
ATOM   5026  C  CB    . GLU A 1 659  ? -8.751  -81.018  32.323  1.00 7.18  ? 660  GLU A CB    1 
ATOM   5027  C  CG    . GLU A 1 659  ? -7.750  -81.984  31.701  1.00 8.96  ? 660  GLU A CG    1 
ATOM   5028  C  CD    . GLU A 1 659  ? -6.325  -81.562  31.980  1.00 10.57 ? 660  GLU A CD    1 
ATOM   5029  O  OE1   . GLU A 1 659  ? -5.753  -81.916  33.050  1.00 12.16 ? 660  GLU A OE1   1 
ATOM   5030  O  OE2   . GLU A 1 659  ? -5.779  -80.832  31.127  1.00 12.10 ? 660  GLU A OE2   1 
ATOM   5031  N  N     . ALA A 1 660  ? -8.928  -79.843  35.494  1.00 5.57  ? 661  ALA A N     1 
ATOM   5032  C  CA    . ALA A 1 660  ? -9.312  -78.715  36.320  1.00 5.59  ? 661  ALA A CA    1 
ATOM   5033  C  C     . ALA A 1 660  ? -9.854  -77.530  35.546  1.00 5.91  ? 661  ALA A C     1 
ATOM   5034  O  O     . ALA A 1 660  ? -10.892 -76.996  35.906  1.00 6.64  ? 661  ALA A O     1 
ATOM   5035  C  CB    . ALA A 1 660  ? -8.151  -78.282  37.198  1.00 5.94  ? 661  ALA A CB    1 
ATOM   5036  N  N     . ASP A 1 661  ? -9.192  -77.138  34.463  1.00 6.30  ? 662  ASP A N     1 
ATOM   5037  C  CA    . ASP A 1 661  ? -9.655  -75.984  33.700  1.00 6.53  ? 662  ASP A CA    1 
ATOM   5038  C  C     . ASP A 1 661  ? -10.633 -76.292  32.591  1.00 6.71  ? 662  ASP A C     1 
ATOM   5039  O  O     . ASP A 1 661  ? -10.888 -75.461  31.736  1.00 6.74  ? 662  ASP A O     1 
ATOM   5040  C  CB    . ASP A 1 661  ? -8.483  -75.153  33.182  1.00 6.60  ? 662  ASP A CB    1 
ATOM   5041  C  CG    . ASP A 1 661  ? -7.644  -75.879  32.167  1.00 7.45  ? 662  ASP A CG    1 
ATOM   5042  O  OD1   . ASP A 1 661  ? -7.873  -77.072  31.926  1.00 8.03  ? 662  ASP A OD1   1 
ATOM   5043  O  OD2   . ASP A 1 661  ? -6.740  -75.244  31.599  1.00 7.88  ? 662  ASP A OD2   1 
ATOM   5044  N  N     . GLY A 1 662  ? -11.174 -77.502  32.621  1.00 7.20  ? 663  GLY A N     1 
ATOM   5045  C  CA    . GLY A 1 662  ? -12.155 -77.946  31.644  1.00 7.46  ? 663  GLY A CA    1 
ATOM   5046  C  C     . GLY A 1 662  ? -11.761 -78.078  30.184  1.00 7.60  ? 663  GLY A C     1 
ATOM   5047  O  O     . GLY A 1 662  ? -12.633 -78.152  29.335  1.00 8.55  ? 663  GLY A O     1 
ATOM   5048  N  N     . ARG A 1 663  ? -10.480 -78.171  29.861  1.00 7.73  ? 664  ARG A N     1 
ATOM   5049  C  CA    . ARG A 1 663  ? -10.091 -78.260  28.454  1.00 7.65  ? 664  ARG A CA    1 
ATOM   5050  C  C     . ARG A 1 663  ? -10.384 -79.616  27.894  1.00 7.77  ? 664  ARG A C     1 
ATOM   5051  O  O     . ARG A 1 663  ? -10.653 -80.541  28.639  1.00 8.26  ? 664  ARG A O     1 
ATOM   5052  C  CB    . ARG A 1 663  ? -8.604  -77.972  28.284  1.00 7.41  ? 664  ARG A CB    1 
ATOM   5053  C  CG    . ARG A 1 663  ? -7.709  -79.033  28.892  1.00 7.82  ? 664  ARG A CG    1 
ATOM   5054  C  CD    . ARG A 1 663  ? -6.234  -78.698  28.741  1.00 8.20  ? 664  ARG A CD    1 
ATOM   5055  N  NE    . ARG A 1 663  ? -5.859  -77.505  29.499  1.00 8.13  ? 664  ARG A NE    1 
ATOM   5056  C  CZ    . ARG A 1 663  ? -5.127  -76.511  29.008  1.00 8.22  ? 664  ARG A CZ    1 
ATOM   5057  N  NH1   . ARG A 1 663  ? -4.692  -76.560  27.758  1.00 7.75  ? 664  ARG A NH1   1 
ATOM   5058  N  NH2   . ARG A 1 663  ? -4.814  -75.472  29.770  1.00 8.92  ? 664  ARG A NH2   1 
ATOM   5059  N  N     . PHE A 1 664  ? -10.327 -79.726  26.575  1.00 8.07  ? 665  PHE A N     1 
ATOM   5060  C  CA    . PHE A 1 664  ? -10.561 -80.985  25.881  1.00 8.53  ? 665  PHE A CA    1 
ATOM   5061  C  C     . PHE A 1 664  ? -9.558  -81.061  24.762  1.00 8.71  ? 665  PHE A C     1 
ATOM   5062  O  O     . PHE A 1 664  ? -9.100  -80.038  24.264  1.00 9.05  ? 665  PHE A O     1 
ATOM   5063  C  CB    . PHE A 1 664  ? -11.974 -81.059  25.271  1.00 9.19  ? 665  PHE A CB    1 
ATOM   5064  C  CG    . PHE A 1 664  ? -12.981 -81.775  26.139  1.00 9.29  ? 665  PHE A CG    1 
ATOM   5065  C  CD1   . PHE A 1 664  ? -13.429 -81.198  27.333  1.00 9.35  ? 665  PHE A CD1   1 
ATOM   5066  C  CD2   . PHE A 1 664  ? -13.424 -83.042  25.803  1.00 9.13  ? 665  PHE A CD2   1 
ATOM   5067  C  CE1   . PHE A 1 664  ? -14.288 -81.875  28.181  1.00 9.08  ? 665  PHE A CE1   1 
ATOM   5068  C  CE2   . PHE A 1 664  ? -14.290 -83.722  26.649  1.00 9.44  ? 665  PHE A CE2   1 
ATOM   5069  C  CZ    . PHE A 1 664  ? -14.719 -83.136  27.845  1.00 9.30  ? 665  PHE A CZ    1 
ATOM   5070  N  N     . PRO A 1 665  ? -9.148  -82.279  24.394  1.00 8.59  ? 666  PRO A N     1 
ATOM   5071  C  CA    . PRO A 1 665  ? -8.190  -82.491  23.316  1.00 8.47  ? 666  PRO A CA    1 
ATOM   5072  C  C     . PRO A 1 665  ? -8.971  -82.464  22.024  1.00 8.60  ? 666  PRO A C     1 
ATOM   5073  O  O     . PRO A 1 665  ? -10.176 -82.706  22.047  1.00 8.64  ? 666  PRO A O     1 
ATOM   5074  C  CB    . PRO A 1 665  ? -7.690  -83.899  23.603  1.00 8.64  ? 666  PRO A CB    1 
ATOM   5075  C  CG    . PRO A 1 665  ? -8.890  -84.579  24.156  1.00 7.88  ? 666  PRO A CG    1 
ATOM   5076  C  CD    . PRO A 1 665  ? -9.426  -83.540  25.103  1.00 9.09  ? 666  PRO A CD    1 
ATOM   5077  N  N     . LEU A 1 666  ? -8.305  -82.179  20.905  1.00 8.64  ? 667  LEU A N     1 
ATOM   5078  C  CA    . LEU A 1 666  ? -8.994  -82.155  19.621  1.00 9.12  ? 667  LEU A CA    1 
ATOM   5079  C  C     . LEU A 1 666  ? -9.235  -83.566  19.049  1.00 10.36 ? 667  LEU A C     1 
ATOM   5080  O  O     . LEU A 1 666  ? -8.981  -84.590  19.708  1.00 11.16 ? 667  LEU A O     1 
ATOM   5081  C  CB    . LEU A 1 666  ? -8.209  -81.348  18.602  1.00 7.86  ? 667  LEU A CB    1 
ATOM   5082  C  CG    . LEU A 1 666  ? -8.050  -79.864  18.820  1.00 7.53  ? 667  LEU A CG    1 
ATOM   5083  C  CD1   . LEU A 1 666  ? -7.052  -79.655  19.910  1.00 7.20  ? 667  LEU A CD1   1 
ATOM   5084  C  CD2   . LEU A 1 666  ? -7.574  -79.224  17.527  1.00 7.46  ? 667  LEU A CD2   1 
ATOM   5085  N  N     . GLY A 1 667  ? -9.781  -83.588  17.833  1.00 11.15 ? 668  GLY A N     1 
ATOM   5086  C  CA    . GLY A 1 667  ? -10.044 -84.820  17.100  1.00 11.35 ? 668  GLY A CA    1 
ATOM   5087  C  C     . GLY A 1 667  ? -10.739 -86.016  17.716  1.00 11.40 ? 668  GLY A C     1 
ATOM   5088  O  O     . GLY A 1 667  ? -10.474 -87.156  17.296  1.00 11.61 ? 668  GLY A O     1 
ATOM   5089  N  N     . THR A 1 668  ? -11.616 -85.801  18.694  1.00 11.24 ? 669  THR A N     1 
ATOM   5090  C  CA    . THR A 1 668  ? -12.311 -86.952  19.268  1.00 11.02 ? 669  THR A CA    1 
ATOM   5091  C  C     . THR A 1 668  ? -13.425 -87.397  18.296  1.00 11.05 ? 669  THR A C     1 
ATOM   5092  O  O     . THR A 1 668  ? -13.890 -88.524  18.344  1.00 10.72 ? 669  THR A O     1 
ATOM   5093  C  CB    . THR A 1 668  ? -12.777 -86.715  20.774  1.00 10.34 ? 669  THR A CB    1 
ATOM   5094  O  OG1   . THR A 1 668  ? -13.711 -85.635  20.871  1.00 9.95  ? 669  THR A OG1   1 
ATOM   5095  C  CG2   . THR A 1 668  ? -11.583 -86.394  21.643  1.00 8.55  ? 669  THR A CG2   1 
ATOM   5096  N  N     . SER A 1 669  ? -13.720 -86.531  17.326  1.00 11.72 ? 670  SER A N     1 
ATOM   5097  C  CA    . SER A 1 669  ? -14.731 -86.757  16.299  1.00 12.49 ? 670  SER A CA    1 
ATOM   5098  C  C     . SER A 1 669  ? -14.366 -87.913  15.390  1.00 13.66 ? 670  SER A C     1 
ATOM   5099  O  O     . SER A 1 669  ? -15.238 -88.662  14.917  1.00 14.98 ? 670  SER A O     1 
ATOM   5100  C  CB    . SER A 1 669  ? -14.896 -85.500  15.446  1.00 11.89 ? 670  SER A CB    1 
ATOM   5101  O  OG    . SER A 1 669  ? -13.646 -85.044  14.939  1.00 11.82 ? 670  SER A OG    1 
ATOM   5102  N  N     . GLN A 1 670  ? -13.071 -88.050  15.136  1.00 14.55 ? 671  GLN A N     1 
ATOM   5103  C  CA    . GLN A 1 670  ? -12.552 -89.101  14.266  1.00 14.96 ? 671  GLN A CA    1 
ATOM   5104  C  C     . GLN A 1 670  ? -13.118 -90.490  14.603  1.00 15.21 ? 671  GLN A C     1 
ATOM   5105  O  O     . GLN A 1 670  ? -13.632 -91.177  13.726  1.00 15.56 ? 671  GLN A O     1 
ATOM   5106  C  CB    . GLN A 1 670  ? -11.016 -89.100  14.309  1.00 15.22 ? 671  GLN A CB    1 
ATOM   5107  C  CG    . GLN A 1 670  ? -10.368 -87.724  14.036  1.00 15.76 ? 671  GLN A CG    1 
ATOM   5108  C  CD    . GLN A 1 670  ? -10.633 -87.183  12.620  1.00 17.02 ? 671  GLN A CD    1 
ATOM   5109  O  OE1   . GLN A 1 670  ? -10.060 -87.666  11.633  1.00 17.17 ? 671  GLN A OE1   1 
ATOM   5110  N  NE2   . GLN A 1 670  ? -11.474 -86.149  12.524  1.00 17.26 ? 671  GLN A NE2   1 
ATOM   5111  N  N     . PHE A 1 671  ? -13.128 -90.846  15.885  1.00 15.37 ? 672  PHE A N     1 
ATOM   5112  C  CA    . PHE A 1 671  ? -13.619 -92.155  16.321  1.00 15.30 ? 672  PHE A CA    1 
ATOM   5113  C  C     . PHE A 1 671  ? -15.105 -92.304  16.504  1.00 15.50 ? 672  PHE A C     1 
ATOM   5114  O  O     . PHE A 1 671  ? -15.547 -93.342  16.989  1.00 16.19 ? 672  PHE A O     1 
ATOM   5115  C  CB    . PHE A 1 671  ? -12.953 -92.573  17.625  1.00 14.60 ? 672  PHE A CB    1 
ATOM   5116  C  CG    . PHE A 1 671  ? -11.499 -92.377  17.613  1.00 14.64 ? 672  PHE A CG    1 
ATOM   5117  C  CD1   . PHE A 1 671  ? -10.696 -93.180  16.816  1.00 14.73 ? 672  PHE A CD1   1 
ATOM   5118  C  CD2   . PHE A 1 671  ? -10.928 -91.331  18.310  1.00 14.41 ? 672  PHE A CD2   1 
ATOM   5119  C  CE1   . PHE A 1 671  ? -9.353  -92.936  16.709  1.00 14.23 ? 672  PHE A CE1   1 
ATOM   5120  C  CE2   . PHE A 1 671  ? -9.595  -91.084  18.205  1.00 13.92 ? 672  PHE A CE2   1 
ATOM   5121  C  CZ    . PHE A 1 671  ? -8.799  -91.887  17.401  1.00 14.10 ? 672  PHE A CZ    1 
ATOM   5122  N  N     . GLU A 1 672  ? -15.892 -91.314  16.109  1.00 15.42 ? 673  GLU A N     1 
ATOM   5123  C  CA    . GLU A 1 672  ? -17.336 -91.438  16.314  1.00 14.99 ? 673  GLU A CA    1 
ATOM   5124  C  C     . GLU A 1 672  ? -18.130 -92.308  15.356  1.00 14.26 ? 673  GLU A C     1 
ATOM   5125  O  O     . GLU A 1 672  ? -19.015 -93.052  15.795  1.00 13.66 ? 673  GLU A O     1 
ATOM   5126  C  CB    . GLU A 1 672  ? -17.974 -90.074  16.422  1.00 15.15 ? 673  GLU A CB    1 
ATOM   5127  C  CG    . GLU A 1 672  ? -18.333 -89.777  17.827  1.00 15.11 ? 673  GLU A CG    1 
ATOM   5128  C  CD    . GLU A 1 672  ? -18.357 -88.323  18.067  1.00 15.64 ? 673  GLU A CD    1 
ATOM   5129  O  OE1   . GLU A 1 672  ? -17.311 -87.685  17.833  1.00 15.73 ? 673  GLU A OE1   1 
ATOM   5130  O  OE2   . GLU A 1 672  ? -19.423 -87.815  18.461  1.00 16.05 ? 673  GLU A OE2   1 
ATOM   5131  N  N     . LYS A 1 673  ? -17.850 -92.132  14.060  1.00 13.78 ? 674  LYS A N     1 
ATOM   5132  C  CA    . LYS A 1 673  ? -18.481 -92.871  12.961  1.00 12.64 ? 674  LYS A CA    1 
ATOM   5133  C  C     . LYS A 1 673  ? -19.944 -93.228  13.252  1.00 12.41 ? 674  LYS A C     1 
ATOM   5134  O  O     . LYS A 1 673  ? -20.309 -94.398  13.266  1.00 12.20 ? 674  LYS A O     1 
ATOM   5135  C  CB    . LYS A 1 673  ? -17.679 -94.154  12.675  1.00 11.74 ? 674  LYS A CB    1 
ATOM   5136  C  CG    . LYS A 1 673  ? -16.176 -94.101  12.962  1.00 9.48  ? 674  LYS A CG    1 
ATOM   5137  C  CD    . LYS A 1 673  ? -15.352 -93.857  11.714  1.00 7.89  ? 674  LYS A CD    1 
ATOM   5138  C  CE    . LYS A 1 673  ? -15.392 -92.397  11.330  1.00 7.70  ? 674  LYS A CE    1 
ATOM   5139  N  NZ    . LYS A 1 673  ? -14.287 -91.956  10.431  1.00 7.03  ? 674  LYS A NZ    1 
ATOM   5140  N  N     . ARG A 1 674  ? -20.767 -92.221  13.521  1.00 12.46 ? 675  ARG A N     1 
ATOM   5141  C  CA    . ARG A 1 674  ? -22.179 -92.448  13.845  1.00 12.72 ? 675  ARG A CA    1 
ATOM   5142  C  C     . ARG A 1 674  ? -22.870 -93.280  12.799  1.00 12.65 ? 675  ARG A C     1 
ATOM   5143  O  O     . ARG A 1 674  ? -23.643 -94.181  13.120  1.00 12.27 ? 675  ARG A O     1 
ATOM   5144  C  CB    . ARG A 1 674  ? -22.926 -91.131  13.935  1.00 13.20 ? 675  ARG A CB    1 
ATOM   5145  C  CG    . ARG A 1 674  ? -22.459 -90.217  14.995  1.00 13.56 ? 675  ARG A CG    1 
ATOM   5146  C  CD    . ARG A 1 674  ? -23.091 -88.888  14.739  1.00 14.43 ? 675  ARG A CD    1 
ATOM   5147  N  NE    . ARG A 1 674  ? -24.504 -88.900  15.068  1.00 14.17 ? 675  ARG A NE    1 
ATOM   5148  C  CZ    . ARG A 1 674  ? -25.313 -87.864  14.899  1.00 14.74 ? 675  ARG A CZ    1 
ATOM   5149  N  NH1   . ARG A 1 674  ? -24.848 -86.732  14.375  1.00 14.60 ? 675  ARG A NH1   1 
ATOM   5150  N  NH2   . ARG A 1 674  ? -26.565 -87.935  15.345  1.00 15.02 ? 675  ARG A NH2   1 
ATOM   5151  N  N     . GLY A 1 675  ? -22.598 -92.918  11.549  1.00 13.16 ? 676  GLY A N     1 
ATOM   5152  C  CA    . GLY A 1 675  ? -23.167 -93.595  10.405  1.00 13.62 ? 676  GLY A CA    1 
ATOM   5153  C  C     . GLY A 1 675  ? -24.678 -93.515  10.393  1.00 14.11 ? 676  GLY A C     1 
ATOM   5154  O  O     . GLY A 1 675  ? -25.340 -94.565  10.515  1.00 14.58 ? 676  GLY A O     1 
ATOM   5155  N  N     . VAL A 1 676  ? -25.227 -92.292  10.278  1.00 13.72 ? 677  VAL A N     1 
ATOM   5156  C  CA    . VAL A 1 676  ? -26.687 -92.110  10.238  1.00 12.76 ? 677  VAL A CA    1 
ATOM   5157  C  C     . VAL A 1 676  ? -27.304 -91.573  8.943   1.00 13.11 ? 677  VAL A C     1 
ATOM   5158  O  O     . VAL A 1 676  ? -28.514 -91.317  8.892   1.00 13.20 ? 677  VAL A O     1 
ATOM   5159  C  CB    . VAL A 1 676  ? -27.214 -91.274  11.406  1.00 12.05 ? 677  VAL A CB    1 
ATOM   5160  C  CG1   . VAL A 1 676  ? -26.518 -91.667  12.676  1.00 11.93 ? 677  VAL A CG1   1 
ATOM   5161  C  CG2   . VAL A 1 676  ? -27.124 -89.802  11.117  1.00 11.43 ? 677  VAL A CG2   1 
ATOM   5162  N  N     . ALA A 1 677  ? -26.493 -91.385  7.902   1.00 13.55 ? 678  ALA A N     1 
ATOM   5163  C  CA    . ALA A 1 677  ? -27.030 -90.910  6.631   1.00 13.87 ? 678  ALA A CA    1 
ATOM   5164  C  C     . ALA A 1 677  ? -27.999 -91.996  6.161   1.00 14.37 ? 678  ALA A C     1 
ATOM   5165  O  O     . ALA A 1 677  ? -27.885 -93.163  6.555   1.00 14.54 ? 678  ALA A O     1 
ATOM   5166  C  CB    . ALA A 1 677  ? -25.918 -90.729  5.617   1.00 12.95 ? 678  ALA A CB    1 
ATOM   5167  N  N     . ILE A 1 678  ? -29.031 -91.610  5.436   1.00 14.87 ? 679  ILE A N     1 
ATOM   5168  C  CA    . ILE A 1 678  ? -29.928 -92.630  4.939   1.00 15.76 ? 679  ILE A CA    1 
ATOM   5169  C  C     . ILE A 1 678  ? -29.284 -93.082  3.650   1.00 15.80 ? 679  ILE A C     1 
ATOM   5170  O  O     . ILE A 1 678  ? -28.973 -94.243  3.468   1.00 15.95 ? 679  ILE A O     1 
ATOM   5171  C  CB    . ILE A 1 678  ? -31.352 -92.093  4.678   1.00 16.43 ? 679  ILE A CB    1 
ATOM   5172  C  CG1   . ILE A 1 678  ? -32.096 -91.927  6.007   1.00 16.09 ? 679  ILE A CG1   1 
ATOM   5173  C  CG2   . ILE A 1 678  ? -32.106 -93.057  3.748   1.00 16.71 ? 679  ILE A CG2   1 
ATOM   5174  C  CD1   . ILE A 1 678  ? -32.187 -93.243  6.806   1.00 16.50 ? 679  ILE A CD1   1 
ATOM   5175  N  N     . ASN A 1 679  ? -29.063 -92.133  2.765   1.00 16.29 ? 680  ASN A N     1 
ATOM   5176  C  CA    . ASN A 1 679  ? -28.429 -92.429  1.513   1.00 17.28 ? 680  ASN A CA    1 
ATOM   5177  C  C     . ASN A 1 679  ? -27.071 -91.729  1.585   1.00 17.88 ? 680  ASN A C     1 
ATOM   5178  O  O     . ASN A 1 679  ? -26.952 -90.662  2.210   1.00 18.14 ? 680  ASN A O     1 
ATOM   5179  C  CB    . ASN A 1 679  ? -29.279 -91.876  0.370   1.00 17.67 ? 680  ASN A CB    1 
ATOM   5180  C  CG    . ASN A 1 679  ? -30.763 -92.225  0.518   1.00 18.28 ? 680  ASN A CG    1 
ATOM   5181  O  OD1   . ASN A 1 679  ? -31.128 -93.381  0.746   1.00 19.48 ? 680  ASN A OD1   1 
ATOM   5182  N  ND2   . ASN A 1 679  ? -31.621 -91.226  0.377   1.00 18.24 ? 680  ASN A ND2   1 
ATOM   5183  N  N     . VAL A 1 680  ? -26.041 -92.393  1.050   1.00 18.07 ? 681  VAL A N     1 
ATOM   5184  C  CA    . VAL A 1 680  ? -24.647 -91.892  0.989   1.00 18.19 ? 681  VAL A CA    1 
ATOM   5185  C  C     . VAL A 1 680  ? -24.208 -91.832  -0.495  1.00 18.41 ? 681  VAL A C     1 
ATOM   5186  O  O     . VAL A 1 680  ? -24.381 -92.810  -1.231  1.00 18.84 ? 681  VAL A O     1 
ATOM   5187  C  CB    . VAL A 1 680  ? -23.652 -92.843  1.759   1.00 17.89 ? 681  VAL A CB    1 
ATOM   5188  C  CG1   . VAL A 1 680  ? -23.425 -92.366  3.183   1.00 17.13 ? 681  VAL A CG1   1 
ATOM   5189  C  CG2   . VAL A 1 680  ? -24.178 -94.279  1.764   1.00 17.35 ? 681  VAL A CG2   1 
ATOM   5190  N  N     . PRO A 1 681  ? -23.589 -90.721  -0.934  1.00 18.45 ? 682  PRO A N     1 
ATOM   5191  C  CA    . PRO A 1 681  ? -23.182 -90.663  -2.342  1.00 18.67 ? 682  PRO A CA    1 
ATOM   5192  C  C     . PRO A 1 681  ? -22.169 -91.754  -2.628  1.00 19.13 ? 682  PRO A C     1 
ATOM   5193  O  O     . PRO A 1 681  ? -21.270 -91.995  -1.822  1.00 20.03 ? 682  PRO A O     1 
ATOM   5194  C  CB    . PRO A 1 681  ? -22.557 -89.271  -2.465  1.00 18.59 ? 682  PRO A CB    1 
ATOM   5195  C  CG    . PRO A 1 681  ? -21.920 -89.075  -1.134  1.00 18.56 ? 682  PRO A CG    1 
ATOM   5196  C  CD    . PRO A 1 681  ? -22.973 -89.624  -0.162  1.00 18.69 ? 682  PRO A CD    1 
ATOM   5197  N  N     . GLN A 1 682  ? -22.331 -92.425  -3.762  1.00 19.15 ? 683  GLN A N     1 
ATOM   5198  C  CA    . GLN A 1 682  ? -21.454 -93.516  -4.175  1.00 19.42 ? 683  GLN A CA    1 
ATOM   5199  C  C     . GLN A 1 682  ? -20.677 -93.081  -5.416  1.00 19.41 ? 683  GLN A C     1 
ATOM   5200  O  O     . GLN A 1 682  ? -21.278 -92.515  -6.339  1.00 19.51 ? 683  GLN A O     1 
ATOM   5201  C  CB    . GLN A 1 682  ? -22.310 -94.737  -4.508  1.00 19.74 ? 683  GLN A CB    1 
ATOM   5202  C  CG    . GLN A 1 682  ? -21.549 -95.880  -5.138  1.00 20.63 ? 683  GLN A CG    1 
ATOM   5203  C  CD    . GLN A 1 682  ? -22.049 -96.232  -6.520  1.00 20.85 ? 683  GLN A CD    1 
ATOM   5204  O  OE1   . GLN A 1 682  ? -22.633 -97.299  -6.726  1.00 21.45 ? 683  GLN A OE1   1 
ATOM   5205  N  NE2   . GLN A 1 682  ? -21.801 -95.348  -7.486  1.00 21.65 ? 683  GLN A NE2   1 
ATOM   5206  N  N     . TRP A 1 683  ? -19.369 -93.373  -5.472  1.00 19.31 ? 684  TRP A N     1 
ATOM   5207  C  CA    . TRP A 1 683  ? -18.560 -92.960  -6.635  1.00 19.15 ? 684  TRP A CA    1 
ATOM   5208  C  C     . TRP A 1 683  ? -18.759 -93.768  -7.910  1.00 19.66 ? 684  TRP A C     1 
ATOM   5209  O  O     . TRP A 1 683  ? -19.063 -94.968  -7.888  1.00 20.02 ? 684  TRP A O     1 
ATOM   5210  C  CB    . TRP A 1 683  ? -17.059 -92.873  -6.323  1.00 17.90 ? 684  TRP A CB    1 
ATOM   5211  C  CG    . TRP A 1 683  ? -16.296 -91.906  -7.223  1.00 16.18 ? 684  TRP A CG    1 
ATOM   5212  C  CD1   . TRP A 1 683  ? -16.732 -90.685  -7.682  1.00 15.86 ? 684  TRP A CD1   1 
ATOM   5213  C  CD2   . TRP A 1 683  ? -14.955 -92.050  -7.701  1.00 15.52 ? 684  TRP A CD2   1 
ATOM   5214  N  NE1   . TRP A 1 683  ? -15.738 -90.066  -8.405  1.00 15.37 ? 684  TRP A NE1   1 
ATOM   5215  C  CE2   . TRP A 1 683  ? -14.638 -90.884  -8.432  1.00 15.58 ? 684  TRP A CE2   1 
ATOM   5216  C  CE3   . TRP A 1 683  ? -13.989 -93.055  -7.580  1.00 15.28 ? 684  TRP A CE3   1 
ATOM   5217  C  CZ2   . TRP A 1 683  ? -13.389 -90.693  -9.032  1.00 15.62 ? 684  TRP A CZ2   1 
ATOM   5218  C  CZ3   . TRP A 1 683  ? -12.748 -92.866  -8.179  1.00 15.47 ? 684  TRP A CZ3   1 
ATOM   5219  C  CH2   . TRP A 1 683  ? -12.463 -91.693  -8.897  1.00 15.62 ? 684  TRP A CH2   1 
ATOM   5220  N  N     . VAL A 1 684  ? -18.496 -93.076  -9.012  1.00 19.88 ? 685  VAL A N     1 
ATOM   5221  C  CA    . VAL A 1 684  ? -18.637 -93.568  -10.364 1.00 20.10 ? 685  VAL A CA    1 
ATOM   5222  C  C     . VAL A 1 684  ? -17.396 -92.996  -11.082 1.00 20.79 ? 685  VAL A C     1 
ATOM   5223  O  O     . VAL A 1 684  ? -17.447 -91.900  -11.660 1.00 20.74 ? 685  VAL A O     1 
ATOM   5224  C  CB    . VAL A 1 684  ? -19.969 -92.983  -10.938 1.00 20.09 ? 685  VAL A CB    1 
ATOM   5225  C  CG1   . VAL A 1 684  ? -20.121 -93.274  -12.418 1.00 20.27 ? 685  VAL A CG1   1 
ATOM   5226  C  CG2   . VAL A 1 684  ? -21.175 -93.522  -10.140 1.00 19.10 ? 685  VAL A CG2   1 
ATOM   5227  N  N     . PRO A 1 685  ? -16.250 -93.718  -11.010 1.00 21.46 ? 686  PRO A N     1 
ATOM   5228  C  CA    . PRO A 1 685  ? -14.943 -93.368  -11.603 1.00 22.13 ? 686  PRO A CA    1 
ATOM   5229  C  C     . PRO A 1 685  ? -14.987 -92.953  -13.073 1.00 22.84 ? 686  PRO A C     1 
ATOM   5230  O  O     . PRO A 1 685  ? -14.306 -91.995  -13.472 1.00 23.58 ? 686  PRO A O     1 
ATOM   5231  C  CB    . PRO A 1 685  ? -14.120 -94.656  -11.432 1.00 21.73 ? 686  PRO A CB    1 
ATOM   5232  C  CG    . PRO A 1 685  ? -14.704 -95.293  -10.233 1.00 21.82 ? 686  PRO A CG    1 
ATOM   5233  C  CD    . PRO A 1 685  ? -16.199 -95.075  -10.434 1.00 21.88 ? 686  PRO A CD    1 
ATOM   5234  N  N     . GLU A 1 686  ? -15.773 -93.686  -13.867 1.00 23.17 ? 687  GLU A N     1 
ATOM   5235  C  CA    . GLU A 1 686  ? -15.930 -93.423  -15.307 1.00 23.12 ? 687  GLU A CA    1 
ATOM   5236  C  C     . GLU A 1 686  ? -16.608 -92.081  -15.654 1.00 22.96 ? 687  GLU A C     1 
ATOM   5237  O  O     . GLU A 1 686  ? -16.769 -91.776  -16.836 1.00 23.20 ? 687  GLU A O     1 
ATOM   5238  C  CB    . GLU A 1 686  ? -16.709 -94.557  -16.012 1.00 23.13 ? 687  GLU A CB    1 
ATOM   5239  C  CG    . GLU A 1 686  ? -17.032 -95.807  -15.167 1.00 23.79 ? 687  GLU A CG    1 
ATOM   5240  C  CD    . GLU A 1 686  ? -18.518 -95.930  -14.785 1.00 24.05 ? 687  GLU A CD    1 
ATOM   5241  O  OE1   . GLU A 1 686  ? -19.371 -96.171  -15.686 1.00 23.74 ? 687  GLU A OE1   1 
ATOM   5242  O  OE2   . GLU A 1 686  ? -18.831 -95.823  -13.571 1.00 24.24 ? 687  GLU A OE2   1 
ATOM   5243  N  N     . ASN A 1 687  ? -17.005 -91.295  -14.647 1.00 22.29 ? 688  ASN A N     1 
ATOM   5244  C  CA    . ASN A 1 687  ? -17.659 -90.005  -14.887 1.00 21.70 ? 688  ASN A CA    1 
ATOM   5245  C  C     . ASN A 1 687  ? -16.971 -88.848  -14.210 1.00 21.60 ? 688  ASN A C     1 
ATOM   5246  O  O     . ASN A 1 687  ? -17.221 -87.675  -14.516 1.00 21.67 ? 688  ASN A O     1 
ATOM   5247  C  CB    . ASN A 1 687  ? -19.104 -90.035  -14.422 1.00 21.66 ? 688  ASN A CB    1 
ATOM   5248  C  CG    . ASN A 1 687  ? -20.026 -90.577  -15.469 1.00 21.69 ? 688  ASN A CG    1 
ATOM   5249  O  OD1   . ASN A 1 687  ? -20.785 -91.506  -15.212 1.00 21.64 ? 688  ASN A OD1   1 
ATOM   5250  N  ND2   . ASN A 1 687  ? -19.966 -90.000  -16.672 1.00 21.36 ? 688  ASN A ND2   1 
ATOM   5251  N  N     . CYS A 1 688  ? -16.116 -89.177  -13.264 1.00 21.15 ? 689  CYS A N     1 
ATOM   5252  C  CA    . CYS A 1 688  ? -15.404 -88.158  -12.533 1.00 20.98 ? 689  CYS A CA    1 
ATOM   5253  C  C     . CYS A 1 688  ? -14.465 -87.401  -13.461 1.00 20.14 ? 689  CYS A C     1 
ATOM   5254  O  O     . CYS A 1 688  ? -13.697 -88.012  -14.190 1.00 20.45 ? 689  CYS A O     1 
ATOM   5255  C  CB    . CYS A 1 688  ? -14.616 -88.837  -11.425 1.00 22.03 ? 689  CYS A CB    1 
ATOM   5256  S  SG    . CYS A 1 688  ? -13.773 -87.727  -10.277 1.00 23.04 ? 689  CYS A SG    1 
ATOM   5257  N  N     . ILE A 1 689  ? -14.590 -86.079  -13.488 1.00 19.40 ? 690  ILE A N     1 
ATOM   5258  C  CA    . ILE A 1 689  ? -13.715 -85.232  -14.295 1.00 18.67 ? 690  ILE A CA    1 
ATOM   5259  C  C     . ILE A 1 689  ? -12.537 -84.737  -13.431 1.00 19.28 ? 690  ILE A C     1 
ATOM   5260  O  O     . ILE A 1 689  ? -11.826 -83.802  -13.808 1.00 19.36 ? 690  ILE A O     1 
ATOM   5261  C  CB    . ILE A 1 689  ? -14.459 -84.001  -14.844 1.00 17.26 ? 690  ILE A CB    1 
ATOM   5262  C  CG1   . ILE A 1 689  ? -14.975 -83.137  -13.704 1.00 16.24 ? 690  ILE A CG1   1 
ATOM   5263  C  CG2   . ILE A 1 689  ? -15.597 -84.428  -15.715 1.00 17.31 ? 690  ILE A CG2   1 
ATOM   5264  C  CD1   . ILE A 1 689  ? -15.584 -81.862  -14.181 1.00 16.46 ? 690  ILE A CD1   1 
ATOM   5265  N  N     . GLN A 1 690  ? -12.340 -85.379  -12.279 1.00 20.05 ? 691  GLN A N     1 
ATOM   5266  C  CA    . GLN A 1 690  ? -11.285 -85.014  -11.326 1.00 21.09 ? 691  GLN A CA    1 
ATOM   5267  C  C     . GLN A 1 690  ? -11.225 -83.509  -11.051 1.00 21.39 ? 691  GLN A C     1 
ATOM   5268  O  O     . GLN A 1 690  ? -10.418 -82.757  -11.627 1.00 21.82 ? 691  GLN A O     1 
ATOM   5269  C  CB    . GLN A 1 690  ? -9.930  -85.607  -11.741 1.00 21.55 ? 691  GLN A CB    1 
ATOM   5270  C  CG    . GLN A 1 690  ? -9.892  -87.119  -11.494 1.00 22.29 ? 691  GLN A CG    1 
ATOM   5271  C  CD    . GLN A 1 690  ? -8.676  -87.811  -12.056 1.00 22.28 ? 691  GLN A CD    1 
ATOM   5272  O  OE1   . GLN A 1 690  ? -8.765  -88.936  -12.555 1.00 22.37 ? 691  GLN A OE1   1 
ATOM   5273  N  NE2   . GLN A 1 690  ? -7.528  -87.161  -11.956 1.00 22.81 ? 691  GLN A NE2   1 
ATOM   5274  N  N     . CYS A 1 691  ? -12.097 -83.073  -10.146 1.00 21.63 ? 692  CYS A N     1 
ATOM   5275  C  CA    . CYS A 1 691  ? -12.168 -81.667  -9.842  1.00 21.51 ? 692  CYS A CA    1 
ATOM   5276  C  C     . CYS A 1 691  ? -12.117 -81.197  -8.398  1.00 21.15 ? 692  CYS A C     1 
ATOM   5277  O  O     . CYS A 1 691  ? -11.755 -80.053  -8.164  1.00 21.85 ? 692  CYS A O     1 
ATOM   5278  C  CB    . CYS A 1 691  ? -13.323 -81.029  -10.614 1.00 21.82 ? 692  CYS A CB    1 
ATOM   5279  S  SG    . CYS A 1 691  ? -15.060 -81.515  -10.325 1.00 22.94 ? 692  CYS A SG    1 
ATOM   5280  N  N     . ASN A 1 692  ? -12.460 -82.056  -7.439  1.00 20.45 ? 693  ASN A N     1 
ATOM   5281  C  CA    . ASN A 1 692  ? -12.423 -81.720  -6.010  1.00 19.57 ? 693  ASN A CA    1 
ATOM   5282  C  C     . ASN A 1 692  ? -13.404 -80.672  -5.473  1.00 19.28 ? 693  ASN A C     1 
ATOM   5283  O  O     . ASN A 1 692  ? -13.165 -79.998  -4.466  1.00 18.64 ? 693  ASN A O     1 
ATOM   5284  C  CB    . ASN A 1 692  ? -10.990 -81.440  -5.592  1.00 19.73 ? 693  ASN A CB    1 
ATOM   5285  C  CG    . ASN A 1 692  ? -10.104 -82.662  -5.748  1.00 20.35 ? 693  ASN A CG    1 
ATOM   5286  O  OD1   . ASN A 1 692  ? -8.873  -82.584  -5.678  1.00 21.03 ? 693  ASN A OD1   1 
ATOM   5287  N  ND2   . ASN A 1 692  ? -10.732 -83.811  -5.958  1.00 20.87 ? 693  ASN A ND2   1 
ATOM   5288  N  N     . GLN A 1 693  ? -14.541 -80.588  -6.154  1.00 19.28 ? 694  GLN A N     1 
ATOM   5289  C  CA    . GLN A 1 693  ? -15.622 -79.692  -5.774  1.00 18.81 ? 694  GLN A CA    1 
ATOM   5290  C  C     . GLN A 1 693  ? -16.470 -80.427  -4.752  1.00 18.83 ? 694  GLN A C     1 
ATOM   5291  O  O     . GLN A 1 693  ? -17.048 -79.806  -3.872  1.00 18.85 ? 694  GLN A O     1 
ATOM   5292  C  CB    . GLN A 1 693  ? -16.486 -79.335  -6.983  1.00 17.76 ? 694  GLN A CB    1 
ATOM   5293  C  CG    . GLN A 1 693  ? -15.749 -78.579  -8.058  1.00 16.34 ? 694  GLN A CG    1 
ATOM   5294  C  CD    . GLN A 1 693  ? -16.626 -77.563  -8.710  1.00 15.80 ? 694  GLN A CD    1 
ATOM   5295  O  OE1   . GLN A 1 693  ? -17.234 -76.752  -8.036  1.00 16.03 ? 694  GLN A OE1   1 
ATOM   5296  N  NE2   . GLN A 1 693  ? -16.709 -77.598  -10.024 1.00 16.26 ? 694  GLN A NE2   1 
ATOM   5297  N  N     . CYS A 1 694  ? -16.539 -81.750  -4.877  1.00 18.87 ? 695  CYS A N     1 
ATOM   5298  C  CA    . CYS A 1 694  ? -17.312 -82.559  -3.944  1.00 19.30 ? 695  CYS A CA    1 
ATOM   5299  C  C     . CYS A 1 694  ? -16.826 -82.502  -2.491  1.00 18.74 ? 695  CYS A C     1 
ATOM   5300  O  O     . CYS A 1 694  ? -17.620 -82.322  -1.574  1.00 18.24 ? 695  CYS A O     1 
ATOM   5301  C  CB    . CYS A 1 694  ? -17.411 -84.017  -4.418  1.00 20.69 ? 695  CYS A CB    1 
ATOM   5302  S  SG    . CYS A 1 694  ? -15.890 -84.886  -4.945  1.00 22.71 ? 695  CYS A SG    1 
ATOM   5303  N  N     . ALA A 1 695  ? -15.526 -82.671  -2.278  1.00 18.56 ? 696  ALA A N     1 
ATOM   5304  C  CA    . ALA A 1 695  ? -14.979 -82.622  -0.919  1.00 18.00 ? 696  ALA A CA    1 
ATOM   5305  C  C     . ALA A 1 695  ? -15.082 -81.173  -0.417  1.00 17.45 ? 696  ALA A C     1 
ATOM   5306  O  O     . ALA A 1 695  ? -15.593 -80.905  0.675   1.00 17.07 ? 696  ALA A O     1 
ATOM   5307  C  CB    . ALA A 1 695  ? -13.524 -83.089  -0.923  1.00 17.89 ? 696  ALA A CB    1 
ATOM   5308  N  N     . PHE A 1 696  ? -14.685 -80.253  -1.296  1.00 16.75 ? 697  PHE A N     1 
ATOM   5309  C  CA    . PHE A 1 696  ? -14.686 -78.825  -1.053  1.00 15.58 ? 697  PHE A CA    1 
ATOM   5310  C  C     . PHE A 1 696  ? -16.037 -78.350  -0.601  1.00 15.17 ? 697  PHE A C     1 
ATOM   5311  O  O     . PHE A 1 696  ? -16.159 -77.310  0.003   1.00 15.68 ? 697  PHE A O     1 
ATOM   5312  C  CB    . PHE A 1 696  ? -14.357 -78.125  -2.354  1.00 15.62 ? 697  PHE A CB    1 
ATOM   5313  C  CG    . PHE A 1 696  ? -13.934 -76.716  -2.180  1.00 15.18 ? 697  PHE A CG    1 
ATOM   5314  C  CD1   . PHE A 1 696  ? -14.864 -75.695  -2.128  1.00 14.93 ? 697  PHE A CD1   1 
ATOM   5315  C  CD2   . PHE A 1 696  ? -12.594 -76.410  -2.073  1.00 15.20 ? 697  PHE A CD2   1 
ATOM   5316  C  CE1   . PHE A 1 696  ? -14.456 -74.380  -1.971  1.00 15.25 ? 697  PHE A CE1   1 
ATOM   5317  C  CE2   . PHE A 1 696  ? -12.173 -75.107  -1.915  1.00 15.42 ? 697  PHE A CE2   1 
ATOM   5318  C  CZ    . PHE A 1 696  ? -13.110 -74.081  -1.864  1.00 15.33 ? 697  PHE A CZ    1 
ATOM   5319  N  N     . VAL A 1 697  ? -17.046 -79.144  -0.899  1.00 15.20 ? 698  VAL A N     1 
ATOM   5320  C  CA    . VAL A 1 697  ? -18.442 -78.848  -0.594  1.00 15.06 ? 698  VAL A CA    1 
ATOM   5321  C  C     . VAL A 1 697  ? -19.058 -79.617  0.595   1.00 15.21 ? 698  VAL A C     1 
ATOM   5322  O  O     . VAL A 1 697  ? -20.019 -79.153  1.215   1.00 15.10 ? 698  VAL A O     1 
ATOM   5323  C  CB    . VAL A 1 697  ? -19.251 -79.121  -1.876  1.00 14.67 ? 698  VAL A CB    1 
ATOM   5324  C  CG1   . VAL A 1 697  ? -20.460 -79.993  -1.631  1.00 14.48 ? 698  VAL A CG1   1 
ATOM   5325  C  CG2   . VAL A 1 697  ? -19.599 -77.841  -2.519  1.00 15.28 ? 698  VAL A CG2   1 
ATOM   5326  N  N     . CYS A 1 698  ? -18.515 -80.798  0.886   1.00 15.35 ? 699  CYS A N     1 
ATOM   5327  C  CA    . CYS A 1 698  ? -19.027 -81.645  1.950   1.00 15.12 ? 699  CYS A CA    1 
ATOM   5328  C  C     . CYS A 1 698  ? -18.993 -80.967  3.306   1.00 15.21 ? 699  CYS A C     1 
ATOM   5329  O  O     . CYS A 1 698  ? -17.920 -80.705  3.827   1.00 15.60 ? 699  CYS A O     1 
ATOM   5330  C  CB    . CYS A 1 698  ? -18.223 -82.928  2.002   1.00 15.16 ? 699  CYS A CB    1 
ATOM   5331  S  SG    . CYS A 1 698  ? -18.870 -84.117  3.204   1.00 15.54 ? 699  CYS A SG    1 
ATOM   5332  N  N     . PRO A 1 699  ? -20.167 -80.614  3.869   1.00 15.20 ? 700  PRO A N     1 
ATOM   5333  C  CA    . PRO A 1 699  ? -20.156 -79.962  5.184   1.00 15.24 ? 700  PRO A CA    1 
ATOM   5334  C  C     . PRO A 1 699  ? -19.718 -80.827  6.389   1.00 15.59 ? 700  PRO A C     1 
ATOM   5335  O  O     . PRO A 1 699  ? -19.921 -80.419  7.547   1.00 15.92 ? 700  PRO A O     1 
ATOM   5336  C  CB    . PRO A 1 699  ? -21.593 -79.428  5.319   1.00 14.58 ? 700  PRO A CB    1 
ATOM   5337  C  CG    . PRO A 1 699  ? -22.393 -80.320  4.466   1.00 15.19 ? 700  PRO A CG    1 
ATOM   5338  C  CD    . PRO A 1 699  ? -21.503 -80.510  3.259   1.00 15.28 ? 700  PRO A CD    1 
ATOM   5339  N  N     . HIS A 1 700  ? -19.120 -82.004  6.135   1.00 15.61 ? 701  HIS A N     1 
ATOM   5340  C  CA    . HIS A 1 700  ? -18.639 -82.874  7.232   1.00 15.61 ? 701  HIS A CA    1 
ATOM   5341  C  C     . HIS A 1 700  ? -17.316 -83.603  6.998   1.00 15.61 ? 701  HIS A C     1 
ATOM   5342  O  O     . HIS A 1 700  ? -16.831 -84.313  7.899   1.00 15.53 ? 701  HIS A O     1 
ATOM   5343  C  CB    . HIS A 1 700  ? -19.711 -83.879  7.645   1.00 15.28 ? 701  HIS A CB    1 
ATOM   5344  C  CG    . HIS A 1 700  ? -20.867 -83.248  8.350   1.00 16.60 ? 701  HIS A CG    1 
ATOM   5345  N  ND1   . HIS A 1 700  ? -22.003 -82.826  7.690   1.00 16.98 ? 701  HIS A ND1   1 
ATOM   5346  C  CD2   . HIS A 1 700  ? -21.039 -82.909  9.652   1.00 17.02 ? 701  HIS A CD2   1 
ATOM   5347  C  CE1   . HIS A 1 700  ? -22.822 -82.252  8.554   1.00 17.41 ? 701  HIS A CE1   1 
ATOM   5348  N  NE2   . HIS A 1 700  ? -22.261 -82.290  9.751   1.00 17.34 ? 701  HIS A NE2   1 
ATOM   5349  N  N     . SER A 1 701  ? -16.738 -83.397  5.805   1.00 15.26 ? 702  SER A N     1 
ATOM   5350  C  CA    . SER A 1 701  ? -15.487 -84.022  5.367   1.00 15.20 ? 702  SER A CA    1 
ATOM   5351  C  C     . SER A 1 701  ? -15.710 -85.520  5.063   1.00 15.34 ? 702  SER A C     1 
ATOM   5352  O  O     . SER A 1 701  ? -14.858 -86.375  5.318   1.00 15.78 ? 702  SER A O     1 
ATOM   5353  C  CB    . SER A 1 701  ? -14.416 -83.827  6.432   1.00 15.53 ? 702  SER A CB    1 
ATOM   5354  O  OG    . SER A 1 701  ? -13.157 -83.607  5.837   1.00 16.45 ? 702  SER A OG    1 
ATOM   5355  N  N     . ALA A 1 702  ? -16.862 -85.807  4.468   1.00 15.23 ? 703  ALA A N     1 
ATOM   5356  C  CA    . ALA A 1 702  ? -17.285 -87.151  4.114   1.00 15.08 ? 703  ALA A CA    1 
ATOM   5357  C  C     . ALA A 1 702  ? -16.625 -87.689  2.848   1.00 15.26 ? 703  ALA A C     1 
ATOM   5358  O  O     . ALA A 1 702  ? -16.584 -88.903  2.630   1.00 14.88 ? 703  ALA A O     1 
ATOM   5359  C  CB    . ALA A 1 702  ? -18.780 -87.169  3.971   1.00 14.88 ? 703  ALA A CB    1 
ATOM   5360  N  N     . ILE A 1 703  ? -16.167 -86.781  1.990   1.00 15.78 ? 704  ILE A N     1 
ATOM   5361  C  CA    . ILE A 1 703  ? -15.498 -87.150  0.742   1.00 16.36 ? 704  ILE A CA    1 
ATOM   5362  C  C     . ILE A 1 703  ? -14.012 -86.870  0.902   1.00 17.27 ? 704  ILE A C     1 
ATOM   5363  O  O     . ILE A 1 703  ? -13.624 -85.784  1.367   1.00 17.83 ? 704  ILE A O     1 
ATOM   5364  C  CB    . ILE A 1 703  ? -16.079 -86.371  -0.435  1.00 15.85 ? 704  ILE A CB    1 
ATOM   5365  C  CG1   . ILE A 1 703  ? -17.542 -86.783  -0.602  1.00 15.76 ? 704  ILE A CG1   1 
ATOM   5366  C  CG2   . ILE A 1 703  ? -15.271 -86.626  -1.706  1.00 15.45 ? 704  ILE A CG2   1 
ATOM   5367  C  CD1   . ILE A 1 703  ? -18.315 -85.926  -1.522  1.00 15.09 ? 704  ILE A CD1   1 
ATOM   5368  N  N     . LEU A 1 704  ? -13.195 -87.853  0.512   1.00 17.93 ? 705  LEU A N     1 
ATOM   5369  C  CA    . LEU A 1 704  ? -11.732 -87.798  0.643   1.00 18.37 ? 705  LEU A CA    1 
ATOM   5370  C  C     . LEU A 1 704  ? -10.975 -88.108  -0.652  1.00 18.96 ? 705  LEU A C     1 
ATOM   5371  O  O     . LEU A 1 704  ? -10.830 -89.279  -1.036  1.00 18.67 ? 705  LEU A O     1 
ATOM   5372  C  CB    . LEU A 1 704  ? -11.294 -88.783  1.724   1.00 18.30 ? 705  LEU A CB    1 
ATOM   5373  C  CG    . LEU A 1 704  ? -9.828  -89.204  1.762   1.00 18.96 ? 705  LEU A CG    1 
ATOM   5374  C  CD1   . LEU A 1 704  ? -8.917  -88.010  2.080   1.00 18.82 ? 705  LEU A CD1   1 
ATOM   5375  C  CD2   . LEU A 1 704  ? -9.661  -90.338  2.787   1.00 19.18 ? 705  LEU A CD2   1 
ATOM   5376  N  N     . PRO A 1 705  ? -10.451 -87.057  -1.322  1.00 19.63 ? 706  PRO A N     1 
ATOM   5377  C  CA    . PRO A 1 705  ? -9.703  -87.201  -2.577  1.00 19.74 ? 706  PRO A CA    1 
ATOM   5378  C  C     . PRO A 1 705  ? -8.314  -87.769  -2.364  1.00 19.51 ? 706  PRO A C     1 
ATOM   5379  O  O     . PRO A 1 705  ? -7.473  -87.150  -1.699  1.00 19.69 ? 706  PRO A O     1 
ATOM   5380  C  CB    . PRO A 1 705  ? -9.647  -85.764  -3.100  1.00 19.79 ? 706  PRO A CB    1 
ATOM   5381  C  CG    . PRO A 1 705  ? -9.567  -84.972  -1.841  1.00 19.25 ? 706  PRO A CG    1 
ATOM   5382  C  CD    . PRO A 1 705  ? -10.642 -85.626  -1.010  1.00 19.41 ? 706  PRO A CD    1 
ATOM   5383  N  N     . VAL A 1 706  ? -8.117  -88.963  -2.929  1.00 19.20 ? 707  VAL A N     1 
ATOM   5384  C  CA    . VAL A 1 706  ? -6.868  -89.716  -2.876  1.00 18.94 ? 707  VAL A CA    1 
ATOM   5385  C  C     . VAL A 1 706  ? -6.075  -89.489  -4.146  1.00 19.07 ? 707  VAL A C     1 
ATOM   5386  O  O     . VAL A 1 706  ? -6.626  -89.476  -5.240  1.00 19.53 ? 707  VAL A O     1 
ATOM   5387  C  CB    . VAL A 1 706  ? -7.121  -91.259  -2.759  1.00 18.76 ? 707  VAL A CB    1 
ATOM   5388  C  CG1   . VAL A 1 706  ? -5.861  -92.052  -3.151  1.00 18.50 ? 707  VAL A CG1   1 
ATOM   5389  C  CG2   . VAL A 1 706  ? -7.557  -91.640  -1.333  1.00 18.22 ? 707  VAL A CG2   1 
ATOM   5390  N  N     . LEU A 1 707  ? -4.785  -89.256  -3.982  1.00 19.06 ? 708  LEU A N     1 
ATOM   5391  C  CA    . LEU A 1 707  ? -3.875  -89.086  -5.095  1.00 19.25 ? 708  LEU A CA    1 
ATOM   5392  C  C     . LEU A 1 707  ? -2.731  -89.885  -4.528  1.00 19.92 ? 708  LEU A C     1 
ATOM   5393  O  O     . LEU A 1 707  ? -2.132  -89.502  -3.522  1.00 19.75 ? 708  LEU A O     1 
ATOM   5394  C  CB    . LEU A 1 707  ? -3.455  -87.634  -5.288  1.00 18.66 ? 708  LEU A CB    1 
ATOM   5395  C  CG    . LEU A 1 707  ? -2.545  -87.441  -6.505  1.00 18.56 ? 708  LEU A CG    1 
ATOM   5396  C  CD1   . LEU A 1 707  ? -3.379  -87.347  -7.765  1.00 18.38 ? 708  LEU A CD1   1 
ATOM   5397  C  CD2   . LEU A 1 707  ? -1.710  -86.196  -6.356  1.00 18.13 ? 708  LEU A CD2   1 
ATOM   5398  N  N     . ALA A 1 708  ? -2.533  -91.074  -5.073  1.00 20.78 ? 709  ALA A N     1 
ATOM   5399  C  CA    . ALA A 1 708  ? -1.480  -91.917  -4.578  1.00 21.60 ? 709  ALA A CA    1 
ATOM   5400  C  C     . ALA A 1 708  ? -0.676  -92.440  -5.719  1.00 22.54 ? 709  ALA A C     1 
ATOM   5401  O  O     . ALA A 1 708  ? -1.225  -92.784  -6.751  1.00 22.34 ? 709  ALA A O     1 
ATOM   5402  C  CB    . ALA A 1 708  ? -2.064  -93.050  -3.808  1.00 21.24 ? 709  ALA A CB    1 
ATOM   5403  N  N     . LYS A 1 709  ? 0.639   -92.374  -5.582  1.00 23.99 ? 710  LYS A N     1 
ATOM   5404  C  CA    . LYS A 1 709  ? 1.489   -92.935  -6.610  1.00 26.16 ? 710  LYS A CA    1 
ATOM   5405  C  C     . LYS A 1 709  ? 1.311   -94.439  -6.402  1.00 27.35 ? 710  LYS A C     1 
ATOM   5406  O  O     . LYS A 1 709  ? 1.183   -94.906  -5.260  1.00 27.55 ? 710  LYS A O     1 
ATOM   5407  C  CB    . LYS A 1 709  ? 2.951   -92.497  -6.461  1.00 26.60 ? 710  LYS A CB    1 
ATOM   5408  C  CG    . LYS A 1 709  ? 3.505   -92.520  -5.043  1.00 27.66 ? 710  LYS A CG    1 
ATOM   5409  C  CD    . LYS A 1 709  ? 3.401   -91.160  -4.322  1.00 28.18 ? 710  LYS A CD    1 
ATOM   5410  C  CE    . LYS A 1 709  ? 4.782   -90.519  -4.047  1.00 28.80 ? 710  LYS A CE    1 
ATOM   5411  N  NZ    . LYS A 1 709  ? 5.331   -89.732  -5.210  1.00 29.38 ? 710  LYS A NZ    1 
ATOM   5412  N  N     . GLU A 1 710  ? 1.264   -95.165  -7.519  1.00 28.41 ? 711  GLU A N     1 
ATOM   5413  C  CA    . GLU A 1 710  ? 1.035   -96.616  -7.587  1.00 29.51 ? 711  GLU A CA    1 
ATOM   5414  C  C     . GLU A 1 710  ? 1.601   -97.653  -6.608  1.00 29.57 ? 711  GLU A C     1 
ATOM   5415  O  O     . GLU A 1 710  ? 1.041   -98.742  -6.499  1.00 29.61 ? 711  GLU A O     1 
ATOM   5416  C  CB    . GLU A 1 710  ? 1.298   -97.104  -9.011  1.00 30.56 ? 711  GLU A CB    1 
ATOM   5417  C  CG    . GLU A 1 710  ? 2.707   -96.831  -9.495  1.00 33.02 ? 711  GLU A CG    1 
ATOM   5418  C  CD    . GLU A 1 710  ? 3.113   -97.687  -10.690 1.00 34.79 ? 711  GLU A CD    1 
ATOM   5419  O  OE1   . GLU A 1 710  ? 2.319   -98.573  -11.121 1.00 35.34 ? 711  GLU A OE1   1 
ATOM   5420  O  OE2   . GLU A 1 710  ? 4.250   -97.479  -11.192 1.00 35.60 ? 711  GLU A OE2   1 
ATOM   5421  N  N     . GLU A 1 711  ? 2.703   -97.379  -5.925  1.00 30.07 ? 712  GLU A N     1 
ATOM   5422  C  CA    . GLU A 1 711  ? 3.218   -98.395  -5.013  1.00 30.73 ? 712  GLU A CA    1 
ATOM   5423  C  C     . GLU A 1 711  ? 2.707   -98.265  -3.580  1.00 30.39 ? 712  GLU A C     1 
ATOM   5424  O  O     . GLU A 1 711  ? 3.094   -99.026  -2.685  1.00 30.24 ? 712  GLU A O     1 
ATOM   5425  C  CB    . GLU A 1 711  ? 4.741   -98.493  -5.084  1.00 32.17 ? 712  GLU A CB    1 
ATOM   5426  C  CG    . GLU A 1 711  ? 5.301   -98.874  -6.506  1.00 34.73 ? 712  GLU A CG    1 
ATOM   5427  C  CD    . GLU A 1 711  ? 4.633   -100.108 -7.211  1.00 35.54 ? 712  GLU A CD    1 
ATOM   5428  O  OE1   . GLU A 1 711  ? 4.586   -101.235 -6.639  1.00 36.05 ? 712  GLU A OE1   1 
ATOM   5429  O  OE2   . GLU A 1 711  ? 4.192   -99.941  -8.379  1.00 35.79 ? 712  GLU A OE2   1 
ATOM   5430  N  N     . GLU A 1 712  ? 1.831   -97.287  -3.378  1.00 29.89 ? 713  GLU A N     1 
ATOM   5431  C  CA    . GLU A 1 712  ? 1.202   -97.068  -2.083  1.00 29.49 ? 713  GLU A CA    1 
ATOM   5432  C  C     . GLU A 1 712  ? -0.114  -97.842  -2.125  1.00 29.11 ? 713  GLU A C     1 
ATOM   5433  O  O     . GLU A 1 712  ? -0.669  -98.200  -1.076  1.00 28.83 ? 713  GLU A O     1 
ATOM   5434  C  CB    . GLU A 1 712  ? 0.842   -95.602  -1.881  1.00 29.67 ? 713  GLU A CB    1 
ATOM   5435  C  CG    . GLU A 1 712  ? 1.967   -94.616  -1.814  1.00 29.47 ? 713  GLU A CG    1 
ATOM   5436  C  CD    . GLU A 1 712  ? 1.436   -93.205  -1.969  1.00 29.82 ? 713  GLU A CD    1 
ATOM   5437  O  OE1   . GLU A 1 712  ? 0.974   -92.886  -3.087  1.00 29.46 ? 713  GLU A OE1   1 
ATOM   5438  O  OE2   . GLU A 1 712  ? 1.447   -92.427  -0.983  1.00 29.62 ? 713  GLU A OE2   1 
ATOM   5439  N  N     . LEU A 1 713  ? -0.630  -98.008  -3.348  1.00 28.62 ? 714  LEU A N     1 
ATOM   5440  C  CA    . LEU A 1 713  ? -1.887  -98.717  -3.623  1.00 28.37 ? 714  LEU A CA    1 
ATOM   5441  C  C     . LEU A 1 713  ? -1.700  -100.228 -3.789  1.00 28.11 ? 714  LEU A C     1 
ATOM   5442  O  O     . LEU A 1 713  ? -2.458  -100.890 -4.499  1.00 28.21 ? 714  LEU A O     1 
ATOM   5443  C  CB    . LEU A 1 713  ? -2.568  -98.131  -4.871  1.00 27.93 ? 714  LEU A CB    1 
ATOM   5444  C  CG    . LEU A 1 713  ? -3.547  -96.977  -4.636  1.00 27.74 ? 714  LEU A CG    1 
ATOM   5445  C  CD1   . LEU A 1 713  ? -3.063  -96.113  -3.488  1.00 27.91 ? 714  LEU A CD1   1 
ATOM   5446  C  CD2   . LEU A 1 713  ? -3.711  -96.154  -5.896  1.00 27.37 ? 714  LEU A CD2   1 
ATOM   5447  N  N     . VAL A 1 714  ? -0.733  -100.775 -3.066  1.00 27.73 ? 715  VAL A N     1 
ATOM   5448  C  CA    . VAL A 1 714  ? -0.453  -102.185 -3.152  1.00 27.49 ? 715  VAL A CA    1 
ATOM   5449  C  C     . VAL A 1 714  ? -1.451  -103.098 -2.386  1.00 27.93 ? 715  VAL A C     1 
ATOM   5450  O  O     . VAL A 1 714  ? -2.359  -103.666 -3.008  1.00 28.20 ? 715  VAL A O     1 
ATOM   5451  C  CB    . VAL A 1 714  ? 1.049   -102.406 -2.890  1.00 26.89 ? 715  VAL A CB    1 
ATOM   5452  C  CG1   . VAL A 1 714  ? 1.307   -103.593 -1.967  1.00 26.84 ? 715  VAL A CG1   1 
ATOM   5453  C  CG2   . VAL A 1 714  ? 1.762   -102.553 -4.244  1.00 26.53 ? 715  VAL A CG2   1 
ATOM   5454  N  N     . GLY A 1 715  ? -1.368  -103.197 -1.060  1.00 27.72 ? 716  GLY A N     1 
ATOM   5455  C  CA    . GLY A 1 715  ? -2.318  -104.048 -0.352  1.00 27.63 ? 716  GLY A CA    1 
ATOM   5456  C  C     . GLY A 1 715  ? -3.750  -103.507 -0.419  1.00 27.75 ? 716  GLY A C     1 
ATOM   5457  O  O     . GLY A 1 715  ? -4.640  -103.909 0.360   1.00 27.85 ? 716  GLY A O     1 
ATOM   5458  N  N     . ALA A 1 716  ? -3.956  -102.555 -1.329  1.00 27.45 ? 717  ALA A N     1 
ATOM   5459  C  CA    . ALA A 1 716  ? -5.246  -101.919 -1.530  1.00 27.70 ? 717  ALA A CA    1 
ATOM   5460  C  C     . ALA A 1 716  ? -6.367  -102.919 -1.833  1.00 27.94 ? 717  ALA A C     1 
ATOM   5461  O  O     . ALA A 1 716  ? -6.113  -103.992 -2.396  1.00 28.80 ? 717  ALA A O     1 
ATOM   5462  C  CB    . ALA A 1 716  ? -5.117  -100.923 -2.677  1.00 27.65 ? 717  ALA A CB    1 
ATOM   5463  N  N     . PRO A 1 717  ? -7.607  -102.625 -1.385  1.00 27.72 ? 718  PRO A N     1 
ATOM   5464  C  CA    . PRO A 1 717  ? -8.720  -103.542 -1.662  1.00 27.92 ? 718  PRO A CA    1 
ATOM   5465  C  C     . PRO A 1 717  ? -8.924  -103.779 -3.176  1.00 28.21 ? 718  PRO A C     1 
ATOM   5466  O  O     . PRO A 1 717  ? -8.526  -102.947 -4.017  1.00 28.16 ? 718  PRO A O     1 
ATOM   5467  C  CB    . PRO A 1 717  ? -9.903  -102.824 -1.013  1.00 27.62 ? 718  PRO A CB    1 
ATOM   5468  C  CG    . PRO A 1 717  ? -9.278  -102.282 0.211   1.00 27.11 ? 718  PRO A CG    1 
ATOM   5469  C  CD    . PRO A 1 717  ? -7.994  -101.667 -0.337  1.00 27.41 ? 718  PRO A CD    1 
ATOM   5470  N  N     . ALA A 1 718  ? -9.492  -104.944 -3.503  1.00 28.23 ? 719  ALA A N     1 
ATOM   5471  C  CA    . ALA A 1 718  ? -9.741  -105.368 -4.888  1.00 27.93 ? 719  ALA A CA    1 
ATOM   5472  C  C     . ALA A 1 718  ? -10.477 -104.282 -5.628  1.00 27.75 ? 719  ALA A C     1 
ATOM   5473  O  O     . ALA A 1 718  ? -10.101 -103.914 -6.756  1.00 27.88 ? 719  ALA A O     1 
ATOM   5474  C  CB    . ALA A 1 718  ? -10.588 -106.649 -4.896  1.00 28.13 ? 719  ALA A CB    1 
ATOM   5475  N  N     . ASN A 1 719  ? -11.505 -103.777 -4.929  1.00 27.36 ? 720  ASN A N     1 
ATOM   5476  C  CA    . ASN A 1 719  ? -12.432 -102.726 -5.356  1.00 26.46 ? 720  ASN A CA    1 
ATOM   5477  C  C     . ASN A 1 719  ? -11.973 -101.257 -5.131  1.00 25.60 ? 720  ASN A C     1 
ATOM   5478  O  O     . ASN A 1 719  ? -12.748 -100.324 -5.369  1.00 26.07 ? 720  ASN A O     1 
ATOM   5479  C  CB    . ASN A 1 719  ? -13.801 -102.978 -4.687  1.00 26.68 ? 720  ASN A CB    1 
ATOM   5480  C  CG    . ASN A 1 719  ? -13.668 -103.600 -3.274  1.00 27.36 ? 720  ASN A CG    1 
ATOM   5481  O  OD1   . ASN A 1 719  ? -14.089 -104.747 -3.028  1.00 27.57 ? 720  ASN A OD1   1 
ATOM   5482  N  ND2   . ASN A 1 719  ? -13.042 -102.860 -2.362  1.00 27.34 ? 720  ASN A ND2   1 
ATOM   5483  N  N     . PHE A 1 720  ? -10.742 -101.045 -4.665  1.00 23.85 ? 721  PHE A N     1 
ATOM   5484  C  CA    . PHE A 1 720  ? -10.220 -99.695  -4.453  1.00 22.41 ? 721  PHE A CA    1 
ATOM   5485  C  C     . PHE A 1 720  ? -9.867  -99.149  -5.841  1.00 22.09 ? 721  PHE A C     1 
ATOM   5486  O  O     . PHE A 1 720  ? -8.701  -99.086  -6.190  1.00 21.95 ? 721  PHE A O     1 
ATOM   5487  C  CB    . PHE A 1 720  ? -8.963  -99.762  -3.563  1.00 21.70 ? 721  PHE A CB    1 
ATOM   5488  C  CG    . PHE A 1 720  ? -8.499  -98.421  -3.016  1.00 21.08 ? 721  PHE A CG    1 
ATOM   5489  C  CD1   . PHE A 1 720  ? -9.004  -97.926  -1.810  1.00 20.90 ? 721  PHE A CD1   1 
ATOM   5490  C  CD2   . PHE A 1 720  ? -7.535  -97.666  -3.690  1.00 20.97 ? 721  PHE A CD2   1 
ATOM   5491  C  CE1   . PHE A 1 720  ? -8.561  -96.704  -1.289  1.00 20.41 ? 721  PHE A CE1   1 
ATOM   5492  C  CE2   . PHE A 1 720  ? -7.082  -96.441  -3.176  1.00 20.46 ? 721  PHE A CE2   1 
ATOM   5493  C  CZ    . PHE A 1 720  ? -7.598  -95.964  -1.977  1.00 20.47 ? 721  PHE A CZ    1 
ATOM   5494  N  N     . THR A 1 721  ? -10.878 -98.791  -6.638  1.00 22.21 ? 722  THR A N     1 
ATOM   5495  C  CA    . THR A 1 721  ? -10.681 -98.266  -8.008  1.00 23.04 ? 722  THR A CA    1 
ATOM   5496  C  C     . THR A 1 721  ? -10.150 -96.833  -8.071  1.00 23.63 ? 722  THR A C     1 
ATOM   5497  O  O     . THR A 1 721  ? -10.633 -95.951  -7.370  1.00 24.02 ? 722  THR A O     1 
ATOM   5498  C  CB    . THR A 1 721  ? -12.011 -98.313  -8.879  1.00 22.78 ? 722  THR A CB    1 
ATOM   5499  O  OG1   . THR A 1 721  ? -12.431 -99.664  -9.082  1.00 22.91 ? 722  THR A OG1   1 
ATOM   5500  C  CG2   . THR A 1 721  ? -11.802 -97.696  -10.255 1.00 22.47 ? 722  THR A CG2   1 
ATOM   5501  N  N     . ALA A 1 722  ? -9.195  -96.593  -8.966  1.00 24.52 ? 723  ALA A N     1 
ATOM   5502  C  CA    . ALA A 1 722  ? -8.635  -95.254  -9.142  1.00 25.65 ? 723  ALA A CA    1 
ATOM   5503  C  C     . ALA A 1 722  ? -8.321  -94.947  -10.607 1.00 26.58 ? 723  ALA A C     1 
ATOM   5504  O  O     . ALA A 1 722  ? -7.859  -95.820  -11.355 1.00 26.76 ? 723  ALA A O     1 
ATOM   5505  C  CB    . ALA A 1 722  ? -7.391  -95.083  -8.298  1.00 25.30 ? 723  ALA A CB    1 
ATOM   5506  N  N     . LEU A 1 723  ? -8.602  -93.705  -11.006 1.00 27.63 ? 724  LEU A N     1 
ATOM   5507  C  CA    . LEU A 1 723  ? -8.342  -93.214  -12.362 1.00 28.52 ? 724  LEU A CA    1 
ATOM   5508  C  C     . LEU A 1 723  ? -6.864  -92.791  -12.519 1.00 29.05 ? 724  LEU A C     1 
ATOM   5509  O  O     . LEU A 1 723  ? -6.058  -92.869  -11.583 1.00 28.92 ? 724  LEU A O     1 
ATOM   5510  C  CB    . LEU A 1 723  ? -9.241  -92.003  -12.659 1.00 28.66 ? 724  LEU A CB    1 
ATOM   5511  C  CG    . LEU A 1 723  ? -10.752 -92.132  -12.416 1.00 29.26 ? 724  LEU A CG    1 
ATOM   5512  C  CD1   . LEU A 1 723  ? -11.458 -90.791  -12.616 1.00 29.33 ? 724  LEU A CD1   1 
ATOM   5513  C  CD2   . LEU A 1 723  ? -11.338 -93.170  -13.357 1.00 29.69 ? 724  LEU A CD2   1 
ATOM   5514  N  N     . GLU A 1 724  ? -6.503  -92.380  -13.725 1.00 29.67 ? 725  GLU A N     1 
ATOM   5515  C  CA    . GLU A 1 724  ? -5.147  -91.919  -13.972 1.00 30.57 ? 725  GLU A CA    1 
ATOM   5516  C  C     . GLU A 1 724  ? -5.263  -90.435  -13.673 1.00 30.71 ? 725  GLU A C     1 
ATOM   5517  O  O     . GLU A 1 724  ? -6.307  -89.839  -13.951 1.00 31.16 ? 725  GLU A O     1 
ATOM   5518  C  CB    . GLU A 1 724  ? -4.785  -92.140  -15.435 1.00 31.57 ? 725  GLU A CB    1 
ATOM   5519  C  CG    . GLU A 1 724  ? -5.351  -93.442  -15.997 1.00 32.74 ? 725  GLU A CG    1 
ATOM   5520  C  CD    . GLU A 1 724  ? -4.298  -94.297  -16.673 1.00 33.40 ? 725  GLU A CD    1 
ATOM   5521  O  OE1   . GLU A 1 724  ? -3.465  -94.898  -15.951 1.00 33.57 ? 725  GLU A OE1   1 
ATOM   5522  O  OE2   . GLU A 1 724  ? -4.315  -94.368  -17.926 1.00 33.97 ? 725  GLU A OE2   1 
ATOM   5523  N  N     . ALA A 1 725  ? -4.215  -89.825  -13.130 1.00 30.69 ? 726  ALA A N     1 
ATOM   5524  C  CA    . ALA A 1 725  ? -4.304  -88.411  -12.788 1.00 30.81 ? 726  ALA A CA    1 
ATOM   5525  C  C     . ALA A 1 725  ? -4.148  -87.405  -13.927 1.00 31.13 ? 726  ALA A C     1 
ATOM   5526  O  O     . ALA A 1 725  ? -3.141  -87.356  -14.649 1.00 31.30 ? 726  ALA A O     1 
ATOM   5527  C  CB    . ALA A 1 725  ? -3.379  -88.074  -11.644 1.00 30.80 ? 726  ALA A CB    1 
ATOM   5528  N  N     . LYS A 1 726  ? -5.210  -86.639  -14.109 1.00 31.39 ? 727  LYS A N     1 
ATOM   5529  C  CA    . LYS A 1 726  ? -5.253  -85.607  -15.115 1.00 31.55 ? 727  LYS A CA    1 
ATOM   5530  C  C     . LYS A 1 726  ? -4.369  -84.512  -14.556 1.00 31.67 ? 727  LYS A C     1 
ATOM   5531  O  O     . LYS A 1 726  ? -4.454  -84.193  -13.366 1.00 31.80 ? 727  LYS A O     1 
ATOM   5532  C  CB    . LYS A 1 726  ? -6.687  -85.097  -15.252 1.00 32.20 ? 727  LYS A CB    1 
ATOM   5533  C  CG    . LYS A 1 726  ? -7.747  -86.201  -15.362 1.00 32.38 ? 727  LYS A CG    1 
ATOM   5534  C  CD    . LYS A 1 726  ? -9.149  -85.606  -15.414 1.00 33.04 ? 727  LYS A CD    1 
ATOM   5535  C  CE    . LYS A 1 726  ? -9.421  -84.890  -16.734 1.00 33.11 ? 727  LYS A CE    1 
ATOM   5536  N  NZ    . LYS A 1 726  ? -10.580 -83.947  -16.628 1.00 33.32 ? 727  LYS A NZ    1 
ATOM   5537  N  N     . GLY A 1 727  ? -3.488  -83.975  -15.393 1.00 32.07 ? 728  GLY A N     1 
ATOM   5538  C  CA    . GLY A 1 727  ? -2.599  -82.918  -14.939 1.00 32.09 ? 728  GLY A CA    1 
ATOM   5539  C  C     . GLY A 1 727  ? -1.126  -83.096  -15.268 1.00 31.94 ? 728  GLY A C     1 
ATOM   5540  O  O     . GLY A 1 727  ? -0.620  -84.215  -15.400 1.00 32.06 ? 728  GLY A O     1 
ATOM   5541  N  N     . LYS A 1 728  ? -0.440  -81.972  -15.429 1.00 31.68 ? 729  LYS A N     1 
ATOM   5542  C  CA    . LYS A 1 728  ? 0.980   -81.976  -15.721 1.00 31.51 ? 729  LYS A CA    1 
ATOM   5543  C  C     . LYS A 1 728  ? 1.666   -82.497  -14.457 1.00 31.17 ? 729  LYS A C     1 
ATOM   5544  O  O     . LYS A 1 728  ? 2.176   -83.611  -14.430 1.00 30.91 ? 729  LYS A O     1 
ATOM   5545  C  CB    . LYS A 1 728  ? 1.433   -80.539  -16.040 1.00 32.06 ? 729  LYS A CB    1 
ATOM   5546  C  CG    . LYS A 1 728  ? 2.958   -80.258  -15.947 1.00 32.93 ? 729  LYS A CG    1 
ATOM   5547  C  CD    . LYS A 1 728  ? 3.278   -78.730  -15.938 1.00 33.23 ? 729  LYS A CD    1 
ATOM   5548  C  CE    . LYS A 1 728  ? 4.787   -78.438  -15.826 1.00 32.92 ? 729  LYS A CE    1 
ATOM   5549  N  NZ    . LYS A 1 728  ? 5.119   -76.989  -15.989 1.00 32.00 ? 729  LYS A NZ    1 
ATOM   5550  N  N     . GLU A 1 729  ? 1.607   -81.692  -13.399 1.00 31.09 ? 730  GLU A N     1 
ATOM   5551  C  CA    . GLU A 1 729  ? 2.201   -82.012  -12.106 1.00 31.07 ? 730  GLU A CA    1 
ATOM   5552  C  C     . GLU A 1 729  ? 1.677   -83.346  -11.634 1.00 30.62 ? 730  GLU A C     1 
ATOM   5553  O  O     . GLU A 1 729  ? 2.357   -84.053  -10.885 1.00 30.80 ? 730  GLU A O     1 
ATOM   5554  C  CB    . GLU A 1 729  ? 1.862   -80.953  -11.043 1.00 31.99 ? 730  GLU A CB    1 
ATOM   5555  C  CG    . GLU A 1 729  ? 1.459   -79.578  -11.568 1.00 33.70 ? 730  GLU A CG    1 
ATOM   5556  C  CD    . GLU A 1 729  ? 0.121   -79.593  -12.307 1.00 35.05 ? 730  GLU A CD    1 
ATOM   5557  O  OE1   . GLU A 1 729  ? -0.569  -80.642  -12.287 1.00 36.10 ? 730  GLU A OE1   1 
ATOM   5558  O  OE2   . GLU A 1 729  ? -0.233  -78.573  -12.944 1.00 36.19 ? 730  GLU A OE2   1 
ATOM   5559  N  N     . LEU A 1 730  ? 0.460   -83.678  -12.058 1.00 30.06 ? 731  LEU A N     1 
ATOM   5560  C  CA    . LEU A 1 730  ? -0.176  -84.943  -11.678 1.00 29.61 ? 731  LEU A CA    1 
ATOM   5561  C  C     . LEU A 1 730  ? -0.055  -86.036  -12.759 1.00 29.58 ? 731  LEU A C     1 
ATOM   5562  O  O     . LEU A 1 730  ? -0.916  -86.154  -13.631 1.00 29.56 ? 731  LEU A O     1 
ATOM   5563  C  CB    . LEU A 1 730  ? -1.651  -84.693  -11.348 1.00 28.83 ? 731  LEU A CB    1 
ATOM   5564  C  CG    . LEU A 1 730  ? -1.963  -83.624  -10.298 1.00 28.14 ? 731  LEU A CG    1 
ATOM   5565  C  CD1   . LEU A 1 730  ? -3.465  -83.553  -10.036 1.00 27.27 ? 731  LEU A CD1   1 
ATOM   5566  C  CD2   . LEU A 1 730  ? -1.218  -83.939  -9.023  1.00 27.78 ? 731  LEU A CD2   1 
ATOM   5567  N  N     . LYS A 1 731  ? 1.031   -86.805  -12.733 1.00 29.64 ? 732  LYS A N     1 
ATOM   5568  C  CA    . LYS A 1 731  ? 1.197   -87.869  -13.718 1.00 29.99 ? 732  LYS A CA    1 
ATOM   5569  C  C     . LYS A 1 731  ? 1.513   -89.245  -13.167 1.00 30.20 ? 732  LYS A C     1 
ATOM   5570  O  O     . LYS A 1 731  ? 0.928   -90.231  -13.625 1.00 30.32 ? 732  LYS A O     1 
ATOM   5571  C  CB    . LYS A 1 731  ? 2.198   -87.498  -14.794 1.00 30.20 ? 732  LYS A CB    1 
ATOM   5572  C  CG    . LYS A 1 731  ? 1.515   -87.062  -16.078 1.00 31.63 ? 732  LYS A CG    1 
ATOM   5573  C  CD    . LYS A 1 731  ? 2.512   -86.948  -17.241 1.00 32.67 ? 732  LYS A CD    1 
ATOM   5574  C  CE    . LYS A 1 731  ? 3.556   -85.822  -17.042 1.00 32.99 ? 732  LYS A CE    1 
ATOM   5575  N  NZ    . LYS A 1 731  ? 3.024   -84.421  -17.274 1.00 33.18 ? 732  LYS A NZ    1 
ATOM   5576  N  N     . GLY A 1 732  ? 2.411   -89.329  -12.186 1.00 30.28 ? 733  GLY A N     1 
ATOM   5577  C  CA    . GLY A 1 732  ? 2.739   -90.630  -11.611 1.00 30.80 ? 733  GLY A CA    1 
ATOM   5578  C  C     . GLY A 1 732  ? 1.746   -91.188  -10.585 1.00 30.64 ? 733  GLY A C     1 
ATOM   5579  O  O     . GLY A 1 732  ? 1.933   -92.308  -10.054 1.00 30.63 ? 733  GLY A O     1 
ATOM   5580  N  N     . TYR A 1 733  ? 0.666   -90.435  -10.353 1.00 29.81 ? 734  TYR A N     1 
ATOM   5581  C  CA    . TYR A 1 733  ? -0.347  -90.797  -9.365  1.00 28.73 ? 734  TYR A CA    1 
ATOM   5582  C  C     . TYR A 1 733  ? -1.681  -91.219  -9.965  1.00 27.84 ? 734  TYR A C     1 
ATOM   5583  O  O     . TYR A 1 733  ? -1.977  -90.912  -11.120 1.00 28.24 ? 734  TYR A O     1 
ATOM   5584  C  CB    . TYR A 1 733  ? -0.627  -89.597  -8.461  1.00 28.81 ? 734  TYR A CB    1 
ATOM   5585  C  CG    . TYR A 1 733  ? 0.574   -88.829  -7.944  1.00 28.91 ? 734  TYR A CG    1 
ATOM   5586  C  CD1   . TYR A 1 733  ? 1.377   -89.349  -6.930  1.00 29.29 ? 734  TYR A CD1   1 
ATOM   5587  C  CD2   . TYR A 1 733  ? 0.816   -87.518  -8.361  1.00 29.34 ? 734  TYR A CD2   1 
ATOM   5588  C  CE1   . TYR A 1 733  ? 2.381   -88.575  -6.325  1.00 29.72 ? 734  TYR A CE1   1 
ATOM   5589  C  CE2   . TYR A 1 733  ? 1.818   -86.727  -7.765  1.00 29.70 ? 734  TYR A CE2   1 
ATOM   5590  C  CZ    . TYR A 1 733  ? 2.594   -87.259  -6.742  1.00 30.09 ? 734  TYR A CZ    1 
ATOM   5591  O  OH    . TYR A 1 733  ? 3.546   -86.465  -6.117  1.00 30.64 ? 734  TYR A OH    1 
ATOM   5592  N  N     . LYS A 1 734  ? -2.483  -91.909  -9.153  1.00 26.55 ? 735  LYS A N     1 
ATOM   5593  C  CA    . LYS A 1 734  ? -3.828  -92.347  -9.531  1.00 25.00 ? 735  LYS A CA    1 
ATOM   5594  C  C     . LYS A 1 734  ? -4.717  -91.642  -8.503  1.00 23.94 ? 735  LYS A C     1 
ATOM   5595  O  O     . LYS A 1 734  ? -4.452  -91.702  -7.301  1.00 23.50 ? 735  LYS A O     1 
ATOM   5596  C  CB    . LYS A 1 734  ? -4.004  -93.869  -9.403  1.00 25.35 ? 735  LYS A CB    1 
ATOM   5597  C  CG    . LYS A 1 734  ? -2.718  -94.707  -9.399  1.00 26.00 ? 735  LYS A CG    1 
ATOM   5598  C  CD    . LYS A 1 734  ? -2.152  -94.969  -10.798 1.00 27.30 ? 735  LYS A CD    1 
ATOM   5599  C  CE    . LYS A 1 734  ? -2.853  -96.129  -11.524 1.00 27.68 ? 735  LYS A CE    1 
ATOM   5600  N  NZ    . LYS A 1 734  ? -2.342  -96.278  -12.926 1.00 28.04 ? 735  LYS A NZ    1 
ATOM   5601  N  N     . PHE A 1 735  ? -5.755  -90.974  -8.993  1.00 22.91 ? 736  PHE A N     1 
ATOM   5602  C  CA    . PHE A 1 735  ? -6.696  -90.196  -8.186  1.00 21.85 ? 736  PHE A CA    1 
ATOM   5603  C  C     . PHE A 1 735  ? -8.010  -90.928  -7.909  1.00 21.57 ? 736  PHE A C     1 
ATOM   5604  O  O     . PHE A 1 735  ? -8.660  -91.366  -8.848  1.00 22.41 ? 736  PHE A O     1 
ATOM   5605  C  CB    . PHE A 1 735  ? -6.982  -88.906  -8.971  1.00 21.54 ? 736  PHE A CB    1 
ATOM   5606  C  CG    . PHE A 1 735  ? -8.049  -88.023  -8.375  1.00 21.02 ? 736  PHE A CG    1 
ATOM   5607  C  CD1   . PHE A 1 735  ? -9.389  -88.397  -8.406  1.00 20.62 ? 736  PHE A CD1   1 
ATOM   5608  C  CD2   . PHE A 1 735  ? -7.712  -86.778  -7.831  1.00 20.77 ? 736  PHE A CD2   1 
ATOM   5609  C  CE1   . PHE A 1 735  ? -10.365 -87.557  -7.915  1.00 20.32 ? 736  PHE A CE1   1 
ATOM   5610  C  CE2   . PHE A 1 735  ? -8.688  -85.932  -7.335  1.00 20.21 ? 736  PHE A CE2   1 
ATOM   5611  C  CZ    . PHE A 1 735  ? -10.013 -86.324  -7.380  1.00 19.97 ? 736  PHE A CZ    1 
ATOM   5612  N  N     . ARG A 1 736  ? -8.438  -91.006  -6.649  1.00 20.90 ? 737  ARG A N     1 
ATOM   5613  C  CA    . ARG A 1 736  ? -9.715  -91.657  -6.312  1.00 20.78 ? 737  ARG A CA    1 
ATOM   5614  C  C     . ARG A 1 736  ? -10.562 -90.840  -5.322  1.00 21.27 ? 737  ARG A C     1 
ATOM   5615  O  O     . ARG A 1 736  ? -10.024 -90.204  -4.414  1.00 21.42 ? 737  ARG A O     1 
ATOM   5616  C  CB    . ARG A 1 736  ? -9.506  -93.090  -5.774  1.00 19.79 ? 737  ARG A CB    1 
ATOM   5617  C  CG    . ARG A 1 736  ? -10.426 -93.491  -4.595  1.00 18.76 ? 737  ARG A CG    1 
ATOM   5618  C  CD    . ARG A 1 736  ? -10.478 -95.005  -4.325  1.00 17.92 ? 737  ARG A CD    1 
ATOM   5619  N  NE    . ARG A 1 736  ? -11.618 -95.627  -5.003  1.00 17.25 ? 737  ARG A NE    1 
ATOM   5620  C  CZ    . ARG A 1 736  ? -12.700 -96.093  -4.386  1.00 17.51 ? 737  ARG A CZ    1 
ATOM   5621  N  NH1   . ARG A 1 736  ? -12.784 -96.014  -3.064  1.00 17.79 ? 737  ARG A NH1   1 
ATOM   5622  N  NH2   . ARG A 1 736  ? -13.724 -96.590  -5.092  1.00 16.59 ? 737  ARG A NH2   1 
ATOM   5623  N  N     . ILE A 1 737  ? -11.878 -90.817  -5.544  1.00 21.14 ? 738  ILE A N     1 
ATOM   5624  C  CA    . ILE A 1 737  ? -12.808 -90.118  -4.658  1.00 20.63 ? 738  ILE A CA    1 
ATOM   5625  C  C     . ILE A 1 737  ? -13.254 -91.159  -3.625  1.00 20.66 ? 738  ILE A C     1 
ATOM   5626  O  O     . ILE A 1 737  ? -13.999 -92.094  -3.956  1.00 20.87 ? 738  ILE A O     1 
ATOM   5627  C  CB    . ILE A 1 737  ? -14.045 -89.602  -5.443  1.00 20.38 ? 738  ILE A CB    1 
ATOM   5628  C  CG1   . ILE A 1 737  ? -13.699 -88.335  -6.208  1.00 20.66 ? 738  ILE A CG1   1 
ATOM   5629  C  CG2   . ILE A 1 737  ? -15.193 -89.281  -4.515  1.00 20.43 ? 738  ILE A CG2   1 
ATOM   5630  C  CD1   . ILE A 1 737  ? -13.430 -87.145  -5.307  1.00 21.01 ? 738  ILE A CD1   1 
ATOM   5631  N  N     . GLN A 1 738  ? -12.766 -91.040  -2.393  1.00 20.40 ? 739  GLN A N     1 
ATOM   5632  C  CA    . GLN A 1 738  ? -13.140 -91.993  -1.346  1.00 20.02 ? 739  GLN A CA    1 
ATOM   5633  C  C     . GLN A 1 738  ? -14.307 -91.535  -0.468  1.00 19.49 ? 739  GLN A C     1 
ATOM   5634  O  O     . GLN A 1 738  ? -14.165 -90.596  0.313   1.00 19.95 ? 739  GLN A O     1 
ATOM   5635  C  CB    . GLN A 1 738  ? -11.954 -92.285  -0.450  1.00 20.19 ? 739  GLN A CB    1 
ATOM   5636  C  CG    . GLN A 1 738  ? -12.336 -93.201  0.689   1.00 21.69 ? 739  GLN A CG    1 
ATOM   5637  C  CD    . GLN A 1 738  ? -12.794 -94.571  0.208   1.00 22.15 ? 739  GLN A CD    1 
ATOM   5638  O  OE1   . GLN A 1 738  ? -13.991 -94.821  0.026   1.00 22.49 ? 739  GLN A OE1   1 
ATOM   5639  N  NE2   . GLN A 1 738  ? -11.836 -95.470  0.009   1.00 22.52 ? 739  GLN A NE2   1 
ATOM   5640  N  N     . ILE A 1 739  ? -15.443 -92.218  -0.548  1.00 18.62 ? 740  ILE A N     1 
ATOM   5641  C  CA    . ILE A 1 739  ? -16.581 -91.825  0.270   1.00 18.11 ? 740  ILE A CA    1 
ATOM   5642  C  C     . ILE A 1 739  ? -16.524 -92.500  1.640   1.00 18.31 ? 740  ILE A C     1 
ATOM   5643  O  O     . ILE A 1 739  ? -16.345 -93.724  1.755   1.00 18.31 ? 740  ILE A O     1 
ATOM   5644  C  CB    . ILE A 1 739  ? -17.976 -92.105  -0.415  1.00 17.63 ? 740  ILE A CB    1 
ATOM   5645  C  CG1   . ILE A 1 739  ? -18.044 -91.474  -1.815  1.00 17.72 ? 740  ILE A CG1   1 
ATOM   5646  C  CG2   . ILE A 1 739  ? -19.101 -91.473  0.387   1.00 16.74 ? 740  ILE A CG2   1 
ATOM   5647  C  CD1   . ILE A 1 739  ? -17.897 -89.964  -1.839  1.00 17.32 ? 740  ILE A CD1   1 
ATOM   5648  N  N     . ASN A 1 740  ? -16.552 -91.655  2.669   1.00 18.25 ? 741  ASN A N     1 
ATOM   5649  C  CA    . ASN A 1 740  ? -16.568 -92.071  4.067   1.00 17.91 ? 741  ASN A CA    1 
ATOM   5650  C  C     . ASN A 1 740  ? -18.084 -92.196  4.267   1.00 18.04 ? 741  ASN A C     1 
ATOM   5651  O  O     . ASN A 1 740  ? -18.759 -91.208  4.553   1.00 18.39 ? 741  ASN A O     1 
ATOM   5652  C  CB    . ASN A 1 740  ? -15.988 -90.927  4.928   1.00 17.59 ? 741  ASN A CB    1 
ATOM   5653  C  CG    . ASN A 1 740  ? -15.928 -91.245  6.434   1.00 17.73 ? 741  ASN A CG    1 
ATOM   5654  O  OD1   . ASN A 1 740  ? -15.210 -90.566  7.168   1.00 17.64 ? 741  ASN A OD1   1 
ATOM   5655  N  ND2   . ASN A 1 740  ? -16.701 -92.235  6.901   1.00 17.51 ? 741  ASN A ND2   1 
ATOM   5656  N  N     . THR A 1 741  ? -18.627 -93.382  4.008   1.00 17.71 ? 742  THR A N     1 
ATOM   5657  C  CA    . THR A 1 741  ? -20.061 -93.625  4.152   1.00 17.76 ? 742  THR A CA    1 
ATOM   5658  C  C     . THR A 1 741  ? -20.537 -93.688  5.642   1.00 18.26 ? 742  THR A C     1 
ATOM   5659  O  O     . THR A 1 741  ? -21.731 -93.879  5.928   1.00 18.79 ? 742  THR A O     1 
ATOM   5660  C  CB    . THR A 1 741  ? -20.464 -94.927  3.396   1.00 17.32 ? 742  THR A CB    1 
ATOM   5661  O  OG1   . THR A 1 741  ? -19.781 -96.049  3.974   1.00 17.19 ? 742  THR A OG1   1 
ATOM   5662  C  CG2   . THR A 1 741  ? -20.099 -94.833  1.918   1.00 16.76 ? 742  THR A CG2   1 
ATOM   5663  N  N     . LEU A 1 742  ? -19.614 -93.508  6.589   1.00 17.97 ? 743  LEU A N     1 
ATOM   5664  C  CA    . LEU A 1 742  ? -19.971 -93.544  8.008   1.00 17.57 ? 743  LEU A CA    1 
ATOM   5665  C  C     . LEU A 1 742  ? -19.842 -92.199  8.732   1.00 17.44 ? 743  LEU A C     1 
ATOM   5666  O  O     . LEU A 1 742  ? -20.133 -92.073  9.930   1.00 17.52 ? 743  LEU A O     1 
ATOM   5667  C  CB    . LEU A 1 742  ? -19.214 -94.654  8.741   1.00 16.91 ? 743  LEU A CB    1 
ATOM   5668  C  CG    . LEU A 1 742  ? -19.877 -96.016  8.587   1.00 16.40 ? 743  LEU A CG    1 
ATOM   5669  C  CD1   . LEU A 1 742  ? -19.502 -96.856  9.774   1.00 16.37 ? 743  LEU A CD1   1 
ATOM   5670  C  CD2   . LEU A 1 742  ? -21.388 -95.866  8.536   1.00 16.55 ? 743  LEU A CD2   1 
ATOM   5671  N  N     . ASP A 1 743  ? -19.384 -91.204  7.989   1.00 17.15 ? 744  ASP A N     1 
ATOM   5672  C  CA    . ASP A 1 743  ? -19.261 -89.855  8.505   1.00 16.76 ? 744  ASP A CA    1 
ATOM   5673  C  C     . ASP A 1 743  ? -19.974 -88.928  7.540   1.00 16.32 ? 744  ASP A C     1 
ATOM   5674  O  O     . ASP A 1 743  ? -19.609 -87.778  7.392   1.00 16.47 ? 744  ASP A O     1 
ATOM   5675  C  CB    . ASP A 1 743  ? -17.806 -89.450  8.605   1.00 16.97 ? 744  ASP A CB    1 
ATOM   5676  C  CG    . ASP A 1 743  ? -17.244 -89.655  9.977   1.00 17.65 ? 744  ASP A CG    1 
ATOM   5677  O  OD1   . ASP A 1 743  ? -18.011 -89.724  10.979  1.00 17.80 ? 744  ASP A OD1   1 
ATOM   5678  O  OD2   . ASP A 1 743  ? -16.002 -89.731  10.041  1.00 18.07 ? 744  ASP A OD2   1 
ATOM   5679  N  N     . CYS A 1 744  ? -20.992 -89.452  6.876   1.00 15.99 ? 745  CYS A N     1 
ATOM   5680  C  CA    . CYS A 1 744  ? -21.762 -88.690  5.910   1.00 15.56 ? 745  CYS A CA    1 
ATOM   5681  C  C     . CYS A 1 744  ? -23.136 -88.495  6.519   1.00 15.40 ? 745  CYS A C     1 
ATOM   5682  O  O     . CYS A 1 744  ? -23.563 -89.286  7.369   1.00 15.53 ? 745  CYS A O     1 
ATOM   5683  C  CB    . CYS A 1 744  ? -21.819 -89.477  4.596   1.00 15.35 ? 745  CYS A CB    1 
ATOM   5684  S  SG    . CYS A 1 744  ? -22.966 -88.946  3.298   1.00 14.80 ? 745  CYS A SG    1 
ATOM   5685  N  N     . MET A 1 745  ? -23.771 -87.384  6.182   1.00 15.16 ? 746  MET A N     1 
ATOM   5686  C  CA    . MET A 1 745  ? -25.099 -87.107  6.699   1.00 15.33 ? 746  MET A CA    1 
ATOM   5687  C  C     . MET A 1 745  ? -26.079 -87.313  5.572   1.00 14.74 ? 746  MET A C     1 
ATOM   5688  O  O     . MET A 1 745  ? -27.279 -87.155  5.757   1.00 14.51 ? 746  MET A O     1 
ATOM   5689  C  CB    . MET A 1 745  ? -25.201 -85.678  7.231   1.00 17.03 ? 746  MET A CB    1 
ATOM   5690  C  CG    . MET A 1 745  ? -24.222 -85.342  8.337   1.00 17.79 ? 746  MET A CG    1 
ATOM   5691  S  SD    . MET A 1 745  ? -24.259 -86.595  9.606   1.00 19.91 ? 746  MET A SD    1 
ATOM   5692  C  CE    . MET A 1 745  ? -25.883 -86.274  10.344  1.00 19.00 ? 746  MET A CE    1 
ATOM   5693  N  N     . GLY A 1 746  ? -25.549 -87.660  4.401   1.00 14.41 ? 747  GLY A N     1 
ATOM   5694  C  CA    . GLY A 1 746  ? -26.386 -87.914  3.244   1.00 14.24 ? 747  GLY A CA    1 
ATOM   5695  C  C     . GLY A 1 746  ? -27.195 -86.688  2.923   1.00 14.48 ? 747  GLY A C     1 
ATOM   5696  O  O     . GLY A 1 746  ? -28.406 -86.753  2.727   1.00 14.07 ? 747  GLY A O     1 
ATOM   5697  N  N     . CYS A 1 747  ? -26.516 -85.555  2.911   1.00 14.91 ? 748  CYS A N     1 
ATOM   5698  C  CA    . CYS A 1 747  ? -27.185 -84.311  2.638   1.00 15.23 ? 748  CYS A CA    1 
ATOM   5699  C  C     . CYS A 1 747  ? -27.457 -84.212  1.155   1.00 15.57 ? 748  CYS A C     1 
ATOM   5700  O  O     . CYS A 1 747  ? -28.470 -83.642  0.730   1.00 16.02 ? 748  CYS A O     1 
ATOM   5701  C  CB    . CYS A 1 747  ? -26.364 -83.143  3.170   1.00 15.87 ? 748  CYS A CB    1 
ATOM   5702  S  SG    . CYS A 1 747  ? -24.852 -82.668  2.273   1.00 15.90 ? 748  CYS A SG    1 
ATOM   5703  N  N     . GLY A 1 748  ? -26.572 -84.813  0.369   1.00 15.68 ? 749  GLY A N     1 
ATOM   5704  C  CA    . GLY A 1 748  ? -26.741 -84.838  -1.075  1.00 15.87 ? 749  GLY A CA    1 
ATOM   5705  C  C     . GLY A 1 748  ? -26.064 -83.735  -1.851  1.00 15.90 ? 749  GLY A C     1 
ATOM   5706  O  O     . GLY A 1 748  ? -26.118 -83.719  -3.089  1.00 15.72 ? 749  GLY A O     1 
ATOM   5707  N  N     . ASN A 1 749  ? -25.398 -82.845  -1.116  1.00 16.18 ? 750  ASN A N     1 
ATOM   5708  C  CA    . ASN A 1 749  ? -24.682 -81.692  -1.671  1.00 16.21 ? 750  ASN A CA    1 
ATOM   5709  C  C     . ASN A 1 749  ? -23.642 -81.952  -2.746  1.00 16.41 ? 750  ASN A C     1 
ATOM   5710  O  O     . ASN A 1 749  ? -23.642 -81.269  -3.770  1.00 16.42 ? 750  ASN A O     1 
ATOM   5711  C  CB    . ASN A 1 749  ? -24.023 -80.905  -0.553  1.00 15.89 ? 750  ASN A CB    1 
ATOM   5712  C  CG    . ASN A 1 749  ? -24.881 -79.803  -0.086  1.00 16.19 ? 750  ASN A CG    1 
ATOM   5713  O  OD1   . ASN A 1 749  ? -25.412 -79.844  1.016   1.00 16.36 ? 750  ASN A OD1   1 
ATOM   5714  N  ND2   . ASN A 1 749  ? -25.106 -78.830  -0.960  1.00 16.38 ? 750  ASN A ND2   1 
ATOM   5715  N  N     . CYS A 1 750  ? -22.752 -82.916  -2.490  1.00 16.31 ? 751  CYS A N     1 
ATOM   5716  C  CA    . CYS A 1 750  ? -21.669 -83.279  -3.406  1.00 15.83 ? 751  CYS A CA    1 
ATOM   5717  C  C     . CYS A 1 750  ? -22.129 -83.783  -4.771  1.00 15.49 ? 751  CYS A C     1 
ATOM   5718  O  O     . CYS A 1 750  ? -21.685 -83.303  -5.809  1.00 14.95 ? 751  CYS A O     1 
ATOM   5719  C  CB    . CYS A 1 750  ? -20.825 -84.330  -2.743  1.00 15.69 ? 751  CYS A CB    1 
ATOM   5720  S  SG    . CYS A 1 750  ? -21.895 -85.611  -2.068  1.00 16.28 ? 751  CYS A SG    1 
ATOM   5721  N  N     . ALA A 1 751  ? -22.990 -84.786  -4.761  1.00 15.61 ? 752  ALA A N     1 
ATOM   5722  C  CA    . ALA A 1 751  ? -23.512 -85.333  -5.999  1.00 16.01 ? 752  ALA A CA    1 
ATOM   5723  C  C     . ALA A 1 751  ? -24.226 -84.210  -6.734  1.00 16.35 ? 752  ALA A C     1 
ATOM   5724  O  O     . ALA A 1 751  ? -23.953 -83.963  -7.900  1.00 16.78 ? 752  ALA A O     1 
ATOM   5725  C  CB    . ALA A 1 751  ? -24.479 -86.464  -5.707  1.00 16.12 ? 752  ALA A CB    1 
ATOM   5726  N  N     . ASP A 1 752  ? -25.090 -83.494  -6.024  1.00 16.41 ? 753  ASP A N     1 
ATOM   5727  C  CA    . ASP A 1 752  ? -25.846 -82.392  -6.611  1.00 16.71 ? 753  ASP A CA    1 
ATOM   5728  C  C     . ASP A 1 752  ? -25.004 -81.323  -7.336  1.00 17.49 ? 753  ASP A C     1 
ATOM   5729  O  O     . ASP A 1 752  ? -25.453 -80.735  -8.335  1.00 17.46 ? 753  ASP A O     1 
ATOM   5730  C  CB    . ASP A 1 752  ? -26.711 -81.753  -5.535  1.00 15.59 ? 753  ASP A CB    1 
ATOM   5731  C  CG    . ASP A 1 752  ? -27.264 -80.430  -5.955  1.00 14.77 ? 753  ASP A CG    1 
ATOM   5732  O  OD1   . ASP A 1 752  ? -26.563 -79.426  -5.750  1.00 15.42 ? 753  ASP A OD1   1 
ATOM   5733  O  OD2   . ASP A 1 752  ? -28.380 -80.380  -6.494  1.00 13.73 ? 753  ASP A OD2   1 
ATOM   5734  N  N     . ILE A 1 753  ? -23.803 -81.054  -6.822  1.00 18.46 ? 754  ILE A N     1 
ATOM   5735  C  CA    . ILE A 1 753  ? -22.907 -80.067  -7.432  1.00 19.37 ? 754  ILE A CA    1 
ATOM   5736  C  C     . ILE A 1 753  ? -21.884 -80.743  -8.401  1.00 20.10 ? 754  ILE A C     1 
ATOM   5737  O  O     . ILE A 1 753  ? -21.331 -80.083  -9.299  1.00 19.94 ? 754  ILE A O     1 
ATOM   5738  C  CB    . ILE A 1 753  ? -22.206 -79.192  -6.347  1.00 18.93 ? 754  ILE A CB    1 
ATOM   5739  C  CG1   . ILE A 1 753  ? -21.573 -77.941  -6.968  1.00 19.57 ? 754  ILE A CG1   1 
ATOM   5740  C  CG2   . ILE A 1 753  ? -21.127 -79.980  -5.639  1.00 19.11 ? 754  ILE A CG2   1 
ATOM   5741  C  CD1   . ILE A 1 753  ? -22.549 -76.812  -7.300  1.00 20.04 ? 754  ILE A CD1   1 
ATOM   5742  N  N     . CYS A 1 754  ? -21.664 -82.057  -8.234  1.00 20.64 ? 755  CYS A N     1 
ATOM   5743  C  CA    . CYS A 1 754  ? -20.759 -82.815  -9.103  1.00 20.89 ? 755  CYS A CA    1 
ATOM   5744  C  C     . CYS A 1 754  ? -21.135 -82.383  -10.518 1.00 20.88 ? 755  CYS A C     1 
ATOM   5745  O  O     . CYS A 1 754  ? -22.269 -82.529  -10.932 1.00 20.90 ? 755  CYS A O     1 
ATOM   5746  C  CB    . CYS A 1 754  ? -20.979 -84.317  -8.921  1.00 21.42 ? 755  CYS A CB    1 
ATOM   5747  S  SG    . CYS A 1 754  ? -19.940 -85.398  -9.965  1.00 22.91 ? 755  CYS A SG    1 
ATOM   5748  N  N     . PRO A 1 755  ? -20.195 -81.757  -11.232 1.00 21.07 ? 756  PRO A N     1 
ATOM   5749  C  CA    . PRO A 1 755  ? -20.230 -81.200  -12.596 1.00 21.12 ? 756  PRO A CA    1 
ATOM   5750  C  C     . PRO A 1 755  ? -20.713 -81.985  -13.841 1.00 21.38 ? 756  PRO A C     1 
ATOM   5751  O  O     . PRO A 1 755  ? -21.523 -81.461  -14.612 1.00 21.53 ? 756  PRO A O     1 
ATOM   5752  C  CB    . PRO A 1 755  ? -18.796 -80.704  -12.797 1.00 21.61 ? 756  PRO A CB    1 
ATOM   5753  C  CG    . PRO A 1 755  ? -18.251 -80.530  -11.354 1.00 21.78 ? 756  PRO A CG    1 
ATOM   5754  C  CD    . PRO A 1 755  ? -18.831 -81.715  -10.672 1.00 21.21 ? 756  PRO A CD    1 
ATOM   5755  N  N     . PRO A 1 756  ? -20.214 -83.221  -14.077 1.00 21.58 ? 757  PRO A N     1 
ATOM   5756  C  CA    . PRO A 1 756  ? -20.662 -83.967  -15.268 1.00 22.13 ? 757  PRO A CA    1 
ATOM   5757  C  C     . PRO A 1 756  ? -22.154 -84.328  -15.342 1.00 23.28 ? 757  PRO A C     1 
ATOM   5758  O  O     . PRO A 1 756  ? -22.820 -84.453  -14.312 1.00 22.99 ? 757  PRO A O     1 
ATOM   5759  C  CB    . PRO A 1 756  ? -19.774 -85.213  -15.242 1.00 21.21 ? 757  PRO A CB    1 
ATOM   5760  C  CG    . PRO A 1 756  ? -19.561 -85.443  -13.811 1.00 21.06 ? 757  PRO A CG    1 
ATOM   5761  C  CD    . PRO A 1 756  ? -19.316 -84.054  -13.259 1.00 21.22 ? 757  PRO A CD    1 
ATOM   5762  N  N     . LYS A 1 757  ? -22.668 -84.463  -16.577 1.00 24.91 ? 758  LYS A N     1 
ATOM   5763  C  CA    . LYS A 1 757  ? -24.085 -84.820  -16.845 1.00 25.82 ? 758  LYS A CA    1 
ATOM   5764  C  C     . LYS A 1 757  ? -24.377 -86.216  -16.291 1.00 25.93 ? 758  LYS A C     1 
ATOM   5765  O  O     . LYS A 1 757  ? -25.451 -86.478  -15.716 1.00 26.27 ? 758  LYS A O     1 
ATOM   5766  C  CB    . LYS A 1 757  ? -24.391 -84.820  -18.356 1.00 26.65 ? 758  LYS A CB    1 
ATOM   5767  C  CG    . LYS A 1 757  ? -24.228 -83.476  -19.094 1.00 27.87 ? 758  LYS A CG    1 
ATOM   5768  C  CD    . LYS A 1 757  ? -25.317 -83.302  -20.200 1.00 28.91 ? 758  LYS A CD    1 
ATOM   5769  C  CE    . LYS A 1 757  ? -24.797 -82.579  -21.469 1.00 28.81 ? 758  LYS A CE    1 
ATOM   5770  N  NZ    . LYS A 1 757  ? -24.045 -83.484  -22.430 1.00 29.28 ? 758  LYS A NZ    1 
ATOM   5771  N  N     . GLU A 1 758  ? -23.458 -87.133  -16.584 1.00 25.88 ? 759  GLU A N     1 
ATOM   5772  C  CA    . GLU A 1 758  ? -23.540 -88.495  -16.084 1.00 25.37 ? 759  GLU A CA    1 
ATOM   5773  C  C     . GLU A 1 758  ? -22.804 -88.256  -14.786 1.00 24.41 ? 759  GLU A C     1 
ATOM   5774  O  O     . GLU A 1 758  ? -21.579 -88.138  -14.792 1.00 24.48 ? 759  GLU A O     1 
ATOM   5775  C  CB    . GLU A 1 758  ? -22.722 -89.444  -16.960 1.00 26.29 ? 759  GLU A CB    1 
ATOM   5776  C  CG    . GLU A 1 758  ? -23.016 -89.388  -18.468 1.00 27.92 ? 759  GLU A CG    1 
ATOM   5777  C  CD    . GLU A 1 758  ? -24.429 -89.844  -18.832 1.00 28.31 ? 759  GLU A CD    1 
ATOM   5778  O  OE1   . GLU A 1 758  ? -24.706 -91.068  -18.747 1.00 28.60 ? 759  GLU A OE1   1 
ATOM   5779  O  OE2   . GLU A 1 758  ? -25.248 -88.973  -19.215 1.00 28.43 ? 759  GLU A OE2   1 
ATOM   5780  N  N     . LYS A 1 759  ? -23.551 -88.089  -13.701 1.00 23.05 ? 760  LYS A N     1 
ATOM   5781  C  CA    . LYS A 1 759  ? -22.940 -87.805  -12.423 1.00 22.05 ? 760  LYS A CA    1 
ATOM   5782  C  C     . LYS A 1 759  ? -21.804 -88.726  -12.039 1.00 21.68 ? 760  LYS A C     1 
ATOM   5783  O  O     . LYS A 1 759  ? -21.712 -89.871  -12.514 1.00 21.63 ? 760  LYS A O     1 
ATOM   5784  C  CB    . LYS A 1 759  ? -23.993 -87.784  -11.334 1.00 22.21 ? 760  LYS A CB    1 
ATOM   5785  C  CG    . LYS A 1 759  ? -24.922 -86.584  -11.429 1.00 22.34 ? 760  LYS A CG    1 
ATOM   5786  C  CD    . LYS A 1 759  ? -24.319 -85.280  -10.879 1.00 21.88 ? 760  LYS A CD    1 
ATOM   5787  C  CE    . LYS A 1 759  ? -25.251 -84.099  -11.217 1.00 22.65 ? 760  LYS A CE    1 
ATOM   5788  N  NZ    . LYS A 1 759  ? -25.161 -82.850  -10.367 1.00 23.45 ? 760  LYS A NZ    1 
ATOM   5789  N  N     . ALA A 1 760  ? -20.890 -88.176  -11.245 1.00 20.98 ? 761  ALA A N     1 
ATOM   5790  C  CA    . ALA A 1 760  ? -19.740 -88.918  -10.754 1.00 20.65 ? 761  ALA A CA    1 
ATOM   5791  C  C     . ALA A 1 760  ? -20.128 -89.502  -9.409  1.00 20.34 ? 761  ALA A C     1 
ATOM   5792  O  O     . ALA A 1 760  ? -19.649 -90.572  -9.032  1.00 20.75 ? 761  ALA A O     1 
ATOM   5793  C  CB    . ALA A 1 760  ? -18.557 -88.005  -10.594 1.00 20.99 ? 761  ALA A CB    1 
ATOM   5794  N  N     . LEU A 1 761  ? -20.970 -88.771  -8.675  1.00 19.42 ? 762  LEU A N     1 
ATOM   5795  C  CA    . LEU A 1 761  ? -21.470 -89.203  -7.365  1.00 18.17 ? 762  LEU A CA    1 
ATOM   5796  C  C     . LEU A 1 761  ? -22.984 -89.428  -7.418  1.00 17.97 ? 762  LEU A C     1 
ATOM   5797  O  O     . LEU A 1 761  ? -23.723 -88.635  -8.007  1.00 17.93 ? 762  LEU A O     1 
ATOM   5798  C  CB    . LEU A 1 761  ? -21.090 -88.179  -6.298  1.00 16.93 ? 762  LEU A CB    1 
ATOM   5799  C  CG    . LEU A 1 761  ? -19.594 -88.304  -6.041  1.00 16.06 ? 762  LEU A CG    1 
ATOM   5800  C  CD1   . LEU A 1 761  ? -19.037 -87.003  -5.572  1.00 15.84 ? 762  LEU A CD1   1 
ATOM   5801  C  CD2   . LEU A 1 761  ? -19.306 -89.446  -5.068  1.00 15.73 ? 762  LEU A CD2   1 
ATOM   5802  N  N     . VAL A 1 762  ? -23.434 -90.544  -6.852  1.00 17.65 ? 763  VAL A N     1 
ATOM   5803  C  CA    . VAL A 1 762  ? -24.850 -90.867  -6.867  1.00 17.57 ? 763  VAL A CA    1 
ATOM   5804  C  C     . VAL A 1 762  ? -25.293 -91.358  -5.512  1.00 17.97 ? 763  VAL A C     1 
ATOM   5805  O  O     . VAL A 1 762  ? -24.671 -92.256  -4.941  1.00 18.25 ? 763  VAL A O     1 
ATOM   5806  C  CB    . VAL A 1 762  ? -25.175 -91.985  -7.874  1.00 17.12 ? 763  VAL A CB    1 
ATOM   5807  C  CG1   . VAL A 1 762  ? -26.689 -92.047  -8.136  1.00 16.77 ? 763  VAL A CG1   1 
ATOM   5808  C  CG2   . VAL A 1 762  ? -24.422 -91.772  -9.151  1.00 17.38 ? 763  VAL A CG2   1 
ATOM   5809  N  N     . MET A 1 763  ? -26.428 -90.839  -5.047  1.00 17.98 ? 764  MET A N     1 
ATOM   5810  C  CA    . MET A 1 763  ? -26.966 -91.219  -3.747  1.00 17.86 ? 764  MET A CA    1 
ATOM   5811  C  C     . MET A 1 763  ? -27.449 -92.672  -3.717  1.00 18.07 ? 764  MET A C     1 
ATOM   5812  O  O     . MET A 1 763  ? -28.167 -93.107  -4.604  1.00 18.79 ? 764  MET A O     1 
ATOM   5813  C  CB    . MET A 1 763  ? -28.092 -90.251  -3.346  1.00 17.24 ? 764  MET A CB    1 
ATOM   5814  C  CG    . MET A 1 763  ? -27.624 -88.795  -3.141  1.00 16.92 ? 764  MET A CG    1 
ATOM   5815  S  SD    . MET A 1 763  ? -26.149 -88.569  -2.047  1.00 16.99 ? 764  MET A SD    1 
ATOM   5816  C  CE    . MET A 1 763  ? -26.923 -88.646  -0.448  1.00 16.07 ? 764  MET A CE    1 
ATOM   5817  N  N     . GLN A 1 764  ? -26.997 -93.436  -2.726  1.00 18.18 ? 765  GLN A N     1 
ATOM   5818  C  CA    . GLN A 1 764  ? -27.411 -94.839  -2.558  1.00 18.21 ? 765  GLN A CA    1 
ATOM   5819  C  C     . GLN A 1 764  ? -27.599 -95.091  -1.062  1.00 18.27 ? 765  GLN A C     1 
ATOM   5820  O  O     . GLN A 1 764  ? -26.858 -94.557  -0.238  1.00 18.67 ? 765  GLN A O     1 
ATOM   5821  C  CB    . GLN A 1 764  ? -26.333 -95.818  -3.046  1.00 18.10 ? 765  GLN A CB    1 
ATOM   5822  C  CG    . GLN A 1 764  ? -25.835 -95.627  -4.455  1.00 18.34 ? 765  GLN A CG    1 
ATOM   5823  C  CD    . GLN A 1 764  ? -26.886 -95.938  -5.476  1.00 18.80 ? 765  GLN A CD    1 
ATOM   5824  O  OE1   . GLN A 1 764  ? -27.106 -95.160  -6.388  1.00 18.98 ? 765  GLN A OE1   1 
ATOM   5825  N  NE2   . GLN A 1 764  ? -27.556 -97.080  -5.327  1.00 19.63 ? 765  GLN A NE2   1 
ATOM   5826  N  N     . PRO A 1 765  ? -28.599 -95.893  -0.682  1.00 17.93 ? 766  PRO A N     1 
ATOM   5827  C  CA    . PRO A 1 765  ? -28.811 -96.178  0.738   1.00 17.64 ? 766  PRO A CA    1 
ATOM   5828  C  C     . PRO A 1 765  ? -27.517 -96.607  1.389   1.00 17.51 ? 766  PRO A C     1 
ATOM   5829  O  O     . PRO A 1 765  ? -26.699 -97.272  0.770   1.00 17.29 ? 766  PRO A O     1 
ATOM   5830  C  CB    . PRO A 1 765  ? -29.831 -97.317  0.716   1.00 17.66 ? 766  PRO A CB    1 
ATOM   5831  C  CG    . PRO A 1 765  ? -29.953 -97.713  -0.760  1.00 17.84 ? 766  PRO A CG    1 
ATOM   5832  C  CD    . PRO A 1 765  ? -29.700 -96.438  -1.482  1.00 17.95 ? 766  PRO A CD    1 
ATOM   5833  N  N     . LEU A 1 766  ? -27.330 -96.207  2.635   1.00 17.78 ? 767  LEU A N     1 
ATOM   5834  C  CA    . LEU A 1 766  ? -26.115 -96.522  3.359   1.00 18.46 ? 767  LEU A CA    1 
ATOM   5835  C  C     . LEU A 1 766  ? -25.744 -97.994  3.338   1.00 19.79 ? 767  LEU A C     1 
ATOM   5836  O  O     . LEU A 1 766  ? -24.559 -98.320  3.240   1.00 20.73 ? 767  LEU A O     1 
ATOM   5837  C  CB    . LEU A 1 766  ? -26.197 -96.029  4.809   1.00 17.46 ? 767  LEU A CB    1 
ATOM   5838  C  CG    . LEU A 1 766  ? -25.052 -96.392  5.768   1.00 16.47 ? 767  LEU A CG    1 
ATOM   5839  C  CD1   . LEU A 1 766  ? -23.743 -95.978  5.159   1.00 16.27 ? 767  LEU A CD1   1 
ATOM   5840  C  CD2   . LEU A 1 766  ? -25.223 -95.740  7.147   1.00 15.98 ? 767  LEU A CD2   1 
ATOM   5841  N  N     . ASP A 1 767  ? -26.734 -98.884  3.406   1.00 20.99 ? 768  ASP A N     1 
ATOM   5842  C  CA    . ASP A 1 767  ? -26.448 -100.327 3.420   1.00 22.16 ? 768  ASP A CA    1 
ATOM   5843  C  C     . ASP A 1 767  ? -25.936 -100.973 2.118   1.00 21.85 ? 768  ASP A C     1 
ATOM   5844  O  O     . ASP A 1 767  ? -25.463 -102.112 2.129   1.00 22.21 ? 768  ASP A O     1 
ATOM   5845  C  CB    . ASP A 1 767  ? -27.591 -101.148 4.065   1.00 23.96 ? 768  ASP A CB    1 
ATOM   5846  C  CG    . ASP A 1 767  ? -29.001 -100.688 3.635   1.00 25.64 ? 768  ASP A CG    1 
ATOM   5847  O  OD1   . ASP A 1 767  ? -29.344 -99.485  3.816   1.00 26.53 ? 768  ASP A OD1   1 
ATOM   5848  O  OD2   . ASP A 1 767  ? -29.787 -101.550 3.161   1.00 26.58 ? 768  ASP A OD2   1 
ATOM   5849  N  N     . THR A 1 768  ? -26.017 -100.257 1.003   1.00 21.16 ? 769  THR A N     1 
ATOM   5850  C  CA    . THR A 1 768  ? -25.504 -100.786 -0.253  1.00 20.45 ? 769  THR A CA    1 
ATOM   5851  C  C     . THR A 1 768  ? -24.042 -100.392 -0.341  1.00 20.96 ? 769  THR A C     1 
ATOM   5852  O  O     . THR A 1 768  ? -23.280 -100.949 -1.134  1.00 21.68 ? 769  THR A O     1 
ATOM   5853  C  CB    . THR A 1 768  ? -26.221 -100.174 -1.474  1.00 19.75 ? 769  THR A CB    1 
ATOM   5854  O  OG1   . THR A 1 768  ? -26.286 -98.746  -1.350  1.00 19.13 ? 769  THR A OG1   1 
ATOM   5855  C  CG2   . THR A 1 768  ? -27.610 -100.738 -1.609  1.00 19.44 ? 769  THR A CG2   1 
ATOM   5856  N  N     . GLN A 1 769  ? -23.643 -99.479  0.541   1.00 21.21 ? 770  GLN A N     1 
ATOM   5857  C  CA    . GLN A 1 769  ? -22.298 -98.927  0.554   1.00 20.95 ? 770  GLN A CA    1 
ATOM   5858  C  C     . GLN A 1 769  ? -21.379 -99.387  1.658   1.00 20.60 ? 770  GLN A C     1 
ATOM   5859  O  O     . GLN A 1 769  ? -20.325 -99.943  1.400   1.00 20.83 ? 770  GLN A O     1 
ATOM   5860  C  CB    . GLN A 1 769  ? -22.394 -97.403  0.632   1.00 21.15 ? 770  GLN A CB    1 
ATOM   5861  C  CG    . GLN A 1 769  ? -23.376 -96.805  -0.363  1.00 22.62 ? 770  GLN A CG    1 
ATOM   5862  C  CD    . GLN A 1 769  ? -23.009 -97.150  -1.797  1.00 23.44 ? 770  GLN A CD    1 
ATOM   5863  O  OE1   . GLN A 1 769  ? -21.865 -96.939  -2.217  1.00 24.22 ? 770  GLN A OE1   1 
ATOM   5864  N  NE2   . GLN A 1 769  ? -23.973 -97.680  -2.558  1.00 23.30 ? 770  GLN A NE2   1 
ATOM   5865  N  N     . ARG A 1 770  ? -21.811 -99.199  2.890   1.00 20.04 ? 771  ARG A N     1 
ATOM   5866  C  CA    . ARG A 1 770  ? -20.986 -99.503  4.043   1.00 20.18 ? 771  ARG A CA    1 
ATOM   5867  C  C     . ARG A 1 770  ? -20.084 -100.750 4.105   1.00 20.01 ? 771  ARG A C     1 
ATOM   5868  O  O     . ARG A 1 770  ? -18.909 -100.656 4.483   1.00 19.54 ? 771  ARG A O     1 
ATOM   5869  C  CB    . ARG A 1 770  ? -21.800 -99.302  5.323   1.00 20.32 ? 771  ARG A CB    1 
ATOM   5870  C  CG    . ARG A 1 770  ? -23.116 -100.023 5.378   1.00 20.92 ? 771  ARG A CG    1 
ATOM   5871  C  CD    . ARG A 1 770  ? -22.988 -101.151 6.357   1.00 22.37 ? 771  ARG A CD    1 
ATOM   5872  N  NE    . ARG A 1 770  ? -22.182 -100.721 7.491   1.00 23.54 ? 771  ARG A NE    1 
ATOM   5873  C  CZ    . ARG A 1 770  ? -22.613 -99.906  8.449   1.00 24.53 ? 771  ARG A CZ    1 
ATOM   5874  N  NH1   . ARG A 1 770  ? -23.858 -99.436  8.419   1.00 24.84 ? 771  ARG A NH1   1 
ATOM   5875  N  NH2   . ARG A 1 770  ? -21.781 -99.521  9.416   1.00 25.27 ? 771  ARG A NH2   1 
ATOM   5876  N  N     . ASP A 1 771  ? -20.577 -101.898 3.671   1.00 20.03 ? 772  ASP A N     1 
ATOM   5877  C  CA    . ASP A 1 771  ? -19.753 -103.089 3.739   1.00 19.86 ? 772  ASP A CA    1 
ATOM   5878  C  C     . ASP A 1 771  ? -18.479 -102.947 2.923   1.00 19.67 ? 772  ASP A C     1 
ATOM   5879  O  O     . ASP A 1 771  ? -17.372 -103.125 3.439   1.00 19.14 ? 772  ASP A O     1 
ATOM   5880  C  CB    . ASP A 1 771  ? -20.576 -104.294 3.333   1.00 20.44 ? 772  ASP A CB    1 
ATOM   5881  C  CG    . ASP A 1 771  ? -21.750 -104.516 4.273   1.00 21.84 ? 772  ASP A CG    1 
ATOM   5882  O  OD1   . ASP A 1 771  ? -21.545 -104.409 5.515   1.00 22.29 ? 772  ASP A OD1   1 
ATOM   5883  O  OD2   . ASP A 1 771  ? -22.887 -104.761 3.784   1.00 22.97 ? 772  ASP A OD2   1 
ATOM   5884  N  N     . ALA A 1 772  ? -18.644 -102.504 1.684   1.00 19.50 ? 773  ALA A N     1 
ATOM   5885  C  CA    . ALA A 1 772  ? -17.529 -102.313 0.775   1.00 19.36 ? 773  ALA A CA    1 
ATOM   5886  C  C     . ALA A 1 772  ? -16.727 -101.031 1.013   1.00 19.78 ? 773  ALA A C     1 
ATOM   5887  O  O     . ALA A 1 772  ? -15.500 -101.078 1.019   1.00 20.50 ? 773  ALA A O     1 
ATOM   5888  C  CB    . ALA A 1 772  ? -18.035 -102.345 -0.636  1.00 19.42 ? 773  ALA A CB    1 
ATOM   5889  N  N     . GLN A 1 773  ? -17.409 -99.899  1.223   1.00 20.03 ? 774  GLN A N     1 
ATOM   5890  C  CA    . GLN A 1 773  ? -16.768 -98.585  1.438   1.00 20.33 ? 774  GLN A CA    1 
ATOM   5891  C  C     . GLN A 1 773  ? -16.171 -98.242  2.820   1.00 20.14 ? 774  GLN A C     1 
ATOM   5892  O  O     . GLN A 1 773  ? -15.569 -97.172  2.993   1.00 20.00 ? 774  GLN A O     1 
ATOM   5893  C  CB    . GLN A 1 773  ? -17.716 -97.469  0.985   1.00 21.46 ? 774  GLN A CB    1 
ATOM   5894  C  CG    . GLN A 1 773  ? -17.435 -96.917  -0.426  1.00 23.78 ? 774  GLN A CG    1 
ATOM   5895  C  CD    . GLN A 1 773  ? -16.988 -97.985  -1.432  1.00 25.27 ? 774  GLN A CD    1 
ATOM   5896  O  OE1   . GLN A 1 773  ? -17.759 -98.895  -1.790  1.00 25.69 ? 774  GLN A OE1   1 
ATOM   5897  N  NE2   . GLN A 1 773  ? -15.736 -97.870  -1.904  1.00 25.94 ? 774  GLN A NE2   1 
ATOM   5898  N  N     . VAL A 1 774  ? -16.387 -99.112  3.806   1.00 19.96 ? 775  VAL A N     1 
ATOM   5899  C  CA    . VAL A 1 774  ? -15.829 -98.911  5.136   1.00 19.55 ? 775  VAL A CA    1 
ATOM   5900  C  C     . VAL A 1 774  ? -14.336 -99.221  5.033   1.00 19.57 ? 775  VAL A C     1 
ATOM   5901  O  O     . VAL A 1 774  ? -13.511 -98.308  5.057   1.00 19.92 ? 775  VAL A O     1 
ATOM   5902  C  CB    . VAL A 1 774  ? -16.478 -99.837  6.192   1.00 19.53 ? 775  VAL A CB    1 
ATOM   5903  C  CG1   . VAL A 1 774  ? -15.601 -99.925  7.418   1.00 19.45 ? 775  VAL A CG1   1 
ATOM   5904  C  CG2   . VAL A 1 774  ? -17.843 -99.323  6.585   1.00 20.04 ? 775  VAL A CG2   1 
ATOM   5905  N  N     . PRO A 1 775  ? -13.969 -100.501 4.814   1.00 19.58 ? 776  PRO A N     1 
ATOM   5906  C  CA    . PRO A 1 775  ? -12.546 -100.860 4.711   1.00 19.54 ? 776  PRO A CA    1 
ATOM   5907  C  C     . PRO A 1 775  ? -11.715 -100.028 3.723   1.00 19.30 ? 776  PRO A C     1 
ATOM   5908  O  O     . PRO A 1 775  ? -10.518 -99.825  3.931   1.00 19.08 ? 776  PRO A O     1 
ATOM   5909  C  CB    . PRO A 1 775  ? -12.599 -102.334 4.295   1.00 19.65 ? 776  PRO A CB    1 
ATOM   5910  C  CG    . PRO A 1 775  ? -13.910 -102.451 3.574   1.00 19.25 ? 776  PRO A CG    1 
ATOM   5911  C  CD    . PRO A 1 775  ? -14.809 -101.668 4.481   1.00 19.30 ? 776  PRO A CD    1 
ATOM   5912  N  N     . ASN A 1 776  ? -12.349 -99.600  2.635   1.00 19.20 ? 777  ASN A N     1 
ATOM   5913  C  CA    . ASN A 1 776  ? -11.680 -98.794  1.631   1.00 19.47 ? 777  ASN A CA    1 
ATOM   5914  C  C     . ASN A 1 776  ? -11.325 -97.458  2.229   1.00 19.82 ? 777  ASN A C     1 
ATOM   5915  O  O     . ASN A 1 776  ? -10.235 -96.946  2.010   1.00 20.34 ? 777  ASN A O     1 
ATOM   5916  C  CB    . ASN A 1 776  ? -12.589 -98.549  0.439   1.00 19.52 ? 777  ASN A CB    1 
ATOM   5917  C  CG    . ASN A 1 776  ? -12.450 -99.593  -0.617  1.00 19.28 ? 777  ASN A CG    1 
ATOM   5918  O  OD1   . ASN A 1 776  ? -13.445 -100.109 -1.119  1.00 19.56 ? 777  ASN A OD1   1 
ATOM   5919  N  ND2   . ASN A 1 776  ? -11.218 -99.887  -1.000  1.00 19.45 ? 777  ASN A ND2   1 
ATOM   5920  N  N     . LEU A 1 777  ? -12.272 -96.868  2.943   1.00 20.04 ? 778  LEU A N     1 
ATOM   5921  C  CA    . LEU A 1 777  ? -12.038 -95.587  3.569   1.00 20.76 ? 778  LEU A CA    1 
ATOM   5922  C  C     . LEU A 1 777  ? -10.764 -95.687  4.421   1.00 21.55 ? 778  LEU A C     1 
ATOM   5923  O  O     . LEU A 1 777  ? -9.794  -94.964  4.169   1.00 21.55 ? 778  LEU A O     1 
ATOM   5924  C  CB    . LEU A 1 777  ? -13.257 -95.194  4.395   1.00 20.44 ? 778  LEU A CB    1 
ATOM   5925  C  CG    . LEU A 1 777  ? -13.246 -93.841  5.102   1.00 20.66 ? 778  LEU A CG    1 
ATOM   5926  C  CD1   . LEU A 1 777  ? -12.685 -94.006  6.521   1.00 19.96 ? 778  LEU A CD1   1 
ATOM   5927  C  CD2   . LEU A 1 777  ? -12.487 -92.778  4.266   1.00 19.98 ? 778  LEU A CD2   1 
ATOM   5928  N  N     . GLU A 1 778  ? -10.744 -96.630  5.369   1.00 22.25 ? 779  GLU A N     1 
ATOM   5929  C  CA    . GLU A 1 778  ? -9.579  -96.866  6.240   1.00 22.40 ? 779  GLU A CA    1 
ATOM   5930  C  C     . GLU A 1 778  ? -8.338  -96.891  5.424   1.00 21.94 ? 779  GLU A C     1 
ATOM   5931  O  O     . GLU A 1 778  ? -7.365  -96.259  5.775   1.00 21.75 ? 779  GLU A O     1 
ATOM   5932  C  CB    . GLU A 1 778  ? -9.640  -98.240  6.910   1.00 23.13 ? 779  GLU A CB    1 
ATOM   5933  C  CG    . GLU A 1 778  ? -10.372 -98.260  8.205   1.00 24.48 ? 779  GLU A CG    1 
ATOM   5934  C  CD    . GLU A 1 778  ? -11.783 -97.792  8.040   1.00 25.41 ? 779  GLU A CD    1 
ATOM   5935  O  OE1   . GLU A 1 778  ? -12.575 -98.557  7.441   1.00 25.72 ? 779  GLU A OE1   1 
ATOM   5936  O  OE2   . GLU A 1 778  ? -12.084 -96.655  8.488   1.00 26.48 ? 779  GLU A OE2   1 
ATOM   5937  N  N     . TYR A 1 779  ? -8.356  -97.713  4.383   1.00 22.01 ? 780  TYR A N     1 
ATOM   5938  C  CA    . TYR A 1 779  ? -7.215  -97.848  3.509   1.00 21.95 ? 780  TYR A CA    1 
ATOM   5939  C  C     . TYR A 1 779  ? -6.806  -96.491  2.985   1.00 21.85 ? 780  TYR A C     1 
ATOM   5940  O  O     . TYR A 1 779  ? -5.662  -96.063  3.144   1.00 22.12 ? 780  TYR A O     1 
ATOM   5941  C  CB    . TYR A 1 779  ? -7.518  -98.762  2.339   1.00 21.91 ? 780  TYR A CB    1 
ATOM   5942  C  CG    . TYR A 1 779  ? -6.291  -98.910  1.502   1.00 22.31 ? 780  TYR A CG    1 
ATOM   5943  C  CD1   . TYR A 1 779  ? -5.177  -99.574  2.003   1.00 22.24 ? 780  TYR A CD1   1 
ATOM   5944  C  CD2   . TYR A 1 779  ? -6.198  -98.310  0.242   1.00 22.70 ? 780  TYR A CD2   1 
ATOM   5945  C  CE1   . TYR A 1 779  ? -4.006  -99.637  1.287   1.00 22.15 ? 780  TYR A CE1   1 
ATOM   5946  C  CE2   . TYR A 1 779  ? -5.017  -98.368  -0.493  1.00 22.28 ? 780  TYR A CE2   1 
ATOM   5947  C  CZ    . TYR A 1 779  ? -3.928  -99.033  0.043   1.00 22.39 ? 780  TYR A CZ    1 
ATOM   5948  O  OH    . TYR A 1 779  ? -2.750  -99.096  -0.648  1.00 22.72 ? 780  TYR A OH    1 
ATOM   5949  N  N     . ALA A 1 780  ? -7.758  -95.817  2.367   1.00 21.51 ? 781  ALA A N     1 
ATOM   5950  C  CA    . ALA A 1 780  ? -7.525  -94.503  1.838   1.00 22.11 ? 781  ALA A CA    1 
ATOM   5951  C  C     . ALA A 1 780  ? -7.087  -93.546  2.954   1.00 22.67 ? 781  ALA A C     1 
ATOM   5952  O  O     . ALA A 1 780  ? -6.376  -92.570  2.708   1.00 22.67 ? 781  ALA A O     1 
ATOM   5953  C  CB    . ALA A 1 780  ? -8.776  -94.014  1.189   1.00 22.25 ? 781  ALA A CB    1 
ATOM   5954  N  N     . ALA A 1 781  ? -7.479  -93.850  4.188   1.00 23.59 ? 782  ALA A N     1 
ATOM   5955  C  CA    . ALA A 1 781  ? -7.135  -93.010  5.349   1.00 24.61 ? 782  ALA A CA    1 
ATOM   5956  C  C     . ALA A 1 781  ? -5.663  -93.104  5.769   1.00 25.08 ? 782  ALA A C     1 
ATOM   5957  O  O     . ALA A 1 781  ? -5.099  -92.124  6.254   1.00 25.30 ? 782  ALA A O     1 
ATOM   5958  C  CB    . ALA A 1 781  ? -8.060  -93.314  6.550   1.00 24.31 ? 782  ALA A CB    1 
ATOM   5959  N  N     . ARG A 1 782  ? -5.062  -94.287  5.647   1.00 25.73 ? 783  ARG A N     1 
ATOM   5960  C  CA    . ARG A 1 782  ? -3.658  -94.431  5.993   1.00 26.46 ? 783  ARG A CA    1 
ATOM   5961  C  C     . ARG A 1 782  ? -2.763  -94.421  4.739   1.00 26.37 ? 783  ARG A C     1 
ATOM   5962  O  O     . ARG A 1 782  ? -1.906  -95.292  4.520   1.00 26.66 ? 783  ARG A O     1 
ATOM   5963  C  CB    . ARG A 1 782  ? -3.381  -95.609  6.959   1.00 27.64 ? 783  ARG A CB    1 
ATOM   5964  C  CG    . ARG A 1 782  ? -4.390  -96.774  7.003   1.00 30.04 ? 783  ARG A CG    1 
ATOM   5965  C  CD    . ARG A 1 782  ? -4.377  -97.640  5.722   1.00 32.40 ? 783  ARG A CD    1 
ATOM   5966  N  NE    . ARG A 1 782  ? -4.491  -99.091  5.968   1.00 34.44 ? 783  ARG A NE    1 
ATOM   5967  C  CZ    . ARG A 1 782  ? -5.615  -99.759  6.280   1.00 35.23 ? 783  ARG A CZ    1 
ATOM   5968  N  NH1   . ARG A 1 782  ? -6.790  -99.140  6.415   1.00 35.14 ? 783  ARG A NH1   1 
ATOM   5969  N  NH2   . ARG A 1 782  ? -5.568  -101.080 6.432   1.00 35.65 ? 783  ARG A NH2   1 
ATOM   5970  N  N     . ILE A 1 783  ? -3.039  -93.426  3.899   1.00 25.69 ? 784  ILE A N     1 
ATOM   5971  C  CA    . ILE A 1 783  ? -2.308  -93.145  2.669   1.00 25.01 ? 784  ILE A CA    1 
ATOM   5972  C  C     . ILE A 1 783  ? -1.972  -91.649  2.837   1.00 25.07 ? 784  ILE A C     1 
ATOM   5973  O  O     . ILE A 1 783  ? -2.728  -90.896  3.452   1.00 24.96 ? 784  ILE A O     1 
ATOM   5974  C  CB    . ILE A 1 783  ? -3.195  -93.353  1.378   1.00 24.58 ? 784  ILE A CB    1 
ATOM   5975  C  CG1   . ILE A 1 783  ? -3.365  -94.828  1.058   1.00 23.98 ? 784  ILE A CG1   1 
ATOM   5976  C  CG2   . ILE A 1 783  ? -2.564  -92.700  0.140   1.00 24.19 ? 784  ILE A CG2   1 
ATOM   5977  C  CD1   . ILE A 1 783  ? -4.046  -95.029  -0.269  1.00 23.49 ? 784  ILE A CD1   1 
ATOM   5978  N  N     . PRO A 1 784  ? -0.792  -91.228  2.387   1.00 25.06 ? 785  PRO A N     1 
ATOM   5979  C  CA    . PRO A 1 784  ? -0.400  -89.822  2.507   1.00 25.09 ? 785  PRO A CA    1 
ATOM   5980  C  C     . PRO A 1 784  ? -1.200  -88.791  1.699   1.00 25.07 ? 785  PRO A C     1 
ATOM   5981  O  O     . PRO A 1 784  ? -1.485  -88.993  0.511   1.00 25.08 ? 785  PRO A O     1 
ATOM   5982  C  CB    . PRO A 1 784  ? 1.061   -89.850  2.068   1.00 25.28 ? 785  PRO A CB    1 
ATOM   5983  C  CG    . PRO A 1 784  ? 1.522   -91.191  2.576   1.00 25.38 ? 785  PRO A CG    1 
ATOM   5984  C  CD    . PRO A 1 784  ? 0.385   -92.086  2.160   1.00 25.22 ? 785  PRO A CD    1 
ATOM   5985  N  N     . VAL A 1 785  ? -1.552  -87.686  2.365   1.00 25.01 ? 786  VAL A N     1 
ATOM   5986  C  CA    . VAL A 1 785  ? -2.269  -86.562  1.750   1.00 24.77 ? 786  VAL A CA    1 
ATOM   5987  C  C     . VAL A 1 785  ? -1.185  -85.774  1.014   1.00 24.87 ? 786  VAL A C     1 
ATOM   5988  O  O     . VAL A 1 785  ? -0.139  -85.465  1.595   1.00 25.20 ? 786  VAL A O     1 
ATOM   5989  C  CB    . VAL A 1 785  ? -2.905  -85.635  2.826   1.00 24.68 ? 786  VAL A CB    1 
ATOM   5990  C  CG1   . VAL A 1 785  ? -3.301  -84.275  2.225   1.00 23.78 ? 786  VAL A CG1   1 
ATOM   5991  C  CG2   . VAL A 1 785  ? -4.105  -86.312  3.456   1.00 24.38 ? 786  VAL A CG2   1 
ATOM   5992  N  N     . LYS A 1 786  ? -1.433  -85.439  -0.247  1.00 24.49 ? 787  LYS A N     1 
ATOM   5993  C  CA    . LYS A 1 786  ? -0.447  -84.723  -1.028  1.00 24.18 ? 787  LYS A CA    1 
ATOM   5994  C  C     . LYS A 1 786  ? -0.557  -83.218  -0.902  1.00 24.50 ? 787  LYS A C     1 
ATOM   5995  O  O     . LYS A 1 786  ? -0.971  -82.515  -1.829  1.00 24.36 ? 787  LYS A O     1 
ATOM   5996  C  CB    . LYS A 1 786  ? -0.526  -85.161  -2.477  1.00 23.67 ? 787  LYS A CB    1 
ATOM   5997  C  CG    . LYS A 1 786  ? -0.429  -86.660  -2.651  1.00 23.56 ? 787  LYS A CG    1 
ATOM   5998  C  CD    . LYS A 1 786  ? 0.775   -87.245  -1.946  1.00 23.35 ? 787  LYS A CD    1 
ATOM   5999  C  CE    . LYS A 1 786  ? 0.962   -88.719  -2.315  1.00 23.91 ? 787  LYS A CE    1 
ATOM   6000  N  NZ    . LYS A 1 786  ? -0.164  -89.627  -1.921  1.00 23.65 ? 787  LYS A NZ    1 
ATOM   6001  N  N     . SER A 1 787  ? -0.108  -82.717  0.237   1.00 25.02 ? 788  SER A N     1 
ATOM   6002  C  CA    . SER A 1 787  ? -0.173  -81.290  0.501   1.00 26.04 ? 788  SER A CA    1 
ATOM   6003  C  C     . SER A 1 787  ? 0.679   -80.404  -0.423  1.00 26.31 ? 788  SER A C     1 
ATOM   6004  O  O     . SER A 1 787  ? 0.236   -79.320  -0.827  1.00 26.65 ? 788  SER A O     1 
ATOM   6005  C  CB    . SER A 1 787  ? 0.117   -81.002  1.989   1.00 26.20 ? 788  SER A CB    1 
ATOM   6006  O  OG    . SER A 1 787  ? 1.428   -81.378  2.387   1.00 26.69 ? 788  SER A OG    1 
ATOM   6007  N  N     . GLU A 1 788  ? 1.856   -80.895  -0.811  1.00 26.53 ? 789  GLU A N     1 
ATOM   6008  C  CA    . GLU A 1 788  ? 2.768   -80.129  -1.664  1.00 26.71 ? 789  GLU A CA    1 
ATOM   6009  C  C     . GLU A 1 788  ? 2.626   -80.220  -3.195  1.00 26.04 ? 789  GLU A C     1 
ATOM   6010  O  O     . GLU A 1 788  ? 2.990   -79.273  -3.903  1.00 26.50 ? 789  GLU A O     1 
ATOM   6011  C  CB    . GLU A 1 788  ? 4.226   -80.396  -1.265  1.00 27.81 ? 789  GLU A CB    1 
ATOM   6012  C  CG    . GLU A 1 788  ? 4.806   -79.375  -0.262  1.00 30.13 ? 789  GLU A CG    1 
ATOM   6013  C  CD    . GLU A 1 788  ? 4.551   -79.720  1.217   1.00 31.33 ? 789  GLU A CD    1 
ATOM   6014  O  OE1   . GLU A 1 788  ? 4.846   -80.866  1.629   1.00 32.34 ? 789  GLU A OE1   1 
ATOM   6015  O  OE2   . GLU A 1 788  ? 4.095   -78.835  1.983   1.00 32.38 ? 789  GLU A OE2   1 
ATOM   6016  N  N     . VAL A 1 789  ? 2.081   -81.319  -3.710  1.00 24.81 ? 790  VAL A N     1 
ATOM   6017  C  CA    . VAL A 1 789  ? 1.938   -81.478  -5.157  1.00 23.40 ? 790  VAL A CA    1 
ATOM   6018  C  C     . VAL A 1 789  ? 1.236   -80.323  -5.867  1.00 22.44 ? 790  VAL A C     1 
ATOM   6019  O  O     . VAL A 1 789  ? 1.687   -79.908  -6.926  1.00 22.76 ? 790  VAL A O     1 
ATOM   6020  C  CB    . VAL A 1 789  ? 1.225   -82.787  -5.519  1.00 23.73 ? 790  VAL A CB    1 
ATOM   6021  C  CG1   . VAL A 1 789  ? -0.250  -82.691  -5.187  1.00 24.00 ? 790  VAL A CG1   1 
ATOM   6022  C  CG2   . VAL A 1 789  ? 1.444   -83.116  -6.989  1.00 24.03 ? 790  VAL A CG2   1 
ATOM   6023  N  N     . LEU A 1 790  ? 0.132   -79.821  -5.308  1.00 21.48 ? 791  LEU A N     1 
ATOM   6024  C  CA    . LEU A 1 790  ? -0.601  -78.702  -5.920  1.00 19.82 ? 791  LEU A CA    1 
ATOM   6025  C  C     . LEU A 1 790  ? -0.659  -77.444  -5.062  1.00 18.68 ? 791  LEU A C     1 
ATOM   6026  O  O     . LEU A 1 790  ? -0.622  -77.519  -3.828  1.00 18.84 ? 791  LEU A O     1 
ATOM   6027  C  CB    . LEU A 1 790  ? -2.010  -79.126  -6.330  1.00 19.65 ? 791  LEU A CB    1 
ATOM   6028  C  CG    . LEU A 1 790  ? -2.096  -79.835  -7.686  1.00 19.56 ? 791  LEU A CG    1 
ATOM   6029  C  CD1   . LEU A 1 790  ? -3.555  -79.985  -8.127  1.00 19.40 ? 791  LEU A CD1   1 
ATOM   6030  C  CD2   . LEU A 1 790  ? -1.324  -79.034  -8.724  1.00 18.94 ? 791  LEU A CD2   1 
ATOM   6031  N  N     . PRO A 1 791  ? -0.809  -76.269  -5.704  1.00 17.49 ? 792  PRO A N     1 
ATOM   6032  C  CA    . PRO A 1 791  ? -0.869  -75.001  -4.975  1.00 16.47 ? 792  PRO A CA    1 
ATOM   6033  C  C     . PRO A 1 791  ? -1.895  -75.106  -3.876  1.00 16.04 ? 792  PRO A C     1 
ATOM   6034  O  O     . PRO A 1 791  ? -3.092  -75.271  -4.136  1.00 16.12 ? 792  PRO A O     1 
ATOM   6035  C  CB    . PRO A 1 791  ? -1.336  -73.999  -6.036  1.00 16.21 ? 792  PRO A CB    1 
ATOM   6036  C  CG    . PRO A 1 791  ? -0.971  -74.624  -7.330  1.00 17.12 ? 792  PRO A CG    1 
ATOM   6037  C  CD    . PRO A 1 791  ? -1.263  -76.083  -7.092  1.00 17.49 ? 792  PRO A CD    1 
ATOM   6038  N  N     . ARG A 1 792  ? -1.406  -75.120  -2.651  1.00 15.40 ? 793  ARG A N     1 
ATOM   6039  C  CA    . ARG A 1 792  ? -2.261  -75.190  -1.489  1.00 15.65 ? 793  ARG A CA    1 
ATOM   6040  C  C     . ARG A 1 792  ? -3.647  -74.552  -1.672  1.00 15.84 ? 793  ARG A C     1 
ATOM   6041  O  O     . ARG A 1 792  ? -4.659  -75.250  -1.651  1.00 16.24 ? 793  ARG A O     1 
ATOM   6042  C  CB    . ARG A 1 792  ? -1.561  -74.493  -0.348  1.00 15.77 ? 793  ARG A CB    1 
ATOM   6043  C  CG    . ARG A 1 792  ? -2.253  -74.639  0.945   1.00 15.78 ? 793  ARG A CG    1 
ATOM   6044  C  CD    . ARG A 1 792  ? -1.237  -74.538  2.036   1.00 17.01 ? 793  ARG A CD    1 
ATOM   6045  N  NE    . ARG A 1 792  ? -1.687  -75.260  3.216   1.00 18.04 ? 793  ARG A NE    1 
ATOM   6046  C  CZ    . ARG A 1 792  ? -1.364  -74.942  4.463   1.00 18.08 ? 793  ARG A CZ    1 
ATOM   6047  N  NH1   . ARG A 1 792  ? -0.562  -73.915  4.720   1.00 17.99 ? 793  ARG A NH1   1 
ATOM   6048  N  NH2   . ARG A 1 792  ? -1.919  -75.609  5.459   1.00 19.01 ? 793  ARG A NH2   1 
ATOM   6049  N  N     . ASP A 1 793  ? -3.672  -73.241  -1.925  1.00 15.64 ? 794  ASP A N     1 
ATOM   6050  C  CA    . ASP A 1 793  ? -4.910  -72.485  -2.081  1.00 14.98 ? 794  ASP A CA    1 
ATOM   6051  C  C     . ASP A 1 793  ? -5.552  -72.445  -3.471  1.00 14.55 ? 794  ASP A C     1 
ATOM   6052  O  O     . ASP A 1 793  ? -6.090  -71.428  -3.903  1.00 14.31 ? 794  ASP A O     1 
ATOM   6053  C  CB    . ASP A 1 793  ? -4.720  -71.073  -1.546  1.00 15.84 ? 794  ASP A CB    1 
ATOM   6054  C  CG    . ASP A 1 793  ? -4.051  -70.152  -2.544  1.00 16.53 ? 794  ASP A CG    1 
ATOM   6055  O  OD1   . ASP A 1 793  ? -2.910  -70.439  -2.968  1.00 16.92 ? 794  ASP A OD1   1 
ATOM   6056  O  OD2   . ASP A 1 793  ? -4.683  -69.139  -2.919  1.00 17.60 ? 794  ASP A OD2   1 
ATOM   6057  N  N     . SER A 1 794  ? -5.487  -73.559  -4.178  1.00 14.12 ? 795  SER A N     1 
ATOM   6058  C  CA    . SER A 1 794  ? -6.119  -73.663  -5.477  1.00 13.49 ? 795  SER A CA    1 
ATOM   6059  C  C     . SER A 1 794  ? -7.227  -74.657  -5.186  1.00 13.52 ? 795  SER A C     1 
ATOM   6060  O  O     . SER A 1 794  ? -6.957  -75.663  -4.552  1.00 12.91 ? 795  SER A O     1 
ATOM   6061  C  CB    . SER A 1 794  ? -5.146  -74.288  -6.458  1.00 13.31 ? 795  SER A CB    1 
ATOM   6062  O  OG    . SER A 1 794  ? -4.757  -75.574  -6.007  1.00 12.85 ? 795  SER A OG    1 
ATOM   6063  N  N     . LEU A 1 795  ? -8.459  -74.381  -5.615  1.00 13.95 ? 796  LEU A N     1 
ATOM   6064  C  CA    . LEU A 1 795  ? -9.594  -75.303  -5.397  1.00 14.42 ? 796  LEU A CA    1 
ATOM   6065  C  C     . LEU A 1 795  ? -9.142  -76.778  -5.342  1.00 14.71 ? 796  LEU A C     1 
ATOM   6066  O  O     . LEU A 1 795  ? -9.246  -77.421  -4.299  1.00 14.65 ? 796  LEU A O     1 
ATOM   6067  C  CB    . LEU A 1 795  ? -10.640 -75.133  -6.517  1.00 13.97 ? 796  LEU A CB    1 
ATOM   6068  C  CG    . LEU A 1 795  ? -12.083 -75.677  -6.424  1.00 13.67 ? 796  LEU A CG    1 
ATOM   6069  C  CD1   . LEU A 1 795  ? -12.758 -75.433  -7.764  1.00 12.88 ? 796  LEU A CD1   1 
ATOM   6070  C  CD2   . LEU A 1 795  ? -12.172 -77.161  -6.064  1.00 13.47 ? 796  LEU A CD2   1 
ATOM   6071  N  N     . LYS A 1 796  ? -8.605  -77.290  -6.450  1.00 15.18 ? 797  LYS A N     1 
ATOM   6072  C  CA    . LYS A 1 796  ? -8.148  -78.675  -6.493  1.00 16.00 ? 797  LYS A CA    1 
ATOM   6073  C  C     . LYS A 1 796  ? -7.043  -78.934  -5.467  1.00 16.29 ? 797  LYS A C     1 
ATOM   6074  O  O     . LYS A 1 796  ? -7.146  -79.860  -4.666  1.00 16.98 ? 797  LYS A O     1 
ATOM   6075  C  CB    . LYS A 1 796  ? -7.671  -79.044  -7.898  1.00 16.75 ? 797  LYS A CB    1 
ATOM   6076  C  CG    . LYS A 1 796  ? -7.501  -80.553  -8.122  1.00 17.62 ? 797  LYS A CG    1 
ATOM   6077  C  CD    . LYS A 1 796  ? -7.104  -80.866  -9.571  1.00 17.68 ? 797  LYS A CD    1 
ATOM   6078  C  CE    . LYS A 1 796  ? -7.068  -82.364  -9.836  1.00 17.64 ? 797  LYS A CE    1 
ATOM   6079  N  NZ    . LYS A 1 796  ? -6.686  -82.638  -11.248 1.00 17.52 ? 797  LYS A NZ    1 
ATOM   6080  N  N     . GLY A 1 797  ? -5.994  -78.113  -5.470  1.00 16.24 ? 798  GLY A N     1 
ATOM   6081  C  CA    . GLY A 1 797  ? -4.927  -78.286  -4.494  1.00 15.93 ? 798  GLY A CA    1 
ATOM   6082  C  C     . GLY A 1 797  ? -5.397  -78.170  -3.040  1.00 16.03 ? 798  GLY A C     1 
ATOM   6083  O  O     . GLY A 1 797  ? -4.812  -78.803  -2.158  1.00 16.66 ? 798  GLY A O     1 
ATOM   6084  N  N     . SER A 1 798  ? -6.467  -77.407  -2.777  1.00 15.37 ? 799  SER A N     1 
ATOM   6085  C  CA    . SER A 1 798  ? -6.948  -77.245  -1.406  1.00 14.21 ? 799  SER A CA    1 
ATOM   6086  C  C     . SER A 1 798  ? -7.538  -78.540  -0.939  1.00 14.38 ? 799  SER A C     1 
ATOM   6087  O  O     . SER A 1 798  ? -7.333  -78.943  0.205   1.00 14.67 ? 799  SER A O     1 
ATOM   6088  C  CB    . SER A 1 798  ? -7.955  -76.092  -1.253  1.00 13.17 ? 799  SER A CB    1 
ATOM   6089  O  OG    . SER A 1 798  ? -9.118  -76.253  -2.032  1.00 11.52 ? 799  SER A OG    1 
ATOM   6090  N  N     . GLN A 1 799  ? -8.227  -79.236  -1.831  1.00 14.49 ? 800  GLN A N     1 
ATOM   6091  C  CA    . GLN A 1 799  ? -8.803  -80.509  -1.439  1.00 15.01 ? 800  GLN A CA    1 
ATOM   6092  C  C     . GLN A 1 799  ? -7.760  -81.600  -1.298  1.00 15.45 ? 800  GLN A C     1 
ATOM   6093  O  O     . GLN A 1 799  ? -8.080  -82.733  -0.952  1.00 16.57 ? 800  GLN A O     1 
ATOM   6094  C  CB    . GLN A 1 799  ? -9.944  -80.926  -2.362  1.00 14.63 ? 800  GLN A CB    1 
ATOM   6095  C  CG    . GLN A 1 799  ? -11.170 -80.063  -2.187  1.00 14.86 ? 800  GLN A CG    1 
ATOM   6096  C  CD    . GLN A 1 799  ? -11.073 -79.220  -0.938  1.00 15.08 ? 800  GLN A CD    1 
ATOM   6097  O  OE1   . GLN A 1 799  ? -11.348 -79.689  0.163   1.00 15.38 ? 800  GLN A OE1   1 
ATOM   6098  N  NE2   . GLN A 1 799  ? -10.601 -77.992  -1.093  1.00 15.02 ? 800  GLN A NE2   1 
ATOM   6099  N  N     . PHE A 1 800  ? -6.505  -81.263  -1.551  1.00 15.29 ? 801  PHE A N     1 
ATOM   6100  C  CA    . PHE A 1 800  ? -5.449  -82.236  -1.384  1.00 15.19 ? 801  PHE A CA    1 
ATOM   6101  C  C     . PHE A 1 800  ? -4.649  -81.888  -0.120  1.00 15.51 ? 801  PHE A C     1 
ATOM   6102  O  O     . PHE A 1 800  ? -3.463  -82.229  -0.002  1.00 15.81 ? 801  PHE A O     1 
ATOM   6103  C  CB    . PHE A 1 800  ? -4.581  -82.292  -2.644  1.00 15.19 ? 801  PHE A CB    1 
ATOM   6104  C  CG    . PHE A 1 800  ? -5.078  -83.280  -3.672  1.00 15.08 ? 801  PHE A CG    1 
ATOM   6105  C  CD1   . PHE A 1 800  ? -5.682  -84.479  -3.269  1.00 15.68 ? 801  PHE A CD1   1 
ATOM   6106  C  CD2   . PHE A 1 800  ? -4.966  -83.008  -5.032  1.00 14.45 ? 801  PHE A CD2   1 
ATOM   6107  C  CE1   . PHE A 1 800  ? -6.174  -85.385  -4.217  1.00 15.49 ? 801  PHE A CE1   1 
ATOM   6108  C  CE2   . PHE A 1 800  ? -5.454  -83.902  -5.975  1.00 14.55 ? 801  PHE A CE2   1 
ATOM   6109  C  CZ    . PHE A 1 800  ? -6.056  -85.090  -5.571  1.00 15.23 ? 801  PHE A CZ    1 
ATOM   6110  N  N     . GLN A 1 801  ? -5.326  -81.207  0.815   1.00 15.38 ? 802  GLN A N     1 
ATOM   6111  C  CA    . GLN A 1 801  ? -4.765  -80.774  2.109   1.00 15.38 ? 802  GLN A CA    1 
ATOM   6112  C  C     . GLN A 1 801  ? -5.436  -81.531  3.283   1.00 14.64 ? 802  GLN A C     1 
ATOM   6113  O  O     . GLN A 1 801  ? -6.473  -82.184  3.116   1.00 14.77 ? 802  GLN A O     1 
ATOM   6114  C  CB    . GLN A 1 801  ? -4.997  -79.261  2.317   1.00 16.44 ? 802  GLN A CB    1 
ATOM   6115  C  CG    . GLN A 1 801  ? -4.420  -78.314  1.251   1.00 18.63 ? 802  GLN A CG    1 
ATOM   6116  C  CD    . GLN A 1 801  ? -2.894  -78.337  1.176   1.00 20.22 ? 802  GLN A CD    1 
ATOM   6117  O  OE1   . GLN A 1 801  ? -2.206  -78.341  2.210   1.00 21.00 ? 802  GLN A OE1   1 
ATOM   6118  N  NE2   . GLN A 1 801  ? -2.354  -78.336  -0.053  1.00 20.23 ? 802  GLN A NE2   1 
ATOM   6119  N  N     . GLU A 1 802  ? -4.847  -81.444  4.472   1.00 13.62 ? 803  GLU A N     1 
ATOM   6120  C  CA    . GLU A 1 802  ? -5.427  -82.091  5.639   1.00 12.70 ? 803  GLU A CA    1 
ATOM   6121  C  C     . GLU A 1 802  ? -6.526  -81.163  6.146   1.00 12.46 ? 803  GLU A C     1 
ATOM   6122  O  O     . GLU A 1 802  ? -6.238  -80.010  6.505   1.00 12.58 ? 803  GLU A O     1 
ATOM   6123  C  CB    . GLU A 1 802  ? -4.379  -82.267  6.748   1.00 12.66 ? 803  GLU A CB    1 
ATOM   6124  C  CG    . GLU A 1 802  ? -3.329  -83.324  6.492   1.00 12.86 ? 803  GLU A CG    1 
ATOM   6125  C  CD    . GLU A 1 802  ? -1.914  -82.843  6.823   1.00 14.14 ? 803  GLU A CD    1 
ATOM   6126  O  OE1   . GLU A 1 802  ? -1.475  -81.791  6.275   1.00 14.83 ? 803  GLU A OE1   1 
ATOM   6127  O  OE2   . GLU A 1 802  ? -1.224  -83.530  7.618   1.00 13.93 ? 803  GLU A OE2   1 
ATOM   6128  N  N     . PRO A 1 803  ? -7.802  -81.620  6.145   1.00 11.89 ? 804  PRO A N     1 
ATOM   6129  C  CA    . PRO A 1 803  ? -8.920  -80.804  6.621   1.00 11.26 ? 804  PRO A CA    1 
ATOM   6130  C  C     . PRO A 1 803  ? -8.781  -80.880  8.120   1.00 11.26 ? 804  PRO A C     1 
ATOM   6131  O  O     . PRO A 1 803  ? -8.835  -81.985  8.673   1.00 11.69 ? 804  PRO A O     1 
ATOM   6132  C  CB    . PRO A 1 803  ? -10.152 -81.618  6.205   1.00 10.62 ? 804  PRO A CB    1 
ATOM   6133  C  CG    . PRO A 1 803  ? -9.653  -82.642  5.286   1.00 11.15 ? 804  PRO A CG    1 
ATOM   6134  C  CD    . PRO A 1 803  ? -8.294  -82.963  5.813   1.00 11.81 ? 804  PRO A CD    1 
ATOM   6135  N  N     . LEU A 1 804  ? -8.553  -79.745  8.774   1.00 10.94 ? 805  LEU A N     1 
ATOM   6136  C  CA    . LEU A 1 804  ? -8.396  -79.736  10.225  1.00 10.83 ? 805  LEU A CA    1 
ATOM   6137  C  C     . LEU A 1 804  ? -9.677  -79.601  11.073  1.00 11.70 ? 805  LEU A C     1 
ATOM   6138  O  O     . LEU A 1 804  ? -9.602  -79.364  12.284  1.00 11.99 ? 805  LEU A O     1 
ATOM   6139  C  CB    . LEU A 1 804  ? -7.320  -78.734  10.635  1.00 9.35  ? 805  LEU A CB    1 
ATOM   6140  C  CG    . LEU A 1 804  ? -5.886  -79.292  10.624  1.00 8.71  ? 805  LEU A CG    1 
ATOM   6141  C  CD1   . LEU A 1 804  ? -5.641  -80.223  9.454   1.00 7.14  ? 805  LEU A CD1   1 
ATOM   6142  C  CD2   . LEU A 1 804  ? -4.863  -78.159  10.660  1.00 8.17  ? 805  LEU A CD2   1 
ATOM   6143  N  N     . MET A 1 805  ? -10.841 -79.817  10.444  1.00 12.27 ? 806  MET A N     1 
ATOM   6144  C  CA    . MET A 1 805  ? -12.155 -79.748  11.124  1.00 12.37 ? 806  MET A CA    1 
ATOM   6145  C  C     . MET A 1 805  ? -13.106 -80.805  10.483  1.00 11.90 ? 806  MET A C     1 
ATOM   6146  O  O     . MET A 1 805  ? -13.702 -80.576  9.425   1.00 11.68 ? 806  MET A O     1 
ATOM   6147  C  CB    . MET A 1 805  ? -12.718 -78.311  11.017  1.00 12.73 ? 806  MET A CB    1 
ATOM   6148  C  CG    . MET A 1 805  ? -13.831 -77.941  12.010  1.00 13.24 ? 806  MET A CG    1 
ATOM   6149  S  SD    . MET A 1 805  ? -15.428 -78.820  11.811  1.00 15.04 ? 806  MET A SD    1 
ATOM   6150  C  CE    . MET A 1 805  ? -16.232 -77.799  10.576  1.00 14.32 ? 806  MET A CE    1 
ATOM   6151  N  N     . GLU A 1 806  ? -13.239 -81.971  11.105  1.00 11.36 ? 807  GLU A N     1 
ATOM   6152  C  CA    . GLU A 1 806  ? -14.075 -83.004  10.500  1.00 11.33 ? 807  GLU A CA    1 
ATOM   6153  C  C     . GLU A 1 806  ? -15.157 -83.584  11.363  1.00 11.36 ? 807  GLU A C     1 
ATOM   6154  O  O     . GLU A 1 806  ? -15.029 -83.619  12.593  1.00 11.16 ? 807  GLU A O     1 
ATOM   6155  C  CB    . GLU A 1 806  ? -13.227 -84.162  10.011  1.00 10.84 ? 807  GLU A CB    1 
ATOM   6156  C  CG    . GLU A 1 806  ? -12.003 -83.732  9.307   1.00 11.58 ? 807  GLU A CG    1 
ATOM   6157  C  CD    . GLU A 1 806  ? -11.249 -84.886  8.749   1.00 12.12 ? 807  GLU A CD    1 
ATOM   6158  O  OE1   . GLU A 1 806  ? -10.989 -85.863  9.493   1.00 12.36 ? 807  GLU A OE1   1 
ATOM   6159  O  OE2   . GLU A 1 806  ? -10.913 -84.812  7.552   1.00 12.59 ? 807  GLU A OE2   1 
ATOM   6160  N  N     . PHE A 1 807  ? -16.219 -84.033  10.684  1.00 11.50 ? 808  PHE A N     1 
ATOM   6161  C  CA    . PHE A 1 807  ? -17.386 -84.681  11.288  1.00 12.11 ? 808  PHE A CA    1 
ATOM   6162  C  C     . PHE A 1 807  ? -18.055 -83.959  12.478  1.00 12.52 ? 808  PHE A C     1 
ATOM   6163  O  O     . PHE A 1 807  ? -18.265 -84.545  13.547  1.00 12.39 ? 808  PHE A O     1 
ATOM   6164  C  CB    . PHE A 1 807  ? -16.995 -86.099  11.689  1.00 12.15 ? 808  PHE A CB    1 
ATOM   6165  C  CG    . PHE A 1 807  ? -15.855 -86.659  10.885  1.00 12.20 ? 808  PHE A CG    1 
ATOM   6166  C  CD1   . PHE A 1 807  ? -15.937 -86.718  9.489   1.00 12.01 ? 808  PHE A CD1   1 
ATOM   6167  C  CD2   . PHE A 1 807  ? -14.686 -87.097  11.526  1.00 11.86 ? 808  PHE A CD2   1 
ATOM   6168  C  CE1   . PHE A 1 807  ? -14.874 -87.210  8.737   1.00 12.16 ? 808  PHE A CE1   1 
ATOM   6169  C  CE2   . PHE A 1 807  ? -13.615 -87.587  10.792  1.00 11.71 ? 808  PHE A CE2   1 
ATOM   6170  C  CZ    . PHE A 1 807  ? -13.705 -87.643  9.388   1.00 12.23 ? 808  PHE A CZ    1 
ATOM   6171  N  N     . SER A 1 808  ? -18.393 -82.691  12.285  1.00 12.89 ? 809  SER A N     1 
ATOM   6172  C  CA    . SER A 1 808  ? -19.025 -81.898  13.331  1.00 13.39 ? 809  SER A CA    1 
ATOM   6173  C  C     . SER A 1 808  ? -20.459 -82.337  13.583  1.00 13.90 ? 809  SER A C     1 
ATOM   6174  O  O     . SER A 1 808  ? -21.164 -82.774  12.657  1.00 14.02 ? 809  SER A O     1 
ATOM   6175  C  CB    . SER A 1 808  ? -19.055 -80.442  12.901  1.00 13.36 ? 809  SER A CB    1 
ATOM   6176  O  OG    . SER A 1 808  ? -19.757 -80.326  11.669  1.00 13.66 ? 809  SER A OG    1 
ATOM   6177  N  N     . GLY A 1 809  ? -20.911 -82.184  14.825  1.00 14.02 ? 810  GLY A N     1 
ATOM   6178  C  CA    . GLY A 1 809  ? -22.282 -82.539  15.148  1.00 13.65 ? 810  GLY A CA    1 
ATOM   6179  C  C     . GLY A 1 809  ? -23.233 -81.474  14.631  1.00 13.57 ? 810  GLY A C     1 
ATOM   6180  O  O     . GLY A 1 809  ? -24.114 -81.008  15.345  1.00 13.76 ? 810  GLY A O     1 
ATOM   6181  N  N     . ALA A 1 810  ? -23.050 -81.076  13.382  1.00 13.51 ? 811  ALA A N     1 
ATOM   6182  C  CA    . ALA A 1 810  ? -23.892 -80.047  12.814  1.00 13.62 ? 811  ALA A CA    1 
ATOM   6183  C  C     . ALA A 1 810  ? -24.842 -80.683  11.842  1.00 13.62 ? 811  ALA A C     1 
ATOM   6184  O  O     . ALA A 1 810  ? -24.598 -81.783  11.365  1.00 13.61 ? 811  ALA A O     1 
ATOM   6185  C  CB    . ALA A 1 810  ? -23.051 -79.013  12.120  1.00 13.69 ? 811  ALA A CB    1 
ATOM   6186  N  N     . CYS A 1 811  ? -25.919 -79.973  11.539  1.00 13.62 ? 812  CYS A N     1 
ATOM   6187  C  CA    . CYS A 1 811  ? -26.931 -80.457  10.616  1.00 13.74 ? 812  CYS A CA    1 
ATOM   6188  C  C     . CYS A 1 811  ? -26.397 -80.957  9.292   1.00 13.95 ? 812  CYS A C     1 
ATOM   6189  O  O     . CYS A 1 811  ? -25.374 -80.478  8.798   1.00 13.12 ? 812  CYS A O     1 
ATOM   6190  C  CB    . CYS A 1 811  ? -27.888 -79.333  10.283  1.00 13.94 ? 812  CYS A CB    1 
ATOM   6191  S  SG    . CYS A 1 811  ? -28.586 -78.480  11.707  1.00 13.59 ? 812  CYS A SG    1 
ATOM   6192  N  N     . SER A 1 812  ? -27.157 -81.867  8.689   1.00 14.73 ? 813  SER A N     1 
ATOM   6193  C  CA    . SER A 1 812  ? -26.818 -82.409  7.375   1.00 15.74 ? 813  SER A CA    1 
ATOM   6194  C  C     . SER A 1 812  ? -26.925 -81.247  6.380   1.00 16.13 ? 813  SER A C     1 
ATOM   6195  O  O     . SER A 1 812  ? -27.918 -80.502  6.371   1.00 16.20 ? 813  SER A O     1 
ATOM   6196  C  CB    . SER A 1 812  ? -27.806 -83.502  6.993   1.00 15.88 ? 813  SER A CB    1 
ATOM   6197  O  OG    . SER A 1 812  ? -27.914 -84.430  8.052   1.00 16.71 ? 813  SER A OG    1 
ATOM   6198  N  N     . GLY A 1 813  ? -25.877 -81.070  5.579   1.00 16.18 ? 814  GLY A N     1 
ATOM   6199  C  CA    . GLY A 1 813  ? -25.870 -79.995  4.617   1.00 15.10 ? 814  GLY A CA    1 
ATOM   6200  C  C     . GLY A 1 813  ? -25.897 -78.639  5.285   1.00 15.04 ? 814  GLY A C     1 
ATOM   6201  O  O     . GLY A 1 813  ? -26.572 -77.722  4.808   1.00 15.86 ? 814  GLY A O     1 
ATOM   6202  N  N     . CYS A 1 814  ? -25.221 -78.515  6.423   1.00 14.12 ? 815  CYS A N     1 
ATOM   6203  C  CA    . CYS A 1 814  ? -25.144 -77.225  7.113   1.00 13.25 ? 815  CYS A CA    1 
ATOM   6204  C  C     . CYS A 1 814  ? -24.384 -76.265  6.199   1.00 12.71 ? 815  CYS A C     1 
ATOM   6205  O  O     . CYS A 1 814  ? -23.529 -76.686  5.432   1.00 13.08 ? 815  CYS A O     1 
ATOM   6206  C  CB    . CYS A 1 814  ? -24.389 -77.379  8.423   1.00 13.29 ? 815  CYS A CB    1 
ATOM   6207  S  SG    . CYS A 1 814  ? -24.072 -75.812  9.246   1.00 13.75 ? 815  CYS A SG    1 
ATOM   6208  N  N     . GLY A 1 815  ? -24.695 -74.979  6.270   1.00 12.19 ? 816  GLY A N     1 
ATOM   6209  C  CA    . GLY A 1 815  ? -24.013 -74.009  5.423   1.00 11.42 ? 816  GLY A CA    1 
ATOM   6210  C  C     . GLY A 1 815  ? -22.768 -73.354  6.010   1.00 10.88 ? 816  GLY A C     1 
ATOM   6211  O  O     . GLY A 1 815  ? -22.085 -72.574  5.335   1.00 10.84 ? 816  GLY A O     1 
ATOM   6212  N  N     . GLU A 1 816  ? -22.463 -73.671  7.261   1.00 9.98  ? 817  GLU A N     1 
ATOM   6213  C  CA    . GLU A 1 816  ? -21.304 -73.094  7.932   1.00 9.09  ? 817  GLU A CA    1 
ATOM   6214  C  C     . GLU A 1 816  ? -19.989 -73.880  7.720   1.00 8.61  ? 817  GLU A C     1 
ATOM   6215  O  O     . GLU A 1 816  ? -18.965 -73.319  7.335   1.00 7.88  ? 817  GLU A O     1 
ATOM   6216  C  CB    . GLU A 1 816  ? -21.613 -72.950  9.421   1.00 8.45  ? 817  GLU A CB    1 
ATOM   6217  C  CG    . GLU A 1 816  ? -23.019 -72.462  9.711   1.00 7.24  ? 817  GLU A CG    1 
ATOM   6218  C  CD    . GLU A 1 816  ? -23.121 -71.772  11.061  1.00 7.17  ? 817  GLU A CD    1 
ATOM   6219  O  OE1   . GLU A 1 816  ? -22.531 -72.273  12.048  1.00 5.59  ? 817  GLU A OE1   1 
ATOM   6220  O  OE2   . GLU A 1 816  ? -23.781 -70.709  11.134  1.00 6.51  ? 817  GLU A OE2   1 
ATOM   6221  N  N     . THR A 1 817  ? -20.052 -75.187  7.938   1.00 8.52  ? 818  THR A N     1 
ATOM   6222  C  CA    . THR A 1 817  ? -18.910 -76.076  7.809   1.00 9.09  ? 818  THR A CA    1 
ATOM   6223  C  C     . THR A 1 817  ? -18.109 -76.113  6.471   1.00 9.05  ? 818  THR A C     1 
ATOM   6224  O  O     . THR A 1 817  ? -16.895 -76.328  6.486   1.00 9.74  ? 818  THR A O     1 
ATOM   6225  C  CB    . THR A 1 817  ? -19.305 -77.454  8.281   1.00 9.83  ? 818  THR A CB    1 
ATOM   6226  O  OG1   . THR A 1 817  ? -20.472 -77.854  7.560   1.00 11.53 ? 818  THR A OG1   1 
ATOM   6227  C  CG2   . THR A 1 817  ? -19.671 -77.401  9.767   1.00 9.63  ? 818  THR A CG2   1 
ATOM   6228  N  N     . PRO A 1 818  ? -18.765 -76.010  5.304   1.00 8.54  ? 819  PRO A N     1 
ATOM   6229  C  CA    . PRO A 1 818  ? -17.879 -76.028  4.128   1.00 8.38  ? 819  PRO A CA    1 
ATOM   6230  C  C     . PRO A 1 818  ? -16.808 -74.890  4.231   1.00 8.26  ? 819  PRO A C     1 
ATOM   6231  O  O     . PRO A 1 818  ? -15.619 -75.129  4.013   1.00 9.14  ? 819  PRO A O     1 
ATOM   6232  C  CB    . PRO A 1 818  ? -18.850 -75.771  2.970   1.00 8.26  ? 819  PRO A CB    1 
ATOM   6233  C  CG    . PRO A 1 818  ? -20.105 -76.476  3.434   1.00 8.43  ? 819  PRO A CG    1 
ATOM   6234  C  CD    . PRO A 1 818  ? -20.184 -76.120  4.915   1.00 8.42  ? 819  PRO A CD    1 
ATOM   6235  N  N     . TYR A 1 819  ? -17.220 -73.679  4.617   1.00 7.52  ? 820  TYR A N     1 
ATOM   6236  C  CA    . TYR A 1 819  ? -16.295 -72.553  4.749   1.00 6.89  ? 820  TYR A CA    1 
ATOM   6237  C  C     . TYR A 1 819  ? -15.200 -72.870  5.729   1.00 6.87  ? 820  TYR A C     1 
ATOM   6238  O  O     . TYR A 1 819  ? -14.062 -73.095  5.343   1.00 6.88  ? 820  TYR A O     1 
ATOM   6239  C  CB    . TYR A 1 819  ? -16.998 -71.287  5.237   1.00 6.42  ? 820  TYR A CB    1 
ATOM   6240  C  CG    . TYR A 1 819  ? -18.020 -70.769  4.287   1.00 6.44  ? 820  TYR A CG    1 
ATOM   6241  C  CD1   . TYR A 1 819  ? -17.639 -70.087  3.153   1.00 6.12  ? 820  TYR A CD1   1 
ATOM   6242  C  CD2   . TYR A 1 819  ? -19.375 -71.013  4.491   1.00 6.93  ? 820  TYR A CD2   1 
ATOM   6243  C  CE1   . TYR A 1 819  ? -18.564 -69.655  2.238   1.00 6.38  ? 820  TYR A CE1   1 
ATOM   6244  C  CE2   . TYR A 1 819  ? -20.319 -70.584  3.578   1.00 7.27  ? 820  TYR A CE2   1 
ATOM   6245  C  CZ    . TYR A 1 819  ? -19.900 -69.905  2.451   1.00 7.41  ? 820  TYR A CZ    1 
ATOM   6246  O  OH    . TYR A 1 819  ? -20.822 -69.449  1.539   1.00 9.53  ? 820  TYR A OH    1 
ATOM   6247  N  N     . VAL A 1 820  ? -15.568 -72.990  6.995   1.00 6.72  ? 821  VAL A N     1 
ATOM   6248  C  CA    . VAL A 1 820  ? -14.564 -73.230  8.005   1.00 7.04  ? 821  VAL A CA    1 
ATOM   6249  C  C     . VAL A 1 820  ? -13.655 -74.419  7.776   1.00 7.43  ? 821  VAL A C     1 
ATOM   6250  O  O     . VAL A 1 820  ? -12.564 -74.445  8.356   1.00 7.97  ? 821  VAL A O     1 
ATOM   6251  C  CB    . VAL A 1 820  ? -15.101 -73.207  9.463   1.00 6.78  ? 821  VAL A CB    1 
ATOM   6252  C  CG1   . VAL A 1 820  ? -16.509 -72.633  9.530   1.00 7.70  ? 821  VAL A CG1   1 
ATOM   6253  C  CG2   . VAL A 1 820  ? -15.013 -74.556  10.072  1.00 7.29  ? 821  VAL A CG2   1 
ATOM   6254  N  N     . ARG A 1 821  ? -14.048 -75.391  6.942   1.00 7.22  ? 822  ARG A N     1 
ATOM   6255  C  CA    . ARG A 1 821  ? -13.120 -76.501  6.707   1.00 6.83  ? 822  ARG A CA    1 
ATOM   6256  C  C     . ARG A 1 821  ? -11.984 -76.046  5.829   1.00 6.20  ? 822  ARG A C     1 
ATOM   6257  O  O     . ARG A 1 821  ? -10.827 -76.224  6.196   1.00 6.29  ? 822  ARG A O     1 
ATOM   6258  C  CB    . ARG A 1 821  ? -13.755 -77.727  6.086   1.00 7.73  ? 822  ARG A CB    1 
ATOM   6259  C  CG    . ARG A 1 821  ? -12.797 -78.933  6.100   1.00 9.54  ? 822  ARG A CG    1 
ATOM   6260  C  CD    . ARG A 1 821  ? -13.431 -80.156  5.441   1.00 11.57 ? 822  ARG A CD    1 
ATOM   6261  N  NE    . ARG A 1 821  ? -14.290 -79.680  4.365   1.00 14.48 ? 822  ARG A NE    1 
ATOM   6262  C  CZ    . ARG A 1 821  ? -14.013 -79.744  3.063   1.00 15.96 ? 822  ARG A CZ    1 
ATOM   6263  N  NH1   . ARG A 1 821  ? -12.887 -80.323  2.624   1.00 16.04 ? 822  ARG A NH1   1 
ATOM   6264  N  NH2   . ARG A 1 821  ? -14.793 -79.061  2.213   1.00 16.47 ? 822  ARG A NH2   1 
ATOM   6265  N  N     . VAL A 1 822  ? -12.292 -75.382  4.715   1.00 5.26  ? 823  VAL A N     1 
ATOM   6266  C  CA    . VAL A 1 822  ? -11.217 -74.926  3.848   1.00 4.34  ? 823  VAL A CA    1 
ATOM   6267  C  C     . VAL A 1 822  ? -10.398 -73.828  4.484   1.00 4.39  ? 823  VAL A C     1 
ATOM   6268  O  O     . VAL A 1 822  ? -9.243  -73.646  4.118   1.00 5.25  ? 823  VAL A O     1 
ATOM   6269  C  CB    . VAL A 1 822  ? -11.682 -74.515  2.445   1.00 3.45  ? 823  VAL A CB    1 
ATOM   6270  C  CG1   . VAL A 1 822  ? -13.016 -75.122  2.156   1.00 4.01  ? 823  VAL A CG1   1 
ATOM   6271  C  CG2   . VAL A 1 822  ? -11.695 -73.012  2.266   1.00 3.15  ? 823  VAL A CG2   1 
ATOM   6272  N  N     . ILE A 1 823  ? -10.965 -73.113  5.452   1.00 4.17  ? 824  ILE A N     1 
ATOM   6273  C  CA    . ILE A 1 823  ? -10.211 -72.057  6.100   1.00 4.03  ? 824  ILE A CA    1 
ATOM   6274  C  C     . ILE A 1 823  ? -9.123  -72.777  6.813   1.00 4.78  ? 824  ILE A C     1 
ATOM   6275  O  O     . ILE A 1 823  ? -7.986  -72.347  6.789   1.00 5.44  ? 824  ILE A O     1 
ATOM   6276  C  CB    . ILE A 1 823  ? -11.018 -71.246  7.081   1.00 2.94  ? 824  ILE A CB    1 
ATOM   6277  C  CG1   . ILE A 1 823  ? -12.063 -70.452  6.328   1.00 3.17  ? 824  ILE A CG1   1 
ATOM   6278  C  CG2   . ILE A 1 823  ? -10.171 -70.223  7.685   1.00 2.00  ? 824  ILE A CG2   1 
ATOM   6279  C  CD1   . ILE A 1 823  ? -13.061 -69.794  7.200   1.00 3.37  ? 824  ILE A CD1   1 
ATOM   6280  N  N     . THR A 1 824  ? -9.431  -73.937  7.372   1.00 5.71  ? 825  THR A N     1 
ATOM   6281  C  CA    . THR A 1 824  ? -8.363  -74.659  8.051   1.00 6.48  ? 825  THR A CA    1 
ATOM   6282  C  C     . THR A 1 824  ? -7.500  -75.402  7.041   1.00 6.48  ? 825  THR A C     1 
ATOM   6283  O  O     . THR A 1 824  ? -6.343  -75.661  7.317   1.00 7.06  ? 825  THR A O     1 
ATOM   6284  C  CB    . THR A 1 824  ? -8.833  -75.618  9.212   1.00 6.38  ? 825  THR A CB    1 
ATOM   6285  O  OG1   . THR A 1 824  ? -9.251  -76.870  8.678   1.00 6.65  ? 825  THR A OG1   1 
ATOM   6286  C  CG2   . THR A 1 824  ? -9.965  -74.998  10.051  1.00 5.94  ? 825  THR A CG2   1 
ATOM   6287  N  N     . GLN A 1 825  ? -8.026  -75.723  5.863   1.00 6.68  ? 826  GLN A N     1 
ATOM   6288  C  CA    . GLN A 1 825  ? -7.193  -76.414  4.876   1.00 7.20  ? 826  GLN A CA    1 
ATOM   6289  C  C     . GLN A 1 825  ? -6.117  -75.496  4.335   1.00 7.20  ? 826  GLN A C     1 
ATOM   6290  O  O     . GLN A 1 825  ? -5.236  -75.955  3.582   1.00 8.11  ? 826  GLN A O     1 
ATOM   6291  C  CB    . GLN A 1 825  ? -8.007  -76.978  3.715   1.00 6.94  ? 826  GLN A CB    1 
ATOM   6292  C  CG    . GLN A 1 825  ? -8.679  -78.259  4.081   1.00 8.61  ? 826  GLN A CG    1 
ATOM   6293  C  CD    . GLN A 1 825  ? -9.572  -78.807  2.990   1.00 9.56  ? 826  GLN A CD    1 
ATOM   6294  O  OE1   . GLN A 1 825  ? -9.949  -78.096  2.058   1.00 9.90  ? 826  GLN A OE1   1 
ATOM   6295  N  NE2   . GLN A 1 825  ? -9.922  -80.086  3.104   1.00 10.40 ? 826  GLN A NE2   1 
ATOM   6296  N  N     . LEU A 1 826  ? -6.181  -74.218  4.728   1.00 5.83  ? 827  LEU A N     1 
ATOM   6297  C  CA    . LEU A 1 826  ? -5.212  -73.219  4.289   1.00 4.73  ? 827  LEU A CA    1 
ATOM   6298  C  C     . LEU A 1 826  ? -4.329  -72.585  5.363   1.00 4.91  ? 827  LEU A C     1 
ATOM   6299  O  O     . LEU A 1 826  ? -3.230  -72.126  5.053   1.00 5.19  ? 827  LEU A O     1 
ATOM   6300  C  CB    . LEU A 1 826  ? -5.923  -72.075  3.594   1.00 3.65  ? 827  LEU A CB    1 
ATOM   6301  C  CG    . LEU A 1 826  ? -6.040  -72.153  2.098   1.00 2.63  ? 827  LEU A CG    1 
ATOM   6302  C  CD1   . LEU A 1 826  ? -6.977  -73.263  1.764   1.00 3.39  ? 827  LEU A CD1   1 
ATOM   6303  C  CD2   . LEU A 1 826  ? -6.589  -70.858  1.625   1.00 2.09  ? 827  LEU A CD2   1 
ATOM   6304  N  N     . PHE A 1 827  ? -4.833  -72.497  6.593   1.00 4.28  ? 828  PHE A N     1 
ATOM   6305  C  CA    . PHE A 1 827  ? -4.119  -71.860  7.677   1.00 3.12  ? 828  PHE A CA    1 
ATOM   6306  C  C     . PHE A 1 827  ? -4.125  -72.698  8.943   1.00 3.14  ? 828  PHE A C     1 
ATOM   6307  O  O     . PHE A 1 827  ? -3.582  -72.298  9.976   1.00 3.12  ? 828  PHE A O     1 
ATOM   6308  C  CB    . PHE A 1 827  ? -4.809  -70.557  8.033   1.00 3.67  ? 828  PHE A CB    1 
ATOM   6309  C  CG    . PHE A 1 827  ? -5.182  -69.684  6.861   1.00 3.74  ? 828  PHE A CG    1 
ATOM   6310  C  CD1   . PHE A 1 827  ? -4.215  -69.156  6.018   1.00 4.10  ? 828  PHE A CD1   1 
ATOM   6311  C  CD2   . PHE A 1 827  ? -6.501  -69.285  6.679   1.00 3.11  ? 828  PHE A CD2   1 
ATOM   6312  C  CE1   . PHE A 1 827  ? -4.557  -68.239  5.019   1.00 3.94  ? 828  PHE A CE1   1 
ATOM   6313  C  CE2   . PHE A 1 827  ? -6.844  -68.367  5.680   1.00 3.44  ? 828  PHE A CE2   1 
ATOM   6314  C  CZ    . PHE A 1 827  ? -5.883  -67.845  4.855   1.00 3.37  ? 828  PHE A CZ    1 
ATOM   6315  N  N     . GLY A 1 828  ? -4.785  -73.838  8.888   1.00 3.02  ? 829  GLY A N     1 
ATOM   6316  C  CA    . GLY A 1 828  ? -4.900  -74.697  10.050  1.00 3.03  ? 829  GLY A CA    1 
ATOM   6317  C  C     . GLY A 1 828  ? -3.750  -74.784  11.029  1.00 3.33  ? 829  GLY A C     1 
ATOM   6318  O  O     . GLY A 1 828  ? -3.924  -74.535  12.218  1.00 3.68  ? 829  GLY A O     1 
ATOM   6319  N  N     . GLU A 1 829  ? -2.561  -75.076  10.512  1.00 3.75  ? 830  GLU A N     1 
ATOM   6320  C  CA    . GLU A 1 829  ? -1.346  -75.269  11.313  1.00 3.48  ? 830  GLU A CA    1 
ATOM   6321  C  C     . GLU A 1 829  ? -0.888  -74.131  12.185  1.00 2.80  ? 830  GLU A C     1 
ATOM   6322  O  O     . GLU A 1 829  ? -0.072  -74.311  13.085  1.00 2.39  ? 830  GLU A O     1 
ATOM   6323  C  CB    . GLU A 1 829  ? -0.188  -75.705  10.422  1.00 3.87  ? 830  GLU A CB    1 
ATOM   6324  C  CG    . GLU A 1 829  ? 0.447   -74.595  9.585   1.00 6.19  ? 830  GLU A CG    1 
ATOM   6325  C  CD    . GLU A 1 829  ? -0.297  -74.266  8.300   1.00 7.64  ? 830  GLU A CD    1 
ATOM   6326  O  OE1   . GLU A 1 829  ? -1.367  -74.863  8.038   1.00 8.17  ? 830  GLU A OE1   1 
ATOM   6327  O  OE2   . GLU A 1 829  ? 0.195   -73.388  7.543   1.00 8.59  ? 830  GLU A OE2   1 
ATOM   6328  N  N     . ARG A 1 830  ? -1.374  -72.940  11.904  1.00 2.64  ? 831  ARG A N     1 
ATOM   6329  C  CA    . ARG A 1 830  ? -0.959  -71.843  12.715  1.00 2.97  ? 831  ARG A CA    1 
ATOM   6330  C  C     . ARG A 1 830  ? -2.080  -70.905  13.071  1.00 3.61  ? 831  ARG A C     1 
ATOM   6331  O  O     . ARG A 1 830  ? -1.836  -69.723  13.152  1.00 4.54  ? 831  ARG A O     1 
ATOM   6332  C  CB    . ARG A 1 830  ? 0.135   -71.072  12.013  1.00 2.55  ? 831  ARG A CB    1 
ATOM   6333  C  CG    . ARG A 1 830  ? -0.326  -70.450  10.723  1.00 2.46  ? 831  ARG A CG    1 
ATOM   6334  C  CD    . ARG A 1 830  ? 0.760   -69.610  10.069  1.00 2.00  ? 831  ARG A CD    1 
ATOM   6335  N  NE    . ARG A 1 830  ? 0.323   -69.187  8.753   1.00 2.41  ? 831  ARG A NE    1 
ATOM   6336  C  CZ    . ARG A 1 830  ? -0.051  -67.951  8.428   1.00 3.05  ? 831  ARG A CZ    1 
ATOM   6337  N  NH1   . ARG A 1 830  ? -0.026  -66.948  9.304   1.00 3.04  ? 831  ARG A NH1   1 
ATOM   6338  N  NH2   . ARG A 1 830  ? -0.578  -67.752  7.234   1.00 3.77  ? 831  ARG A NH2   1 
ATOM   6339  N  N     . MET A 1 831  ? -3.279  -71.393  13.381  1.00 3.85  ? 832  MET A N     1 
ATOM   6340  C  CA    . MET A 1 831  ? -4.343  -70.446  13.705  1.00 3.58  ? 832  MET A CA    1 
ATOM   6341  C  C     . MET A 1 831  ? -4.964  -70.485  15.080  1.00 3.57  ? 832  MET A C     1 
ATOM   6342  O  O     . MET A 1 831  ? -4.964  -71.516  15.769  1.00 4.11  ? 832  MET A O     1 
ATOM   6343  C  CB    . MET A 1 831  ? -5.439  -70.410  12.623  1.00 3.51  ? 832  MET A CB    1 
ATOM   6344  C  CG    . MET A 1 831  ? -6.200  -71.690  12.364  1.00 3.21  ? 832  MET A CG    1 
ATOM   6345  S  SD    . MET A 1 831  ? -7.348  -71.498  10.942  1.00 5.02  ? 832  MET A SD    1 
ATOM   6346  C  CE    . MET A 1 831  ? -8.838  -70.682  11.649  1.00 2.12  ? 832  MET A CE    1 
ATOM   6347  N  N     . PHE A 1 832  ? -5.415  -69.311  15.495  1.00 2.47  ? 833  PHE A N     1 
ATOM   6348  C  CA    . PHE A 1 832  ? -6.076  -69.136  16.759  1.00 2.43  ? 833  PHE A CA    1 
ATOM   6349  C  C     . PHE A 1 832  ? -7.508  -68.924  16.347  1.00 3.00  ? 833  PHE A C     1 
ATOM   6350  O  O     . PHE A 1 832  ? -7.787  -68.197  15.386  1.00 3.58  ? 833  PHE A O     1 
ATOM   6351  C  CB    . PHE A 1 832  ? -5.592  -67.857  17.444  1.00 2.36  ? 833  PHE A CB    1 
ATOM   6352  C  CG    . PHE A 1 832  ? -4.361  -68.037  18.248  1.00 2.00  ? 833  PHE A CG    1 
ATOM   6353  C  CD1   . PHE A 1 832  ? -3.117  -67.934  17.661  1.00 2.00  ? 833  PHE A CD1   1 
ATOM   6354  C  CD2   . PHE A 1 832  ? -4.450  -68.376  19.567  1.00 2.00  ? 833  PHE A CD2   1 
ATOM   6355  C  CE1   . PHE A 1 832  ? -1.983  -68.178  18.383  1.00 2.00  ? 833  PHE A CE1   1 
ATOM   6356  C  CE2   . PHE A 1 832  ? -3.323  -68.623  20.306  1.00 2.00  ? 833  PHE A CE2   1 
ATOM   6357  C  CZ    . PHE A 1 832  ? -2.088  -68.528  19.716  1.00 2.00  ? 833  PHE A CZ    1 
ATOM   6358  N  N     . ILE A 1 833  ? -8.430  -69.577  17.037  1.00 2.84  ? 834  ILE A N     1 
ATOM   6359  C  CA    . ILE A 1 833  ? -9.824  -69.384  16.723  1.00 2.09  ? 834  ILE A CA    1 
ATOM   6360  C  C     . ILE A 1 833  ? -10.546 -68.962  17.983  1.00 2.15  ? 834  ILE A C     1 
ATOM   6361  O  O     . ILE A 1 833  ? -10.495 -69.660  18.997  1.00 2.30  ? 834  ILE A O     1 
ATOM   6362  C  CB    . ILE A 1 833  ? -10.468 -70.667  16.145  1.00 2.00  ? 834  ILE A CB    1 
ATOM   6363  C  CG1   . ILE A 1 833  ? -9.835  -71.009  14.799  1.00 2.18  ? 834  ILE A CG1   1 
ATOM   6364  C  CG2   . ILE A 1 833  ? -11.954 -70.472  15.901  1.00 2.00  ? 834  ILE A CG2   1 
ATOM   6365  C  CD1   . ILE A 1 833  ? -10.619 -72.017  14.013  1.00 2.00  ? 834  ILE A CD1   1 
ATOM   6366  N  N     . ALA A 1 834  ? -11.081 -67.744  17.959  1.00 2.63  ? 835  ALA A N     1 
ATOM   6367  C  CA    . ALA A 1 834  ? -11.903 -67.200  19.055  1.00 2.96  ? 835  ALA A CA    1 
ATOM   6368  C  C     . ALA A 1 834  ? -13.353 -67.261  18.521  1.00 3.11  ? 835  ALA A C     1 
ATOM   6369  O  O     . ALA A 1 834  ? -13.823 -66.410  17.749  1.00 2.79  ? 835  ALA A O     1 
ATOM   6370  C  CB    . ALA A 1 834  ? -11.510 -65.761  19.380  1.00 3.37  ? 835  ALA A CB    1 
ATOM   6371  N  N     . ASN A 1 835  ? -14.034 -68.321  18.907  1.00 3.58  ? 836  ASN A N     1 
ATOM   6372  C  CA    . ASN A 1 835  ? -15.385 -68.580  18.466  1.00 4.33  ? 836  ASN A CA    1 
ATOM   6373  C  C     . ASN A 1 835  ? -16.517 -68.011  19.326  1.00 5.42  ? 836  ASN A C     1 
ATOM   6374  O  O     . ASN A 1 835  ? -16.685 -68.386  20.509  1.00 6.16  ? 836  ASN A O     1 
ATOM   6375  C  CB    . ASN A 1 835  ? -15.545 -70.082  18.321  1.00 3.45  ? 836  ASN A CB    1 
ATOM   6376  C  CG    . ASN A 1 835  ? -16.239 -70.437  17.092  1.00 2.89  ? 836  ASN A CG    1 
ATOM   6377  O  OD1   . ASN A 1 835  ? -17.259 -69.845  16.798  1.00 3.45  ? 836  ASN A OD1   1 
ATOM   6378  N  ND2   . ASN A 1 835  ? -15.658 -71.334  16.293  1.00 2.41  ? 836  ASN A ND2   1 
ATOM   6379  N  N     . ALA A 1 836  ? -17.280 -67.095  18.723  1.00 5.70  ? 837  ALA A N     1 
ATOM   6380  C  CA    . ALA A 1 836  ? -18.429 -66.463  19.358  1.00 6.10  ? 837  ALA A CA    1 
ATOM   6381  C  C     . ALA A 1 836  ? -19.399 -67.578  19.549  1.00 6.70  ? 837  ALA A C     1 
ATOM   6382  O  O     . ALA A 1 836  ? -19.395 -68.545  18.790  1.00 6.56  ? 837  ALA A O     1 
ATOM   6383  C  CB    . ALA A 1 836  ? -19.049 -65.444  18.433  1.00 6.29  ? 837  ALA A CB    1 
ATOM   6384  N  N     . THR A 1 837  ? -20.248 -67.458  20.553  1.00 7.83  ? 838  THR A N     1 
ATOM   6385  C  CA    . THR A 1 837  ? -21.211 -68.515  20.778  1.00 8.13  ? 838  THR A CA    1 
ATOM   6386  C  C     . THR A 1 837  ? -22.200 -68.510  19.621  1.00 8.09  ? 838  THR A C     1 
ATOM   6387  O  O     . THR A 1 837  ? -22.373 -67.500  18.936  1.00 6.66  ? 838  THR A O     1 
ATOM   6388  C  CB    . THR A 1 837  ? -21.932 -68.390  22.117  1.00 8.24  ? 838  THR A CB    1 
ATOM   6389  O  OG1   . THR A 1 837  ? -21.016 -67.915  23.117  1.00 9.42  ? 838  THR A OG1   1 
ATOM   6390  C  CG2   . THR A 1 837  ? -22.426 -69.771  22.540  1.00 8.84  ? 838  THR A CG2   1 
ATOM   6391  N  N     . GLY A 1 838  ? -22.808 -69.672  19.402  1.00 8.74  ? 839  GLY A N     1 
ATOM   6392  C  CA    . GLY A 1 838  ? -23.742 -69.874  18.314  1.00 8.98  ? 839  GLY A CA    1 
ATOM   6393  C  C     . GLY A 1 838  ? -23.463 -71.247  17.734  1.00 9.83  ? 839  GLY A C     1 
ATOM   6394  O  O     . GLY A 1 838  ? -22.660 -72.003  18.288  1.00 10.24 ? 839  GLY A O     1 
ATOM   6395  N  N     . CYS A 1 839  ? -24.099 -71.574  16.614  1.00 10.75 ? 840  CYS A N     1 
ATOM   6396  C  CA    . CYS A 1 839  ? -23.888 -72.876  15.992  1.00 11.25 ? 840  CYS A CA    1 
ATOM   6397  C  C     . CYS A 1 839  ? -22.428 -73.201  15.844  1.00 11.71 ? 840  CYS A C     1 
ATOM   6398  O  O     . CYS A 1 839  ? -22.064 -74.363  15.939  1.00 12.19 ? 840  CYS A O     1 
ATOM   6399  C  CB    . CYS A 1 839  ? -24.553 -72.966  14.631  1.00 11.19 ? 840  CYS A CB    1 
ATOM   6400  S  SG    . CYS A 1 839  ? -26.349 -73.246  14.692  1.00 11.63 ? 840  CYS A SG    1 
ATOM   6401  N  N     . SER A 1 840  ? -21.593 -72.170  15.686  1.00 11.95 ? 841  SER A N     1 
ATOM   6402  C  CA    . SER A 1 840  ? -20.154 -72.345  15.521  1.00 11.82 ? 841  SER A CA    1 
ATOM   6403  C  C     . SER A 1 840  ? -19.597 -73.087  16.703  1.00 12.27 ? 841  SER A C     1 
ATOM   6404  O  O     . SER A 1 840  ? -18.907 -74.103  16.551  1.00 12.37 ? 841  SER A O     1 
ATOM   6405  C  CB    . SER A 1 840  ? -19.462 -71.002  15.465  1.00 11.45 ? 841  SER A CB    1 
ATOM   6406  O  OG    . SER A 1 840  ? -20.060 -70.159  14.523  1.00 11.87 ? 841  SER A OG    1 
ATOM   6407  N  N     . SER A 1 841  ? -19.875 -72.570  17.893  1.00 12.29 ? 842  SER A N     1 
ATOM   6408  C  CA    . SER A 1 841  ? -19.362 -73.213  19.084  1.00 12.72 ? 842  SER A CA    1 
ATOM   6409  C  C     . SER A 1 841  ? -20.111 -74.494  19.411  1.00 13.01 ? 842  SER A C     1 
ATOM   6410  O  O     . SER A 1 841  ? -19.510 -75.463  19.905  1.00 13.57 ? 842  SER A O     1 
ATOM   6411  C  CB    . SER A 1 841  ? -19.400 -72.246  20.256  1.00 12.61 ? 842  SER A CB    1 
ATOM   6412  O  OG    . SER A 1 841  ? -20.613 -71.533  20.245  1.00 12.21 ? 842  SER A OG    1 
ATOM   6413  N  N     . ILE A 1 842  ? -21.406 -74.527  19.095  1.00 12.55 ? 843  ILE A N     1 
ATOM   6414  C  CA    . ILE A 1 842  ? -22.213 -75.703  19.381  1.00 11.80 ? 843  ILE A CA    1 
ATOM   6415  C  C     . ILE A 1 842  ? -21.770 -76.853  18.523  1.00 11.28 ? 843  ILE A C     1 
ATOM   6416  O  O     . ILE A 1 842  ? -21.612 -77.958  19.027  1.00 12.08 ? 843  ILE A O     1 
ATOM   6417  C  CB    . ILE A 1 842  ? -23.697 -75.476  19.162  1.00 12.26 ? 843  ILE A CB    1 
ATOM   6418  C  CG1   . ILE A 1 842  ? -24.218 -74.381  20.098  1.00 12.68 ? 843  ILE A CG1   1 
ATOM   6419  C  CG2   . ILE A 1 842  ? -24.450 -76.757  19.448  1.00 12.77 ? 843  ILE A CG2   1 
ATOM   6420  C  CD1   . ILE A 1 842  ? -24.259 -74.774  21.580  1.00 13.39 ? 843  ILE A CD1   1 
ATOM   6421  N  N     . TRP A 1 843  ? -21.583 -76.625  17.227  1.00 10.18 ? 844  TRP A N     1 
ATOM   6422  C  CA    . TRP A 1 843  ? -21.122 -77.726  16.395  1.00 9.56  ? 844  TRP A CA    1 
ATOM   6423  C  C     . TRP A 1 843  ? -19.625 -77.912  16.516  1.00 9.58  ? 844  TRP A C     1 
ATOM   6424  O  O     . TRP A 1 843  ? -19.123 -79.032  16.445  1.00 10.17 ? 844  TRP A O     1 
ATOM   6425  C  CB    . TRP A 1 843  ? -21.567 -77.644  14.913  1.00 8.60  ? 844  TRP A CB    1 
ATOM   6426  C  CG    . TRP A 1 843  ? -21.179 -76.455  14.047  1.00 7.48  ? 844  TRP A CG    1 
ATOM   6427  C  CD1   . TRP A 1 843  ? -22.039 -75.560  13.498  1.00 7.22  ? 844  TRP A CD1   1 
ATOM   6428  C  CD2   . TRP A 1 843  ? -19.857 -76.078  13.579  1.00 7.00  ? 844  TRP A CD2   1 
ATOM   6429  N  NE1   . TRP A 1 843  ? -21.356 -74.648  12.728  1.00 7.35  ? 844  TRP A NE1   1 
ATOM   6430  C  CE2   . TRP A 1 843  ? -20.018 -74.936  12.762  1.00 7.14  ? 844  TRP A CE2   1 
ATOM   6431  C  CE3   . TRP A 1 843  ? -18.562 -76.589  13.770  1.00 6.72  ? 844  TRP A CE3   1 
ATOM   6432  C  CZ2   . TRP A 1 843  ? -18.929 -74.284  12.139  1.00 6.82  ? 844  TRP A CZ2   1 
ATOM   6433  C  CZ3   . TRP A 1 843  ? -17.476 -75.942  13.147  1.00 6.18  ? 844  TRP A CZ3   1 
ATOM   6434  C  CH2   . TRP A 1 843  ? -17.674 -74.800  12.344  1.00 6.28  ? 844  TRP A CH2   1 
ATOM   6435  N  N     . GLY A 1 844  ? -18.924 -76.819  16.793  1.00 9.51  ? 845  GLY A N     1 
ATOM   6436  C  CA    . GLY A 1 844  ? -17.483 -76.870  16.900  1.00 8.68  ? 845  GLY A CA    1 
ATOM   6437  C  C     . GLY A 1 844  ? -16.913 -77.316  18.224  1.00 8.26  ? 845  GLY A C     1 
ATOM   6438  O  O     . GLY A 1 844  ? -15.724 -77.619  18.259  1.00 8.88  ? 845  GLY A O     1 
ATOM   6439  N  N     . ALA A 1 845  ? -17.717 -77.421  19.284  1.00 7.49  ? 846  ALA A N     1 
ATOM   6440  C  CA    . ALA A 1 845  ? -17.153 -77.801  20.582  1.00 7.26  ? 846  ALA A CA    1 
ATOM   6441  C  C     . ALA A 1 845  ? -18.084 -78.379  21.655  1.00 7.45  ? 846  ALA A C     1 
ATOM   6442  O  O     . ALA A 1 845  ? -17.938 -78.083  22.838  1.00 7.24  ? 846  ALA A O     1 
ATOM   6443  C  CB    . ALA A 1 845  ? -16.386 -76.618  21.152  1.00 6.72  ? 846  ALA A CB    1 
ATOM   6444  N  N     . SER A 1 846  ? -18.994 -79.256  21.259  1.00 7.51  ? 847  SER A N     1 
ATOM   6445  C  CA    . SER A 1 846  ? -19.911 -79.851  22.215  1.00 7.42  ? 847  SER A CA    1 
ATOM   6446  C  C     . SER A 1 846  ? -19.284 -81.089  22.869  1.00 8.07  ? 847  SER A C     1 
ATOM   6447  O  O     . SER A 1 846  ? -19.265 -82.164  22.243  1.00 8.88  ? 847  SER A O     1 
ATOM   6448  C  CB    . SER A 1 846  ? -21.193 -80.232  21.488  1.00 7.06  ? 847  SER A CB    1 
ATOM   6449  O  OG    . SER A 1 846  ? -22.044 -79.116  21.310  1.00 6.72  ? 847  SER A OG    1 
ATOM   6450  N  N     . ALA A 1 847  ? -18.775 -80.957  24.104  1.00 7.61  ? 848  ALA A N     1 
ATOM   6451  C  CA    . ALA A 1 847  ? -18.142 -82.090  24.799  1.00 7.33  ? 848  ALA A CA    1 
ATOM   6452  C  C     . ALA A 1 847  ? -19.124 -83.228  24.723  1.00 7.84  ? 848  ALA A C     1 
ATOM   6453  O  O     . ALA A 1 847  ? -20.326 -82.989  24.815  1.00 7.50  ? 848  ALA A O     1 
ATOM   6454  C  CB    . ALA A 1 847  ? -17.844 -81.754  26.260  1.00 6.86  ? 848  ALA A CB    1 
ATOM   6455  N  N     . PRO A 1 848  ? -18.640 -84.474  24.524  1.00 8.25  ? 849  PRO A N     1 
ATOM   6456  C  CA    . PRO A 1 848  ? -17.234 -84.851  24.375  1.00 8.67  ? 849  PRO A CA    1 
ATOM   6457  C  C     . PRO A 1 848  ? -16.658 -84.751  22.950  1.00 9.18  ? 849  PRO A C     1 
ATOM   6458  O  O     . PRO A 1 848  ? -15.437 -84.705  22.759  1.00 9.79  ? 849  PRO A O     1 
ATOM   6459  C  CB    . PRO A 1 848  ? -17.254 -86.301  24.837  1.00 7.94  ? 849  PRO A CB    1 
ATOM   6460  C  CG    . PRO A 1 848  ? -18.496 -86.787  24.217  1.00 7.32  ? 849  PRO A CG    1 
ATOM   6461  C  CD    . PRO A 1 848  ? -19.481 -85.686  24.544  1.00 7.86  ? 849  PRO A CD    1 
ATOM   6462  N  N     . SER A 1 849  ? -17.537 -84.733  21.958  1.00 9.35  ? 850  SER A N     1 
ATOM   6463  C  CA    . SER A 1 849  ? -17.141 -84.703  20.548  1.00 9.09  ? 850  SER A CA    1 
ATOM   6464  C  C     . SER A 1 849  ? -16.639 -83.359  20.013  1.00 9.16  ? 850  SER A C     1 
ATOM   6465  O  O     . SER A 1 849  ? -17.391 -82.380  19.999  1.00 9.59  ? 850  SER A O     1 
ATOM   6466  C  CB    . SER A 1 849  ? -18.327 -85.188  19.731  1.00 8.66  ? 850  SER A CB    1 
ATOM   6467  O  OG    . SER A 1 849  ? -18.164 -84.908  18.370  1.00 8.51  ? 850  SER A OG    1 
ATOM   6468  N  N     . MET A 1 850  ? -15.391 -83.337  19.527  1.00 9.09  ? 851  MET A N     1 
ATOM   6469  C  CA    . MET A 1 850  ? -14.739 -82.114  18.983  1.00 8.89  ? 851  MET A CA    1 
ATOM   6470  C  C     . MET A 1 850  ? -14.285 -82.314  17.531  1.00 8.91  ? 851  MET A C     1 
ATOM   6471  O  O     . MET A 1 850  ? -13.302 -83.037  17.291  1.00 8.57  ? 851  MET A O     1 
ATOM   6472  C  CB    . MET A 1 850  ? -13.485 -81.797  19.770  1.00 8.50  ? 851  MET A CB    1 
ATOM   6473  C  CG    . MET A 1 850  ? -13.535 -82.191  21.193  1.00 8.53  ? 851  MET A CG    1 
ATOM   6474  S  SD    . MET A 1 850  ? -14.000 -80.780  22.071  1.00 9.33  ? 851  MET A SD    1 
ATOM   6475  C  CE    . MET A 1 850  ? -15.764 -81.147  22.450  1.00 9.97  ? 851  MET A CE    1 
ATOM   6476  N  N     . PRO A 1 851  ? -14.898 -81.583  16.566  1.00 8.59  ? 852  PRO A N     1 
ATOM   6477  C  CA    . PRO A 1 851  ? -14.521 -81.730  15.153  1.00 8.42  ? 852  PRO A CA    1 
ATOM   6478  C  C     . PRO A 1 851  ? -13.057 -81.436  14.800  1.00 8.81  ? 852  PRO A C     1 
ATOM   6479  O  O     . PRO A 1 851  ? -12.382 -82.323  14.252  1.00 8.86  ? 852  PRO A O     1 
ATOM   6480  C  CB    . PRO A 1 851  ? -15.492 -80.785  14.430  1.00 7.49  ? 852  PRO A CB    1 
ATOM   6481  C  CG    . PRO A 1 851  ? -15.814 -79.757  15.437  1.00 7.11  ? 852  PRO A CG    1 
ATOM   6482  C  CD    . PRO A 1 851  ? -15.940 -80.548  16.720  1.00 7.90  ? 852  PRO A CD    1 
ATOM   6483  N  N     . TYR A 1 852  ? -12.567 -80.252  15.199  1.00 8.58  ? 853  TYR A N     1 
ATOM   6484  C  CA    . TYR A 1 852  ? -11.215 -79.785  14.897  1.00 8.26  ? 853  TYR A CA    1 
ATOM   6485  C  C     . TYR A 1 852  ? -10.124 -80.732  15.280  1.00 8.95  ? 853  TYR A C     1 
ATOM   6486  O  O     . TYR A 1 852  ? -10.066 -81.175  16.424  1.00 8.72  ? 853  TYR A O     1 
ATOM   6487  C  CB    . TYR A 1 852  ? -10.905 -78.494  15.620  1.00 7.88  ? 853  TYR A CB    1 
ATOM   6488  C  CG    . TYR A 1 852  ? -11.709 -77.292  15.202  1.00 7.67  ? 853  TYR A CG    1 
ATOM   6489  C  CD1   . TYR A 1 852  ? -11.383 -76.561  14.064  1.00 7.11  ? 853  TYR A CD1   1 
ATOM   6490  C  CD2   . TYR A 1 852  ? -12.795 -76.875  15.957  1.00 7.73  ? 853  TYR A CD2   1 
ATOM   6491  C  CE1   . TYR A 1 852  ? -12.120 -75.447  13.689  1.00 6.41  ? 853  TYR A CE1   1 
ATOM   6492  C  CE2   . TYR A 1 852  ? -13.529 -75.777  15.587  1.00 7.47  ? 853  TYR A CE2   1 
ATOM   6493  C  CZ    . TYR A 1 852  ? -13.190 -75.061  14.449  1.00 7.01  ? 853  TYR A CZ    1 
ATOM   6494  O  OH    . TYR A 1 852  ? -13.950 -73.962  14.098  1.00 7.89  ? 853  TYR A OH    1 
ATOM   6495  N  N     . LYS A 1 853  ? -9.242  -81.039  14.333  1.00 9.76  ? 854  LYS A N     1 
ATOM   6496  C  CA    . LYS A 1 853  ? -8.108  -81.900  14.638  1.00 10.61 ? 854  LYS A CA    1 
ATOM   6497  C  C     . LYS A 1 853  ? -6.771  -81.308  14.223  1.00 10.36 ? 854  LYS A C     1 
ATOM   6498  O  O     . LYS A 1 853  ? -6.708  -80.298  13.519  1.00 9.98  ? 854  LYS A O     1 
ATOM   6499  C  CB    . LYS A 1 853  ? -8.252  -83.306  14.054  1.00 11.65 ? 854  LYS A CB    1 
ATOM   6500  C  CG    . LYS A 1 853  ? -9.215  -83.459  12.899  1.00 13.67 ? 854  LYS A CG    1 
ATOM   6501  C  CD    . LYS A 1 853  ? -8.616  -84.346  11.826  1.00 14.26 ? 854  LYS A CD    1 
ATOM   6502  C  CE    . LYS A 1 853  ? -7.450  -83.606  11.218  1.00 16.19 ? 854  LYS A CE    1 
ATOM   6503  N  NZ    . LYS A 1 853  ? -7.639  -82.112  11.423  1.00 16.63 ? 854  LYS A NZ    1 
ATOM   6504  N  N     . THR A 1 854  ? -5.712  -81.968  14.680  1.00 9.93  ? 855  THR A N     1 
ATOM   6505  C  CA    . THR A 1 854  ? -4.338  -81.586  14.409  1.00 9.97  ? 855  THR A CA    1 
ATOM   6506  C  C     . THR A 1 854  ? -3.908  -82.212  13.080  1.00 9.71  ? 855  THR A C     1 
ATOM   6507  O  O     . THR A 1 854  ? -4.629  -83.021  12.526  1.00 9.58  ? 855  THR A O     1 
ATOM   6508  C  CB    . THR A 1 854  ? -3.428  -82.100  15.537  1.00 10.36 ? 855  THR A CB    1 
ATOM   6509  O  OG1   . THR A 1 854  ? -3.107  -83.474  15.310  1.00 10.91 ? 855  THR A OG1   1 
ATOM   6510  C  CG2   . THR A 1 854  ? -4.142  -82.014  16.869  1.00 10.26 ? 855  THR A CG2   1 
ATOM   6511  N  N     . ASN A 1 855  ? -2.743  -81.866  12.556  1.00 9.69  ? 856  ASN A N     1 
ATOM   6512  C  CA    . ASN A 1 855  ? -2.349  -82.470  11.295  1.00 10.10 ? 856  ASN A CA    1 
ATOM   6513  C  C     . ASN A 1 855  ? -1.407  -83.604  11.555  1.00 10.63 ? 856  ASN A C     1 
ATOM   6514  O  O     . ASN A 1 855  ? -1.212  -83.984  12.702  1.00 10.85 ? 856  ASN A O     1 
ATOM   6515  C  CB    . ASN A 1 855  ? -1.722  -81.456  10.339  1.00 9.70  ? 856  ASN A CB    1 
ATOM   6516  C  CG    . ASN A 1 855  ? -0.562  -80.738  10.939  1.00 8.94  ? 856  ASN A CG    1 
ATOM   6517  O  OD1   . ASN A 1 855  ? 0.124   -81.270  11.817  1.00 7.93  ? 856  ASN A OD1   1 
ATOM   6518  N  ND2   . ASN A 1 855  ? -0.353  -79.496  10.501  1.00 7.79  ? 856  ASN A ND2   1 
ATOM   6519  N  N     . ARG A 1 856  ? -0.854  -84.178  10.491  1.00 11.32 ? 857  ARG A N     1 
ATOM   6520  C  CA    . ARG A 1 856  ? 0.091   -85.276  10.648  1.00 12.21 ? 857  ARG A CA    1 
ATOM   6521  C  C     . ARG A 1 856  ? 1.152   -84.905  11.679  1.00 11.85 ? 857  ARG A C     1 
ATOM   6522  O  O     . ARG A 1 856  ? 1.594   -85.765  12.429  1.00 12.39 ? 857  ARG A O     1 
ATOM   6523  C  CB    . ARG A 1 856  ? 0.761   -85.654  9.308   1.00 13.37 ? 857  ARG A CB    1 
ATOM   6524  C  CG    . ARG A 1 856  ? 1.588   -84.547  8.616   1.00 15.95 ? 857  ARG A CG    1 
ATOM   6525  C  CD    . ARG A 1 856  ? 2.130   -85.012  7.244   1.00 18.14 ? 857  ARG A CD    1 
ATOM   6526  N  NE    . ARG A 1 856  ? 1.707   -84.182  6.096   1.00 19.04 ? 857  ARG A NE    1 
ATOM   6527  C  CZ    . ARG A 1 856  ? 0.893   -84.583  5.106   1.00 19.36 ? 857  ARG A CZ    1 
ATOM   6528  N  NH1   . ARG A 1 856  ? 0.360   -85.813  5.087   1.00 19.06 ? 857  ARG A NH1   1 
ATOM   6529  N  NH2   . ARG A 1 856  ? 0.664   -83.768  4.079   1.00 19.63 ? 857  ARG A NH2   1 
ATOM   6530  N  N     . LEU A 1 857  ? 1.463   -83.608  11.778  1.00 11.21 ? 858  LEU A N     1 
ATOM   6531  C  CA    . LEU A 1 857  ? 2.486   -83.088  12.684  1.00 9.76  ? 858  LEU A CA    1 
ATOM   6532  C  C     . LEU A 1 857  ? 2.068   -82.662  14.074  1.00 9.15  ? 858  LEU A C     1 
ATOM   6533  O  O     . LEU A 1 857  ? 2.863   -82.059  14.775  1.00 10.20 ? 858  LEU A O     1 
ATOM   6534  C  CB    . LEU A 1 857  ? 3.232   -81.927  12.027  1.00 9.97  ? 858  LEU A CB    1 
ATOM   6535  C  CG    . LEU A 1 857  ? 4.494   -82.204  11.210  1.00 9.37  ? 858  LEU A CG    1 
ATOM   6536  C  CD1   . LEU A 1 857  ? 4.431   -83.580  10.591  1.00 10.29 ? 858  LEU A CD1   1 
ATOM   6537  C  CD2   . LEU A 1 857  ? 4.653   -81.144  10.142  1.00 9.17  ? 858  LEU A CD2   1 
ATOM   6538  N  N     . GLY A 1 858  ? 0.820   -82.894  14.460  1.00 8.32  ? 859  GLY A N     1 
ATOM   6539  C  CA    . GLY A 1 858  ? 0.396   -82.542  15.811  1.00 6.98  ? 859  GLY A CA    1 
ATOM   6540  C  C     . GLY A 1 858  ? 0.000   -81.111  16.085  1.00 6.11  ? 859  GLY A C     1 
ATOM   6541  O  O     . GLY A 1 858  ? -0.203  -80.704  17.234  1.00 5.57  ? 859  GLY A O     1 
ATOM   6542  N  N     . GLN A 1 859  ? -0.135  -80.350  15.019  1.00 5.48  ? 860  GLN A N     1 
ATOM   6543  C  CA    . GLN A 1 859  ? -0.518  -78.973  15.140  1.00 5.11  ? 860  GLN A CA    1 
ATOM   6544  C  C     . GLN A 1 859  ? -1.841  -78.758  14.457  1.00 4.61  ? 860  GLN A C     1 
ATOM   6545  O  O     . GLN A 1 859  ? -2.152  -79.419  13.490  1.00 4.85  ? 860  GLN A O     1 
ATOM   6546  C  CB    . GLN A 1 859  ? 0.535   -78.111  14.501  1.00 5.51  ? 860  GLN A CB    1 
ATOM   6547  C  CG    . GLN A 1 859  ? 0.858   -78.525  13.107  1.00 6.31  ? 860  GLN A CG    1 
ATOM   6548  C  CD    . GLN A 1 859  ? 2.195   -77.994  12.676  1.00 6.57  ? 860  GLN A CD    1 
ATOM   6549  O  OE1   . GLN A 1 859  ? 2.950   -77.490  13.501  1.00 6.98  ? 860  GLN A OE1   1 
ATOM   6550  N  NE2   . GLN A 1 859  ? 2.502   -78.096  11.384  1.00 6.44  ? 860  GLN A NE2   1 
ATOM   6551  N  N     . GLY A 1 860  ? -2.617  -77.822  14.971  1.00 4.06  ? 861  GLY A N     1 
ATOM   6552  C  CA    . GLY A 1 860  ? -3.906  -77.522  14.395  1.00 4.18  ? 861  GLY A CA    1 
ATOM   6553  C  C     . GLY A 1 860  ? -4.452  -76.300  15.102  1.00 4.16  ? 861  GLY A C     1 
ATOM   6554  O  O     . GLY A 1 860  ? -3.788  -75.802  16.017  1.00 4.23  ? 861  GLY A O     1 
ATOM   6555  N  N     . PRO A 1 861  ? -5.688  -75.858  14.779  1.00 4.08  ? 862  PRO A N     1 
ATOM   6556  C  CA    . PRO A 1 861  ? -6.378  -74.692  15.348  1.00 4.20  ? 862  PRO A CA    1 
ATOM   6557  C  C     . PRO A 1 861  ? -6.512  -74.687  16.879  1.00 4.33  ? 862  PRO A C     1 
ATOM   6558  O  O     . PRO A 1 861  ? -7.098  -75.623  17.426  1.00 5.48  ? 862  PRO A O     1 
ATOM   6559  C  CB    . PRO A 1 861  ? -7.777  -74.777  14.705  1.00 4.06  ? 862  PRO A CB    1 
ATOM   6560  C  CG    . PRO A 1 861  ? -7.560  -75.501  13.452  1.00 3.55  ? 862  PRO A CG    1 
ATOM   6561  C  CD    . PRO A 1 861  ? -6.593  -76.581  13.861  1.00 3.40  ? 862  PRO A CD    1 
ATOM   6562  N  N     . ALA A 1 862  ? -5.959  -73.674  17.562  1.00 3.71  ? 863  ALA A N     1 
ATOM   6563  C  CA    . ALA A 1 862  ? -6.081  -73.543  19.022  1.00 2.89  ? 863  ALA A CA    1 
ATOM   6564  C  C     . ALA A 1 862  ? -7.478  -72.978  19.163  1.00 3.21  ? 863  ALA A C     1 
ATOM   6565  O  O     . ALA A 1 862  ? -7.738  -71.824  18.800  1.00 3.75  ? 863  ALA A O     1 
ATOM   6566  C  CB    . ALA A 1 862  ? -5.099  -72.582  19.533  1.00 2.66  ? 863  ALA A CB    1 
ATOM   6567  N  N     . TRP A 1 863  ? -8.377  -73.774  19.712  1.00 3.21  ? 864  TRP A N     1 
ATOM   6568  C  CA    . TRP A 1 863  ? -9.764  -73.370  19.770  1.00 3.23  ? 864  TRP A CA    1 
ATOM   6569  C  C     . TRP A 1 863  ? -10.337 -72.985  21.115  1.00 3.67  ? 864  TRP A C     1 
ATOM   6570  O  O     . TRP A 1 863  ? -10.118 -73.670  22.110  1.00 4.24  ? 864  TRP A O     1 
ATOM   6571  C  CB    . TRP A 1 863  ? -10.592 -74.486  19.162  1.00 2.52  ? 864  TRP A CB    1 
ATOM   6572  C  CG    . TRP A 1 863  ? -11.902 -74.053  18.705  1.00 2.29  ? 864  TRP A CG    1 
ATOM   6573  C  CD1   . TRP A 1 863  ? -12.257 -73.807  17.424  1.00 2.00  ? 864  TRP A CD1   1 
ATOM   6574  C  CD2   . TRP A 1 863  ? -13.085 -73.869  19.500  1.00 2.00  ? 864  TRP A CD2   1 
ATOM   6575  N  NE1   . TRP A 1 863  ? -13.589 -73.498  17.362  1.00 2.13  ? 864  TRP A NE1   1 
ATOM   6576  C  CE2   . TRP A 1 863  ? -14.121 -73.528  18.625  1.00 2.08  ? 864  TRP A CE2   1 
ATOM   6577  C  CE3   . TRP A 1 863  ? -13.364 -73.960  20.870  1.00 2.47  ? 864  TRP A CE3   1 
ATOM   6578  C  CZ2   . TRP A 1 863  ? -15.438 -73.286  19.073  1.00 2.41  ? 864  TRP A CZ2   1 
ATOM   6579  C  CZ3   . TRP A 1 863  ? -14.676 -73.714  21.313  1.00 2.02  ? 864  TRP A CZ3   1 
ATOM   6580  C  CH2   . TRP A 1 863  ? -15.687 -73.381  20.416  1.00 2.00  ? 864  TRP A CH2   1 
ATOM   6581  N  N     . GLY A 1 864  ? -11.119 -71.909  21.125  1.00 3.60  ? 865  GLY A N     1 
ATOM   6582  C  CA    . GLY A 1 864  ? -11.721 -71.475  22.362  1.00 3.96  ? 865  GLY A CA    1 
ATOM   6583  C  C     . GLY A 1 864  ? -12.881 -70.523  22.210  1.00 4.65  ? 865  GLY A C     1 
ATOM   6584  O  O     . GLY A 1 864  ? -12.812 -69.562  21.455  1.00 4.62  ? 865  GLY A O     1 
ATOM   6585  N  N     . ASN A 1 865  ? -13.957 -70.823  22.931  1.00 5.38  ? 866  ASN A N     1 
ATOM   6586  C  CA    . ASN A 1 865  ? -15.180 -70.020  22.974  1.00 6.18  ? 866  ASN A CA    1 
ATOM   6587  C  C     . ASN A 1 865  ? -15.083 -69.186  24.269  1.00 7.34  ? 866  ASN A C     1 
ATOM   6588  O  O     . ASN A 1 865  ? -14.911 -69.743  25.364  1.00 6.66  ? 866  ASN A O     1 
ATOM   6589  C  CB    . ASN A 1 865  ? -16.400 -70.975  23.027  1.00 5.30  ? 866  ASN A CB    1 
ATOM   6590  C  CG    . ASN A 1 865  ? -17.734 -70.277  23.381  1.00 4.78  ? 866  ASN A CG    1 
ATOM   6591  O  OD1   . ASN A 1 865  ? -18.067 -69.198  22.879  1.00 4.21  ? 866  ASN A OD1   1 
ATOM   6592  N  ND2   . ASN A 1 865  ? -18.534 -70.957  24.193  1.00 3.89  ? 866  ASN A ND2   1 
ATOM   6593  N  N     . SER A 1 866  ? -15.060 -67.857  24.142  1.00 8.67  ? 867  SER A N     1 
ATOM   6594  C  CA    . SER A 1 866  ? -15.011 -67.045  25.353  1.00 9.37  ? 867  SER A CA    1 
ATOM   6595  C  C     . SER A 1 866  ? -16.456 -66.981  25.758  1.00 9.82  ? 867  SER A C     1 
ATOM   6596  O  O     . SER A 1 866  ? -16.905 -67.778  26.586  1.00 10.39 ? 867  SER A O     1 
ATOM   6597  C  CB    . SER A 1 866  ? -14.480 -65.634  25.100  1.00 10.01 ? 867  SER A CB    1 
ATOM   6598  O  OG    . SER A 1 866  ? -14.500 -64.861  26.300  1.00 9.46  ? 867  SER A OG    1 
ATOM   6599  N  N     . LEU A 1 867  ? -17.193 -66.069  25.126  1.00 9.79  ? 868  LEU A N     1 
ATOM   6600  C  CA    . LEU A 1 867  ? -18.620 -65.908  25.389  1.00 9.74  ? 868  LEU A CA    1 
ATOM   6601  C  C     . LEU A 1 867  ? -19.294 -65.562  24.070  1.00 9.94  ? 868  LEU A C     1 
ATOM   6602  O  O     . LEU A 1 867  ? -18.701 -65.705  22.983  1.00 10.57 ? 868  LEU A O     1 
ATOM   6603  C  CB    . LEU A 1 867  ? -18.872 -64.790  26.400  1.00 9.07  ? 868  LEU A CB    1 
ATOM   6604  C  CG    . LEU A 1 867  ? -18.157 -64.842  27.749  1.00 9.07  ? 868  LEU A CG    1 
ATOM   6605  C  CD1   . LEU A 1 867  ? -18.617 -63.657  28.534  1.00 9.36  ? 868  LEU A CD1   1 
ATOM   6606  C  CD2   . LEU A 1 867  ? -18.443 -66.121  28.528  1.00 8.55  ? 868  LEU A CD2   1 
ATOM   6607  N  N     . PHE A 1 868  ? -20.530 -65.106  24.151  1.00 9.33  ? 869  PHE A N     1 
ATOM   6608  C  CA    . PHE A 1 868  ? -21.233 -64.752  22.939  1.00 9.13  ? 869  PHE A CA    1 
ATOM   6609  C  C     . PHE A 1 868  ? -21.009 -63.296  22.663  1.00 8.74  ? 869  PHE A C     1 
ATOM   6610  O  O     . PHE A 1 868  ? -20.679 -62.900  21.547  1.00 9.58  ? 869  PHE A O     1 
ATOM   6611  C  CB    . PHE A 1 868  ? -22.724 -64.997  23.118  1.00 9.91  ? 869  PHE A CB    1 
ATOM   6612  C  CG    . PHE A 1 868  ? -23.549 -64.650  21.922  1.00 9.40  ? 869  PHE A CG    1 
ATOM   6613  C  CD1   . PHE A 1 868  ? -23.068 -64.871  20.644  1.00 9.79  ? 869  PHE A CD1   1 
ATOM   6614  C  CD2   . PHE A 1 868  ? -24.830 -64.124  22.079  1.00 9.75  ? 869  PHE A CD2   1 
ATOM   6615  C  CE1   . PHE A 1 868  ? -23.865 -64.570  19.543  1.00 9.94  ? 869  PHE A CE1   1 
ATOM   6616  C  CE2   . PHE A 1 868  ? -25.625 -63.824  20.992  1.00 9.49  ? 869  PHE A CE2   1 
ATOM   6617  C  CZ    . PHE A 1 868  ? -25.146 -64.044  19.717  1.00 9.49  ? 869  PHE A CZ    1 
ATOM   6618  N  N     . GLU A 1 869  ? -21.095 -62.509  23.716  1.00 7.10  ? 870  GLU A N     1 
ATOM   6619  C  CA    . GLU A 1 869  ? -20.956 -61.096  23.566  1.00 6.16  ? 870  GLU A CA    1 
ATOM   6620  C  C     . GLU A 1 869  ? -19.582 -60.572  23.182  1.00 5.39  ? 870  GLU A C     1 
ATOM   6621  O  O     . GLU A 1 869  ? -19.482 -59.480  22.631  1.00 5.70  ? 870  GLU A O     1 
ATOM   6622  C  CB    . GLU A 1 869  ? -21.483 -60.396  24.819  1.00 7.09  ? 870  GLU A CB    1 
ATOM   6623  C  CG    . GLU A 1 869  ? -20.763 -60.705  26.137  1.00 9.11  ? 870  GLU A CG    1 
ATOM   6624  C  CD    . GLU A 1 869  ? -21.312 -61.906  26.906  1.00 10.76 ? 870  GLU A CD    1 
ATOM   6625  O  OE1   . GLU A 1 869  ? -21.865 -62.846  26.268  1.00 10.97 ? 870  GLU A OE1   1 
ATOM   6626  O  OE2   . GLU A 1 869  ? -21.161 -61.910  28.162  1.00 10.34 ? 870  GLU A OE2   1 
ATOM   6627  N  N     . ASP A 1 870  ? -18.534 -61.377  23.333  1.00 4.81  ? 871  ASP A N     1 
ATOM   6628  C  CA    . ASP A 1 870  ? -17.167 -60.880  23.078  1.00 3.46  ? 871  ASP A CA    1 
ATOM   6629  C  C     . ASP A 1 870  ? -16.182 -61.679  22.255  1.00 2.95  ? 871  ASP A C     1 
ATOM   6630  O  O     . ASP A 1 870  ? -15.008 -61.673  22.567  1.00 2.65  ? 871  ASP A O     1 
ATOM   6631  C  CB    . ASP A 1 870  ? -16.490 -60.674  24.408  1.00 2.26  ? 871  ASP A CB    1 
ATOM   6632  C  CG    . ASP A 1 870  ? -16.352 -61.951  25.165  1.00 2.66  ? 871  ASP A CG    1 
ATOM   6633  O  OD1   . ASP A 1 870  ? -16.677 -63.027  24.610  1.00 2.31  ? 871  ASP A OD1   1 
ATOM   6634  O  OD2   . ASP A 1 870  ? -15.942 -61.885  26.343  1.00 3.95  ? 871  ASP A OD2   1 
ATOM   6635  N  N     . ALA A 1 871  ? -16.616 -62.325  21.191  1.00 2.86  ? 872  ALA A N     1 
ATOM   6636  C  CA    . ALA A 1 871  ? -15.688 -63.120  20.421  1.00 2.23  ? 872  ALA A CA    1 
ATOM   6637  C  C     . ALA A 1 871  ? -14.515 -62.373  19.853  1.00 2.27  ? 872  ALA A C     1 
ATOM   6638  O  O     . ALA A 1 871  ? -13.389 -62.859  19.882  1.00 2.40  ? 872  ALA A O     1 
ATOM   6639  C  CB    . ALA A 1 871  ? -16.394 -63.784  19.353  1.00 2.29  ? 872  ALA A CB    1 
ATOM   6640  N  N     . ALA A 1 872  ? -14.787 -61.197  19.309  1.00 2.77  ? 873  ALA A N     1 
ATOM   6641  C  CA    . ALA A 1 872  ? -13.760 -60.381  18.683  1.00 2.98  ? 873  ALA A CA    1 
ATOM   6642  C  C     . ALA A 1 872  ? -12.778 -59.827  19.679  1.00 3.09  ? 873  ALA A C     1 
ATOM   6643  O  O     . ALA A 1 872  ? -11.570 -59.953  19.524  1.00 2.66  ? 873  ALA A O     1 
ATOM   6644  C  CB    . ALA A 1 872  ? -14.397 -59.252  17.908  1.00 3.30  ? 873  ALA A CB    1 
ATOM   6645  N  N     . GLU A 1 873  ? -13.294 -59.187  20.712  1.00 3.97  ? 874  GLU A N     1 
ATOM   6646  C  CA    . GLU A 1 873  ? -12.396 -58.621  21.693  1.00 5.07  ? 874  GLU A CA    1 
ATOM   6647  C  C     . GLU A 1 873  ? -11.595 -59.732  22.374  1.00 4.98  ? 874  GLU A C     1 
ATOM   6648  O  O     . GLU A 1 873  ? -10.506 -59.491  22.878  1.00 5.70  ? 874  GLU A O     1 
ATOM   6649  C  CB    . GLU A 1 873  ? -13.123 -57.678  22.674  1.00 5.07  ? 874  GLU A CB    1 
ATOM   6650  C  CG    . GLU A 1 873  ? -14.410 -58.199  23.242  1.00 6.78  ? 874  GLU A CG    1 
ATOM   6651  C  CD    . GLU A 1 873  ? -15.666 -57.688  22.526  1.00 7.95  ? 874  GLU A CD    1 
ATOM   6652  O  OE1   . GLU A 1 873  ? -16.135 -56.588  22.862  1.00 8.67  ? 874  GLU A OE1   1 
ATOM   6653  O  OE2   . GLU A 1 873  ? -16.225 -58.401  21.664  1.00 9.81  ? 874  GLU A OE2   1 
ATOM   6654  N  N     . TYR A 1 874  ? -12.071 -60.967  22.268  1.00 4.57  ? 875  TYR A N     1 
ATOM   6655  C  CA    . TYR A 1 874  ? -11.373 -62.102  22.858  1.00 3.76  ? 875  TYR A CA    1 
ATOM   6656  C  C     . TYR A 1 874  ? -10.230 -62.423  21.940  1.00 3.53  ? 875  TYR A C     1 
ATOM   6657  O  O     . TYR A 1 874  ? -9.108  -62.559  22.389  1.00 3.50  ? 875  TYR A O     1 
ATOM   6658  C  CB    . TYR A 1 874  ? -12.315 -63.293  22.958  1.00 3.44  ? 875  TYR A CB    1 
ATOM   6659  C  CG    . TYR A 1 874  ? -11.738 -64.603  23.463  1.00 2.75  ? 875  TYR A CG    1 
ATOM   6660  C  CD1   . TYR A 1 874  ? -11.036 -64.680  24.666  1.00 2.95  ? 875  TYR A CD1   1 
ATOM   6661  C  CD2   . TYR A 1 874  ? -11.994 -65.786  22.779  1.00 2.00  ? 875  TYR A CD2   1 
ATOM   6662  C  CE1   . TYR A 1 874  ? -10.624 -65.914  25.161  1.00 2.69  ? 875  TYR A CE1   1 
ATOM   6663  C  CE2   . TYR A 1 874  ? -11.597 -66.996  23.258  1.00 2.00  ? 875  TYR A CE2   1 
ATOM   6664  C  CZ    . TYR A 1 874  ? -10.919 -67.070  24.437  1.00 2.00  ? 875  TYR A CZ    1 
ATOM   6665  O  OH    . TYR A 1 874  ? -10.541 -68.311  24.890  1.00 2.06  ? 875  TYR A OH    1 
ATOM   6666  N  N     . GLY A 1 875  ? -10.521 -62.491  20.644  1.00 3.61  ? 876  GLY A N     1 
ATOM   6667  C  CA    . GLY A 1 875  ? -9.498  -62.797  19.659  1.00 3.60  ? 876  GLY A CA    1 
ATOM   6668  C  C     . GLY A 1 875  ? -8.521  -61.657  19.498  1.00 3.68  ? 876  GLY A C     1 
ATOM   6669  O  O     . GLY A 1 875  ? -7.540  -61.759  18.784  1.00 3.85  ? 876  GLY A O     1 
ATOM   6670  N  N     . PHE A 1 876  ? -8.838  -60.531  20.110  1.00 3.87  ? 877  PHE A N     1 
ATOM   6671  C  CA    . PHE A 1 876  ? -7.974  -59.371  20.055  1.00 4.15  ? 877  PHE A CA    1 
ATOM   6672  C  C     . PHE A 1 876  ? -7.019  -59.553  21.232  1.00 4.84  ? 877  PHE A C     1 
ATOM   6673  O  O     . PHE A 1 876  ? -5.910  -59.030  21.250  1.00 5.74  ? 877  PHE A O     1 
ATOM   6674  C  CB    . PHE A 1 876  ? -8.818  -58.122  20.250  1.00 2.91  ? 877  PHE A CB    1 
ATOM   6675  C  CG    . PHE A 1 876  ? -8.044  -56.852  20.218  1.00 2.33  ? 877  PHE A CG    1 
ATOM   6676  C  CD1   . PHE A 1 876  ? -7.616  -56.314  19.016  1.00 2.00  ? 877  PHE A CD1   1 
ATOM   6677  C  CD2   . PHE A 1 876  ? -7.818  -56.135  21.385  1.00 2.36  ? 877  PHE A CD2   1 
ATOM   6678  C  CE1   . PHE A 1 876  ? -6.984  -55.084  18.978  1.00 2.00  ? 877  PHE A CE1   1 
ATOM   6679  C  CE2   . PHE A 1 876  ? -7.190  -54.901  21.360  1.00 2.00  ? 877  PHE A CE2   1 
ATOM   6680  C  CZ    . PHE A 1 876  ? -6.773  -54.378  20.153  1.00 2.16  ? 877  PHE A CZ    1 
ATOM   6681  N  N     . GLY A 1 877  ? -7.464  -60.319  22.220  1.00 4.92  ? 878  GLY A N     1 
ATOM   6682  C  CA    . GLY A 1 877  ? -6.648  -60.555  23.391  1.00 4.37  ? 878  GLY A CA    1 
ATOM   6683  C  C     . GLY A 1 877  ? -5.486  -61.410  23.003  1.00 3.92  ? 878  GLY A C     1 
ATOM   6684  O  O     . GLY A 1 877  ? -4.352  -61.116  23.318  1.00 4.39  ? 878  GLY A O     1 
ATOM   6685  N  N     . MET A 1 878  ? -5.789  -62.463  22.271  1.00 3.98  ? 879  MET A N     1 
ATOM   6686  C  CA    . MET A 1 878  ? -4.780  -63.398  21.823  1.00 3.67  ? 879  MET A CA    1 
ATOM   6687  C  C     . MET A 1 878  ? -3.790  -62.663  20.964  1.00 3.80  ? 879  MET A C     1 
ATOM   6688  O  O     . MET A 1 878  ? -2.593  -62.817  21.117  1.00 4.40  ? 879  MET A O     1 
ATOM   6689  C  CB    . MET A 1 878  ? -5.420  -64.522  21.012  1.00 2.84  ? 879  MET A CB    1 
ATOM   6690  C  CG    . MET A 1 878  ? -6.586  -65.176  21.692  1.00 2.00  ? 879  MET A CG    1 
ATOM   6691  S  SD    . MET A 1 878  ? -7.127  -66.545  20.743  1.00 2.00  ? 879  MET A SD    1 
ATOM   6692  C  CE    . MET A 1 878  ? -8.440  -66.951  21.608  1.00 2.06  ? 879  MET A CE    1 
ATOM   6693  N  N     . ASN A 1 879  ? -4.307  -61.815  20.094  1.00 3.99  ? 880  ASN A N     1 
ATOM   6694  C  CA    . ASN A 1 879  ? -3.485  -61.047  19.180  1.00 4.28  ? 880  ASN A CA    1 
ATOM   6695  C  C     . ASN A 1 879  ? -2.461  -60.232  19.948  1.00 4.24  ? 880  ASN A C     1 
ATOM   6696  O  O     . ASN A 1 879  ? -1.285  -60.225  19.609  1.00 4.12  ? 880  ASN A O     1 
ATOM   6697  C  CB    . ASN A 1 879  ? -4.389  -60.150  18.368  1.00 4.67  ? 880  ASN A CB    1 
ATOM   6698  C  CG    . ASN A 1 879  ? -3.637  -59.228  17.506  1.00 5.18  ? 880  ASN A CG    1 
ATOM   6699  O  OD1   . ASN A 1 879  ? -3.792  -58.016  17.623  1.00 5.78  ? 880  ASN A OD1   1 
ATOM   6700  N  ND2   . ASN A 1 879  ? -2.799  -59.779  16.621  1.00 5.12  ? 880  ASN A ND2   1 
ATOM   6701  N  N     . MET A 1 880  ? -2.929  -59.535  20.976  1.00 4.52  ? 881  MET A N     1 
ATOM   6702  C  CA    . MET A 1 880  ? -2.069  -58.757  21.842  1.00 4.53  ? 881  MET A CA    1 
ATOM   6703  C  C     . MET A 1 880  ? -1.019  -59.665  22.494  1.00 4.35  ? 881  MET A C     1 
ATOM   6704  O  O     . MET A 1 880  ? 0.148   -59.326  22.497  1.00 4.55  ? 881  MET A O     1 
ATOM   6705  C  CB    . MET A 1 880  ? -2.886  -58.079  22.930  1.00 4.90  ? 881  MET A CB    1 
ATOM   6706  C  CG    . MET A 1 880  ? -3.600  -56.860  22.469  1.00 5.91  ? 881  MET A CG    1 
ATOM   6707  S  SD    . MET A 1 880  ? -4.748  -56.234  23.728  1.00 6.85  ? 881  MET A SD    1 
ATOM   6708  C  CE    . MET A 1 880  ? -3.643  -55.682  24.975  1.00 7.60  ? 881  MET A CE    1 
ATOM   6709  N  N     . SER A 1 881  ? -1.418  -60.814  23.036  1.00 4.26  ? 882  SER A N     1 
ATOM   6710  C  CA    . SER A 1 881  ? -0.461  -61.720  23.665  1.00 4.55  ? 882  SER A CA    1 
ATOM   6711  C  C     . SER A 1 881  ? 0.633   -62.140  22.714  1.00 5.26  ? 882  SER A C     1 
ATOM   6712  O  O     . SER A 1 881  ? 1.782   -62.298  23.139  1.00 5.07  ? 882  SER A O     1 
ATOM   6713  C  CB    . SER A 1 881  ? -1.119  -62.975  24.183  1.00 4.84  ? 882  SER A CB    1 
ATOM   6714  O  OG    . SER A 1 881  ? -0.106  -63.889  24.559  1.00 5.05  ? 882  SER A OG    1 
ATOM   6715  N  N     . MET A 1 882  ? 0.259   -62.418  21.459  1.00 5.65  ? 883  MET A N     1 
ATOM   6716  C  CA    . MET A 1 882  ? 1.231   -62.789  20.431  1.00 5.76  ? 883  MET A CA    1 
ATOM   6717  C  C     . MET A 1 882  ? 2.157   -61.619  20.182  1.00 6.06  ? 883  MET A C     1 
ATOM   6718  O  O     . MET A 1 882  ? 3.354   -61.810  20.036  1.00 7.02  ? 883  MET A O     1 
ATOM   6719  C  CB    . MET A 1 882  ? 0.585   -63.211  19.112  1.00 5.30  ? 883  MET A CB    1 
ATOM   6720  C  CG    . MET A 1 882  ? 0.167   -64.646  19.100  1.00 5.44  ? 883  MET A CG    1 
ATOM   6721  S  SD    . MET A 1 882  ? 0.979   -65.596  20.425  1.00 7.69  ? 883  MET A SD    1 
ATOM   6722  C  CE    . MET A 1 882  ? 1.561   -66.975  19.571  1.00 5.48  ? 883  MET A CE    1 
ATOM   6723  N  N     . PHE A 1 883  ? 1.635   -60.404  20.149  1.00 5.68  ? 884  PHE A N     1 
ATOM   6724  C  CA    . PHE A 1 883  ? 2.520   -59.273  19.943  1.00 5.76  ? 884  PHE A CA    1 
ATOM   6725  C  C     . PHE A 1 883  ? 3.606   -59.281  21.013  1.00 5.20  ? 884  PHE A C     1 
ATOM   6726  O  O     . PHE A 1 883  ? 4.771   -59.496  20.710  1.00 5.05  ? 884  PHE A O     1 
ATOM   6727  C  CB    . PHE A 1 883  ? 1.753   -57.957  20.001  1.00 6.76  ? 884  PHE A CB    1 
ATOM   6728  C  CG    . PHE A 1 883  ? 2.545   -56.786  19.517  1.00 7.08  ? 884  PHE A CG    1 
ATOM   6729  C  CD1   . PHE A 1 883  ? 2.603   -56.495  18.163  1.00 7.39  ? 884  PHE A CD1   1 
ATOM   6730  C  CD2   . PHE A 1 883  ? 3.256   -55.997  20.403  1.00 7.60  ? 884  PHE A CD2   1 
ATOM   6731  C  CE1   . PHE A 1 883  ? 3.360   -55.439  17.697  1.00 8.10  ? 884  PHE A CE1   1 
ATOM   6732  C  CE2   . PHE A 1 883  ? 4.026   -54.927  19.945  1.00 7.91  ? 884  PHE A CE2   1 
ATOM   6733  C  CZ    . PHE A 1 883  ? 4.080   -54.648  18.590  1.00 8.25  ? 884  PHE A CZ    1 
ATOM   6734  N  N     . ALA A 1 884  ? 3.200   -59.133  22.269  1.00 5.09  ? 885  ALA A N     1 
ATOM   6735  C  CA    . ALA A 1 884  ? 4.125   -59.115  23.401  1.00 5.05  ? 885  ALA A CA    1 
ATOM   6736  C  C     . ALA A 1 884  ? 5.046   -60.347  23.476  1.00 5.31  ? 885  ALA A C     1 
ATOM   6737  O  O     . ALA A 1 884  ? 6.267   -60.218  23.552  1.00 5.53  ? 885  ALA A O     1 
ATOM   6738  C  CB    . ALA A 1 884  ? 3.363   -58.950  24.684  1.00 4.21  ? 885  ALA A CB    1 
ATOM   6739  N  N     . ARG A 1 885  ? 4.484   -61.544  23.437  1.00 4.98  ? 886  ARG A N     1 
ATOM   6740  C  CA    . ARG A 1 885  ? 5.332   -62.707  23.492  1.00 4.47  ? 886  ARG A CA    1 
ATOM   6741  C  C     . ARG A 1 885  ? 6.248   -62.775  22.262  1.00 4.17  ? 886  ARG A C     1 
ATOM   6742  O  O     . ARG A 1 885  ? 7.434   -63.105  22.394  1.00 4.08  ? 886  ARG A O     1 
ATOM   6743  C  CB    . ARG A 1 885  ? 4.484   -63.957  23.668  1.00 4.70  ? 886  ARG A CB    1 
ATOM   6744  C  CG    . ARG A 1 885  ? 3.702   -63.939  24.987  1.00 5.93  ? 886  ARG A CG    1 
ATOM   6745  C  CD    . ARG A 1 885  ? 2.871   -65.209  25.228  1.00 6.56  ? 886  ARG A CD    1 
ATOM   6746  N  NE    . ARG A 1 885  ? 3.724   -66.383  25.272  1.00 7.02  ? 886  ARG A NE    1 
ATOM   6747  C  CZ    . ARG A 1 885  ? 3.388   -67.577  24.806  1.00 8.05  ? 886  ARG A CZ    1 
ATOM   6748  N  NH1   . ARG A 1 885  ? 2.189   -67.790  24.267  1.00 9.28  ? 886  ARG A NH1   1 
ATOM   6749  N  NH2   . ARG A 1 885  ? 4.300   -68.536  24.775  1.00 9.13  ? 886  ARG A NH2   1 
ATOM   6750  N  N     . ARG A 1 886  ? 5.743   -62.389  21.087  1.00 3.70  ? 887  ARG A N     1 
ATOM   6751  C  CA    . ARG A 1 886  ? 6.559   -62.427  19.874  1.00 3.51  ? 887  ARG A CA    1 
ATOM   6752  C  C     . ARG A 1 886  ? 7.558   -61.301  19.808  1.00 4.40  ? 887  ARG A C     1 
ATOM   6753  O  O     . ARG A 1 886  ? 8.610   -61.420  19.178  1.00 4.36  ? 887  ARG A O     1 
ATOM   6754  C  CB    . ARG A 1 886  ? 5.723   -62.478  18.613  1.00 2.25  ? 887  ARG A CB    1 
ATOM   6755  C  CG    . ARG A 1 886  ? 5.683   -63.864  18.019  1.00 2.35  ? 887  ARG A CG    1 
ATOM   6756  C  CD    . ARG A 1 886  ? 4.966   -63.879  16.694  1.00 2.37  ? 887  ARG A CD    1 
ATOM   6757  N  NE    . ARG A 1 886  ? 5.534   -64.840  15.761  1.00 2.67  ? 887  ARG A NE    1 
ATOM   6758  C  CZ    . ARG A 1 886  ? 6.005   -64.506  14.560  1.00 3.54  ? 887  ARG A CZ    1 
ATOM   6759  N  NH1   . ARG A 1 886  ? 5.973   -63.232  14.175  1.00 2.00  ? 887  ARG A NH1   1 
ATOM   6760  N  NH2   . ARG A 1 886  ? 6.444   -65.447  13.713  1.00 3.60  ? 887  ARG A NH2   1 
ATOM   6761  N  N     . THR A 1 887  ? 7.256   -60.225  20.525  1.00 5.04  ? 888  THR A N     1 
ATOM   6762  C  CA    . THR A 1 887  ? 8.158   -59.098  20.603  1.00 5.02  ? 888  THR A CA    1 
ATOM   6763  C  C     . THR A 1 887  ? 9.314   -59.469  21.521  1.00 5.69  ? 888  THR A C     1 
ATOM   6764  O  O     . THR A 1 887  ? 10.467  -59.133  21.254  1.00 6.99  ? 888  THR A O     1 
ATOM   6765  C  CB    . THR A 1 887  ? 7.485   -57.919  21.161  1.00 3.91  ? 888  THR A CB    1 
ATOM   6766  O  OG1   . THR A 1 887  ? 6.486   -57.505  20.241  1.00 4.97  ? 888  THR A OG1   1 
ATOM   6767  C  CG2   . THR A 1 887  ? 8.459   -56.816  21.306  1.00 4.83  ? 888  THR A CG2   1 
ATOM   6768  N  N     . HIS A 1 888  ? 8.997   -60.167  22.601  1.00 5.51  ? 889  HIS A N     1 
ATOM   6769  C  CA    . HIS A 1 888  ? 9.997   -60.606  23.545  1.00 5.35  ? 889  HIS A CA    1 
ATOM   6770  C  C     . HIS A 1 888  ? 10.980  -61.437  22.752  1.00 5.84  ? 889  HIS A C     1 
ATOM   6771  O  O     . HIS A 1 888  ? 12.190  -61.209  22.809  1.00 5.82  ? 889  HIS A O     1 
ATOM   6772  C  CB    . HIS A 1 888  ? 9.337   -61.482  24.604  1.00 5.69  ? 889  HIS A CB    1 
ATOM   6773  C  CG    . HIS A 1 888  ? 10.184  -61.734  25.813  1.00 5.95  ? 889  HIS A CG    1 
ATOM   6774  N  ND1   . HIS A 1 888  ? 9.700   -62.383  26.928  1.00 5.97  ? 889  HIS A ND1   1 
ATOM   6775  C  CD2   . HIS A 1 888  ? 11.471  -61.414  26.096  1.00 5.80  ? 889  HIS A CD2   1 
ATOM   6776  C  CE1   . HIS A 1 888  ? 10.649  -62.455  27.845  1.00 5.89  ? 889  HIS A CE1   1 
ATOM   6777  N  NE2   . HIS A 1 888  ? 11.734  -61.873  27.364  1.00 5.53  ? 889  HIS A NE2   1 
ATOM   6778  N  N     . LEU A 1 889  ? 10.465  -62.359  21.944  1.00 6.45  ? 890  LEU A N     1 
ATOM   6779  C  CA    . LEU A 1 889  ? 11.354  -63.231  21.185  1.00 6.69  ? 890  LEU A CA    1 
ATOM   6780  C  C     . LEU A 1 889  ? 12.313  -62.454  20.309  1.00 7.34  ? 890  LEU A C     1 
ATOM   6781  O  O     . LEU A 1 889  ? 13.484  -62.766  20.261  1.00 6.92  ? 890  LEU A O     1 
ATOM   6782  C  CB    . LEU A 1 889  ? 10.565  -64.240  20.357  1.00 5.59  ? 890  LEU A CB    1 
ATOM   6783  C  CG    . LEU A 1 889  ? 11.424  -65.123  19.460  1.00 5.59  ? 890  LEU A CG    1 
ATOM   6784  C  CD1   . LEU A 1 889  ? 12.580  -65.670  20.252  1.00 4.86  ? 890  LEU A CD1   1 
ATOM   6785  C  CD2   . LEU A 1 889  ? 10.594  -66.240  18.852  1.00 5.24  ? 890  LEU A CD2   1 
ATOM   6786  N  N     . ALA A 1 890  ? 11.809  -61.401  19.680  1.00 8.68  ? 891  ALA A N     1 
ATOM   6787  C  CA    . ALA A 1 890  ? 12.593  -60.558  18.788  1.00 10.00 ? 891  ALA A CA    1 
ATOM   6788  C  C     . ALA A 1 890  ? 13.636  -59.692  19.477  1.00 11.00 ? 891  ALA A C     1 
ATOM   6789  O  O     . ALA A 1 890  ? 14.664  -59.399  18.887  1.00 11.50 ? 891  ALA A O     1 
ATOM   6790  C  CB    . ALA A 1 890  ? 11.682  -59.709  17.958  1.00 9.46  ? 891  ALA A CB    1 
ATOM   6791  N  N     . ASP A 1 891  ? 13.361  -59.222  20.687  1.00 12.56 ? 892  ASP A N     1 
ATOM   6792  C  CA    . ASP A 1 891  ? 14.357  -58.423  21.397  1.00 14.09 ? 892  ASP A CA    1 
ATOM   6793  C  C     . ASP A 1 891  ? 15.414  -59.382  21.898  1.00 13.81 ? 892  ASP A C     1 
ATOM   6794  O  O     . ASP A 1 891  ? 16.578  -59.037  21.984  1.00 14.27 ? 892  ASP A O     1 
ATOM   6795  C  CB    . ASP A 1 891  ? 13.748  -57.637  22.562  1.00 16.30 ? 892  ASP A CB    1 
ATOM   6796  C  CG    . ASP A 1 891  ? 12.947  -56.416  22.092  1.00 19.80 ? 892  ASP A CG    1 
ATOM   6797  O  OD1   . ASP A 1 891  ? 12.471  -56.431  20.920  1.00 21.15 ? 892  ASP A OD1   1 
ATOM   6798  O  OD2   . ASP A 1 891  ? 12.787  -55.436  22.885  1.00 21.17 ? 892  ASP A OD2   1 
ATOM   6799  N  N     . LEU A 1 892  ? 15.005  -60.610  22.179  1.00 13.12 ? 893  LEU A N     1 
ATOM   6800  C  CA    . LEU A 1 892  ? 15.915  -61.625  22.651  1.00 12.68 ? 893  LEU A CA    1 
ATOM   6801  C  C     . LEU A 1 892  ? 16.786  -62.104  21.504  1.00 12.97 ? 893  LEU A C     1 
ATOM   6802  O  O     . LEU A 1 892  ? 17.973  -62.343  21.674  1.00 13.32 ? 893  LEU A O     1 
ATOM   6803  C  CB    . LEU A 1 892  ? 15.119  -62.789  23.209  1.00 12.06 ? 893  LEU A CB    1 
ATOM   6804  C  CG    . LEU A 1 892  ? 15.499  -63.257  24.601  1.00 11.66 ? 893  LEU A CG    1 
ATOM   6805  C  CD1   . LEU A 1 892  ? 15.540  -62.083  25.519  1.00 11.94 ? 893  LEU A CD1   1 
ATOM   6806  C  CD2   . LEU A 1 892  ? 14.488  -64.260  25.084  1.00 11.89 ? 893  LEU A CD2   1 
ATOM   6807  N  N     . ALA A 1 893  ? 16.197  -62.235  20.324  1.00 13.14 ? 894  ALA A N     1 
ATOM   6808  C  CA    . ALA A 1 893  ? 16.936  -62.692  19.164  1.00 12.80 ? 894  ALA A CA    1 
ATOM   6809  C  C     . ALA A 1 893  ? 17.860  -61.570  18.773  1.00 12.96 ? 894  ALA A C     1 
ATOM   6810  O  O     . ALA A 1 893  ? 19.043  -61.787  18.530  1.00 13.12 ? 894  ALA A O     1 
ATOM   6811  C  CB    . ALA A 1 893  ? 15.999  -63.038  18.042  1.00 11.96 ? 894  ALA A CB    1 
ATOM   6812  N  N     . ALA A 1 894  ? 17.332  -60.357  18.766  1.00 13.49 ? 895  ALA A N     1 
ATOM   6813  C  CA    . ALA A 1 894  ? 18.136  -59.196  18.423  1.00 14.60 ? 895  ALA A CA    1 
ATOM   6814  C  C     . ALA A 1 894  ? 19.344  -59.124  19.336  1.00 15.54 ? 895  ALA A C     1 
ATOM   6815  O  O     . ALA A 1 894  ? 20.416  -58.679  18.924  1.00 15.68 ? 895  ALA A O     1 
ATOM   6816  C  CB    . ALA A 1 894  ? 17.321  -57.934  18.548  1.00 14.76 ? 895  ALA A CB    1 
ATOM   6817  N  N     . LYS A 1 895  ? 19.167  -59.564  20.580  1.00 16.67 ? 896  LYS A N     1 
ATOM   6818  C  CA    . LYS A 1 895  ? 20.257  -59.565  21.553  1.00 17.48 ? 896  LYS A CA    1 
ATOM   6819  C  C     . LYS A 1 895  ? 21.236  -60.692  21.280  1.00 17.60 ? 896  LYS A C     1 
ATOM   6820  O  O     . LYS A 1 895  ? 22.426  -60.488  21.366  1.00 18.27 ? 896  LYS A O     1 
ATOM   6821  C  CB    . LYS A 1 895  ? 19.750  -59.672  23.007  1.00 18.14 ? 896  LYS A CB    1 
ATOM   6822  C  CG    . LYS A 1 895  ? 19.204  -58.372  23.634  1.00 18.83 ? 896  LYS A CG    1 
ATOM   6823  C  CD    . LYS A 1 895  ? 19.042  -58.534  25.157  1.00 19.93 ? 896  LYS A CD    1 
ATOM   6824  C  CE    . LYS A 1 895  ? 18.013  -57.562  25.747  1.00 21.16 ? 896  LYS A CE    1 
ATOM   6825  N  NZ    . LYS A 1 895  ? 16.806  -58.256  26.371  1.00 22.43 ? 896  LYS A NZ    1 
ATOM   6826  N  N     . ALA A 1 896  ? 20.752  -61.883  20.968  1.00 18.05 ? 897  ALA A N     1 
ATOM   6827  C  CA    . ALA A 1 896  ? 21.662  -62.986  20.709  1.00 18.54 ? 897  ALA A CA    1 
ATOM   6828  C  C     . ALA A 1 896  ? 22.682  -62.668  19.610  1.00 18.97 ? 897  ALA A C     1 
ATOM   6829  O  O     . ALA A 1 896  ? 23.827  -63.094  19.703  1.00 19.15 ? 897  ALA A O     1 
ATOM   6830  C  CB    . ALA A 1 896  ? 20.893  -64.253  20.405  1.00 18.53 ? 897  ALA A CB    1 
ATOM   6831  N  N     . LEU A 1 897  ? 22.290  -61.901  18.594  1.00 19.67 ? 898  LEU A N     1 
ATOM   6832  C  CA    . LEU A 1 897  ? 23.213  -61.514  17.517  1.00 20.87 ? 898  LEU A CA    1 
ATOM   6833  C  C     . LEU A 1 897  ? 24.477  -60.790  18.049  1.00 22.29 ? 898  LEU A C     1 
ATOM   6834  O  O     . LEU A 1 897  ? 25.514  -60.769  17.390  1.00 22.68 ? 898  LEU A O     1 
ATOM   6835  C  CB    . LEU A 1 897  ? 22.507  -60.612  16.507  1.00 19.97 ? 898  LEU A CB    1 
ATOM   6836  C  CG    . LEU A 1 897  ? 21.367  -61.151  15.652  1.00 19.52 ? 898  LEU A CG    1 
ATOM   6837  C  CD1   . LEU A 1 897  ? 20.751  -60.027  14.837  1.00 18.79 ? 898  LEU A CD1   1 
ATOM   6838  C  CD2   . LEU A 1 897  ? 21.898  -62.199  14.715  1.00 19.61 ? 898  LEU A CD2   1 
ATOM   6839  N  N     . GLU A 1 898  ? 24.357  -60.153  19.214  1.00 23.96 ? 899  GLU A N     1 
ATOM   6840  C  CA    . GLU A 1 898  ? 25.453  -59.458  19.881  1.00 24.56 ? 899  GLU A CA    1 
ATOM   6841  C  C     . GLU A 1 898  ? 26.152  -60.453  20.789  0.00 25.25 ? 899  GLU A C     1 
ATOM   6842  O  O     . GLU A 1 898  ? 26.719  -60.065  21.789  1.00 25.44 ? 899  GLU A O     1 
ATOM   6843  C  CB    . GLU A 1 898  ? 24.926  -58.347  20.792  0.00 25.49 ? 899  GLU A CB    1 
ATOM   6844  C  CG    . GLU A 1 898  ? 24.319  -57.135  20.138  0.00 26.72 ? 899  GLU A CG    1 
ATOM   6845  C  CD    . GLU A 1 898  ? 23.878  -56.123  21.178  0.00 27.74 ? 899  GLU A CD    1 
ATOM   6846  O  OE1   . GLU A 1 898  ? 24.705  -55.276  21.577  0.00 27.90 ? 899  GLU A OE1   1 
ATOM   6847  O  OE2   . GLU A 1 898  ? 22.712  -56.196  21.622  0.00 27.91 ? 899  GLU A OE2   1 
ATOM   6848  N  N     . SER A 1 899  ? 26.062  -61.742  20.504  1.00 25.35 ? 900  SER A N     1 
ATOM   6849  C  CA    . SER A 1 899  ? 26.716  -62.703  21.386  1.00 26.41 ? 900  SER A CA    1 
ATOM   6850  C  C     . SER A 1 899  ? 27.736  -63.549  20.655  1.00 27.35 ? 900  SER A C     1 
ATOM   6851  O  O     . SER A 1 899  ? 27.974  -63.352  19.462  1.00 27.75 ? 900  SER A O     1 
ATOM   6852  C  CB    . SER A 1 899  ? 25.688  -63.601  22.110  1.00 26.17 ? 900  SER A CB    1 
ATOM   6853  O  OG    . SER A 1 899  ? 25.169  -64.637  21.294  1.00 24.78 ? 900  SER A OG    1 
ATOM   6854  N  N     . ASP A 1 900  ? 28.381  -64.453  21.388  1.00 27.97 ? 901  ASP A N     1 
ATOM   6855  C  CA    . ASP A 1 900  ? 29.359  -65.341  20.790  1.00 28.94 ? 901  ASP A CA    1 
ATOM   6856  C  C     . ASP A 1 900  ? 28.646  -66.595  20.265  1.00 28.92 ? 901  ASP A C     1 
ATOM   6857  O  O     . ASP A 1 900  ? 29.218  -67.689  20.240  1.00 29.34 ? 901  ASP A O     1 
ATOM   6858  C  CB    . ASP A 1 900  ? 30.476  -65.694  21.789  1.00 30.61 ? 901  ASP A CB    1 
ATOM   6859  C  CG    . ASP A 1 900  ? 29.997  -66.566  22.952  1.00 32.33 ? 901  ASP A CG    1 
ATOM   6860  O  OD1   . ASP A 1 900  ? 28.984  -66.195  23.597  1.00 33.16 ? 901  ASP A OD1   1 
ATOM   6861  O  OD2   . ASP A 1 900  ? 30.650  -67.611  23.237  1.00 33.16 ? 901  ASP A OD2   1 
ATOM   6862  N  N     . ALA A 1 901  ? 27.393  -66.419  19.840  1.00 28.39 ? 902  ALA A N     1 
ATOM   6863  C  CA    . ALA A 1 901  ? 26.573  -67.505  19.313  1.00 27.22 ? 902  ALA A CA    1 
ATOM   6864  C  C     . ALA A 1 901  ? 27.103  -67.891  17.954  1.00 26.55 ? 902  ALA A C     1 
ATOM   6865  O  O     . ALA A 1 901  ? 27.676  -67.060  17.247  1.00 26.45 ? 902  ALA A O     1 
ATOM   6866  C  CB    . ALA A 1 901  ? 25.132  -67.049  19.186  1.00 27.41 ? 902  ALA A CB    1 
ATOM   6867  N  N     . SER A 1 902  ? 26.893  -69.151  17.598  1.00 25.62 ? 903  SER A N     1 
ATOM   6868  C  CA    . SER A 1 902  ? 27.319  -69.699  16.322  1.00 25.11 ? 903  SER A CA    1 
ATOM   6869  C  C     . SER A 1 902  ? 27.055  -68.751  15.173  1.00 24.97 ? 903  SER A C     1 
ATOM   6870  O  O     . SER A 1 902  ? 26.256  -67.841  15.287  1.00 25.20 ? 903  SER A O     1 
ATOM   6871  C  CB    . SER A 1 902  ? 26.546  -70.988  16.083  1.00 25.55 ? 903  SER A CB    1 
ATOM   6872  O  OG    . SER A 1 902  ? 26.612  -71.432  14.743  1.00 26.04 ? 903  SER A OG    1 
ATOM   6873  N  N     . GLY A 1 903  ? 27.738  -68.950  14.060  1.00 25.08 ? 904  GLY A N     1 
ATOM   6874  C  CA    . GLY A 1 903  ? 27.497  -68.105  12.901  1.00 25.69 ? 904  GLY A CA    1 
ATOM   6875  C  C     . GLY A 1 903  ? 26.172  -68.513  12.275  1.00 25.82 ? 904  GLY A C     1 
ATOM   6876  O  O     . GLY A 1 903  ? 25.364  -67.684  11.873  1.00 25.91 ? 904  GLY A O     1 
ATOM   6877  N  N     . ASP A 1 904  ? 25.961  -69.817  12.197  1.00 26.17 ? 905  ASP A N     1 
ATOM   6878  C  CA    . ASP A 1 904  ? 24.730  -70.357  11.675  1.00 26.49 ? 905  ASP A CA    1 
ATOM   6879  C  C     . ASP A 1 904  ? 23.595  -69.868  12.541  1.00 26.21 ? 905  ASP A C     1 
ATOM   6880  O  O     . ASP A 1 904  ? 22.588  -69.403  12.022  1.00 26.75 ? 905  ASP A O     1 
ATOM   6881  C  CB    . ASP A 1 904  ? 24.762  -71.877  11.704  1.00 27.39 ? 905  ASP A CB    1 
ATOM   6882  C  CG    . ASP A 1 904  ? 25.686  -72.454  10.665  1.00 28.25 ? 905  ASP A CG    1 
ATOM   6883  O  OD1   . ASP A 1 904  ? 26.164  -71.692  9.789   1.00 28.71 ? 905  ASP A OD1   1 
ATOM   6884  O  OD2   . ASP A 1 904  ? 25.918  -73.682  10.721  1.00 29.11 ? 905  ASP A OD2   1 
ATOM   6885  N  N     . VAL A 1 905  ? 23.753  -69.966  13.858  1.00 25.41 ? 906  VAL A N     1 
ATOM   6886  C  CA    . VAL A 1 905  ? 22.708  -69.510  14.763  1.00 24.83 ? 906  VAL A CA    1 
ATOM   6887  C  C     . VAL A 1 905  ? 22.359  -68.063  14.442  1.00 25.15 ? 906  VAL A C     1 
ATOM   6888  O  O     . VAL A 1 905  ? 21.202  -67.738  14.200  1.00 25.83 ? 906  VAL A O     1 
ATOM   6889  C  CB    . VAL A 1 905  ? 23.113  -69.651  16.238  1.00 23.90 ? 906  VAL A CB    1 
ATOM   6890  C  CG1   . VAL A 1 905  ? 22.298  -68.728  17.095  1.00 23.97 ? 906  VAL A CG1   1 
ATOM   6891  C  CG2   . VAL A 1 905  ? 22.886  -71.064  16.703  1.00 23.31 ? 906  VAL A CG2   1 
ATOM   6892  N  N     . LYS A 1 906  ? 23.365  -67.213  14.342  1.00 25.02 ? 907  LYS A N     1 
ATOM   6893  C  CA    . LYS A 1 906  ? 23.127  -65.815  14.044  1.00 25.17 ? 907  LYS A CA    1 
ATOM   6894  C  C     . LYS A 1 906  ? 22.484  -65.604  12.679  1.00 25.26 ? 907  LYS A C     1 
ATOM   6895  O  O     . LYS A 1 906  ? 21.768  -64.626  12.463  1.00 25.28 ? 907  LYS A O     1 
ATOM   6896  C  CB    . LYS A 1 906  ? 24.440  -65.042  14.097  1.00 25.66 ? 907  LYS A CB    1 
ATOM   6897  C  CG    . LYS A 1 906  ? 25.135  -65.059  15.442  1.00 26.04 ? 907  LYS A CG    1 
ATOM   6898  C  CD    . LYS A 1 906  ? 26.280  -64.085  15.445  1.00 26.29 ? 907  LYS A CD    1 
ATOM   6899  C  CE    . LYS A 1 906  ? 27.018  -64.108  16.754  1.00 26.89 ? 907  LYS A CE    1 
ATOM   6900  N  NZ    . LYS A 1 906  ? 28.153  -63.138  16.688  1.00 27.96 ? 907  LYS A NZ    1 
ATOM   6901  N  N     . GLU A 1 907  ? 22.756  -66.519  11.757  1.00 25.47 ? 908  GLU A N     1 
ATOM   6902  C  CA    . GLU A 1 907  ? 22.247  -66.437  10.397  1.00 25.57 ? 908  GLU A CA    1 
ATOM   6903  C  C     . GLU A 1 907  ? 20.771  -66.761  10.333  1.00 24.52 ? 908  GLU A C     1 
ATOM   6904  O  O     . GLU A 1 907  ? 20.061  -66.261  9.460   1.00 24.69 ? 908  GLU A O     1 
ATOM   6905  C  CB    . GLU A 1 907  ? 23.016  -67.411  9.521   1.00 27.80 ? 908  GLU A CB    1 
ATOM   6906  C  CG    . GLU A 1 907  ? 22.861  -67.171  8.034   1.00 31.40 ? 908  GLU A CG    1 
ATOM   6907  C  CD    . GLU A 1 907  ? 23.550  -68.243  7.171   1.00 33.60 ? 908  GLU A CD    1 
ATOM   6908  O  OE1   . GLU A 1 907  ? 24.541  -68.888  7.624   1.00 34.70 ? 908  GLU A OE1   1 
ATOM   6909  O  OE2   . GLU A 1 907  ? 23.088  -68.438  6.017   1.00 34.99 ? 908  GLU A OE2   1 
ATOM   6910  N  N     . ALA A 1 908  ? 20.340  -67.675  11.209  1.00 23.18 ? 909  ALA A N     1 
ATOM   6911  C  CA    . ALA A 1 908  ? 18.946  -68.088  11.311  1.00 21.27 ? 909  ALA A CA    1 
ATOM   6912  C  C     . ALA A 1 908  ? 18.303  -66.924  12.000  1.00 20.24 ? 909  ALA A C     1 
ATOM   6913  O  O     . ALA A 1 908  ? 17.409  -66.307  11.469  1.00 20.55 ? 909  ALA A O     1 
ATOM   6914  C  CB    . ALA A 1 908  ? 18.819  -69.318  12.162  1.00 20.84 ? 909  ALA A CB    1 
ATOM   6915  N  N     . LEU A 1 909  ? 18.846  -66.571  13.152  1.00 18.97 ? 910  LEU A N     1 
ATOM   6916  C  CA    . LEU A 1 909  ? 18.357  -65.458  13.934  1.00 18.15 ? 910  LEU A CA    1 
ATOM   6917  C  C     . LEU A 1 909  ? 18.070  -64.161  13.146  1.00 18.09 ? 910  LEU A C     1 
ATOM   6918  O  O     . LEU A 1 909  ? 16.966  -63.650  13.261  1.00 17.94 ? 910  LEU A O     1 
ATOM   6919  C  CB    . LEU A 1 909  ? 19.295  -65.217  15.124  1.00 18.00 ? 910  LEU A CB    1 
ATOM   6920  C  CG    . LEU A 1 909  ? 18.847  -65.331  16.599  1.00 17.93 ? 910  LEU A CG    1 
ATOM   6921  C  CD1   . LEU A 1 909  ? 17.856  -66.445  16.840  1.00 17.70 ? 910  LEU A CD1   1 
ATOM   6922  C  CD2   . LEU A 1 909  ? 20.060  -65.537  17.479  1.00 17.67 ? 910  LEU A CD2   1 
ATOM   6923  N  N     . GLN A 1 910  ? 18.989  -63.612  12.337  1.00 18.52 ? 911  GLN A N     1 
ATOM   6924  C  CA    . GLN A 1 910  ? 18.596  -62.376  11.638  1.00 18.86 ? 911  GLN A CA    1 
ATOM   6925  C  C     . GLN A 1 910  ? 17.614  -62.675  10.546  1.00 17.70 ? 911  GLN A C     1 
ATOM   6926  O  O     . GLN A 1 910  ? 16.757  -61.856  10.267  1.00 18.03 ? 911  GLN A O     1 
ATOM   6927  C  CB    . GLN A 1 910  ? 19.735  -61.468  11.117  1.00 20.54 ? 911  GLN A CB    1 
ATOM   6928  C  CG    . GLN A 1 910  ? 19.200  -60.030  10.600  1.00 24.11 ? 911  GLN A CG    1 
ATOM   6929  C  CD    . GLN A 1 910  ? 19.296  -58.810  11.625  1.00 26.81 ? 911  GLN A CD    1 
ATOM   6930  O  OE1   . GLN A 1 910  ? 20.390  -58.258  11.857  1.00 28.09 ? 911  GLN A OE1   1 
ATOM   6931  N  NE2   . GLN A 1 910  ? 18.138  -58.357  12.159  1.00 27.51 ? 911  GLN A NE2   1 
ATOM   6932  N  N     . GLY A 1 911  ? 17.718  -63.847  9.933   1.00 16.44 ? 912  GLY A N     1 
ATOM   6933  C  CA    . GLY A 1 911  ? 16.760  -64.203  8.903   1.00 15.06 ? 912  GLY A CA    1 
ATOM   6934  C  C     . GLY A 1 911  ? 15.354  -64.208  9.497   1.00 14.38 ? 912  GLY A C     1 
ATOM   6935  O  O     . GLY A 1 911  ? 14.389  -63.713  8.892   1.00 14.10 ? 912  GLY A O     1 
ATOM   6936  N  N     . TRP A 1 912  ? 15.243  -64.766  10.701  1.00 13.44 ? 913  TRP A N     1 
ATOM   6937  C  CA    . TRP A 1 912  ? 13.974  -64.834  11.397  1.00 12.11 ? 913  TRP A CA    1 
ATOM   6938  C  C     . TRP A 1 912  ? 13.564  -63.437  11.731  1.00 11.83 ? 913  TRP A C     1 
ATOM   6939  O  O     . TRP A 1 912  ? 12.462  -63.034  11.411  1.00 12.33 ? 913  TRP A O     1 
ATOM   6940  C  CB    . TRP A 1 912  ? 14.069  -65.629  12.687  1.00 11.02 ? 913  TRP A CB    1 
ATOM   6941  C  CG    . TRP A 1 912  ? 12.782  -65.603  13.445  1.00 10.34 ? 913  TRP A CG    1 
ATOM   6942  C  CD1   . TRP A 1 912  ? 11.731  -66.465  13.301  1.00 10.02 ? 913  TRP A CD1   1 
ATOM   6943  C  CD2   . TRP A 1 912  ? 12.383  -64.655  14.443  1.00 10.36 ? 913  TRP A CD2   1 
ATOM   6944  N  NE1   . TRP A 1 912  ? 10.712  -66.109  14.137  1.00 9.56  ? 913  TRP A NE1   1 
ATOM   6945  C  CE2   . TRP A 1 912  ? 11.083  -65.005  14.855  1.00 9.93  ? 913  TRP A CE2   1 
ATOM   6946  C  CE3   . TRP A 1 912  ? 13.006  -63.544  15.035  1.00 10.14 ? 913  TRP A CE3   1 
ATOM   6947  C  CZ2   . TRP A 1 912  ? 10.386  -64.286  15.839  1.00 9.60  ? 913  TRP A CZ2   1 
ATOM   6948  C  CZ3   . TRP A 1 912  ? 12.307  -62.830  16.016  1.00 9.97  ? 913  TRP A CZ3   1 
ATOM   6949  C  CH2   . TRP A 1 912  ? 11.014  -63.211  16.404  1.00 9.25  ? 913  TRP A CH2   1 
ATOM   6950  N  N     . LEU A 1 913  ? 14.445  -62.702  12.395  1.00 11.38 ? 914  LEU A N     1 
ATOM   6951  C  CA    . LEU A 1 913  ? 14.147  -61.328  12.763  1.00 11.54 ? 914  LEU A CA    1 
ATOM   6952  C  C     . LEU A 1 913  ? 13.646  -60.581  11.547  1.00 11.90 ? 914  LEU A C     1 
ATOM   6953  O  O     . LEU A 1 913  ? 12.734  -59.772  11.630  1.00 12.20 ? 914  LEU A O     1 
ATOM   6954  C  CB    . LEU A 1 913  ? 15.395  -60.608  13.278  1.00 11.46 ? 914  LEU A CB    1 
ATOM   6955  C  CG    . LEU A 1 913  ? 15.678  -60.377  14.761  1.00 11.41 ? 914  LEU A CG    1 
ATOM   6956  C  CD1   . LEU A 1 913  ? 14.450  -59.849  15.478  1.00 11.25 ? 914  LEU A CD1   1 
ATOM   6957  C  CD2   . LEU A 1 913  ? 16.137  -61.651  15.369  1.00 11.68 ? 914  LEU A CD2   1 
ATOM   6958  N  N     . ALA A 1 914  ? 14.232  -60.888  10.403  1.00 12.57 ? 915  ALA A N     1 
ATOM   6959  C  CA    . ALA A 1 914  ? 13.867  -60.215  9.178   1.00 13.40 ? 915  ALA A CA    1 
ATOM   6960  C  C     . ALA A 1 914  ? 12.571  -60.740  8.613   1.00 14.22 ? 915  ALA A C     1 
ATOM   6961  O  O     . ALA A 1 914  ? 11.882  -60.000  7.891   1.00 14.96 ? 915  ALA A O     1 
ATOM   6962  C  CB    . ALA A 1 914  ? 14.960  -60.344  8.161   1.00 13.54 ? 915  ALA A CB    1 
ATOM   6963  N  N     . GLY A 1 915  ? 12.252  -62.009  8.907   1.00 13.94 ? 916  GLY A N     1 
ATOM   6964  C  CA    . GLY A 1 915  ? 11.023  -62.604  8.403   1.00 13.18 ? 916  GLY A CA    1 
ATOM   6965  C  C     . GLY A 1 915  ? 10.036  -63.001  9.478   1.00 13.16 ? 916  GLY A C     1 
ATOM   6966  O  O     . GLY A 1 915  ? 9.214   -63.889  9.267   1.00 13.44 ? 916  GLY A O     1 
ATOM   6967  N  N     . LYS A 1 916  ? 10.056  -62.303  10.609  1.00 13.01 ? 917  LYS A N     1 
ATOM   6968  C  CA    . LYS A 1 916  ? 9.171   -62.642  11.725  1.00 12.89 ? 917  LYS A CA    1 
ATOM   6969  C  C     . LYS A 1 916  ? 7.708   -62.725  11.360  1.00 12.10 ? 917  LYS A C     1 
ATOM   6970  O  O     . LYS A 1 916  ? 6.989   -63.635  11.785  1.00 11.84 ? 917  LYS A O     1 
ATOM   6971  C  CB    . LYS A 1 916  ? 9.332   -61.647  12.880  1.00 13.76 ? 917  LYS A CB    1 
ATOM   6972  C  CG    . LYS A 1 916  ? 8.696   -60.261  12.655  1.00 15.33 ? 917  LYS A CG    1 
ATOM   6973  C  CD    . LYS A 1 916  ? 8.775   -59.349  13.890  1.00 15.70 ? 917  LYS A CD    1 
ATOM   6974  C  CE    . LYS A 1 916  ? 10.229  -59.132  14.307  1.00 16.63 ? 917  LYS A CE    1 
ATOM   6975  N  NZ    . LYS A 1 916  ? 10.885  -60.398  14.818  1.00 16.38 ? 917  LYS A NZ    1 
ATOM   6976  N  N     . ASN A 1 917  ? 7.284   -61.800  10.522  1.00 11.35 ? 918  ASN A N     1 
ATOM   6977  C  CA    . ASN A 1 917  ? 5.906   -61.760  10.154  1.00 10.65 ? 918  ASN A CA    1 
ATOM   6978  C  C     . ASN A 1 917  ? 5.537   -62.364  8.845   1.00 10.98 ? 918  ASN A C     1 
ATOM   6979  O  O     . ASN A 1 917  ? 4.467   -62.094  8.326   1.00 11.45 ? 918  ASN A O     1 
ATOM   6980  C  CB    . ASN A 1 917  ? 5.424   -60.348  10.276  1.00 9.55  ? 918  ASN A CB    1 
ATOM   6981  C  CG    . ASN A 1 917  ? 5.386   -59.909  11.697  1.00 8.69  ? 918  ASN A CG    1 
ATOM   6982  O  OD1   . ASN A 1 917  ? 5.376   -58.726  11.992  1.00 8.95  ? 918  ASN A OD1   1 
ATOM   6983  N  ND2   . ASN A 1 917  ? 5.383   -60.869  12.604  1.00 8.66  ? 918  ASN A ND2   1 
ATOM   6984  N  N     . ASP A 1 918  ? 6.371   -63.273  8.374   1.00 11.25 ? 919  ASP A N     1 
ATOM   6985  C  CA    . ASP A 1 918  ? 6.139   -63.937  7.112   1.00 11.67 ? 919  ASP A CA    1 
ATOM   6986  C  C     . ASP A 1 918  ? 5.797   -65.340  7.504   1.00 11.15 ? 919  ASP A C     1 
ATOM   6987  O  O     . ASP A 1 918  ? 6.589   -66.013  8.136   1.00 11.67 ? 919  ASP A O     1 
ATOM   6988  C  CB    . ASP A 1 918  ? 7.439   -63.944  6.314   1.00 13.68 ? 919  ASP A CB    1 
ATOM   6989  C  CG    . ASP A 1 918  ? 7.208   -63.985  4.826   1.00 16.08 ? 919  ASP A CG    1 
ATOM   6990  O  OD1   . ASP A 1 918  ? 6.586   -63.020  4.307   1.00 17.75 ? 919  ASP A OD1   1 
ATOM   6991  O  OD2   . ASP A 1 918  ? 7.659   -64.962  4.167   1.00 17.25 ? 919  ASP A OD2   1 
ATOM   6992  N  N     . PRO A 1 919  ? 4.601   -65.806  7.174   1.00 10.47 ? 920  PRO A N     1 
ATOM   6993  C  CA    . PRO A 1 919  ? 4.313   -67.180  7.578   1.00 10.39 ? 920  PRO A CA    1 
ATOM   6994  C  C     . PRO A 1 919  ? 5.104   -68.273  6.832   1.00 10.57 ? 920  PRO A C     1 
ATOM   6995  O  O     . PRO A 1 919  ? 4.878   -69.475  7.031   1.00 11.58 ? 920  PRO A O     1 
ATOM   6996  C  CB    . PRO A 1 919  ? 2.806   -67.281  7.358   1.00 9.89  ? 920  PRO A CB    1 
ATOM   6997  C  CG    . PRO A 1 919  ? 2.514   -66.264  6.354   1.00 9.49  ? 920  PRO A CG    1 
ATOM   6998  C  CD    . PRO A 1 919  ? 3.381   -65.120  6.738   1.00 10.12 ? 920  PRO A CD    1 
ATOM   6999  N  N     . ILE A 1 920  ? 6.069   -67.848  6.019   1.00 10.48 ? 921  ILE A N     1 
ATOM   7000  C  CA    . ILE A 1 920  ? 6.920   -68.745  5.225   1.00 10.13 ? 921  ILE A CA    1 
ATOM   7001  C  C     . ILE A 1 920  ? 8.343   -68.666  5.744   1.00 10.02 ? 921  ILE A C     1 
ATOM   7002  O  O     . ILE A 1 920  ? 8.957   -69.685  6.078   1.00 9.61  ? 921  ILE A O     1 
ATOM   7003  C  CB    . ILE A 1 920  ? 6.892   -68.322  3.723   1.00 10.05 ? 921  ILE A CB    1 
ATOM   7004  C  CG1   . ILE A 1 920  ? 5.705   -68.956  3.028   1.00 9.40  ? 921  ILE A CG1   1 
ATOM   7005  C  CG2   . ILE A 1 920  ? 8.185   -68.672  2.988   1.00 10.30 ? 921  ILE A CG2   1 
ATOM   7006  C  CD1   . ILE A 1 920  ? 5.117   -68.031  2.012   1.00 10.34 ? 921  ILE A CD1   1 
ATOM   7007  N  N     . LYS A 1 921  ? 8.859   -67.439  5.772   1.00 9.86  ? 922  LYS A N     1 
ATOM   7008  C  CA    . LYS A 1 921  ? 10.199  -67.178  6.239   1.00 10.14 ? 922  LYS A CA    1 
ATOM   7009  C  C     . LYS A 1 921  ? 10.271  -67.366  7.744   1.00 10.32 ? 922  LYS A C     1 
ATOM   7010  O  O     . LYS A 1 921  ? 11.231  -67.951  8.242   1.00 10.96 ? 922  LYS A O     1 
ATOM   7011  C  CB    . LYS A 1 921  ? 10.653  -65.771  5.839   1.00 10.26 ? 922  LYS A CB    1 
ATOM   7012  C  CG    . LYS A 1 921  ? 10.858  -65.560  4.315   1.00 11.37 ? 922  LYS A CG    1 
ATOM   7013  C  CD    . LYS A 1 921  ? 11.917  -66.510  3.719   1.00 11.87 ? 922  LYS A CD    1 
ATOM   7014  C  CE    . LYS A 1 921  ? 12.085  -66.366  2.198   1.00 12.07 ? 922  LYS A CE    1 
ATOM   7015  N  NZ    . LYS A 1 921  ? 12.659  -65.046  1.722   1.00 13.06 ? 922  LYS A NZ    1 
ATOM   7016  N  N     . SER A 1 922  ? 9.246   -66.923  8.469   1.00 10.03 ? 923  SER A N     1 
ATOM   7017  C  CA    . SER A 1 922  ? 9.252   -67.071  9.916   1.00 9.80  ? 923  SER A CA    1 
ATOM   7018  C  C     . SER A 1 922  ? 9.370   -68.531  10.258  1.00 9.68  ? 923  SER A C     1 
ATOM   7019  O  O     . SER A 1 922  ? 10.023  -68.876  11.219  1.00 9.70  ? 923  SER A O     1 
ATOM   7020  C  CB    . SER A 1 922  ? 7.998   -66.490  10.555  1.00 9.82  ? 923  SER A CB    1 
ATOM   7021  O  OG    . SER A 1 922  ? 6.882   -67.320  10.303  1.00 10.50 ? 923  SER A OG    1 
ATOM   7022  N  N     . LYS A 1 923  ? 8.749   -69.392  9.464   1.00 10.34 ? 924  LYS A N     1 
ATOM   7023  C  CA    . LYS A 1 923  ? 8.821   -70.838  9.703   1.00 10.76 ? 924  LYS A CA    1 
ATOM   7024  C  C     . LYS A 1 923  ? 10.082  -71.428  9.123   1.00 10.97 ? 924  LYS A C     1 
ATOM   7025  O  O     . LYS A 1 923  ? 10.699  -72.283  9.738   1.00 10.47 ? 924  LYS A O     1 
ATOM   7026  C  CB    . LYS A 1 923  ? 7.635   -71.593  9.097   1.00 10.46 ? 924  LYS A CB    1 
ATOM   7027  C  CG    . LYS A 1 923  ? 7.778   -73.099  9.306   1.00 10.40 ? 924  LYS A CG    1 
ATOM   7028  C  CD    . LYS A 1 923  ? 6.841   -73.907  8.434   1.00 10.44 ? 924  LYS A CD    1 
ATOM   7029  C  CE    . LYS A 1 923  ? 7.103   -75.399  8.533   1.00 10.27 ? 924  LYS A CE    1 
ATOM   7030  N  NZ    . LYS A 1 923  ? 7.014   -75.903  9.942   1.00 11.39 ? 924  LYS A NZ    1 
ATOM   7031  N  N     . GLU A 1 924  ? 10.424  -71.007  7.908   1.00 11.78 ? 925  GLU A N     1 
ATOM   7032  C  CA    . GLU A 1 924  ? 11.623  -71.497  7.247   1.00 13.02 ? 925  GLU A CA    1 
ATOM   7033  C  C     . GLU A 1 924  ? 12.801  -71.335  8.180   1.00 13.57 ? 925  GLU A C     1 
ATOM   7034  O  O     . GLU A 1 924  ? 13.619  -72.246  8.325   1.00 14.14 ? 925  GLU A O     1 
ATOM   7035  C  CB    . GLU A 1 924  ? 11.929  -70.709  5.986   1.00 13.16 ? 925  GLU A CB    1 
ATOM   7036  C  CG    . GLU A 1 924  ? 13.212  -71.177  5.346   1.00 14.23 ? 925  GLU A CG    1 
ATOM   7037  C  CD    . GLU A 1 924  ? 13.686  -70.284  4.237   1.00 15.62 ? 925  GLU A CD    1 
ATOM   7038  O  OE1   . GLU A 1 924  ? 12.849  -69.628  3.572   1.00 16.45 ? 925  GLU A OE1   1 
ATOM   7039  O  OE2   . GLU A 1 924  ? 14.915  -70.236  4.020   1.00 16.64 ? 925  GLU A OE2   1 
ATOM   7040  N  N     . TYR A 1 925  ? 12.876  -70.154  8.788   1.00 14.01 ? 926  TYR A N     1 
ATOM   7041  C  CA    . TYR A 1 925  ? 13.923  -69.795  9.723   1.00 14.50 ? 926  TYR A CA    1 
ATOM   7042  C  C     . TYR A 1 925  ? 13.727  -70.319  11.126  1.00 14.75 ? 926  TYR A C     1 
ATOM   7043  O  O     . TYR A 1 925  ? 14.689  -70.688  11.783  1.00 15.65 ? 926  TYR A O     1 
ATOM   7044  C  CB    . TYR A 1 925  ? 14.091  -68.287  9.758   1.00 15.05 ? 926  TYR A CB    1 
ATOM   7045  C  CG    . TYR A 1 925  ? 14.888  -67.819  8.588   1.00 16.74 ? 926  TYR A CG    1 
ATOM   7046  C  CD1   . TYR A 1 925  ? 16.223  -68.216  8.449   1.00 17.45 ? 926  TYR A CD1   1 
ATOM   7047  C  CD2   . TYR A 1 925  ? 14.322  -67.018  7.590   1.00 17.01 ? 926  TYR A CD2   1 
ATOM   7048  C  CE1   . TYR A 1 925  ? 16.979  -67.837  7.348   1.00 17.24 ? 926  TYR A CE1   1 
ATOM   7049  C  CE2   . TYR A 1 925  ? 15.078  -66.625  6.476   1.00 17.25 ? 926  TYR A CE2   1 
ATOM   7050  C  CZ    . TYR A 1 925  ? 16.406  -67.045  6.374   1.00 17.29 ? 926  TYR A CZ    1 
ATOM   7051  O  OH    . TYR A 1 925  ? 17.185  -66.678  5.315   1.00 18.07 ? 926  TYR A OH    1 
ATOM   7052  N  N     . GLY A 1 926  ? 12.494  -70.334  11.609  1.00 14.54 ? 927  GLY A N     1 
ATOM   7053  C  CA    . GLY A 1 926  ? 12.260  -70.832  12.951  1.00 14.27 ? 927  GLY A CA    1 
ATOM   7054  C  C     . GLY A 1 926  ? 12.621  -72.303  13.060  1.00 14.27 ? 927  GLY A C     1 
ATOM   7055  O  O     . GLY A 1 926  ? 13.043  -72.769  14.114  1.00 14.48 ? 927  GLY A O     1 
ATOM   7056  N  N     . ASP A 1 927  ? 12.462  -73.043  11.969  1.00 14.04 ? 928  ASP A N     1 
ATOM   7057  C  CA    . ASP A 1 927  ? 12.770  -74.459  11.983  1.00 13.63 ? 928  ASP A CA    1 
ATOM   7058  C  C     . ASP A 1 927  ? 14.258  -74.675  12.014  1.00 13.80 ? 928  ASP A C     1 
ATOM   7059  O  O     . ASP A 1 927  ? 14.729  -75.583  12.694  1.00 14.11 ? 928  ASP A O     1 
ATOM   7060  C  CB    . ASP A 1 927  ? 12.188  -75.139  10.773  1.00 13.49 ? 928  ASP A CB    1 
ATOM   7061  C  CG    . ASP A 1 927  ? 10.724  -74.871  10.612  1.00 13.65 ? 928  ASP A CG    1 
ATOM   7062  O  OD1   . ASP A 1 927  ? 10.065  -74.457  11.594  1.00 14.08 ? 928  ASP A OD1   1 
ATOM   7063  O  OD2   . ASP A 1 927  ? 10.238  -75.063  9.481   1.00 13.76 ? 928  ASP A OD2   1 
ATOM   7064  N  N     . LYS A 1 928  ? 14.995  -73.858  11.264  1.00 13.95 ? 929  LYS A N     1 
ATOM   7065  C  CA    . LYS A 1 928  ? 16.451  -73.951  11.232  1.00 14.26 ? 929  LYS A CA    1 
ATOM   7066  C  C     . LYS A 1 928  ? 16.917  -73.689  12.648  1.00 14.52 ? 929  LYS A C     1 
ATOM   7067  O  O     . LYS A 1 928  ? 17.774  -74.369  13.190  1.00 15.15 ? 929  LYS A O     1 
ATOM   7068  C  CB    . LYS A 1 928  ? 17.043  -72.872  10.327  1.00 14.62 ? 929  LYS A CB    1 
ATOM   7069  C  CG    . LYS A 1 928  ? 17.105  -73.232  8.840   1.00 15.68 ? 929  LYS A CG    1 
ATOM   7070  C  CD    . LYS A 1 928  ? 17.571  -72.025  7.982   1.00 16.09 ? 929  LYS A CD    1 
ATOM   7071  C  CE    . LYS A 1 928  ? 17.484  -72.336  6.483   1.00 16.97 ? 929  LYS A CE    1 
ATOM   7072  N  NZ    . LYS A 1 928  ? 17.369  -71.125  5.605   1.00 16.94 ? 929  LYS A NZ    1 
ATOM   7073  N  N     . LEU A 1 929  ? 16.246  -72.747  13.272  1.00 14.61 ? 930  LEU A N     1 
ATOM   7074  C  CA    . LEU A 1 929  ? 16.552  -72.329  14.617  1.00 14.86 ? 930  LEU A CA    1 
ATOM   7075  C  C     . LEU A 1 929  ? 16.101  -73.376  15.618  1.00 15.01 ? 930  LEU A C     1 
ATOM   7076  O  O     . LEU A 1 929  ? 16.736  -73.586  16.628  1.00 14.64 ? 930  LEU A O     1 
ATOM   7077  C  CB    . LEU A 1 929  ? 15.823  -71.007  14.838  1.00 14.66 ? 930  LEU A CB    1 
ATOM   7078  C  CG    . LEU A 1 929  ? 16.303  -69.871  15.721  1.00 14.18 ? 930  LEU A CG    1 
ATOM   7079  C  CD1   . LEU A 1 929  ? 17.796  -69.952  15.973  1.00 13.99 ? 930  LEU A CD1   1 
ATOM   7080  C  CD2   . LEU A 1 929  ? 15.897  -68.583  15.003  1.00 13.78 ? 930  LEU A CD2   1 
ATOM   7081  N  N     . LYS A 1 930  ? 15.015  -74.064  15.310  1.00 16.06 ? 931  LYS A N     1 
ATOM   7082  C  CA    . LYS A 1 930  ? 14.500  -75.063  16.233  1.00 17.55 ? 931  LYS A CA    1 
ATOM   7083  C  C     . LYS A 1 930  ? 15.470  -76.220  16.301  1.00 17.88 ? 931  LYS A C     1 
ATOM   7084  O  O     . LYS A 1 930  ? 15.561  -76.888  17.328  1.00 18.21 ? 931  LYS A O     1 
ATOM   7085  C  CB    . LYS A 1 930  ? 13.103  -75.552  15.814  1.00 18.13 ? 931  LYS A CB    1 
ATOM   7086  C  CG    . LYS A 1 930  ? 12.343  -76.296  16.919  1.00 18.82 ? 931  LYS A CG    1 
ATOM   7087  C  CD    . LYS A 1 930  ? 11.058  -77.006  16.430  1.00 19.87 ? 931  LYS A CD    1 
ATOM   7088  C  CE    . LYS A 1 930  ? 10.035  -76.065  15.759  1.00 20.71 ? 931  LYS A CE    1 
ATOM   7089  N  NZ    . LYS A 1 930  ? 8.819   -76.792  15.220  1.00 20.85 ? 931  LYS A NZ    1 
ATOM   7090  N  N     . LYS A 1 931  ? 16.181  -76.455  15.200  1.00 18.38 ? 932  LYS A N     1 
ATOM   7091  C  CA    . LYS A 1 931  ? 17.170  -77.531  15.135  1.00 19.16 ? 932  LYS A CA    1 
ATOM   7092  C  C     . LYS A 1 931  ? 18.497  -77.013  15.691  1.00 18.89 ? 932  LYS A C     1 
ATOM   7093  O  O     . LYS A 1 931  ? 19.179  -77.710  16.449  1.00 18.77 ? 932  LYS A O     1 
ATOM   7094  C  CB    . LYS A 1 931  ? 17.390  -77.996  13.679  1.00 20.63 ? 932  LYS A CB    1 
ATOM   7095  C  CG    . LYS A 1 931  ? 16.241  -78.797  13.050  1.00 22.53 ? 932  LYS A CG    1 
ATOM   7096  C  CD    . LYS A 1 931  ? 16.422  -79.048  11.512  1.00 23.92 ? 932  LYS A CD    1 
ATOM   7097  C  CE    . LYS A 1 931  ? 17.454  -80.157  11.155  1.00 25.57 ? 932  LYS A CE    1 
ATOM   7098  N  NZ    . LYS A 1 931  ? 17.478  -80.590  9.686   1.00 25.72 ? 932  LYS A NZ    1 
ATOM   7099  N  N     . LEU A 1 932  ? 18.835  -75.780  15.313  1.00 18.13 ? 933  LEU A N     1 
ATOM   7100  C  CA    . LEU A 1 932  ? 20.071  -75.133  15.725  1.00 17.67 ? 933  LEU A CA    1 
ATOM   7101  C  C     . LEU A 1 932  ? 20.232  -74.940  17.234  1.00 18.23 ? 933  LEU A C     1 
ATOM   7102  O  O     . LEU A 1 932  ? 21.348  -75.053  17.756  1.00 18.73 ? 933  LEU A O     1 
ATOM   7103  C  CB    . LEU A 1 932  ? 20.239  -73.795  15.002  1.00 16.82 ? 933  LEU A CB    1 
ATOM   7104  C  CG    . LEU A 1 932  ? 20.880  -73.826  13.612  1.00 15.96 ? 933  LEU A CG    1 
ATOM   7105  C  CD1   . LEU A 1 932  ? 21.150  -72.430  13.108  1.00 15.57 ? 933  LEU A CD1   1 
ATOM   7106  C  CD2   . LEU A 1 932  ? 22.172  -74.567  13.677  1.00 15.72 ? 933  LEU A CD2   1 
ATOM   7107  N  N     . LEU A 1 933  ? 19.137  -74.632  17.930  1.00 18.25 ? 934  LEU A N     1 
ATOM   7108  C  CA    . LEU A 1 933  ? 19.165  -74.433  19.375  1.00 17.99 ? 934  LEU A CA    1 
ATOM   7109  C  C     . LEU A 1 933  ? 18.662  -75.671  20.105  1.00 18.99 ? 934  LEU A C     1 
ATOM   7110  O  O     . LEU A 1 933  ? 18.283  -75.615  21.272  1.00 18.86 ? 934  LEU A O     1 
ATOM   7111  C  CB    . LEU A 1 933  ? 18.306  -73.243  19.772  1.00 16.73 ? 934  LEU A CB    1 
ATOM   7112  C  CG    . LEU A 1 933  ? 18.559  -71.951  19.021  1.00 16.46 ? 934  LEU A CG    1 
ATOM   7113  C  CD1   . LEU A 1 933  ? 17.703  -70.878  19.642  1.00 16.26 ? 934  LEU A CD1   1 
ATOM   7114  C  CD2   . LEU A 1 933  ? 20.037  -71.572  19.045  1.00 16.17 ? 934  LEU A CD2   1 
ATOM   7115  N  N     . ALA A 1 934  ? 18.664  -76.808  19.435  1.00 20.36 ? 935  ALA A N     1 
ATOM   7116  C  CA    . ALA A 1 934  ? 18.182  -77.996  20.099  1.00 22.38 ? 935  ALA A CA    1 
ATOM   7117  C  C     . ALA A 1 934  ? 19.105  -78.344  21.271  1.00 23.68 ? 935  ALA A C     1 
ATOM   7118  O  O     . ALA A 1 934  ? 20.329  -78.357  21.126  1.00 24.20 ? 935  ALA A O     1 
ATOM   7119  C  CB    . ALA A 1 934  ? 18.094  -79.129  19.121  1.00 22.70 ? 935  ALA A CB    1 
ATOM   7120  N  N     . GLY A 1 935  ? 18.512  -78.546  22.446  1.00 25.04 ? 936  GLY A N     1 
ATOM   7121  C  CA    . GLY A 1 935  ? 19.294  -78.890  23.624  1.00 26.02 ? 936  GLY A CA    1 
ATOM   7122  C  C     . GLY A 1 935  ? 19.704  -77.686  24.449  1.00 26.94 ? 936  GLY A C     1 
ATOM   7123  O  O     . GLY A 1 935  ? 19.829  -77.777  25.672  1.00 27.09 ? 936  GLY A O     1 
ATOM   7124  N  N     . GLN A 1 936  ? 19.919  -76.563  23.768  1.00 27.68 ? 937  GLN A N     1 
ATOM   7125  C  CA    . GLN A 1 936  ? 20.305  -75.297  24.392  1.00 28.49 ? 937  GLN A CA    1 
ATOM   7126  C  C     . GLN A 1 936  ? 19.433  -75.032  25.619  1.00 28.93 ? 937  GLN A C     1 
ATOM   7127  O  O     . GLN A 1 936  ? 18.207  -75.103  25.521  1.00 29.42 ? 937  GLN A O     1 
ATOM   7128  C  CB    . GLN A 1 936  ? 20.090  -74.172  23.381  1.00 28.67 ? 937  GLN A CB    1 
ATOM   7129  C  CG    . GLN A 1 936  ? 20.708  -72.848  23.731  1.00 28.99 ? 937  GLN A CG    1 
ATOM   7130  C  CD    . GLN A 1 936  ? 22.200  -72.879  23.597  1.00 29.14 ? 937  GLN A CD    1 
ATOM   7131  O  OE1   . GLN A 1 936  ? 22.738  -73.340  22.584  1.00 28.87 ? 937  GLN A OE1   1 
ATOM   7132  N  NE2   . GLN A 1 936  ? 22.891  -72.409  24.633  1.00 30.30 ? 937  GLN A NE2   1 
ATOM   7133  N  N     . LYS A 1 937  ? 20.052  -74.750  26.766  1.00 29.16 ? 938  LYS A N     1 
ATOM   7134  C  CA    . LYS A 1 937  ? 19.297  -74.481  27.988  1.00 29.12 ? 938  LYS A CA    1 
ATOM   7135  C  C     . LYS A 1 937  ? 19.849  -73.347  28.829  1.00 28.87 ? 938  LYS A C     1 
ATOM   7136  O  O     . LYS A 1 937  ? 19.183  -72.869  29.746  1.00 29.54 ? 938  LYS A O     1 
ATOM   7137  C  CB    . LYS A 1 937  ? 19.144  -75.758  28.827  1.00 29.25 ? 938  LYS A CB    1 
ATOM   7138  C  CG    . LYS A 1 937  ? 18.005  -76.637  28.322  1.00 30.91 ? 938  LYS A CG    1 
ATOM   7139  C  CD    . LYS A 1 937  ? 18.207  -78.142  28.556  1.00 32.48 ? 938  LYS A CD    1 
ATOM   7140  C  CE    . LYS A 1 937  ? 17.079  -78.983  27.886  1.00 33.33 ? 938  LYS A CE    1 
ATOM   7141  N  NZ    . LYS A 1 937  ? 17.271  -79.280  26.419  1.00 33.84 ? 938  LYS A NZ    1 
ATOM   7142  N  N     . ASP A 1 938  ? 21.037  -72.867  28.505  1.00 28.12 ? 939  ASP A N     1 
ATOM   7143  C  CA    . ASP A 1 938  ? 21.592  -71.788  29.302  1.00 27.43 ? 939  ASP A CA    1 
ATOM   7144  C  C     . ASP A 1 938  ? 21.412  -70.423  28.670  1.00 26.09 ? 939  ASP A C     1 
ATOM   7145  O  O     . ASP A 1 938  ? 21.584  -70.262  27.463  1.00 26.49 ? 939  ASP A O     1 
ATOM   7146  C  CB    . ASP A 1 938  ? 23.081  -72.021  29.549  1.00 29.14 ? 939  ASP A CB    1 
ATOM   7147  C  CG    . ASP A 1 938  ? 23.412  -73.480  29.738  1.00 30.66 ? 939  ASP A CG    1 
ATOM   7148  O  OD1   . ASP A 1 938  ? 22.943  -74.071  30.745  1.00 31.35 ? 939  ASP A OD1   1 
ATOM   7149  O  OD2   . ASP A 1 938  ? 24.121  -74.029  28.856  1.00 31.98 ? 939  ASP A OD2   1 
ATOM   7150  N  N     . GLY A 1 939  ? 21.048  -69.453  29.503  1.00 24.30 ? 940  GLY A N     1 
ATOM   7151  C  CA    . GLY A 1 939  ? 20.896  -68.073  29.076  1.00 21.79 ? 940  GLY A CA    1 
ATOM   7152  C  C     . GLY A 1 939  ? 20.297  -67.796  27.725  1.00 20.04 ? 940  GLY A C     1 
ATOM   7153  O  O     . GLY A 1 939  ? 19.747  -68.678  27.101  1.00 19.94 ? 940  GLY A O     1 
ATOM   7154  N  N     . LEU A 1 940  ? 20.382  -66.541  27.307  1.00 18.93 ? 941  LEU A N     1 
ATOM   7155  C  CA    . LEU A 1 940  ? 19.856  -66.062  26.035  1.00 17.68 ? 941  LEU A CA    1 
ATOM   7156  C  C     . LEU A 1 940  ? 19.481  -67.131  25.024  1.00 17.16 ? 941  LEU A C     1 
ATOM   7157  O  O     . LEU A 1 940  ? 18.307  -67.369  24.745  1.00 17.35 ? 941  LEU A O     1 
ATOM   7158  C  CB    . LEU A 1 940  ? 20.860  -65.111  25.389  1.00 17.27 ? 941  LEU A CB    1 
ATOM   7159  C  CG    . LEU A 1 940  ? 20.387  -63.683  25.124  1.00 17.73 ? 941  LEU A CG    1 
ATOM   7160  C  CD1   . LEU A 1 940  ? 21.233  -63.051  24.019  1.00 17.85 ? 941  LEU A CD1   1 
ATOM   7161  C  CD2   . LEU A 1 940  ? 18.936  -63.698  24.712  1.00 18.02 ? 941  LEU A CD2   1 
ATOM   7162  N  N     . LEU A 1 941  ? 20.485  -67.816  24.510  1.00 16.31 ? 942  LEU A N     1 
ATOM   7163  C  CA    . LEU A 1 941  ? 20.265  -68.842  23.521  1.00 15.43 ? 942  LEU A CA    1 
ATOM   7164  C  C     . LEU A 1 941  ? 19.287  -69.901  23.978  1.00 14.58 ? 942  LEU A C     1 
ATOM   7165  O  O     . LEU A 1 941  ? 18.555  -70.467  23.187  1.00 14.71 ? 942  LEU A O     1 
ATOM   7166  C  CB    . LEU A 1 941  ? 21.585  -69.473  23.164  1.00 16.19 ? 942  LEU A CB    1 
ATOM   7167  C  CG    . LEU A 1 941  ? 21.795  -69.476  21.657  1.00 17.07 ? 942  LEU A CG    1 
ATOM   7168  C  CD1   . LEU A 1 941  ? 21.848  -68.049  21.073  1.00 16.36 ? 942  LEU A CD1   1 
ATOM   7169  C  CD2   . LEU A 1 941  ? 23.077  -70.229  21.400  1.00 17.65 ? 942  LEU A CD2   1 
ATOM   7170  N  N     . GLY A 1 942  ? 19.342  -70.243  25.247  1.00 13.66 ? 943  GLY A N     1 
ATOM   7171  C  CA    . GLY A 1 942  ? 18.407  -71.216  25.758  1.00 13.05 ? 943  GLY A CA    1 
ATOM   7172  C  C     . GLY A 1 942  ? 17.015  -70.618  25.792  1.00 12.39 ? 943  GLY A C     1 
ATOM   7173  O  O     . GLY A 1 942  ? 16.047  -71.284  25.437  1.00 13.15 ? 943  GLY A O     1 
ATOM   7174  N  N     . GLN A 1 943  ? 16.901  -69.364  26.216  1.00 11.61 ? 944  GLN A N     1 
ATOM   7175  C  CA    . GLN A 1 943  ? 15.603  -68.706  26.299  1.00 10.55 ? 944  GLN A CA    1 
ATOM   7176  C  C     . GLN A 1 943  ? 14.933  -68.858  24.940  1.00 10.10 ? 944  GLN A C     1 
ATOM   7177  O  O     . GLN A 1 943  ? 13.895  -69.509  24.836  1.00 10.16 ? 944  GLN A O     1 
ATOM   7178  C  CB    . GLN A 1 943  ? 15.730  -67.207  26.640  1.00 10.35 ? 944  GLN A CB    1 
ATOM   7179  C  CG    . GLN A 1 943  ? 16.314  -66.860  28.006  1.00 10.30 ? 944  GLN A CG    1 
ATOM   7180  C  CD    . GLN A 1 943  ? 15.823  -65.505  28.530  1.00 10.88 ? 944  GLN A CD    1 
ATOM   7181  O  OE1   . GLN A 1 943  ? 14.626  -65.313  28.753  1.00 11.67 ? 944  GLN A OE1   1 
ATOM   7182  N  NE2   . GLN A 1 943  ? 16.741  -64.569  28.737  1.00 10.72 ? 944  GLN A NE2   1 
ATOM   7183  N  N     . ILE A 1 944  ? 15.590  -68.352  23.896  1.00 8.86  ? 945  ILE A N     1 
ATOM   7184  C  CA    . ILE A 1 944  ? 15.058  -68.402  22.551  1.00 7.88  ? 945  ILE A CA    1 
ATOM   7185  C  C     . ILE A 1 944  ? 14.734  -69.815  22.132  1.00 8.07  ? 945  ILE A C     1 
ATOM   7186  O  O     . ILE A 1 944  ? 13.855  -70.032  21.307  1.00 8.26  ? 945  ILE A O     1 
ATOM   7187  C  CB    . ILE A 1 944  ? 16.042  -67.860  21.541  1.00 7.73  ? 945  ILE A CB    1 
ATOM   7188  C  CG1   . ILE A 1 944  ? 16.585  -66.528  22.002  1.00 8.63  ? 945  ILE A CG1   1 
ATOM   7189  C  CG2   . ILE A 1 944  ? 15.359  -67.647  20.209  1.00 7.43  ? 945  ILE A CG2   1 
ATOM   7190  C  CD1   . ILE A 1 944  ? 17.576  -65.918  21.032  1.00 9.48  ? 945  ILE A CD1   1 
ATOM   7191  N  N     . ALA A 1 945  ? 15.477  -70.782  22.651  1.00 7.94  ? 946  ALA A N     1 
ATOM   7192  C  CA    . ALA A 1 945  ? 15.234  -72.168  22.304  1.00 7.50  ? 946  ALA A CA    1 
ATOM   7193  C  C     . ALA A 1 945  ? 13.888  -72.581  22.858  1.00 7.61  ? 946  ALA A C     1 
ATOM   7194  O  O     . ALA A 1 945  ? 13.167  -73.348  22.223  1.00 8.49  ? 946  ALA A O     1 
ATOM   7195  C  CB    . ALA A 1 945  ? 16.297  -73.036  22.857  1.00 7.22  ? 946  ALA A CB    1 
ATOM   7196  N  N     . ALA A 1 946  ? 13.527  -72.064  24.026  1.00 7.27  ? 947  ALA A N     1 
ATOM   7197  C  CA    . ALA A 1 946  ? 12.240  -72.399  24.629  1.00 7.15  ? 947  ALA A CA    1 
ATOM   7198  C  C     . ALA A 1 946  ? 11.026  -71.658  24.056  1.00 7.20  ? 947  ALA A C     1 
ATOM   7199  O  O     . ALA A 1 946  ? 9.894   -72.052  24.297  1.00 8.31  ? 947  ALA A O     1 
ATOM   7200  C  CB    . ALA A 1 946  ? 12.290  -72.201  26.105  1.00 6.90  ? 947  ALA A CB    1 
ATOM   7201  N  N     . MET A 1 947  ? 11.237  -70.593  23.304  1.00 6.33  ? 948  MET A N     1 
ATOM   7202  C  CA    . MET A 1 947  ? 10.118  -69.858  22.752  1.00 5.43  ? 948  MET A CA    1 
ATOM   7203  C  C     . MET A 1 947  ? 9.804   -70.305  21.344  1.00 5.70  ? 948  MET A C     1 
ATOM   7204  O  O     . MET A 1 947  ? 9.260   -69.547  20.535  1.00 5.83  ? 948  MET A O     1 
ATOM   7205  C  CB    . MET A 1 947  ? 10.439  -68.388  22.776  1.00 4.73  ? 948  MET A CB    1 
ATOM   7206  C  CG    . MET A 1 947  ? 10.555  -67.850  24.148  1.00 4.70  ? 948  MET A CG    1 
ATOM   7207  S  SD    . MET A 1 947  ? 11.343  -66.289  24.067  1.00 5.54  ? 948  MET A SD    1 
ATOM   7208  C  CE    . MET A 1 947  ? 9.911   -65.204  24.111  1.00 5.97  ? 948  MET A CE    1 
ATOM   7209  N  N     . SER A 1 948  ? 10.079  -71.575  21.085  1.00 5.97  ? 949  SER A N     1 
ATOM   7210  C  CA    . SER A 1 948  ? 9.879   -72.169  19.776  1.00 6.03  ? 949  SER A CA    1 
ATOM   7211  C  C     . SER A 1 948  ? 8.447   -72.224  19.265  1.00 6.52  ? 949  SER A C     1 
ATOM   7212  O  O     . SER A 1 948  ? 8.250   -72.475  18.073  1.00 6.96  ? 949  SER A O     1 
ATOM   7213  C  CB    . SER A 1 948  ? 10.526  -73.549  19.738  1.00 5.45  ? 949  SER A CB    1 
ATOM   7214  O  OG    . SER A 1 948  ? 9.601   -74.529  19.342  1.00 5.39  ? 949  SER A OG    1 
ATOM   7215  N  N     . ASP A 1 949  ? 7.455   -72.037  20.142  1.00 6.78  ? 950  ASP A N     1 
ATOM   7216  C  CA    . ASP A 1 949  ? 6.061   -72.038  19.703  1.00 6.88  ? 950  ASP A CA    1 
ATOM   7217  C  C     . ASP A 1 949  ? 5.584   -70.640  19.377  1.00 6.19  ? 950  ASP A C     1 
ATOM   7218  O  O     . ASP A 1 949  ? 4.394   -70.411  19.172  1.00 6.05  ? 950  ASP A O     1 
ATOM   7219  C  CB    . ASP A 1 949  ? 5.116   -72.744  20.679  1.00 8.31  ? 950  ASP A CB    1 
ATOM   7220  C  CG    . ASP A 1 949  ? 5.157   -72.183  22.080  1.00 9.95  ? 950  ASP A CG    1 
ATOM   7221  O  OD1   . ASP A 1 949  ? 6.234   -71.777  22.566  1.00 11.78 ? 950  ASP A OD1   1 
ATOM   7222  O  OD2   . ASP A 1 949  ? 4.100   -72.217  22.738  1.00 10.58 ? 950  ASP A OD2   1 
ATOM   7223  N  N     . LEU A 1 950  ? 6.565   -69.755  19.187  1.00 5.39  ? 951  LEU A N     1 
ATOM   7224  C  CA    . LEU A 1 950  ? 6.369   -68.352  18.849  1.00 4.27  ? 951  LEU A CA    1 
ATOM   7225  C  C     . LEU A 1 950  ? 7.147   -67.959  17.580  1.00 4.42  ? 951  LEU A C     1 
ATOM   7226  O  O     . LEU A 1 950  ? 6.933   -66.875  17.030  1.00 4.06  ? 951  LEU A O     1 
ATOM   7227  C  CB    . LEU A 1 950  ? 6.842   -67.495  20.007  1.00 2.79  ? 951  LEU A CB    1 
ATOM   7228  C  CG    . LEU A 1 950  ? 6.084   -67.716  21.302  1.00 2.38  ? 951  LEU A CG    1 
ATOM   7229  C  CD1   . LEU A 1 950  ? 6.664   -66.853  22.361  1.00 2.15  ? 951  LEU A CD1   1 
ATOM   7230  C  CD2   . LEU A 1 950  ? 4.645   -67.348  21.105  1.00 2.00  ? 951  LEU A CD2   1 
ATOM   7231  N  N     . TYR A 1 951  ? 8.020   -68.857  17.107  1.00 4.54  ? 952  TYR A N     1 
ATOM   7232  C  CA    . TYR A 1 951  ? 8.852   -68.629  15.915  1.00 4.29  ? 952  TYR A CA    1 
ATOM   7233  C  C     . TYR A 1 951  ? 8.070   -68.317  14.644  1.00 3.99  ? 952  TYR A C     1 
ATOM   7234  O  O     . TYR A 1 951  ? 8.435   -67.418  13.906  1.00 3.91  ? 952  TYR A O     1 
ATOM   7235  C  CB    . TYR A 1 951  ? 9.738   -69.850  15.572  1.00 4.97  ? 952  TYR A CB    1 
ATOM   7236  C  CG    . TYR A 1 951  ? 10.865  -70.274  16.520  1.00 5.40  ? 952  TYR A CG    1 
ATOM   7237  C  CD1   . TYR A 1 951  ? 11.395  -69.414  17.488  1.00 6.01  ? 952  TYR A CD1   1 
ATOM   7238  C  CD2   . TYR A 1 951  ? 11.409  -71.553  16.423  1.00 6.02  ? 952  TYR A CD2   1 
ATOM   7239  C  CE1   . TYR A 1 951  ? 12.443  -69.824  18.338  1.00 5.82  ? 952  TYR A CE1   1 
ATOM   7240  C  CE2   . TYR A 1 951  ? 12.446  -71.969  17.261  1.00 6.31  ? 952  TYR A CE2   1 
ATOM   7241  C  CZ    . TYR A 1 951  ? 12.961  -71.102  18.215  1.00 5.92  ? 952  TYR A CZ    1 
ATOM   7242  O  OH    . TYR A 1 951  ? 13.983  -71.543  19.026  1.00 5.22  ? 952  TYR A OH    1 
ATOM   7243  N  N     . THR A 1 952  ? 7.052   -69.115  14.329  1.00 4.18  ? 953  THR A N     1 
ATOM   7244  C  CA    . THR A 1 952  ? 6.284   -68.898  13.084  1.00 4.59  ? 953  THR A CA    1 
ATOM   7245  C  C     . THR A 1 952  ? 4.997   -68.079  13.213  1.00 4.62  ? 953  THR A C     1 
ATOM   7246  O  O     . THR A 1 952  ? 4.136   -68.399  14.037  1.00 4.67  ? 953  THR A O     1 
ATOM   7247  C  CB    . THR A 1 952  ? 6.018   -70.248  12.234  1.00 4.19  ? 953  THR A CB    1 
ATOM   7248  O  OG1   . THR A 1 952  ? 4.759   -70.167  11.556  1.00 3.94  ? 953  THR A OG1   1 
ATOM   7249  C  CG2   . THR A 1 952  ? 6.035   -71.497  13.069  1.00 3.55  ? 953  THR A CG2   1 
ATOM   7250  N  N     . LYS A 1 953  ? 4.842   -67.066  12.359  1.00 4.39  ? 954  LYS A N     1 
ATOM   7251  C  CA    . LYS A 1 953  ? 3.651   -66.235  12.411  1.00 4.85  ? 954  LYS A CA    1 
ATOM   7252  C  C     . LYS A 1 953  ? 2.363   -67.030  12.445  1.00 5.56  ? 954  LYS A C     1 
ATOM   7253  O  O     . LYS A 1 953  ? 2.157   -67.942  11.649  1.00 6.28  ? 954  LYS A O     1 
ATOM   7254  C  CB    . LYS A 1 953  ? 3.598   -65.247  11.272  1.00 4.64  ? 954  LYS A CB    1 
ATOM   7255  C  CG    . LYS A 1 953  ? 3.110   -63.912  11.765  1.00 4.95  ? 954  LYS A CG    1 
ATOM   7256  C  CD    . LYS A 1 953  ? 1.989   -63.379  10.953  1.00 4.71  ? 954  LYS A CD    1 
ATOM   7257  C  CE    . LYS A 1 953  ? 1.142   -62.482  11.820  1.00 5.09  ? 954  LYS A CE    1 
ATOM   7258  N  NZ    . LYS A 1 953  ? -0.281  -62.946  11.755  1.00 5.74  ? 954  LYS A NZ    1 
ATOM   7259  N  N     . LYS A 1 954  ? 1.492   -66.673  13.383  1.00 5.74  ? 955  LYS A N     1 
ATOM   7260  C  CA    . LYS A 1 954  ? 0.223   -67.357  13.592  1.00 5.14  ? 955  LYS A CA    1 
ATOM   7261  C  C     . LYS A 1 954  ? -0.903  -66.543  12.992  1.00 4.96  ? 955  LYS A C     1 
ATOM   7262  O  O     . LYS A 1 954  ? -0.765  -65.339  12.815  1.00 5.10  ? 955  LYS A O     1 
ATOM   7263  C  CB    . LYS A 1 954  ? 0.020   -67.527  15.087  1.00 5.24  ? 955  LYS A CB    1 
ATOM   7264  C  CG    . LYS A 1 954  ? 1.338   -67.697  15.816  1.00 5.46  ? 955  LYS A CG    1 
ATOM   7265  C  CD    . LYS A 1 954  ? 1.313   -68.881  16.737  1.00 5.80  ? 955  LYS A CD    1 
ATOM   7266  C  CE    . LYS A 1 954  ? 2.668   -69.540  16.793  1.00 4.98  ? 955  LYS A CE    1 
ATOM   7267  N  NZ    . LYS A 1 954  ? 2.783   -70.329  15.558  1.00 6.12  ? 955  LYS A NZ    1 
ATOM   7268  N  N     . SER A 1 955  ? -2.028  -67.191  12.701  1.00 4.93  ? 956  SER A N     1 
ATOM   7269  C  CA    . SER A 1 955  ? -3.176  -66.538  12.085  1.00 5.21  ? 956  SER A CA    1 
ATOM   7270  C  C     . SER A 1 955  ? -4.324  -66.460  13.078  1.00 5.38  ? 956  SER A C     1 
ATOM   7271  O  O     . SER A 1 955  ? -4.941  -67.484  13.396  1.00 6.19  ? 956  SER A O     1 
ATOM   7272  C  CB    . SER A 1 955  ? -3.617  -67.309  10.845  1.00 4.98  ? 956  SER A CB    1 
ATOM   7273  O  OG    . SER A 1 955  ? -4.669  -66.631  10.184  1.00 5.16  ? 956  SER A OG    1 
ATOM   7274  N  N     . VAL A 1 956  ? -4.635  -65.249  13.544  1.00 4.58  ? 957  VAL A N     1 
ATOM   7275  C  CA    . VAL A 1 956  ? -5.685  -65.082  14.544  1.00 3.73  ? 957  VAL A CA    1 
ATOM   7276  C  C     . VAL A 1 956  ? -7.052  -64.867  13.936  1.00 3.52  ? 957  VAL A C     1 
ATOM   7277  O  O     . VAL A 1 956  ? -7.349  -63.817  13.380  1.00 3.92  ? 957  VAL A O     1 
ATOM   7278  C  CB    . VAL A 1 956  ? -5.348  -63.950  15.550  1.00 3.26  ? 957  VAL A CB    1 
ATOM   7279  C  CG1   . VAL A 1 956  ? -6.435  -63.851  16.627  1.00 2.00  ? 957  VAL A CG1   1 
ATOM   7280  C  CG2   . VAL A 1 956  ? -3.988  -64.208  16.192  1.00 2.00  ? 957  VAL A CG2   1 
ATOM   7281  N  N     . TRP A 1 957  ? -7.886  -65.879  14.054  1.00 2.91  ? 958  TRP A N     1 
ATOM   7282  C  CA    . TRP A 1 957  ? -9.215  -65.787  13.529  1.00 2.68  ? 958  TRP A CA    1 
ATOM   7283  C  C     . TRP A 1 957  ? -10.295 -65.563  14.588  1.00 2.52  ? 958  TRP A C     1 
ATOM   7284  O  O     . TRP A 1 957  ? -10.163 -66.010  15.733  1.00 2.08  ? 958  TRP A O     1 
ATOM   7285  C  CB    . TRP A 1 957  ? -9.500  -67.044  12.735  1.00 3.06  ? 958  TRP A CB    1 
ATOM   7286  C  CG    . TRP A 1 957  ? -8.771  -67.083  11.436  1.00 3.43  ? 958  TRP A CG    1 
ATOM   7287  C  CD1   . TRP A 1 957  ? -7.471  -67.456  11.231  1.00 3.67  ? 958  TRP A CD1   1 
ATOM   7288  C  CD2   . TRP A 1 957  ? -9.289  -66.699  10.163  1.00 2.56  ? 958  TRP A CD2   1 
ATOM   7289  N  NE1   . TRP A 1 957  ? -7.156  -67.319  9.896   1.00 4.11  ? 958  TRP A NE1   1 
ATOM   7290  C  CE2   . TRP A 1 957  ? -8.252  -66.852  9.222   1.00 3.20  ? 958  TRP A CE2   1 
ATOM   7291  C  CE3   . TRP A 1 957  ? -10.528 -66.239  9.726   1.00 2.00  ? 958  TRP A CE3   1 
ATOM   7292  C  CZ2   . TRP A 1 957  ? -8.418  -66.549  7.873   1.00 2.82  ? 958  TRP A CZ2   1 
ATOM   7293  C  CZ3   . TRP A 1 957  ? -10.694 -65.941  8.388   1.00 3.22  ? 958  TRP A CZ3   1 
ATOM   7294  C  CH2   . TRP A 1 957  ? -9.642  -66.097  7.470   1.00 2.55  ? 958  TRP A CH2   1 
ATOM   7295  N  N     . ILE A 1 958  ? -11.346 -64.834  14.214  1.00 2.12  ? 959  ILE A N     1 
ATOM   7296  C  CA    . ILE A 1 958  ? -12.481 -64.593  15.099  1.00 2.34  ? 959  ILE A CA    1 
ATOM   7297  C  C     . ILE A 1 958  ? -13.712 -65.134  14.363  1.00 2.63  ? 959  ILE A C     1 
ATOM   7298  O  O     . ILE A 1 958  ? -14.127 -64.560  13.370  1.00 3.03  ? 959  ILE A O     1 
ATOM   7299  C  CB    . ILE A 1 958  ? -12.692 -63.103  15.367  1.00 2.00  ? 959  ILE A CB    1 
ATOM   7300  C  CG1   . ILE A 1 958  ? -11.428 -62.476  15.906  1.00 2.00  ? 959  ILE A CG1   1 
ATOM   7301  C  CG2   . ILE A 1 958  ? -13.752 -62.918  16.409  1.00 2.18  ? 959  ILE A CG2   1 
ATOM   7302  C  CD1   . ILE A 1 958  ? -11.538 -61.023  16.042  1.00 2.00  ? 959  ILE A CD1   1 
ATOM   7303  N  N     . PHE A 1 959  ? -14.280 -66.236  14.846  1.00 2.44  ? 960  PHE A N     1 
ATOM   7304  C  CA    . PHE A 1 959  ? -15.442 -66.880  14.222  1.00 2.07  ? 960  PHE A CA    1 
ATOM   7305  C  C     . PHE A 1 959  ? -16.758 -66.557  14.910  1.00 2.00  ? 960  PHE A C     1 
ATOM   7306  O  O     . PHE A 1 959  ? -16.858 -66.662  16.123  1.00 2.00  ? 960  PHE A O     1 
ATOM   7307  C  CB    . PHE A 1 959  ? -15.294 -68.398  14.301  1.00 2.35  ? 960  PHE A CB    1 
ATOM   7308  C  CG    . PHE A 1 959  ? -14.363 -68.986  13.290  1.00 3.15  ? 960  PHE A CG    1 
ATOM   7309  C  CD1   . PHE A 1 959  ? -13.771 -68.197  12.321  1.00 3.28  ? 960  PHE A CD1   1 
ATOM   7310  C  CD2   . PHE A 1 959  ? -14.126 -70.354  13.273  1.00 3.33  ? 960  PHE A CD2   1 
ATOM   7311  C  CE1   . PHE A 1 959  ? -12.967 -68.785  11.354  1.00 3.60  ? 960  PHE A CE1   1 
ATOM   7312  C  CE2   . PHE A 1 959  ? -13.318 -70.936  12.299  1.00 3.21  ? 960  PHE A CE2   1 
ATOM   7313  C  CZ    . PHE A 1 959  ? -12.744 -70.161  11.345  1.00 2.81  ? 960  PHE A CZ    1 
ATOM   7314  N  N     . GLY A 1 960  ? -17.798 -66.306  14.128  1.00 2.00  ? 961  GLY A N     1 
ATOM   7315  C  CA    . GLY A 1 960  ? -19.096 -66.025  14.695  1.00 2.00  ? 961  GLY A CA    1 
ATOM   7316  C  C     . GLY A 1 960  ? -20.061 -65.816  13.554  1.00 2.11  ? 961  GLY A C     1 
ATOM   7317  O  O     . GLY A 1 960  ? -19.618 -65.576  12.432  1.00 2.58  ? 961  GLY A O     1 
ATOM   7318  N  N     . GLY A 1 961  ? -21.366 -65.903  13.837  1.00 2.00  ? 962  GLY A N     1 
ATOM   7319  C  CA    . GLY A 1 961  ? -22.402 -65.724  12.833  1.00 2.00  ? 962  GLY A CA    1 
ATOM   7320  C  C     . GLY A 1 961  ? -22.965 -64.313  12.820  1.00 2.31  ? 962  GLY A C     1 
ATOM   7321  O  O     . GLY A 1 961  ? -22.385 -63.403  13.404  1.00 2.99  ? 962  GLY A O     1 
ATOM   7322  N  N     . ASP A 1 962  ? -24.130 -64.126  12.202  1.00 2.64  ? 963  ASP A N     1 
ATOM   7323  C  CA    . ASP A 1 962  ? -24.751 -62.800  12.083  1.00 2.27  ? 963  ASP A CA    1 
ATOM   7324  C  C     . ASP A 1 962  ? -25.299 -62.208  13.361  1.00 2.46  ? 963  ASP A C     1 
ATOM   7325  O  O     . ASP A 1 962  ? -25.314 -60.999  13.511  1.00 3.17  ? 963  ASP A O     1 
ATOM   7326  C  CB    . ASP A 1 962  ? -25.853 -62.825  11.030  1.00 2.00  ? 963  ASP A CB    1 
ATOM   7327  C  CG    . ASP A 1 962  ? -26.933 -63.841  11.348  1.00 2.69  ? 963  ASP A CG    1 
ATOM   7328  O  OD1   . ASP A 1 962  ? -26.682 -65.074  11.252  1.00 2.00  ? 963  ASP A OD1   1 
ATOM   7329  O  OD2   . ASP A 1 962  ? -28.041 -63.394  11.710  1.00 2.33  ? 963  ASP A OD2   1 
ATOM   7330  N  N     . GLY A 1 963  ? -25.791 -63.056  14.258  1.00 2.76  ? 964  GLY A N     1 
ATOM   7331  C  CA    . GLY A 1 963  ? -26.328 -62.575  15.516  1.00 2.88  ? 964  GLY A CA    1 
ATOM   7332  C  C     . GLY A 1 963  ? -25.260 -61.935  16.370  1.00 3.52  ? 964  GLY A C     1 
ATOM   7333  O  O     . GLY A 1 963  ? -25.513 -60.945  17.039  1.00 4.83  ? 964  GLY A O     1 
ATOM   7334  N  N     . TRP A 1 964  ? -24.051 -62.489  16.326  1.00 3.72  ? 965  TRP A N     1 
ATOM   7335  C  CA    . TRP A 1 964  ? -22.922 -61.973  17.081  1.00 4.04  ? 965  TRP A CA    1 
ATOM   7336  C  C     . TRP A 1 964  ? -22.370 -60.728  16.418  1.00 4.29  ? 965  TRP A C     1 
ATOM   7337  O  O     . TRP A 1 964  ? -22.356 -59.664  17.010  1.00 4.82  ? 965  TRP A O     1 
ATOM   7338  C  CB    . TRP A 1 964  ? -21.810 -63.033  17.188  1.00 3.99  ? 965  TRP A CB    1 
ATOM   7339  C  CG    . TRP A 1 964  ? -20.453 -62.457  17.425  1.00 4.20  ? 965  TRP A CG    1 
ATOM   7340  C  CD1   . TRP A 1 964  ? -19.972 -61.990  18.596  1.00 4.44  ? 965  TRP A CD1   1 
ATOM   7341  C  CD2   . TRP A 1 964  ? -19.425 -62.203  16.438  1.00 4.43  ? 965  TRP A CD2   1 
ATOM   7342  N  NE1   . TRP A 1 964  ? -18.722 -61.444  18.410  1.00 5.50  ? 965  TRP A NE1   1 
ATOM   7343  C  CE2   . TRP A 1 964  ? -18.366 -61.562  17.093  1.00 4.66  ? 965  TRP A CE2   1 
ATOM   7344  C  CE3   . TRP A 1 964  ? -19.312 -62.453  15.055  1.00 3.83  ? 965  TRP A CE3   1 
ATOM   7345  C  CZ2   . TRP A 1 964  ? -17.197 -61.165  16.426  1.00 4.34  ? 965  TRP A CZ2   1 
ATOM   7346  C  CZ3   . TRP A 1 964  ? -18.153 -62.060  14.398  1.00 3.41  ? 965  TRP A CZ3   1 
ATOM   7347  C  CH2   . TRP A 1 964  ? -17.114 -61.421  15.083  1.00 3.95  ? 965  TRP A CH2   1 
ATOM   7348  N  N     . ALA A 1 965  ? -21.937 -60.870  15.171  1.00 4.23  ? 966  ALA A N     1 
ATOM   7349  C  CA    . ALA A 1 965  ? -21.336 -59.773  14.422  1.00 3.60  ? 966  ALA A CA    1 
ATOM   7350  C  C     . ALA A 1 965  ? -22.202 -58.553  14.198  1.00 3.30  ? 966  ALA A C     1 
ATOM   7351  O  O     . ALA A 1 965  ? -21.687 -57.456  14.240  1.00 2.92  ? 966  ALA A O     1 
ATOM   7352  C  CB    . ALA A 1 965  ? -20.829 -60.277  13.114  1.00 3.82  ? 966  ALA A CB    1 
ATOM   7353  N  N     . TYR A 1 966  ? -23.488 -58.756  13.898  1.00 3.39  ? 967  TYR A N     1 
ATOM   7354  C  CA    . TYR A 1 966  ? -24.442 -57.670  13.650  1.00 3.13  ? 967  TYR A CA    1 
ATOM   7355  C  C     . TYR A 1 966  ? -25.142 -57.191  14.880  1.00 3.39  ? 967  TYR A C     1 
ATOM   7356  O  O     . TYR A 1 966  ? -25.690 -56.105  14.866  1.00 3.10  ? 967  TYR A O     1 
ATOM   7357  C  CB    . TYR A 1 966  ? -25.569 -58.106  12.738  1.00 2.95  ? 967  TYR A CB    1 
ATOM   7358  C  CG    . TYR A 1 966  ? -25.187 -58.363  11.325  1.00 3.79  ? 967  TYR A CG    1 
ATOM   7359  C  CD1   . TYR A 1 966  ? -24.480 -59.495  10.974  1.00 4.18  ? 967  TYR A CD1   1 
ATOM   7360  C  CD2   . TYR A 1 966  ? -25.587 -57.501  10.313  1.00 4.18  ? 967  TYR A CD2   1 
ATOM   7361  C  CE1   . TYR A 1 966  ? -24.181 -59.771  9.645   1.00 4.29  ? 967  TYR A CE1   1 
ATOM   7362  C  CE2   . TYR A 1 966  ? -25.289 -57.773  8.981   1.00 4.10  ? 967  TYR A CE2   1 
ATOM   7363  C  CZ    . TYR A 1 966  ? -24.589 -58.912  8.662   1.00 4.03  ? 967  TYR A CZ    1 
ATOM   7364  O  OH    . TYR A 1 966  ? -24.306 -59.213  7.360   1.00 4.29  ? 967  TYR A OH    1 
ATOM   7365  N  N     . ASP A 1 967  ? -25.253 -58.029  15.904  1.00 3.40  ? 968  ASP A N     1 
ATOM   7366  C  CA    . ASP A 1 967  ? -25.964 -57.598  17.087  1.00 3.23  ? 968  ASP A CA    1 
ATOM   7367  C  C     . ASP A 1 967  ? -25.167 -57.483  18.352  1.00 2.87  ? 968  ASP A C     1 
ATOM   7368  O  O     . ASP A 1 967  ? -24.462 -56.517  18.565  1.00 2.68  ? 968  ASP A O     1 
ATOM   7369  C  CB    . ASP A 1 967  ? -27.192 -58.492  17.339  1.00 3.65  ? 968  ASP A CB    1 
ATOM   7370  C  CG    . ASP A 1 967  ? -28.246 -58.355  16.269  1.00 4.32  ? 968  ASP A CG    1 
ATOM   7371  O  OD1   . ASP A 1 967  ? -28.040 -57.541  15.364  1.00 4.07  ? 968  ASP A OD1   1 
ATOM   7372  O  OD2   . ASP A 1 967  ? -29.285 -59.046  16.334  1.00 4.49  ? 968  ASP A OD2   1 
ATOM   7373  N  N     . ILE A 1 968  ? -25.288 -58.493  19.191  1.00 2.61  ? 969  ILE A N     1 
ATOM   7374  C  CA    . ILE A 1 968  ? -24.649 -58.511  20.472  1.00 2.16  ? 969  ILE A CA    1 
ATOM   7375  C  C     . ILE A 1 968  ? -23.183 -58.184  20.435  1.00 2.26  ? 969  ILE A C     1 
ATOM   7376  O  O     . ILE A 1 968  ? -22.728 -57.371  21.228  1.00 3.07  ? 969  ILE A O     1 
ATOM   7377  C  CB    . ILE A 1 968  ? -24.903 -59.862  21.175  1.00 2.17  ? 969  ILE A CB    1 
ATOM   7378  C  CG1   . ILE A 1 968  ? -24.594 -59.777  22.665  1.00 2.00  ? 969  ILE A CG1   1 
ATOM   7379  C  CG2   . ILE A 1 968  ? -24.092 -60.928  20.525  1.00 2.25  ? 969  ILE A CG2   1 
ATOM   7380  C  CD1   . ILE A 1 968  ? -25.221 -60.876  23.466  1.00 2.00  ? 969  ILE A CD1   1 
ATOM   7381  N  N     . GLY A 1 969  ? -22.446 -58.733  19.478  1.00 2.00  ? 970  GLY A N     1 
ATOM   7382  C  CA    . GLY A 1 969  ? -21.014 -58.484  19.444  1.00 2.00  ? 970  GLY A CA    1 
ATOM   7383  C  C     . GLY A 1 969  ? -20.468 -57.411  18.530  1.00 2.00  ? 970  GLY A C     1 
ATOM   7384  O  O     . GLY A 1 969  ? -19.264 -57.181  18.528  1.00 2.00  ? 970  GLY A O     1 
ATOM   7385  N  N     . TYR A 1 970  ? -21.349 -56.770  17.760  1.00 2.67  ? 971  TYR A N     1 
ATOM   7386  C  CA    . TYR A 1 970  ? -21.009 -55.718  16.804  1.00 2.70  ? 971  TYR A CA    1 
ATOM   7387  C  C     . TYR A 1 970  ? -20.136 -54.649  17.386  1.00 3.54  ? 971  TYR A C     1 
ATOM   7388  O  O     . TYR A 1 970  ? -19.040 -54.443  16.906  1.00 4.22  ? 971  TYR A O     1 
ATOM   7389  C  CB    . TYR A 1 970  ? -22.264 -55.071  16.250  1.00 2.09  ? 971  TYR A CB    1 
ATOM   7390  C  CG    . TYR A 1 970  ? -21.982 -53.974  15.272  1.00 2.07  ? 971  TYR A CG    1 
ATOM   7391  C  CD1   . TYR A 1 970  ? -21.158 -54.189  14.183  1.00 2.00  ? 971  TYR A CD1   1 
ATOM   7392  C  CD2   . TYR A 1 970  ? -22.546 -52.706  15.451  1.00 3.26  ? 971  TYR A CD2   1 
ATOM   7393  C  CE1   . TYR A 1 970  ? -20.897 -53.175  13.293  1.00 3.11  ? 971  TYR A CE1   1 
ATOM   7394  C  CE2   . TYR A 1 970  ? -22.297 -51.674  14.573  1.00 3.45  ? 971  TYR A CE2   1 
ATOM   7395  C  CZ    . TYR A 1 970  ? -21.469 -51.909  13.490  1.00 4.13  ? 971  TYR A CZ    1 
ATOM   7396  O  OH    . TYR A 1 970  ? -21.215 -50.878  12.608  1.00 4.64  ? 971  TYR A OH    1 
ATOM   7397  N  N     . GLY A 1 971  ? -20.634 -53.959  18.411  1.00 4.37  ? 972  GLY A N     1 
ATOM   7398  C  CA    . GLY A 1 971  ? -19.881 -52.902  19.071  1.00 4.51  ? 972  GLY A CA    1 
ATOM   7399  C  C     . GLY A 1 971  ? -18.425 -53.257  19.271  1.00 4.80  ? 972  GLY A C     1 
ATOM   7400  O  O     . GLY A 1 971  ? -17.536 -52.413  19.096  1.00 6.06  ? 972  GLY A O     1 
ATOM   7401  N  N     . GLY A 1 972  ? -18.186 -54.521  19.606  1.00 4.68  ? 973  GLY A N     1 
ATOM   7402  C  CA    . GLY A 1 972  ? -16.842 -55.021  19.804  1.00 3.97  ? 973  GLY A CA    1 
ATOM   7403  C  C     . GLY A 1 972  ? -16.214 -55.332  18.470  1.00 3.70  ? 973  GLY A C     1 
ATOM   7404  O  O     . GLY A 1 972  ? -15.078 -54.969  18.224  1.00 4.62  ? 973  GLY A O     1 
ATOM   7405  N  N     . LEU A 1 973  ? -16.965 -55.958  17.579  1.00 3.31  ? 974  LEU A N     1 
ATOM   7406  C  CA    . LEU A 1 973  ? -16.449 -56.310  16.269  1.00 2.66  ? 974  LEU A CA    1 
ATOM   7407  C  C     . LEU A 1 973  ? -15.907 -55.055  15.654  1.00 3.08  ? 974  LEU A C     1 
ATOM   7408  O  O     . LEU A 1 973  ? -14.773 -55.007  15.183  1.00 3.69  ? 974  LEU A O     1 
ATOM   7409  C  CB    . LEU A 1 973  ? -17.563 -56.833  15.413  1.00 2.00  ? 974  LEU A CB    1 
ATOM   7410  C  CG    . LEU A 1 973  ? -17.236 -56.943  13.960  1.00 2.00  ? 974  LEU A CG    1 
ATOM   7411  C  CD1   . LEU A 1 973  ? -16.138 -57.931  13.839  1.00 2.00  ? 974  LEU A CD1   1 
ATOM   7412  C  CD2   . LEU A 1 973  ? -18.465 -57.417  13.227  1.00 2.00  ? 974  LEU A CD2   1 
ATOM   7413  N  N     . ASP A 1 974  ? -16.681 -53.995  15.796  1.00 2.99  ? 975  ASP A N     1 
ATOM   7414  C  CA    . ASP A 1 974  ? -16.330 -52.701  15.263  1.00 3.02  ? 975  ASP A CA    1 
ATOM   7415  C  C     . ASP A 1 974  ? -15.053 -52.150  15.862  1.00 3.42  ? 975  ASP A C     1 
ATOM   7416  O  O     . ASP A 1 974  ? -14.198 -51.656  15.142  1.00 4.09  ? 975  ASP A O     1 
ATOM   7417  C  CB    . ASP A 1 974  ? -17.454 -51.738  15.556  1.00 2.43  ? 975  ASP A CB    1 
ATOM   7418  C  CG    . ASP A 1 974  ? -17.203 -50.402  14.975  1.00 2.35  ? 975  ASP A CG    1 
ATOM   7419  O  OD1   . ASP A 1 974  ? -17.321 -50.305  13.739  1.00 2.66  ? 975  ASP A OD1   1 
ATOM   7420  O  OD2   . ASP A 1 974  ? -16.899 -49.467  15.746  1.00 2.00  ? 975  ASP A OD2   1 
ATOM   7421  N  N     . HIS A 1 975  ? -14.919 -52.232  17.180  1.00 3.54  ? 976  HIS A N     1 
ATOM   7422  C  CA    . HIS A 1 975  ? -13.743 -51.712  17.850  1.00 3.30  ? 976  HIS A CA    1 
ATOM   7423  C  C     . HIS A 1 975  ? -12.472 -52.418  17.476  1.00 3.41  ? 976  HIS A C     1 
ATOM   7424  O  O     . HIS A 1 975  ? -11.454 -51.783  17.203  1.00 3.59  ? 976  HIS A O     1 
ATOM   7425  C  CB    . HIS A 1 975  ? -13.895 -51.795  19.337  1.00 3.92  ? 976  HIS A CB    1 
ATOM   7426  C  CG    . HIS A 1 975  ? -13.003 -50.848  20.056  1.00 4.87  ? 976  HIS A CG    1 
ATOM   7427  N  ND1   . HIS A 1 975  ? -11.760 -51.208  20.524  1.00 5.61  ? 976  HIS A ND1   1 
ATOM   7428  C  CD2   . HIS A 1 975  ? -13.161 -49.540  20.359  1.00 4.93  ? 976  HIS A CD2   1 
ATOM   7429  C  CE1   . HIS A 1 975  ? -11.188 -50.163  21.091  1.00 5.99  ? 976  HIS A CE1   1 
ATOM   7430  N  NE2   . HIS A 1 975  ? -12.019 -49.138  21.003  1.00 6.34  ? 976  HIS A NE2   1 
ATOM   7431  N  N     . VAL A 1 976  ? -12.504 -53.737  17.568  1.00 2.62  ? 977  VAL A N     1 
ATOM   7432  C  CA    . VAL A 1 976  ? -11.365 -54.527  17.207  1.00 2.05  ? 977  VAL A CA    1 
ATOM   7433  C  C     . VAL A 1 976  ? -11.021 -54.178  15.780  1.00 2.28  ? 977  VAL A C     1 
ATOM   7434  O  O     . VAL A 1 976  ? -9.880  -53.864  15.472  1.00 2.00  ? 977  VAL A O     1 
ATOM   7435  C  CB    . VAL A 1 976  ? -11.699 -55.984  17.310  1.00 2.00  ? 977  VAL A CB    1 
ATOM   7436  C  CG1   . VAL A 1 976  ? -10.625 -56.838  16.664  1.00 2.00  ? 977  VAL A CG1   1 
ATOM   7437  C  CG2   . VAL A 1 976  ? -11.875 -56.329  18.752  1.00 2.03  ? 977  VAL A CG2   1 
ATOM   7438  N  N     . LEU A 1 977  ? -12.019 -54.139  14.909  1.00 2.71  ? 978  LEU A N     1 
ATOM   7439  C  CA    . LEU A 1 977  ? -11.722 -53.832  13.509  1.00 3.08  ? 978  LEU A CA    1 
ATOM   7440  C  C     . LEU A 1 977  ? -11.138 -52.440  13.340  1.00 3.14  ? 978  LEU A C     1 
ATOM   7441  O  O     . LEU A 1 977  ? -10.253 -52.234  12.531  1.00 3.34  ? 978  LEU A O     1 
ATOM   7442  C  CB    . LEU A 1 977  ? -12.951 -54.016  12.614  1.00 2.68  ? 978  LEU A CB    1 
ATOM   7443  C  CG    . LEU A 1 977  ? -13.457 -55.433  12.333  1.00 2.00  ? 978  LEU A CG    1 
ATOM   7444  C  CD1   . LEU A 1 977  ? -14.591 -55.355  11.339  1.00 2.01  ? 978  LEU A CD1   1 
ATOM   7445  C  CD2   . LEU A 1 977  ? -12.351 -56.284  11.776  1.00 2.00  ? 978  LEU A CD2   1 
ATOM   7446  N  N     . ALA A 1 978  ? -11.585 -51.503  14.158  1.00 3.07  ? 979  ALA A N     1 
ATOM   7447  C  CA    . ALA A 1 978  ? -11.084 -50.150  14.066  1.00 3.35  ? 979  ALA A CA    1 
ATOM   7448  C  C     . ALA A 1 978  ? -9.706  -50.072  14.669  1.00 3.68  ? 979  ALA A C     1 
ATOM   7449  O  O     . ALA A 1 978  ? -8.963  -49.135  14.415  1.00 3.66  ? 979  ALA A O     1 
ATOM   7450  C  CB    . ALA A 1 978  ? -12.003 -49.203  14.787  1.00 2.90  ? 979  ALA A CB    1 
ATOM   7451  N  N     . SER A 1 979  ? -9.356  -51.060  15.478  1.00 4.55  ? 980  SER A N     1 
ATOM   7452  C  CA    . SER A 1 979  ? -8.060  -51.036  16.130  1.00 4.95  ? 980  SER A CA    1 
ATOM   7453  C  C     . SER A 1 979  ? -6.961  -51.143  15.110  1.00 4.89  ? 980  SER A C     1 
ATOM   7454  O  O     . SER A 1 979  ? -5.825  -50.867  15.412  1.00 5.41  ? 980  SER A O     1 
ATOM   7455  C  CB    . SER A 1 979  ? -7.927  -52.166  17.149  1.00 5.67  ? 980  SER A CB    1 
ATOM   7456  O  OG    . SER A 1 979  ? -7.623  -53.412  16.524  1.00 6.58  ? 980  SER A OG    1 
ATOM   7457  N  N     . GLY A 1 980  ? -7.290  -51.581  13.905  1.00 5.35  ? 981  GLY A N     1 
ATOM   7458  C  CA    . GLY A 1 980  ? -6.270  -51.700  12.873  1.00 5.72  ? 981  GLY A CA    1 
ATOM   7459  C  C     . GLY A 1 980  ? -5.203  -52.781  13.031  1.00 6.44  ? 981  GLY A C     1 
ATOM   7460  O  O     . GLY A 1 980  ? -4.335  -52.877  12.173  1.00 6.63  ? 981  GLY A O     1 
ATOM   7461  N  N     . GLU A 1 981  ? -5.249  -53.586  14.097  1.00 7.12  ? 982  GLU A N     1 
ATOM   7462  C  CA    . GLU A 1 981  ? -4.263  -54.647  14.289  1.00 7.80  ? 982  GLU A CA    1 
ATOM   7463  C  C     . GLU A 1 981  ? -4.603  -55.853  13.381  1.00 7.24  ? 982  GLU A C     1 
ATOM   7464  O  O     . GLU A 1 981  ? -5.681  -55.881  12.793  1.00 6.94  ? 982  GLU A O     1 
ATOM   7465  C  CB    . GLU A 1 981  ? -4.105  -54.991  15.795  1.00 9.46  ? 982  GLU A CB    1 
ATOM   7466  C  CG    . GLU A 1 981  ? -2.946  -54.195  16.505  1.00 12.31 ? 982  GLU A CG    1 
ATOM   7467  C  CD    . GLU A 1 981  ? -3.059  -54.090  18.051  1.00 14.90 ? 982  GLU A CD    1 
ATOM   7468  O  OE1   . GLU A 1 981  ? -3.682  -53.114  18.547  1.00 16.44 ? 982  GLU A OE1   1 
ATOM   7469  O  OE2   . GLU A 1 981  ? -2.479  -54.930  18.796  1.00 15.87 ? 982  GLU A OE2   1 
ATOM   7470  N  N     . ASP A 1 982  ? -3.667  -56.792  13.208  1.00 6.87  ? 983  ASP A N     1 
ATOM   7471  C  CA    . ASP A 1 982  ? -3.843  -57.964  12.334  1.00 6.52  ? 983  ASP A CA    1 
ATOM   7472  C  C     . ASP A 1 982  ? -4.626  -59.155  12.866  1.00 5.72  ? 983  ASP A C     1 
ATOM   7473  O  O     . ASP A 1 982  ? -4.054  -60.112  13.374  1.00 5.27  ? 983  ASP A O     1 
ATOM   7474  C  CB    . ASP A 1 982  ? -2.470  -58.440  11.854  1.00 8.49  ? 983  ASP A CB    1 
ATOM   7475  C  CG    . ASP A 1 982  ? -2.515  -59.681  10.915  1.00 10.56 ? 983  ASP A CG    1 
ATOM   7476  O  OD1   . ASP A 1 982  ? -3.591  -60.259  10.597  1.00 12.01 ? 983  ASP A OD1   1 
ATOM   7477  O  OD2   . ASP A 1 982  ? -1.409  -60.085  10.473  1.00 11.20 ? 983  ASP A OD2   1 
ATOM   7478  N  N     . VAL A 1 983  ? -5.936  -59.116  12.691  1.00 4.77  ? 984  VAL A N     1 
ATOM   7479  C  CA    . VAL A 1 983  ? -6.787  -60.226  13.079  1.00 3.80  ? 984  VAL A CA    1 
ATOM   7480  C  C     . VAL A 1 983  ? -7.724  -60.441  11.904  1.00 3.30  ? 984  VAL A C     1 
ATOM   7481  O  O     . VAL A 1 983  ? -7.931  -59.546  11.102  1.00 3.56  ? 984  VAL A O     1 
ATOM   7482  C  CB    . VAL A 1 983  ? -7.608  -59.949  14.356  1.00 3.13  ? 984  VAL A CB    1 
ATOM   7483  C  CG1   . VAL A 1 983  ? -6.692  -59.871  15.538  1.00 2.93  ? 984  VAL A CG1   1 
ATOM   7484  C  CG2   . VAL A 1 983  ? -8.451  -58.711  14.205  1.00 2.00  ? 984  VAL A CG2   1 
ATOM   7485  N  N     . ASN A 1 984  ? -8.317  -61.615  11.825  1.00 2.70  ? 985  ASN A N     1 
ATOM   7486  C  CA    . ASN A 1 984  ? -9.209  -61.939  10.739  1.00 2.81  ? 985  ASN A CA    1 
ATOM   7487  C  C     . ASN A 1 984  ? -10.605 -62.365  11.254  1.00 2.58  ? 985  ASN A C     1 
ATOM   7488  O  O     . ASN A 1 984  ? -10.705 -63.369  11.970  1.00 2.49  ? 985  ASN A O     1 
ATOM   7489  C  CB    . ASN A 1 984  ? -8.544  -63.062  9.930   1.00 3.03  ? 985  ASN A CB    1 
ATOM   7490  C  CG    . ASN A 1 984  ? -7.134  -62.699  9.479   1.00 3.44  ? 985  ASN A CG    1 
ATOM   7491  O  OD1   . ASN A 1 984  ? -6.918  -61.674  8.823   1.00 2.95  ? 985  ASN A OD1   1 
ATOM   7492  N  ND2   . ASN A 1 984  ? -6.162  -63.535  9.835   1.00 4.01  ? 985  ASN A ND2   1 
ATOM   7493  N  N     . VAL A 1 985  ? -11.666 -61.601  10.969  1.00 2.00  ? 986  VAL A N     1 
ATOM   7494  C  CA    . VAL A 1 985  ? -12.992 -62.029  11.430  1.00 2.00  ? 986  VAL A CA    1 
ATOM   7495  C  C     . VAL A 1 985  ? -13.783 -62.680  10.304  1.00 2.03  ? 986  VAL A C     1 
ATOM   7496  O  O     . VAL A 1 985  ? -13.801 -62.192  9.177   1.00 2.92  ? 986  VAL A O     1 
ATOM   7497  C  CB    . VAL A 1 985  ? -13.806 -60.920  12.224  1.00 2.00  ? 986  VAL A CB    1 
ATOM   7498  C  CG1   . VAL A 1 985  ? -12.972 -59.704  12.501  1.00 2.00  ? 986  VAL A CG1   1 
ATOM   7499  C  CG2   . VAL A 1 985  ? -15.102 -60.562  11.556  1.00 2.00  ? 986  VAL A CG2   1 
ATOM   7500  N  N     . PHE A 1 986  ? -14.351 -63.843  10.572  1.00 2.00  ? 987  PHE A N     1 
ATOM   7501  C  CA    . PHE A 1 986  ? -15.108 -64.554  9.560   1.00 2.00  ? 987  PHE A CA    1 
ATOM   7502  C  C     . PHE A 1 986  ? -16.499 -64.715  10.117  1.00 2.00  ? 987  PHE A C     1 
ATOM   7503  O  O     . PHE A 1 986  ? -16.673 -65.338  11.144  1.00 2.40  ? 987  PHE A O     1 
ATOM   7504  C  CB    . PHE A 1 986  ? -14.473 -65.928  9.287   1.00 2.00  ? 987  PHE A CB    1 
ATOM   7505  C  CG    . PHE A 1 986  ? -15.107 -66.677  8.142   1.00 2.29  ? 987  PHE A CG    1 
ATOM   7506  C  CD1   . PHE A 1 986  ? -14.990 -66.218  6.835   1.00 2.24  ? 987  PHE A CD1   1 
ATOM   7507  C  CD2   . PHE A 1 986  ? -15.867 -67.823  8.373   1.00 2.38  ? 987  PHE A CD2   1 
ATOM   7508  C  CE1   . PHE A 1 986  ? -15.621 -66.881  5.784   1.00 2.00  ? 987  PHE A CE1   1 
ATOM   7509  C  CE2   . PHE A 1 986  ? -16.504 -68.493  7.318   1.00 2.00  ? 987  PHE A CE2   1 
ATOM   7510  C  CZ    . PHE A 1 986  ? -16.380 -68.018  6.035   1.00 2.00  ? 987  PHE A CZ    1 
ATOM   7511  N  N     . VAL A 1 987  ? -17.478 -64.119  9.454   1.00 2.00  ? 988  VAL A N     1 
ATOM   7512  C  CA    . VAL A 1 987  ? -18.871 -64.162  9.874   1.00 2.00  ? 988  VAL A CA    1 
ATOM   7513  C  C     . VAL A 1 987  ? -19.673 -65.119  8.993   1.00 2.04  ? 988  VAL A C     1 
ATOM   7514  O  O     . VAL A 1 987  ? -19.695 -64.964  7.769   1.00 2.05  ? 988  VAL A O     1 
ATOM   7515  C  CB    . VAL A 1 987  ? -19.509 -62.747  9.745   1.00 2.00  ? 988  VAL A CB    1 
ATOM   7516  C  CG1   . VAL A 1 987  ? -20.901 -62.715  10.302  1.00 2.00  ? 988  VAL A CG1   1 
ATOM   7517  C  CG2   . VAL A 1 987  ? -18.684 -61.733  10.436  1.00 2.00  ? 988  VAL A CG2   1 
ATOM   7518  N  N     . MET A 1 988  ? -20.306 -66.127  9.584   1.00 2.23  ? 989  MET A N     1 
ATOM   7519  C  CA    . MET A 1 988  ? -21.128 -67.035  8.780   1.00 2.91  ? 989  MET A CA    1 
ATOM   7520  C  C     . MET A 1 988  ? -22.516 -66.420  8.836   1.00 3.35  ? 989  MET A C     1 
ATOM   7521  O  O     . MET A 1 988  ? -23.112 -66.346  9.906   1.00 3.72  ? 989  MET A O     1 
ATOM   7522  C  CB    . MET A 1 988  ? -21.174 -68.464  9.356   1.00 2.54  ? 989  MET A CB    1 
ATOM   7523  C  CG    . MET A 1 988  ? -19.968 -69.357  9.089   1.00 2.00  ? 989  MET A CG    1 
ATOM   7524  S  SD    . MET A 1 988  ? -18.873 -69.521  10.539  1.00 3.91  ? 989  MET A SD    1 
ATOM   7525  C  CE    . MET A 1 988  ? -19.555 -70.857  11.433  1.00 3.23  ? 989  MET A CE    1 
ATOM   7526  N  N     . ASP A 1 989  ? -23.006 -65.921  7.711   1.00 3.76  ? 990  ASP A N     1 
ATOM   7527  C  CA    . ASP A 1 989  ? -24.322 -65.298  7.687   1.00 4.69  ? 990  ASP A CA    1 
ATOM   7528  C  C     . ASP A 1 989  ? -25.480 -66.244  7.391   1.00 6.22  ? 990  ASP A C     1 
ATOM   7529  O  O     . ASP A 1 989  ? -25.604 -66.773  6.285   1.00 6.62  ? 990  ASP A O     1 
ATOM   7530  C  CB    . ASP A 1 989  ? -24.356 -64.152  6.684   1.00 3.32  ? 990  ASP A CB    1 
ATOM   7531  C  CG    . ASP A 1 989  ? -25.241 -63.039  7.129   1.00 2.73  ? 990  ASP A CG    1 
ATOM   7532  O  OD1   . ASP A 1 989  ? -25.965 -63.241  8.114   1.00 2.00  ? 990  ASP A OD1   1 
ATOM   7533  O  OD2   . ASP A 1 989  ? -25.185 -61.945  6.532   1.00 2.00  ? 990  ASP A OD2   1 
ATOM   7534  N  N     . THR A 1 990  ? -26.313 -66.478  8.400   1.00 7.88  ? 991  THR A N     1 
ATOM   7535  C  CA    . THR A 1 990  ? -27.501 -67.320  8.260   1.00 8.68  ? 991  THR A CA    1 
ATOM   7536  C  C     . THR A 1 990  ? -28.753 -66.415  8.197   1.00 9.72  ? 991  THR A C     1 
ATOM   7537  O  O     . THR A 1 990  ? -29.856 -66.867  7.893   1.00 10.38 ? 991  THR A O     1 
ATOM   7538  C  CB    . THR A 1 990  ? -27.609 -68.377  9.401   1.00 8.11  ? 991  THR A CB    1 
ATOM   7539  O  OG1   . THR A 1 990  ? -27.523 -67.741  10.684  1.00 7.82  ? 991  THR A OG1   1 
ATOM   7540  C  CG2   . THR A 1 990  ? -26.492 -69.391  9.271   1.00 7.85  ? 991  THR A CG2   1 
ATOM   7541  N  N     . GLU A 1 991  ? -28.547 -65.125  8.438   1.00 10.47 ? 992  GLU A N     1 
ATOM   7542  C  CA    . GLU A 1 991  ? -29.595 -64.120  8.388   1.00 11.70 ? 992  GLU A CA    1 
ATOM   7543  C  C     . GLU A 1 991  ? -30.655 -64.321  9.474   1.00 12.36 ? 992  GLU A C     1 
ATOM   7544  O  O     . GLU A 1 991  ? -31.858 -64.058  9.283   1.00 12.95 ? 992  GLU A O     1 
ATOM   7545  C  CB    . GLU A 1 991  ? -30.204 -64.073  6.980   1.00 11.95 ? 992  GLU A CB    1 
ATOM   7546  C  CG    . GLU A 1 991  ? -29.149 -63.900  5.889   1.00 12.86 ? 992  GLU A CG    1 
ATOM   7547  C  CD    . GLU A 1 991  ? -29.709 -63.460  4.554   1.00 13.33 ? 992  GLU A CD    1 
ATOM   7548  O  OE1   . GLU A 1 991  ? -30.243 -64.314  3.812   1.00 13.53 ? 992  GLU A OE1   1 
ATOM   7549  O  OE2   . GLU A 1 991  ? -29.571 -62.260  4.234   1.00 13.20 ? 992  GLU A OE2   1 
ATOM   7550  N  N     . VAL A 1 992  ? -30.182 -64.733  10.645  1.00 12.38 ? 993  VAL A N     1 
ATOM   7551  C  CA    . VAL A 1 992  ? -31.053 -64.972  11.776  1.00 12.40 ? 993  VAL A CA    1 
ATOM   7552  C  C     . VAL A 1 992  ? -30.206 -65.605  12.884  1.00 12.45 ? 993  VAL A C     1 
ATOM   7553  O  O     . VAL A 1 992  ? -29.042 -65.953  12.658  1.00 12.87 ? 993  VAL A O     1 
ATOM   7554  C  CB    . VAL A 1 992  ? -32.177 -65.950  11.356  1.00 12.73 ? 993  VAL A CB    1 
ATOM   7555  C  CG1   . VAL A 1 992  ? -31.700 -67.400  11.414  1.00 12.77 ? 993  VAL A CG1   1 
ATOM   7556  C  CG2   . VAL A 1 992  ? -33.407 -65.732  12.177  1.00 13.30 ? 993  VAL A CG2   1 
ATOM   7557  N  N     . TYR A 1 993  ? -30.777 -65.681  14.089  1.00 12.12 ? 994  TYR A N     1 
ATOM   7558  C  CA    . TYR A 1 993  ? -30.145 -66.302  15.249  1.00 11.35 ? 994  TYR A CA    1 
ATOM   7559  C  C     . TYR A 1 993  ? -30.541 -67.775  15.052  1.00 11.56 ? 994  TYR A C     1 
ATOM   7560  O  O     . TYR A 1 993  ? -31.697 -68.130  15.281  1.00 12.98 ? 994  TYR A O     1 
ATOM   7561  C  CB    . TYR A 1 993  ? -30.778 -65.785  16.555  1.00 11.31 ? 994  TYR A CB    1 
ATOM   7562  C  CG    . TYR A 1 993  ? -30.459 -64.358  16.996  1.00 10.71 ? 994  TYR A CG    1 
ATOM   7563  C  CD1   . TYR A 1 993  ? -29.757 -63.490  16.196  1.00 9.59  ? 994  TYR A CD1   1 
ATOM   7564  C  CD2   . TYR A 1 993  ? -30.807 -63.910  18.274  1.00 10.79 ? 994  TYR A CD2   1 
ATOM   7565  C  CE1   . TYR A 1 993  ? -29.382 -62.204  16.656  1.00 9.76  ? 994  TYR A CE1   1 
ATOM   7566  C  CE2   . TYR A 1 993  ? -30.440 -62.620  18.738  1.00 10.30 ? 994  TYR A CE2   1 
ATOM   7567  C  CZ    . TYR A 1 993  ? -29.715 -61.783  17.918  1.00 9.90  ? 994  TYR A CZ    1 
ATOM   7568  O  OH    . TYR A 1 993  ? -29.228 -60.581  18.388  1.00 8.35  ? 994  TYR A OH    1 
ATOM   7569  N  N     . SER A 1 994  ? -29.625 -68.600  14.548  1.00 11.28 ? 995  SER A N     1 
ATOM   7570  C  CA    . SER A 1 994  ? -29.920 -70.003  14.295  1.00 11.51 ? 995  SER A CA    1 
ATOM   7571  C  C     . SER A 1 994  ? -29.969 -70.817  15.556  1.00 11.47 ? 995  SER A C     1 
ATOM   7572  O  O     . SER A 1 994  ? -31.039 -71.160  16.030  1.00 11.84 ? 995  SER A O     1 
ATOM   7573  C  CB    . SER A 1 994  ? -28.896 -70.650  13.337  1.00 12.36 ? 995  SER A CB    1 
ATOM   7574  O  OG    . SER A 1 994  ? -29.036 -70.226  11.982  1.00 12.95 ? 995  SER A OG    1 
ATOM   7575  N  N     . ASN A 1 995  ? -28.793 -71.135  16.078  1.00 11.79 ? 996  ASN A N     1 
ATOM   7576  C  CA    . ASN A 1 995  ? -28.625 -71.968  17.272  1.00 11.94 ? 996  ASN A CA    1 
ATOM   7577  C  C     . ASN A 1 995  ? -29.742 -72.049  18.334  1.00 11.55 ? 996  ASN A C     1 
ATOM   7578  O  O     . ASN A 1 995  ? -29.986 -73.120  18.897  1.00 11.09 ? 996  ASN A O     1 
ATOM   7579  C  CB    . ASN A 1 995  ? -27.309 -71.611  17.963  1.00 12.01 ? 996  ASN A CB    1 
ATOM   7580  C  CG    . ASN A 1 995  ? -27.076 -72.430  19.217  1.00 12.20 ? 996  ASN A CG    1 
ATOM   7581  O  OD1   . ASN A 1 995  ? -27.149 -73.667  19.180  1.00 12.17 ? 996  ASN A OD1   1 
ATOM   7582  N  ND2   . ASN A 1 995  ? -26.815 -71.749  20.338  1.00 12.43 ? 996  ASN A ND2   1 
ATOM   7583  N  N     . THR A 1 996  ? -30.429 -70.934  18.568  1.00 11.14 ? 997  THR A N     1 
ATOM   7584  C  CA    . THR A 1 996  ? -31.459 -70.851  19.596  1.00 11.02 ? 997  THR A CA    1 
ATOM   7585  C  C     . THR A 1 996  ? -32.938 -70.864  19.214  1.00 11.07 ? 997  THR A C     1 
ATOM   7586  O  O     . THR A 1 996  ? -33.803 -70.882  20.093  1.00 11.01 ? 997  THR A O     1 
ATOM   7587  C  CB    . THR A 1 996  ? -31.234 -69.593  20.448  1.00 10.98 ? 997  THR A CB    1 
ATOM   7588  O  OG1   . THR A 1 996  ? -30.690 -68.549  19.625  1.00 10.83 ? 997  THR A OG1   1 
ATOM   7589  C  CG2   . THR A 1 996  ? -30.320 -69.879  21.614  1.00 10.61 ? 997  THR A CG2   1 
ATOM   7590  N  N     . GLY A 1 997  ? -33.252 -70.763  17.934  1.00 11.27 ? 998  GLY A N     1 
ATOM   7591  C  CA    . GLY A 1 997  ? -34.658 -70.773  17.567  1.00 12.22 ? 998  GLY A CA    1 
ATOM   7592  C  C     . GLY A 1 997  ? -35.032 -69.973  16.339  1.00 12.17 ? 998  GLY A C     1 
ATOM   7593  O  O     . GLY A 1 997  ? -36.210 -69.695  16.103  1.00 12.25 ? 998  GLY A O     1 
ATOM   7594  N  N     . GLY A 1 998  ? -34.028 -69.591  15.564  1.00 11.94 ? 999  GLY A N     1 
ATOM   7595  C  CA    . GLY A 1 998  ? -34.297 -68.850  14.360  1.00 12.21 ? 999  GLY A CA    1 
ATOM   7596  C  C     . GLY A 1 998  ? -34.935 -67.517  14.650  1.00 12.81 ? 999  GLY A C     1 
ATOM   7597  O  O     . GLY A 1 998  ? -35.901 -67.161  13.958  1.00 12.84 ? 999  GLY A O     1 
ATOM   7598  N  N     . GLN A 1 999  ? -34.447 -66.818  15.692  1.00 12.86 ? 1000 GLN A N     1 
ATOM   7599  C  CA    . GLN A 1 999  ? -34.949 -65.474  16.069  1.00 12.54 ? 1000 GLN A CA    1 
ATOM   7600  C  C     . GLN A 1 999  ? -34.397 -64.480  15.070  1.00 12.29 ? 1000 GLN A C     1 
ATOM   7601  O  O     . GLN A 1 999  ? -33.258 -64.613  14.670  1.00 12.32 ? 1000 GLN A O     1 
ATOM   7602  C  CB    . GLN A 1 999  ? -34.454 -65.035  17.447  1.00 12.40 ? 1000 GLN A CB    1 
ATOM   7603  C  CG    . GLN A 1 999  ? -35.012 -65.813  18.602  1.00 12.70 ? 1000 GLN A CG    1 
ATOM   7604  C  CD    . GLN A 1 999  ? -34.269 -67.092  18.824  1.00 12.85 ? 1000 GLN A CD    1 
ATOM   7605  O  OE1   . GLN A 1 999  ? -34.823 -68.053  19.359  1.00 13.61 ? 1000 GLN A OE1   1 
ATOM   7606  N  NE2   . GLN A 1 999  ? -32.998 -67.121  18.423  1.00 12.58 ? 1000 GLN A NE2   1 
ATOM   7607  N  N     . SER A 1 1000 ? -35.159 -63.449  14.724  1.00 11.86 ? 1001 SER A N     1 
ATOM   7608  C  CA    . SER A 1 1000 ? -34.695 -62.480  13.739  1.00 11.23 ? 1001 SER A CA    1 
ATOM   7609  C  C     . SER A 1 1000 ? -33.551 -61.626  14.247  1.00 10.78 ? 1001 SER A C     1 
ATOM   7610  O  O     . SER A 1 1000 ? -33.639 -61.081  15.333  1.00 10.95 ? 1001 SER A O     1 
ATOM   7611  C  CB    . SER A 1 1000 ? -35.838 -61.598  13.272  1.00 10.28 ? 1001 SER A CB    1 
ATOM   7612  O  OG    . SER A 1 1000 ? -35.448 -60.248  13.301  1.00 10.42 ? 1001 SER A OG    1 
ATOM   7613  N  N     . SER A 1 1001 ? -32.495 -61.509  13.441  1.00 10.33 ? 1002 SER A N     1 
ATOM   7614  C  CA    . SER A 1 1001 ? -31.305 -60.719  13.785  1.00 9.76  ? 1002 SER A CA    1 
ATOM   7615  C  C     . SER A 1 1001 ? -31.281 -59.421  12.988  1.00 9.63  ? 1002 SER A C     1 
ATOM   7616  O  O     . SER A 1 1001 ? -32.077 -59.265  12.060  1.00 9.47  ? 1002 SER A O     1 
ATOM   7617  C  CB    . SER A 1 1001 ? -30.055 -61.520  13.457  1.00 9.28  ? 1002 SER A CB    1 
ATOM   7618  O  OG    . SER A 1 1001 ? -29.320 -60.894  12.428  1.00 8.78  ? 1002 SER A OG    1 
ATOM   7619  N  N     . LYS A 1 1002 ? -30.323 -58.536  13.270  1.00 9.07  ? 1003 LYS A N     1 
ATOM   7620  C  CA    . LYS A 1 1002 ? -30.266 -57.277  12.527  1.00 9.33  ? 1003 LYS A CA    1 
ATOM   7621  C  C     . LYS A 1 1002 ? -29.760 -57.506  11.107  1.00 10.26 ? 1003 LYS A C     1 
ATOM   7622  O  O     . LYS A 1 1002 ? -29.740 -56.569  10.296  1.00 10.78 ? 1003 LYS A O     1 
ATOM   7623  C  CB    . LYS A 1 1002 ? -29.399 -56.240  13.240  1.00 8.76  ? 1003 LYS A CB    1 
ATOM   7624  C  CG    . LYS A 1 1002 ? -29.952 -54.802  13.291  1.00 7.62  ? 1003 LYS A CG    1 
ATOM   7625  C  CD    . LYS A 1 1002 ? -29.524 -54.071  14.584  1.00 7.33  ? 1003 LYS A CD    1 
ATOM   7626  C  CE    . LYS A 1 1002 ? -27.990 -54.065  14.797  1.00 7.96  ? 1003 LYS A CE    1 
ATOM   7627  N  NZ    . LYS A 1 1002 ? -27.452 -53.595  16.152  1.00 8.30  ? 1003 LYS A NZ    1 
ATOM   7628  N  N     . ALA A 1 1003 ? -29.372 -58.758  10.823  1.00 10.74 ? 1004 ALA A N     1 
ATOM   7629  C  CA    . ALA A 1 1003 ? -28.877 -59.200  9.512   1.00 11.22 ? 1004 ALA A CA    1 
ATOM   7630  C  C     . ALA A 1 1003 ? -29.982 -59.822  8.670   1.00 11.92 ? 1004 ALA A C     1 
ATOM   7631  O  O     . ALA A 1 1003 ? -29.791 -60.042  7.474   1.00 12.24 ? 1004 ALA A O     1 
ATOM   7632  C  CB    . ALA A 1 1003 ? -27.761 -60.193  9.669   1.00 11.72 ? 1004 ALA A CB    1 
ATOM   7633  N  N     . THR A 1 1004 ? -31.096 -60.184  9.312   1.00 12.24 ? 1005 THR A N     1 
ATOM   7634  C  CA    . THR A 1 1004 ? -32.272 -60.737  8.635   1.00 12.06 ? 1005 THR A CA    1 
ATOM   7635  C  C     . THR A 1 1004 ? -32.804 -59.713  7.607   1.00 12.11 ? 1005 THR A C     1 
ATOM   7636  O  O     . THR A 1 1004 ? -32.981 -58.545  7.931   1.00 12.10 ? 1005 THR A O     1 
ATOM   7637  C  CB    . THR A 1 1004 ? -33.348 -61.002  9.661   1.00 12.45 ? 1005 THR A CB    1 
ATOM   7638  O  OG1   . THR A 1 1004 ? -32.879 -61.993  10.585  1.00 12.29 ? 1005 THR A OG1   1 
ATOM   7639  C  CG2   . THR A 1 1004 ? -34.651 -61.450  8.992   1.00 12.90 ? 1005 THR A CG2   1 
ATOM   7640  N  N     . PRO A 1 1005 ? -33.112 -60.158  6.376   1.00 12.27 ? 1006 PRO A N     1 
ATOM   7641  C  CA    . PRO A 1 1005 ? -33.620 -59.398  5.218   1.00 12.69 ? 1006 PRO A CA    1 
ATOM   7642  C  C     . PRO A 1 1005 ? -35.040 -58.827  5.303   1.00 13.25 ? 1006 PRO A C     1 
ATOM   7643  O  O     . PRO A 1 1005 ? -35.856 -59.255  6.133   1.00 13.81 ? 1006 PRO A O     1 
ATOM   7644  C  CB    . PRO A 1 1005 ? -33.592 -60.430  4.089   1.00 12.54 ? 1006 PRO A CB    1 
ATOM   7645  C  CG    . PRO A 1 1005 ? -32.817 -61.632  4.667   1.00 12.52 ? 1006 PRO A CG    1 
ATOM   7646  C  CD    . PRO A 1 1005 ? -33.151 -61.600  6.092   1.00 12.21 ? 1006 PRO A CD    1 
ATOM   7647  N  N     . THR A 1 1006 ? -35.354 -57.893  4.410   1.00 13.26 ? 1007 THR A N     1 
ATOM   7648  C  CA    . THR A 1 1006 ? -36.699 -57.332  4.376   1.00 13.36 ? 1007 THR A CA    1 
ATOM   7649  C  C     . THR A 1 1006 ? -37.678 -58.442  4.010   1.00 13.58 ? 1007 THR A C     1 
ATOM   7650  O  O     . THR A 1 1006 ? -37.489 -59.176  3.039   1.00 13.71 ? 1007 THR A O     1 
ATOM   7651  C  CB    . THR A 1 1006 ? -36.822 -56.228  3.321   1.00 13.38 ? 1007 THR A CB    1 
ATOM   7652  O  OG1   . THR A 1 1006 ? -36.256 -55.023  3.837   1.00 13.68 ? 1007 THR A OG1   1 
ATOM   7653  C  CG2   . THR A 1 1006 ? -38.276 -55.984  2.962   1.00 12.83 ? 1007 THR A CG2   1 
ATOM   7654  N  N     . GLY A 1 1007 ? -38.687 -58.612  4.837   1.00 13.73 ? 1008 GLY A N     1 
ATOM   7655  C  CA    . GLY A 1 1007 ? -39.685 -59.617  4.546   1.00 14.22 ? 1008 GLY A CA    1 
ATOM   7656  C  C     . GLY A 1 1007 ? -39.387 -61.072  4.853   1.00 14.25 ? 1008 GLY A C     1 
ATOM   7657  O  O     . GLY A 1 1007 ? -40.194 -61.939  4.483   1.00 14.87 ? 1008 GLY A O     1 
ATOM   7658  N  N     . ALA A 1 1008 ? -38.252 -61.371  5.487   1.00 13.70 ? 1009 ALA A N     1 
ATOM   7659  C  CA    . ALA A 1 1008 ? -37.938 -62.758  5.854   1.00 12.95 ? 1009 ALA A CA    1 
ATOM   7660  C  C     . ALA A 1 1008 ? -38.719 -63.064  7.133   1.00 12.47 ? 1009 ALA A C     1 
ATOM   7661  O  O     . ALA A 1 1008 ? -38.782 -62.215  8.013   1.00 12.26 ? 1009 ALA A O     1 
ATOM   7662  C  CB    . ALA A 1 1008 ? -36.448 -62.916  6.103   1.00 12.86 ? 1009 ALA A CB    1 
ATOM   7663  N  N     . VAL A 1 1009 ? -39.326 -64.251  7.230   1.00 12.33 ? 1010 VAL A N     1 
ATOM   7664  C  CA    . VAL A 1 1009 ? -40.111 -64.638  8.422   1.00 12.18 ? 1010 VAL A CA    1 
ATOM   7665  C  C     . VAL A 1 1009 ? -39.273 -65.350  9.505   1.00 12.71 ? 1010 VAL A C     1 
ATOM   7666  O  O     . VAL A 1 1009 ? -38.928 -66.513  9.353   1.00 13.56 ? 1010 VAL A O     1 
ATOM   7667  C  CB    . VAL A 1 1009 ? -41.337 -65.537  8.046   1.00 11.06 ? 1010 VAL A CB    1 
ATOM   7668  C  CG1   . VAL A 1 1009 ? -42.217 -65.774  9.250   1.00 10.39 ? 1010 VAL A CG1   1 
ATOM   7669  C  CG2   . VAL A 1 1009 ? -42.149 -64.887  6.974   1.00 10.10 ? 1010 VAL A CG2   1 
ATOM   7670  N  N     . ALA A 1 1010 ? -38.952 -64.654  10.594  1.00 12.98 ? 1011 ALA A N     1 
ATOM   7671  C  CA    . ALA A 1 1010 ? -38.165 -65.234  11.692  1.00 13.04 ? 1011 ALA A CA    1 
ATOM   7672  C  C     . ALA A 1 1010 ? -38.897 -64.932  12.985  1.00 13.29 ? 1011 ALA A C     1 
ATOM   7673  O  O     . ALA A 1 1010 ? -39.981 -64.359  12.956  1.00 13.81 ? 1011 ALA A O     1 
ATOM   7674  C  CB    . ALA A 1 1010 ? -36.772 -64.602  11.734  1.00 12.46 ? 1011 ALA A CB    1 
ATOM   7675  N  N     . LYS A 1 1011 ? -38.309 -65.291  14.121  1.00 13.53 ? 1012 LYS A N     1 
ATOM   7676  C  CA    . LYS A 1 1011 ? -38.939 -64.984  15.404  1.00 13.98 ? 1012 LYS A CA    1 
ATOM   7677  C  C     . LYS A 1 1011 ? -38.798 -63.484  15.719  1.00 14.37 ? 1012 LYS A C     1 
ATOM   7678  O  O     . LYS A 1 1011 ? -37.696 -62.928  15.697  1.00 14.90 ? 1012 LYS A O     1 
ATOM   7679  C  CB    . LYS A 1 1011 ? -38.352 -65.836  16.524  1.00 13.62 ? 1012 LYS A CB    1 
ATOM   7680  C  CG    . LYS A 1 1011 ? -38.498 -67.308  16.266  1.00 14.43 ? 1012 LYS A CG    1 
ATOM   7681  C  CD    . LYS A 1 1011 ? -39.925 -67.689  15.873  1.00 15.31 ? 1012 LYS A CD    1 
ATOM   7682  C  CE    . LYS A 1 1011 ? -40.846 -67.821  17.080  1.00 16.15 ? 1012 LYS A CE    1 
ATOM   7683  N  NZ    . LYS A 1 1011 ? -42.255 -68.141  16.673  1.00 16.86 ? 1012 LYS A NZ    1 
ATOM   7684  N  N     . PHE A 1 1012 ? -39.922 -62.849  16.039  1.00 14.51 ? 1013 PHE A N     1 
ATOM   7685  C  CA    . PHE A 1 1012 ? -39.972 -61.418  16.309  1.00 14.53 ? 1013 PHE A CA    1 
ATOM   7686  C  C     . PHE A 1 1012 ? -39.977 -60.635  14.985  1.00 15.27 ? 1013 PHE A C     1 
ATOM   7687  O  O     . PHE A 1 1012 ? -39.826 -59.414  14.969  1.00 15.94 ? 1013 PHE A O     1 
ATOM   7688  C  CB    . PHE A 1 1012 ? -38.847 -60.974  17.238  1.00 13.56 ? 1013 PHE A CB    1 
ATOM   7689  C  CG    . PHE A 1 1012 ? -38.839 -61.703  18.552  1.00 13.33 ? 1013 PHE A CG    1 
ATOM   7690  C  CD1   . PHE A 1 1012 ? -39.854 -61.493  19.485  1.00 13.10 ? 1013 PHE A CD1   1 
ATOM   7691  C  CD2   . PHE A 1 1012 ? -37.814 -62.604  18.860  1.00 13.03 ? 1013 PHE A CD2   1 
ATOM   7692  C  CE1   . PHE A 1 1012 ? -39.845 -62.168  20.708  1.00 12.70 ? 1013 PHE A CE1   1 
ATOM   7693  C  CE2   . PHE A 1 1012 ? -37.793 -63.287  20.077  1.00 12.69 ? 1013 PHE A CE2   1 
ATOM   7694  C  CZ    . PHE A 1 1012 ? -38.806 -63.068  21.002  1.00 12.67 ? 1013 PHE A CZ    1 
ATOM   7695  N  N     . ALA A 1 1013 ? -40.117 -61.365  13.872  1.00 15.67 ? 1014 ALA A N     1 
ATOM   7696  C  CA    . ALA A 1 1013 ? -40.238 -60.809  12.508  1.00 15.75 ? 1014 ALA A CA    1 
ATOM   7697  C  C     . ALA A 1 1013 ? -41.292 -61.732  11.865  1.00 15.97 ? 1014 ALA A C     1 
ATOM   7698  O  O     . ALA A 1 1013 ? -41.223 -62.059  10.681  1.00 16.44 ? 1014 ALA A O     1 
ATOM   7699  C  CB    . ALA A 1 1013 ? -38.911 -60.875  11.747  1.00 15.19 ? 1014 ALA A CB    1 
ATOM   7700  N  N     . ALA A 1 1014 ? -42.234 -62.165  12.716  1.00 16.01 ? 1015 ALA A N     1 
ATOM   7701  C  CA    . ALA A 1 1014 ? -43.351 -63.071  12.408  1.00 15.48 ? 1015 ALA A CA    1 
ATOM   7702  C  C     . ALA A 1 1014 ? -44.243 -62.672  11.227  1.00 15.05 ? 1015 ALA A C     1 
ATOM   7703  O  O     . ALA A 1 1014 ? -45.003 -63.491  10.718  1.00 15.26 ? 1015 ALA A O     1 
ATOM   7704  C  CB    . ALA A 1 1014 ? -44.206 -63.290  13.679  1.00 15.43 ? 1015 ALA A CB    1 
ATOM   7705  N  N     . ALA A 1 1015 ? -44.187 -61.414  10.814  1.00 14.16 ? 1016 ALA A N     1 
ATOM   7706  C  CA    . ALA A 1 1015 ? -44.971 -60.995  9.659   1.00 13.63 ? 1016 ALA A CA    1 
ATOM   7707  C  C     . ALA A 1 1015 ? -43.958 -60.659  8.539   1.00 13.09 ? 1016 ALA A C     1 
ATOM   7708  O  O     . ALA A 1 1015 ? -44.284 -60.003  7.530   1.00 12.97 ? 1016 ALA A O     1 
ATOM   7709  C  CB    . ALA A 1 1015 ? -45.838 -59.773  10.023  1.00 13.54 ? 1016 ALA A CB    1 
ATOM   7710  N  N     . GLY A 1 1016 ? -42.751 -61.202  8.690   1.00 11.67 ? 1017 GLY A N     1 
ATOM   7711  C  CA    . GLY A 1 1016 ? -41.691 -60.929  7.747   1.00 10.15 ? 1017 GLY A CA    1 
ATOM   7712  C  C     . GLY A 1 1016 ? -41.073 -59.634  8.230   1.00 9.56  ? 1017 GLY A C     1 
ATOM   7713  O  O     . GLY A 1 1016 ? -41.795 -58.670  8.474   1.00 9.81  ? 1017 GLY A O     1 
ATOM   7714  N  N     . LYS A 1 1017 ? -39.762 -59.624  8.432   1.00 8.58  ? 1018 LYS A N     1 
ATOM   7715  C  CA    . LYS A 1 1017 ? -39.056 -58.446  8.903   1.00 8.04  ? 1018 LYS A CA    1 
ATOM   7716  C  C     . LYS A 1 1017 ? -39.435 -57.189  8.130   1.00 8.41  ? 1018 LYS A C     1 
ATOM   7717  O  O     . LYS A 1 1017 ? -39.348 -57.151  6.911   1.00 8.73  ? 1018 LYS A O     1 
ATOM   7718  C  CB    . LYS A 1 1017 ? -37.562 -58.699  8.799   1.00 8.30  ? 1018 LYS A CB    1 
ATOM   7719  C  CG    . LYS A 1 1017 ? -36.683 -57.545  9.245   1.00 8.14  ? 1018 LYS A CG    1 
ATOM   7720  C  CD    . LYS A 1 1017 ? -35.471 -58.084  9.947   1.00 7.25  ? 1018 LYS A CD    1 
ATOM   7721  C  CE    . LYS A 1 1017 ? -34.664 -56.978  10.529  1.00 7.41  ? 1018 LYS A CE    1 
ATOM   7722  N  NZ    . LYS A 1 1017 ? -33.902 -56.278  9.472   1.00 8.33  ? 1018 LYS A NZ    1 
ATOM   7723  N  N     . ARG A 1 1018 ? -39.840 -56.140  8.833   1.00 8.98  ? 1019 ARG A N     1 
ATOM   7724  C  CA    . ARG A 1 1018 ? -40.238 -54.906  8.152   1.00 9.28  ? 1019 ARG A CA    1 
ATOM   7725  C  C     . ARG A 1 1018 ? -39.163 -53.824  8.195   1.00 10.08 ? 1019 ARG A C     1 
ATOM   7726  O  O     . ARG A 1 1018 ? -39.438 -52.652  8.451   1.00 10.04 ? 1019 ARG A O     1 
ATOM   7727  C  CB    . ARG A 1 1018 ? -41.555 -54.380  8.721   1.00 8.69  ? 1019 ARG A CB    1 
ATOM   7728  C  CG    . ARG A 1 1018 ? -42.704 -55.398  8.758   1.00 7.33  ? 1019 ARG A CG    1 
ATOM   7729  C  CD    . ARG A 1 1018 ? -43.107 -55.913  7.403   1.00 6.66  ? 1019 ARG A CD    1 
ATOM   7730  N  NE    . ARG A 1 1018 ? -44.048 -57.008  7.568   1.00 6.78  ? 1019 ARG A NE    1 
ATOM   7731  C  CZ    . ARG A 1 1018 ? -45.356 -56.921  7.357   1.00 6.96  ? 1019 ARG A CZ    1 
ATOM   7732  N  NH1   . ARG A 1 1018 ? -45.904 -55.791  6.949   1.00 6.78  ? 1019 ARG A NH1   1 
ATOM   7733  N  NH2   . ARG A 1 1018 ? -46.132 -57.959  7.615   1.00 6.82  ? 1019 ARG A NH2   1 
ATOM   7734  N  N     . THR A 1 1019 ? -37.928 -54.237  7.938   1.00 11.11 ? 1020 THR A N     1 
ATOM   7735  C  CA    . THR A 1 1019 ? -36.767 -53.341  7.915   1.00 12.07 ? 1020 THR A CA    1 
ATOM   7736  C  C     . THR A 1 1019 ? -35.652 -54.025  7.125   1.00 11.82 ? 1020 THR A C     1 
ATOM   7737  O  O     . THR A 1 1019 ? -35.539 -55.263  7.111   1.00 11.57 ? 1020 THR A O     1 
ATOM   7738  C  CB    . THR A 1 1019 ? -36.202 -53.033  9.336   1.00 12.98 ? 1020 THR A CB    1 
ATOM   7739  O  OG1   . THR A 1 1019 ? -36.194 -54.239  10.114  1.00 14.54 ? 1020 THR A OG1   1 
ATOM   7740  C  CG2   . THR A 1 1019 ? -37.001 -51.940  10.050  1.00 12.57 ? 1020 THR A CG2   1 
ATOM   7741  N  N     . GLY A 1 1020 ? -34.817 -53.211  6.490   1.00 11.53 ? 1021 GLY A N     1 
ATOM   7742  C  CA    . GLY A 1 1020 ? -33.738 -53.765  5.708   1.00 11.60 ? 1021 GLY A CA    1 
ATOM   7743  C  C     . GLY A 1 1020 ? -32.630 -54.428  6.503   1.00 11.14 ? 1021 GLY A C     1 
ATOM   7744  O  O     . GLY A 1 1020 ? -32.530 -54.298  7.733   1.00 12.01 ? 1021 GLY A O     1 
ATOM   7745  N  N     . LYS A 1 1021 ? -31.800 -55.172  5.782   1.00 10.29 ? 1022 LYS A N     1 
ATOM   7746  C  CA    . LYS A 1 1021 ? -30.652 -55.836  6.377   1.00 9.49  ? 1022 LYS A CA    1 
ATOM   7747  C  C     . LYS A 1 1021 ? -29.643 -54.751  6.825   1.00 9.08  ? 1022 LYS A C     1 
ATOM   7748  O  O     . LYS A 1 1021 ? -29.557 -53.650  6.233   1.00 9.50  ? 1022 LYS A O     1 
ATOM   7749  C  CB    . LYS A 1 1021 ? -30.007 -56.798  5.350   1.00 8.68  ? 1022 LYS A CB    1 
ATOM   7750  C  CG    . LYS A 1 1021 ? -28.883 -57.693  5.921   1.00 6.96  ? 1022 LYS A CG    1 
ATOM   7751  C  CD    . LYS A 1 1021 ? -28.240 -58.607  4.872   1.00 4.54  ? 1022 LYS A CD    1 
ATOM   7752  C  CE    . LYS A 1 1021 ? -27.196 -59.511  5.493   1.00 2.97  ? 1022 LYS A CE    1 
ATOM   7753  N  NZ    . LYS A 1 1021 ? -27.699 -60.879  5.733   1.00 2.25  ? 1022 LYS A NZ    1 
ATOM   7754  N  N     . LYS A 1 1022 ? -28.965 -55.016  7.932   1.00 8.22  ? 1023 LYS A N     1 
ATOM   7755  C  CA    . LYS A 1 1022 ? -27.975 -54.080  8.402   1.00 7.84  ? 1023 LYS A CA    1 
ATOM   7756  C  C     . LYS A 1 1022 ? -26.843 -54.310  7.425   1.00 7.74  ? 1023 LYS A C     1 
ATOM   7757  O  O     . LYS A 1 1022 ? -26.485 -55.461  7.148   1.00 7.51  ? 1023 LYS A O     1 
ATOM   7758  C  CB    . LYS A 1 1022 ? -27.532 -54.421  9.820   1.00 7.99  ? 1023 LYS A CB    1 
ATOM   7759  C  CG    . LYS A 1 1022 ? -26.359 -53.595  10.339  1.00 7.24  ? 1023 LYS A CG    1 
ATOM   7760  C  CD    . LYS A 1 1022 ? -25.932 -54.102  11.689  1.00 6.83  ? 1023 LYS A CD    1 
ATOM   7761  C  CE    . LYS A 1 1022 ? -24.930 -53.164  12.283  1.00 7.29  ? 1023 LYS A CE    1 
ATOM   7762  N  NZ    . LYS A 1 1022 ? -24.904 -53.272  13.758  1.00 6.60  ? 1023 LYS A NZ    1 
ATOM   7763  N  N     . ASP A 1 1023 ? -26.336 -53.220  6.852   1.00 7.78  ? 1024 ASP A N     1 
ATOM   7764  C  CA    . ASP A 1 1023 ? -25.239 -53.292  5.892   1.00 7.33  ? 1024 ASP A CA    1 
ATOM   7765  C  C     . ASP A 1 1023 ? -23.917 -53.208  6.662   1.00 6.76  ? 1024 ASP A C     1 
ATOM   7766  O  O     . ASP A 1 1023 ? -23.336 -52.131  6.759   1.00 6.89  ? 1024 ASP A O     1 
ATOM   7767  C  CB    . ASP A 1 1023 ? -25.360 -52.118  4.916   1.00 8.32  ? 1024 ASP A CB    1 
ATOM   7768  C  CG    . ASP A 1 1023 ? -24.562 -52.322  3.647   1.00 9.68  ? 1024 ASP A CG    1 
ATOM   7769  O  OD1   . ASP A 1 1023 ? -23.597 -53.118  3.664   1.00 10.94 ? 1024 ASP A OD1   1 
ATOM   7770  O  OD2   . ASP A 1 1023 ? -24.906 -51.702  2.611   1.00 10.30 ? 1024 ASP A OD2   1 
ATOM   7771  N  N     . LEU A 1 1024 ? -23.439 -54.336  7.204   1.00 5.63  ? 1025 LEU A N     1 
ATOM   7772  C  CA    . LEU A 1 1024 ? -22.188 -54.350  7.983   1.00 4.24  ? 1025 LEU A CA    1 
ATOM   7773  C  C     . LEU A 1 1024 ? -20.984 -54.046  7.109   1.00 4.29  ? 1025 LEU A C     1 
ATOM   7774  O  O     . LEU A 1 1024 ? -20.139 -53.221  7.467   1.00 3.98  ? 1025 LEU A O     1 
ATOM   7775  C  CB    . LEU A 1 1024 ? -22.003 -55.680  8.699   1.00 2.72  ? 1025 LEU A CB    1 
ATOM   7776  C  CG    . LEU A 1 1024 ? -20.800 -55.907  9.596   1.00 2.33  ? 1025 LEU A CG    1 
ATOM   7777  C  CD1   . LEU A 1 1024 ? -20.669 -54.844  10.627  1.00 2.00  ? 1025 LEU A CD1   1 
ATOM   7778  C  CD2   . LEU A 1 1024 ? -20.944 -57.247  10.284  1.00 2.02  ? 1025 LEU A CD2   1 
ATOM   7779  N  N     . ALA A 1 1025 ? -20.973 -54.640  5.918   1.00 4.38  ? 1026 ALA A N     1 
ATOM   7780  C  CA    . ALA A 1 1025 ? -19.899 -54.459  4.954   1.00 4.20  ? 1026 ALA A CA    1 
ATOM   7781  C  C     . ALA A 1 1025 ? -19.724 -53.006  4.582   1.00 4.51  ? 1026 ALA A C     1 
ATOM   7782  O  O     . ALA A 1 1025 ? -18.643 -52.454  4.703   1.00 5.62  ? 1026 ALA A O     1 
ATOM   7783  C  CB    . ALA A 1 1025 ? -20.172 -55.256  3.730   1.00 4.20  ? 1026 ALA A CB    1 
ATOM   7784  N  N     . ARG A 1 1026 ? -20.780 -52.352  4.148   1.00 4.37  ? 1027 ARG A N     1 
ATOM   7785  C  CA    . ARG A 1 1026 ? -20.591 -50.977  3.786   1.00 4.31  ? 1027 ARG A CA    1 
ATOM   7786  C  C     . ARG A 1 1026 ? -20.318 -50.215  5.062   1.00 4.07  ? 1027 ARG A C     1 
ATOM   7787  O  O     . ARG A 1 1026 ? -19.530 -49.279  5.070   1.00 3.89  ? 1027 ARG A O     1 
ATOM   7788  C  CB    . ARG A 1 1026 ? -21.771 -50.442  2.973   1.00 5.15  ? 1027 ARG A CB    1 
ATOM   7789  C  CG    . ARG A 1 1026 ? -21.868 -51.140  1.603   1.00 6.76  ? 1027 ARG A CG    1 
ATOM   7790  C  CD    . ARG A 1 1026 ? -22.367 -50.268  0.463   1.00 8.51  ? 1027 ARG A CD    1 
ATOM   7791  N  NE    . ARG A 1 1026 ? -23.767 -49.900  0.636   1.00 10.66 ? 1027 ARG A NE    1 
ATOM   7792  C  CZ    . ARG A 1 1026 ? -24.197 -48.708  1.050   1.00 11.37 ? 1027 ARG A CZ    1 
ATOM   7793  N  NH1   . ARG A 1 1026 ? -23.336 -47.740  1.339   1.00 11.24 ? 1027 ARG A NH1   1 
ATOM   7794  N  NH2   . ARG A 1 1026 ? -25.502 -48.488  1.192   1.00 12.18 ? 1027 ARG A NH2   1 
ATOM   7795  N  N     . MET A 1 1027 ? -20.850 -50.703  6.176   1.00 3.83  ? 1028 MET A N     1 
ATOM   7796  C  CA    . MET A 1 1027 ? -20.608 -50.015  7.430   1.00 3.62  ? 1028 MET A CA    1 
ATOM   7797  C  C     . MET A 1 1027 ? -19.154 -50.046  7.859   1.00 4.05  ? 1028 MET A C     1 
ATOM   7798  O  O     . MET A 1 1027 ? -18.618 -49.005  8.267   1.00 4.14  ? 1028 MET A O     1 
ATOM   7799  C  CB    . MET A 1 1027 ? -21.524 -50.494  8.551   1.00 2.83  ? 1028 MET A CB    1 
ATOM   7800  C  CG    . MET A 1 1027 ? -22.742 -49.625  8.711   1.00 2.00  ? 1028 MET A CG    1 
ATOM   7801  S  SD    . MET A 1 1027 ? -23.847 -50.250  9.953   1.00 2.00  ? 1028 MET A SD    1 
ATOM   7802  C  CE    . MET A 1 1027 ? -23.564 -49.193  11.290  1.00 2.20  ? 1028 MET A CE    1 
ATOM   7803  N  N     . VAL A 1 1028 ? -18.469 -51.179  7.731   1.00 3.82  ? 1029 VAL A N     1 
ATOM   7804  C  CA    . VAL A 1 1028 ? -17.083 -51.144  8.154   1.00 3.91  ? 1029 VAL A CA    1 
ATOM   7805  C  C     . VAL A 1 1028 ? -16.170 -50.670  7.059   1.00 3.83  ? 1029 VAL A C     1 
ATOM   7806  O  O     . VAL A 1 1028 ? -15.069 -50.221  7.322   1.00 4.50  ? 1029 VAL A O     1 
ATOM   7807  C  CB    . VAL A 1 1028 ? -16.597 -52.438  8.823   1.00 4.23  ? 1029 VAL A CB    1 
ATOM   7808  C  CG1   . VAL A 1 1028 ? -17.779 -53.302  9.233   1.00 4.97  ? 1029 VAL A CG1   1 
ATOM   7809  C  CG2   . VAL A 1 1028 ? -15.600 -53.164  7.968   1.00 4.55  ? 1029 VAL A CG2   1 
ATOM   7810  N  N     . MET A 1 1029 ? -16.655 -50.675  5.830   1.00 3.94  ? 1030 MET A N     1 
ATOM   7811  C  CA    . MET A 1 1029 ? -15.836 -50.187  4.735   1.00 4.16  ? 1030 MET A CA    1 
ATOM   7812  C  C     . MET A 1 1029 ? -15.541 -48.698  4.847   1.00 4.12  ? 1030 MET A C     1 
ATOM   7813  O  O     . MET A 1 1029 ? -14.694 -48.198  4.124   1.00 4.58  ? 1030 MET A O     1 
ATOM   7814  C  CB    . MET A 1 1029 ? -16.483 -50.464  3.381   1.00 4.25  ? 1030 MET A CB    1 
ATOM   7815  C  CG    . MET A 1 1029 ? -16.217 -51.853  2.843   1.00 5.34  ? 1030 MET A CG    1 
ATOM   7816  S  SD    . MET A 1 1029 ? -16.618 -52.010  1.097   1.00 6.20  ? 1030 MET A SD    1 
ATOM   7817  C  CE    . MET A 1 1029 ? -18.384 -52.509  1.143   1.00 4.93  ? 1030 MET A CE    1 
ATOM   7818  N  N     . THR A 1 1030 ? -16.226 -47.991  5.748   1.00 4.49  ? 1031 THR A N     1 
ATOM   7819  C  CA    . THR A 1 1030 ? -16.018 -46.535  5.930   1.00 4.50  ? 1031 THR A CA    1 
ATOM   7820  C  C     . THR A 1 1030 ? -14.680 -46.163  6.611   1.00 4.90  ? 1031 THR A C     1 
ATOM   7821  O  O     . THR A 1 1030 ? -14.141 -45.056  6.442   1.00 4.34  ? 1031 THR A O     1 
ATOM   7822  C  CB    . THR A 1 1030 ? -17.189 -45.887  6.686   1.00 3.94  ? 1031 THR A CB    1 
ATOM   7823  O  OG1   . THR A 1 1030 ? -17.369 -46.538  7.954   1.00 3.99  ? 1031 THR A OG1   1 
ATOM   7824  C  CG2   . THR A 1 1030 ? -18.458 -45.978  5.857   1.00 2.12  ? 1031 THR A CG2   1 
ATOM   7825  N  N     . TYR A 1 1031 ? -14.146 -47.123  7.360   1.00 5.62  ? 1032 TYR A N     1 
ATOM   7826  C  CA    . TYR A 1 1031 ? -12.864 -46.958  8.028   1.00 5.90  ? 1032 TYR A CA    1 
ATOM   7827  C  C     . TYR A 1 1031 ? -11.775 -46.694  6.990   1.00 5.93  ? 1032 TYR A C     1 
ATOM   7828  O  O     . TYR A 1 1031 ? -11.039 -45.716  7.089   1.00 6.39  ? 1032 TYR A O     1 
ATOM   7829  C  CB    . TYR A 1 1031 ? -12.546 -48.207  8.829   1.00 4.99  ? 1032 TYR A CB    1 
ATOM   7830  C  CG    . TYR A 1 1031 ? -13.243 -48.219  10.146  1.00 4.69  ? 1032 TYR A CG    1 
ATOM   7831  C  CD1   . TYR A 1 1031 ? -12.958 -47.243  11.090  1.00 5.18  ? 1032 TYR A CD1   1 
ATOM   7832  C  CD2   . TYR A 1 1031 ? -14.171 -49.200  10.462  1.00 3.50  ? 1032 TYR A CD2   1 
ATOM   7833  C  CE1   . TYR A 1 1031 ? -13.576 -47.245  12.313  1.00 4.89  ? 1032 TYR A CE1   1 
ATOM   7834  C  CE2   . TYR A 1 1031 ? -14.788 -49.214  11.674  1.00 3.65  ? 1032 TYR A CE2   1 
ATOM   7835  C  CZ    . TYR A 1 1031 ? -14.489 -48.237  12.602  1.00 4.48  ? 1032 TYR A CZ    1 
ATOM   7836  O  OH    . TYR A 1 1031 ? -15.065 -48.243  13.847  1.00 5.64  ? 1032 TYR A OH    1 
ATOM   7837  N  N     . GLY A 1 1032 ? -11.681 -47.575  5.997   1.00 6.06  ? 1033 GLY A N     1 
ATOM   7838  C  CA    . GLY A 1 1032 ? -10.709 -47.395  4.930   1.00 5.40  ? 1033 GLY A CA    1 
ATOM   7839  C  C     . GLY A 1 1032 ? -9.458  -48.224  5.055   1.00 5.06  ? 1033 GLY A C     1 
ATOM   7840  O  O     . GLY A 1 1032 ? -8.748  -48.433  4.056   1.00 4.90  ? 1033 GLY A O     1 
ATOM   7841  N  N     . TYR A 1 1033 ? -9.184  -48.650  6.288   1.00 4.29  ? 1034 TYR A N     1 
ATOM   7842  C  CA    . TYR A 1 1033 ? -8.029  -49.459  6.579   1.00 3.87  ? 1034 TYR A CA    1 
ATOM   7843  C  C     . TYR A 1 1033 ? -8.380  -50.865  6.973   1.00 3.63  ? 1034 TYR A C     1 
ATOM   7844  O  O     . TYR A 1 1033 ? -7.525  -51.569  7.517   1.00 4.01  ? 1034 TYR A O     1 
ATOM   7845  C  CB    . TYR A 1 1033 ? -7.153  -48.836  7.655   1.00 3.84  ? 1034 TYR A CB    1 
ATOM   7846  C  CG    . TYR A 1 1033 ? -7.846  -48.501  8.969   1.00 4.74  ? 1034 TYR A CG    1 
ATOM   7847  C  CD1   . TYR A 1 1033 ? -8.185  -49.490  9.910   1.00 4.43  ? 1034 TYR A CD1   1 
ATOM   7848  C  CD2   . TYR A 1 1033 ? -8.084  -47.176  9.307   1.00 4.72  ? 1034 TYR A CD2   1 
ATOM   7849  C  CE1   . TYR A 1 1033 ? -8.729  -49.145  11.140  1.00 4.21  ? 1034 TYR A CE1   1 
ATOM   7850  C  CE2   . TYR A 1 1033 ? -8.621  -46.834  10.522  1.00 5.19  ? 1034 TYR A CE2   1 
ATOM   7851  C  CZ    . TYR A 1 1033 ? -8.941  -47.808  11.431  1.00 4.72  ? 1034 TYR A CZ    1 
ATOM   7852  O  OH    . TYR A 1 1033 ? -9.492  -47.374  12.607  1.00 6.27  ? 1034 TYR A OH    1 
ATOM   7853  N  N     . VAL A 1 1034 ? -9.618  -51.276  6.708   1.00 2.67  ? 1035 VAL A N     1 
ATOM   7854  C  CA    . VAL A 1 1034 ? -10.028 -52.641  7.007   1.00 2.66  ? 1035 VAL A CA    1 
ATOM   7855  C  C     . VAL A 1 1034 ? -10.414 -53.408  5.743   1.00 2.64  ? 1035 VAL A C     1 
ATOM   7856  O  O     . VAL A 1 1034 ? -11.289 -52.980  4.991   1.00 2.57  ? 1035 VAL A O     1 
ATOM   7857  C  CB    . VAL A 1 1034 ? -11.169 -52.648  8.008   1.00 2.56  ? 1035 VAL A CB    1 
ATOM   7858  C  CG1   . VAL A 1 1034 ? -11.782 -54.022  8.128   1.00 2.25  ? 1035 VAL A CG1   1 
ATOM   7859  C  CG2   . VAL A 1 1034 ? -10.632 -52.237  9.319   1.00 3.43  ? 1035 VAL A CG2   1 
ATOM   7860  N  N     . TYR A 1 1035 ? -9.718  -54.513  5.492   1.00 2.77  ? 1036 TYR A N     1 
ATOM   7861  C  CA    . TYR A 1 1035 ? -9.980  -55.347  4.324   1.00 3.16  ? 1036 TYR A CA    1 
ATOM   7862  C  C     . TYR A 1 1035 ? -11.352 -55.906  4.555   1.00 4.12  ? 1036 TYR A C     1 
ATOM   7863  O  O     . TYR A 1 1035 ? -11.563 -56.548  5.594   1.00 5.08  ? 1036 TYR A O     1 
ATOM   7864  C  CB    . TYR A 1 1035 ? -9.002  -56.514  4.244   1.00 2.47  ? 1036 TYR A CB    1 
ATOM   7865  C  CG    . TYR A 1 1035 ? -9.246  -57.412  3.053   1.00 2.52  ? 1036 TYR A CG    1 
ATOM   7866  C  CD1   . TYR A 1 1035 ? -10.268 -58.358  3.061   1.00 2.53  ? 1036 TYR A CD1   1 
ATOM   7867  C  CD2   . TYR A 1 1035 ? -8.475  -57.299  1.902   1.00 2.81  ? 1036 TYR A CD2   1 
ATOM   7868  C  CE1   . TYR A 1 1035 ? -10.514 -59.162  1.952   1.00 2.18  ? 1036 TYR A CE1   1 
ATOM   7869  C  CE2   . TYR A 1 1035 ? -8.718  -58.104  0.784   1.00 2.19  ? 1036 TYR A CE2   1 
ATOM   7870  C  CZ    . TYR A 1 1035 ? -9.739  -59.016  0.820   1.00 2.14  ? 1036 TYR A CZ    1 
ATOM   7871  O  OH    . TYR A 1 1035 ? -10.040 -59.725  -0.305  1.00 2.18  ? 1036 TYR A OH    1 
ATOM   7872  N  N     . VAL A 1 1036 ? -12.260 -55.699  3.591   1.00 4.03  ? 1037 VAL A N     1 
ATOM   7873  C  CA    . VAL A 1 1036 ? -13.655 -56.152  3.680   1.00 3.26  ? 1037 VAL A CA    1 
ATOM   7874  C  C     . VAL A 1 1036 ? -14.082 -56.891  2.423   1.00 2.86  ? 1037 VAL A C     1 
ATOM   7875  O  O     . VAL A 1 1036 ? -13.974 -56.371  1.313   1.00 2.21  ? 1037 VAL A O     1 
ATOM   7876  C  CB    . VAL A 1 1036 ? -14.609 -54.941  3.849   1.00 3.18  ? 1037 VAL A CB    1 
ATOM   7877  C  CG1   . VAL A 1 1036 ? -16.032 -55.383  4.113   1.00 3.46  ? 1037 VAL A CG1   1 
ATOM   7878  C  CG2   . VAL A 1 1036 ? -14.128 -54.061  4.955   1.00 3.29  ? 1037 VAL A CG2   1 
ATOM   7879  N  N     . ALA A 1 1037 ? -14.597 -58.095  2.597   1.00 2.35  ? 1038 ALA A N     1 
ATOM   7880  C  CA    . ALA A 1 1037 ? -15.040 -58.864  1.453   1.00 2.80  ? 1038 ALA A CA    1 
ATOM   7881  C  C     . ALA A 1 1037 ? -16.206 -59.735  1.841   1.00 3.23  ? 1038 ALA A C     1 
ATOM   7882  O  O     . ALA A 1 1037 ? -16.398 -60.040  3.025   1.00 3.38  ? 1038 ALA A O     1 
ATOM   7883  C  CB    . ALA A 1 1037 ? -13.922 -59.725  0.919   1.00 2.00  ? 1038 ALA A CB    1 
ATOM   7884  N  N     . THR A 1 1038 ? -17.000 -60.105  0.839   1.00 3.28  ? 1039 THR A N     1 
ATOM   7885  C  CA    . THR A 1 1038 ? -18.141 -60.978  1.039   1.00 3.92  ? 1039 THR A CA    1 
ATOM   7886  C  C     . THR A 1 1038 ? -17.956 -62.172  0.107   1.00 4.33  ? 1039 THR A C     1 
ATOM   7887  O  O     . THR A 1 1038 ? -17.215 -62.098  -0.869  1.00 4.75  ? 1039 THR A O     1 
ATOM   7888  C  CB    . THR A 1 1038 ? -19.458 -60.258  0.786   1.00 4.47  ? 1039 THR A CB    1 
ATOM   7889  O  OG1   . THR A 1 1038 ? -19.535 -59.805  -0.563  1.00 4.74  ? 1039 THR A OG1   1 
ATOM   7890  C  CG2   . THR A 1 1038 ? -19.549 -59.060  1.675   1.00 5.35  ? 1039 THR A CG2   1 
ATOM   7891  N  N     . VAL A 1 1039 ? -18.564 -63.298  0.427   1.00 4.66  ? 1040 VAL A N     1 
ATOM   7892  C  CA    . VAL A 1 1039 ? -18.364 -64.465  -0.400  1.00 4.99  ? 1040 VAL A CA    1 
ATOM   7893  C  C     . VAL A 1 1039 ? -19.583 -65.371  -0.389  1.00 5.65  ? 1040 VAL A C     1 
ATOM   7894  O  O     . VAL A 1 1039 ? -20.524 -65.138  0.362   1.00 6.32  ? 1040 VAL A O     1 
ATOM   7895  C  CB    . VAL A 1 1039 ? -17.131 -65.263  0.088   1.00 4.52  ? 1040 VAL A CB    1 
ATOM   7896  C  CG1   . VAL A 1 1039 ? -15.881 -64.384  0.133   1.00 3.97  ? 1040 VAL A CG1   1 
ATOM   7897  C  CG2   . VAL A 1 1039 ? -17.397 -65.834  1.446   1.00 4.76  ? 1040 VAL A CG2   1 
ATOM   7898  N  N     . SER A 1 1040 ? -19.567 -66.380  -1.254  1.00 6.12  ? 1041 SER A N     1 
ATOM   7899  C  CA    . SER A 1 1040 ? -20.643 -67.357  -1.376  1.00 6.21  ? 1041 SER A CA    1 
ATOM   7900  C  C     . SER A 1 1040 ? -19.960 -68.526  -2.038  1.00 6.74  ? 1041 SER A C     1 
ATOM   7901  O  O     . SER A 1 1040 ? -19.370 -68.375  -3.112  1.00 7.17  ? 1041 SER A O     1 
ATOM   7902  C  CB    . SER A 1 1040 ? -21.723 -66.839  -2.301  1.00 6.21  ? 1041 SER A CB    1 
ATOM   7903  O  OG    . SER A 1 1040 ? -22.858 -67.679  -2.248  1.00 6.63  ? 1041 SER A OG    1 
ATOM   7904  N  N     . MET A 1 1041 ? -19.984 -69.674  -1.379  1.00 6.83  ? 1042 MET A N     1 
ATOM   7905  C  CA    . MET A 1 1041 ? -19.318 -70.852  -1.900  1.00 6.77  ? 1042 MET A CA    1 
ATOM   7906  C  C     . MET A 1 1041 ? -19.961 -71.353  -3.175  1.00 6.98  ? 1042 MET A C     1 
ATOM   7907  O  O     . MET A 1 1041 ? -19.303 -71.500  -4.186  1.00 6.92  ? 1042 MET A O     1 
ATOM   7908  C  CB    . MET A 1 1041 ? -19.310 -71.939  -0.836  1.00 6.89  ? 1042 MET A CB    1 
ATOM   7909  C  CG    . MET A 1 1041 ? -18.617 -73.209  -1.242  1.00 7.37  ? 1042 MET A CG    1 
ATOM   7910  S  SD    . MET A 1 1041 ? -17.970 -74.076  0.215   1.00 7.75  ? 1042 MET A SD    1 
ATOM   7911  C  CE    . MET A 1 1041 ? -16.410 -73.357  0.254   1.00 7.64  ? 1042 MET A CE    1 
ATOM   7912  N  N     . GLY A 1 1042 ? -21.270 -71.532  -3.153  1.00 7.16  ? 1043 GLY A N     1 
ATOM   7913  C  CA    . GLY A 1 1042 ? -21.957 -72.028  -4.326  1.00 7.55  ? 1043 GLY A CA    1 
ATOM   7914  C  C     . GLY A 1 1042 ? -21.690 -71.262  -5.598  1.00 8.04  ? 1043 GLY A C     1 
ATOM   7915  O  O     . GLY A 1 1042 ? -21.760 -71.819  -6.684  1.00 8.58  ? 1043 GLY A O     1 
ATOM   7916  N  N     . TYR A 1 1043 ? -21.358 -69.988  -5.473  1.00 8.85  ? 1044 TYR A N     1 
ATOM   7917  C  CA    . TYR A 1 1043 ? -21.112 -69.160  -6.638  1.00 9.17  ? 1044 TYR A CA    1 
ATOM   7918  C  C     . TYR A 1 1043 ? -19.681 -69.243  -7.120  1.00 9.48  ? 1044 TYR A C     1 
ATOM   7919  O  O     . TYR A 1 1043 ? -19.442 -69.608  -8.270  1.00 10.43 ? 1044 TYR A O     1 
ATOM   7920  C  CB    . TYR A 1 1043 ? -21.481 -67.734  -6.333  1.00 9.62  ? 1044 TYR A CB    1 
ATOM   7921  C  CG    . TYR A 1 1043 ? -21.242 -66.793  -7.468  1.00 10.60 ? 1044 TYR A CG    1 
ATOM   7922  C  CD1   . TYR A 1 1043 ? -22.066 -66.805  -8.586  1.00 10.86 ? 1044 TYR A CD1   1 
ATOM   7923  C  CD2   . TYR A 1 1043 ? -20.256 -65.814  -7.377  1.00 11.37 ? 1044 TYR A CD2   1 
ATOM   7924  C  CE1   . TYR A 1 1043 ? -21.925 -65.865  -9.565  1.00 11.36 ? 1044 TYR A CE1   1 
ATOM   7925  C  CE2   . TYR A 1 1043 ? -20.106 -64.868  -8.347  1.00 11.86 ? 1044 TYR A CE2   1 
ATOM   7926  C  CZ    . TYR A 1 1043 ? -20.953 -64.893  -9.433  1.00 11.73 ? 1044 TYR A CZ    1 
ATOM   7927  O  OH    . TYR A 1 1043 ? -20.868 -63.885  -10.346 1.00 13.33 ? 1044 TYR A OH    1 
ATOM   7928  N  N     . SER A 1 1044 ? -18.728 -68.843  -6.288  1.00 9.24  ? 1045 SER A N     1 
ATOM   7929  C  CA    . SER A 1 1044 ? -17.337 -68.956  -6.681  1.00 9.26  ? 1045 SER A CA    1 
ATOM   7930  C  C     . SER A 1 1044 ? -16.500 -69.469  -5.519  1.00 9.36  ? 1045 SER A C     1 
ATOM   7931  O  O     . SER A 1 1044 ? -16.515 -68.895  -4.431  1.00 9.98  ? 1045 SER A O     1 
ATOM   7932  C  CB    . SER A 1 1044 ? -16.806 -67.625  -7.207  1.00 9.56  ? 1045 SER A CB    1 
ATOM   7933  O  OG    . SER A 1 1044 ? -15.584 -67.807  -7.910  1.00 9.60  ? 1045 SER A OG    1 
ATOM   7934  N  N     . LYS A 1 1045 ? -15.893 -70.634  -5.719  1.00 9.65  ? 1046 LYS A N     1 
ATOM   7935  C  CA    . LYS A 1 1045 ? -15.020 -71.260  -4.726  1.00 10.39 ? 1046 LYS A CA    1 
ATOM   7936  C  C     . LYS A 1 1045 ? -13.629 -70.668  -4.956  1.00 11.76 ? 1046 LYS A C     1 
ATOM   7937  O  O     . LYS A 1 1045 ? -12.746 -70.730  -4.089  1.00 12.50 ? 1046 LYS A O     1 
ATOM   7938  C  CB    . LYS A 1 1045 ? -14.909 -72.767  -4.968  1.00 8.90  ? 1046 LYS A CB    1 
ATOM   7939  C  CG    . LYS A 1 1045 ? -16.202 -73.515  -4.986  1.00 7.22  ? 1046 LYS A CG    1 
ATOM   7940  C  CD    . LYS A 1 1045 ? -15.965 -74.957  -5.314  1.00 5.79  ? 1046 LYS A CD    1 
ATOM   7941  C  CE    . LYS A 1 1045 ? -17.249 -75.728  -5.241  1.00 5.73  ? 1046 LYS A CE    1 
ATOM   7942  N  NZ    . LYS A 1 1045 ? -18.323 -75.168  -6.122  1.00 5.73  ? 1046 LYS A NZ    1 
ATOM   7943  N  N     . GLN A 1 1046 ? -13.431 -70.147  -6.164  1.00 12.63 ? 1047 GLN A N     1 
ATOM   7944  C  CA    . GLN A 1 1046 ? -12.162 -69.565  -6.577  1.00 13.33 ? 1047 GLN A CA    1 
ATOM   7945  C  C     . GLN A 1 1046 ? -12.051 -68.226  -5.871  1.00 12.88 ? 1047 GLN A C     1 
ATOM   7946  O  O     . GLN A 1 1046 ? -10.996 -67.862  -5.333  1.00 13.70 ? 1047 GLN A O     1 
ATOM   7947  C  CB    . GLN A 1 1046 ? -12.129 -69.345  -8.107  1.00 14.96 ? 1047 GLN A CB    1 
ATOM   7948  C  CG    . GLN A 1 1046 ? -12.525 -70.559  -9.027  1.00 17.45 ? 1047 GLN A CG    1 
ATOM   7949  C  CD    . GLN A 1 1046 ? -14.057 -70.896  -9.051  1.00 19.07 ? 1047 GLN A CD    1 
ATOM   7950  O  OE1   . GLN A 1 1046 ? -14.522 -71.830  -8.367  1.00 19.41 ? 1047 GLN A OE1   1 
ATOM   7951  N  NE2   . GLN A 1 1046 ? -14.823 -70.152  -9.859  1.00 19.51 ? 1047 GLN A NE2   1 
ATOM   7952  N  N     . GLN A 1 1047 ? -13.160 -67.496  -5.869  1.00 11.68 ? 1048 GLN A N     1 
ATOM   7953  C  CA    . GLN A 1 1047 ? -13.213 -66.177  -5.257  1.00 10.12 ? 1048 GLN A CA    1 
ATOM   7954  C  C     . GLN A 1 1047 ? -13.170 -66.274  -3.746  1.00 9.38  ? 1048 GLN A C     1 
ATOM   7955  O  O     . GLN A 1 1047 ? -12.839 -65.299  -3.077  1.00 9.57  ? 1048 GLN A O     1 
ATOM   7956  C  CB    . GLN A 1 1047 ? -14.476 -65.447  -5.709  1.00 9.17  ? 1048 GLN A CB    1 
ATOM   7957  C  CG    . GLN A 1 1047 ? -14.519 -64.017  -5.299  1.00 8.40  ? 1048 GLN A CG    1 
ATOM   7958  C  CD    . GLN A 1 1047 ? -15.233 -63.798  -4.001  1.00 8.41  ? 1048 GLN A CD    1 
ATOM   7959  O  OE1   . GLN A 1 1047 ? -15.624 -62.676  -3.700  1.00 8.65  ? 1048 GLN A OE1   1 
ATOM   7960  N  NE2   . GLN A 1 1047 ? -15.455 -64.867  -3.237  1.00 8.33  ? 1048 GLN A NE2   1 
ATOM   7961  N  N     . PHE A 1 1048 ? -13.617 -67.410  -3.214  1.00 8.27  ? 1049 PHE A N     1 
ATOM   7962  C  CA    . PHE A 1 1048 ? -13.618 -67.632  -1.773  1.00 6.62  ? 1049 PHE A CA    1 
ATOM   7963  C  C     . PHE A 1 1048 ? -12.159 -67.776  -1.418  1.00 6.31  ? 1049 PHE A C     1 
ATOM   7964  O  O     . PHE A 1 1048 ? -11.654 -66.998  -0.621  1.00 6.90  ? 1049 PHE A O     1 
ATOM   7965  C  CB    . PHE A 1 1048 ? -14.416 -68.889  -1.416  1.00 5.27  ? 1049 PHE A CB    1 
ATOM   7966  C  CG    . PHE A 1 1048 ? -14.403 -69.244  0.045   1.00 4.27  ? 1049 PHE A CG    1 
ATOM   7967  C  CD1   . PHE A 1 1048 ? -14.475 -68.267  1.027   1.00 4.22  ? 1049 PHE A CD1   1 
ATOM   7968  C  CD2   . PHE A 1 1048 ? -14.339 -70.584  0.443   1.00 4.28  ? 1049 PHE A CD2   1 
ATOM   7969  C  CE1   . PHE A 1 1048 ? -14.477 -68.613  2.386   1.00 3.65  ? 1049 PHE A CE1   1 
ATOM   7970  C  CE2   . PHE A 1 1048 ? -14.336 -70.943  1.792   1.00 3.62  ? 1049 PHE A CE2   1 
ATOM   7971  C  CZ    . PHE A 1 1048 ? -14.408 -69.959  2.763   1.00 4.07  ? 1049 PHE A CZ    1 
ATOM   7972  N  N     . LEU A 1 1049 ? -11.448 -68.657  -2.121  1.00 5.73  ? 1050 LEU A N     1 
ATOM   7973  C  CA    . LEU A 1 1049 ? -10.031 -68.865  -1.853  1.00 5.31  ? 1050 LEU A CA    1 
ATOM   7974  C  C     . LEU A 1 1049 ? -9.205  -67.585  -2.048  1.00 5.82  ? 1050 LEU A C     1 
ATOM   7975  O  O     . LEU A 1 1049 ? -8.239  -67.336  -1.324  1.00 6.02  ? 1050 LEU A O     1 
ATOM   7976  C  CB    . LEU A 1 1049 ? -9.493  -69.998  -2.717  1.00 4.21  ? 1050 LEU A CB    1 
ATOM   7977  C  CG    . LEU A 1 1049 ? -10.065 -71.395  -2.470  1.00 3.76  ? 1050 LEU A CG    1 
ATOM   7978  C  CD1   . LEU A 1 1049 ? -9.432  -72.398  -3.439  1.00 3.76  ? 1050 LEU A CD1   1 
ATOM   7979  C  CD2   . LEU A 1 1049 ? -9.811  -71.825  -1.030  1.00 3.20  ? 1050 LEU A CD2   1 
ATOM   7980  N  N     . LYS A 1 1050 ? -9.637  -66.736  -2.978  1.00 6.27  ? 1051 LYS A N     1 
ATOM   7981  C  CA    . LYS A 1 1050 ? -8.938  -65.485  -3.259  1.00 6.33  ? 1051 LYS A CA    1 
ATOM   7982  C  C     . LYS A 1 1050 ? -9.184  -64.526  -2.125  1.00 5.99  ? 1051 LYS A C     1 
ATOM   7983  O  O     . LYS A 1 1050 ? -8.421  -63.619  -1.909  1.00 6.53  ? 1051 LYS A O     1 
ATOM   7984  C  CB    . LYS A 1 1050 ? -9.438  -64.862  -4.568  1.00 7.17  ? 1051 LYS A CB    1 
ATOM   7985  C  CG    . LYS A 1 1050 ? -8.584  -63.715  -5.098  1.00 8.30  ? 1051 LYS A CG    1 
ATOM   7986  C  CD    . LYS A 1 1050 ? -9.284  -62.890  -6.192  1.00 10.43 ? 1051 LYS A CD    1 
ATOM   7987  C  CE    . LYS A 1 1050 ? -8.333  -61.826  -6.812  1.00 12.78 ? 1051 LYS A CE    1 
ATOM   7988  N  NZ    . LYS A 1 1050 ? -8.953  -60.750  -7.719  1.00 14.29 ? 1051 LYS A NZ    1 
ATOM   7989  N  N     . VAL A 1 1051 ? -10.283 -64.700  -1.416  1.00 6.04  ? 1052 VAL A N     1 
ATOM   7990  C  CA    . VAL A 1 1051 ? -10.587 -63.817  -0.300  1.00 5.85  ? 1052 VAL A CA    1 
ATOM   7991  C  C     . VAL A 1 1051 ? -9.858  -64.353  0.929   1.00 6.57  ? 1052 VAL A C     1 
ATOM   7992  O  O     . VAL A 1 1051 ? -9.251  -63.588  1.669   1.00 6.67  ? 1052 VAL A O     1 
ATOM   7993  C  CB    . VAL A 1 1051 ? -12.100 -63.704  -0.094  1.00 5.00  ? 1052 VAL A CB    1 
ATOM   7994  C  CG1   . VAL A 1 1051 ? -12.424 -63.334  1.304   1.00 4.80  ? 1052 VAL A CG1   1 
ATOM   7995  C  CG2   . VAL A 1 1051 ? -12.648 -62.672  -1.021  1.00 3.92  ? 1052 VAL A CG2   1 
ATOM   7996  N  N     . LEU A 1 1052 ? -9.851  -65.668  1.117   1.00 7.13  ? 1053 LEU A N     1 
ATOM   7997  C  CA    . LEU A 1 1052 ? -9.140  -66.215  2.255   1.00 8.37  ? 1053 LEU A CA    1 
ATOM   7998  C  C     . LEU A 1 1052 ? -7.679  -65.789  2.176   1.00 10.01 ? 1053 LEU A C     1 
ATOM   7999  O  O     . LEU A 1 1052 ? -7.173  -65.151  3.106   1.00 10.61 ? 1053 LEU A O     1 
ATOM   8000  C  CB    . LEU A 1 1052 ? -9.278  -67.729  2.335   1.00 7.11  ? 1053 LEU A CB    1 
ATOM   8001  C  CG    . LEU A 1 1052 ? -10.660 -68.091  2.858   1.00 6.53  ? 1053 LEU A CG    1 
ATOM   8002  C  CD1   . LEU A 1 1052 ? -10.765 -69.565  3.106   1.00 6.99  ? 1053 LEU A CD1   1 
ATOM   8003  C  CD2   . LEU A 1 1052 ? -10.895 -67.353  4.144   1.00 6.14  ? 1053 LEU A CD2   1 
ATOM   8004  N  N     . LYS A 1 1053 ? -7.057  -65.997  1.013   1.00 11.14 ? 1054 LYS A N     1 
ATOM   8005  C  CA    . LYS A 1 1053 ? -5.655  -65.627  0.814   1.00 12.09 ? 1054 LYS A CA    1 
ATOM   8006  C  C     . LYS A 1 1053 ? -5.420  -64.127  1.028   1.00 11.95 ? 1054 LYS A C     1 
ATOM   8007  O  O     . LYS A 1 1053 ? -4.482  -63.753  1.718   1.00 11.91 ? 1054 LYS A O     1 
ATOM   8008  C  CB    . LYS A 1 1053 ? -5.172  -66.071  -0.585  1.00 14.07 ? 1054 LYS A CB    1 
ATOM   8009  C  CG    . LYS A 1 1053 ? -3.622  -65.994  -0.877  1.00 15.73 ? 1054 LYS A CG    1 
ATOM   8010  C  CD    . LYS A 1 1053 ? -3.177  -64.648  -1.559  1.00 17.60 ? 1054 LYS A CD    1 
ATOM   8011  C  CE    . LYS A 1 1053 ? -1.730  -64.671  -2.142  1.00 18.66 ? 1054 LYS A CE    1 
ATOM   8012  N  NZ    . LYS A 1 1053 ? -0.582  -64.825  -1.149  1.00 19.39 ? 1054 LYS A NZ    1 
ATOM   8013  N  N     . GLU A 1 1054 ? -6.289  -63.281  0.480   1.00 11.78 ? 1055 GLU A N     1 
ATOM   8014  C  CA    . GLU A 1 1054 ? -6.160  -61.827  0.612   1.00 11.93 ? 1055 GLU A CA    1 
ATOM   8015  C  C     . GLU A 1 1054 ? -6.448  -61.247  1.999   1.00 12.27 ? 1055 GLU A C     1 
ATOM   8016  O  O     . GLU A 1 1054 ? -5.811  -60.288  2.416   1.00 12.44 ? 1055 GLU A O     1 
ATOM   8017  C  CB    . GLU A 1 1054 ? -7.101  -61.126  -0.352  1.00 11.72 ? 1055 GLU A CB    1 
ATOM   8018  C  CG    . GLU A 1 1054 ? -6.704  -61.162  -1.786  1.00 12.43 ? 1055 GLU A CG    1 
ATOM   8019  C  CD    . GLU A 1 1054 ? -7.638  -60.332  -2.651  1.00 13.18 ? 1055 GLU A CD    1 
ATOM   8020  O  OE1   . GLU A 1 1054 ? -8.183  -59.312  -2.169  1.00 14.24 ? 1055 GLU A OE1   1 
ATOM   8021  O  OE2   . GLU A 1 1054 ? -7.818  -60.683  -3.831  1.00 13.81 ? 1055 GLU A OE2   1 
ATOM   8022  N  N     . ALA A 1 1055 ? -7.451  -61.798  2.677   1.00 12.31 ? 1056 ALA A N     1 
ATOM   8023  C  CA    . ALA A 1 1055 ? -7.871  -61.320  3.984   1.00 11.99 ? 1056 ALA A CA    1 
ATOM   8024  C  C     . ALA A 1 1055 ? -6.828  -61.628  5.020   1.00 12.15 ? 1056 ALA A C     1 
ATOM   8025  O  O     . ALA A 1 1055 ? -6.442  -60.759  5.800   1.00 12.26 ? 1056 ALA A O     1 
ATOM   8026  C  CB    . ALA A 1 1055 ? -9.187  -61.975  4.384   1.00 12.09 ? 1056 ALA A CB    1 
ATOM   8027  N  N     . GLU A 1 1056 ? -6.374  -62.876  5.033   1.00 11.99 ? 1057 GLU A N     1 
ATOM   8028  C  CA    . GLU A 1 1056 ? -5.382  -63.320  6.010   1.00 11.60 ? 1057 GLU A CA    1 
ATOM   8029  C  C     . GLU A 1 1056 ? -4.046  -62.572  5.889   1.00 11.45 ? 1057 GLU A C     1 
ATOM   8030  O  O     . GLU A 1 1056 ? -3.400  -62.263  6.905   1.00 12.21 ? 1057 GLU A O     1 
ATOM   8031  C  CB    . GLU A 1 1056 ? -5.171  -64.824  5.851   1.00 11.38 ? 1057 GLU A CB    1 
ATOM   8032  C  CG    . GLU A 1 1056 ? -4.805  -65.566  7.105   1.00 12.12 ? 1057 GLU A CG    1 
ATOM   8033  C  CD    . GLU A 1 1056 ? -3.451  -65.179  7.616   1.00 13.22 ? 1057 GLU A CD    1 
ATOM   8034  O  OE1   . GLU A 1 1056 ? -2.474  -65.339  6.854   1.00 12.75 ? 1057 GLU A OE1   1 
ATOM   8035  O  OE2   . GLU A 1 1056 ? -3.370  -64.685  8.767   1.00 14.32 ? 1057 GLU A OE2   1 
ATOM   8036  N  N     . SER A 1 1057 ? -3.706  -62.183  4.658   1.00 10.64 ? 1058 SER A N     1 
ATOM   8037  C  CA    . SER A 1 1057 ? -2.445  -61.507  4.354   1.00 9.24  ? 1058 SER A CA    1 
ATOM   8038  C  C     . SER A 1 1057 ? -2.409  -60.000  4.457   1.00 8.87  ? 1058 SER A C     1 
ATOM   8039  O  O     . SER A 1 1057 ? -1.329  -59.421  4.412   1.00 9.49  ? 1058 SER A O     1 
ATOM   8040  C  CB    . SER A 1 1057 ? -1.979  -61.893  2.963   1.00 8.67  ? 1058 SER A CB    1 
ATOM   8041  O  OG    . SER A 1 1057 ? -2.881  -61.423  1.986   1.00 8.85  ? 1058 SER A OG    1 
ATOM   8042  N  N     . PHE A 1 1058 ? -3.568  -59.354  4.485   1.00 8.12  ? 1059 PHE A N     1 
ATOM   8043  C  CA    . PHE A 1 1058 ? -3.599  -57.910  4.612   1.00 7.19  ? 1059 PHE A CA    1 
ATOM   8044  C  C     . PHE A 1 1058 ? -3.117  -57.645  6.027   1.00 7.24  ? 1059 PHE A C     1 
ATOM   8045  O  O     . PHE A 1 1058 ? -3.634  -58.217  6.993   1.00 7.31  ? 1059 PHE A O     1 
ATOM   8046  C  CB    . PHE A 1 1058 ? -5.022  -57.385  4.411   1.00 7.55  ? 1059 PHE A CB    1 
ATOM   8047  C  CG    . PHE A 1 1058 ? -5.206  -55.940  4.779   1.00 7.81  ? 1059 PHE A CG    1 
ATOM   8048  C  CD1   . PHE A 1 1058 ? -4.608  -54.928  4.036   1.00 7.94  ? 1059 PHE A CD1   1 
ATOM   8049  C  CD2   . PHE A 1 1058 ? -5.979  -55.589  5.879   1.00 8.50  ? 1059 PHE A CD2   1 
ATOM   8050  C  CE1   . PHE A 1 1058 ? -4.768  -53.580  4.380   1.00 7.95  ? 1059 PHE A CE1   1 
ATOM   8051  C  CE2   . PHE A 1 1058 ? -6.152  -54.235  6.246   1.00 8.74  ? 1059 PHE A CE2   1 
ATOM   8052  C  CZ    . PHE A 1 1058 ? -5.540  -53.229  5.489   1.00 8.83  ? 1059 PHE A CZ    1 
ATOM   8053  N  N     . PRO A 1 1059 ? -1.999  -56.915  6.149   1.00 7.23  ? 1060 PRO A N     1 
ATOM   8054  C  CA    . PRO A 1 1059 ? -1.393  -56.557  7.428   1.00 6.85  ? 1060 PRO A CA    1 
ATOM   8055  C  C     . PRO A 1 1059 ? -2.339  -55.580  8.126   1.00 6.47  ? 1060 PRO A C     1 
ATOM   8056  O  O     . PRO A 1 1059 ? -2.163  -54.355  8.086   1.00 6.19  ? 1060 PRO A O     1 
ATOM   8057  C  CB    . PRO A 1 1059 ? -0.083  -55.911  6.987   1.00 7.14  ? 1060 PRO A CB    1 
ATOM   8058  C  CG    . PRO A 1 1059 ? -0.446  -55.261  5.702   1.00 7.02  ? 1060 PRO A CG    1 
ATOM   8059  C  CD    . PRO A 1 1059 ? -1.189  -56.387  5.039   1.00 7.51  ? 1060 PRO A CD    1 
ATOM   8060  N  N     . GLY A 1 1060 ? -3.391  -56.162  8.696   1.00 6.45  ? 1061 GLY A N     1 
ATOM   8061  C  CA    . GLY A 1 1060 ? -4.424  -55.407  9.371   1.00 5.60  ? 1061 GLY A CA    1 
ATOM   8062  C  C     . GLY A 1 1060 ? -5.703  -56.229  9.434   1.00 5.76  ? 1061 GLY A C     1 
ATOM   8063  O  O     . GLY A 1 1060 ? -5.707  -57.415  9.054   1.00 5.72  ? 1061 GLY A O     1 
ATOM   8064  N  N     . PRO A 1 1061 ? -6.816  -55.617  9.879   1.00 5.36  ? 1062 PRO A N     1 
ATOM   8065  C  CA    . PRO A 1 1061 ? -8.147  -56.195  10.034  1.00 5.10  ? 1062 PRO A CA    1 
ATOM   8066  C  C     . PRO A 1 1061 ? -8.712  -56.644  8.708   1.00 5.54  ? 1062 PRO A C     1 
ATOM   8067  O  O     . PRO A 1 1061 ? -8.462  -56.017  7.673   1.00 6.37  ? 1062 PRO A O     1 
ATOM   8068  C  CB    . PRO A 1 1061 ? -8.958  -55.020  10.560  1.00 4.92  ? 1062 PRO A CB    1 
ATOM   8069  C  CG    . PRO A 1 1061 ? -7.970  -54.176  11.208  1.00 5.02  ? 1062 PRO A CG    1 
ATOM   8070  C  CD    . PRO A 1 1061 ? -6.866  -54.192  10.224  1.00 5.41  ? 1062 PRO A CD    1 
ATOM   8071  N  N     . SER A 1 1062 ? -9.555  -57.669  8.757   1.00 5.20  ? 1063 SER A N     1 
ATOM   8072  C  CA    . SER A 1 1062 ? -10.179 -58.216  7.568   1.00 4.51  ? 1063 SER A CA    1 
ATOM   8073  C  C     . SER A 1 1062 ? -11.540 -58.696  7.989   1.00 4.74  ? 1063 SER A C     1 
ATOM   8074  O  O     . SER A 1 1062 ? -11.655 -59.383  9.007   1.00 5.64  ? 1063 SER A O     1 
ATOM   8075  C  CB    . SER A 1 1062 ? -9.387  -59.421  7.118   1.00 4.40  ? 1063 SER A CB    1 
ATOM   8076  O  OG    . SER A 1 1062 ? -8.010  -59.189  7.324   1.00 6.24  ? 1063 SER A OG    1 
ATOM   8077  N  N     . LEU A 1 1063 ? -12.569 -58.373  7.213   1.00 4.00  ? 1064 LEU A N     1 
ATOM   8078  C  CA    . LEU A 1 1063 ? -13.915 -58.812  7.524   1.00 3.82  ? 1064 LEU A CA    1 
ATOM   8079  C  C     . LEU A 1 1063 ? -14.314 -59.745  6.402   1.00 3.86  ? 1064 LEU A C     1 
ATOM   8080  O  O     . LEU A 1 1063 ? -14.114 -59.424  5.237   1.00 4.02  ? 1064 LEU A O     1 
ATOM   8081  C  CB    . LEU A 1 1063 ? -14.869 -57.621  7.519   1.00 4.19  ? 1064 LEU A CB    1 
ATOM   8082  C  CG    . LEU A 1 1063 ? -16.115 -57.610  8.426   1.00 3.77  ? 1064 LEU A CG    1 
ATOM   8083  C  CD1   . LEU A 1 1063 ? -17.203 -56.826  7.710   1.00 2.98  ? 1064 LEU A CD1   1 
ATOM   8084  C  CD2   . LEU A 1 1063 ? -16.566 -59.018  8.750   1.00 2.72  ? 1064 LEU A CD2   1 
ATOM   8085  N  N     . VAL A 1 1064 ? -14.862 -60.902  6.731   1.00 3.74  ? 1065 VAL A N     1 
ATOM   8086  C  CA    . VAL A 1 1064 ? -15.286 -61.819  5.689   1.00 4.19  ? 1065 VAL A CA    1 
ATOM   8087  C  C     . VAL A 1 1064 ? -16.661 -62.347  6.054   1.00 4.80  ? 1065 VAL A C     1 
ATOM   8088  O  O     . VAL A 1 1064 ? -16.823 -63.078  7.024   1.00 5.36  ? 1065 VAL A O     1 
ATOM   8089  C  CB    . VAL A 1 1064 ? -14.289 -62.985  5.483   1.00 3.91  ? 1065 VAL A CB    1 
ATOM   8090  C  CG1   . VAL A 1 1064 ? -14.820 -63.953  4.439   1.00 2.75  ? 1065 VAL A CG1   1 
ATOM   8091  C  CG2   . VAL A 1 1064 ? -12.955 -62.444  5.012   1.00 3.43  ? 1065 VAL A CG2   1 
ATOM   8092  N  N     . ILE A 1 1065 ? -17.657 -61.925  5.290   1.00 4.94  ? 1066 ILE A N     1 
ATOM   8093  C  CA    . ILE A 1 1065 ? -19.031 -62.323  5.516   1.00 4.91  ? 1066 ILE A CA    1 
ATOM   8094  C  C     . ILE A 1 1065 ? -19.383 -63.322  4.421   1.00 6.18  ? 1066 ILE A C     1 
ATOM   8095  O  O     . ILE A 1 1065 ? -19.220 -63.028  3.241   1.00 6.56  ? 1066 ILE A O     1 
ATOM   8096  C  CB    . ILE A 1 1065 ? -19.966 -61.092  5.450   1.00 3.52  ? 1066 ILE A CB    1 
ATOM   8097  C  CG1   . ILE A 1 1065 ? -19.294 -59.902  6.132   1.00 2.59  ? 1066 ILE A CG1   1 
ATOM   8098  C  CG2   . ILE A 1 1065 ? -21.271 -61.388  6.161   1.00 3.72  ? 1066 ILE A CG2   1 
ATOM   8099  C  CD1   . ILE A 1 1065 ? -20.160 -58.732  6.362   1.00 2.00  ? 1066 ILE A CD1   1 
ATOM   8100  N  N     . ALA A 1 1066 ? -19.859 -64.500  4.814   1.00 7.20  ? 1067 ALA A N     1 
ATOM   8101  C  CA    . ALA A 1 1066 ? -20.205 -65.544  3.856   1.00 8.19  ? 1067 ALA A CA    1 
ATOM   8102  C  C     . ALA A 1 1066 ? -21.660 -65.945  3.947   1.00 9.14  ? 1067 ALA A C     1 
ATOM   8103  O  O     . ALA A 1 1066 ? -22.154 -66.103  5.061   1.00 10.16 ? 1067 ALA A O     1 
ATOM   8104  C  CB    . ALA A 1 1066 ? -19.366 -66.739  4.130   1.00 8.41  ? 1067 ALA A CB    1 
ATOM   8105  N  N     . TYR A 1 1067 ? -22.331 -66.147  2.803   1.00 9.31  ? 1068 TYR A N     1 
ATOM   8106  C  CA    . TYR A 1 1067 ? -23.738 -66.569  2.807   1.00 9.82  ? 1068 TYR A CA    1 
ATOM   8107  C  C     . TYR A 1 1067 ? -23.732 -68.006  3.304   1.00 9.51  ? 1068 TYR A C     1 
ATOM   8108  O  O     . TYR A 1 1067 ? -23.053 -68.869  2.737   1.00 9.24  ? 1068 TYR A O     1 
ATOM   8109  C  CB    . TYR A 1 1067 ? -24.378 -66.484  1.400   1.00 11.39 ? 1068 TYR A CB    1 
ATOM   8110  C  CG    . TYR A 1 1067 ? -25.905 -66.719  1.349   1.00 12.09 ? 1068 TYR A CG    1 
ATOM   8111  C  CD1   . TYR A 1 1067 ? -26.804 -65.713  1.718   1.00 12.83 ? 1068 TYR A CD1   1 
ATOM   8112  C  CD2   . TYR A 1 1067 ? -26.435 -67.953  0.964   1.00 12.48 ? 1068 TYR A CD2   1 
ATOM   8113  C  CE1   . TYR A 1 1067 ? -28.206 -65.934  1.716   1.00 13.74 ? 1068 TYR A CE1   1 
ATOM   8114  C  CE2   . TYR A 1 1067 ? -27.823 -68.188  0.954   1.00 13.24 ? 1068 TYR A CE2   1 
ATOM   8115  C  CZ    . TYR A 1 1067 ? -28.714 -67.175  1.338   1.00 13.92 ? 1068 TYR A CZ    1 
ATOM   8116  O  OH    . TYR A 1 1067 ? -30.091 -67.421  1.397   1.00 13.47 ? 1068 TYR A OH    1 
ATOM   8117  N  N     . ALA A 1 1068 ? -24.462 -68.261  4.382   1.00 8.92  ? 1069 ALA A N     1 
ATOM   8118  C  CA    . ALA A 1 1068 ? -24.494 -69.602  4.960   1.00 8.78  ? 1069 ALA A CA    1 
ATOM   8119  C  C     . ALA A 1 1068 ? -25.921 -70.101  5.011   1.00 8.40  ? 1069 ALA A C     1 
ATOM   8120  O  O     . ALA A 1 1068 ? -26.823 -69.387  5.444   1.00 8.81  ? 1069 ALA A O     1 
ATOM   8121  C  CB    . ALA A 1 1068 ? -23.885 -69.578  6.349   1.00 8.43  ? 1069 ALA A CB    1 
ATOM   8122  N  N     . THR A 1 1069 ? -26.143 -71.316  4.540   1.00 7.71  ? 1070 THR A N     1 
ATOM   8123  C  CA    . THR A 1 1069 ? -27.490 -71.844  4.536   1.00 7.43  ? 1070 THR A CA    1 
ATOM   8124  C  C     . THR A 1 1069 ? -27.814 -72.398  5.905   1.00 7.93  ? 1070 THR A C     1 
ATOM   8125  O  O     . THR A 1 1069 ? -26.921 -72.562  6.728   1.00 8.09  ? 1070 THR A O     1 
ATOM   8126  C  CB    . THR A 1 1069 ? -27.668 -72.888  3.451   1.00 6.60  ? 1070 THR A CB    1 
ATOM   8127  O  OG1   . THR A 1 1069 ? -26.674 -73.896  3.607   1.00 6.08  ? 1070 THR A OG1   1 
ATOM   8128  C  CG2   . THR A 1 1069 ? -27.524 -72.236  2.090   1.00 6.14  ? 1070 THR A CG2   1 
ATOM   8129  N  N     . CYS A 1 1070 ? -29.080 -72.710  6.146   1.00 8.23  ? 1071 CYS A N     1 
ATOM   8130  C  CA    . CYS A 1 1070 ? -29.476 -73.178  7.453   1.00 8.64  ? 1071 CYS A CA    1 
ATOM   8131  C  C     . CYS A 1 1070 ? -30.798 -73.904  7.394   1.00 9.00  ? 1071 CYS A C     1 
ATOM   8132  O  O     . CYS A 1 1070 ? -31.579 -73.726  6.449   1.00 9.25  ? 1071 CYS A O     1 
ATOM   8133  C  CB    . CYS A 1 1070 ? -29.626 -71.966  8.360   1.00 9.15  ? 1071 CYS A CB    1 
ATOM   8134  S  SG    . CYS A 1 1070 ? -29.884 -72.358  10.110  1.00 11.34 ? 1071 CYS A SG    1 
ATOM   8135  N  N     . ILE A 1 1071 ? -31.055 -74.736  8.401   1.00 9.40  ? 1072 ILE A N     1 
ATOM   8136  C  CA    . ILE A 1 1071 ? -32.316 -75.440  8.427   1.00 9.56  ? 1072 ILE A CA    1 
ATOM   8137  C  C     . ILE A 1 1071 ? -33.349 -74.346  8.592   1.00 10.63 ? 1072 ILE A C     1 
ATOM   8138  O  O     . ILE A 1 1071 ? -34.382 -74.371  7.931   1.00 11.36 ? 1072 ILE A O     1 
ATOM   8139  C  CB    . ILE A 1 1071 ? -32.430 -76.524  9.542   1.00 8.69  ? 1072 ILE A CB    1 
ATOM   8140  C  CG1   . ILE A 1 1071 ? -32.176 -75.968  10.934  1.00 8.76  ? 1072 ILE A CG1   1 
ATOM   8141  C  CG2   . ILE A 1 1071 ? -31.475 -77.648  9.287   1.00 8.92  ? 1072 ILE A CG2   1 
ATOM   8142  C  CD1   . ILE A 1 1071 ? -32.244 -77.052  12.000  1.00 7.86  ? 1072 ILE A CD1   1 
ATOM   8143  N  N     . ASN A 1 1072 ? -33.003 -73.310  9.355   1.00 11.40 ? 1073 ASN A N     1 
ATOM   8144  C  CA    . ASN A 1 1072 ? -33.915 -72.199  9.576   1.00 12.14 ? 1073 ASN A CA    1 
ATOM   8145  C  C     . ASN A 1 1072 ? -34.327 -71.411  8.338   1.00 12.53 ? 1073 ASN A C     1 
ATOM   8146  O  O     . ASN A 1 1072 ? -35.429 -70.874  8.330   1.00 13.28 ? 1073 ASN A O     1 
ATOM   8147  C  CB    . ASN A 1 1072 ? -33.401 -71.268  10.663  1.00 12.61 ? 1073 ASN A CB    1 
ATOM   8148  C  CG    . ASN A 1 1072 ? -33.295 -71.956  12.007  1.00 13.70 ? 1073 ASN A CG    1 
ATOM   8149  O  OD1   . ASN A 1 1072 ? -32.427 -71.620  12.817  1.00 14.90 ? 1073 ASN A OD1   1 
ATOM   8150  N  ND2   . ASN A 1 1072 ? -34.180 -72.922  12.259  1.00 13.64 ? 1073 ASN A ND2   1 
ATOM   8151  N  N     . GLN A 1 1073 ? -33.495 -71.311  7.296   1.00 12.70 ? 1074 GLN A N     1 
ATOM   8152  C  CA    . GLN A 1 1073 ? -33.969 -70.583  6.105   1.00 13.12 ? 1074 GLN A CA    1 
ATOM   8153  C  C     . GLN A 1 1073 ? -35.037 -71.367  5.359   1.00 13.30 ? 1074 GLN A C     1 
ATOM   8154  O  O     . GLN A 1 1073 ? -35.822 -70.800  4.603   1.00 13.18 ? 1074 GLN A O     1 
ATOM   8155  C  CB    . GLN A 1 1073 ? -32.859 -70.143  5.145   1.00 13.39 ? 1074 GLN A CB    1 
ATOM   8156  C  CG    . GLN A 1 1073 ? -31.553 -70.883  5.180   1.00 14.21 ? 1074 GLN A CG    1 
ATOM   8157  C  CD    . GLN A 1 1073 ? -30.419 -69.991  4.674   1.00 15.39 ? 1074 GLN A CD    1 
ATOM   8158  O  OE1   . GLN A 1 1073 ? -30.222 -69.837  3.454   1.00 16.33 ? 1074 GLN A OE1   1 
ATOM   8159  N  NE2   . GLN A 1 1073 ? -29.707 -69.347  5.607   1.00 13.99 ? 1074 GLN A NE2   1 
ATOM   8160  N  N     . GLY A 1 1074 ? -35.059 -72.675  5.607   1.00 13.90 ? 1075 GLY A N     1 
ATOM   8161  C  CA    . GLY A 1 1074 ? -36.042 -73.569  5.023   1.00 14.51 ? 1075 GLY A CA    1 
ATOM   8162  C  C     . GLY A 1 1074 ? -35.981 -73.766  3.530   1.00 14.89 ? 1075 GLY A C     1 
ATOM   8163  O  O     . GLY A 1 1074 ? -36.918 -73.399  2.830   1.00 14.93 ? 1075 GLY A O     1 
ATOM   8164  N  N     . LEU A 1 1075 ? -34.886 -74.353  3.044   1.00 15.76 ? 1076 LEU A N     1 
ATOM   8165  C  CA    . LEU A 1 1075 ? -34.705 -74.607  1.606   1.00 16.41 ? 1076 LEU A CA    1 
ATOM   8166  C  C     . LEU A 1 1075 ? -35.664 -75.748  1.163   1.00 17.61 ? 1076 LEU A C     1 
ATOM   8167  O  O     . LEU A 1 1075 ? -35.515 -76.925  1.540   1.00 17.87 ? 1076 LEU A O     1 
ATOM   8168  C  CB    . LEU A 1 1075 ? -33.213 -74.898  1.256   1.00 15.18 ? 1076 LEU A CB    1 
ATOM   8169  C  CG    . LEU A 1 1075 ? -32.019 -74.056  1.788   1.00 14.03 ? 1076 LEU A CG    1 
ATOM   8170  C  CD1   . LEU A 1 1075 ? -30.800 -74.244  0.913   1.00 13.40 ? 1076 LEU A CD1   1 
ATOM   8171  C  CD2   . LEU A 1 1075 ? -32.331 -72.587  1.846   1.00 13.38 ? 1076 LEU A CD2   1 
ATOM   8172  N  N     . ARG A 1 1076 ? -36.685 -75.337  0.412   1.00 19.02 ? 1077 ARG A N     1 
ATOM   8173  C  CA    . ARG A 1 1076 ? -37.746 -76.199  -0.096  1.00 20.17 ? 1077 ARG A CA    1 
ATOM   8174  C  C     . ARG A 1 1076 ? -37.315 -77.529  -0.666  1.00 20.54 ? 1077 ARG A C     1 
ATOM   8175  O  O     . ARG A 1 1076 ? -37.907 -78.559  -0.335  1.00 21.15 ? 1077 ARG A O     1 
ATOM   8176  C  CB    . ARG A 1 1076 ? -38.605 -75.453  -1.132  1.00 20.93 ? 1077 ARG A CB    1 
ATOM   8177  C  CG    . ARG A 1 1076 ? -39.723 -76.305  -1.762  1.00 22.86 ? 1077 ARG A CG    1 
ATOM   8178  C  CD    . ARG A 1 1076 ? -40.595 -75.540  -2.791  1.00 24.14 ? 1077 ARG A CD    1 
ATOM   8179  N  NE    . ARG A 1 1076 ? -41.762 -74.848  -2.216  1.00 25.13 ? 1077 ARG A NE    1 
ATOM   8180  C  CZ    . ARG A 1 1076 ? -41.724 -73.743  -1.459  1.00 25.72 ? 1077 ARG A CZ    1 
ATOM   8181  N  NH1   . ARG A 1 1076 ? -40.567 -73.156  -1.136  1.00 25.17 ? 1077 ARG A NH1   1 
ATOM   8182  N  NH2   . ARG A 1 1076 ? -42.869 -73.180  -1.072  1.00 26.36 ? 1077 ARG A NH2   1 
ATOM   8183  N  N     . LYS A 1 1077 ? -36.292 -77.520  -1.514  1.00 20.48 ? 1078 LYS A N     1 
ATOM   8184  C  CA    . LYS A 1 1077 ? -35.851 -78.760  -2.133  1.00 20.33 ? 1078 LYS A CA    1 
ATOM   8185  C  C     . LYS A 1 1077 ? -34.800 -79.572  -1.349  1.00 19.86 ? 1078 LYS A C     1 
ATOM   8186  O  O     . LYS A 1 1077 ? -34.433 -80.682  -1.738  1.00 19.68 ? 1078 LYS A O     1 
ATOM   8187  C  CB    . LYS A 1 1077 ? -35.455 -78.484  -3.598  1.00 21.12 ? 1078 LYS A CB    1 
ATOM   8188  C  CG    . LYS A 1 1077 ? -36.678 -78.229  -4.543  1.00 22.00 ? 1078 LYS A CG    1 
ATOM   8189  C  CD    . LYS A 1 1077 ? -36.309 -77.633  -5.935  1.00 22.72 ? 1078 LYS A CD    1 
ATOM   8190  C  CE    . LYS A 1 1077 ? -35.862 -78.684  -6.981  1.00 23.35 ? 1078 LYS A CE    1 
ATOM   8191  N  NZ    . LYS A 1 1077 ? -34.777 -78.214  -7.951  1.00 23.75 ? 1078 LYS A NZ    1 
ATOM   8192  N  N     . GLY A 1 1078 ? -34.393 -79.062  -0.192  1.00 19.49 ? 1079 GLY A N     1 
ATOM   8193  C  CA    . GLY A 1 1078 ? -33.411 -79.776  0.607   1.00 19.39 ? 1079 GLY A CA    1 
ATOM   8194  C  C     . GLY A 1 1078 ? -32.106 -79.023  0.798   1.00 19.30 ? 1079 GLY A C     1 
ATOM   8195  O  O     . GLY A 1 1078 ? -31.845 -78.043  0.087   1.00 19.39 ? 1079 GLY A O     1 
ATOM   8196  N  N     . MET A 1 1079 ? -31.285 -79.477  1.752   1.00 18.83 ? 1080 MET A N     1 
ATOM   8197  C  CA    . MET A 1 1079 ? -29.999 -78.836  2.033   1.00 18.31 ? 1080 MET A CA    1 
ATOM   8198  C  C     . MET A 1 1079 ? -28.972 -79.291  1.003   1.00 17.56 ? 1080 MET A C     1 
ATOM   8199  O  O     . MET A 1 1079 ? -27.845 -78.787  0.958   1.00 16.93 ? 1080 MET A O     1 
ATOM   8200  C  CB    . MET A 1 1079 ? -29.521 -79.117  3.471   1.00 19.49 ? 1080 MET A CB    1 
ATOM   8201  C  CG    . MET A 1 1079 ? -30.328 -78.439  4.620   1.00 20.28 ? 1080 MET A CG    1 
ATOM   8202  S  SD    . MET A 1 1079 ? -30.512 -76.607  4.552   1.00 22.76 ? 1080 MET A SD    1 
ATOM   8203  C  CE    . MET A 1 1079 ? -29.063 -76.096  5.384   1.00 22.30 ? 1080 MET A CE    1 
ATOM   8204  N  N     . GLY A 1 1080 ? -29.371 -80.276  0.198   1.00 17.17 ? 1081 GLY A N     1 
ATOM   8205  C  CA    . GLY A 1 1080 ? -28.523 -80.755  -0.876  1.00 16.14 ? 1081 GLY A CA    1 
ATOM   8206  C  C     . GLY A 1 1080 ? -28.506 -79.645  -1.912  1.00 15.68 ? 1081 GLY A C     1 
ATOM   8207  O  O     . GLY A 1 1080 ? -27.516 -79.440  -2.599  1.00 15.90 ? 1081 GLY A O     1 
ATOM   8208  N  N     . LYS A 1 1081 ? -29.598 -78.880  -1.969  1.00 15.26 ? 1082 LYS A N     1 
ATOM   8209  C  CA    . LYS A 1 1081 ? -29.749 -77.751  -2.898  1.00 14.91 ? 1082 LYS A CA    1 
ATOM   8210  C  C     . LYS A 1 1081 ? -29.072 -76.477  -2.391  1.00 14.59 ? 1082 LYS A C     1 
ATOM   8211  O  O     . LYS A 1 1081 ? -29.180 -75.404  -2.997  1.00 14.19 ? 1082 LYS A O     1 
ATOM   8212  C  CB    . LYS A 1 1081 ? -31.236 -77.496  -3.165  1.00 14.77 ? 1082 LYS A CB    1 
ATOM   8213  C  CG    . LYS A 1 1081 ? -31.814 -78.451  -4.186  1.00 14.91 ? 1082 LYS A CG    1 
ATOM   8214  C  CD    . LYS A 1 1081 ? -31.056 -78.298  -5.507  1.00 16.26 ? 1082 LYS A CD    1 
ATOM   8215  C  CE    . LYS A 1 1081 ? -31.453 -79.326  -6.555  1.00 16.79 ? 1082 LYS A CE    1 
ATOM   8216  N  NZ    . LYS A 1 1081 ? -31.032 -80.737  -6.203  1.00 17.39 ? 1082 LYS A NZ    1 
ATOM   8217  N  N     . SER A 1 1082 ? -28.346 -76.643  -1.287  1.00 14.64 ? 1083 SER A N     1 
ATOM   8218  C  CA    . SER A 1 1082 ? -27.622 -75.577  -0.612  1.00 14.16 ? 1083 SER A CA    1 
ATOM   8219  C  C     . SER A 1 1082 ? -26.640 -74.838  -1.516  1.00 14.17 ? 1083 SER A C     1 
ATOM   8220  O  O     . SER A 1 1082 ? -26.767 -73.633  -1.701  1.00 14.58 ? 1083 SER A O     1 
ATOM   8221  C  CB    . SER A 1 1082 ? -26.889 -76.148  0.585   1.00 13.67 ? 1083 SER A CB    1 
ATOM   8222  O  OG    . SER A 1 1082 ? -26.470 -75.101  1.404   1.00 14.30 ? 1083 SER A OG    1 
ATOM   8223  N  N     . GLN A 1 1083 ? -25.668 -75.551  -2.081  1.00 13.74 ? 1084 GLN A N     1 
ATOM   8224  C  CA    . GLN A 1 1083 ? -24.688 -74.937  -2.979  1.00 13.04 ? 1084 GLN A CA    1 
ATOM   8225  C  C     . GLN A 1 1083 ? -25.413 -74.212  -4.114  1.00 13.00 ? 1084 GLN A C     1 
ATOM   8226  O  O     . GLN A 1 1083 ? -25.181 -73.029  -4.377  1.00 12.85 ? 1084 GLN A O     1 
ATOM   8227  C  CB    . GLN A 1 1083 ? -23.767 -76.007  -3.546  1.00 12.84 ? 1084 GLN A CB    1 
ATOM   8228  C  CG    . GLN A 1 1083 ? -22.706 -76.478  -2.576  1.00 13.01 ? 1084 GLN A CG    1 
ATOM   8229  C  CD    . GLN A 1 1083 ? -21.622 -75.436  -2.348  1.00 13.93 ? 1084 GLN A CD    1 
ATOM   8230  O  OE1   . GLN A 1 1083 ? -21.288 -75.125  -1.203  1.00 14.38 ? 1084 GLN A OE1   1 
ATOM   8231  N  NE2   . GLN A 1 1083 ? -21.036 -74.917  -3.438  1.00 13.93 ? 1084 GLN A NE2   1 
ATOM   8232  N  N     . ASP A 1 1084 ? -26.348 -74.909  -4.744  1.00 13.33 ? 1085 ASP A N     1 
ATOM   8233  C  CA    . ASP A 1 1084 ? -27.111 -74.312  -5.819  1.00 13.15 ? 1085 ASP A CA    1 
ATOM   8234  C  C     . ASP A 1 1084 ? -27.753 -73.007  -5.298  1.00 12.29 ? 1085 ASP A C     1 
ATOM   8235  O  O     . ASP A 1 1084 ? -27.760 -71.987  -5.987  1.00 12.13 ? 1085 ASP A O     1 
ATOM   8236  C  CB    . ASP A 1 1084 ? -28.149 -75.320  -6.354  1.00 13.99 ? 1085 ASP A CB    1 
ATOM   8237  C  CG    . ASP A 1 1084 ? -29.033 -74.731  -7.454  1.00 15.68 ? 1085 ASP A CG    1 
ATOM   8238  O  OD1   . ASP A 1 1084 ? -28.538 -74.482  -8.595  1.00 16.41 ? 1085 ASP A OD1   1 
ATOM   8239  O  OD2   . ASP A 1 1084 ? -30.236 -74.500  -7.170  1.00 16.30 ? 1085 ASP A OD2   1 
ATOM   8240  N  N     . VAL A 1 1085 ? -28.155 -73.001  -4.034  1.00 11.35 ? 1086 VAL A N     1 
ATOM   8241  C  CA    . VAL A 1 1085 ? -28.791 -71.822  -3.455  1.00 10.69 ? 1086 VAL A CA    1 
ATOM   8242  C  C     . VAL A 1 1085 ? -27.857 -70.631  -3.200  1.00 10.73 ? 1086 VAL A C     1 
ATOM   8243  O  O     . VAL A 1 1085 ? -28.237 -69.487  -3.479  1.00 10.80 ? 1086 VAL A O     1 
ATOM   8244  C  CB    . VAL A 1 1085 ? -29.588 -72.193  -2.201  1.00 9.98  ? 1086 VAL A CB    1 
ATOM   8245  C  CG1   . VAL A 1 1085 ? -29.793 -71.006  -1.340  1.00 9.95  ? 1086 VAL A CG1   1 
ATOM   8246  C  CG2   . VAL A 1 1085 ? -30.932 -72.722  -2.603  1.00 9.76  ? 1086 VAL A CG2   1 
ATOM   8247  N  N     . MET A 1 1086 ? -26.651 -70.894  -2.682  1.00 10.50 ? 1087 MET A N     1 
ATOM   8248  C  CA    . MET A 1 1086 ? -25.656 -69.839  -2.409  1.00 10.11 ? 1087 MET A CA    1 
ATOM   8249  C  C     . MET A 1 1086 ? -25.388 -69.192  -3.753  1.00 10.23 ? 1087 MET A C     1 
ATOM   8250  O  O     . MET A 1 1086 ? -25.311 -67.964  -3.893  1.00 10.26 ? 1087 MET A O     1 
ATOM   8251  C  CB    . MET A 1 1086 ? -24.329 -70.431  -1.900  1.00 9.27  ? 1087 MET A CB    1 
ATOM   8252  C  CG    . MET A 1 1086 ? -24.451 -71.428  -0.772  1.00 8.84  ? 1087 MET A CG    1 
ATOM   8253  S  SD    . MET A 1 1086 ? -22.881 -71.817  0.013   1.00 8.73  ? 1087 MET A SD    1 
ATOM   8254  C  CE    . MET A 1 1086 ? -23.461 -72.484  1.571   1.00 8.11  ? 1087 MET A CE    1 
ATOM   8255  N  N     . ASN A 1 1087 ? -25.276 -70.067  -4.745  1.00 10.20 ? 1088 ASN A N     1 
ATOM   8256  C  CA    . ASN A 1 1087 ? -25.033 -69.689  -6.120  1.00 10.38 ? 1088 ASN A CA    1 
ATOM   8257  C  C     . ASN A 1 1087 ? -26.151 -68.824  -6.691  1.00 9.92  ? 1088 ASN A C     1 
ATOM   8258  O  O     . ASN A 1 1087 ? -25.872 -67.908  -7.445  1.00 10.30 ? 1088 ASN A O     1 
ATOM   8259  C  CB    . ASN A 1 1087 ? -24.875 -70.951  -6.954  1.00 11.02 ? 1088 ASN A CB    1 
ATOM   8260  C  CG    . ASN A 1 1087 ? -24.400 -70.676  -8.356  1.00 11.67 ? 1088 ASN A CG    1 
ATOM   8261  O  OD1   . ASN A 1 1087 ? -24.369 -71.593  -9.182  1.00 11.83 ? 1088 ASN A OD1   1 
ATOM   8262  N  ND2   . ASN A 1 1087 ? -24.004 -69.423  -8.640  1.00 11.64 ? 1088 ASN A ND2   1 
ATOM   8263  N  N     . THR A 1 1088 ? -27.405 -69.135  -6.369  1.00 9.27  ? 1089 THR A N     1 
ATOM   8264  C  CA    . THR A 1 1088 ? -28.525 -68.331  -6.850  1.00 8.93  ? 1089 THR A CA    1 
ATOM   8265  C  C     . THR A 1 1088 ? -28.575 -67.000  -6.101  1.00 8.91  ? 1089 THR A C     1 
ATOM   8266  O  O     . THR A 1 1088 ? -29.061 -65.982  -6.628  1.00 8.66  ? 1089 THR A O     1 
ATOM   8267  C  CB    . THR A 1 1088 ? -29.859 -69.044  -6.656  1.00 8.83  ? 1089 THR A CB    1 
ATOM   8268  O  OG1   . THR A 1 1088 ? -29.925 -70.163  -7.540  1.00 9.84  ? 1089 THR A OG1   1 
ATOM   8269  C  CG2   . THR A 1 1088 ? -31.005 -68.125  -6.989  1.00 9.03  ? 1089 THR A CG2   1 
ATOM   8270  N  N     . ALA A 1 1089 ? -28.054 -67.009  -4.875  1.00 8.65  ? 1090 ALA A N     1 
ATOM   8271  C  CA    . ALA A 1 1089 ? -28.052 -65.814  -4.059  1.00 8.47  ? 1090 ALA A CA    1 
ATOM   8272  C  C     . ALA A 1 1089 ? -27.188 -64.735  -4.677  1.00 9.23  ? 1090 ALA A C     1 
ATOM   8273  O  O     . ALA A 1 1089 ? -27.480 -63.545  -4.514  1.00 10.03 ? 1090 ALA A O     1 
ATOM   8274  C  CB    . ALA A 1 1089 ? -27.589 -66.126  -2.685  1.00 7.87  ? 1090 ALA A CB    1 
ATOM   8275  N  N     . VAL A 1 1090 ? -26.155 -65.136  -5.425  1.00 8.95  ? 1091 VAL A N     1 
ATOM   8276  C  CA    . VAL A 1 1090 ? -25.259 -64.165  -6.035  1.00 8.68  ? 1091 VAL A CA    1 
ATOM   8277  C  C     . VAL A 1 1090 ? -25.737 -63.779  -7.412  1.00 8.72  ? 1091 VAL A C     1 
ATOM   8278  O  O     . VAL A 1 1090 ? -25.626 -62.618  -7.832  1.00 9.31  ? 1091 VAL A O     1 
ATOM   8279  C  CB    . VAL A 1 1090 ? -23.819 -64.684  -6.139  1.00 8.78  ? 1091 VAL A CB    1 
ATOM   8280  C  CG1   . VAL A 1 1090 ? -22.905 -63.569  -6.597  1.00 8.77  ? 1091 VAL A CG1   1 
ATOM   8281  C  CG2   . VAL A 1 1090 ? -23.346 -65.200  -4.806  1.00 9.09  ? 1091 VAL A CG2   1 
ATOM   8282  N  N     . LYS A 1 1091 ? -26.265 -64.748  -8.135  1.00 8.41  ? 1092 LYS A N     1 
ATOM   8283  C  CA    . LYS A 1 1091 ? -26.752 -64.448  -9.460  1.00 8.40  ? 1092 LYS A CA    1 
ATOM   8284  C  C     . LYS A 1 1091 ? -27.907 -63.450  -9.361  1.00 7.93  ? 1092 LYS A C     1 
ATOM   8285  O  O     . LYS A 1 1091 ? -27.807 -62.348  -9.896  1.00 7.95  ? 1092 LYS A O     1 
ATOM   8286  C  CB    . LYS A 1 1091 ? -27.125 -65.739  -10.205 1.00 9.15  ? 1092 LYS A CB    1 
ATOM   8287  C  CG    . LYS A 1 1091 ? -25.898 -66.639  -10.429 1.00 10.74 ? 1092 LYS A CG    1 
ATOM   8288  C  CD    . LYS A 1 1091 ? -26.054 -67.596  -11.598 1.00 12.84 ? 1092 LYS A CD    1 
ATOM   8289  C  CE    . LYS A 1 1091 ? -27.093 -68.690  -11.304 1.00 14.43 ? 1092 LYS A CE    1 
ATOM   8290  N  NZ    . LYS A 1 1091 ? -27.641 -69.398  -12.539 1.00 15.86 ? 1092 LYS A NZ    1 
ATOM   8291  N  N     . SER A 1 1092 ? -28.903 -63.775  -8.532  1.00 7.75  ? 1093 SER A N     1 
ATOM   8292  C  CA    . SER A 1 1092 ? -30.103 -62.962  -8.316  1.00 6.92  ? 1093 SER A CA    1 
ATOM   8293  C  C     . SER A 1 1092 ? -29.845 -61.518  -7.978  1.00 7.12  ? 1093 SER A C     1 
ATOM   8294  O  O     . SER A 1 1092 ? -30.733 -60.690  -8.134  1.00 7.52  ? 1093 SER A O     1 
ATOM   8295  C  CB    . SER A 1 1092 ? -30.928 -63.553  -7.186  1.00 6.29  ? 1093 SER A CB    1 
ATOM   8296  O  OG    . SER A 1 1092 ? -30.175 -63.531  -5.997  1.00 5.39  ? 1093 SER A OG    1 
ATOM   8297  N  N     . GLY A 1 1093 ? -28.631 -61.232  -7.509  1.00 7.38  ? 1094 GLY A N     1 
ATOM   8298  C  CA    . GLY A 1 1093 ? -28.239 -59.891  -7.092  1.00 7.21  ? 1094 GLY A CA    1 
ATOM   8299  C  C     . GLY A 1 1093 ? -28.472 -59.734  -5.589  1.00 7.60  ? 1094 GLY A C     1 
ATOM   8300  O  O     . GLY A 1 1093 ? -28.107 -58.724  -4.973  1.00 7.84  ? 1094 GLY A O     1 
ATOM   8301  N  N     . TYR A 1 1094 ? -29.091 -60.756  -5.002  1.00 7.66  ? 1095 TYR A N     1 
ATOM   8302  C  CA    . TYR A 1 1094 ? -29.442 -60.787  -3.589  1.00 7.47  ? 1095 TYR A CA    1 
ATOM   8303  C  C     . TYR A 1 1094 ? -28.249 -60.607  -2.678  1.00 7.45  ? 1095 TYR A C     1 
ATOM   8304  O  O     . TYR A 1 1094 ? -28.306 -59.829  -1.713  1.00 7.30  ? 1095 TYR A O     1 
ATOM   8305  C  CB    . TYR A 1 1094 ? -30.130 -62.120  -3.270  1.00 7.53  ? 1095 TYR A CB    1 
ATOM   8306  C  CG    . TYR A 1 1094 ? -30.608 -62.295  -1.840  1.00 7.85  ? 1095 TYR A CG    1 
ATOM   8307  C  CD1   . TYR A 1 1094 ? -31.762 -61.662  -1.376  1.00 8.21  ? 1095 TYR A CD1   1 
ATOM   8308  C  CD2   . TYR A 1 1094 ? -29.915 -63.117  -0.959  1.00 8.29  ? 1095 TYR A CD2   1 
ATOM   8309  C  CE1   . TYR A 1 1094 ? -32.203 -61.849  -0.066  1.00 8.77  ? 1095 TYR A CE1   1 
ATOM   8310  C  CE2   . TYR A 1 1094 ? -30.345 -63.312  0.340   1.00 8.24  ? 1095 TYR A CE2   1 
ATOM   8311  C  CZ    . TYR A 1 1094 ? -31.484 -62.681  0.781   1.00 8.75  ? 1095 TYR A CZ    1 
ATOM   8312  O  OH    . TYR A 1 1094 ? -31.896 -62.908  2.069   1.00 10.08 ? 1095 TYR A OH    1 
ATOM   8313  N  N     . TRP A 1 1095 ? -27.150 -61.249  -3.063  1.00 6.97  ? 1096 TRP A N     1 
ATOM   8314  C  CA    . TRP A 1 1095 ? -25.927 -61.265  -2.283  1.00 6.81  ? 1096 TRP A CA    1 
ATOM   8315  C  C     . TRP A 1 1095 ? -24.769 -61.021  -3.219  1.00 6.84  ? 1096 TRP A C     1 
ATOM   8316  O  O     . TRP A 1 1095 ? -24.203 -61.974  -3.765  1.00 7.33  ? 1096 TRP A O     1 
ATOM   8317  C  CB    . TRP A 1 1095 ? -25.789 -62.658  -1.668  1.00 6.58  ? 1096 TRP A CB    1 
ATOM   8318  C  CG    . TRP A 1 1095 ? -24.639 -62.846  -0.739  1.00 6.42  ? 1096 TRP A CG    1 
ATOM   8319  C  CD1   . TRP A 1 1095 ? -23.384 -63.261  -1.059  1.00 5.83  ? 1096 TRP A CD1   1 
ATOM   8320  C  CD2   . TRP A 1 1095 ? -24.654 -62.667  0.679   1.00 6.63  ? 1096 TRP A CD2   1 
ATOM   8321  N  NE1   . TRP A 1 1095 ? -22.616 -63.354  0.072   1.00 5.99  ? 1096 TRP A NE1   1 
ATOM   8322  C  CE2   . TRP A 1 1095 ? -23.372 -62.991  1.154   1.00 6.68  ? 1096 TRP A CE2   1 
ATOM   8323  C  CE3   . TRP A 1 1095 ? -25.634 -62.257  1.597   1.00 6.68  ? 1096 TRP A CE3   1 
ATOM   8324  C  CZ2   . TRP A 1 1095 ? -23.039 -62.923  2.508   1.00 7.22  ? 1096 TRP A CZ2   1 
ATOM   8325  C  CZ3   . TRP A 1 1095 ? -25.306 -62.191  2.937   1.00 6.59  ? 1096 TRP A CZ3   1 
ATOM   8326  C  CH2   . TRP A 1 1095 ? -24.020 -62.519  3.383   1.00 7.24  ? 1096 TRP A CH2   1 
ATOM   8327  N  N     . PRO A 1 1096 ? -24.350 -59.754  -3.376  1.00 6.31  ? 1097 PRO A N     1 
ATOM   8328  C  CA    . PRO A 1 1096 ? -23.241 -59.522  -4.288  1.00 5.64  ? 1097 PRO A CA    1 
ATOM   8329  C  C     . PRO A 1 1096 ? -21.899 -59.700  -3.607  1.00 5.08  ? 1097 PRO A C     1 
ATOM   8330  O  O     . PRO A 1 1096 ? -21.729 -59.435  -2.410  1.00 5.14  ? 1097 PRO A O     1 
ATOM   8331  C  CB    . PRO A 1 1096 ? -23.495 -58.093  -4.777  1.00 5.75  ? 1097 PRO A CB    1 
ATOM   8332  C  CG    . PRO A 1 1096 ? -24.124 -57.398  -3.592  1.00 6.01  ? 1097 PRO A CG    1 
ATOM   8333  C  CD    . PRO A 1 1096 ? -24.711 -58.509  -2.673  1.00 6.84  ? 1097 PRO A CD    1 
ATOM   8334  N  N     . LEU A 1 1097 ? -20.962 -60.189  -4.395  1.00 4.56  ? 1098 LEU A N     1 
ATOM   8335  C  CA    . LEU A 1 1097 ? -19.639 -60.441  -3.937  1.00 4.05  ? 1098 LEU A CA    1 
ATOM   8336  C  C     . LEU A 1 1097 ? -18.739 -59.306  -4.308  1.00 4.36  ? 1098 LEU A C     1 
ATOM   8337  O  O     . LEU A 1 1097 ? -18.639 -58.964  -5.467  1.00 5.00  ? 1098 LEU A O     1 
ATOM   8338  C  CB    . LEU A 1 1097 ? -19.105 -61.696  -4.599  1.00 4.31  ? 1098 LEU A CB    1 
ATOM   8339  C  CG    . LEU A 1 1097 ? -19.921 -62.973  -4.438  1.00 4.25  ? 1098 LEU A CG    1 
ATOM   8340  C  CD1   . LEU A 1 1097 ? -19.084 -64.141  -4.914  1.00 3.77  ? 1098 LEU A CD1   1 
ATOM   8341  C  CD2   . LEU A 1 1097 ? -20.320 -63.144  -2.970  1.00 4.42  ? 1098 LEU A CD2   1 
ATOM   8342  N  N     . PHE A 1 1098 ? -18.073 -58.728  -3.318  1.00 4.72  ? 1099 PHE A N     1 
ATOM   8343  C  CA    . PHE A 1 1098 ? -17.114 -57.661  -3.544  1.00 4.54  ? 1099 PHE A CA    1 
ATOM   8344  C  C     . PHE A 1 1098 ? -15.874 -57.813  -2.638  1.00 4.62  ? 1099 PHE A C     1 
ATOM   8345  O  O     . PHE A 1 1098 ? -15.748 -58.782  -1.887  1.00 4.75  ? 1099 PHE A O     1 
ATOM   8346  C  CB    . PHE A 1 1098 ? -17.775 -56.315  -3.368  1.00 3.81  ? 1099 PHE A CB    1 
ATOM   8347  C  CG    . PHE A 1 1098 ? -18.631 -56.229  -2.176  1.00 4.35  ? 1099 PHE A CG    1 
ATOM   8348  C  CD1   . PHE A 1 1098 ? -18.086 -56.025  -0.925  1.00 4.74  ? 1099 PHE A CD1   1 
ATOM   8349  C  CD2   . PHE A 1 1098 ? -20.006 -56.301  -2.296  1.00 5.32  ? 1099 PHE A CD2   1 
ATOM   8350  C  CE1   . PHE A 1 1098 ? -18.910 -55.883  0.202   1.00 4.91  ? 1099 PHE A CE1   1 
ATOM   8351  C  CE2   . PHE A 1 1098 ? -20.834 -56.159  -1.170  1.00 5.28  ? 1099 PHE A CE2   1 
ATOM   8352  C  CZ    . PHE A 1 1098 ? -20.279 -55.948  0.076   1.00 4.56  ? 1099 PHE A CZ    1 
ATOM   8353  N  N     . ARG A 1 1099 ? -14.929 -56.896  -2.789  1.00 4.06  ? 1100 ARG A N     1 
ATOM   8354  C  CA    . ARG A 1 1099 ? -13.714 -56.913  -2.014  1.00 4.05  ? 1100 ARG A CA    1 
ATOM   8355  C  C     . ARG A 1 1099 ? -13.215 -55.501  -1.942  1.00 4.64  ? 1100 ARG A C     1 
ATOM   8356  O  O     . ARG A 1 1099 ? -13.191 -54.799  -2.951  1.00 5.34  ? 1100 ARG A O     1 
ATOM   8357  C  CB    . ARG A 1 1099 ? -12.658 -57.760  -2.695  1.00 3.94  ? 1100 ARG A CB    1 
ATOM   8358  C  CG    . ARG A 1 1099 ? -12.660 -59.182  -2.263  1.00 4.30  ? 1100 ARG A CG    1 
ATOM   8359  C  CD    . ARG A 1 1099 ? -11.590 -59.919  -2.969  1.00 4.61  ? 1100 ARG A CD    1 
ATOM   8360  N  NE    . ARG A 1 1099 ? -11.918 -60.074  -4.378  1.00 6.17  ? 1100 ARG A NE    1 
ATOM   8361  C  CZ    . ARG A 1 1099 ? -11.237 -59.504  -5.373  1.00 7.31  ? 1100 ARG A CZ    1 
ATOM   8362  N  NH1   . ARG A 1 1099 ? -10.183 -58.743  -5.111  1.00 7.26  ? 1100 ARG A NH1   1 
ATOM   8363  N  NH2   . ARG A 1 1099 ? -11.636 -59.659  -6.631  1.00 7.43  ? 1100 ARG A NH2   1 
ATOM   8364  N  N     . TYR A 1 1100 ? -12.843 -55.078  -0.740  1.00 4.59  ? 1101 TYR A N     1 
ATOM   8365  C  CA    . TYR A 1 1100 ? -12.334 -53.747  -0.513  1.00 4.63  ? 1101 TYR A CA    1 
ATOM   8366  C  C     . TYR A 1 1100 ? -11.011 -54.010  0.142   1.00 5.38  ? 1101 TYR A C     1 
ATOM   8367  O  O     . TYR A 1 1100 ? -10.973 -54.342  1.321   1.00 6.73  ? 1101 TYR A O     1 
ATOM   8368  C  CB    . TYR A 1 1100 ? -13.225 -53.013  0.469   1.00 4.39  ? 1101 TYR A CB    1 
ATOM   8369  C  CG    . TYR A 1 1100 ? -12.823 -51.582  0.654   1.00 4.25  ? 1101 TYR A CG    1 
ATOM   8370  C  CD1   . TYR A 1 1100 ? -11.623 -51.237  1.277   1.00 3.65  ? 1101 TYR A CD1   1 
ATOM   8371  C  CD2   . TYR A 1 1100 ? -13.585 -50.577  0.101   1.00 4.25  ? 1101 TYR A CD2   1 
ATOM   8372  C  CE1   . TYR A 1 1100 ? -11.203 -49.925  1.326   1.00 4.09  ? 1101 TYR A CE1   1 
ATOM   8373  C  CE2   . TYR A 1 1100 ? -13.172 -49.273  0.141   1.00 4.57  ? 1101 TYR A CE2   1 
ATOM   8374  C  CZ    . TYR A 1 1100 ? -11.985 -48.949  0.747   1.00 4.31  ? 1101 TYR A CZ    1 
ATOM   8375  O  OH    . TYR A 1 1100 ? -11.595 -47.635  0.754   1.00 6.10  ? 1101 TYR A OH    1 
ATOM   8376  N  N     . ASP A 1 1101 ? -9.925  -53.821  -0.597  1.00 5.46  ? 1102 ASP A N     1 
ATOM   8377  C  CA    . ASP A 1 1101 ? -8.580  -54.086  -0.092  1.00 5.71  ? 1102 ASP A CA    1 
ATOM   8378  C  C     . ASP A 1 1101 ? -7.728  -52.813  -0.128  1.00 5.60  ? 1102 ASP A C     1 
ATOM   8379  O  O     . ASP A 1 1101 ? -7.157  -52.478  -1.160  1.00 6.41  ? 1102 ASP A O     1 
ATOM   8380  C  CB    . ASP A 1 1101 ? -7.964  -55.174  -0.971  1.00 6.63  ? 1102 ASP A CB    1 
ATOM   8381  C  CG    . ASP A 1 1101 ? -6.508  -55.428  -0.667  1.00 7.94  ? 1102 ASP A CG    1 
ATOM   8382  O  OD1   . ASP A 1 1101 ? -6.016  -54.957  0.386   1.00 7.61  ? 1102 ASP A OD1   1 
ATOM   8383  O  OD2   . ASP A 1 1101 ? -5.863  -56.135  -1.479  1.00 8.83  ? 1102 ASP A OD2   1 
ATOM   8384  N  N     . PRO A 1 1102 ? -7.521  -52.174  1.027   1.00 4.58  ? 1103 PRO A N     1 
ATOM   8385  C  CA    . PRO A 1 1102 ? -6.743  -50.948  1.132   1.00 4.28  ? 1103 PRO A CA    1 
ATOM   8386  C  C     . PRO A 1 1102 ? -5.355  -50.927  0.501   1.00 5.05  ? 1103 PRO A C     1 
ATOM   8387  O  O     . PRO A 1 1102 ? -4.847  -49.837  0.206   1.00 4.89  ? 1103 PRO A O     1 
ATOM   8388  C  CB    . PRO A 1 1102 ? -6.676  -50.731  2.630   1.00 4.07  ? 1103 PRO A CB    1 
ATOM   8389  C  CG    . PRO A 1 1102 ? -7.908  -51.354  3.121   1.00 3.67  ? 1103 PRO A CG    1 
ATOM   8390  C  CD    . PRO A 1 1102 ? -7.946  -52.621  2.358   1.00 4.31  ? 1103 PRO A CD    1 
ATOM   8391  N  N     . ARG A 1 1103 ? -4.710  -52.078  0.287   1.00 5.73  ? 1104 ARG A N     1 
ATOM   8392  C  CA    . ARG A 1 1103 ? -3.380  -51.995  -0.331  1.00 6.79  ? 1104 ARG A CA    1 
ATOM   8393  C  C     . ARG A 1 1103 ? -3.443  -51.510  -1.772  1.00 7.88  ? 1104 ARG A C     1 
ATOM   8394  O  O     . ARG A 1 1103 ? -2.471  -50.957  -2.285  1.00 8.62  ? 1104 ARG A O     1 
ATOM   8395  C  CB    . ARG A 1 1103 ? -2.486  -53.240  -0.147  1.00 5.74  ? 1104 ARG A CB    1 
ATOM   8396  C  CG    . ARG A 1 1103 ? -3.128  -54.599  -0.197  1.00 6.11  ? 1104 ARG A CG    1 
ATOM   8397  C  CD    . ARG A 1 1103 ? -3.177  -55.217  1.188   1.00 5.48  ? 1104 ARG A CD    1 
ATOM   8398  N  NE    . ARG A 1 1103 ? -2.853  -56.647  1.259   1.00 6.28  ? 1104 ARG A NE    1 
ATOM   8399  C  CZ    . ARG A 1 1103 ? -3.678  -57.667  0.993   1.00 6.46  ? 1104 ARG A CZ    1 
ATOM   8400  N  NH1   . ARG A 1 1103 ? -4.923  -57.472  0.596   1.00 5.38  ? 1104 ARG A NH1   1 
ATOM   8401  N  NH2   . ARG A 1 1103 ? -3.286  -58.903  1.256   1.00 6.03  ? 1104 ARG A NH2   1 
ATOM   8402  N  N     . LEU A 1 1104 ? -4.611  -51.656  -2.399  1.00 8.51  ? 1105 LEU A N     1 
ATOM   8403  C  CA    . LEU A 1 1104 ? -4.814  -51.164  -3.758  1.00 8.31  ? 1105 LEU A CA    1 
ATOM   8404  C  C     . LEU A 1 1104 ? -4.819  -49.647  -3.659  1.00 9.16  ? 1105 LEU A C     1 
ATOM   8405  O  O     . LEU A 1 1104 ? -4.242  -48.955  -4.493  1.00 9.86  ? 1105 LEU A O     1 
ATOM   8406  C  CB    . LEU A 1 1104 ? -6.144  -51.640  -4.318  1.00 7.04  ? 1105 LEU A CB    1 
ATOM   8407  C  CG    . LEU A 1 1104 ? -6.246  -53.098  -4.740  1.00 6.16  ? 1105 LEU A CG    1 
ATOM   8408  C  CD1   . LEU A 1 1104 ? -6.540  -53.159  -6.206  1.00 6.65  ? 1105 LEU A CD1   1 
ATOM   8409  C  CD2   . LEU A 1 1104 ? -4.984  -53.850  -4.410  1.00 6.52  ? 1105 LEU A CD2   1 
ATOM   8410  N  N     . ALA A 1 1105 ? -5.467  -49.123  -2.629  1.00 9.83  ? 1106 ALA A N     1 
ATOM   8411  C  CA    . ALA A 1 1105 ? -5.491  -47.684  -2.455  1.00 10.60 ? 1106 ALA A CA    1 
ATOM   8412  C  C     . ALA A 1 1105 ? -4.059  -47.238  -2.269  1.00 11.10 ? 1106 ALA A C     1 
ATOM   8413  O  O     . ALA A 1 1105 ? -3.699  -46.147  -2.690  1.00 11.15 ? 1106 ALA A O     1 
ATOM   8414  C  CB    . ALA A 1 1105 ? -6.313  -47.300  -1.257  1.00 10.75 ? 1106 ALA A CB    1 
ATOM   8415  N  N     . ALA A 1 1106 ? -3.231  -48.105  -1.675  1.00 12.00 ? 1107 ALA A N     1 
ATOM   8416  C  CA    . ALA A 1 1106 ? -1.817  -47.769  -1.445  1.00 12.53 ? 1107 ALA A CA    1 
ATOM   8417  C  C     . ALA A 1 1106 ? -1.109  -47.536  -2.768  1.00 12.89 ? 1107 ALA A C     1 
ATOM   8418  O  O     . ALA A 1 1106 ? -0.307  -46.622  -2.870  1.00 13.53 ? 1107 ALA A O     1 
ATOM   8419  C  CB    . ALA A 1 1106 ? -1.107  -48.844  -0.634  1.00 12.29 ? 1107 ALA A CB    1 
ATOM   8420  N  N     . GLN A 1 1107 ? -1.432  -48.330  -3.788  1.00 13.09 ? 1108 GLN A N     1 
ATOM   8421  C  CA    . GLN A 1 1107 ? -0.825  -48.149  -5.100  1.00 13.58 ? 1108 GLN A CA    1 
ATOM   8422  C  C     . GLN A 1 1107 ? -1.574  -47.198  -6.010  1.00 13.87 ? 1108 GLN A C     1 
ATOM   8423  O  O     . GLN A 1 1107 ? -1.354  -47.201  -7.221  1.00 14.26 ? 1108 GLN A O     1 
ATOM   8424  C  CB    . GLN A 1 1107 ? -0.658  -49.466  -5.836  1.00 13.97 ? 1108 GLN A CB    1 
ATOM   8425  C  CG    . GLN A 1 1107 ? -1.519  -50.567  -5.371  1.00 15.40 ? 1108 GLN A CG    1 
ATOM   8426  C  CD    . GLN A 1 1107 ? -0.678  -51.730  -4.908  1.00 17.16 ? 1108 GLN A CD    1 
ATOM   8427  O  OE1   . GLN A 1 1107 ? -0.128  -51.709  -3.809  1.00 18.77 ? 1108 GLN A OE1   1 
ATOM   8428  N  NE2   . GLN A 1 1107 ? -0.536  -52.743  -5.759  1.00 18.12 ? 1108 GLN A NE2   1 
ATOM   8429  N  N     . GLY A 1 1108 ? -2.466  -46.391  -5.449  1.00 14.00 ? 1109 GLY A N     1 
ATOM   8430  C  CA    . GLY A 1 1108 ? -3.224  -45.468  -6.275  1.00 13.97 ? 1109 GLY A CA    1 
ATOM   8431  C  C     . GLY A 1 1108 ? -4.386  -46.108  -7.016  1.00 14.26 ? 1109 GLY A C     1 
ATOM   8432  O  O     . GLY A 1 1108 ? -5.023  -45.445  -7.831  1.00 14.35 ? 1109 GLY A O     1 
ATOM   8433  N  N     . LYS A 1 1109 ? -4.618  -47.405  -6.805  1.00 14.58 ? 1110 LYS A N     1 
ATOM   8434  C  CA    . LYS A 1 1109 ? -5.742  -48.095  -7.441  1.00 14.53 ? 1110 LYS A CA    1 
ATOM   8435  C  C     . LYS A 1 1109 ? -6.911  -48.112  -6.469  1.00 14.62 ? 1110 LYS A C     1 
ATOM   8436  O  O     . LYS A 1 1109 ? -6.711  -48.064  -5.253  1.00 15.15 ? 1110 LYS A O     1 
ATOM   8437  C  CB    . LYS A 1 1109 ? -5.401  -49.531  -7.818  1.00 14.44 ? 1110 LYS A CB    1 
ATOM   8438  C  CG    . LYS A 1 1109 ? -4.620  -49.675  -9.090  1.00 15.64 ? 1110 LYS A CG    1 
ATOM   8439  C  CD    . LYS A 1 1109 ? -3.128  -49.873  -8.812  1.00 17.08 ? 1110 LYS A CD    1 
ATOM   8440  C  CE    . LYS A 1 1109 ? -2.600  -51.203  -9.392  1.00 17.21 ? 1110 LYS A CE    1 
ATOM   8441  N  NZ    . LYS A 1 1109 ? -1.554  -51.056  -10.479 1.00 17.31 ? 1110 LYS A NZ    1 
ATOM   8442  N  N     . ASN A 1 1110 ? -8.126  -48.141  -7.017  1.00 14.46 ? 1111 ASN A N     1 
ATOM   8443  C  CA    . ASN A 1 1110 ? -9.366  -48.172  -6.241  1.00 14.25 ? 1111 ASN A CA    1 
ATOM   8444  C  C     . ASN A 1 1110 ? -9.401  -49.507  -5.492  1.00 13.16 ? 1111 ASN A C     1 
ATOM   8445  O  O     . ASN A 1 1110 ? -9.224  -50.559  -6.105  1.00 13.10 ? 1111 ASN A O     1 
ATOM   8446  C  CB    . ASN A 1 1110 ? -10.546 -48.085  -7.213  1.00 16.28 ? 1111 ASN A CB    1 
ATOM   8447  C  CG    . ASN A 1 1110 ? -11.876 -47.894  -6.514  1.00 17.61 ? 1111 ASN A CG    1 
ATOM   8448  O  OD1   . ASN A 1 1110 ? -12.660 -48.834  -6.388  1.00 18.75 ? 1111 ASN A OD1   1 
ATOM   8449  N  ND2   . ASN A 1 1110 ? -12.157 -46.660  -6.095  1.00 18.60 ? 1111 ASN A ND2   1 
ATOM   8450  N  N     . PRO A 1 1111 ? -9.589  -49.483  -4.162  1.00 11.80 ? 1112 PRO A N     1 
ATOM   8451  C  CA    . PRO A 1 1111 ? -9.623  -50.736  -3.417  1.00 11.02 ? 1112 PRO A CA    1 
ATOM   8452  C  C     . PRO A 1 1111 ? -10.908 -51.529  -3.566  1.00 10.80 ? 1112 PRO A C     1 
ATOM   8453  O  O     . PRO A 1 1111 ? -10.932 -52.718  -3.259  1.00 10.67 ? 1112 PRO A O     1 
ATOM   8454  C  CB    . PRO A 1 1111 ? -9.411  -50.272  -1.988  1.00 10.87 ? 1112 PRO A CB    1 
ATOM   8455  C  CG    . PRO A 1 1111 ? -10.084 -48.972  -1.965  1.00 10.93 ? 1112 PRO A CG    1 
ATOM   8456  C  CD    . PRO A 1 1111 ? -9.597  -48.341  -3.238  1.00 11.66 ? 1112 PRO A CD    1 
ATOM   8457  N  N     . PHE A 1 1112 ? -11.962 -50.903  -4.081  1.00 10.59 ? 1113 PHE A N     1 
ATOM   8458  C  CA    . PHE A 1 1112 ? -13.237 -51.605  -4.223  1.00 10.53 ? 1113 PHE A CA    1 
ATOM   8459  C  C     . PHE A 1 1112 ? -13.430 -52.393  -5.526  1.00 10.62 ? 1113 PHE A C     1 
ATOM   8460  O  O     . PHE A 1 1112 ? -13.479 -51.823  -6.611  1.00 10.61 ? 1113 PHE A O     1 
ATOM   8461  C  CB    . PHE A 1 1112 ? -14.416 -50.638  -3.995  1.00 9.97  ? 1113 PHE A CB    1 
ATOM   8462  C  CG    . PHE A 1 1112 ? -15.763 -51.330  -3.898  1.00 9.88  ? 1113 PHE A CG    1 
ATOM   8463  C  CD1   . PHE A 1 1112 ? -16.200 -51.866  -2.693  1.00 9.13  ? 1113 PHE A CD1   1 
ATOM   8464  C  CD2   . PHE A 1 1112 ? -16.563 -51.510  -5.032  1.00 10.04 ? 1113 PHE A CD2   1 
ATOM   8465  C  CE1   . PHE A 1 1112 ? -17.394 -52.568  -2.613  1.00 8.41  ? 1113 PHE A CE1   1 
ATOM   8466  C  CE2   . PHE A 1 1112 ? -17.766 -52.218  -4.954  1.00 9.10  ? 1113 PHE A CE2   1 
ATOM   8467  C  CZ    . PHE A 1 1112 ? -18.175 -52.743  -3.745  1.00 8.58  ? 1113 PHE A CZ    1 
ATOM   8468  N  N     . GLN A 1 1113 ? -13.608 -53.701  -5.412  1.00 10.81 ? 1114 GLN A N     1 
ATOM   8469  C  CA    . GLN A 1 1113 ? -13.820 -54.514  -6.592  1.00 12.06 ? 1114 GLN A CA    1 
ATOM   8470  C  C     . GLN A 1 1113 ? -15.098 -55.317  -6.481  1.00 11.97 ? 1114 GLN A C     1 
ATOM   8471  O  O     . GLN A 1 1113 ? -15.281 -56.009  -5.494  1.00 12.18 ? 1114 GLN A O     1 
ATOM   8472  C  CB    . GLN A 1 1113 ? -12.696 -55.541  -6.781  1.00 13.44 ? 1114 GLN A CB    1 
ATOM   8473  C  CG    . GLN A 1 1113 ? -11.245 -55.043  -6.747  1.00 15.29 ? 1114 GLN A CG    1 
ATOM   8474  C  CD    . GLN A 1 1113 ? -10.244 -56.193  -6.480  1.00 16.22 ? 1114 GLN A CD    1 
ATOM   8475  O  OE1   . GLN A 1 1113 ? -10.268 -57.230  -7.151  1.00 16.20 ? 1114 GLN A OE1   1 
ATOM   8476  N  NE2   . GLN A 1 1113 ? -9.387  -56.013  -5.476  1.00 16.34 ? 1114 GLN A NE2   1 
ATOM   8477  N  N     . LEU A 1 1114 ? -15.981 -55.228  -7.472  1.00 12.05 ? 1115 LEU A N     1 
ATOM   8478  C  CA    . LEU A 1 1114 ? -17.188 -56.060  -7.477  1.00 12.64 ? 1115 LEU A CA    1 
ATOM   8479  C  C     . LEU A 1 1114 ? -16.718 -57.377  -8.091  1.00 13.01 ? 1115 LEU A C     1 
ATOM   8480  O  O     . LEU A 1 1114 ? -15.806 -57.369  -8.920  1.00 13.76 ? 1115 LEU A O     1 
ATOM   8481  C  CB    . LEU A 1 1114 ? -18.249 -55.460  -8.387  1.00 13.09 ? 1115 LEU A CB    1 
ATOM   8482  C  CG    . LEU A 1 1114 ? -19.485 -54.838  -7.733  1.00 14.04 ? 1115 LEU A CG    1 
ATOM   8483  C  CD1   . LEU A 1 1114 ? -20.401 -54.285  -8.822  1.00 12.95 ? 1115 LEU A CD1   1 
ATOM   8484  C  CD2   . LEU A 1 1114 ? -20.206 -55.881  -6.854  1.00 14.06 ? 1115 LEU A CD2   1 
ATOM   8485  N  N     . ASP A 1 1115 ? -17.340 -58.496  -7.729  1.00 12.89 ? 1116 ASP A N     1 
ATOM   8486  C  CA    . ASP A 1 1115 ? -16.947 -59.808  -8.248  1.00 12.56 ? 1116 ASP A CA    1 
ATOM   8487  C  C     . ASP A 1 1115 ? -18.144 -60.566  -8.793  1.00 12.74 ? 1116 ASP A C     1 
ATOM   8488  O  O     . ASP A 1 1115 ? -18.002 -61.608  -9.424  1.00 13.50 ? 1116 ASP A O     1 
ATOM   8489  C  CB    . ASP A 1 1115 ? -16.312 -60.664  -7.145  1.00 12.66 ? 1116 ASP A CB    1 
ATOM   8490  C  CG    . ASP A 1 1115 ? -14.902 -60.202  -6.750  1.00 14.05 ? 1116 ASP A CG    1 
ATOM   8491  O  OD1   . ASP A 1 1115 ? -14.146 -59.673  -7.603  1.00 14.10 ? 1116 ASP A OD1   1 
ATOM   8492  O  OD2   . ASP A 1 1115 ? -14.532 -60.402  -5.566  1.00 14.40 ? 1116 ASP A OD2   1 
ATOM   8493  N  N     . SER A 1 1116 ? -19.329 -60.048  -8.521  1.00 12.89 ? 1117 SER A N     1 
ATOM   8494  C  CA    . SER A 1 1116 ? -20.584 -60.657  -8.932  1.00 13.01 ? 1117 SER A CA    1 
ATOM   8495  C  C     . SER A 1 1116 ? -21.179 -59.773  -10.019 1.00 13.13 ? 1117 SER A C     1 
ATOM   8496  O  O     . SER A 1 1116 ? -20.901 -58.583  -10.051 1.00 13.18 ? 1117 SER A O     1 
ATOM   8497  C  CB    . SER A 1 1116 ? -21.502 -60.720  -7.691  1.00 13.41 ? 1117 SER A CB    1 
ATOM   8498  O  OG    . SER A 1 1116 ? -22.888 -60.862  -7.995  1.00 14.19 ? 1117 SER A OG    1 
ATOM   8499  N  N     . LYS A 1 1117 ? -21.968 -60.328  -10.935 1.00 13.57 ? 1118 LYS A N     1 
ATOM   8500  C  CA    . LYS A 1 1117 ? -22.548 -59.461  -11.957 1.00 14.04 ? 1118 LYS A CA    1 
ATOM   8501  C  C     . LYS A 1 1117 ? -23.925 -59.022  -11.535 1.00 14.06 ? 1118 LYS A C     1 
ATOM   8502  O  O     . LYS A 1 1117 ? -24.546 -59.614  -10.634 1.00 14.05 ? 1118 LYS A O     1 
ATOM   8503  C  CB    . LYS A 1 1117 ? -22.639 -60.111  -13.337 1.00 14.29 ? 1118 LYS A CB    1 
ATOM   8504  C  CG    . LYS A 1 1117 ? -21.449 -60.938  -13.722 1.00 15.58 ? 1118 LYS A CG    1 
ATOM   8505  C  CD    . LYS A 1 1117 ? -21.875 -62.416  -13.897 1.00 17.85 ? 1118 LYS A CD    1 
ATOM   8506  C  CE    . LYS A 1 1117 ? -22.732 -62.976  -12.707 1.00 17.90 ? 1118 LYS A CE    1 
ATOM   8507  N  NZ    . LYS A 1 1117 ? -23.066 -64.442  -12.876 1.00 18.00 ? 1118 LYS A NZ    1 
ATOM   8508  N  N     . ALA A 1 1118 ? -24.394 -57.995  -12.238 1.00 13.71 ? 1119 ALA A N     1 
ATOM   8509  C  CA    . ALA A 1 1118 ? -25.693 -57.390  -12.020 1.00 13.28 ? 1119 ALA A CA    1 
ATOM   8510  C  C     . ALA A 1 1118 ? -26.794 -58.425  -11.822 1.00 12.96 ? 1119 ALA A C     1 
ATOM   8511  O  O     . ALA A 1 1118 ? -26.622 -59.599  -12.174 1.00 12.47 ? 1119 ALA A O     1 
ATOM   8512  C  CB    . ALA A 1 1118 ? -26.013 -56.480  -13.173 1.00 13.32 ? 1119 ALA A CB    1 
ATOM   8513  N  N     . PRO A 1 1119 ? -27.904 -58.018  -11.171 1.00 13.04 ? 1120 PRO A N     1 
ATOM   8514  C  CA    . PRO A 1 1119 ? -29.046 -58.905  -10.906 1.00 13.34 ? 1120 PRO A CA    1 
ATOM   8515  C  C     . PRO A 1 1119 ? -29.691 -59.381  -12.193 1.00 13.89 ? 1120 PRO A C     1 
ATOM   8516  O  O     . PRO A 1 1119 ? -29.748 -58.642  -13.182 1.00 14.60 ? 1120 PRO A O     1 
ATOM   8517  C  CB    . PRO A 1 1119 ? -29.981 -58.026  -10.090 1.00 13.01 ? 1120 PRO A CB    1 
ATOM   8518  C  CG    . PRO A 1 1119 ? -29.024 -57.103  -9.381  1.00 13.21 ? 1120 PRO A CG    1 
ATOM   8519  C  CD    . PRO A 1 1119 ? -28.080 -56.728  -10.482 1.00 12.79 ? 1120 PRO A CD    1 
ATOM   8520  N  N     . ASP A 1 1120 ? -30.175 -60.619  -12.173 1.00 13.88 ? 1121 ASP A N     1 
ATOM   8521  C  CA    . ASP A 1 1120 ? -30.783 -61.249  -13.339 1.00 13.90 ? 1121 ASP A CA    1 
ATOM   8522  C  C     . ASP A 1 1120 ? -32.228 -61.740  -13.123 1.00 13.89 ? 1121 ASP A C     1 
ATOM   8523  O  O     . ASP A 1 1120 ? -32.570 -62.850  -13.511 1.00 14.03 ? 1121 ASP A O     1 
ATOM   8524  C  CB    . ASP A 1 1120 ? -29.908 -62.431  -13.728 1.00 14.42 ? 1121 ASP A CB    1 
ATOM   8525  C  CG    . ASP A 1 1120 ? -29.912 -63.518  -12.671 1.00 15.80 ? 1121 ASP A CG    1 
ATOM   8526  O  OD1   . ASP A 1 1120 ? -30.281 -63.217  -11.517 1.00 16.42 ? 1121 ASP A OD1   1 
ATOM   8527  O  OD2   . ASP A 1 1120 ? -29.579 -64.683  -12.983 1.00 17.10 ? 1121 ASP A OD2   1 
ATOM   8528  N  N     . GLY A 1 1121 ? -33.044 -60.943  -12.446 1.00 14.19 ? 1122 GLY A N     1 
ATOM   8529  C  CA    . GLY A 1 1121 ? -34.436 -61.295  -12.200 1.00 14.16 ? 1122 GLY A CA    1 
ATOM   8530  C  C     . GLY A 1 1121 ? -34.754 -62.609  -11.508 1.00 14.12 ? 1122 GLY A C     1 
ATOM   8531  O  O     . GLY A 1 1121 ? -35.928 -63.001  -11.448 1.00 14.30 ? 1122 GLY A O     1 
ATOM   8532  N  N     . SER A 1 1122 ? -33.730 -63.297  -11.003 1.00 14.18 ? 1123 SER A N     1 
ATOM   8533  C  CA    . SER A 1 1122 ? -33.918 -64.582  -10.317 1.00 14.49 ? 1123 SER A CA    1 
ATOM   8534  C  C     . SER A 1 1122 ? -34.603 -64.373  -8.978  1.00 15.10 ? 1123 SER A C     1 
ATOM   8535  O  O     . SER A 1 1122 ? -35.247 -65.275  -8.437  1.00 15.05 ? 1123 SER A O     1 
ATOM   8536  C  CB    . SER A 1 1122 ? -32.570 -65.249  -10.025 1.00 14.60 ? 1123 SER A CB    1 
ATOM   8537  O  OG    . SER A 1 1122 ? -31.690 -65.231  -11.130 1.00 14.48 ? 1123 SER A OG    1 
ATOM   8538  N  N     . VAL A 1 1123 ? -34.382 -63.184  -8.429  1.00 15.90 ? 1124 VAL A N     1 
ATOM   8539  C  CA    . VAL A 1 1123 ? -34.904 -62.773  -7.135  1.00 16.20 ? 1124 VAL A CA    1 
ATOM   8540  C  C     . VAL A 1 1123 ? -36.111 -63.554  -6.650  1.00 16.80 ? 1124 VAL A C     1 
ATOM   8541  O  O     . VAL A 1 1123 ? -35.965 -64.466  -5.856  1.00 16.84 ? 1124 VAL A O     1 
ATOM   8542  C  CB    . VAL A 1 1123 ? -35.236 -61.313  -7.134  1.00 15.96 ? 1124 VAL A CB    1 
ATOM   8543  C  CG1   . VAL A 1 1123 ? -35.165 -60.806  -5.719  1.00 15.66 ? 1124 VAL A CG1   1 
ATOM   8544  C  CG2   . VAL A 1 1123 ? -34.286 -60.564  -8.078  1.00 16.33 ? 1124 VAL A CG2   1 
ATOM   8545  N  N     . GLU A 1 1124 ? -37.293 -63.248  -7.170  1.00 17.48 ? 1125 GLU A N     1 
ATOM   8546  C  CA    . GLU A 1 1124 ? -38.497 -63.949  -6.745  1.00 17.89 ? 1125 GLU A CA    1 
ATOM   8547  C  C     . GLU A 1 1124 ? -38.420 -65.469  -6.780  1.00 17.61 ? 1125 GLU A C     1 
ATOM   8548  O  O     . GLU A 1 1124 ? -38.891 -66.108  -5.843  1.00 17.74 ? 1125 GLU A O     1 
ATOM   8549  C  CB    . GLU A 1 1124 ? -39.705 -63.487  -7.544  1.00 19.27 ? 1125 GLU A CB    1 
ATOM   8550  C  CG    . GLU A 1 1124 ? -40.968 -64.228  -7.170  1.00 21.00 ? 1125 GLU A CG    1 
ATOM   8551  C  CD    . GLU A 1 1124 ? -41.948 -63.378  -6.401  1.00 22.13 ? 1125 GLU A CD    1 
ATOM   8552  O  OE1   . GLU A 1 1124 ? -41.507 -62.461  -5.659  1.00 22.42 ? 1125 GLU A OE1   1 
ATOM   8553  O  OE2   . GLU A 1 1124 ? -43.168 -63.637  -6.553  1.00 23.31 ? 1125 GLU A OE2   1 
ATOM   8554  N  N     . GLU A 1 1125 ? -37.868 -66.064  -7.840  1.00 17.26 ? 1126 GLU A N     1 
ATOM   8555  C  CA    . GLU A 1 1125 ? -37.782 -67.524  -7.874  1.00 17.06 ? 1126 GLU A CA    1 
ATOM   8556  C  C     . GLU A 1 1125 ? -36.810 -68.026  -6.809  0.00 16.24 ? 1126 GLU A C     1 
ATOM   8557  O  O     . GLU A 1 1125 ? -36.838 -69.189  -6.432  1.00 16.48 ? 1126 GLU A O     1 
ATOM   8558  C  CB    . GLU A 1 1125 ? -37.448 -68.075  -9.271  0.00 18.37 ? 1126 GLU A CB    1 
ATOM   8559  C  CG    . GLU A 1 1125 ? -36.392 -67.330  -10.056 0.00 20.35 ? 1126 GLU A CG    1 
ATOM   8560  C  CD    . GLU A 1 1125 ? -36.941 -66.730  -11.338 0.00 21.55 ? 1126 GLU A CD    1 
ATOM   8561  O  OE1   . GLU A 1 1125 ? -37.717 -65.753  -11.257 0.00 22.03 ? 1126 GLU A OE1   1 
ATOM   8562  O  OE2   . GLU A 1 1125 ? -36.600 -67.238  -12.426 0.00 22.05 ? 1126 GLU A OE2   1 
ATOM   8563  N  N     . PHE A 1 1126 ? -36.014 -67.104  -6.273  1.00 15.06 ? 1127 PHE A N     1 
ATOM   8564  C  CA    . PHE A 1 1126 ? -35.036 -67.383  -5.220  1.00 13.77 ? 1127 PHE A CA    1 
ATOM   8565  C  C     . PHE A 1 1126 ? -35.713 -67.332  -3.848  1.00 13.29 ? 1127 PHE A C     1 
ATOM   8566  O  O     . PHE A 1 1126 ? -35.541 -68.244  -3.033  1.00 13.33 ? 1127 PHE A O     1 
ATOM   8567  C  CB    . PHE A 1 1126 ? -33.892 -66.343  -5.303  1.00 12.98 ? 1127 PHE A CB    1 
ATOM   8568  C  CG    . PHE A 1 1126 ? -32.959 -66.337  -4.118  1.00 11.32 ? 1127 PHE A CG    1 
ATOM   8569  C  CD1   . PHE A 1 1126 ? -32.018 -67.327  -3.952  1.00 11.18 ? 1127 PHE A CD1   1 
ATOM   8570  C  CD2   . PHE A 1 1126 ? -33.011 -65.328  -3.189  1.00 10.91 ? 1127 PHE A CD2   1 
ATOM   8571  C  CE1   . PHE A 1 1126 ? -31.142 -67.308  -2.868  1.00 11.34 ? 1127 PHE A CE1   1 
ATOM   8572  C  CE2   . PHE A 1 1126 ? -32.140 -65.306  -2.109  1.00 11.34 ? 1127 PHE A CE2   1 
ATOM   8573  C  CZ    . PHE A 1 1126 ? -31.203 -66.300  -1.947  1.00 10.88 ? 1127 PHE A CZ    1 
ATOM   8574  N  N     . LEU A 1 1127 ? -36.473 -66.260  -3.609  1.00 12.28 ? 1128 LEU A N     1 
ATOM   8575  C  CA    . LEU A 1 1127 ? -37.172 -66.043  -2.348  1.00 11.39 ? 1128 LEU A CA    1 
ATOM   8576  C  C     . LEU A 1 1127 ? -38.267 -67.059  -2.163  1.00 11.27 ? 1128 LEU A C     1 
ATOM   8577  O  O     . LEU A 1 1127 ? -38.390 -67.710  -1.122  1.00 11.55 ? 1128 LEU A O     1 
ATOM   8578  C  CB    . LEU A 1 1127 ? -37.823 -64.664  -2.306  1.00 10.42 ? 1128 LEU A CB    1 
ATOM   8579  C  CG    . LEU A 1 1127 ? -36.976 -63.421  -2.537  1.00 10.34 ? 1128 LEU A CG    1 
ATOM   8580  C  CD1   . LEU A 1 1127 ? -37.806 -62.215  -2.185  1.00 10.31 ? 1128 LEU A CD1   1 
ATOM   8581  C  CD2   . LEU A 1 1127 ? -35.722 -63.448  -1.703  1.00 10.21 ? 1128 LEU A CD2   1 
ATOM   8582  N  N     . MET A 1 1128 ? -39.083 -67.182  -3.188  1.00 11.09 ? 1129 MET A N     1 
ATOM   8583  C  CA    . MET A 1 1128 ? -40.187 -68.101  -3.134  1.00 11.32 ? 1129 MET A CA    1 
ATOM   8584  C  C     . MET A 1 1128 ? -39.738 -69.562  -2.947  1.00 11.35 ? 1129 MET A C     1 
ATOM   8585  O  O     . MET A 1 1128 ? -40.548 -70.465  -2.742  1.00 11.16 ? 1129 MET A O     1 
ATOM   8586  C  CB    . MET A 1 1128 ? -41.072 -67.880  -4.359  1.00 11.84 ? 1129 MET A CB    1 
ATOM   8587  C  CG    . MET A 1 1128 ? -42.070 -66.755  -4.170  1.00 11.72 ? 1129 MET A CG    1 
ATOM   8588  S  SD    . MET A 1 1128 ? -43.152 -67.310  -2.853  1.00 13.49 ? 1129 MET A SD    1 
ATOM   8589  C  CE    . MET A 1 1128 ? -43.038 -66.009  -1.694  1.00 13.21 ? 1129 MET A CE    1 
ATOM   8590  N  N     . ALA A 1 1129 ? -38.436 -69.779  -2.922  1.00 11.65 ? 1130 ALA A N     1 
ATOM   8591  C  CA    . ALA A 1 1129 ? -37.933 -71.126  -2.722  1.00 12.71 ? 1130 ALA A CA    1 
ATOM   8592  C  C     . ALA A 1 1129 ? -37.620 -71.437  -1.244  1.00 13.23 ? 1130 ALA A C     1 
ATOM   8593  O  O     . ALA A 1 1129 ? -37.411 -72.607  -0.881  1.00 13.63 ? 1130 ALA A O     1 
ATOM   8594  C  CB    . ALA A 1 1129 ? -36.704 -71.362  -3.587  1.00 13.38 ? 1130 ALA A CB    1 
ATOM   8595  N  N     . GLN A 1 1130 ? -37.566 -70.404  -0.400  1.00 12.73 ? 1131 GLN A N     1 
ATOM   8596  C  CA    . GLN A 1 1130 ? -37.288 -70.607  1.019   1.00 11.90 ? 1131 GLN A CA    1 
ATOM   8597  C  C     . GLN A 1 1130 ? -38.533 -70.366  1.816   1.00 11.23 ? 1131 GLN A C     1 
ATOM   8598  O  O     . GLN A 1 1130 ? -39.181 -69.326  1.691   1.00 10.83 ? 1131 GLN A O     1 
ATOM   8599  C  CB    . GLN A 1 1130 ? -36.199 -69.672  1.513   1.00 12.33 ? 1131 GLN A CB    1 
ATOM   8600  C  CG    . GLN A 1 1130 ? -34.854 -69.896  0.873   1.00 12.75 ? 1131 GLN A CG    1 
ATOM   8601  C  CD    . GLN A 1 1130 ? -34.052 -68.632  0.870   1.00 13.56 ? 1131 GLN A CD    1 
ATOM   8602  O  OE1   . GLN A 1 1130 ? -34.192 -67.804  1.770   1.00 13.59 ? 1131 GLN A OE1   1 
ATOM   8603  N  NE2   . GLN A 1 1130 ? -33.247 -68.436  -0.174  1.00 13.74 ? 1131 GLN A NE2   1 
ATOM   8604  N  N     . ASN A 1 1131 ? -38.839 -71.340  2.658   1.00 10.88 ? 1132 ASN A N     1 
ATOM   8605  C  CA    . ASN A 1 1131 ? -40.009 -71.284  3.497   1.00 10.43 ? 1132 ASN A CA    1 
ATOM   8606  C  C     . ASN A 1 1131 ? -40.030 -70.010  4.289   1.00 10.58 ? 1132 ASN A C     1 
ATOM   8607  O  O     . ASN A 1 1131 ? -41.090 -69.453  4.511   1.00 10.83 ? 1132 ASN A O     1 
ATOM   8608  C  CB    . ASN A 1 1131 ? -40.037 -72.457  4.449   1.00 9.76  ? 1132 ASN A CB    1 
ATOM   8609  C  CG    . ASN A 1 1131 ? -41.429 -72.809  4.859   1.00 9.73  ? 1132 ASN A CG    1 
ATOM   8610  O  OD1   . ASN A 1 1131 ? -41.803 -72.663  6.016   1.00 10.49 ? 1132 ASN A OD1   1 
ATOM   8611  N  ND2   . ASN A 1 1131 ? -42.216 -73.272  3.910   1.00 9.71  ? 1132 ASN A ND2   1 
ATOM   8612  N  N     . ARG A 1 1132 ? -38.861 -69.524  4.688   1.00 10.77 ? 1133 ARG A N     1 
ATOM   8613  C  CA    . ARG A 1 1132 ? -38.821 -68.293  5.456   1.00 11.15 ? 1133 ARG A CA    1 
ATOM   8614  C  C     . ARG A 1 1132 ? -39.566 -67.182  4.729   1.00 10.99 ? 1133 ARG A C     1 
ATOM   8615  O  O     . ARG A 1 1132 ? -40.258 -66.392  5.353   1.00 11.02 ? 1133 ARG A O     1 
ATOM   8616  C  CB    . ARG A 1 1132 ? -37.378 -67.866  5.812   1.00 11.64 ? 1133 ARG A CB    1 
ATOM   8617  C  CG    . ARG A 1 1132 ? -36.373 -67.785  4.664   1.00 12.60 ? 1133 ARG A CG    1 
ATOM   8618  C  CD    . ARG A 1 1132 ? -35.098 -67.035  5.083   1.00 12.94 ? 1133 ARG A CD    1 
ATOM   8619  N  NE    . ARG A 1 1132 ? -34.044 -67.137  4.074   1.00 12.89 ? 1133 ARG A NE    1 
ATOM   8620  C  CZ    . ARG A 1 1132 ? -33.089 -66.225  3.869   1.00 14.17 ? 1133 ARG A CZ    1 
ATOM   8621  N  NH1   . ARG A 1 1132 ? -33.012 -65.111  4.605   1.00 13.99 ? 1133 ARG A NH1   1 
ATOM   8622  N  NH2   . ARG A 1 1132 ? -32.201 -66.422  2.899   1.00 14.67 ? 1133 ARG A NH2   1 
ATOM   8623  N  N     . PHE A 1 1133 ? -39.513 -67.203  3.404   1.00 11.02 ? 1134 PHE A N     1 
ATOM   8624  C  CA    . PHE A 1 1133 ? -40.171 -66.186  2.587   1.00 11.41 ? 1134 PHE A CA    1 
ATOM   8625  C  C     . PHE A 1 1133 ? -41.554 -66.587  2.064   1.00 12.18 ? 1134 PHE A C     1 
ATOM   8626  O  O     . PHE A 1 1133 ? -42.454 -65.736  1.904   1.00 12.30 ? 1134 PHE A O     1 
ATOM   8627  C  CB    . PHE A 1 1133 ? -39.267 -65.813  1.410   1.00 10.46 ? 1134 PHE A CB    1 
ATOM   8628  C  CG    . PHE A 1 1133 ? -38.063 -64.995  1.799   1.00 9.11  ? 1134 PHE A CG    1 
ATOM   8629  C  CD1   . PHE A 1 1133 ? -38.198 -63.659  2.143   1.00 8.59  ? 1134 PHE A CD1   1 
ATOM   8630  C  CD2   . PHE A 1 1133 ? -36.800 -65.561  1.819   1.00 8.34  ? 1134 PHE A CD2   1 
ATOM   8631  C  CE1   . PHE A 1 1133 ? -37.104 -62.916  2.499   1.00 7.43  ? 1134 PHE A CE1   1 
ATOM   8632  C  CE2   . PHE A 1 1133 ? -35.710 -64.813  2.172   1.00 7.48  ? 1134 PHE A CE2   1 
ATOM   8633  C  CZ    . PHE A 1 1133 ? -35.863 -63.493  2.512   1.00 6.95  ? 1134 PHE A CZ    1 
ATOM   8634  N  N     . ALA A 1 1134 ? -41.694 -67.881  1.777   1.00 12.63 ? 1135 ALA A N     1 
ATOM   8635  C  CA    . ALA A 1 1134 ? -42.922 -68.462  1.254   1.00 13.08 ? 1135 ALA A CA    1 
ATOM   8636  C  C     . ALA A 1 1134 ? -44.065 -68.600  2.264   1.00 13.60 ? 1135 ALA A C     1 
ATOM   8637  O  O     . ALA A 1 1134 ? -45.225 -68.626  1.864   1.00 13.86 ? 1135 ALA A O     1 
ATOM   8638  C  CB    . ALA A 1 1134 ? -42.617 -69.809  0.629   1.00 13.77 ? 1135 ALA A CB    1 
ATOM   8639  N  N     . VAL A 1 1135 ? -43.763 -68.785  3.551   1.00 13.91 ? 1136 VAL A N     1 
ATOM   8640  C  CA    . VAL A 1 1135 ? -44.850 -68.872  4.520   1.00 14.05 ? 1136 VAL A CA    1 
ATOM   8641  C  C     . VAL A 1 1135 ? -45.616 -67.554  4.491   1.00 14.64 ? 1136 VAL A C     1 
ATOM   8642  O  O     . VAL A 1 1135 ? -46.833 -67.555  4.327   1.00 15.56 ? 1136 VAL A O     1 
ATOM   8643  C  CB    . VAL A 1 1135 ? -44.408 -69.149  5.975   1.00 13.57 ? 1136 VAL A CB    1 
ATOM   8644  C  CG1   . VAL A 1 1135 ? -44.544 -70.612  6.300   1.00 12.97 ? 1136 VAL A CG1   1 
ATOM   8645  C  CG2   . VAL A 1 1135 ? -43.015 -68.677  6.213   1.00 13.37 ? 1136 VAL A CG2   1 
ATOM   8646  N  N     . LEU A 1 1136 ? -44.912 -66.426  4.573   1.00 14.74 ? 1137 LEU A N     1 
ATOM   8647  C  CA    . LEU A 1 1136 ? -45.592 -65.130  4.552   1.00 14.99 ? 1137 LEU A CA    1 
ATOM   8648  C  C     . LEU A 1 1136 ? -46.539 -65.032  3.345   1.00 15.60 ? 1137 LEU A C     1 
ATOM   8649  O  O     . LEU A 1 1136 ? -47.589 -64.388  3.410   1.00 15.26 ? 1137 LEU A O     1 
ATOM   8650  C  CB    . LEU A 1 1136 ? -44.579 -63.975  4.516   1.00 14.27 ? 1137 LEU A CB    1 
ATOM   8651  C  CG    . LEU A 1 1136 ? -44.870 -62.777  5.433   1.00 13.94 ? 1137 LEU A CG    1 
ATOM   8652  C  CD1   . LEU A 1 1136 ? -44.942 -61.493  4.666   1.00 13.21 ? 1137 LEU A CD1   1 
ATOM   8653  C  CD2   . LEU A 1 1136 ? -46.153 -62.986  6.227   1.00 14.19 ? 1137 LEU A CD2   1 
ATOM   8654  N  N     . ASP A 1 1137 ? -46.156 -65.676  2.245   1.00 16.04 ? 1138 ASP A N     1 
ATOM   8655  C  CA    . ASP A 1 1137 ? -46.972 -65.651  1.050   1.00 16.59 ? 1138 ASP A CA    1 
ATOM   8656  C  C     . ASP A 1 1137 ? -48.237 -66.433  1.302   1.00 17.31 ? 1138 ASP A C     1 
ATOM   8657  O  O     . ASP A 1 1137 ? -49.332 -65.903  1.128   1.00 18.19 ? 1138 ASP A O     1 
ATOM   8658  C  CB    . ASP A 1 1137 ? -46.239 -66.235  -0.140  1.00 16.33 ? 1138 ASP A CB    1 
ATOM   8659  C  CG    . ASP A 1 1137 ? -47.016 -66.075  -1.411  1.00 16.26 ? 1138 ASP A CG    1 
ATOM   8660  O  OD1   . ASP A 1 1137 ? -47.053 -64.947  -1.945  1.00 15.95 ? 1138 ASP A OD1   1 
ATOM   8661  O  OD2   . ASP A 1 1137 ? -47.612 -67.068  -1.859  1.00 16.88 ? 1138 ASP A OD2   1 
ATOM   8662  N  N     . ARG A 1 1138 ? -48.090 -67.694  1.703   1.00 17.46 ? 1139 ARG A N     1 
ATOM   8663  C  CA    . ARG A 1 1138 ? -49.229 -68.548  2.012   1.00 17.58 ? 1139 ARG A CA    1 
ATOM   8664  C  C     . ARG A 1 1138 ? -50.222 -67.863  2.935   1.00 18.27 ? 1139 ARG A C     1 
ATOM   8665  O  O     . ARG A 1 1138 ? -51.410 -67.785  2.622   1.00 18.70 ? 1139 ARG A O     1 
ATOM   8666  C  CB    . ARG A 1 1138 ? -48.754 -69.803  2.718   1.00 17.36 ? 1139 ARG A CB    1 
ATOM   8667  C  CG    . ARG A 1 1138 ? -48.337 -70.903  1.802   1.00 17.76 ? 1139 ARG A CG    1 
ATOM   8668  C  CD    . ARG A 1 1138 ? -47.488 -71.913  2.536   1.00 18.15 ? 1139 ARG A CD    1 
ATOM   8669  N  NE    . ARG A 1 1138 ? -46.230 -72.053  1.820   1.00 19.13 ? 1139 ARG A NE    1 
ATOM   8670  C  CZ    . ARG A 1 1138 ? -45.106 -72.537  2.333   1.00 19.62 ? 1139 ARG A CZ    1 
ATOM   8671  N  NH1   . ARG A 1 1138 ? -45.055 -72.937  3.606   1.00 18.91 ? 1139 ARG A NH1   1 
ATOM   8672  N  NH2   . ARG A 1 1138 ? -44.038 -72.636  1.545   1.00 19.55 ? 1139 ARG A NH2   1 
ATOM   8673  N  N     . SER A 1 1139 ? -49.704 -67.308  4.031   1.00 19.01 ? 1140 SER A N     1 
ATOM   8674  C  CA    . SER A 1 1139 ? -50.494 -66.647  5.079   1.00 19.42 ? 1140 SER A CA    1 
ATOM   8675  C  C     . SER A 1 1139 ? -50.714 -65.107  5.059   1.00 20.06 ? 1140 SER A C     1 
ATOM   8676  O  O     . SER A 1 1139 ? -51.495 -64.584  5.869   1.00 20.08 ? 1140 SER A O     1 
ATOM   8677  C  CB    . SER A 1 1139 ? -49.924 -67.071  6.444   1.00 19.14 ? 1140 SER A CB    1 
ATOM   8678  O  OG    . SER A 1 1139 ? -49.586 -68.458  6.444   1.00 19.08 ? 1140 SER A OG    1 
ATOM   8679  N  N     . PHE A 1 1140 ? -50.046 -64.373  4.168   1.00 20.47 ? 1141 PHE A N     1 
ATOM   8680  C  CA    . PHE A 1 1140 ? -50.198 -62.900  4.109   1.00 20.78 ? 1141 PHE A CA    1 
ATOM   8681  C  C     . PHE A 1 1140 ? -49.815 -62.416  2.729   1.00 20.83 ? 1141 PHE A C     1 
ATOM   8682  O  O     . PHE A 1 1140 ? -49.022 -61.480  2.610   1.00 21.12 ? 1141 PHE A O     1 
ATOM   8683  C  CB    . PHE A 1 1140 ? -49.244 -62.185  5.073   1.00 20.86 ? 1141 PHE A CB    1 
ATOM   8684  C  CG    . PHE A 1 1140 ? -49.673 -62.198  6.502   1.00 21.24 ? 1141 PHE A CG    1 
ATOM   8685  C  CD1   . PHE A 1 1140 ? -49.442 -63.313  7.303   1.00 21.18 ? 1141 PHE A CD1   1 
ATOM   8686  C  CD2   . PHE A 1 1140 ? -50.237 -61.066  7.073   1.00 21.41 ? 1141 PHE A CD2   1 
ATOM   8687  C  CE1   . PHE A 1 1140 ? -49.763 -63.303  8.645   1.00 21.17 ? 1141 PHE A CE1   1 
ATOM   8688  C  CE2   . PHE A 1 1140 ? -50.562 -61.044  8.420   1.00 21.73 ? 1141 PHE A CE2   1 
ATOM   8689  C  CZ    . PHE A 1 1140 ? -50.323 -62.169  9.202   1.00 21.45 ? 1141 PHE A CZ    1 
ATOM   8690  N  N     . PRO A 1 1141 ? -50.433 -62.977  1.674   1.00 20.54 ? 1142 PRO A N     1 
ATOM   8691  C  CA    . PRO A 1 1141 ? -50.168 -62.632  0.276   1.00 20.10 ? 1142 PRO A CA    1 
ATOM   8692  C  C     . PRO A 1 1141 ? -50.163 -61.154  0.009   1.00 20.34 ? 1142 PRO A C     1 
ATOM   8693  O  O     . PRO A 1 1141 ? -49.229 -60.652  -0.608  1.00 19.88 ? 1142 PRO A O     1 
ATOM   8694  C  CB    . PRO A 1 1141 ? -51.323 -63.279  -0.458  1.00 20.07 ? 1142 PRO A CB    1 
ATOM   8695  C  CG    . PRO A 1 1141 ? -51.743 -64.392  0.450   1.00 20.16 ? 1142 PRO A CG    1 
ATOM   8696  C  CD    . PRO A 1 1141 ? -51.675 -63.753  1.779   1.00 20.15 ? 1142 PRO A CD    1 
ATOM   8697  N  N     . GLU A 1 1142 ? -51.190 -60.444  0.472   1.00 21.08 ? 1143 GLU A N     1 
ATOM   8698  C  CA    . GLU A 1 1142 ? -51.204 -59.023  0.180   1.00 21.95 ? 1143 GLU A CA    1 
ATOM   8699  C  C     . GLU A 1 1142 ? -49.946 -58.335  0.693   1.00 21.31 ? 1143 GLU A C     1 
ATOM   8700  O  O     . GLU A 1 1142 ? -49.295 -57.635  -0.078  1.00 21.29 ? 1143 GLU A O     1 
ATOM   8701  C  CB    . GLU A 1 1142 ? -52.550 -58.304  0.499   1.00 24.13 ? 1143 GLU A CB    1 
ATOM   8702  C  CG    . GLU A 1 1142 ? -53.299 -58.598  1.839   1.00 28.32 ? 1143 GLU A CG    1 
ATOM   8703  C  CD    . GLU A 1 1142 ? -54.793 -58.063  1.858   1.00 30.55 ? 1143 GLU A CD    1 
ATOM   8704  O  OE1   . GLU A 1 1142 ? -55.699 -58.791  1.369   1.00 31.96 ? 1143 GLU A OE1   1 
ATOM   8705  O  OE2   . GLU A 1 1142 ? -55.075 -56.936  2.368   1.00 31.17 ? 1143 GLU A OE2   1 
ATOM   8706  N  N     . ASP A 1 1143 ? -49.501 -58.677  1.909   1.00 20.60 ? 1144 ASP A N     1 
ATOM   8707  C  CA    . ASP A 1 1143 ? -48.273 -58.079  2.471   1.00 19.30 ? 1144 ASP A CA    1 
ATOM   8708  C  C     . ASP A 1 1143 ? -46.975 -58.631  1.867   1.00 18.56 ? 1144 ASP A C     1 
ATOM   8709  O  O     . ASP A 1 1143 ? -46.046 -57.873  1.606   1.00 18.38 ? 1144 ASP A O     1 
ATOM   8710  C  CB    . ASP A 1 1143 ? -48.228 -58.226  4.000   1.00 18.71 ? 1144 ASP A CB    1 
ATOM   8711  C  CG    . ASP A 1 1143 ? -48.872 -57.051  4.717   1.00 19.25 ? 1144 ASP A CG    1 
ATOM   8712  O  OD1   . ASP A 1 1143 ? -49.875 -56.504  4.186   1.00 19.44 ? 1144 ASP A OD1   1 
ATOM   8713  O  OD2   . ASP A 1 1143 ? -48.377 -56.664  5.805   1.00 18.25 ? 1144 ASP A OD2   1 
ATOM   8714  N  N     . ALA A 1 1144 ? -46.945 -59.943  1.615   1.00 17.67 ? 1145 ALA A N     1 
ATOM   8715  C  CA    . ALA A 1 1144 ? -45.781 -60.642  1.071   1.00 16.74 ? 1145 ALA A CA    1 
ATOM   8716  C  C     . ALA A 1 1144 ? -45.358 -60.238  -0.338  1.00 16.79 ? 1145 ALA A C     1 
ATOM   8717  O  O     . ALA A 1 1144 ? -44.165 -60.122  -0.610  1.00 17.27 ? 1145 ALA A O     1 
ATOM   8718  C  CB    . ALA A 1 1144 ? -45.986 -62.153  1.158   1.00 15.87 ? 1145 ALA A CB    1 
ATOM   8719  N  N     . LYS A 1 1145 ? -46.315 -60.045  -1.244  1.00 16.71 ? 1146 LYS A N     1 
ATOM   8720  C  CA    . LYS A 1 1145 ? -46.009 -59.637  -2.622  1.00 15.95 ? 1146 LYS A CA    1 
ATOM   8721  C  C     . LYS A 1 1145 ? -45.339 -58.281  -2.575  1.00 15.09 ? 1146 LYS A C     1 
ATOM   8722  O  O     . LYS A 1 1145 ? -44.524 -57.956  -3.413  1.00 15.21 ? 1146 LYS A O     1 
ATOM   8723  C  CB    . LYS A 1 1145 ? -47.299 -59.543  -3.454  1.00 17.07 ? 1146 LYS A CB    1 
ATOM   8724  C  CG    . LYS A 1 1145 ? -47.558 -58.168  -4.123  1.00 18.78 ? 1146 LYS A CG    1 
ATOM   8725  C  CD    . LYS A 1 1145 ? -49.071 -57.829  -4.227  1.00 20.90 ? 1146 LYS A CD    1 
ATOM   8726  C  CE    . LYS A 1 1145 ? -49.779 -58.403  -5.491  1.00 21.75 ? 1146 LYS A CE    1 
ATOM   8727  N  NZ    . LYS A 1 1145 ? -51.301 -58.260  -5.467  1.00 21.89 ? 1146 LYS A NZ    1 
ATOM   8728  N  N     . ARG A 1 1146 ? -45.678 -57.501  -1.565  1.00 14.39 ? 1147 ARG A N     1 
ATOM   8729  C  CA    . ARG A 1 1146 ? -45.133 -56.172  -1.408  1.00 14.47 ? 1147 ARG A CA    1 
ATOM   8730  C  C     . ARG A 1 1146 ? -43.671 -56.186  -1.006  1.00 14.15 ? 1147 ARG A C     1 
ATOM   8731  O  O     . ARG A 1 1146 ? -42.855 -55.426  -1.532  1.00 14.57 ? 1147 ARG A O     1 
ATOM   8732  C  CB    . ARG A 1 1146 ? -45.910 -55.449  -0.321  1.00 15.45 ? 1147 ARG A CB    1 
ATOM   8733  C  CG    . ARG A 1 1146 ? -46.466 -54.091  -0.695  1.00 17.60 ? 1147 ARG A CG    1 
ATOM   8734  C  CD    . ARG A 1 1146 ? -47.251 -53.488  0.488   1.00 19.64 ? 1147 ARG A CD    1 
ATOM   8735  N  NE    . ARG A 1 1146 ? -46.375 -53.222  1.643   1.00 21.86 ? 1147 ARG A NE    1 
ATOM   8736  C  CZ    . ARG A 1 1146 ? -46.382 -53.900  2.797   1.00 21.88 ? 1147 ARG A CZ    1 
ATOM   8737  N  NH1   . ARG A 1 1146 ? -47.229 -54.911  3.002   1.00 22.06 ? 1147 ARG A NH1   1 
ATOM   8738  N  NH2   . ARG A 1 1146 ? -45.487 -53.598  3.731   1.00 22.13 ? 1147 ARG A NH2   1 
ATOM   8739  N  N     . LEU A 1 1147 ? -43.360 -57.015  -0.020  1.00 13.38 ? 1148 LEU A N     1 
ATOM   8740  C  CA    . LEU A 1 1147 ? -42.022 -57.098  0.518   1.00 12.45 ? 1148 LEU A CA    1 
ATOM   8741  C  C     . LEU A 1 1147 ? -40.997 -57.751  -0.407  1.00 13.27 ? 1148 LEU A C     1 
ATOM   8742  O  O     . LEU A 1 1147 ? -39.841 -57.316  -0.466  1.00 13.91 ? 1148 LEU A O     1 
ATOM   8743  C  CB    . LEU A 1 1147 ? -42.068 -57.764  1.892   1.00 10.68 ? 1148 LEU A CB    1 
ATOM   8744  C  CG    . LEU A 1 1147 ? -42.754 -56.962  3.004   1.00 9.32  ? 1148 LEU A CG    1 
ATOM   8745  C  CD1   . LEU A 1 1147 ? -43.121 -57.873  4.117   1.00 8.15  ? 1148 LEU A CD1   1 
ATOM   8746  C  CD2   . LEU A 1 1147 ? -41.874 -55.836  3.515   1.00 8.99  ? 1148 LEU A CD2   1 
ATOM   8747  N  N     . ARG A 1 1148 ? -41.393 -58.763  -1.167  1.00 13.52 ? 1149 ARG A N     1 
ATOM   8748  C  CA    . ARG A 1 1148 ? -40.436 -59.396  -2.079  1.00 13.65 ? 1149 ARG A CA    1 
ATOM   8749  C  C     . ARG A 1 1148 ? -40.072 -58.409  -3.189  1.00 14.23 ? 1149 ARG A C     1 
ATOM   8750  O  O     . ARG A 1 1148 ? -39.084 -58.588  -3.901  1.00 14.61 ? 1149 ARG A O     1 
ATOM   8751  C  CB    . ARG A 1 1148 ? -41.005 -60.702  -2.646  1.00 13.26 ? 1149 ARG A CB    1 
ATOM   8752  C  CG    . ARG A 1 1148 ? -41.426 -61.666  -1.556  1.00 12.22 ? 1149 ARG A CG    1 
ATOM   8753  C  CD    . ARG A 1 1148 ? -41.315 -63.109  -1.966  1.00 11.50 ? 1149 ARG A CD    1 
ATOM   8754  N  NE    . ARG A 1 1148 ? -42.283 -63.588  -2.958  1.00 11.41 ? 1149 ARG A NE    1 
ATOM   8755  C  CZ    . ARG A 1 1148 ? -43.522 -63.130  -3.160  1.00 11.87 ? 1149 ARG A CZ    1 
ATOM   8756  N  NH1   . ARG A 1 1148 ? -44.032 -62.118  -2.466  1.00 12.02 ? 1149 ARG A NH1   1 
ATOM   8757  N  NH2   . ARG A 1 1148 ? -44.314 -63.785  -3.993  1.00 11.54 ? 1149 ARG A NH2   1 
ATOM   8758  N  N     . ALA A 1 1149 ? -40.897 -57.374  -3.320  1.00 14.70 ? 1150 ALA A N     1 
ATOM   8759  C  CA    . ALA A 1 1149 ? -40.675 -56.321  -4.290  1.00 15.45 ? 1150 ALA A CA    1 
ATOM   8760  C  C     . ALA A 1 1149 ? -39.717 -55.350  -3.646  1.00 15.76 ? 1150 ALA A C     1 
ATOM   8761  O  O     . ALA A 1 1149 ? -38.913 -54.741  -4.320  1.00 15.60 ? 1150 ALA A O     1 
ATOM   8762  C  CB    . ALA A 1 1149 ? -41.963 -55.628  -4.608  1.00 15.76 ? 1150 ALA A CB    1 
ATOM   8763  N  N     . GLN A 1 1150 ? -39.853 -55.182  -2.331  1.00 16.83 ? 1151 GLN A N     1 
ATOM   8764  C  CA    . GLN A 1 1150 ? -38.977 -54.301  -1.557  1.00 17.41 ? 1151 GLN A CA    1 
ATOM   8765  C  C     . GLN A 1 1150 ? -37.576 -54.870  -1.695  1.00 17.00 ? 1151 GLN A C     1 
ATOM   8766  O  O     . GLN A 1 1150 ? -36.659 -54.168  -2.137  1.00 17.18 ? 1151 GLN A O     1 
ATOM   8767  C  CB    . GLN A 1 1150 ? -39.359 -54.268  -0.064  1.00 18.60 ? 1151 GLN A CB    1 
ATOM   8768  C  CG    . GLN A 1 1150 ? -40.225 -53.082  0.398   1.00 20.72 ? 1151 GLN A CG    1 
ATOM   8769  C  CD    . GLN A 1 1150 ? -40.010 -52.733  1.893   1.00 22.74 ? 1151 GLN A CD    1 
ATOM   8770  O  OE1   . GLN A 1 1150 ? -40.873 -52.993  2.757   1.00 23.59 ? 1151 GLN A OE1   1 
ATOM   8771  N  NE2   . GLN A 1 1150 ? -38.845 -52.152  2.198   1.00 23.27 ? 1151 GLN A NE2   1 
ATOM   8772  N  N     . VAL A 1 1151 ? -37.440 -56.161  -1.381  1.00 16.20 ? 1152 VAL A N     1 
ATOM   8773  C  CA    . VAL A 1 1151 ? -36.154 -56.841  -1.465  1.00 15.40 ? 1152 VAL A CA    1 
ATOM   8774  C  C     . VAL A 1 1151 ? -35.628 -56.823  -2.899  1.00 15.16 ? 1152 VAL A C     1 
ATOM   8775  O  O     . VAL A 1 1151 ? -34.437 -56.669  -3.122  1.00 15.37 ? 1152 VAL A O     1 
ATOM   8776  C  CB    . VAL A 1 1151 ? -36.252 -58.279  -0.947  1.00 14.98 ? 1152 VAL A CB    1 
ATOM   8777  C  CG1   . VAL A 1 1151 ? -34.885 -58.881  -0.792  1.00 14.98 ? 1152 VAL A CG1   1 
ATOM   8778  C  CG2   . VAL A 1 1151 ? -36.942 -58.294  0.380   1.00 15.00 ? 1152 VAL A CG2   1 
ATOM   8779  N  N     . ALA A 1 1152 ? -36.518 -56.883  -3.879  1.00 15.10 ? 1153 ALA A N     1 
ATOM   8780  C  CA    . ALA A 1 1152 ? -36.069 -56.859  -5.271  1.00 15.28 ? 1153 ALA A CA    1 
ATOM   8781  C  C     . ALA A 1 1152 ? -35.633 -55.477  -5.679  1.00 15.09 ? 1153 ALA A C     1 
ATOM   8782  O  O     . ALA A 1 1152 ? -34.913 -55.321  -6.651  1.00 15.41 ? 1153 ALA A O     1 
ATOM   8783  C  CB    . ALA A 1 1152 ? -37.159 -57.348  -6.209  1.00 15.55 ? 1153 ALA A CB    1 
ATOM   8784  N  N     . HIS A 1 1153 ? -36.095 -54.477  -4.949  1.00 15.25 ? 1154 HIS A N     1 
ATOM   8785  C  CA    . HIS A 1 1153 ? -35.757 -53.095  -5.235  1.00 15.74 ? 1154 HIS A CA    1 
ATOM   8786  C  C     . HIS A 1 1153 ? -34.461 -52.750  -4.526  1.00 15.56 ? 1154 HIS A C     1 
ATOM   8787  O  O     . HIS A 1 1153 ? -33.582 -52.095  -5.076  1.00 15.54 ? 1154 HIS A O     1 
ATOM   8788  C  CB    . HIS A 1 1153 ? -36.888 -52.210  -4.741  1.00 17.10 ? 1154 HIS A CB    1 
ATOM   8789  C  CG    . HIS A 1 1153 ? -36.598 -50.744  -4.811  1.00 19.69 ? 1154 HIS A CG    1 
ATOM   8790  N  ND1   . HIS A 1 1153 ? -36.561 -49.941  -3.687  1.00 20.88 ? 1154 HIS A ND1   1 
ATOM   8791  C  CD2   . HIS A 1 1153 ? -36.341 -49.932  -5.866  1.00 20.41 ? 1154 HIS A CD2   1 
ATOM   8792  C  CE1   . HIS A 1 1153 ? -36.293 -48.698  -4.048  1.00 21.44 ? 1154 HIS A CE1   1 
ATOM   8793  N  NE2   . HIS A 1 1153 ? -36.156 -48.667  -5.363  1.00 21.23 ? 1154 HIS A NE2   1 
ATOM   8794  N  N     . GLU A 1 1154 ? -34.342 -53.247  -3.307  1.00 15.09 ? 1155 GLU A N     1 
ATOM   8795  C  CA    . GLU A 1 1154 ? -33.172 -53.016  -2.489  1.00 14.58 ? 1155 GLU A CA    1 
ATOM   8796  C  C     . GLU A 1 1154 ? -31.911 -53.557  -3.121  1.00 14.03 ? 1155 GLU A C     1 
ATOM   8797  O  O     . GLU A 1 1154 ? -30.935 -52.832  -3.264  1.00 13.83 ? 1155 GLU A O     1 
ATOM   8798  C  CB    . GLU A 1 1154 ? -33.389 -53.640  -1.116  1.00 14.90 ? 1155 GLU A CB    1 
ATOM   8799  C  CG    . GLU A 1 1154 ? -34.505 -52.944  -0.367  1.00 16.33 ? 1155 GLU A CG    1 
ATOM   8800  C  CD    . GLU A 1 1154 ? -34.950 -53.638  0.898   1.00 16.87 ? 1155 GLU A CD    1 
ATOM   8801  O  OE1   . GLU A 1 1154 ? -34.362 -54.687  1.273   1.00 17.33 ? 1155 GLU A OE1   1 
ATOM   8802  O  OE2   . GLU A 1 1154 ? -35.916 -53.120  1.515   1.00 16.97 ? 1155 GLU A OE2   1 
ATOM   8803  N  N     . LEU A 1 1155 ? -31.926 -54.829  -3.499  1.00 13.68 ? 1156 LEU A N     1 
ATOM   8804  C  CA    . LEU A 1 1155 ? -30.753 -55.421  -4.111  1.00 13.80 ? 1156 LEU A CA    1 
ATOM   8805  C  C     . LEU A 1 1155 ? -30.459 -54.700  -5.422  1.00 14.62 ? 1156 LEU A C     1 
ATOM   8806  O  O     . LEU A 1 1155 ? -29.311 -54.620  -5.875  1.00 14.80 ? 1156 LEU A O     1 
ATOM   8807  C  CB    . LEU A 1 1155 ? -30.950 -56.919  -4.303  1.00 12.62 ? 1156 LEU A CB    1 
ATOM   8808  C  CG    . LEU A 1 1155 ? -32.182 -57.372  -5.062  1.00 11.73 ? 1156 LEU A CG    1 
ATOM   8809  C  CD1   . LEU A 1 1155 ? -31.867 -57.416  -6.519  1.00 12.14 ? 1156 LEU A CD1   1 
ATOM   8810  C  CD2   . LEU A 1 1155 ? -32.564 -58.741  -4.617  1.00 11.30 ? 1156 LEU A CD2   1 
ATOM   8811  N  N     . ASP A 1 1156 ? -31.495 -54.129  -6.018  1.00 15.38 ? 1157 ASP A N     1 
ATOM   8812  C  CA    . ASP A 1 1156 ? -31.276 -53.394  -7.241  1.00 16.07 ? 1157 ASP A CA    1 
ATOM   8813  C  C     . ASP A 1 1156 ? -30.540 -52.087  -6.952  1.00 15.69 ? 1157 ASP A C     1 
ATOM   8814  O  O     . ASP A 1 1156 ? -29.730 -51.666  -7.765  1.00 15.93 ? 1157 ASP A O     1 
ATOM   8815  C  CB    . ASP A 1 1156 ? -32.583 -53.114  -7.987  1.00 17.22 ? 1157 ASP A CB    1 
ATOM   8816  C  CG    . ASP A 1 1156 ? -32.360 -52.311  -9.268  1.00 18.69 ? 1157 ASP A CG    1 
ATOM   8817  O  OD1   . ASP A 1 1156 ? -31.412 -52.631  -10.042 1.00 18.98 ? 1157 ASP A OD1   1 
ATOM   8818  O  OD2   . ASP A 1 1156 ? -33.118 -51.339  -9.489  1.00 19.66 ? 1157 ASP A OD2   1 
ATOM   8819  N  N     . VAL A 1 1157 ? -30.819 -51.454  -5.807  1.00 15.43 ? 1158 VAL A N     1 
ATOM   8820  C  CA    . VAL A 1 1157 ? -30.170 -50.180  -5.443  1.00 15.02 ? 1158 VAL A CA    1 
ATOM   8821  C  C     . VAL A 1 1157 ? -28.762 -50.402  -4.964  1.00 15.02 ? 1158 VAL A C     1 
ATOM   8822  O  O     . VAL A 1 1157 ? -27.818 -49.768  -5.440  1.00 15.28 ? 1158 VAL A O     1 
ATOM   8823  C  CB    . VAL A 1 1157 ? -30.914 -49.409  -4.326  1.00 14.64 ? 1158 VAL A CB    1 
ATOM   8824  C  CG1   . VAL A 1 1157 ? -30.193 -48.094  -4.014  1.00 14.45 ? 1158 VAL A CG1   1 
ATOM   8825  C  CG2   . VAL A 1 1157 ? -32.351 -49.121  -4.744  1.00 15.02 ? 1158 VAL A CG2   1 
ATOM   8826  N  N     . ARG A 1 1158 ? -28.625 -51.297  -3.999  1.00 15.15 ? 1159 ARG A N     1 
ATOM   8827  C  CA    . ARG A 1 1158 ? -27.328 -51.601  -3.452  1.00 14.89 ? 1159 ARG A CA    1 
ATOM   8828  C  C     . ARG A 1 1158 ? -26.392 -51.990  -4.565  1.00 14.71 ? 1159 ARG A C     1 
ATOM   8829  O  O     . ARG A 1 1158 ? -25.268 -51.541  -4.571  1.00 15.48 ? 1159 ARG A O     1 
ATOM   8830  C  CB    . ARG A 1 1158 ? -27.422 -52.725  -2.439  1.00 15.62 ? 1159 ARG A CB    1 
ATOM   8831  C  CG    . ARG A 1 1158 ? -26.201 -52.835  -1.542  1.00 16.74 ? 1159 ARG A CG    1 
ATOM   8832  C  CD    . ARG A 1 1158 ? -26.193 -54.157  -0.760  1.00 16.85 ? 1159 ARG A CD    1 
ATOM   8833  N  NE    . ARG A 1 1158 ? -25.039 -54.230  0.124   1.00 17.32 ? 1159 ARG A NE    1 
ATOM   8834  C  CZ    . ARG A 1 1158 ? -24.296 -55.321  0.328   1.00 18.74 ? 1159 ARG A CZ    1 
ATOM   8835  N  NH1   . ARG A 1 1158 ? -24.583 -56.480  -0.284  1.00 17.94 ? 1159 ARG A NH1   1 
ATOM   8836  N  NH2   . ARG A 1 1158 ? -23.232 -55.237  1.138   1.00 18.78 ? 1159 ARG A NH2   1 
ATOM   8837  N  N     . PHE A 1 1159 ? -26.837 -52.777  -5.538  1.00 14.30 ? 1160 PHE A N     1 
ATOM   8838  C  CA    . PHE A 1 1159 ? -25.918 -53.138  -6.609  1.00 14.40 ? 1160 PHE A CA    1 
ATOM   8839  C  C     . PHE A 1 1159 ? -25.616 -51.985  -7.547  1.00 15.01 ? 1160 PHE A C     1 
ATOM   8840  O  O     . PHE A 1 1159 ? -24.619 -52.007  -8.247  1.00 15.34 ? 1160 PHE A O     1 
ATOM   8841  C  CB    . PHE A 1 1159 ? -26.407 -54.317  -7.427  1.00 13.98 ? 1160 PHE A CB    1 
ATOM   8842  C  CG    . PHE A 1 1159 ? -25.347 -54.904  -8.331  1.00 12.86 ? 1160 PHE A CG    1 
ATOM   8843  C  CD1   . PHE A 1 1159 ? -24.998 -54.276  -9.532  1.00 12.68 ? 1160 PHE A CD1   1 
ATOM   8844  C  CD2   . PHE A 1 1159 ? -24.711 -56.089  -7.985  1.00 12.61 ? 1160 PHE A CD2   1 
ATOM   8845  C  CE1   . PHE A 1 1159 ? -24.036 -54.817  -10.368 1.00 12.13 ? 1160 PHE A CE1   1 
ATOM   8846  C  CE2   . PHE A 1 1159 ? -23.748 -56.644  -8.813  1.00 12.79 ? 1160 PHE A CE2   1 
ATOM   8847  C  CZ    . PHE A 1 1159 ? -23.407 -56.009  -10.009 1.00 12.72 ? 1160 PHE A CZ    1 
ATOM   8848  N  N     . LYS A 1 1160 ? -26.481 -50.988  -7.618  1.00 15.75 ? 1161 LYS A N     1 
ATOM   8849  C  CA    . LYS A 1 1160 ? -26.176 -49.886  -8.499  1.00 16.46 ? 1161 LYS A CA    1 
ATOM   8850  C  C     . LYS A 1 1160 ? -25.196 -48.983  -7.797  1.00 17.02 ? 1161 LYS A C     1 
ATOM   8851  O  O     . LYS A 1 1160 ? -24.391 -48.321  -8.455  1.00 17.80 ? 1161 LYS A O     1 
ATOM   8852  C  CB    . LYS A 1 1160 ? -27.437 -49.172  -8.985  1.00 16.67 ? 1161 LYS A CB    1 
ATOM   8853  C  CG    . LYS A 1 1160 ? -27.856 -49.717  -10.368 1.00 18.24 ? 1161 LYS A CG    1 
ATOM   8854  C  CD    . LYS A 1 1160 ? -29.362 -49.616  -10.687 1.00 18.37 ? 1161 LYS A CD    1 
ATOM   8855  C  CE    . LYS A 1 1160 ? -29.618 -48.782  -11.959 1.00 18.25 ? 1161 LYS A CE    1 
ATOM   8856  N  NZ    . LYS A 1 1160 ? -30.724 -49.336  -12.812 1.00 18.61 ? 1161 LYS A NZ    1 
ATOM   8857  N  N     . GLU A 1 1161 ? -25.191 -49.045  -6.462  1.00 17.35 ? 1162 GLU A N     1 
ATOM   8858  C  CA    . GLU A 1 1161 ? -24.274 -48.249  -5.645  1.00 17.75 ? 1162 GLU A CA    1 
ATOM   8859  C  C     . GLU A 1 1161 ? -22.950 -48.993  -5.571  1.00 17.74 ? 1162 GLU A C     1 
ATOM   8860  O  O     . GLU A 1 1161 ? -21.892 -48.389  -5.400  1.00 17.80 ? 1162 GLU A O     1 
ATOM   8861  C  CB    . GLU A 1 1161 ? -24.835 -48.029  -4.240  1.00 18.52 ? 1162 GLU A CB    1 
ATOM   8862  C  CG    . GLU A 1 1161 ? -26.106 -47.203  -4.219  1.00 20.66 ? 1162 GLU A CG    1 
ATOM   8863  C  CD    . GLU A 1 1161 ? -26.731 -47.083  -2.830  1.00 22.65 ? 1162 GLU A CD    1 
ATOM   8864  O  OE1   . GLU A 1 1161 ? -27.026 -48.137  -2.204  1.00 23.43 ? 1162 GLU A OE1   1 
ATOM   8865  O  OE2   . GLU A 1 1161 ? -26.941 -45.933  -2.362  1.00 23.46 ? 1162 GLU A OE2   1 
ATOM   8866  N  N     . LEU A 1 1162 ? -23.014 -50.316  -5.695  1.00 17.57 ? 1163 LEU A N     1 
ATOM   8867  C  CA    . LEU A 1 1162 ? -21.810 -51.118  -5.673  1.00 17.65 ? 1163 LEU A CA    1 
ATOM   8868  C  C     . LEU A 1 1162 ? -21.082 -50.869  -6.987  1.00 18.06 ? 1163 LEU A C     1 
ATOM   8869  O  O     . LEU A 1 1162 ? -19.864 -50.994  -7.069  1.00 18.35 ? 1163 LEU A O     1 
ATOM   8870  C  CB    . LEU A 1 1162 ? -22.138 -52.599  -5.517  1.00 16.82 ? 1163 LEU A CB    1 
ATOM   8871  C  CG    . LEU A 1 1162 ? -22.649 -53.074  -4.161  1.00 16.68 ? 1163 LEU A CG    1 
ATOM   8872  C  CD1   . LEU A 1 1162 ? -22.252 -54.541  -4.022  1.00 16.64 ? 1163 LEU A CD1   1 
ATOM   8873  C  CD2   . LEU A 1 1162 ? -22.074 -52.232  -2.999  1.00 15.95 ? 1163 LEU A CD2   1 
ATOM   8874  N  N     . GLU A 1 1163 ? -21.835 -50.457  -8.000  1.00 18.56 ? 1164 GLU A N     1 
ATOM   8875  C  CA    . GLU A 1 1163 ? -21.253 -50.188  -9.296  1.00 19.40 ? 1164 GLU A CA    1 
ATOM   8876  C  C     . GLU A 1 1163 ? -20.390 -48.943  -9.342  1.00 20.04 ? 1164 GLU A C     1 
ATOM   8877  O  O     . GLU A 1 1163 ? -19.269 -49.036  -9.820  1.00 20.38 ? 1164 GLU A O     1 
ATOM   8878  C  CB    . GLU A 1 1163 ? -22.308 -50.197  -10.389 1.00 19.22 ? 1164 GLU A CB    1 
ATOM   8879  C  CG    . GLU A 1 1163 ? -22.845 -51.584  -10.607 1.00 19.73 ? 1164 GLU A CG    1 
ATOM   8880  C  CD    . GLU A 1 1163 ? -23.763 -51.691  -11.788 1.00 20.44 ? 1164 GLU A CD    1 
ATOM   8881  O  OE1   . GLU A 1 1163 ? -24.968 -51.382  -11.645 1.00 21.66 ? 1164 GLU A OE1   1 
ATOM   8882  O  OE2   . GLU A 1 1163 ? -23.286 -52.113  -12.865 1.00 21.13 ? 1164 GLU A OE2   1 
ATOM   8883  N  N     . HIS A 1 1164 ? -20.875 -47.784  -8.884  1.00 20.94 ? 1165 HIS A N     1 
ATOM   8884  C  CA    . HIS A 1 1164 ? -20.001 -46.608  -8.901  1.00 21.88 ? 1165 HIS A CA    1 
ATOM   8885  C  C     . HIS A 1 1164 ? -19.358 -46.414  -7.554  0.00 22.08 ? 1165 HIS A C     1 
ATOM   8886  O  O     . HIS A 1 1164 ? -19.777 -45.606  -6.740  1.00 22.95 ? 1165 HIS A O     1 
ATOM   8887  C  CB    . HIS A 1 1164 ? -20.665 -45.312  -9.375  0.00 23.27 ? 1165 HIS A CB    1 
ATOM   8888  C  CG    . HIS A 1 1164 ? -19.685 -44.188  -9.573  0.00 24.82 ? 1165 HIS A CG    1 
ATOM   8889  N  ND1   . HIS A 1 1164 ? -18.911 -44.064  -10.705 0.00 25.46 ? 1165 HIS A ND1   1 
ATOM   8890  C  CD2   . HIS A 1 1164 ? -19.304 -43.183  -8.746  0.00 25.25 ? 1165 HIS A CD2   1 
ATOM   8891  C  CE1   . HIS A 1 1164 ? -18.094 -43.038  -10.572 0.00 25.48 ? 1165 HIS A CE1   1 
ATOM   8892  N  NE2   . HIS A 1 1164 ? -18.308 -42.484  -9.393  0.00 25.44 ? 1165 HIS A NE2   1 
ATOM   8893  N  N     . MET A 1 1165 ? -18.353 -47.243  -7.351  1.00 21.87 ? 1166 MET A N     1 
ATOM   8894  C  CA    . MET A 1 1165 ? -17.514 -47.318  -6.166  1.00 21.54 ? 1166 MET A CA    1 
ATOM   8895  C  C     . MET A 1 1165 ? -16.373 -48.017  -6.874  1.00 21.24 ? 1166 MET A C     1 
ATOM   8896  O  O     . MET A 1 1165 ? -15.219 -47.630  -6.777  1.00 21.08 ? 1166 MET A O     1 
ATOM   8897  C  CB    . MET A 1 1165 ? -18.130 -48.245  -5.111  1.00 21.75 ? 1166 MET A CB    1 
ATOM   8898  C  CG    . MET A 1 1165 ? -18.185 -47.645  -3.713  1.00 21.88 ? 1166 MET A CG    1 
ATOM   8899  S  SD    . MET A 1 1165 ? -18.627 -48.813  -2.374  1.00 22.40 ? 1166 MET A SD    1 
ATOM   8900  C  CE    . MET A 1 1165 ? -17.124 -48.795  -1.350  1.00 21.99 ? 1166 MET A CE    1 
ATOM   8901  N  N     . ALA A 1 1166 ? -16.742 -49.018  -7.660  1.00 21.03 ? 1167 ALA A N     1 
ATOM   8902  C  CA    . ALA A 1 1166 ? -15.799 -49.734  -8.472  1.00 21.36 ? 1167 ALA A CA    1 
ATOM   8903  C  C     . ALA A 1 1166 ? -15.192 -48.696  -9.417  1.00 21.69 ? 1167 ALA A C     1 
ATOM   8904  O  O     . ALA A 1 1166 ? -13.980 -48.679  -9.672  1.00 22.02 ? 1167 ALA A O     1 
ATOM   8905  C  CB    . ALA A 1 1166 ? -16.524 -50.779  -9.263  1.00 21.41 ? 1167 ALA A CB    1 
ATOM   8906  N  N     . ALA A 1 1167 ? -16.034 -47.786  -9.880  1.00 22.00 ? 1168 ALA A N     1 
ATOM   8907  C  CA    . ALA A 1 1167 ? -15.582 -46.756  -10.799 1.00 23.13 ? 1168 ALA A CA    1 
ATOM   8908  C  C     . ALA A 1 1167 ? -15.181 -45.414  -10.189 1.00 24.02 ? 1168 ALA A C     1 
ATOM   8909  O  O     . ALA A 1 1167 ? -14.836 -44.486  -10.930 1.00 24.58 ? 1168 ALA A O     1 
ATOM   8910  C  CB    . ALA A 1 1167 ? -16.602 -46.544  -11.881 1.00 22.95 ? 1168 ALA A CB    1 
ATOM   8911  N  N     . THR A 1 1168 ? -15.196 -45.293  -8.860  1.00 24.71 ? 1169 THR A N     1 
ATOM   8912  C  CA    . THR A 1 1168 ? -14.805 -44.022  -8.241  1.00 24.66 ? 1169 THR A CA    1 
ATOM   8913  C  C     . THR A 1 1168 ? -13.313 -43.684  -8.203  1.00 25.16 ? 1169 THR A C     1 
ATOM   8914  O  O     . THR A 1 1168 ? -12.466 -44.462  -7.765  1.00 24.83 ? 1169 THR A O     1 
ATOM   8915  C  CB    . THR A 1 1168 ? -15.381 -43.827  -6.833  1.00 24.16 ? 1169 THR A CB    1 
ATOM   8916  O  OG1   . THR A 1 1168 ? -14.969 -42.545  -6.353  1.00 24.34 ? 1169 THR A OG1   1 
ATOM   8917  C  CG2   . THR A 1 1168 ? -14.878 -44.885  -5.864  1.00 23.74 ? 1169 THR A CG2   1 
ATOM   8918  N  N     . ASN A 1 1169 ? -13.031 -42.464  -8.630  1.00 26.11 ? 1170 ASN A N     1 
ATOM   8919  C  CA    . ASN A 1 1169 ? -11.683 -41.914  -8.652  1.00 27.36 ? 1170 ASN A CA    1 
ATOM   8920  C  C     . ASN A 1 1169 ? -11.373 -41.459  -7.228  1.00 27.52 ? 1170 ASN A C     1 
ATOM   8921  O  O     . ASN A 1 1169 ? -10.216 -41.493  -6.801  1.00 27.71 ? 1170 ASN A O     1 
ATOM   8922  C  CB    . ASN A 1 1169 ? -11.631 -40.730  -9.609  1.00 28.38 ? 1170 ASN A CB    1 
ATOM   8923  C  CG    . ASN A 1 1169 ? -12.882 -40.635  -10.467 1.00 29.85 ? 1170 ASN A CG    1 
ATOM   8924  O  OD1   . ASN A 1 1169 ? -13.865 -39.982  -10.071 1.00 30.89 ? 1170 ASN A OD1   1 
ATOM   8925  N  ND2   . ASN A 1 1169 ? -12.893 -41.349  -11.605 1.00 30.12 ? 1170 ASN A ND2   1 
ATOM   8926  N  N     . ILE A 1 1170 ? -12.406 -41.009  -6.510  1.00 27.49 ? 1171 ILE A N     1 
ATOM   8927  C  CA    . ILE A 1 1170 ? -12.262 -40.598  -5.112  1.00 27.61 ? 1171 ILE A CA    1 
ATOM   8928  C  C     . ILE A 1 1170 ? -12.139 -41.900  -4.324  1.00 28.04 ? 1171 ILE A C     1 
ATOM   8929  O  O     . ILE A 1 1170 ? -12.733 -42.903  -4.722  1.00 28.54 ? 1171 ILE A O     1 
ATOM   8930  C  CB    . ILE A 1 1170 ? -13.538 -39.920  -4.543  1.00 27.30 ? 1171 ILE A CB    1 
ATOM   8931  C  CG1   . ILE A 1 1170 ? -14.134 -38.911  -5.520  1.00 27.30 ? 1171 ILE A CG1   1 
ATOM   8932  C  CG2   . ILE A 1 1170 ? -13.208 -39.253  -3.223  1.00 27.34 ? 1171 ILE A CG2   1 
ATOM   8933  C  CD1   . ILE A 1 1170 ? -15.539 -39.284  -5.989  1.00 26.77 ? 1171 ILE A CD1   1 
ATOM   8934  N  N     . PHE A 1 1171 ? -11.348 -41.894  -3.248  1.00 28.34 ? 1172 PHE A N     1 
ATOM   8935  C  CA    . PHE A 1 1171 ? -11.161 -43.051  -2.358  1.00 28.56 ? 1172 PHE A CA    1 
ATOM   8936  C  C     . PHE A 1 1171 ? -10.141 -42.895  -1.225  1.00 29.64 ? 1172 PHE A C     1 
ATOM   8937  O  O     . PHE A 1 1171 ? -9.199  -42.083  -1.281  1.00 29.40 ? 1172 PHE A O     1 
ATOM   8938  C  CB    . PHE A 1 1171 ? -10.979 -44.392  -3.091  1.00 27.10 ? 1172 PHE A CB    1 
ATOM   8939  C  CG    . PHE A 1 1171 ? -9.854  -44.419  -4.074  1.00 25.90 ? 1172 PHE A CG    1 
ATOM   8940  C  CD1   . PHE A 1 1171 ? -8.541  -44.525  -3.640  1.00 25.36 ? 1172 PHE A CD1   1 
ATOM   8941  C  CD2   . PHE A 1 1171 ? -10.116 -44.409  -5.439  1.00 25.41 ? 1172 PHE A CD2   1 
ATOM   8942  C  CE1   . PHE A 1 1171 ? -7.504  -44.629  -4.552  1.00 25.27 ? 1172 PHE A CE1   1 
ATOM   8943  C  CE2   . PHE A 1 1171 ? -9.094  -44.510  -6.356  1.00 25.29 ? 1172 PHE A CE2   1 
ATOM   8944  C  CZ    . PHE A 1 1171 ? -7.780  -44.623  -5.916  1.00 25.22 ? 1172 PHE A CZ    1 
ATOM   8945  N  N     . GLU A 1 1172 ? -10.335 -43.741  -0.218  1.00 30.97 ? 1173 GLU A N     1 
ATOM   8946  C  CA    . GLU A 1 1172 ? -9.551  -43.721  1.014   1.00 31.72 ? 1173 GLU A CA    1 
ATOM   8947  C  C     . GLU A 1 1172 ? -8.231  -44.504  1.006   1.00 32.15 ? 1173 GLU A C     1 
ATOM   8948  O  O     . GLU A 1 1172 ? -8.198  -45.744  1.097   1.00 31.56 ? 1173 GLU A O     1 
ATOM   8949  C  CB    . GLU A 1 1172 ? -10.476 -44.097  2.200   1.00 31.73 ? 1173 GLU A CB    1 
ATOM   8950  C  CG    . GLU A 1 1172 ? -12.000 -43.854  1.911   1.00 31.04 ? 1173 GLU A CG    1 
ATOM   8951  C  CD    . GLU A 1 1172 ? -12.791 -43.286  3.093   1.00 30.83 ? 1173 GLU A CD    1 
ATOM   8952  O  OE1   . GLU A 1 1172 ? -13.131 -44.054  4.027   1.00 30.41 ? 1173 GLU A OE1   1 
ATOM   8953  O  OE2   . GLU A 1 1172 ? -13.102 -42.069  3.067   1.00 30.63 ? 1173 GLU A OE2   1 
ATOM   8954  N  N     . SER A 1 1173 ? -7.159  -43.710  0.950   1.00 33.09 ? 1174 SER A N     1 
ATOM   8955  C  CA    . SER A 1 1173 ? -5.750  -44.134  0.906   1.00 34.29 ? 1174 SER A CA    1 
ATOM   8956  C  C     . SER A 1 1173 ? -5.315  -45.139  2.000   1.00 35.37 ? 1174 SER A C     1 
ATOM   8957  O  O     . SER A 1 1173 ? -6.135  -45.526  2.846   1.00 36.33 ? 1174 SER A O     1 
ATOM   8958  C  CB    . SER A 1 1173 ? -4.880  -42.871  0.963   1.00 33.47 ? 1174 SER A CB    1 
ATOM   8959  O  OG    . SER A 1 1173 ? -3.594  -43.098  0.435   1.00 33.04 ? 1174 SER A OG    1 
ATOM   8960  N  N     . PHE A 1 1174 ? -4.058  -45.598  1.972   1.00 36.20 ? 1175 PHE A N     1 
ATOM   8961  C  CA    . PHE A 1 1174 ? -3.600  -46.537  3.009   1.00 37.45 ? 1175 PHE A CA    1 
ATOM   8962  C  C     . PHE A 1 1174 ? -2.116  -46.601  3.393   1.00 38.55 ? 1175 PHE A C     1 
ATOM   8963  O  O     . PHE A 1 1174 ? -1.222  -46.556  2.534   1.00 39.08 ? 1175 PHE A O     1 
ATOM   8964  C  CB    . PHE A 1 1174 ? -4.080  -47.967  2.737   1.00 37.05 ? 1175 PHE A CB    1 
ATOM   8965  C  CG    . PHE A 1 1174 ? -3.667  -48.954  3.809   1.00 36.81 ? 1175 PHE A CG    1 
ATOM   8966  C  CD1   . PHE A 1 1174 ? -4.173  -48.845  5.109   1.00 36.76 ? 1175 PHE A CD1   1 
ATOM   8967  C  CD2   . PHE A 1 1174 ? -2.782  -49.994  3.517   1.00 37.06 ? 1175 PHE A CD2   1 
ATOM   8968  C  CE1   . PHE A 1 1174 ? -3.807  -49.755  6.109   1.00 36.95 ? 1175 PHE A CE1   1 
ATOM   8969  C  CE2   . PHE A 1 1174 ? -2.407  -50.913  4.507   1.00 37.44 ? 1175 PHE A CE2   1 
ATOM   8970  C  CZ    . PHE A 1 1174 ? -2.927  -50.793  5.812   1.00 37.21 ? 1175 PHE A CZ    1 
ATOM   8971  N  N     . ALA A 1 1175 ? -1.906  -46.783  4.703   1.00 39.33 ? 1176 ALA A N     1 
ATOM   8972  C  CA    . ALA A 1 1175 ? -0.605  -46.923  5.363   1.00 39.70 ? 1176 ALA A CA    1 
ATOM   8973  C  C     . ALA A 1 1175 ? -0.818  -48.017  6.434   1.00 40.14 ? 1176 ALA A C     1 
ATOM   8974  O  O     . ALA A 1 1175 ? -1.748  -47.927  7.240   1.00 40.34 ? 1176 ALA A O     1 
ATOM   8975  C  CB    . ALA A 1 1175 ? -0.209  -45.594  6.016   1.00 39.51 ? 1176 ALA A CB    1 
ATOM   8976  N  N     . PRO A 1 1176 ? 0.024   -49.071  6.446   1.00 40.71 ? 1177 PRO A N     1 
ATOM   8977  C  CA    . PRO A 1 1176 ? -0.160  -50.135  7.452   1.00 41.29 ? 1177 PRO A CA    1 
ATOM   8978  C  C     . PRO A 1 1176 ? 0.009   -49.602  8.875   1.00 41.78 ? 1177 PRO A C     1 
ATOM   8979  O  O     . PRO A 1 1176 ? -0.704  -50.025  9.800   1.00 41.82 ? 1177 PRO A O     1 
ATOM   8980  C  CB    . PRO A 1 1176 ? 0.949   -51.148  7.104   1.00 41.39 ? 1177 PRO A CB    1 
ATOM   8981  C  CG    . PRO A 1 1176 ? 1.313   -50.830  5.647   1.00 41.27 ? 1177 PRO A CG    1 
ATOM   8982  C  CD    . PRO A 1 1176 ? 1.227   -49.316  5.631   1.00 41.15 ? 1177 PRO A CD    1 
ATOM   8983  N  N     . ALA A 1 1177 ? 0.923   -48.632  8.992   1.00 42.20 ? 1178 ALA A N     1 
ATOM   8984  C  CA    . ALA A 1 1177 ? 1.331   -47.926  10.223  1.00 42.45 ? 1178 ALA A CA    1 
ATOM   8985  C  C     . ALA A 1 1177 ? 2.845   -47.686  10.072  1.00 42.50 ? 1178 ALA A C     1 
ATOM   8986  O  O     . ALA A 1 1177 ? 3.468   -48.255  9.160   1.00 42.47 ? 1178 ALA A O     1 
ATOM   8987  C  CB    . ALA A 1 1177 ? 1.042   -48.761  11.498  1.00 42.21 ? 1178 ALA A CB    1 
ATOM   8988  N  N     . GLY A 1 1178 ? 3.420   -46.829  10.923  1.00 42.53 ? 1179 GLY A N     1 
ATOM   8989  C  CA    . GLY A 1 1178 ? 4.854   -46.559  10.847  1.00 42.64 ? 1179 GLY A CA    1 
ATOM   8990  C  C     . GLY A 1 1178 ? 5.315   -45.192  11.337  1.00 42.87 ? 1179 GLY A C     1 
ATOM   8991  O  O     . GLY A 1 1178 ? 5.418   -44.235  10.558  1.00 42.82 ? 1179 GLY A O     1 
ATOM   8992  N  N     . GLY A 1 1179 ? 5.631   -45.099  12.623  1.00 42.95 ? 1180 GLY A N     1 
ATOM   8993  C  CA    . GLY A 1 1179 ? 6.087   -43.832  13.163  1.00 43.32 ? 1180 GLY A CA    1 
ATOM   8994  C  C     . GLY A 1 1179 ? 6.369   -43.854  14.654  1.00 43.58 ? 1180 GLY A C     1 
ATOM   8995  O  O     . GLY A 1 1179 ? 7.347   -44.466  15.096  1.00 43.80 ? 1180 GLY A O     1 
ATOM   8996  N  N     . LYS A 1 1180 ? 5.456   -43.244  15.419  1.00 43.57 ? 1181 LYS A N     1 
ATOM   8997  C  CA    . LYS A 1 1180 ? 5.530   -43.113  16.884  1.00 43.30 ? 1181 LYS A CA    1 
ATOM   8998  C  C     . LYS A 1 1180 ? 6.924   -42.937  17.454  1.00 42.77 ? 1181 LYS A C     1 
ATOM   8999  O  O     . LYS A 1 1180 ? 7.441   -41.811  17.484  1.00 42.96 ? 1181 LYS A O     1 
ATOM   9000  C  CB    . LYS A 1 1180 ? 4.769   -44.220  17.655  1.00 43.48 ? 1181 LYS A CB    1 
ATOM   9001  C  CG    . LYS A 1 1180 ? 4.180   -45.347  16.828  1.00 44.46 ? 1181 LYS A CG    1 
ATOM   9002  C  CD    . LYS A 1 1180 ? 5.236   -46.358  16.364  1.00 45.11 ? 1181 LYS A CD    1 
ATOM   9003  C  CE    . LYS A 1 1180 ? 4.722   -47.148  15.158  1.00 45.55 ? 1181 LYS A CE    1 
ATOM   9004  N  NZ    . LYS A 1 1180 ? 5.721   -48.084  14.560  1.00 46.26 ? 1181 LYS A NZ    1 
ATOM   9005  N  N     . ALA A 1 1181 ? 7.538   -44.051  17.858  1.00 42.01 ? 1182 ALA A N     1 
ATOM   9006  C  CA    . ALA A 1 1181 ? 8.868   -44.044  18.469  1.00 41.38 ? 1182 ALA A CA    1 
ATOM   9007  C  C     . ALA A 1 1181 ? 8.779   -43.382  19.851  1.00 40.63 ? 1182 ALA A C     1 
ATOM   9008  O  O     . ALA A 1 1181 ? 8.056   -42.388  20.052  1.00 40.38 ? 1182 ALA A O     1 
ATOM   9009  C  CB    . ALA A 1 1181 ? 9.909   -43.335  17.576  1.00 41.43 ? 1182 ALA A CB    1 
ATOM   9010  N  N     . ASP A 1 1182 ? 9.543   -43.941  20.786  1.00 39.53 ? 1183 ASP A N     1 
ATOM   9011  C  CA    . ASP A 1 1182 ? 9.554   -43.500  22.172  1.00 38.08 ? 1183 ASP A CA    1 
ATOM   9012  C  C     . ASP A 1 1182 ? 9.320   -42.021  22.409  1.00 36.45 ? 1183 ASP A C     1 
ATOM   9013  O  O     . ASP A 1 1182 ? 10.040  -41.152  21.899  1.00 36.10 ? 1183 ASP A O     1 
ATOM   9014  C  CB    . ASP A 1 1182 ? 10.806  -44.020  22.869  1.00 39.06 ? 1183 ASP A CB    1 
ATOM   9015  C  CG    . ASP A 1 1182 ? 10.886  -45.544  22.830  1.00 40.19 ? 1183 ASP A CG    1 
ATOM   9016  O  OD1   . ASP A 1 1182 ? 11.010  -46.100  21.704  1.00 39.85 ? 1183 ASP A OD1   1 
ATOM   9017  O  OD2   . ASP A 1 1182 ? 10.788  -46.180  23.915  1.00 40.90 ? 1183 ASP A OD2   1 
ATOM   9018  N  N     . GLY A 1 1183 ? 8.214   -41.761  23.097  1.00 34.80 ? 1184 GLY A N     1 
ATOM   9019  C  CA    . GLY A 1 1183 ? 7.830   -40.401  23.406  1.00 32.88 ? 1184 GLY A CA    1 
ATOM   9020  C  C     . GLY A 1 1183 ? 6.377   -40.300  23.831  1.00 31.04 ? 1184 GLY A C     1 
ATOM   9021  O  O     . GLY A 1 1183 ? 5.474   -40.762  23.137  1.00 30.32 ? 1184 GLY A O     1 
ATOM   9022  N  N     . SER A 1 1184 ? 6.180   -39.649  24.972  1.00 29.42 ? 1185 SER A N     1 
ATOM   9023  C  CA    . SER A 1 1184 ? 4.881   -39.449  25.580  1.00 27.73 ? 1185 SER A CA    1 
ATOM   9024  C  C     . SER A 1 1184 ? 4.731   -37.956  25.848  1.00 27.07 ? 1185 SER A C     1 
ATOM   9025  O  O     . SER A 1 1184 ? 5.700   -37.263  26.189  1.00 27.73 ? 1185 SER A O     1 
ATOM   9026  C  CB    . SER A 1 1184 ? 4.814   -40.268  26.883  1.00 27.49 ? 1185 SER A CB    1 
ATOM   9027  O  OG    . SER A 1 1184 ? 4.244   -39.559  27.973  1.00 27.76 ? 1185 SER A OG    1 
ATOM   9028  N  N     . VAL A 1 1185 ? 3.511   -37.461  25.683  1.00 25.68 ? 1186 VAL A N     1 
ATOM   9029  C  CA    . VAL A 1 1185 ? 3.205   -36.055  25.882  1.00 23.80 ? 1186 VAL A CA    1 
ATOM   9030  C  C     . VAL A 1 1185 ? 1.713   -35.928  26.275  1.00 23.06 ? 1186 VAL A C     1 
ATOM   9031  O  O     . VAL A 1 1185 ? 0.826   -36.526  25.646  1.00 23.66 ? 1186 VAL A O     1 
ATOM   9032  C  CB    . VAL A 1 1185 ? 3.603   -35.242  24.597  1.00 23.14 ? 1186 VAL A CB    1 
ATOM   9033  C  CG1   . VAL A 1 1185 ? 3.204   -35.982  23.342  1.00 22.25 ? 1186 VAL A CG1   1 
ATOM   9034  C  CG2   . VAL A 1 1185 ? 2.986   -33.869  24.603  1.00 23.48 ? 1186 VAL A CG2   1 
ATOM   9035  N  N     . ASP A 1 1186 ? 1.445   -35.240  27.380  1.00 21.49 ? 1187 ASP A N     1 
ATOM   9036  C  CA    . ASP A 1 1186 ? 0.066   -35.074  27.844  1.00 20.38 ? 1187 ASP A CA    1 
ATOM   9037  C  C     . ASP A 1 1186 ? -0.580  -33.970  27.027  1.00 19.85 ? 1187 ASP A C     1 
ATOM   9038  O  O     . ASP A 1 1186 ? 0.099   -33.025  26.646  1.00 19.95 ? 1187 ASP A O     1 
ATOM   9039  C  CB    . ASP A 1 1186 ? 0.065   -34.701  29.333  1.00 19.78 ? 1187 ASP A CB    1 
ATOM   9040  C  CG    . ASP A 1 1186 ? -1.321  -34.650  29.926  1.00 19.13 ? 1187 ASP A CG    1 
ATOM   9041  O  OD1   . ASP A 1 1186 ? -1.917  -35.734  30.116  1.00 18.35 ? 1187 ASP A OD1   1 
ATOM   9042  O  OD2   . ASP A 1 1186 ? -1.800  -33.526  30.211  1.00 18.22 ? 1187 ASP A OD2   1 
ATOM   9043  N  N     . PHE A 1 1187 ? -1.878  -34.072  26.754  1.00 19.32 ? 1188 PHE A N     1 
ATOM   9044  C  CA    . PHE A 1 1187 ? -2.549  -33.026  25.980  1.00 18.91 ? 1188 PHE A CA    1 
ATOM   9045  C  C     . PHE A 1 1187 ? -2.479  -31.672  26.698  1.00 19.41 ? 1188 PHE A C     1 
ATOM   9046  O  O     . PHE A 1 1187 ? -2.747  -30.626  26.098  1.00 19.47 ? 1188 PHE A O     1 
ATOM   9047  C  CB    . PHE A 1 1187 ? -4.017  -33.399  25.666  1.00 17.69 ? 1188 PHE A CB    1 
ATOM   9048  C  CG    . PHE A 1 1187 ? -4.885  -33.624  26.891  1.00 16.88 ? 1188 PHE A CG    1 
ATOM   9049  C  CD1   . PHE A 1 1187 ? -5.568  -32.564  27.486  1.00 16.49 ? 1188 PHE A CD1   1 
ATOM   9050  C  CD2   . PHE A 1 1187 ? -5.023  -34.907  27.448  1.00 16.46 ? 1188 PHE A CD2   1 
ATOM   9051  C  CE1   . PHE A 1 1187 ? -6.373  -32.779  28.626  1.00 16.16 ? 1188 PHE A CE1   1 
ATOM   9052  C  CE2   . PHE A 1 1187 ? -5.819  -35.131  28.579  1.00 15.45 ? 1188 PHE A CE2   1 
ATOM   9053  C  CZ    . PHE A 1 1187 ? -6.494  -34.068  29.169  1.00 15.78 ? 1188 PHE A CZ    1 
ATOM   9054  N  N     . GLY A 1 1188 ? -2.063  -31.703  27.965  1.00 19.81 ? 1189 GLY A N     1 
ATOM   9055  C  CA    . GLY A 1 1188 ? -1.979  -30.496  28.769  1.00 20.88 ? 1189 GLY A CA    1 
ATOM   9056  C  C     . GLY A 1 1188 ? -0.709  -29.651  28.781  1.00 21.62 ? 1189 GLY A C     1 
ATOM   9057  O  O     . GLY A 1 1188 ? -0.704  -28.579  29.395  1.00 21.90 ? 1189 GLY A O     1 
ATOM   9058  N  N     . GLU A 1 1189 ? 0.357   -30.104  28.121  1.00 22.18 ? 1190 GLU A N     1 
ATOM   9059  C  CA    . GLU A 1 1189 ? 1.620   -29.360  28.079  1.00 22.17 ? 1190 GLU A CA    1 
ATOM   9060  C  C     . GLU A 1 1189 ? 1.568   -28.063  27.283  1.00 21.71 ? 1190 GLU A C     1 
ATOM   9061  O  O     . GLU A 1 1189 ? 0.951   -27.981  26.226  1.00 21.91 ? 1190 GLU A O     1 
ATOM   9062  C  CB    . GLU A 1 1189 ? 2.746   -30.218  27.487  1.00 23.20 ? 1190 GLU A CB    1 
ATOM   9063  C  CG    . GLU A 1 1189 ? 3.018   -31.569  28.185  1.00 24.86 ? 1190 GLU A CG    1 
ATOM   9064  C  CD    . GLU A 1 1189 ? 3.275   -31.452  29.680  1.00 25.74 ? 1190 GLU A CD    1 
ATOM   9065  O  OE1   . GLU A 1 1189 ? 3.699   -30.350  30.131  1.00 25.92 ? 1190 GLU A OE1   1 
ATOM   9066  O  OE2   . GLU A 1 1189 ? 3.048   -32.467  30.404  1.00 25.90 ? 1190 GLU A OE2   1 
ATOM   9067  N  N     . GLY A 1 1190 ? 2.250   -27.052  27.798  1.00 21.37 ? 1191 GLY A N     1 
ATOM   9068  C  CA    . GLY A 1 1190 ? 2.324   -25.770  27.125  1.00 21.06 ? 1191 GLY A CA    1 
ATOM   9069  C  C     . GLY A 1 1190 ? 1.028   -25.170  26.646  1.00 20.62 ? 1191 GLY A C     1 
ATOM   9070  O  O     . GLY A 1 1190 ? 1.014   -24.410  25.663  1.00 20.87 ? 1191 GLY A O     1 
ATOM   9071  N  N     . ALA A 1 1191 ? -0.063  -25.565  27.295  1.00 20.17 ? 1192 ALA A N     1 
ATOM   9072  C  CA    . ALA A 1 1191 ? -1.378  -25.038  26.971  1.00 19.50 ? 1192 ALA A CA    1 
ATOM   9073  C  C     . ALA A 1 1191 ? -1.448  -23.726  27.744  1.00 19.39 ? 1192 ALA A C     1 
ATOM   9074  O  O     . ALA A 1 1191 ? -0.823  -23.587  28.804  1.00 19.36 ? 1192 ALA A O     1 
ATOM   9075  C  CB    . ALA A 1 1191 ? -2.447  -25.990  27.433  1.00 19.46 ? 1192 ALA A CB    1 
ATOM   9076  N  N     . GLU A 1 1192 ? -2.239  -22.789  27.242  1.00 18.91 ? 1193 GLU A N     1 
ATOM   9077  C  CA    . GLU A 1 1192 ? -2.353  -21.471  27.850  1.00 19.04 ? 1193 GLU A CA    1 
ATOM   9078  C  C     . GLU A 1 1192 ? -3.437  -21.423  28.906  1.00 18.44 ? 1193 GLU A C     1 
ATOM   9079  O  O     . GLU A 1 1192 ? -3.228  -20.909  30.006  1.00 18.60 ? 1193 GLU A O     1 
ATOM   9080  C  CB    . GLU A 1 1192 ? -2.607  -20.406  26.776  1.00 20.22 ? 1193 GLU A CB    1 
ATOM   9081  C  CG    . GLU A 1 1192 ? -1.733  -20.555  25.537  1.00 21.94 ? 1193 GLU A CG    1 
ATOM   9082  C  CD    . GLU A 1 1192 ? -1.972  -21.897  24.847  1.00 23.84 ? 1193 GLU A CD    1 
ATOM   9083  O  OE1   . GLU A 1 1192 ? -3.153  -22.214  24.561  1.00 24.22 ? 1193 GLU A OE1   1 
ATOM   9084  O  OE2   . GLU A 1 1192 ? -1.001  -22.678  24.672  1.00 25.10 ? 1193 GLU A OE2   1 
ATOM   9085  N  N     . PHE A 1 1193 ? -4.613  -21.921  28.563  1.00 18.05 ? 1194 PHE A N     1 
ATOM   9086  C  CA    . PHE A 1 1193 ? -5.700  -21.952  29.524  1.00 17.69 ? 1194 PHE A CA    1 
ATOM   9087  C  C     . PHE A 1 1193 ? -5.745  -23.311  30.227  1.00 17.74 ? 1194 PHE A C     1 
ATOM   9088  O  O     . PHE A 1 1193 ? -4.979  -24.227  29.892  1.00 17.13 ? 1194 PHE A O     1 
ATOM   9089  C  CB    . PHE A 1 1193 ? -7.018  -21.639  28.839  1.00 17.28 ? 1194 PHE A CB    1 
ATOM   9090  C  CG    . PHE A 1 1193 ? -7.161  -20.196  28.451  1.00 17.21 ? 1194 PHE A CG    1 
ATOM   9091  C  CD1   . PHE A 1 1193 ? -6.690  -19.734  27.218  1.00 17.06 ? 1194 PHE A CD1   1 
ATOM   9092  C  CD2   . PHE A 1 1193 ? -7.801  -19.293  29.302  1.00 16.75 ? 1194 PHE A CD2   1 
ATOM   9093  C  CE1   . PHE A 1 1193 ? -6.862  -18.393  26.841  1.00 16.97 ? 1194 PHE A CE1   1 
ATOM   9094  C  CE2   . PHE A 1 1193 ? -7.972  -17.953  28.936  1.00 16.63 ? 1194 PHE A CE2   1 
ATOM   9095  C  CZ    . PHE A 1 1193 ? -7.506  -17.502  27.705  1.00 16.68 ? 1194 PHE A CZ    1 
ATOM   9096  N  N     . CYS A 1 1194 ? -6.576  -23.411  31.263  1.00 17.95 ? 1195 CYS A N     1 
ATOM   9097  C  CA    . CYS A 1 1194 ? -6.708  -24.660  31.989  1.00 17.76 ? 1195 CYS A CA    1 
ATOM   9098  C  C     . CYS A 1 1194 ? -7.242  -25.642  30.991  1.00 17.51 ? 1195 CYS A C     1 
ATOM   9099  O  O     . CYS A 1 1194 ? -7.988  -25.259  30.068  1.00 17.77 ? 1195 CYS A O     1 
ATOM   9100  C  CB    . CYS A 1 1194 ? -7.656  -24.548  33.173  1.00 18.02 ? 1195 CYS A CB    1 
ATOM   9101  S  SG    . CYS A 1 1194 ? -6.981  -23.616  34.590  1.00 20.05 ? 1195 CYS A SG    1 
ATOM   9102  N  N     . THR A 1 1195 ? -6.814  -26.893  31.165  1.00 17.16 ? 1196 THR A N     1 
ATOM   9103  C  CA    . THR A 1 1195 ? -7.167  -28.013  30.306  1.00 16.61 ? 1196 THR A CA    1 
ATOM   9104  C  C     . THR A 1 1195 ? -7.859  -29.134  31.119  1.00 16.89 ? 1196 THR A C     1 
ATOM   9105  O  O     . THR A 1 1195 ? -8.223  -30.196  30.609  1.00 17.48 ? 1196 THR A O     1 
ATOM   9106  C  CB    . THR A 1 1195 ? -5.890  -28.447  29.568  1.00 16.32 ? 1196 THR A CB    1 
ATOM   9107  O  OG1   . THR A 1 1195 ? -6.139  -28.433  28.169  1.00 16.63 ? 1196 THR A OG1   1 
ATOM   9108  C  CG2   . THR A 1 1195 ? -5.382  -29.794  30.007  1.00 16.76 ? 1196 THR A CG2   1 
ATOM   9109  N  N     . ARG A 1 1196 ? -8.129  -28.828  32.377  1.00 16.92 ? 1197 ARG A N     1 
ATOM   9110  C  CA    . ARG A 1 1196 ? -8.786  -29.740  33.278  1.00 16.90 ? 1197 ARG A CA    1 
ATOM   9111  C  C     . ARG A 1 1196 ? -9.683  -28.985  34.270  1.00 17.39 ? 1197 ARG A C     1 
ATOM   9112  O  O     . ARG A 1 1196 ? -9.558  -27.753  34.438  1.00 17.58 ? 1197 ARG A O     1 
ATOM   9113  C  CB    . ARG A 1 1196 ? -7.747  -30.579  33.983  1.00 16.46 ? 1197 ARG A CB    1 
ATOM   9114  C  CG    . ARG A 1 1196 ? -7.641  -31.945  33.372  1.00 16.50 ? 1197 ARG A CG    1 
ATOM   9115  C  CD    . ARG A 1 1196 ? -6.322  -32.226  32.720  1.00 16.45 ? 1197 ARG A CD    1 
ATOM   9116  N  NE    . ARG A 1 1196 ? -6.100  -33.668  32.771  1.00 17.82 ? 1197 ARG A NE    1 
ATOM   9117  C  CZ    . ARG A 1 1196 ? -5.098  -34.322  32.182  1.00 18.46 ? 1197 ARG A CZ    1 
ATOM   9118  N  NH1   . ARG A 1 1196 ? -4.178  -33.677  31.462  1.00 17.86 ? 1197 ARG A NH1   1 
ATOM   9119  N  NH2   . ARG A 1 1196 ? -5.010  -35.641  32.338  1.00 18.51 ? 1197 ARG A NH2   1 
ATOM   9120  N  N     . ASP A 1 1197 ? -10.625 -29.698  34.884  1.00 17.28 ? 1198 ASP A N     1 
ATOM   9121  C  CA    . ASP A 1 1197 ? -11.530 -29.047  35.809  1.00 17.54 ? 1198 ASP A CA    1 
ATOM   9122  C  C     . ASP A 1 1197 ? -11.321 -29.407  37.270  1.00 18.24 ? 1198 ASP A C     1 
ATOM   9123  O  O     . ASP A 1 1197 ? -10.506 -30.277  37.599  1.00 18.42 ? 1198 ASP A O     1 
ATOM   9124  C  CB    . ASP A 1 1197 ? -12.980 -29.265  35.386  1.00 17.57 ? 1198 ASP A CB    1 
ATOM   9125  C  CG    . ASP A 1 1197 ? -13.361 -30.732  35.284  1.00 18.26 ? 1198 ASP A CG    1 
ATOM   9126  O  OD1   . ASP A 1 1197 ? -12.811 -31.574  36.033  1.00 18.70 ? 1198 ASP A OD1   1 
ATOM   9127  O  OD2   . ASP A 1 1197 ? -14.241 -31.045  34.454  1.00 18.28 ? 1198 ASP A OD2   1 
ATOM   9128  N  N     . ASP A 1 1198 ? -12.072 -28.716  38.131  1.00 18.75 ? 1199 ASP A N     1 
ATOM   9129  C  CA    . ASP A 1 1198 ? -12.039 -28.882  39.589  1.00 19.07 ? 1199 ASP A CA    1 
ATOM   9130  C  C     . ASP A 1 1198 ? -12.710 -30.187  40.057  1.00 19.10 ? 1199 ASP A C     1 
ATOM   9131  O  O     . ASP A 1 1198 ? -12.778 -30.465  41.254  1.00 19.56 ? 1199 ASP A O     1 
ATOM   9132  C  CB    . ASP A 1 1198 ? -12.733 -27.686  40.256  1.00 19.50 ? 1199 ASP A CB    1 
ATOM   9133  C  CG    . ASP A 1 1198 ? -12.303 -26.349  39.662  1.00 20.34 ? 1199 ASP A CG    1 
ATOM   9134  O  OD1   . ASP A 1 1198 ? -11.389 -26.313  38.810  1.00 20.84 ? 1199 ASP A OD1   1 
ATOM   9135  O  OD2   . ASP A 1 1198 ? -12.878 -25.312  40.051  1.00 21.58 ? 1199 ASP A OD2   1 
ATOM   9136  N  N     . THR A 1 1199 ? -13.250 -30.940  39.105  1.00 18.54 ? 1200 THR A N     1 
ATOM   9137  C  CA    . THR A 1 1199 ? -13.911 -32.205  39.360  1.00 18.05 ? 1200 THR A CA    1 
ATOM   9138  C  C     . THR A 1 1199 ? -12.871 -33.238  39.826  1.00 17.55 ? 1200 THR A C     1 
ATOM   9139  O  O     . THR A 1 1199 ? -11.721 -33.195  39.389  1.00 17.51 ? 1200 THR A O     1 
ATOM   9140  C  CB    . THR A 1 1199 ? -14.640 -32.643  38.060  1.00 18.44 ? 1200 THR A CB    1 
ATOM   9141  O  OG1   . THR A 1 1199 ? -16.014 -32.246  38.129  1.00 19.04 ? 1200 THR A OG1   1 
ATOM   9142  C  CG2   . THR A 1 1199 ? -14.525 -34.117  37.799  1.00 18.20 ? 1200 THR A CG2   1 
ATOM   9143  N  N     . PRO A 1 1200 ? -13.252 -34.135  40.770  1.00 17.02 ? 1201 PRO A N     1 
ATOM   9144  C  CA    . PRO A 1 1200 ? -12.431 -35.204  41.361  1.00 16.51 ? 1201 PRO A CA    1 
ATOM   9145  C  C     . PRO A 1 1200 ? -12.122 -36.295  40.362  1.00 16.23 ? 1201 PRO A C     1 
ATOM   9146  O  O     . PRO A 1 1200 ? -11.339 -37.201  40.632  1.00 16.04 ? 1201 PRO A O     1 
ATOM   9147  C  CB    . PRO A 1 1200 ? -13.346 -35.773  42.446  1.00 16.23 ? 1201 PRO A CB    1 
ATOM   9148  C  CG    . PRO A 1 1200 ? -14.224 -34.676  42.778  1.00 16.59 ? 1201 PRO A CG    1 
ATOM   9149  C  CD    . PRO A 1 1200 ? -14.561 -34.106  41.433  1.00 16.95 ? 1201 PRO A CD    1 
ATOM   9150  N  N     . MET A 1 1201 ? -12.837 -36.254  39.246  1.00 16.23 ? 1202 MET A N     1 
ATOM   9151  C  CA    . MET A 1 1201 ? -12.682 -37.229  38.186  1.00 16.30 ? 1202 MET A CA    1 
ATOM   9152  C  C     . MET A 1 1201 ? -11.469 -36.909  37.331  1.00 15.67 ? 1202 MET A C     1 
ATOM   9153  O  O     . MET A 1 1201 ? -10.795 -37.820  36.844  1.00 15.55 ? 1202 MET A O     1 
ATOM   9154  C  CB    . MET A 1 1201 ? -13.955 -37.261  37.351  1.00 17.12 ? 1202 MET A CB    1 
ATOM   9155  C  CG    . MET A 1 1201 ? -15.169 -37.488  38.203  1.00 18.77 ? 1202 MET A CG    1 
ATOM   9156  S  SD    . MET A 1 1201 ? -16.694 -37.061  37.407  1.00 20.40 ? 1202 MET A SD    1 
ATOM   9157  C  CE    . MET A 1 1201 ? -17.249 -35.660  38.392  1.00 19.38 ? 1202 MET A CE    1 
ATOM   9158  N  N     . MET A 1 1202 ? -11.191 -35.615  37.164  1.00 15.40 ? 1203 MET A N     1 
ATOM   9159  C  CA    . MET A 1 1202 ? -10.041 -35.184  36.379  1.00 15.67 ? 1203 MET A CA    1 
ATOM   9160  C  C     . MET A 1 1202 ? -8.740  -35.091  37.179  1.00 15.60 ? 1203 MET A C     1 
ATOM   9161  O  O     . MET A 1 1202 ? -7.651  -35.229  36.619  1.00 16.06 ? 1203 MET A O     1 
ATOM   9162  C  CB    . MET A 1 1202 ? -10.334 -33.903  35.585  1.00 16.06 ? 1203 MET A CB    1 
ATOM   9163  C  CG    . MET A 1 1202 ? -11.128 -34.180  34.285  1.00 16.57 ? 1203 MET A CG    1 
ATOM   9164  S  SD    . MET A 1 1202 ? -10.840 -33.054  32.880  1.00 16.77 ? 1203 MET A SD    1 
ATOM   9165  C  CE    . MET A 1 1202 ? -12.491 -32.616  32.405  1.00 16.61 ? 1203 MET A CE    1 
ATOM   9166  N  N     . ALA A 1 1203 ? -8.850  -34.987  38.499  1.00 15.44 ? 1204 ALA A N     1 
ATOM   9167  C  CA    . ALA A 1 1203 ? -7.664  -34.913  39.348  1.00 15.08 ? 1204 ALA A CA    1 
ATOM   9168  C  C     . ALA A 1 1203 ? -6.703  -36.070  39.067  1.00 15.10 ? 1204 ALA A C     1 
ATOM   9169  O  O     . ALA A 1 1203 ? -7.092  -37.242  38.975  1.00 14.78 ? 1204 ALA A O     1 
ATOM   9170  C  CB    . ALA A 1 1203 ? -8.060  -34.883  40.808  1.00 14.60 ? 1204 ALA A CB    1 
ATOM   9171  N  N     . ARG A 1 1204 ? -5.453  -35.708  38.831  1.00 15.23 ? 1205 ARG A N     1 
ATOM   9172  C  CA    . ARG A 1 1204 ? -4.423  -36.686  38.548  1.00 15.47 ? 1205 ARG A CA    1 
ATOM   9173  C  C     . ARG A 1 1204 ? -3.289  -36.543  39.550  1.00 15.35 ? 1205 ARG A C     1 
ATOM   9174  O  O     . ARG A 1 1204 ? -3.268  -35.609  40.349  1.00 15.30 ? 1205 ARG A O     1 
ATOM   9175  C  CB    . ARG A 1 1204 ? -3.911  -36.531  37.107  1.00 16.06 ? 1205 ARG A CB    1 
ATOM   9176  C  CG    . ARG A 1 1204 ? -4.818  -37.144  36.055  1.00 16.54 ? 1205 ARG A CG    1 
ATOM   9177  C  CD    . ARG A 1 1204 ? -5.124  -38.580  36.404  1.00 17.49 ? 1205 ARG A CD    1 
ATOM   9178  N  NE    . ARG A 1 1204 ? -6.558  -38.836  36.406  1.00 18.33 ? 1205 ARG A NE    1 
ATOM   9179  C  CZ    . ARG A 1 1204 ? -7.267  -39.005  35.296  1.00 19.02 ? 1205 ARG A CZ    1 
ATOM   9180  N  NH1   . ARG A 1 1204 ? -6.658  -38.933  34.117  1.00 19.36 ? 1205 ARG A NH1   1 
ATOM   9181  N  NH2   . ARG A 1 1204 ? -8.562  -39.295  35.354  1.00 18.69 ? 1205 ARG A NH2   1 
ATOM   9182  N  N     . PRO A 1 1205 ? -2.341  -37.493  39.542  1.00 15.53 ? 1206 PRO A N     1 
ATOM   9183  C  CA    . PRO A 1 1205 ? -1.222  -37.421  40.476  1.00 15.76 ? 1206 PRO A CA    1 
ATOM   9184  C  C     . PRO A 1 1205 ? -0.400  -36.157  40.349  1.00 16.58 ? 1206 PRO A C     1 
ATOM   9185  O  O     . PRO A 1 1205 ? -0.053  -35.545  41.357  1.00 16.99 ? 1206 PRO A O     1 
ATOM   9186  C  CB    . PRO A 1 1205 ? -0.406  -38.648  40.104  1.00 14.97 ? 1206 PRO A CB    1 
ATOM   9187  C  CG    . PRO A 1 1205 ? -1.427  -39.597  39.696  1.00 14.78 ? 1206 PRO A CG    1 
ATOM   9188  C  CD    . PRO A 1 1205 ? -2.303  -38.766  38.808  1.00 15.31 ? 1206 PRO A CD    1 
ATOM   9189  N  N     . ASP A 1 1206 ? -0.093  -35.756  39.119  1.00 17.46 ? 1207 ASP A N     1 
ATOM   9190  C  CA    . ASP A 1 1206 ? 0.730   -34.576  38.930  1.00 18.60 ? 1207 ASP A CA    1 
ATOM   9191  C  C     . ASP A 1 1206 ? -0.018  -33.320  38.536  1.00 18.84 ? 1207 ASP A C     1 
ATOM   9192  O  O     . ASP A 1 1206 ? 0.593   -32.360  38.053  1.00 18.75 ? 1207 ASP A O     1 
ATOM   9193  C  CB    . ASP A 1 1206 ? 1.937   -34.868  38.013  1.00 19.84 ? 1207 ASP A CB    1 
ATOM   9194  C  CG    . ASP A 1 1206 ? 3.077   -35.660  38.739  1.00 21.74 ? 1207 ASP A CG    1 
ATOM   9195  O  OD1   . ASP A 1 1206 ? 3.035   -35.812  39.991  1.00 22.15 ? 1207 ASP A OD1   1 
ATOM   9196  O  OD2   . ASP A 1 1206 ? 4.025   -36.133  38.058  1.00 22.66 ? 1207 ASP A OD2   1 
ATOM   9197  N  N     . SER A 1 1207 ? -1.322  -33.301  38.832  1.00 19.17 ? 1208 SER A N     1 
ATOM   9198  C  CA    . SER A 1 1207 ? -2.182  -32.144  38.534  1.00 19.89 ? 1208 SER A CA    1 
ATOM   9199  C  C     . SER A 1 1207 ? -2.293  -31.171  39.726  1.00 20.30 ? 1208 SER A C     1 
ATOM   9200  O  O     . SER A 1 1207 ? -1.932  -31.513  40.850  1.00 20.71 ? 1208 SER A O     1 
ATOM   9201  C  CB    . SER A 1 1207 ? -3.569  -32.605  38.103  1.00 19.60 ? 1208 SER A CB    1 
ATOM   9202  O  OG    . SER A 1 1207 ? -4.233  -33.238  39.171  1.00 20.11 ? 1208 SER A OG    1 
ATOM   9203  N  N     . GLY A 1 1208 ? -2.782  -29.961  39.479  1.00 20.48 ? 1209 GLY A N     1 
ATOM   9204  C  CA    . GLY A 1 1208 ? -2.880  -28.990  40.553  1.00 21.06 ? 1209 GLY A CA    1 
ATOM   9205  C  C     . GLY A 1 1208 ? -2.142  -27.669  40.336  1.00 21.44 ? 1209 GLY A C     1 
ATOM   9206  O  O     . GLY A 1 1208 ? -2.289  -26.758  41.150  1.00 21.38 ? 1209 GLY A O     1 
ATOM   9207  N  N     . GLU A 1 1209 ? -1.328  -27.572  39.279  1.00 21.98 ? 1210 GLU A N     1 
ATOM   9208  C  CA    . GLU A 1 1209 ? -0.592  -26.344  38.933  1.00 21.96 ? 1210 GLU A CA    1 
ATOM   9209  C  C     . GLU A 1 1209 ? -1.608  -25.328  38.414  0.00 21.59 ? 1210 GLU A C     1 
ATOM   9210  O  O     . GLU A 1 1209 ? -2.513  -25.677  37.673  1.00 21.75 ? 1210 GLU A O     1 
ATOM   9211  C  CB    . GLU A 1 1209 ? 0.454   -26.633  37.850  0.00 22.79 ? 1210 GLU A CB    1 
ATOM   9212  C  CG    . GLU A 1 1209 ? 1.352   -25.448  37.513  0.00 24.35 ? 1210 GLU A CG    1 
ATOM   9213  C  CD    . GLU A 1 1209 ? 2.222   -25.700  36.296  0.00 25.05 ? 1210 GLU A CD    1 
ATOM   9214  O  OE1   . GLU A 1 1209 ? 1.741   -25.470  35.166  0.00 25.17 ? 1210 GLU A OE1   1 
ATOM   9215  O  OE2   . GLU A 1 1209 ? 3.384   -26.125  36.467  0.00 25.18 ? 1210 GLU A OE2   1 
ATOM   9216  N  N     . ALA A 1 1210 ? -1.441  -24.064  38.769  1.00 20.92 ? 1211 ALA A N     1 
ATOM   9217  C  CA    . ALA A 1 1210 ? -2.387  -23.028  38.347  1.00 20.79 ? 1211 ALA A CA    1 
ATOM   9218  C  C     . ALA A 1 1210 ? -2.461  -22.731  36.849  1.00 20.35 ? 1211 ALA A C     1 
ATOM   9219  O  O     . ALA A 1 1210 ? -1.515  -22.996  36.100  1.00 20.00 ? 1211 ALA A O     1 
ATOM   9220  C  CB    . ALA A 1 1210 ? -2.138  -21.725  39.122  1.00 21.38 ? 1211 ALA A CB    1 
ATOM   9221  N  N     . CYS A 1 1211 ? -3.591  -22.143  36.443  1.00 19.54 ? 1212 CYS A N     1 
ATOM   9222  C  CA    . CYS A 1 1211 ? -3.850  -21.778  35.054  1.00 18.80 ? 1212 CYS A CA    1 
ATOM   9223  C  C     . CYS A 1 1211 ? -5.098  -20.908  34.933  1.00 18.28 ? 1212 CYS A C     1 
ATOM   9224  O  O     . CYS A 1 1211 ? -5.771  -20.635  35.934  1.00 18.10 ? 1212 CYS A O     1 
ATOM   9225  C  CB    . CYS A 1 1211 ? -4.004  -23.028  34.183  1.00 19.25 ? 1212 CYS A CB    1 
ATOM   9226  S  SG    . CYS A 1 1211 ? -5.096  -24.311  34.886  1.00 19.25 ? 1212 CYS A SG    1 
ATOM   9227  N  N     . ASP A 1 1212 ? -5.376  -20.467  33.700  1.00 17.54 ? 1213 ASP A N     1 
ATOM   9228  C  CA    . ASP A 1 1212 ? -6.536  -19.624  33.364  1.00 16.53 ? 1213 ASP A CA    1 
ATOM   9229  C  C     . ASP A 1 1212 ? -7.760  -20.520  33.110  1.00 15.72 ? 1213 ASP A C     1 
ATOM   9230  O  O     . ASP A 1 1212 ? -7.883  -21.120  32.051  1.00 15.58 ? 1213 ASP A O     1 
ATOM   9231  C  CB    . ASP A 1 1212 ? -6.222  -18.821  32.088  1.00 17.02 ? 1213 ASP A CB    1 
ATOM   9232  C  CG    . ASP A 1 1212 ? -6.995  -17.491  31.976  1.00 16.82 ? 1213 ASP A CG    1 
ATOM   9233  O  OD1   . ASP A 1 1212 ? -8.101  -17.331  32.557  1.00 17.79 ? 1213 ASP A OD1   1 
ATOM   9234  O  OD2   . ASP A 1 1212 ? -6.481  -16.601  31.255  1.00 16.66 ? 1213 ASP A OD2   1 
ATOM   9235  N  N     . GLN A 1 1213 ? -8.692  -20.509  34.057  1.00 14.58 ? 1214 GLN A N     1 
ATOM   9236  C  CA    . GLN A 1 1213 ? -9.929  -21.290  34.041  1.00 13.27 ? 1214 GLN A CA    1 
ATOM   9237  C  C     . GLN A 1 1213 ? -10.985 -20.677  33.099  1.00 13.02 ? 1214 GLN A C     1 
ATOM   9238  O  O     . GLN A 1 1213 ? -12.161 -21.018  33.178  1.00 13.27 ? 1214 GLN A O     1 
ATOM   9239  C  CB    . GLN A 1 1213 ? -10.449 -21.287  35.485  1.00 13.00 ? 1214 GLN A CB    1 
ATOM   9240  C  CG    . GLN A 1 1213 ? -11.416 -22.362  35.934  1.00 12.50 ? 1214 GLN A CG    1 
ATOM   9241  C  CD    . GLN A 1 1213 ? -11.725 -22.264  37.440  1.00 12.82 ? 1214 GLN A CD    1 
ATOM   9242  O  OE1   . GLN A 1 1213 ? -11.956 -21.171  37.975  1.00 12.94 ? 1214 GLN A OE1   1 
ATOM   9243  N  NE2   . GLN A 1 1213 ? -11.747 -23.411  38.121  1.00 12.09 ? 1214 GLN A NE2   1 
ATOM   9244  N  N     . ASN A 1 1214 ? -10.564 -19.759  32.232  1.00 12.96 ? 1215 ASN A N     1 
ATOM   9245  C  CA    . ASN A 1 1214 ? -11.446 -19.067  31.281  1.00 13.34 ? 1215 ASN A CA    1 
ATOM   9246  C  C     . ASN A 1 1214 ? -12.548 -18.191  31.867  1.00 13.62 ? 1215 ASN A C     1 
ATOM   9247  O  O     . ASN A 1 1214 ? -13.392 -17.684  31.129  1.00 13.97 ? 1215 ASN A O     1 
ATOM   9248  C  CB    . ASN A 1 1214 ? -12.073 -20.030  30.275  1.00 13.70 ? 1215 ASN A CB    1 
ATOM   9249  C  CG    . ASN A 1 1214 ? -11.196 -20.267  29.071  1.00 14.25 ? 1215 ASN A CG    1 
ATOM   9250  O  OD1   . ASN A 1 1214 ? -10.703 -21.379  28.851  1.00 15.71 ? 1215 ASN A OD1   1 
ATOM   9251  N  ND2   . ASN A 1 1214 ? -11.008 -19.231  28.264  1.00 14.89 ? 1215 ASN A ND2   1 
ATOM   9252  N  N     . ARG A 1 1215 ? -12.558 -18.007  33.180  1.00 13.50 ? 1216 ARG A N     1 
ATOM   9253  C  CA    . ARG A 1 1215 ? -13.572 -17.170  33.802  1.00 13.44 ? 1216 ARG A CA    1 
ATOM   9254  C  C     . ARG A 1 1215 ? -13.397 -15.684  33.474  1.00 14.20 ? 1216 ARG A C     1 
ATOM   9255  O  O     . ARG A 1 1215 ? -14.353 -14.904  33.542  1.00 14.58 ? 1216 ARG A O     1 
ATOM   9256  C  CB    . ARG A 1 1215 ? -13.582 -17.397  35.308  1.00 12.18 ? 1216 ARG A CB    1 
ATOM   9257  C  CG    . ARG A 1 1215 ? -14.555 -18.478  35.710  1.00 11.81 ? 1216 ARG A CG    1 
ATOM   9258  C  CD    . ARG A 1 1215 ? -14.120 -19.207  36.971  1.00 11.64 ? 1216 ARG A CD    1 
ATOM   9259  N  NE    . ARG A 1 1215 ? -13.977 -18.301  38.101  1.00 11.11 ? 1216 ARG A NE    1 
ATOM   9260  C  CZ    . ARG A 1 1215 ? -12.819 -17.984  38.674  1.00 10.60 ? 1216 ARG A CZ    1 
ATOM   9261  N  NH1   . ARG A 1 1215 ? -11.682 -18.522  38.241  1.00 8.65  ? 1216 ARG A NH1   1 
ATOM   9262  N  NH2   . ARG A 1 1215 ? -12.799 -17.052  39.627  1.00 10.30 ? 1216 ARG A NH2   1 
ATOM   9263  N  N     . ALA A 1 1216 ? -12.197 -15.308  33.046  1.00 15.09 ? 1217 ALA A N     1 
ATOM   9264  C  CA    . ALA A 1 1216 ? -11.909 -13.916  32.735  1.00 15.75 ? 1217 ALA A CA    1 
ATOM   9265  C  C     . ALA A 1 1216 ? -11.904 -13.563  31.265  1.00 16.33 ? 1217 ALA A C     1 
ATOM   9266  O  O     . ALA A 1 1216 ? -11.384 -12.524  30.877  1.00 16.43 ? 1217 ALA A O     1 
ATOM   9267  C  CB    . ALA A 1 1216 ? -10.610 -13.490  33.373  1.00 15.91 ? 1217 ALA A CB    1 
ATOM   9268  N  N     . GLY A 1 1217 ? -12.458 -14.429  30.434  1.00 17.16 ? 1218 GLY A N     1 
ATOM   9269  C  CA    . GLY A 1 1217 ? -12.522 -14.109  29.023  1.00 17.87 ? 1218 GLY A CA    1 
ATOM   9270  C  C     . GLY A 1 1217 ? -11.371 -14.519  28.137  1.00 18.33 ? 1218 GLY A C     1 
ATOM   9271  O  O     . GLY A 1 1217 ? -10.377 -15.124  28.559  1.00 18.17 ? 1218 GLY A O     1 
ATOM   9272  N  N     . THR A 1 1218 ? -11.564 -14.185  26.871  1.00 18.89 ? 1219 THR A N     1 
ATOM   9273  C  CA    . THR A 1 1218 ? -10.631 -14.451  25.805  1.00 19.67 ? 1219 THR A CA    1 
ATOM   9274  C  C     . THR A 1 1218 ? -9.337  -13.662  25.981  1.00 20.04 ? 1219 THR A C     1 
ATOM   9275  O  O     . THR A 1 1218 ? -9.282  -12.686  26.725  1.00 19.60 ? 1219 THR A O     1 
ATOM   9276  C  CB    . THR A 1 1218 ? -11.314 -14.124  24.458  1.00 19.97 ? 1219 THR A CB    1 
ATOM   9277  O  OG1   . THR A 1 1218 ? -11.781 -15.341  23.868  1.00 20.66 ? 1219 THR A OG1   1 
ATOM   9278  C  CG2   . THR A 1 1218 ? -10.397 -13.389  23.501  1.00 19.73 ? 1219 THR A CG2   1 
ATOM   9279  N  N     . SER A 1 1219 ? -8.281  -14.130  25.328  1.00 20.89 ? 1220 SER A N     1 
ATOM   9280  C  CA    . SER A 1 1219 ? -7.002  -13.457  25.414  1.00 21.61 ? 1220 SER A CA    1 
ATOM   9281  C  C     . SER A 1 1219 ? -7.233  -12.035  25.018  1.00 21.88 ? 1220 SER A C     1 
ATOM   9282  O  O     . SER A 1 1219 ? -7.165  -11.162  25.863  1.00 22.17 ? 1220 SER A O     1 
ATOM   9283  C  CB    . SER A 1 1219 ? -5.968  -14.092  24.490  1.00 22.20 ? 1220 SER A CB    1 
ATOM   9284  O  OG    . SER A 1 1219 ? -5.265  -15.126  25.164  1.00 22.91 ? 1220 SER A OG    1 
ATOM   9285  N  N     . GLU A 1 1220 ? -7.618  -11.807  23.766  1.00 22.17 ? 1221 GLU A N     1 
ATOM   9286  C  CA    . GLU A 1 1220 ? -7.847  -10.439  23.340  1.00 22.54 ? 1221 GLU A CA    1 
ATOM   9287  C  C     . GLU A 1 1220 ? -8.810  -9.647   24.233  1.00 22.02 ? 1221 GLU A C     1 
ATOM   9288  O  O     . GLU A 1 1220 ? -8.654  -8.439   24.369  1.00 22.48 ? 1221 GLU A O     1 
ATOM   9289  C  CB    . GLU A 1 1220 ? -8.215  -10.325  21.845  1.00 23.62 ? 1221 GLU A CB    1 
ATOM   9290  C  CG    . GLU A 1 1220 ? -9.250  -11.316  21.294  1.00 25.65 ? 1221 GLU A CG    1 
ATOM   9291  C  CD    . GLU A 1 1220 ? -8.605  -12.476  20.534  1.00 26.79 ? 1221 GLU A CD    1 
ATOM   9292  O  OE1   . GLU A 1 1220 ? -8.118  -13.432  21.202  1.00 27.59 ? 1221 GLU A OE1   1 
ATOM   9293  O  OE2   . GLU A 1 1220 ? -8.587  -12.423  19.275  1.00 26.50 ? 1221 GLU A OE2   1 
ATOM   9294  N  N     . GLN A 1 1221 ? -9.751  -10.302  24.902  1.00 20.95 ? 1222 GLN A N     1 
ATOM   9295  C  CA    . GLN A 1 1221 ? -10.657 -9.546   25.767  1.00 20.58 ? 1222 GLN A CA    1 
ATOM   9296  C  C     . GLN A 1 1221 ? -9.903  -9.168   27.040  1.00 20.23 ? 1222 GLN A C     1 
ATOM   9297  O  O     . GLN A 1 1221 ? -10.099 -8.091   27.606  1.00 20.29 ? 1222 GLN A O     1 
ATOM   9298  C  CB    . GLN A 1 1221 ? -11.945 -10.343  26.072  1.00 20.81 ? 1222 GLN A CB    1 
ATOM   9299  C  CG    . GLN A 1 1221 ? -13.109 -10.105  25.066  1.00 20.62 ? 1222 GLN A CG    1 
ATOM   9300  C  CD    . GLN A 1 1221 ? -13.927 -11.363  24.797  1.00 20.11 ? 1222 GLN A CD    1 
ATOM   9301  O  OE1   . GLN A 1 1221 ? -13.713 -12.393  25.433  1.00 19.51 ? 1222 GLN A OE1   1 
ATOM   9302  N  NE2   . GLN A 1 1221 ? -14.850 -11.287  23.836  1.00 19.78 ? 1222 GLN A NE2   1 
ATOM   9303  N  N     . GLN A 1 1222 ? -9.008  -10.051  27.459  1.00 19.95 ? 1223 GLN A N     1 
ATOM   9304  C  CA    . GLN A 1 1222 ? -8.198  -9.806   28.639  1.00 20.14 ? 1223 GLN A CA    1 
ATOM   9305  C  C     . GLN A 1 1222 ? -7.266  -8.614   28.369  1.00 20.45 ? 1223 GLN A C     1 
ATOM   9306  O  O     . GLN A 1 1222 ? -7.143  -7.713   29.206  1.00 20.22 ? 1223 GLN A O     1 
ATOM   9307  C  CB    . GLN A 1 1222 ? -7.394  -11.069  28.994  1.00 19.71 ? 1223 GLN A CB    1 
ATOM   9308  C  CG    . GLN A 1 1222 ? -7.947  -11.852  30.179  1.00 19.70 ? 1223 GLN A CG    1 
ATOM   9309  C  CD    . GLN A 1 1222 ? -7.512  -13.309  30.211  1.00 19.79 ? 1223 GLN A CD    1 
ATOM   9310  O  OE1   . GLN A 1 1222 ? -6.795  -13.725  31.121  1.00 19.95 ? 1223 GLN A OE1   1 
ATOM   9311  N  NE2   . GLN A 1 1222 ? -7.984  -14.103  29.241  1.00 19.42 ? 1223 GLN A NE2   1 
ATOM   9312  N  N     . GLY A 1 1223 ? -6.666  -8.599   27.172  1.00 20.83 ? 1224 GLY A N     1 
ATOM   9313  C  CA    . GLY A 1 1223 ? -5.750  -7.543   26.760  1.00 20.92 ? 1224 GLY A CA    1 
ATOM   9314  C  C     . GLY A 1 1223 ? -6.411  -6.213   26.436  1.00 21.49 ? 1224 GLY A C     1 
ATOM   9315  O  O     . GLY A 1 1223 ? -5.947  -5.160   26.874  1.00 20.98 ? 1224 GLY A O     1 
ATOM   9316  N  N     . ASP A 1 1224 ? -7.478  -6.235   25.647  1.00 22.09 ? 1225 ASP A N     1 
ATOM   9317  C  CA    . ASP A 1 1224 ? -8.151  -4.993   25.338  1.00 22.91 ? 1225 ASP A CA    1 
ATOM   9318  C  C     . ASP A 1 1224 ? -8.549  -4.398   26.679  1.00 22.85 ? 1225 ASP A C     1 
ATOM   9319  O  O     . ASP A 1 1224 ? -8.554  -3.188   26.822  1.00 23.46 ? 1225 ASP A O     1 
ATOM   9320  C  CB    . ASP A 1 1224 ? -9.330  -5.230   24.376  1.00 24.43 ? 1225 ASP A CB    1 
ATOM   9321  C  CG    . ASP A 1 1224 ? -10.676 -4.698   24.901  1.00 26.94 ? 1225 ASP A CG    1 
ATOM   9322  O  OD1   . ASP A 1 1224 ? -11.328 -5.383   25.739  1.00 28.27 ? 1225 ASP A OD1   1 
ATOM   9323  O  OD2   . ASP A 1 1224 ? -11.126 -3.627   24.420  1.00 28.23 ? 1225 ASP A OD2   1 
ATOM   9324  N  N     . LEU A 1 1225 ? -8.756  -5.244   27.690  1.00 22.50 ? 1226 LEU A N     1 
ATOM   9325  C  CA    . LEU A 1 1225 ? -9.123  -4.769   29.022  1.00 22.52 ? 1226 LEU A CA    1 
ATOM   9326  C  C     . LEU A 1 1225 ? -7.922  -4.152   29.755  1.00 23.39 ? 1226 LEU A C     1 
ATOM   9327  O  O     . LEU A 1 1225 ? -8.041  -3.109   30.410  1.00 23.14 ? 1226 LEU A O     1 
ATOM   9328  C  CB    . LEU A 1 1225 ? -9.718  -5.906   29.862  1.00 21.17 ? 1226 LEU A CB    1 
ATOM   9329  C  CG    . LEU A 1 1225 ? -10.330 -5.419   31.182  1.00 20.67 ? 1226 LEU A CG    1 
ATOM   9330  C  CD1   . LEU A 1 1225 ? -11.506 -4.543   30.873  1.00 20.30 ? 1226 LEU A CD1   1 
ATOM   9331  C  CD2   . LEU A 1 1225 ? -10.766 -6.555   32.078  1.00 20.55 ? 1226 LEU A CD2   1 
ATOM   9332  N  N     . SER A 1 1226 ? -6.770  -4.811   29.659  1.00 24.66 ? 1227 SER A N     1 
ATOM   9333  C  CA    . SER A 1 1226 ? -5.540  -4.336   30.301  1.00 25.90 ? 1227 SER A CA    1 
ATOM   9334  C  C     . SER A 1 1226 ? -5.125  -3.048   29.647  1.00 27.14 ? 1227 SER A C     1 
ATOM   9335  O  O     . SER A 1 1226 ? -4.577  -2.142   30.277  1.00 27.37 ? 1227 SER A O     1 
ATOM   9336  C  CB    . SER A 1 1226 ? -4.411  -5.344   30.108  1.00 25.49 ? 1227 SER A CB    1 
ATOM   9337  O  OG    . SER A 1 1226 ? -3.149  -4.702   30.201  1.00 24.72 ? 1227 SER A OG    1 
ATOM   9338  N  N     . LYS A 1 1227 ? -5.355  -3.023   28.344  1.00 28.59 ? 1228 LYS A N     1 
ATOM   9339  C  CA    . LYS A 1 1227 ? -5.050  -1.898   27.499  1.00 29.97 ? 1228 LYS A CA    1 
ATOM   9340  C  C     . LYS A 1 1227 ? -6.241  -0.941   27.625  1.00 30.79 ? 1228 LYS A C     1 
ATOM   9341  O  O     . LYS A 1 1227 ? -6.591  -0.252   26.674  1.00 31.26 ? 1228 LYS A O     1 
ATOM   9342  C  CB    . LYS A 1 1227 ? -4.920  -2.411   26.061  1.00 30.18 ? 1228 LYS A CB    1 
ATOM   9343  C  CG    . LYS A 1 1227 ? -4.151  -1.503   25.127  1.00 30.87 ? 1228 LYS A CG    1 
ATOM   9344  C  CD    . LYS A 1 1227 ? -4.785  -1.464   23.734  1.00 31.65 ? 1228 LYS A CD    1 
ATOM   9345  C  CE    . LYS A 1 1227 ? -4.123  -0.386   22.884  1.00 31.92 ? 1228 LYS A CE    1 
ATOM   9346  N  NZ    . LYS A 1 1227 ? -2.640  -0.578   22.876  1.00 32.26 ? 1228 LYS A NZ    1 
ATOM   9347  N  N     . ARG A 1 1228 ? -6.871  -0.904   28.796  1.00 31.59 ? 1229 ARG A N     1 
ATOM   9348  C  CA    . ARG A 1 1228 ? -8.036  -0.049   29.006  1.00 32.81 ? 1229 ARG A CA    1 
ATOM   9349  C  C     . ARG A 1 1228 ? -8.199  0.380    30.458  1.00 33.78 ? 1229 ARG A C     1 
ATOM   9350  O  O     . ARG A 1 1228 ? -9.268  0.871    30.852  1.00 34.00 ? 1229 ARG A O     1 
ATOM   9351  C  CB    . ARG A 1 1228 ? -9.319  -0.772   28.573  1.00 32.55 ? 1229 ARG A CB    1 
ATOM   9352  C  CG    . ARG A 1 1228 ? -9.681  -0.624   27.107  1.00 32.64 ? 1229 ARG A CG    1 
ATOM   9353  C  CD    . ARG A 1 1228 ? -11.163 -0.924   26.878  1.00 32.59 ? 1229 ARG A CD    1 
ATOM   9354  N  NE    . ARG A 1 1228 ? -11.503 -2.342   26.978  1.00 32.48 ? 1229 ARG A NE    1 
ATOM   9355  C  CZ    . ARG A 1 1228 ? -12.315 -2.867   27.892  1.00 32.38 ? 1229 ARG A CZ    1 
ATOM   9356  N  NH1   . ARG A 1 1228 ? -12.872 -2.102   28.825  1.00 32.22 ? 1229 ARG A NH1   1 
ATOM   9357  N  NH2   . ARG A 1 1228 ? -12.627 -4.154   27.824  1.00 32.35 ? 1229 ARG A NH2   1 
ATOM   9358  N  N     . THR A 1 1229 ? -7.166  0.152    31.263  1.00 34.85 ? 1230 THR A N     1 
ATOM   9359  C  CA    . THR A 1 1229 ? -7.204  0.508    32.681  1.00 35.82 ? 1230 THR A CA    1 
ATOM   9360  C  C     . THR A 1 1229 ? -5.803  0.912    33.094  1.00 36.82 ? 1230 THR A C     1 
ATOM   9361  O  O     . THR A 1 1229 ? -5.618  1.970    33.684  1.00 36.71 ? 1230 THR A O     1 
ATOM   9362  C  CB    . THR A 1 1229 ? -7.658  -0.692   33.569  1.00 35.45 ? 1230 THR A CB    1 
ATOM   9363  O  OG1   . THR A 1 1229 ? -6.801  -1.813   33.325  1.00 35.42 ? 1230 THR A OG1   1 
ATOM   9364  C  CG2   . THR A 1 1229 ? -9.117  -1.092   33.281  1.00 35.15 ? 1230 THR A CG2   1 
ATOM   9365  N  N     . LYS A 1 1230 ? -4.843  0.051    32.725  1.00 38.37 ? 1231 LYS A N     1 
ATOM   9366  C  CA    . LYS A 1 1230 ? -3.389  0.158    32.968  1.00 39.50 ? 1231 LYS A CA    1 
ATOM   9367  C  C     . LYS A 1 1230 ? -2.899  0.913    34.205  1.00 40.21 ? 1231 LYS A C     1 
ATOM   9368  O  O     . LYS A 1 1230 ? -2.102  0.375    34.983  1.00 40.44 ? 1231 LYS A O     1 
ATOM   9369  C  CB    . LYS A 1 1230 ? -2.655  0.618    31.701  1.00 39.49 ? 1231 LYS A CB    1 
ATOM   9370  C  CG    . LYS A 1 1230 ? -3.480  1.531    30.831  1.00 40.03 ? 1231 LYS A CG    1 
ATOM   9371  C  CD    . LYS A 1 1230 ? -2.854  1.787    29.464  1.00 40.47 ? 1231 LYS A CD    1 
ATOM   9372  C  CE    . LYS A 1 1230 ? -3.839  2.583    28.597  1.00 40.69 ? 1231 LYS A CE    1 
ATOM   9373  N  NZ    . LYS A 1 1230 ? -4.597  3.628    29.392  1.00 40.32 ? 1231 LYS A NZ    1 
ATOM   9374  N  N     . LYS A 1 1231 ? -3.302  2.174    34.338  1.00 41.12 ? 1232 LYS A N     1 
ATOM   9375  C  CA    . LYS A 1 1231 ? -2.950  2.982    35.504  1.00 41.80 ? 1232 LYS A CA    1 
ATOM   9376  C  C     . LYS A 1 1231 ? -1.445  3.261    35.646  1.00 42.20 ? 1232 LYS A C     1 
ATOM   9377  O  O     . LYS A 1 1231 ? -0.961  3.654    36.718  1.00 42.54 ? 1232 LYS A O     1 
ATOM   9378  C  CB    . LYS A 1 1231 ? -3.509  2.299    36.767  1.00 42.17 ? 1232 LYS A CB    1 
ATOM   9379  C  CG    . LYS A 1 1231 ? -5.049  2.222    36.810  1.00 42.44 ? 1232 LYS A CG    1 
ATOM   9380  C  CD    . LYS A 1 1231 ? -5.686  3.621    36.889  1.00 42.23 ? 1232 LYS A CD    1 
ATOM   9381  C  CE    . LYS A 1 1231 ? -5.436  4.291    38.256  1.00 42.25 ? 1232 LYS A CE    1 
ATOM   9382  N  NZ    . LYS A 1 1231 ? -3.988  4.428    38.658  1.00 41.91 ? 1232 LYS A NZ    1 
ATOM   9383  N  N     . GLY B 1 1    ? 16.801  -52.981  45.668  1.00 38.92 ? 2    GLY B N     1 
ATOM   9384  C  CA    . GLY B 1 1    ? 15.890  -52.955  46.798  1.00 37.19 ? 2    GLY B CA    1 
ATOM   9385  C  C     . GLY B 1 1    ? 14.864  -51.850  46.959  1.00 35.97 ? 2    GLY B C     1 
ATOM   9386  O  O     . GLY B 1 1    ? 14.314  -51.327  46.001  1.00 35.74 ? 2    GLY B O     1 
ATOM   9387  N  N     . LYS B 1 2    ? 14.621  -51.516  48.224  1.00 35.11 ? 3    LYS B N     1 
ATOM   9388  C  CA    . LYS B 1 2    ? 13.654  -50.513  48.660  1.00 34.06 ? 3    LYS B CA    1 
ATOM   9389  C  C     . LYS B 1 2    ? 13.896  -49.115  48.134  1.00 32.82 ? 3    LYS B C     1 
ATOM   9390  O  O     . LYS B 1 2    ? 15.031  -48.703  47.911  1.00 32.89 ? 3    LYS B O     1 
ATOM   9391  C  CB    . LYS B 1 2    ? 13.631  -50.455  50.189  1.00 34.96 ? 3    LYS B CB    1 
ATOM   9392  C  CG    . LYS B 1 2    ? 13.364  -51.783  50.886  1.00 35.59 ? 3    LYS B CG    1 
ATOM   9393  C  CD    . LYS B 1 2    ? 14.072  -51.785  52.230  1.00 36.46 ? 3    LYS B CD    1 
ATOM   9394  C  CE    . LYS B 1 2    ? 13.546  -52.859  53.167  1.00 37.27 ? 3    LYS B CE    1 
ATOM   9395  N  NZ    . LYS B 1 2    ? 14.435  -53.027  54.371  1.00 37.68 ? 3    LYS B NZ    1 
ATOM   9396  N  N     . LYS B 1 3    ? 12.812  -48.362  48.025  1.00 31.19 ? 4    LYS B N     1 
ATOM   9397  C  CA    . LYS B 1 3    ? 12.878  -47.007  47.540  1.00 29.86 ? 4    LYS B CA    1 
ATOM   9398  C  C     . LYS B 1 3    ? 11.789  -46.157  48.191  1.00 28.74 ? 4    LYS B C     1 
ATOM   9399  O  O     . LYS B 1 3    ? 10.622  -46.530  48.168  1.00 29.14 ? 4    LYS B O     1 
ATOM   9400  C  CB    . LYS B 1 3    ? 12.707  -46.994  46.028  1.00 30.30 ? 4    LYS B CB    1 
ATOM   9401  C  CG    . LYS B 1 3    ? 12.878  -45.611  45.470  1.00 31.73 ? 4    LYS B CG    1 
ATOM   9402  C  CD    . LYS B 1 3    ? 12.853  -45.567  43.965  1.00 33.28 ? 4    LYS B CD    1 
ATOM   9403  C  CE    . LYS B 1 3    ? 13.570  -44.304  43.497  1.00 34.31 ? 4    LYS B CE    1 
ATOM   9404  N  NZ    . LYS B 1 3    ? 13.396  -44.051  42.037  1.00 35.60 ? 4    LYS B NZ    1 
ATOM   9405  N  N     . MET B 1 4    ? 12.159  -45.029  48.794  1.00 26.92 ? 5    MET B N     1 
ATOM   9406  C  CA    . MET B 1 4    ? 11.155  -44.171  49.413  1.00 25.03 ? 5    MET B CA    1 
ATOM   9407  C  C     . MET B 1 4    ? 10.442  -43.462  48.286  1.00 22.91 ? 5    MET B C     1 
ATOM   9408  O  O     . MET B 1 4    ? 11.038  -43.184  47.253  1.00 23.05 ? 5    MET B O     1 
ATOM   9409  C  CB    . MET B 1 4    ? 11.794  -43.168  50.361  1.00 26.43 ? 5    MET B CB    1 
ATOM   9410  C  CG    . MET B 1 4    ? 12.274  -43.788  51.652  1.00 27.86 ? 5    MET B CG    1 
ATOM   9411  S  SD    . MET B 1 4    ? 10.846  -44.250  52.659  1.00 29.68 ? 5    MET B SD    1 
ATOM   9412  C  CE    . MET B 1 4    ? 11.096  -46.057  52.904  1.00 29.71 ? 5    MET B CE    1 
ATOM   9413  N  N     . MET B 1 5    ? 9.179   -43.142  48.493  1.00 20.27 ? 6    MET B N     1 
ATOM   9414  C  CA    . MET B 1 5    ? 8.408   -42.514  47.455  1.00 17.42 ? 6    MET B CA    1 
ATOM   9415  C  C     . MET B 1 5    ? 7.193   -41.973  48.137  1.00 16.41 ? 6    MET B C     1 
ATOM   9416  O  O     . MET B 1 5    ? 6.660   -42.585  49.063  1.00 15.98 ? 6    MET B O     1 
ATOM   9417  C  CB    . MET B 1 5    ? 7.982   -43.588  46.474  1.00 16.76 ? 6    MET B CB    1 
ATOM   9418  C  CG    . MET B 1 5    ? 7.742   -43.130  45.078  1.00 16.60 ? 6    MET B CG    1 
ATOM   9419  S  SD    . MET B 1 5    ? 7.603   -44.547  43.967  1.00 16.96 ? 6    MET B SD    1 
ATOM   9420  C  CE    . MET B 1 5    ? 5.891   -44.968  44.206  1.00 16.22 ? 6    MET B CE    1 
ATOM   9421  N  N     . THR B 1 6    ? 6.768   -40.797  47.723  1.00 14.84 ? 7    THR B N     1 
ATOM   9422  C  CA    . THR B 1 6    ? 5.592   -40.229  48.317  1.00 13.33 ? 7    THR B CA    1 
ATOM   9423  C  C     . THR B 1 6    ? 4.524   -40.081  47.217  1.00 12.33 ? 7    THR B C     1 
ATOM   9424  O  O     . THR B 1 6    ? 4.610   -39.202  46.362  1.00 12.48 ? 7    THR B O     1 
ATOM   9425  C  CB    . THR B 1 6    ? 5.933   -38.922  49.094  1.00 13.08 ? 7    THR B CB    1 
ATOM   9426  O  OG1   . THR B 1 6    ? 5.427   -37.779  48.416  1.00 13.46 ? 7    THR B OG1   1 
ATOM   9427  C  CG2   . THR B 1 6    ? 7.428   -38.765  49.228  1.00 13.91 ? 7    THR B CG2   1 
ATOM   9428  N  N     . THR B 1 7    ? 3.586   -41.031  47.185  1.00 10.72 ? 8    THR B N     1 
ATOM   9429  C  CA    . THR B 1 7    ? 2.504   -41.027  46.211  1.00 9.13  ? 8    THR B CA    1 
ATOM   9430  C  C     . THR B 1 7    ? 1.221   -41.619  46.736  1.00 8.34  ? 8    THR B C     1 
ATOM   9431  O  O     . THR B 1 7    ? 1.139   -42.077  47.865  1.00 8.56  ? 8    THR B O     1 
ATOM   9432  C  CB    . THR B 1 7    ? 2.829   -41.868  45.033  1.00 9.33  ? 8    THR B CB    1 
ATOM   9433  O  OG1   . THR B 1 7    ? 2.998   -43.223  45.464  1.00 8.80  ? 8    THR B OG1   1 
ATOM   9434  C  CG2   . THR B 1 7    ? 4.062   -41.354  44.349  1.00 9.98  ? 8    THR B CG2   1 
ATOM   9435  N  N     . ASP B 1 8    ? 0.243   -41.697  45.856  1.00 7.07  ? 9    ASP B N     1 
ATOM   9436  C  CA    . ASP B 1 8    ? -1.051  -42.222  46.195  1.00 6.49  ? 9    ASP B CA    1 
ATOM   9437  C  C     . ASP B 1 8    ? -1.099  -43.733  46.074  1.00 5.67  ? 9    ASP B C     1 
ATOM   9438  O  O     . ASP B 1 8    ? -0.148  -44.348  45.589  1.00 5.58  ? 9    ASP B O     1 
ATOM   9439  C  CB    . ASP B 1 8    ? -2.085  -41.605  45.279  1.00 8.09  ? 9    ASP B CB    1 
ATOM   9440  C  CG    . ASP B 1 8    ? -1.822  -41.900  43.821  1.00 9.59  ? 9    ASP B CG    1 
ATOM   9441  O  OD1   . ASP B 1 8    ? -0.988  -42.775  43.522  1.00 10.03 ? 9    ASP B OD1   1 
ATOM   9442  O  OD2   . ASP B 1 8    ? -2.450  -41.247  42.964  1.00 11.10 ? 9    ASP B OD2   1 
ATOM   9443  N  N     . GLY B 1 9    ? -2.262  -44.297  46.397  1.00 4.32  ? 10   GLY B N     1 
ATOM   9444  C  CA    . GLY B 1 9    ? -2.463  -45.727  46.358  1.00 2.61  ? 10   GLY B CA    1 
ATOM   9445  C  C     . GLY B 1 9    ? -2.516  -46.236  44.958  1.00 2.46  ? 10   GLY B C     1 
ATOM   9446  O  O     . GLY B 1 9    ? -2.089  -47.347  44.710  1.00 2.32  ? 10   GLY B O     1 
ATOM   9447  N  N     . ASN B 1 10   ? -3.029  -45.430  44.038  1.00 2.54  ? 11   ASN B N     1 
ATOM   9448  C  CA    . ASN B 1 10   ? -3.131  -45.819  42.628  1.00 2.81  ? 11   ASN B CA    1 
ATOM   9449  C  C     . ASN B 1 10   ? -1.772  -46.114  41.999  1.00 3.02  ? 11   ASN B C     1 
ATOM   9450  O  O     . ASN B 1 10   ? -1.506  -47.211  41.497  1.00 3.58  ? 11   ASN B O     1 
ATOM   9451  C  CB    . ASN B 1 10   ? -3.736  -44.681  41.830  1.00 3.67  ? 11   ASN B CB    1 
ATOM   9452  C  CG    . ASN B 1 10   ? -5.212  -44.826  41.597  1.00 4.59  ? 11   ASN B CG    1 
ATOM   9453  O  OD1   . ASN B 1 10   ? -5.859  -43.841  41.233  1.00 5.19  ? 11   ASN B OD1   1 
ATOM   9454  N  ND2   . ASN B 1 10   ? -5.755  -46.043  41.746  1.00 4.33  ? 11   ASN B ND2   1 
ATOM   9455  N  N     . THR B 1 11   ? -0.930  -45.097  41.976  1.00 2.76  ? 12   THR B N     1 
ATOM   9456  C  CA    . THR B 1 11   ? 0.378   -45.248  41.403  1.00 3.08  ? 12   THR B CA    1 
ATOM   9457  C  C     . THR B 1 11   ? 1.162   -46.215  42.274  1.00 3.06  ? 12   THR B C     1 
ATOM   9458  O  O     . THR B 1 11   ? 2.064   -46.881  41.793  1.00 3.14  ? 12   THR B O     1 
ATOM   9459  C  CB    . THR B 1 11   ? 1.092   -43.889  41.252  1.00 3.23  ? 12   THR B CB    1 
ATOM   9460  O  OG1   . THR B 1 11   ? 1.846   -43.594  42.425  1.00 4.26  ? 12   THR B OG1   1 
ATOM   9461  C  CG2   . THR B 1 11   ? 0.077   -42.798  41.053  1.00 2.00  ? 12   THR B CG2   1 
ATOM   9462  N  N     . ALA B 1 12   ? 0.836   -46.295  43.563  1.00 2.79  ? 13   ALA B N     1 
ATOM   9463  C  CA    . ALA B 1 12   ? 1.527   -47.257  44.406  1.00 2.32  ? 13   ALA B CA    1 
ATOM   9464  C  C     . ALA B 1 12   ? 1.241   -48.602  43.787  1.00 2.61  ? 13   ALA B C     1 
ATOM   9465  O  O     . ALA B 1 12   ? 2.164   -49.364  43.612  1.00 3.36  ? 13   ALA B O     1 
ATOM   9466  C  CB    . ALA B 1 12   ? 1.022   -47.242  45.810  1.00 2.10  ? 13   ALA B CB    1 
ATOM   9467  N  N     . THR B 1 13   ? -0.001  -48.872  43.371  1.00 2.54  ? 14   THR B N     1 
ATOM   9468  C  CA    . THR B 1 13   ? -0.266  -50.181  42.781  1.00 2.95  ? 14   THR B CA    1 
ATOM   9469  C  C     . THR B 1 13   ? 0.103   -50.320  41.325  1.00 3.07  ? 14   THR B C     1 
ATOM   9470  O  O     . THR B 1 13   ? 0.557   -51.404  40.912  1.00 3.16  ? 14   THR B O     1 
ATOM   9471  C  CB    . THR B 1 13   ? -1.671  -50.760  43.055  1.00 3.04  ? 14   THR B CB    1 
ATOM   9472  O  OG1   . THR B 1 13   ? -2.417  -50.842  41.848  1.00 4.10  ? 14   THR B OG1   1 
ATOM   9473  C  CG2   . THR B 1 13   ? -2.399  -49.937  44.008  1.00 3.40  ? 14   THR B CG2   1 
ATOM   9474  N  N     . ALA B 1 14   ? -0.018  -49.232  40.557  1.00 2.90  ? 15   ALA B N     1 
ATOM   9475  C  CA    . ALA B 1 14   ? 0.347   -49.284  39.135  1.00 2.57  ? 15   ALA B CA    1 
ATOM   9476  C  C     . ALA B 1 14   ? 1.841   -49.531  39.010  1.00 2.00  ? 15   ALA B C     1 
ATOM   9477  O  O     . ALA B 1 14   ? 2.305   -49.936  37.992  1.00 2.00  ? 15   ALA B O     1 
ATOM   9478  C  CB    . ALA B 1 14   ? -0.051  -48.012  38.412  1.00 2.01  ? 15   ALA B CB    1 
ATOM   9479  N  N     . HIS B 1 15   ? 2.588   -49.268  40.067  1.00 2.32  ? 16   HIS B N     1 
ATOM   9480  C  CA    . HIS B 1 15   ? 4.027   -49.489  40.094  1.00 2.95  ? 16   HIS B CA    1 
ATOM   9481  C  C     . HIS B 1 15   ? 4.158   -50.999  39.916  1.00 3.29  ? 16   HIS B C     1 
ATOM   9482  O  O     . HIS B 1 15   ? 4.638   -51.468  38.879  1.00 3.63  ? 16   HIS B O     1 
ATOM   9483  C  CB    . HIS B 1 15   ? 4.590   -49.051  41.471  1.00 3.46  ? 16   HIS B CB    1 
ATOM   9484  C  CG    . HIS B 1 15   ? 6.083   -49.171  41.618  1.00 4.17  ? 16   HIS B CG    1 
ATOM   9485  N  ND1   . HIS B 1 15   ? 6.674   -49.915  42.621  1.00 4.63  ? 16   HIS B ND1   1 
ATOM   9486  C  CD2   . HIS B 1 15   ? 7.102   -48.607  40.923  1.00 4.80  ? 16   HIS B CD2   1 
ATOM   9487  C  CE1   . HIS B 1 15   ? 7.987   -49.807  42.537  1.00 4.41  ? 16   HIS B CE1   1 
ATOM   9488  N  NE2   . HIS B 1 15   ? 8.273   -49.020  41.518  1.00 4.71  ? 16   HIS B NE2   1 
ATOM   9489  N  N     . VAL B 1 16   ? 3.585   -51.744  40.864  1.00 2.59  ? 17   VAL B N     1 
ATOM   9490  C  CA    . VAL B 1 16   ? 3.645   -53.197  40.879  1.00 2.00  ? 17   VAL B CA    1 
ATOM   9491  C  C     . VAL B 1 16   ? 3.045   -53.895  39.665  1.00 2.12  ? 17   VAL B C     1 
ATOM   9492  O  O     . VAL B 1 16   ? 3.577   -54.906  39.223  1.00 2.08  ? 17   VAL B O     1 
ATOM   9493  C  CB    . VAL B 1 16   ? 2.998   -53.742  42.149  1.00 2.00  ? 17   VAL B CB    1 
ATOM   9494  C  CG1   . VAL B 1 16   ? 3.102   -55.220  42.194  1.00 2.00  ? 17   VAL B CG1   1 
ATOM   9495  C  CG2   . VAL B 1 16   ? 3.672   -53.167  43.358  1.00 2.00  ? 17   VAL B CG2   1 
ATOM   9496  N  N     . ALA B 1 17   ? 1.933   -53.370  39.140  1.00 2.38  ? 18   ALA B N     1 
ATOM   9497  C  CA    . ALA B 1 17   ? 1.253   -53.963  37.981  1.00 2.00  ? 18   ALA B CA    1 
ATOM   9498  C  C     . ALA B 1 17   ? 2.071   -53.849  36.726  1.00 2.00  ? 18   ALA B C     1 
ATOM   9499  O  O     . ALA B 1 17   ? 2.212   -54.815  36.002  1.00 2.66  ? 18   ALA B O     1 
ATOM   9500  C  CB    . ALA B 1 17   ? -0.102  -53.355  37.765  1.00 2.00  ? 18   ALA B CB    1 
ATOM   9501  N  N     . TYR B 1 18   ? 2.618   -52.682  36.446  1.00 2.00  ? 19   TYR B N     1 
ATOM   9502  C  CA    . TYR B 1 18   ? 3.427   -52.552  35.261  1.00 2.00  ? 19   TYR B CA    1 
ATOM   9503  C  C     . TYR B 1 18   ? 4.588   -53.571  35.316  1.00 2.08  ? 19   TYR B C     1 
ATOM   9504  O  O     . TYR B 1 18   ? 4.891   -54.249  34.341  1.00 2.00  ? 19   TYR B O     1 
ATOM   9505  C  CB    . TYR B 1 18   ? 3.944   -51.129  35.155  1.00 2.00  ? 19   TYR B CB    1 
ATOM   9506  C  CG    . TYR B 1 18   ? 4.573   -50.852  33.832  1.00 2.00  ? 19   TYR B CG    1 
ATOM   9507  C  CD1   . TYR B 1 18   ? 5.684   -51.550  33.435  1.00 2.00  ? 19   TYR B CD1   1 
ATOM   9508  C  CD2   . TYR B 1 18   ? 4.006   -49.946  32.941  1.00 2.00  ? 19   TYR B CD2   1 
ATOM   9509  C  CE1   . TYR B 1 18   ? 6.215   -51.386  32.197  1.00 2.03  ? 19   TYR B CE1   1 
ATOM   9510  C  CE2   . TYR B 1 18   ? 4.532   -49.773  31.694  1.00 2.00  ? 19   TYR B CE2   1 
ATOM   9511  C  CZ    . TYR B 1 18   ? 5.645   -50.504  31.331  1.00 2.08  ? 19   TYR B CZ    1 
ATOM   9512  O  OH    . TYR B 1 18   ? 6.208   -50.393  30.093  1.00 2.70  ? 19   TYR B OH    1 
ATOM   9513  N  N     . ALA B 1 19   ? 5.185   -53.728  36.491  1.00 2.39  ? 20   ALA B N     1 
ATOM   9514  C  CA    . ALA B 1 19   ? 6.299   -54.650  36.680  1.00 2.00  ? 20   ALA B CA    1 
ATOM   9515  C  C     . ALA B 1 19   ? 5.957   -56.099  36.404  1.00 2.12  ? 20   ALA B C     1 
ATOM   9516  O  O     . ALA B 1 19   ? 6.719   -56.795  35.764  1.00 2.39  ? 20   ALA B O     1 
ATOM   9517  C  CB    . ALA B 1 19   ? 6.833   -54.535  38.100  1.00 2.00  ? 20   ALA B CB    1 
ATOM   9518  N  N     . MET B 1 20   ? 4.800   -56.544  36.873  1.00 2.23  ? 21   MET B N     1 
ATOM   9519  C  CA    . MET B 1 20   ? 4.386   -57.941  36.738  1.00 2.34  ? 21   MET B CA    1 
ATOM   9520  C  C     . MET B 1 20   ? 3.501   -58.297  35.549  1.00 2.26  ? 21   MET B C     1 
ATOM   9521  O  O     . MET B 1 20   ? 2.941   -59.403  35.510  1.00 2.00  ? 21   MET B O     1 
ATOM   9522  C  CB    . MET B 1 20   ? 3.609   -58.352  37.991  1.00 2.51  ? 21   MET B CB    1 
ATOM   9523  C  CG    . MET B 1 20   ? 4.228   -57.989  39.306  1.00 2.85  ? 21   MET B CG    1 
ATOM   9524  S  SD    . MET B 1 20   ? 5.787   -58.830  39.644  1.00 3.88  ? 21   MET B SD    1 
ATOM   9525  C  CE    . MET B 1 20   ? 5.525   -60.479  39.127  1.00 3.10  ? 21   MET B CE    1 
ATOM   9526  N  N     . SER B 1 21   ? 3.352   -57.381  34.599  1.00 2.00  ? 22   SER B N     1 
ATOM   9527  C  CA    . SER B 1 21   ? 2.465   -57.636  33.483  1.00 2.00  ? 22   SER B CA    1 
ATOM   9528  C  C     . SER B 1 21   ? 3.050   -57.532  32.093  1.00 2.68  ? 22   SER B C     1 
ATOM   9529  O  O     . SER B 1 21   ? 3.969   -56.746  31.833  1.00 3.34  ? 22   SER B O     1 
ATOM   9530  C  CB    . SER B 1 21   ? 1.261   -56.728  33.600  1.00 2.00  ? 22   SER B CB    1 
ATOM   9531  O  OG    . SER B 1 21   ? 0.640   -56.948  34.847  1.00 2.00  ? 22   SER B OG    1 
ATOM   9532  N  N     . GLU B 1 22   ? 2.533   -58.351  31.190  1.00 2.49  ? 23   GLU B N     1 
ATOM   9533  C  CA    . GLU B 1 22   ? 3.007   -58.316  29.828  1.00 2.53  ? 23   GLU B CA    1 
ATOM   9534  C  C     . GLU B 1 22   ? 1.964   -57.702  28.942  1.00 2.75  ? 23   GLU B C     1 
ATOM   9535  O  O     . GLU B 1 22   ? 2.268   -57.302  27.832  1.00 3.55  ? 23   GLU B O     1 
ATOM   9536  C  CB    . GLU B 1 22   ? 3.269   -59.714  29.312  1.00 2.84  ? 23   GLU B CB    1 
ATOM   9537  C  CG    . GLU B 1 22   ? 4.363   -60.447  29.989  1.00 4.16  ? 23   GLU B CG    1 
ATOM   9538  C  CD    . GLU B 1 22   ? 4.519   -61.825  29.403  1.00 5.56  ? 23   GLU B CD    1 
ATOM   9539  O  OE1   . GLU B 1 22   ? 3.597   -62.632  29.619  1.00 6.56  ? 23   GLU B OE1   1 
ATOM   9540  O  OE2   . GLU B 1 22   ? 5.529   -62.101  28.705  1.00 6.32  ? 23   GLU B OE2   1 
ATOM   9541  N  N     . VAL B 1 23   ? 0.731   -57.609  29.417  1.00 2.65  ? 24   VAL B N     1 
ATOM   9542  C  CA    . VAL B 1 23   ? -0.325  -57.080  28.581  1.00 2.47  ? 24   VAL B CA    1 
ATOM   9543  C  C     . VAL B 1 23   ? -1.338  -56.448  29.449  1.00 2.75  ? 24   VAL B C     1 
ATOM   9544  O  O     . VAL B 1 23   ? -1.600  -56.948  30.530  1.00 3.86  ? 24   VAL B O     1 
ATOM   9545  C  CB    . VAL B 1 23   ? -1.054  -58.221  27.862  1.00 2.10  ? 24   VAL B CB    1 
ATOM   9546  C  CG1   . VAL B 1 23   ? -2.409  -57.763  27.380  1.00 2.00  ? 24   VAL B CG1   1 
ATOM   9547  C  CG2   . VAL B 1 23   ? -0.230  -58.730  26.711  1.00 2.00  ? 24   VAL B CG2   1 
ATOM   9548  N  N     . ALA B 1 24   ? -1.966  -55.400  28.949  1.00 2.65  ? 25   ALA B N     1 
ATOM   9549  C  CA    . ALA B 1 24   ? -3.017  -54.733  29.680  1.00 2.81  ? 25   ALA B CA    1 
ATOM   9550  C  C     . ALA B 1 24   ? -4.060  -54.313  28.668  1.00 3.33  ? 25   ALA B C     1 
ATOM   9551  O  O     . ALA B 1 24   ? -3.716  -53.665  27.674  1.00 3.90  ? 25   ALA B O     1 
ATOM   9552  C  CB    . ALA B 1 24   ? -2.475  -53.520  30.392  1.00 2.54  ? 25   ALA B CB    1 
ATOM   9553  N  N     . ALA B 1 25   ? -5.297  -54.776  28.853  1.00 3.22  ? 26   ALA B N     1 
ATOM   9554  C  CA    . ALA B 1 25   ? -6.419  -54.392  27.996  1.00 3.60  ? 26   ALA B CA    1 
ATOM   9555  C  C     . ALA B 1 25   ? -7.093  -53.433  28.960  1.00 4.26  ? 26   ALA B C     1 
ATOM   9556  O  O     . ALA B 1 25   ? -7.403  -53.833  30.079  1.00 4.54  ? 26   ALA B O     1 
ATOM   9557  C  CB    . ALA B 1 25   ? -7.282  -55.561  27.739  1.00 4.05  ? 26   ALA B CB    1 
ATOM   9558  N  N     . ILE B 1 26   ? -7.398  -52.214  28.520  1.00 4.86  ? 27   ILE B N     1 
ATOM   9559  C  CA    . ILE B 1 26   ? -7.890  -51.162  29.425  1.00 5.24  ? 27   ILE B CA    1 
ATOM   9560  C  C     . ILE B 1 26   ? -9.152  -50.336  29.087  1.00 5.53  ? 27   ILE B C     1 
ATOM   9561  O  O     . ILE B 1 26   ? -9.682  -50.443  27.980  1.00 5.85  ? 27   ILE B O     1 
ATOM   9562  C  CB    . ILE B 1 26   ? -6.663  -50.237  29.669  1.00 5.43  ? 27   ILE B CB    1 
ATOM   9563  C  CG1   . ILE B 1 26   ? -6.098  -50.469  31.044  1.00 6.45  ? 27   ILE B CG1   1 
ATOM   9564  C  CG2   . ILE B 1 26   ? -6.906  -48.801  29.347  1.00 5.69  ? 27   ILE B CG2   1 
ATOM   9565  C  CD1   . ILE B 1 26   ? -4.572  -50.563  31.017  1.00 7.77  ? 27   ILE B CD1   1 
ATOM   9566  N  N     . TYR B 1 27   ? -9.633  -49.538  30.064  1.00 5.38  ? 28   TYR B N     1 
ATOM   9567  C  CA    . TYR B 1 27   ? -10.814 -48.635  29.921  1.00 5.04  ? 28   TYR B CA    1 
ATOM   9568  C  C     . TYR B 1 27   ? -10.954 -47.677  31.122  1.00 4.54  ? 28   TYR B C     1 
ATOM   9569  O  O     . TYR B 1 27   ? -11.069 -48.120  32.270  1.00 5.07  ? 28   TYR B O     1 
ATOM   9570  C  CB    . TYR B 1 27   ? -12.116 -49.420  29.764  1.00 5.55  ? 28   TYR B CB    1 
ATOM   9571  C  CG    . TYR B 1 27   ? -13.245 -48.598  29.157  1.00 5.99  ? 28   TYR B CG    1 
ATOM   9572  C  CD1   . TYR B 1 27   ? -13.249 -48.298  27.803  1.00 6.49  ? 28   TYR B CD1   1 
ATOM   9573  C  CD2   . TYR B 1 27   ? -14.309 -48.140  29.923  1.00 5.29  ? 28   TYR B CD2   1 
ATOM   9574  C  CE1   . TYR B 1 27   ? -14.272 -47.579  27.230  1.00 6.12  ? 28   TYR B CE1   1 
ATOM   9575  C  CE2   . TYR B 1 27   ? -15.336 -47.414  29.353  1.00 5.21  ? 28   TYR B CE2   1 
ATOM   9576  C  CZ    . TYR B 1 27   ? -15.304 -47.143  28.002  1.00 5.82  ? 28   TYR B CZ    1 
ATOM   9577  O  OH    . TYR B 1 27   ? -16.298 -46.427  27.387  1.00 6.72  ? 28   TYR B OH    1 
ATOM   9578  N  N     . PRO B 1 28   ? -11.054 -46.358  30.861  1.00 3.72  ? 29   PRO B N     1 
ATOM   9579  C  CA    . PRO B 1 28   ? -11.174 -45.343  31.915  1.00 3.25  ? 29   PRO B CA    1 
ATOM   9580  C  C     . PRO B 1 28   ? -12.444 -45.256  32.761  1.00 3.11  ? 29   PRO B C     1 
ATOM   9581  O  O     . PRO B 1 28   ? -13.522 -45.049  32.240  1.00 3.70  ? 29   PRO B O     1 
ATOM   9582  C  CB    . PRO B 1 28   ? -10.918 -44.052  31.153  1.00 2.59  ? 29   PRO B CB    1 
ATOM   9583  C  CG    . PRO B 1 28   ? -11.505 -44.333  29.816  1.00 2.86  ? 29   PRO B CG    1 
ATOM   9584  C  CD    . PRO B 1 28   ? -10.991 -45.715  29.535  1.00 3.37  ? 29   PRO B CD    1 
ATOM   9585  N  N     . ILE B 1 29   ? -12.298 -45.393  34.077  1.00 3.16  ? 30   ILE B N     1 
ATOM   9586  C  CA    . ILE B 1 29   ? -13.420 -45.287  35.008  1.00 2.56  ? 30   ILE B CA    1 
ATOM   9587  C  C     . ILE B 1 29   ? -12.909 -44.726  36.351  1.00 2.59  ? 30   ILE B C     1 
ATOM   9588  O  O     . ILE B 1 29   ? -12.028 -45.302  36.962  1.00 2.96  ? 30   ILE B O     1 
ATOM   9589  C  CB    . ILE B 1 29   ? -14.217 -46.655  35.187  1.00 2.27  ? 30   ILE B CB    1 
ATOM   9590  C  CG1   . ILE B 1 29   ? -15.476 -46.409  36.025  1.00 2.04  ? 30   ILE B CG1   1 
ATOM   9591  C  CG2   . ILE B 1 29   ? -13.375 -47.722  35.866  1.00 2.00  ? 30   ILE B CG2   1 
ATOM   9592  C  CD1   . ILE B 1 29   ? -16.343 -47.585  36.259  1.00 2.00  ? 30   ILE B CD1   1 
ATOM   9593  N  N     . THR B 1 30   ? -13.423 -43.570  36.775  1.00 2.58  ? 31   THR B N     1 
ATOM   9594  C  CA    . THR B 1 30   ? -13.022 -42.917  38.044  1.00 2.54  ? 31   THR B CA    1 
ATOM   9595  C  C     . THR B 1 30   ? -13.397 -43.906  39.158  1.00 2.67  ? 31   THR B C     1 
ATOM   9596  O  O     . THR B 1 30   ? -14.443 -44.514  39.090  1.00 3.67  ? 31   THR B O     1 
ATOM   9597  C  CB    . THR B 1 30   ? -13.832 -41.591  38.278  1.00 2.05  ? 31   THR B CB    1 
ATOM   9598  O  OG1   . THR B 1 30   ? -13.769 -40.748  37.121  1.00 2.00  ? 31   THR B OG1   1 
ATOM   9599  C  CG2   . THR B 1 30   ? -13.313 -40.843  39.454  1.00 2.00  ? 31   THR B CG2   1 
ATOM   9600  N  N     . PRO B 1 31   ? -12.600 -44.013  40.214  1.00 2.34  ? 32   PRO B N     1 
ATOM   9601  C  CA    . PRO B 1 31   ? -11.372 -43.305  40.491  1.00 2.67  ? 32   PRO B CA    1 
ATOM   9602  C  C     . PRO B 1 31   ? -10.155 -44.033  39.976  1.00 3.05  ? 32   PRO B C     1 
ATOM   9603  O  O     . PRO B 1 31   ? -9.041  -43.535  40.149  1.00 4.38  ? 32   PRO B O     1 
ATOM   9604  C  CB    . PRO B 1 31   ? -11.326 -43.272  42.023  1.00 2.50  ? 32   PRO B CB    1 
ATOM   9605  C  CG    . PRO B 1 31   ? -12.441 -44.191  42.479  1.00 2.63  ? 32   PRO B CG    1 
ATOM   9606  C  CD    . PRO B 1 31   ? -12.856 -44.974  41.294  1.00 2.26  ? 32   PRO B CD    1 
ATOM   9607  N  N     . SER B 1 32   ? -10.341 -45.172  39.326  1.00 2.16  ? 33   SER B N     1 
ATOM   9608  C  CA    . SER B 1 32   ? -9.209  -45.957  38.861  1.00 2.00  ? 33   SER B CA    1 
ATOM   9609  C  C     . SER B 1 32   ? -8.543  -45.583  37.551  1.00 2.04  ? 33   SER B C     1 
ATOM   9610  O  O     . SER B 1 32   ? -7.556  -46.220  37.164  1.00 2.00  ? 33   SER B O     1 
ATOM   9611  C  CB    . SER B 1 32   ? -9.603  -47.410  38.785  1.00 2.00  ? 33   SER B CB    1 
ATOM   9612  O  OG    . SER B 1 32   ? -10.390 -47.628  37.645  1.00 2.00  ? 33   SER B OG    1 
ATOM   9613  N  N     . SER B 1 33   ? -9.026  -44.535  36.891  1.00 2.59  ? 34   SER B N     1 
ATOM   9614  C  CA    . SER B 1 33   ? -8.466  -44.113  35.597  1.00 3.12  ? 34   SER B CA    1 
ATOM   9615  C  C     . SER B 1 33   ? -6.969  -43.905  35.553  1.00 3.28  ? 34   SER B C     1 
ATOM   9616  O  O     . SER B 1 33   ? -6.320  -44.305  34.598  1.00 3.77  ? 34   SER B O     1 
ATOM   9617  C  CB    . SER B 1 33   ? -9.174  -42.873  35.089  1.00 3.10  ? 34   SER B CB    1 
ATOM   9618  O  OG    . SER B 1 33   ? -10.570 -43.119  35.054  1.00 4.85  ? 34   SER B OG    1 
ATOM   9619  N  N     . THR B 1 34   ? -6.418  -43.269  36.577  1.00 3.30  ? 35   THR B N     1 
ATOM   9620  C  CA    . THR B 1 34   ? -4.982  -43.028  36.656  1.00 3.35  ? 35   THR B CA    1 
ATOM   9621  C  C     . THR B 1 34   ? -4.164  -44.282  36.292  1.00 3.65  ? 35   THR B C     1 
ATOM   9622  O  O     . THR B 1 34   ? -3.558  -44.319  35.234  1.00 4.55  ? 35   THR B O     1 
ATOM   9623  C  CB    . THR B 1 34   ? -4.622  -42.561  38.052  1.00 3.10  ? 35   THR B CB    1 
ATOM   9624  O  OG1   . THR B 1 34   ? -5.406  -41.415  38.360  1.00 3.42  ? 35   THR B OG1   1 
ATOM   9625  C  CG2   . THR B 1 34   ? -3.194  -42.195  38.130  1.00 2.84  ? 35   THR B CG2   1 
ATOM   9626  N  N     . MET B 1 35   ? -4.210  -45.316  37.131  1.00 3.48  ? 36   MET B N     1 
ATOM   9627  C  CA    . MET B 1 35   ? -3.486  -46.563  36.910  1.00 3.27  ? 36   MET B CA    1 
ATOM   9628  C  C     . MET B 1 35   ? -3.278  -46.903  35.442  1.00 3.44  ? 36   MET B C     1 
ATOM   9629  O  O     . MET B 1 35   ? -2.151  -47.059  34.986  1.00 4.30  ? 36   MET B O     1 
ATOM   9630  C  CB    . MET B 1 35   ? -4.189  -47.749  37.602  1.00 2.99  ? 36   MET B CB    1 
ATOM   9631  C  CG    . MET B 1 35   ? -4.228  -47.694  39.140  1.00 2.63  ? 36   MET B CG    1 
ATOM   9632  S  SD    . MET B 1 35   ? -4.600  -49.260  39.982  1.00 2.00  ? 36   MET B SD    1 
ATOM   9633  C  CE    . MET B 1 35   ? -6.244  -49.300  39.942  1.00 2.00  ? 36   MET B CE    1 
ATOM   9634  N  N     . GLY B 1 36   ? -4.355  -46.977  34.679  1.00 3.41  ? 37   GLY B N     1 
ATOM   9635  C  CA    . GLY B 1 36   ? -4.220  -47.321  33.278  1.00 3.28  ? 37   GLY B CA    1 
ATOM   9636  C  C     . GLY B 1 36   ? -3.416  -46.304  32.494  1.00 3.58  ? 37   GLY B C     1 
ATOM   9637  O  O     . GLY B 1 36   ? -2.668  -46.666  31.596  1.00 4.21  ? 37   GLY B O     1 
ATOM   9638  N  N     . GLU B 1 37   ? -3.574  -45.028  32.828  1.00 3.70  ? 38   GLU B N     1 
ATOM   9639  C  CA    . GLU B 1 37   ? -2.881  -43.952  32.138  1.00 3.83  ? 38   GLU B CA    1 
ATOM   9640  C  C     . GLU B 1 37   ? -1.398  -43.948  32.446  1.00 4.29  ? 38   GLU B C     1 
ATOM   9641  O  O     . GLU B 1 37   ? -0.565  -43.677  31.578  1.00 4.44  ? 38   GLU B O     1 
ATOM   9642  C  CB    . GLU B 1 37   ? -3.529  -42.633  32.499  1.00 3.78  ? 38   GLU B CB    1 
ATOM   9643  C  CG    . GLU B 1 37   ? -5.028  -42.753  32.505  1.00 6.48  ? 38   GLU B CG    1 
ATOM   9644  C  CD    . GLU B 1 37   ? -5.750  -41.452  32.781  1.00 8.26  ? 38   GLU B CD    1 
ATOM   9645  O  OE1   . GLU B 1 37   ? -5.234  -40.388  32.372  1.00 8.90  ? 38   GLU B OE1   1 
ATOM   9646  O  OE2   . GLU B 1 37   ? -6.855  -41.495  33.381  1.00 8.80  ? 38   GLU B OE2   1 
ATOM   9647  N  N     . GLU B 1 38   ? -1.052  -44.253  33.685  1.00 4.43  ? 39   GLU B N     1 
ATOM   9648  C  CA    . GLU B 1 38   ? 0.342   -44.310  34.059  1.00 5.21  ? 39   GLU B CA    1 
ATOM   9649  C  C     . GLU B 1 38   ? 0.968   -45.550  33.403  1.00 6.39  ? 39   GLU B C     1 
ATOM   9650  O  O     . GLU B 1 38   ? 2.091   -45.498  32.889  1.00 7.29  ? 39   GLU B O     1 
ATOM   9651  C  CB    . GLU B 1 38   ? 0.466   -44.411  35.562  1.00 4.89  ? 39   GLU B CB    1 
ATOM   9652  C  CG    . GLU B 1 38   ? -0.133  -43.279  36.313  1.00 4.29  ? 39   GLU B CG    1 
ATOM   9653  C  CD    . GLU B 1 38   ? 0.256   -43.306  37.776  1.00 3.76  ? 39   GLU B CD    1 
ATOM   9654  O  OE1   . GLU B 1 38   ? 0.328   -44.394  38.368  1.00 3.34  ? 39   GLU B OE1   1 
ATOM   9655  O  OE2   . GLU B 1 38   ? 0.518   -42.230  38.328  1.00 3.81  ? 39   GLU B OE2   1 
ATOM   9656  N  N     . ALA B 1 39   ? 0.237   -46.663  33.422  1.00 7.00  ? 40   ALA B N     1 
ATOM   9657  C  CA    . ALA B 1 39   ? 0.709   -47.897  32.829  1.00 7.59  ? 40   ALA B CA    1 
ATOM   9658  C  C     . ALA B 1 39   ? 1.085   -47.558  31.413  1.00 8.35  ? 40   ALA B C     1 
ATOM   9659  O  O     . ALA B 1 39   ? 2.140   -47.926  30.944  1.00 8.67  ? 40   ALA B O     1 
ATOM   9660  C  CB    . ALA B 1 39   ? -0.369  -48.924  32.863  1.00 6.74  ? 40   ALA B CB    1 
ATOM   9661  N  N     . ASP B 1 40   ? 0.311   -46.659  30.826  1.00 10.01 ? 41   ASP B N     1 
ATOM   9662  C  CA    . ASP B 1 40   ? 0.509   -46.216  29.446  1.00 11.83 ? 41   ASP B CA    1 
ATOM   9663  C  C     . ASP B 1 40   ? 1.609   -45.171  29.167  1.00 12.27 ? 41   ASP B C     1 
ATOM   9664  O  O     . ASP B 1 40   ? 2.271   -45.232  28.136  1.00 12.72 ? 41   ASP B O     1 
ATOM   9665  C  CB    . ASP B 1 40   ? -0.822  -45.741  28.862  1.00 12.50 ? 41   ASP B CB    1 
ATOM   9666  C  CG    . ASP B 1 40   ? -0.727  -45.448  27.401  1.00 13.30 ? 41   ASP B CG    1 
ATOM   9667  O  OD1   . ASP B 1 40   ? -0.411  -46.388  26.648  1.00 14.35 ? 41   ASP B OD1   1 
ATOM   9668  O  OD2   . ASP B 1 40   ? -0.940  -44.281  27.003  1.00 14.94 ? 41   ASP B OD2   1 
ATOM   9669  N  N     . ASP B 1 41   ? 1.772   -44.188  30.044  1.00 12.44 ? 42   ASP B N     1 
ATOM   9670  C  CA    . ASP B 1 41   ? 2.803   -43.185  29.843  1.00 11.87 ? 42   ASP B CA    1 
ATOM   9671  C  C     . ASP B 1 41   ? 4.132   -43.830  30.038  1.00 11.23 ? 42   ASP B C     1 
ATOM   9672  O  O     . ASP B 1 41   ? 5.085   -43.521  29.330  1.00 11.62 ? 42   ASP B O     1 
ATOM   9673  C  CB    . ASP B 1 41   ? 2.674   -42.093  30.864  1.00 12.87 ? 42   ASP B CB    1 
ATOM   9674  C  CG    . ASP B 1 41   ? 1.493   -41.228  30.619  1.00 14.69 ? 42   ASP B CG    1 
ATOM   9675  O  OD1   . ASP B 1 41   ? 0.898   -41.318  29.510  1.00 15.11 ? 42   ASP B OD1   1 
ATOM   9676  O  OD2   . ASP B 1 41   ? 1.172   -40.440  31.541  1.00 15.52 ? 42   ASP B OD2   1 
ATOM   9677  N  N     . TRP B 1 42   ? 4.198   -44.675  31.060  1.00 10.11 ? 43   TRP B N     1 
ATOM   9678  C  CA    . TRP B 1 42   ? 5.405   -45.399  31.380  1.00 9.34  ? 43   TRP B CA    1 
ATOM   9679  C  C     . TRP B 1 42   ? 5.810   -46.251  30.206  1.00 9.62  ? 43   TRP B C     1 
ATOM   9680  O  O     . TRP B 1 42   ? 6.970   -46.258  29.791  1.00 9.78  ? 43   TRP B O     1 
ATOM   9681  C  CB    . TRP B 1 42   ? 5.158   -46.304  32.543  1.00 8.22  ? 43   TRP B CB    1 
ATOM   9682  C  CG    . TRP B 1 42   ? 4.875   -45.594  33.767  1.00 7.28  ? 43   TRP B CG    1 
ATOM   9683  C  CD1   . TRP B 1 42   ? 5.052   -44.269  34.010  1.00 6.81  ? 43   TRP B CD1   1 
ATOM   9684  C  CD2   . TRP B 1 42   ? 4.429   -46.178  34.987  1.00 6.96  ? 43   TRP B CD2   1 
ATOM   9685  N  NE1   . TRP B 1 42   ? 4.757   -43.992  35.329  1.00 6.47  ? 43   TRP B NE1   1 
ATOM   9686  C  CE2   . TRP B 1 42   ? 4.373   -45.153  35.947  1.00 6.93  ? 43   TRP B CE2   1 
ATOM   9687  C  CE3   . TRP B 1 42   ? 4.076   -47.478  35.363  1.00 6.21  ? 43   TRP B CE3   1 
ATOM   9688  C  CZ2   . TRP B 1 42   ? 3.983   -45.392  37.263  1.00 6.95  ? 43   TRP B CZ2   1 
ATOM   9689  C  CZ3   . TRP B 1 42   ? 3.692   -47.711  36.663  1.00 5.76  ? 43   TRP B CZ3   1 
ATOM   9690  C  CH2   . TRP B 1 42   ? 3.648   -46.679  37.598  1.00 6.16  ? 43   TRP B CH2   1 
ATOM   9691  N  N     . ALA B 1 43   ? 4.861   -46.998  29.672  1.00 9.68  ? 44   ALA B N     1 
ATOM   9692  C  CA    . ALA B 1 43   ? 5.190   -47.822  28.531  1.00 10.11 ? 44   ALA B CA    1 
ATOM   9693  C  C     . ALA B 1 43   ? 5.703   -46.917  27.439  1.00 10.56 ? 44   ALA B C     1 
ATOM   9694  O  O     . ALA B 1 43   ? 6.711   -47.206  26.839  1.00 11.48 ? 44   ALA B O     1 
ATOM   9695  C  CB    . ALA B 1 43   ? 4.006   -48.579  28.067  1.00 9.80  ? 44   ALA B CB    1 
ATOM   9696  N  N     . ALA B 1 44   ? 5.087   -45.756  27.271  1.00 11.35 ? 45   ALA B N     1 
ATOM   9697  C  CA    . ALA B 1 44   ? 5.516   -44.816  26.240  1.00 12.10 ? 45   ALA B CA    1 
ATOM   9698  C  C     . ALA B 1 44   ? 6.900   -44.232  26.485  1.00 12.54 ? 45   ALA B C     1 
ATOM   9699  O  O     . ALA B 1 44   ? 7.493   -43.632  25.587  1.00 12.73 ? 45   ALA B O     1 
ATOM   9700  C  CB    . ALA B 1 44   ? 4.510   -43.719  26.085  1.00 11.89 ? 45   ALA B CB    1 
ATOM   9701  N  N     . GLN B 1 45   ? 7.420   -44.427  27.690  1.00 13.37 ? 46   GLN B N     1 
ATOM   9702  C  CA    . GLN B 1 45   ? 8.742   -43.921  28.039  1.00 14.76 ? 46   GLN B CA    1 
ATOM   9703  C  C     . GLN B 1 45   ? 9.815   -45.037  28.100  1.00 14.90 ? 46   GLN B C     1 
ATOM   9704  O  O     . GLN B 1 45   ? 10.849  -44.916  28.759  1.00 15.45 ? 46   GLN B O     1 
ATOM   9705  C  CB    . GLN B 1 45   ? 8.649   -43.119  29.336  1.00 15.98 ? 46   GLN B CB    1 
ATOM   9706  C  CG    . GLN B 1 45   ? 7.605   -41.998  29.241  1.00 18.35 ? 46   GLN B CG    1 
ATOM   9707  C  CD    . GLN B 1 45   ? 7.219   -41.361  30.591  1.00 19.93 ? 46   GLN B CD    1 
ATOM   9708  O  OE1   . GLN B 1 45   ? 6.364   -40.461  30.631  1.00 20.51 ? 46   GLN B OE1   1 
ATOM   9709  N  NE2   . GLN B 1 45   ? 7.849   -41.813  31.693  1.00 19.99 ? 46   GLN B NE2   1 
ATOM   9710  N  N     . GLY B 1 46   ? 9.547   -46.134  27.401  1.00 14.68 ? 47   GLY B N     1 
ATOM   9711  C  CA    . GLY B 1 46   ? 10.489  -47.233  27.329  1.00 13.80 ? 47   GLY B CA    1 
ATOM   9712  C  C     . GLY B 1 46   ? 10.617  -48.094  28.558  1.00 13.28 ? 47   GLY B C     1 
ATOM   9713  O  O     . GLY B 1 46   ? 11.350  -49.089  28.539  1.00 14.22 ? 47   GLY B O     1 
ATOM   9714  N  N     . ARG B 1 47   ? 9.891   -47.749  29.610  1.00 11.99 ? 48   ARG B N     1 
ATOM   9715  C  CA    . ARG B 1 47   ? 9.950   -48.504  30.856  1.00 11.35 ? 48   ARG B CA    1 
ATOM   9716  C  C     . ARG B 1 47   ? 9.784   -50.007  30.667  1.00 11.02 ? 48   ARG B C     1 
ATOM   9717  O  O     . ARG B 1 47   ? 8.853   -50.469  29.990  1.00 10.85 ? 48   ARG B O     1 
ATOM   9718  C  CB    . ARG B 1 47   ? 8.886   -47.987  31.808  1.00 11.42 ? 48   ARG B CB    1 
ATOM   9719  C  CG    . ARG B 1 47   ? 9.032   -48.419  33.224  1.00 10.56 ? 48   ARG B CG    1 
ATOM   9720  C  CD    . ARG B 1 47   ? 8.379   -47.379  34.061  1.00 10.81 ? 48   ARG B CD    1 
ATOM   9721  N  NE    . ARG B 1 47   ? 7.848   -47.941  35.284  1.00 11.16 ? 48   ARG B NE    1 
ATOM   9722  C  CZ    . ARG B 1 47   ? 7.574   -47.225  36.362  1.00 12.44 ? 48   ARG B CZ    1 
ATOM   9723  N  NH1   . ARG B 1 47   ? 7.786   -45.916  36.377  1.00 13.58 ? 48   ARG B NH1   1 
ATOM   9724  N  NH2   . ARG B 1 47   ? 7.093   -47.817  37.439  1.00 13.78 ? 48   ARG B NH2   1 
ATOM   9725  N  N     . LYS B 1 48   ? 10.677  -50.772  31.293  1.00 10.48 ? 49   LYS B N     1 
ATOM   9726  C  CA    . LYS B 1 48   ? 10.615  -52.219  31.168  1.00 9.24  ? 49   LYS B CA    1 
ATOM   9727  C  C     . LYS B 1 48   ? 9.994   -52.965  32.358  1.00 7.67  ? 49   LYS B C     1 
ATOM   9728  O  O     . LYS B 1 48   ? 10.115  -52.553  33.512  1.00 7.20  ? 49   LYS B O     1 
ATOM   9729  C  CB    . LYS B 1 48   ? 12.014  -52.753  30.841  1.00 10.51 ? 49   LYS B CB    1 
ATOM   9730  C  CG    . LYS B 1 48   ? 12.648  -52.146  29.546  1.00 12.47 ? 49   LYS B CG    1 
ATOM   9731  C  CD    . LYS B 1 48   ? 11.695  -52.198  28.313  1.00 14.30 ? 49   LYS B CD    1 
ATOM   9732  C  CE    . LYS B 1 48   ? 12.383  -51.917  26.936  1.00 15.29 ? 49   LYS B CE    1 
ATOM   9733  N  NZ    . LYS B 1 48   ? 12.350  -53.064  25.903  1.00 15.88 ? 49   LYS B NZ    1 
ATOM   9734  N  N     . ASN B 1 49   ? 9.256   -54.024  32.050  1.00 5.94  ? 50   ASN B N     1 
ATOM   9735  C  CA    . ASN B 1 49   ? 8.640   -54.867  33.068  1.00 4.71  ? 50   ASN B CA    1 
ATOM   9736  C  C     . ASN B 1 49   ? 9.708   -55.885  33.530  1.00 3.66  ? 50   ASN B C     1 
ATOM   9737  O  O     . ASN B 1 49   ? 10.846  -55.815  33.104  1.00 3.28  ? 50   ASN B O     1 
ATOM   9738  C  CB    . ASN B 1 49   ? 7.391   -55.572  32.496  1.00 3.97  ? 50   ASN B CB    1 
ATOM   9739  C  CG    . ASN B 1 49   ? 7.709   -56.448  31.310  1.00 3.39  ? 50   ASN B CG    1 
ATOM   9740  O  OD1   . ASN B 1 49   ? 8.866   -56.752  31.042  1.00 2.81  ? 50   ASN B OD1   1 
ATOM   9741  N  ND2   . ASN B 1 49   ? 6.689   -56.843  30.583  1.00 3.47  ? 50   ASN B ND2   1 
ATOM   9742  N  N     . ILE B 1 50   ? 9.361   -56.858  34.357  1.00 2.95  ? 51   ILE B N     1 
ATOM   9743  C  CA    . ILE B 1 50   ? 10.378  -57.799  34.805  1.00 2.43  ? 51   ILE B CA    1 
ATOM   9744  C  C     . ILE B 1 50   ? 11.031  -58.675  33.736  1.00 2.11  ? 51   ILE B C     1 
ATOM   9745  O  O     . ILE B 1 50   ? 12.021  -59.337  34.000  1.00 2.20  ? 51   ILE B O     1 
ATOM   9746  C  CB    . ILE B 1 50   ? 9.890   -58.682  35.976  1.00 2.00  ? 51   ILE B CB    1 
ATOM   9747  C  CG1   . ILE B 1 50   ? 8.601   -59.416  35.598  1.00 2.00  ? 51   ILE B CG1   1 
ATOM   9748  C  CG2   . ILE B 1 50   ? 9.747   -57.839  37.211  1.00 2.00  ? 51   ILE B CG2   1 
ATOM   9749  C  CD1   . ILE B 1 50   ? 8.308   -60.631  36.450  1.00 2.00  ? 51   ILE B CD1   1 
ATOM   9750  N  N     . PHE B 1 51   ? 10.467  -58.714  32.541  1.00 2.08  ? 52   PHE B N     1 
ATOM   9751  C  CA    . PHE B 1 51   ? 11.031  -59.541  31.483  1.00 2.00  ? 52   PHE B CA    1 
ATOM   9752  C  C     . PHE B 1 51   ? 11.829  -58.655  30.566  1.00 2.34  ? 52   PHE B C     1 
ATOM   9753  O  O     . PHE B 1 51   ? 12.232  -59.070  29.487  1.00 2.99  ? 52   PHE B O     1 
ATOM   9754  C  CB    . PHE B 1 51   ? 9.933   -60.214  30.669  1.00 2.00  ? 52   PHE B CB    1 
ATOM   9755  C  CG    . PHE B 1 51   ? 8.921   -60.937  31.489  1.00 2.00  ? 52   PHE B CG    1 
ATOM   9756  C  CD1   . PHE B 1 51   ? 7.794   -60.285  31.947  1.00 2.75  ? 52   PHE B CD1   1 
ATOM   9757  C  CD2   . PHE B 1 51   ? 9.077   -62.273  31.780  1.00 2.00  ? 52   PHE B CD2   1 
ATOM   9758  C  CE1   . PHE B 1 51   ? 6.834   -60.961  32.687  1.00 2.76  ? 52   PHE B CE1   1 
ATOM   9759  C  CE2   . PHE B 1 51   ? 8.141   -62.959  32.506  1.00 2.00  ? 52   PHE B CE2   1 
ATOM   9760  C  CZ    . PHE B 1 51   ? 7.010   -62.303  32.963  1.00 2.84  ? 52   PHE B CZ    1 
ATOM   9761  N  N     . GLY B 1 52   ? 11.975  -57.399  30.956  1.00 2.44  ? 53   GLY B N     1 
ATOM   9762  C  CA    . GLY B 1 52   ? 12.741  -56.462  30.171  1.00 2.42  ? 53   GLY B CA    1 
ATOM   9763  C  C     . GLY B 1 52   ? 12.009  -55.877  28.989  1.00 3.27  ? 53   GLY B C     1 
ATOM   9764  O  O     . GLY B 1 52   ? 12.643  -55.198  28.170  1.00 3.53  ? 53   GLY B O     1 
ATOM   9765  N  N     . GLN B 1 53   ? 10.694  -56.108  28.906  1.00 3.60  ? 54   GLN B N     1 
ATOM   9766  C  CA    . GLN B 1 53   ? 9.866   -55.592  27.817  1.00 3.87  ? 54   GLN B CA    1 
ATOM   9767  C  C     . GLN B 1 53   ? 8.941   -54.473  28.231  1.00 3.72  ? 54   GLN B C     1 
ATOM   9768  O  O     . GLN B 1 53   ? 8.532   -54.419  29.372  1.00 3.45  ? 54   GLN B O     1 
ATOM   9769  C  CB    . GLN B 1 53   ? 8.983   -56.702  27.273  1.00 5.29  ? 54   GLN B CB    1 
ATOM   9770  C  CG    . GLN B 1 53   ? 9.734   -57.902  26.866  1.00 7.31  ? 54   GLN B CG    1 
ATOM   9771  C  CD    . GLN B 1 53   ? 10.917  -57.515  26.066  1.00 8.35  ? 54   GLN B CD    1 
ATOM   9772  O  OE1   . GLN B 1 53   ? 10.800  -56.723  25.132  1.00 9.49  ? 54   GLN B OE1   1 
ATOM   9773  N  NE2   . GLN B 1 53   ? 12.088  -58.000  26.461  1.00 9.09  ? 54   GLN B NE2   1 
ATOM   9774  N  N     . THR B 1 54   ? 8.596   -53.587  27.301  1.00 4.40  ? 55   THR B N     1 
ATOM   9775  C  CA    . THR B 1 54   ? 7.641   -52.524  27.619  1.00 5.75  ? 55   THR B CA    1 
ATOM   9776  C  C     . THR B 1 54   ? 6.251   -53.174  27.561  1.00 5.84  ? 55   THR B C     1 
ATOM   9777  O  O     . THR B 1 54   ? 6.055   -54.136  26.815  1.00 6.78  ? 55   THR B O     1 
ATOM   9778  C  CB    . THR B 1 54   ? 7.665   -51.374  26.605  1.00 6.16  ? 55   THR B CB    1 
ATOM   9779  O  OG1   . THR B 1 54   ? 7.352   -51.882  25.310  1.00 7.51  ? 55   THR B OG1   1 
ATOM   9780  C  CG2   . THR B 1 54   ? 9.008   -50.720  26.571  1.00 6.31  ? 55   THR B CG2   1 
ATOM   9781  N  N     . LEU B 1 55   ? 5.284   -52.629  28.302  1.00 5.63  ? 56   LEU B N     1 
ATOM   9782  C  CA    . LEU B 1 55   ? 3.924   -53.180  28.368  1.00 5.28  ? 56   LEU B CA    1 
ATOM   9783  C  C     . LEU B 1 55   ? 3.082   -52.932  27.140  1.00 5.18  ? 56   LEU B C     1 
ATOM   9784  O  O     . LEU B 1 55   ? 3.207   -51.899  26.502  1.00 5.09  ? 56   LEU B O     1 
ATOM   9785  C  CB    . LEU B 1 55   ? 3.196   -52.614  29.589  1.00 5.47  ? 56   LEU B CB    1 
ATOM   9786  C  CG    . LEU B 1 55   ? 1.812   -53.175  29.920  1.00 5.46  ? 56   LEU B CG    1 
ATOM   9787  C  CD1   . LEU B 1 55   ? 2.002   -54.610  30.316  1.00 6.08  ? 56   LEU B CD1   1 
ATOM   9788  C  CD2   . LEU B 1 55   ? 1.130   -52.412  31.047  1.00 4.42  ? 56   LEU B CD2   1 
ATOM   9789  N  N     . THR B 1 56   ? 2.231   -53.892  26.800  1.00 5.42  ? 57   THR B N     1 
ATOM   9790  C  CA    . THR B 1 56   ? 1.345   -53.743  25.655  1.00 5.81  ? 57   THR B CA    1 
ATOM   9791  C  C     . THR B 1 56   ? 0.007   -53.303  26.197  1.00 6.21  ? 57   THR B C     1 
ATOM   9792  O  O     . THR B 1 56   ? -0.711  -54.098  26.781  1.00 6.80  ? 57   THR B O     1 
ATOM   9793  C  CB    . THR B 1 56   ? 1.136   -55.067  24.908  1.00 5.75  ? 57   THR B CB    1 
ATOM   9794  O  OG1   . THR B 1 56   ? 2.395   -55.671  24.632  1.00 6.32  ? 57   THR B OG1   1 
ATOM   9795  C  CG2   . THR B 1 56   ? 0.461   -54.817  23.585  1.00 6.02  ? 57   THR B CG2   1 
ATOM   9796  N  N     . ILE B 1 57   ? -0.327  -52.033  26.050  1.00 6.56  ? 58   ILE B N     1 
ATOM   9797  C  CA    . ILE B 1 57   ? -1.606  -51.570  26.547  1.00 7.51  ? 58   ILE B CA    1 
ATOM   9798  C  C     . ILE B 1 57   ? -2.446  -51.281  25.345  1.00 8.11  ? 58   ILE B C     1 
ATOM   9799  O  O     . ILE B 1 57   ? -1.927  -50.853  24.330  1.00 9.21  ? 58   ILE B O     1 
ATOM   9800  C  CB    . ILE B 1 57   ? -1.498  -50.224  27.275  1.00 8.37  ? 58   ILE B CB    1 
ATOM   9801  C  CG1   . ILE B 1 57   ? -0.165  -50.101  27.997  1.00 10.03 ? 58   ILE B CG1   1 
ATOM   9802  C  CG2   . ILE B 1 57   ? -2.581  -50.091  28.315  1.00 8.64  ? 58   ILE B CG2   1 
ATOM   9803  C  CD1   . ILE B 1 57   ? 0.932   -49.550  27.122  1.00 11.50 ? 58   ILE B CD1   1 
ATOM   9804  N  N     . ARG B 1 58   ? -3.736  -51.573  25.421  1.00 8.52  ? 59   ARG B N     1 
ATOM   9805  C  CA    . ARG B 1 58   ? -4.662  -51.245  24.338  1.00 8.72  ? 59   ARG B CA    1 
ATOM   9806  C  C     . ARG B 1 58   ? -5.938  -50.751  25.025  1.00 8.22  ? 59   ARG B C     1 
ATOM   9807  O  O     . ARG B 1 58   ? -6.249  -51.185  26.136  1.00 8.33  ? 59   ARG B O     1 
ATOM   9808  C  CB    . ARG B 1 58   ? -4.949  -52.465  23.470  1.00 9.85  ? 59   ARG B CB    1 
ATOM   9809  C  CG    . ARG B 1 58   ? -3.720  -53.066  22.816  1.00 12.19 ? 59   ARG B CG    1 
ATOM   9810  C  CD    . ARG B 1 58   ? -3.133  -52.215  21.691  1.00 13.25 ? 59   ARG B CD    1 
ATOM   9811  N  NE    . ARG B 1 58   ? -1.788  -52.696  21.367  1.00 15.84 ? 59   ARG B NE    1 
ATOM   9812  C  CZ    . ARG B 1 58   ? -0.729  -51.899  21.209  1.00 17.10 ? 59   ARG B CZ    1 
ATOM   9813  N  NH1   . ARG B 1 58   ? -0.867  -50.577  21.315  1.00 17.91 ? 59   ARG B NH1   1 
ATOM   9814  N  NH2   . ARG B 1 58   ? 0.487   -52.418  21.056  1.00 16.88 ? 59   ARG B NH2   1 
ATOM   9815  N  N     . GLU B 1 59   ? -6.632  -49.793  24.424  1.00 7.62  ? 60   GLU B N     1 
ATOM   9816  C  CA    . GLU B 1 59   ? -7.863  -49.298  25.033  1.00 6.91  ? 60   GLU B CA    1 
ATOM   9817  C  C     . GLU B 1 59   ? -9.073  -49.899  24.347  1.00 7.02  ? 60   GLU B C     1 
ATOM   9818  O  O     . GLU B 1 59   ? -9.214  -49.780  23.123  1.00 7.98  ? 60   GLU B O     1 
ATOM   9819  C  CB    . GLU B 1 59   ? -7.964  -47.792  24.930  1.00 6.43  ? 60   GLU B CB    1 
ATOM   9820  C  CG    . GLU B 1 59   ? -9.188  -47.245  25.632  1.00 5.20  ? 60   GLU B CG    1 
ATOM   9821  C  CD    . GLU B 1 59   ? -9.292  -45.741  25.512  1.00 4.74  ? 60   GLU B CD    1 
ATOM   9822  O  OE1   . GLU B 1 59   ? -8.982  -45.209  24.434  1.00 4.56  ? 60   GLU B OE1   1 
ATOM   9823  O  OE2   . GLU B 1 59   ? -9.680  -45.083  26.493  1.00 5.08  ? 60   GLU B OE2   1 
ATOM   9824  N  N     . MET B 1 60   ? -9.943  -50.546  25.120  1.00 5.72  ? 61   MET B N     1 
ATOM   9825  C  CA    . MET B 1 60   ? -11.142 -51.142  24.558  1.00 4.24  ? 61   MET B CA    1 
ATOM   9826  C  C     . MET B 1 60   ? -12.326 -50.157  24.491  1.00 3.80  ? 61   MET B C     1 
ATOM   9827  O  O     . MET B 1 60   ? -12.205 -49.000  24.897  1.00 3.27  ? 61   MET B O     1 
ATOM   9828  C  CB    . MET B 1 60   ? -11.500 -52.409  25.315  1.00 3.71  ? 61   MET B CB    1 
ATOM   9829  C  CG    . MET B 1 60   ? -10.427 -53.449  25.220  1.00 3.33  ? 61   MET B CG    1 
ATOM   9830  S  SD    . MET B 1 60   ? -9.741  -53.599  23.568  1.00 4.02  ? 61   MET B SD    1 
ATOM   9831  C  CE    . MET B 1 60   ? -10.943 -54.693  22.686  1.00 2.18  ? 61   MET B CE    1 
ATOM   9832  N  N     . GLN B 1 61   ? -13.444 -50.628  23.935  1.00 3.17  ? 62   GLN B N     1 
ATOM   9833  C  CA    . GLN B 1 61   ? -14.656 -49.837  23.738  1.00 2.64  ? 62   GLN B CA    1 
ATOM   9834  C  C     . GLN B 1 61   ? -15.504 -49.716  24.961  1.00 2.75  ? 62   GLN B C     1 
ATOM   9835  O  O     . GLN B 1 61   ? -16.430 -48.910  25.000  1.00 2.52  ? 62   GLN B O     1 
ATOM   9836  C  CB    . GLN B 1 61   ? -15.517 -50.439  22.642  1.00 2.30  ? 62   GLN B CB    1 
ATOM   9837  C  CG    . GLN B 1 61   ? -16.451 -51.543  23.111  1.00 2.21  ? 62   GLN B CG    1 
ATOM   9838  C  CD    . GLN B 1 61   ? -15.776 -52.882  23.285  1.00 2.00  ? 62   GLN B CD    1 
ATOM   9839  O  OE1   . GLN B 1 61   ? -14.583 -52.964  23.505  1.00 2.19  ? 62   GLN B OE1   1 
ATOM   9840  N  NE2   . GLN B 1 61   ? -16.542 -53.939  23.170  1.00 2.00  ? 62   GLN B NE2   1 
ATOM   9841  N  N     . SER B 1 62   ? -15.240 -50.621  25.897  1.00 3.06  ? 63   SER B N     1 
ATOM   9842  C  CA    . SER B 1 62   ? -15.931 -50.721  27.179  1.00 3.10  ? 63   SER B CA    1 
ATOM   9843  C  C     . SER B 1 62   ? -15.098 -51.706  28.006  1.00 3.24  ? 63   SER B C     1 
ATOM   9844  O  O     . SER B 1 62   ? -14.236 -52.421  27.478  1.00 2.86  ? 63   SER B O     1 
ATOM   9845  C  CB    . SER B 1 62   ? -17.342 -51.286  26.989  1.00 3.12  ? 63   SER B CB    1 
ATOM   9846  O  OG    . SER B 1 62   ? -17.323 -52.700  26.991  1.00 2.63  ? 63   SER B OG    1 
ATOM   9847  N  N     . GLU B 1 63   ? -15.385 -51.786  29.295  1.00 3.23  ? 64   GLU B N     1 
ATOM   9848  C  CA    . GLU B 1 63   ? -14.617 -52.665  30.142  1.00 4.06  ? 64   GLU B CA    1 
ATOM   9849  C  C     . GLU B 1 63   ? -15.046 -54.108  30.065  1.00 4.37  ? 64   GLU B C     1 
ATOM   9850  O  O     . GLU B 1 63   ? -14.460 -55.002  30.692  1.00 5.02  ? 64   GLU B O     1 
ATOM   9851  C  CB    . GLU B 1 63   ? -14.607 -52.174  31.567  1.00 4.84  ? 64   GLU B CB    1 
ATOM   9852  C  CG    . GLU B 1 63   ? -15.923 -51.716  31.995  1.00 6.13  ? 64   GLU B CG    1 
ATOM   9853  C  CD    . GLU B 1 63   ? -16.026 -50.217  32.037  1.00 6.97  ? 64   GLU B CD    1 
ATOM   9854  O  OE1   . GLU B 1 63   ? -15.149 -49.552  32.632  1.00 7.35  ? 64   GLU B OE1   1 
ATOM   9855  O  OE2   . GLU B 1 63   ? -17.023 -49.690  31.537  1.00 8.75  ? 64   GLU B OE2   1 
ATOM   9856  N  N     . ALA B 1 64   ? -16.072 -54.356  29.280  1.00 4.34  ? 65   ALA B N     1 
ATOM   9857  C  CA    . ALA B 1 64   ? -16.510 -55.712  29.106  1.00 3.88  ? 65   ALA B CA    1 
ATOM   9858  C  C     . ALA B 1 64   ? -15.606 -56.172  27.981  1.00 4.06  ? 65   ALA B C     1 
ATOM   9859  O  O     . ALA B 1 64   ? -15.086 -57.275  28.006  1.00 4.00  ? 65   ALA B O     1 
ATOM   9860  C  CB    . ALA B 1 64   ? -17.910 -55.728  28.701  1.00 4.22  ? 65   ALA B CB    1 
ATOM   9861  N  N     . GLY B 1 65   ? -15.379 -55.278  27.019  1.00 3.83  ? 66   GLY B N     1 
ATOM   9862  C  CA    . GLY B 1 65   ? -14.474 -55.564  25.928  1.00 2.74  ? 66   GLY B CA    1 
ATOM   9863  C  C     . GLY B 1 65   ? -13.122 -55.801  26.583  1.00 2.23  ? 66   GLY B C     1 
ATOM   9864  O  O     . GLY B 1 65   ? -12.511 -56.810  26.310  1.00 2.45  ? 66   GLY B O     1 
ATOM   9865  N  N     . ALA B 1 66   ? -12.683 -54.912  27.477  1.00 2.00  ? 67   ALA B N     1 
ATOM   9866  C  CA    . ALA B 1 66   ? -11.419 -55.084  28.200  1.00 2.00  ? 67   ALA B CA    1 
ATOM   9867  C  C     . ALA B 1 66   ? -11.382 -56.403  28.985  1.00 2.13  ? 67   ALA B C     1 
ATOM   9868  O  O     . ALA B 1 66   ? -10.329 -57.036  29.116  1.00 2.00  ? 67   ALA B O     1 
ATOM   9869  C  CB    . ALA B 1 66   ? -11.186 -53.922  29.139  1.00 2.00  ? 67   ALA B CB    1 
ATOM   9870  N  N     . ALA B 1 67   ? -12.525 -56.819  29.522  1.00 2.26  ? 68   ALA B N     1 
ATOM   9871  C  CA    . ALA B 1 67   ? -12.577 -58.065  30.276  1.00 2.46  ? 68   ALA B CA    1 
ATOM   9872  C  C     . ALA B 1 67   ? -12.310 -59.206  29.336  1.00 2.66  ? 68   ALA B C     1 
ATOM   9873  O  O     . ALA B 1 67   ? -11.552 -60.106  29.647  1.00 3.65  ? 68   ALA B O     1 
ATOM   9874  C  CB    . ALA B 1 67   ? -13.906 -58.243  30.890  1.00 2.42  ? 68   ALA B CB    1 
ATOM   9875  N  N     . GLY B 1 68   ? -12.927 -59.159  28.168  1.00 2.44  ? 69   GLY B N     1 
ATOM   9876  C  CA    . GLY B 1 68   ? -12.727 -60.208  27.193  1.00 2.29  ? 69   GLY B CA    1 
ATOM   9877  C  C     . GLY B 1 68   ? -11.335 -60.218  26.591  1.00 2.14  ? 69   GLY B C     1 
ATOM   9878  O  O     . GLY B 1 68   ? -10.822 -61.274  26.237  1.00 2.30  ? 69   GLY B O     1 
ATOM   9879  N  N     . ALA B 1 69   ? -10.727 -59.046  26.469  1.00 2.00  ? 70   ALA B N     1 
ATOM   9880  C  CA    . ALA B 1 69   ? -9.404  -58.945  25.904  1.00 2.00  ? 70   ALA B CA    1 
ATOM   9881  C  C     . ALA B 1 69   ? -8.470  -59.533  26.917  1.00 2.23  ? 70   ALA B C     1 
ATOM   9882  O  O     . ALA B 1 69   ? -7.582  -60.303  26.564  1.00 2.33  ? 70   ALA B O     1 
ATOM   9883  C  CB    . ALA B 1 69   ? -9.067  -57.546  25.653  1.00 2.00  ? 70   ALA B CB    1 
ATOM   9884  N  N     . VAL B 1 70   ? -8.689  -59.196  28.189  1.00 2.76  ? 71   VAL B N     1 
ATOM   9885  C  CA    . VAL B 1 70   ? -7.872  -59.737  29.274  1.00 3.04  ? 71   VAL B CA    1 
ATOM   9886  C  C     . VAL B 1 70   ? -7.981  -61.259  29.259  1.00 3.56  ? 71   VAL B C     1 
ATOM   9887  O  O     . VAL B 1 70   ? -6.990  -61.955  29.446  1.00 4.57  ? 71   VAL B O     1 
ATOM   9888  C  CB    . VAL B 1 70   ? -8.297  -59.194  30.641  1.00 2.83  ? 71   VAL B CB    1 
ATOM   9889  C  CG1   . VAL B 1 70   ? -7.716  -60.018  31.738  1.00 2.51  ? 71   VAL B CG1   1 
ATOM   9890  C  CG2   . VAL B 1 70   ? -7.789  -57.788  30.810  1.00 3.12  ? 71   VAL B CG2   1 
ATOM   9891  N  N     . HIS B 1 71   ? -9.168  -61.777  28.974  1.00 3.68  ? 72   HIS B N     1 
ATOM   9892  C  CA    . HIS B 1 71   ? -9.354  -63.225  28.919  1.00 3.76  ? 72   HIS B CA    1 
ATOM   9893  C  C     . HIS B 1 71   ? -8.572  -63.891  27.768  1.00 3.87  ? 72   HIS B C     1 
ATOM   9894  O  O     . HIS B 1 71   ? -7.851  -64.861  27.985  1.00 4.42  ? 72   HIS B O     1 
ATOM   9895  C  CB    . HIS B 1 71   ? -10.843 -63.550  28.831  1.00 3.17  ? 72   HIS B CB    1 
ATOM   9896  C  CG    . HIS B 1 71   ? -11.137 -65.013  28.724  1.00 2.80  ? 72   HIS B CG    1 
ATOM   9897  N  ND1   . HIS B 1 71   ? -12.293 -65.492  28.151  1.00 2.00  ? 72   HIS B ND1   1 
ATOM   9898  C  CD2   . HIS B 1 71   ? -10.422 -66.099  29.096  1.00 2.16  ? 72   HIS B CD2   1 
ATOM   9899  C  CE1   . HIS B 1 71   ? -12.271 -66.812  28.165  1.00 2.00  ? 72   HIS B CE1   1 
ATOM   9900  N  NE2   . HIS B 1 71   ? -11.148 -67.208  28.731  1.00 2.00  ? 72   HIS B NE2   1 
ATOM   9901  N  N     . GLY B 1 72   ? -8.729  -63.387  26.547  1.00 4.20  ? 73   GLY B N     1 
ATOM   9902  C  CA    . GLY B 1 72   ? -8.016  -63.950  25.408  1.00 4.22  ? 73   GLY B CA    1 
ATOM   9903  C  C     . GLY B 1 72   ? -6.498  -63.906  25.512  1.00 4.48  ? 73   GLY B C     1 
ATOM   9904  O  O     . GLY B 1 72   ? -5.820  -64.796  25.033  1.00 4.33  ? 73   GLY B O     1 
ATOM   9905  N  N     . ALA B 1 73   ? -5.968  -62.877  26.163  1.00 4.66  ? 74   ALA B N     1 
ATOM   9906  C  CA    . ALA B 1 73   ? -4.522  -62.723  26.334  1.00 4.28  ? 74   ALA B CA    1 
ATOM   9907  C  C     . ALA B 1 73   ? -3.982  -63.832  27.207  1.00 3.81  ? 74   ALA B C     1 
ATOM   9908  O  O     . ALA B 1 73   ? -3.071  -64.539  26.795  1.00 4.55  ? 74   ALA B O     1 
ATOM   9909  C  CB    . ALA B 1 73   ? -4.200  -61.366  26.948  1.00 4.55  ? 74   ALA B CB    1 
ATOM   9910  N  N     . LEU B 1 74   ? -4.548  -63.978  28.406  1.00 3.33  ? 75   LEU B N     1 
ATOM   9911  C  CA    . LEU B 1 74   ? -4.157  -65.023  29.369  1.00 2.92  ? 75   LEU B CA    1 
ATOM   9912  C  C     . LEU B 1 74   ? -4.256  -66.403  28.740  1.00 3.17  ? 75   LEU B C     1 
ATOM   9913  O  O     . LEU B 1 74   ? -3.387  -67.264  28.904  1.00 3.04  ? 75   LEU B O     1 
ATOM   9914  C  CB    . LEU B 1 74   ? -5.087  -64.983  30.578  1.00 2.34  ? 75   LEU B CB    1 
ATOM   9915  C  CG    . LEU B 1 74   ? -4.784  -63.866  31.551  1.00 2.00  ? 75   LEU B CG    1 
ATOM   9916  C  CD1   . LEU B 1 74   ? -5.943  -63.646  32.483  1.00 2.00  ? 75   LEU B CD1   1 
ATOM   9917  C  CD2   . LEU B 1 74   ? -3.500  -64.209  32.269  1.00 2.00  ? 75   LEU B CD2   1 
ATOM   9918  N  N     . ALA B 1 75   ? -5.370  -66.624  28.062  1.00 3.20  ? 76   ALA B N     1 
ATOM   9919  C  CA    . ALA B 1 75   ? -5.585  -67.870  27.386  1.00 2.92  ? 76   ALA B CA    1 
ATOM   9920  C  C     . ALA B 1 75   ? -4.367  -68.045  26.481  1.00 2.93  ? 76   ALA B C     1 
ATOM   9921  O  O     . ALA B 1 75   ? -3.653  -69.027  26.595  1.00 3.22  ? 76   ALA B O     1 
ATOM   9922  C  CB    . ALA B 1 75   ? -6.860  -67.788  26.578  1.00 2.71  ? 76   ALA B CB    1 
ATOM   9923  N  N     . ALA B 1 76   ? -4.038  -67.007  25.714  1.00 2.94  ? 77   ALA B N     1 
ATOM   9924  C  CA    . ALA B 1 76   ? -2.915  -67.041  24.788  1.00 2.56  ? 77   ALA B CA    1 
ATOM   9925  C  C     . ALA B 1 76   ? -1.517  -66.979  25.395  1.00 3.15  ? 77   ALA B C     1 
ATOM   9926  O  O     . ALA B 1 76   ? -0.562  -66.637  24.699  1.00 4.16  ? 77   ALA B O     1 
ATOM   9927  C  CB    . ALA B 1 76   ? -3.067  -65.974  23.768  1.00 2.00  ? 77   ALA B CB    1 
ATOM   9928  N  N     . GLY B 1 77   ? -1.373  -67.283  26.681  1.00 3.09  ? 78   GLY B N     1 
ATOM   9929  C  CA    . GLY B 1 77   ? -0.052  -67.260  27.273  1.00 2.53  ? 78   GLY B CA    1 
ATOM   9930  C  C     . GLY B 1 77   ? 0.517   -66.007  27.908  1.00 3.18  ? 78   GLY B C     1 
ATOM   9931  O  O     . GLY B 1 77   ? 1.487   -66.132  28.649  1.00 4.13  ? 78   GLY B O     1 
ATOM   9932  N  N     . ALA B 1 78   ? 0.015   -64.807  27.636  1.00 2.87  ? 79   ALA B N     1 
ATOM   9933  C  CA    . ALA B 1 78   ? 0.617   -63.631  28.283  1.00 3.21  ? 79   ALA B CA    1 
ATOM   9934  C  C     . ALA B 1 78   ? 0.073   -63.389  29.702  1.00 3.66  ? 79   ALA B C     1 
ATOM   9935  O  O     . ALA B 1 78   ? -1.042  -63.796  29.985  1.00 5.31  ? 79   ALA B O     1 
ATOM   9936  C  CB    . ALA B 1 78   ? 0.396   -62.419  27.436  1.00 2.52  ? 79   ALA B CB    1 
ATOM   9937  N  N     . LEU B 1 79   ? 0.876   -62.855  30.629  1.00 3.18  ? 80   LEU B N     1 
ATOM   9938  C  CA    . LEU B 1 79   ? 0.366   -62.542  31.976  1.00 2.92  ? 80   LEU B CA    1 
ATOM   9939  C  C     . LEU B 1 79   ? -0.368  -61.202  31.743  1.00 2.85  ? 80   LEU B C     1 
ATOM   9940  O  O     . LEU B 1 79   ? 0.183   -60.322  31.086  1.00 2.88  ? 80   LEU B O     1 
ATOM   9941  C  CB    . LEU B 1 79   ? 1.499   -62.383  33.014  1.00 2.22  ? 80   LEU B CB    1 
ATOM   9942  C  CG    . LEU B 1 79   ? 2.412   -63.546  33.415  1.00 2.00  ? 80   LEU B CG    1 
ATOM   9943  C  CD1   . LEU B 1 79   ? 3.556   -63.008  34.238  1.00 2.00  ? 80   LEU B CD1   1 
ATOM   9944  C  CD2   . LEU B 1 79   ? 1.663   -64.632  34.183  1.00 2.00  ? 80   LEU B CD2   1 
ATOM   9945  N  N     . THR B 1 80   ? -1.549  -60.996  32.327  1.00 2.61  ? 81   THR B N     1 
ATOM   9946  C  CA    . THR B 1 80   ? -2.303  -59.772  32.028  1.00 2.17  ? 81   THR B CA    1 
ATOM   9947  C  C     . THR B 1 80   ? -2.930  -59.058  33.218  1.00 2.00  ? 81   THR B C     1 
ATOM   9948  O  O     . THR B 1 80   ? -3.081  -59.656  34.261  1.00 2.00  ? 81   THR B O     1 
ATOM   9949  C  CB    . THR B 1 80   ? -3.439  -60.132  31.038  1.00 2.13  ? 81   THR B CB    1 
ATOM   9950  O  OG1   . THR B 1 80   ? -2.890  -60.822  29.912  1.00 2.00  ? 81   THR B OG1   1 
ATOM   9951  C  CG2   . THR B 1 80   ? -4.145  -58.909  30.546  1.00 2.24  ? 81   THR B CG2   1 
ATOM   9952  N  N     . THR B 1 81   ? -3.294  -57.783  33.047  1.00 2.00  ? 82   THR B N     1 
ATOM   9953  C  CA    . THR B 1 81   ? -3.949  -56.990  34.105  1.00 2.16  ? 82   THR B CA    1 
ATOM   9954  C  C     . THR B 1 81   ? -5.003  -56.059  33.567  1.00 2.73  ? 82   THR B C     1 
ATOM   9955  O  O     . THR B 1 81   ? -5.126  -55.866  32.355  1.00 3.72  ? 82   THR B O     1 
ATOM   9956  C  CB    . THR B 1 81   ? -3.056  -55.990  34.775  1.00 2.00  ? 82   THR B CB    1 
ATOM   9957  O  OG1   . THR B 1 81   ? -1.696  -56.383  34.657  1.00 2.55  ? 82   THR B OG1   1 
ATOM   9958  C  CG2   . THR B 1 81   ? -3.425  -55.899  36.222  1.00 2.00  ? 82   THR B CG2   1 
ATOM   9959  N  N     . THR B 1 82   ? -5.692  -55.404  34.492  1.00 2.00  ? 83   THR B N     1 
ATOM   9960  C  CA    . THR B 1 82   ? -6.694  -54.448  34.149  1.00 2.00  ? 83   THR B CA    1 
ATOM   9961  C  C     . THR B 1 82   ? -7.047  -53.695  35.402  1.00 2.00  ? 83   THR B C     1 
ATOM   9962  O  O     . THR B 1 82   ? -6.942  -54.193  36.499  1.00 2.00  ? 83   THR B O     1 
ATOM   9963  C  CB    . THR B 1 82   ? -7.923  -55.093  33.540  1.00 2.00  ? 83   THR B CB    1 
ATOM   9964  O  OG1   . THR B 1 82   ? -8.698  -54.094  32.877  1.00 2.00  ? 83   THR B OG1   1 
ATOM   9965  C  CG2   . THR B 1 82   ? -8.765  -55.693  34.605  1.00 2.74  ? 83   THR B CG2   1 
ATOM   9966  N  N     . PHE B 1 83   ? -7.486  -52.473  35.222  1.00 2.34  ? 84   PHE B N     1 
ATOM   9967  C  CA    . PHE B 1 83   ? -7.818  -51.628  36.337  1.00 2.34  ? 84   PHE B CA    1 
ATOM   9968  C  C     . PHE B 1 83   ? -9.264  -51.283  36.126  1.00 2.00  ? 84   PHE B C     1 
ATOM   9969  O  O     . PHE B 1 83   ? -9.643  -50.988  35.001  1.00 2.00  ? 84   PHE B O     1 
ATOM   9970  C  CB    . PHE B 1 83   ? -6.929  -50.384  36.255  1.00 2.77  ? 84   PHE B CB    1 
ATOM   9971  C  CG    . PHE B 1 83   ? -5.468  -50.700  35.982  1.00 3.37  ? 84   PHE B CG    1 
ATOM   9972  C  CD1   . PHE B 1 83   ? -4.606  -51.033  37.036  1.00 3.49  ? 84   PHE B CD1   1 
ATOM   9973  C  CD2   . PHE B 1 83   ? -4.969  -50.708  34.689  1.00 2.39  ? 84   PHE B CD2   1 
ATOM   9974  C  CE1   . PHE B 1 83   ? -3.277  -51.374  36.811  1.00 2.82  ? 84   PHE B CE1   1 
ATOM   9975  C  CE2   . PHE B 1 83   ? -3.643  -51.045  34.458  1.00 3.28  ? 84   PHE B CE2   1 
ATOM   9976  C  CZ    . PHE B 1 83   ? -2.789  -51.383  35.531  1.00 2.71  ? 84   PHE B CZ    1 
ATOM   9977  N  N     . THR B 1 84   ? -10.066 -51.314  37.188  1.00 2.00  ? 85   THR B N     1 
ATOM   9978  C  CA    . THR B 1 84   ? -11.487 -51.006  37.058  1.00 2.17  ? 85   THR B CA    1 
ATOM   9979  C  C     . THR B 1 84   ? -12.179 -50.662  38.391  1.00 2.36  ? 85   THR B C     1 
ATOM   9980  O  O     . THR B 1 84   ? -11.565 -50.742  39.438  1.00 2.26  ? 85   THR B O     1 
ATOM   9981  C  CB    . THR B 1 84   ? -12.205 -52.187  36.384  1.00 2.33  ? 85   THR B CB    1 
ATOM   9982  O  OG1   . THR B 1 84   ? -13.440 -51.736  35.823  1.00 2.95  ? 85   THR B OG1   1 
ATOM   9983  C  CG2   . THR B 1 84   ? -12.457 -53.303  37.379  1.00 2.00  ? 85   THR B CG2   1 
ATOM   9984  N  N     . ALA B 1 85   ? -13.436 -50.229  38.340  1.00 2.25  ? 86   ALA B N     1 
ATOM   9985  C  CA    . ALA B 1 85   ? -14.190 -49.901  39.559  1.00 2.73  ? 86   ALA B CA    1 
ATOM   9986  C  C     . ALA B 1 85   ? -15.694 -50.042  39.310  1.00 3.10  ? 86   ALA B C     1 
ATOM   9987  O  O     . ALA B 1 85   ? -16.108 -50.254  38.179  1.00 3.86  ? 86   ALA B O     1 
ATOM   9988  C  CB    . ALA B 1 85   ? -13.863 -48.505  40.031  1.00 3.05  ? 86   ALA B CB    1 
ATOM   9989  N  N     . SER B 1 86   ? -16.505 -49.864  40.345  1.00 2.56  ? 87   SER B N     1 
ATOM   9990  C  CA    . SER B 1 86   ? -17.953 -50.028  40.273  1.00 2.12  ? 87   SER B CA    1 
ATOM   9991  C  C     . SER B 1 86   ? -18.580 -50.607  39.024  1.00 2.00  ? 87   SER B C     1 
ATOM   9992  O  O     . SER B 1 86   ? -18.474 -51.804  38.822  1.00 2.00  ? 87   SER B O     1 
ATOM   9993  C  CB    . SER B 1 86   ? -18.690 -48.772  40.710  1.00 2.49  ? 87   SER B CB    1 
ATOM   9994  O  OG    . SER B 1 86   ? -18.524 -47.738  39.784  1.00 2.67  ? 87   SER B OG    1 
ATOM   9995  N  N     . GLN B 1 87   ? -19.212 -49.797  38.173  1.00 2.23  ? 88   GLN B N     1 
ATOM   9996  C  CA    . GLN B 1 87   ? -19.875 -50.365  36.990  1.00 3.30  ? 88   GLN B CA    1 
ATOM   9997  C  C     . GLN B 1 87   ? -18.914 -51.089  36.052  1.00 3.15  ? 88   GLN B C     1 
ATOM   9998  O  O     . GLN B 1 87   ? -19.254 -52.121  35.458  1.00 3.78  ? 88   GLN B O     1 
ATOM   9999  C  CB    . GLN B 1 87   ? -20.702 -49.342  36.181  1.00 4.36  ? 88   GLN B CB    1 
ATOM   10000 C  CG    . GLN B 1 87   ? -21.250 -48.072  36.897  1.00 6.22  ? 88   GLN B CG    1 
ATOM   10001 C  CD    . GLN B 1 87   ? -22.188 -48.340  38.071  1.00 6.86  ? 88   GLN B CD    1 
ATOM   10002 O  OE1   . GLN B 1 87   ? -22.083 -47.695  39.116  1.00 7.20  ? 88   GLN B OE1   1 
ATOM   10003 N  NE2   . GLN B 1 87   ? -23.105 -49.282  37.903  1.00 7.58  ? 88   GLN B NE2   1 
ATOM   10004 N  N     . GLY B 1 88   ? -17.704 -50.569  35.931  1.00 2.60  ? 89   GLY B N     1 
ATOM   10005 C  CA    . GLY B 1 88   ? -16.727 -51.191  35.074  1.00 2.00  ? 89   GLY B CA    1 
ATOM   10006 C  C     . GLY B 1 88   ? -16.535 -52.598  35.536  1.00 2.00  ? 89   GLY B C     1 
ATOM   10007 O  O     . GLY B 1 88   ? -16.551 -53.520  34.750  1.00 2.00  ? 89   GLY B O     1 
ATOM   10008 N  N     . LEU B 1 89   ? -16.443 -52.771  36.839  1.00 2.00  ? 90   LEU B N     1 
ATOM   10009 C  CA    . LEU B 1 89   ? -16.249 -54.089  37.387  1.00 2.00  ? 90   LEU B CA    1 
ATOM   10010 C  C     . LEU B 1 89   ? -17.416 -54.986  37.095  1.00 2.04  ? 90   LEU B C     1 
ATOM   10011 O  O     . LEU B 1 89   ? -17.214 -56.100  36.635  1.00 2.00  ? 90   LEU B O     1 
ATOM   10012 C  CB    . LEU B 1 89   ? -16.027 -54.011  38.860  1.00 2.00  ? 90   LEU B CB    1 
ATOM   10013 C  CG    . LEU B 1 89   ? -15.637 -55.335  39.430  1.00 2.00  ? 90   LEU B CG    1 
ATOM   10014 C  CD1   . LEU B 1 89   ? -14.282 -55.759  38.981  1.00 2.00  ? 90   LEU B CD1   1 
ATOM   10015 C  CD2   . LEU B 1 89   ? -15.626 -55.106  40.874  1.00 2.63  ? 90   LEU B CD2   1 
ATOM   10016 N  N     . LEU B 1 90   ? -18.635 -54.507  37.338  1.00 2.23  ? 91   LEU B N     1 
ATOM   10017 C  CA    . LEU B 1 90   ? -19.832 -55.301  37.061  1.00 2.43  ? 91   LEU B CA    1 
ATOM   10018 C  C     . LEU B 1 90   ? -19.809 -55.838  35.633  1.00 2.95  ? 91   LEU B C     1 
ATOM   10019 O  O     . LEU B 1 90   ? -20.188 -56.986  35.393  1.00 4.18  ? 91   LEU B O     1 
ATOM   10020 C  CB    . LEU B 1 90   ? -21.102 -54.480  37.262  1.00 2.14  ? 91   LEU B CB    1 
ATOM   10021 C  CG    . LEU B 1 90   ? -21.490 -54.211  38.716  1.00 2.36  ? 91   LEU B CG    1 
ATOM   10022 C  CD1   . LEU B 1 90   ? -22.691 -53.302  38.763  1.00 2.00  ? 91   LEU B CD1   1 
ATOM   10023 C  CD2   . LEU B 1 90   ? -21.781 -55.508  39.424  1.00 2.00  ? 91   LEU B CD2   1 
ATOM   10024 N  N     . LEU B 1 91   ? -19.345 -55.029  34.686  1.00 2.70  ? 92   LEU B N     1 
ATOM   10025 C  CA    . LEU B 1 91   ? -19.274 -55.479  33.298  1.00 2.10  ? 92   LEU B CA    1 
ATOM   10026 C  C     . LEU B 1 91   ? -18.239 -56.546  33.075  1.00 2.00  ? 92   LEU B C     1 
ATOM   10027 O  O     . LEU B 1 91   ? -18.239 -57.199  32.043  1.00 2.00  ? 92   LEU B O     1 
ATOM   10028 C  CB    . LEU B 1 91   ? -18.985 -54.328  32.341  1.00 2.00  ? 92   LEU B CB    1 
ATOM   10029 C  CG    . LEU B 1 91   ? -20.031 -53.225  32.271  1.00 2.00  ? 92   LEU B CG    1 
ATOM   10030 C  CD1   . LEU B 1 91   ? -19.910 -52.518  30.961  1.00 2.00  ? 92   LEU B CD1   1 
ATOM   10031 C  CD2   . LEU B 1 91   ? -21.394 -53.840  32.364  1.00 2.36  ? 92   LEU B CD2   1 
ATOM   10032 N  N     . MET B 1 92   ? -17.316 -56.707  34.007  1.00 2.