data_2PEG
# 
_entry.id   2PEG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2PEG         
RCSB  RCSB042286   
WWPDB D_1000042286 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1LA6 'Crystal structure of tetrameric hemoglobin in a partial hemichrome state'       unspecified 
PDB 1S5Y 'Crystal structure of Trematomus bernacchii hemoglobin oxidized by ferricyanide' unspecified 
PDB 1S5X 'Crystal structure of Trematomus bernacchii hemoglobin oxidized by air'          unspecified 
# 
_pdbx_database_status.entry_id                        2PEG 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-03 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vergara, A.'    1 
'Franzese, M.'   2 
'Merlino, A.'    3 
'Vitagliano, L.' 4 
'Mazzarella, L.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural characterization of ferric hemoglobins from three antarctic fish species of the suborder notothenioidei.' 
Biophys.J.             93  2822 2829 2007 BIOJAU US 0006-3495 0030 ? 17545238 10.1529/biophysj.107.105700 
1       'The crystal structure of a tetrameric hemoglobin in a partial hemichrome state'                                      
Proc.Natl.Acad.Sci.USA 99  9801 9806 2002 PNASA6 US 0027-8424 0040 ? ?        ?                           
2       'The oxidation process of Antarctic fish hemoglobins'                                                                 
Eur.J.Biochem.         271 1651 1659 2004 EJBCAI IX 0014-2956 0262 ? ?        ?                           
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Vergara, A.'    1  ? 
primary 'Franzese, M.'   2  ? 
primary 'Merlino, A.'    3  ? 
primary 'Vitagliano, L.' 4  ? 
primary 'Verde, C.'      5  ? 
primary 'di Prisco, G.'  6  ? 
primary 'Lee, H.C.'      7  ? 
primary 'Peisach, J.'    8  ? 
primary 'Mazzarella, L.' 9  ? 
1       'Riccio, A.'     10 ? 
1       'Vitagliano, L.' 11 ? 
1       'di Prisco, G.'  12 ? 
1       'Zagari, A.'     13 ? 
1       'Mazzarella, L.' 14 ? 
2       'Vitagliano, L.' 15 ? 
2       'Bonomi, G.'     16 ? 
2       'Riccio, A.'     17 ? 
2       'di Prisco, G.'  18 ? 
2       'Smulevich, G.'  19 ? 
2       'Mazzarella, L.' 20 ? 
# 
_cell.length_a           87.160 
_cell.length_b           87.740 
_cell.length_c           55.380 
_cell.angle_alpha        90.000 
_cell.angle_beta         97.660 
_cell.angle_gamma        90.000 
_cell.entry_id           2PEG 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.entry_id                         2PEG 
_symmetry.Int_Tables_number                5 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Hemoglobin subunit alpha'        15683.271 1   ? ? ? ? 
2 polymer     nat 'Hemoglobin subunit beta'         16153.368 1   ? ? ? ? 
3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   2   ? ? ? ? 
4 water       nat water                             18.015    215 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Hemoglobin alpha chain, Alpha-globin' 
2 'Hemoglobin beta chain, Beta-globin'   
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;(ACE)SLSDKDKAAVRALWSKIGKSADAIGNDALSRMIVVYPQTKTYFSHWPDVTPGSPHIKAHGKKVMGGIALAVSKID
DLKTGLMELSEQHAYKLRVDPANFKILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR
;
;XSLSDKDKAAVRALWSKIGKSADAIGNDALSRMIVVYPQTKTYFSHWPDVTPGSPHIKAHGKKVMGGIALAVSKIDDLKT
GLMELSEQHAYKLRVDPANFKILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR
;
A ? 
2 'polypeptide(L)' no no  
;VEWTDKERSIISDIFSHMDYDDIGPKALSRCLIVYPWTQRHFSGFGNLYNAEAIIGNANVAAHGIKVLHGLDRGVKNMDN
IAATYADLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAVVVSALGKQYH
;
;VEWTDKERSIISDIFSHMDYDDIGPKALSRCLIVYPWTQRHFSGFGNLYNAEAIIGNANVAAHGIKVLHGLDRGVKNMDN
IAATYADLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAVVVSALGKQYH
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ACE n 
1 2   SER n 
1 3   LEU n 
1 4   SER n 
1 5   ASP n 
1 6   LYS n 
1 7   ASP n 
1 8   LYS n 
1 9   ALA n 
1 10  ALA n 
1 11  VAL n 
1 12  ARG n 
1 13  ALA n 
1 14  LEU n 
1 15  TRP n 
1 16  SER n 
1 17  LYS n 
1 18  ILE n 
1 19  GLY n 
1 20  LYS n 
1 21  SER n 
1 22  ALA n 
1 23  ASP n 
1 24  ALA n 
1 25  ILE n 
1 26  GLY n 
1 27  ASN n 
1 28  ASP n 
1 29  ALA n 
1 30  LEU n 
1 31  SER n 
1 32  ARG n 
1 33  MET n 
1 34  ILE n 
1 35  VAL n 
1 36  VAL n 
1 37  TYR n 
1 38  PRO n 
1 39  GLN n 
1 40  THR n 
1 41  LYS n 
1 42  THR n 
1 43  TYR n 
1 44  PHE n 
1 45  SER n 
1 46  HIS n 
1 47  TRP n 
1 48  PRO n 
1 49  ASP n 
1 50  VAL n 
1 51  THR n 
1 52  PRO n 
1 53  GLY n 
1 54  SER n 
1 55  PRO n 
1 56  HIS n 
1 57  ILE n 
1 58  LYS n 
1 59  ALA n 
1 60  HIS n 
1 61  GLY n 
1 62  LYS n 
1 63  LYS n 
1 64  VAL n 
1 65  MET n 
1 66  GLY n 
1 67  GLY n 
1 68  ILE n 
1 69  ALA n 
1 70  LEU n 
1 71  ALA n 
1 72  VAL n 
1 73  SER n 
1 74  LYS n 
1 75  ILE n 
1 76  ASP n 
1 77  ASP n 
1 78  LEU n 
1 79  LYS n 
1 80  THR n 
1 81  GLY n 
1 82  LEU n 
1 83  MET n 
1 84  GLU n 
1 85  LEU n 
1 86  SER n 
1 87  GLU n 
1 88  GLN n 
1 89  HIS n 
1 90  ALA n 
1 91  TYR n 
1 92  LYS n 
1 93  LEU n 
1 94  ARG n 
1 95  VAL n 
1 96  ASP n 
1 97  PRO n 
1 98  ALA n 
1 99  ASN n 
1 100 PHE n 
1 101 LYS n 
1 102 ILE n 
1 103 LEU n 
1 104 ASN n 
1 105 HIS n 
1 106 CYS n 
1 107 ILE n 
1 108 LEU n 
1 109 VAL n 
1 110 VAL n 
1 111 ILE n 
1 112 SER n 
1 113 THR n 
1 114 MET n 
1 115 PHE n 
1 116 PRO n 
1 117 LYS n 
1 118 GLU n 
1 119 PHE n 
1 120 THR n 
1 121 PRO n 
1 122 GLU n 
1 123 ALA n 
1 124 HIS n 
1 125 VAL n 
1 126 SER n 
1 127 LEU n 
1 128 ASP n 
1 129 LYS n 
1 130 PHE n 
1 131 LEU n 
1 132 SER n 
1 133 GLY n 
1 134 VAL n 
1 135 ALA n 
1 136 LEU n 
1 137 ALA n 
1 138 LEU n 
1 139 ALA n 
1 140 GLU n 
1 141 ARG n 
1 142 TYR n 
1 143 ARG n 
2 1   VAL n 
2 2   GLU n 
2 3   TRP n 
2 4   THR n 
2 5   ASP n 
2 6   LYS n 
2 7   GLU n 
2 8   ARG n 
2 9   SER n 
2 10  ILE n 
2 11  ILE n 
2 12  SER n 
2 13  ASP n 
2 14  ILE n 
2 15  PHE n 
2 16  SER n 
2 17  HIS n 
2 18  MET n 
2 19  ASP n 
2 20  TYR n 
2 21  ASP n 
2 22  ASP n 
2 23  ILE n 
2 24  GLY n 
2 25  PRO n 
2 26  LYS n 
2 27  ALA n 
2 28  LEU n 
2 29  SER n 
2 30  ARG n 
2 31  CYS n 
2 32  LEU n 
2 33  ILE n 
2 34  VAL n 
2 35  TYR n 
2 36  PRO n 
2 37  TRP n 
2 38  THR n 
2 39  GLN n 
2 40  ARG n 
2 41  HIS n 
2 42  PHE n 
2 43  SER n 
2 44  GLY n 
2 45  PHE n 
2 46  GLY n 
2 47  ASN n 
2 48  LEU n 
2 49  TYR n 
2 50  ASN n 
2 51  ALA n 
2 52  GLU n 
2 53  ALA n 
2 54  ILE n 
2 55  ILE n 
2 56  GLY n 
2 57  ASN n 
2 58  ALA n 
2 59  ASN n 
2 60  VAL n 
2 61  ALA n 
2 62  ALA n 
2 63  HIS n 
2 64  GLY n 
2 65  ILE n 
2 66  LYS n 
2 67  VAL n 
2 68  LEU n 
2 69  HIS n 
2 70  GLY n 
2 71  LEU n 
2 72  ASP n 
2 73  ARG n 
2 74  GLY n 
2 75  VAL n 
2 76  LYS n 
2 77  ASN n 
2 78  MET n 
2 79  ASP n 
2 80  ASN n 
2 81  ILE n 
2 82  ALA n 
2 83  ALA n 
2 84  THR n 
2 85  TYR n 
2 86  ALA n 
2 87  ASP n 
2 88  LEU n 
2 89  SER n 
2 90  THR n 
2 91  LEU n 
2 92  HIS n 
2 93  SER n 
2 94  GLU n 
2 95  LYS n 
2 96  LEU n 
2 97  HIS n 
2 98  VAL n 
2 99  ASP n 
2 100 PRO n 
2 101 ASP n 
2 102 ASN n 
2 103 PHE n 
2 104 LYS n 
2 105 LEU n 
2 106 LEU n 
2 107 SER n 
2 108 ASP n 
2 109 CYS n 
2 110 ILE n 
2 111 THR n 
2 112 ILE n 
2 113 VAL n 
2 114 LEU n 
2 115 ALA n 
2 116 ALA n 
2 117 LYS n 
2 118 MET n 
2 119 GLY n 
2 120 HIS n 
2 121 ALA n 
2 122 PHE n 
2 123 THR n 
2 124 ALA n 
2 125 GLU n 
2 126 THR n 
2 127 GLN n 
2 128 GLY n 
2 129 ALA n 
2 130 PHE n 
2 131 GLN n 
2 132 LYS n 
2 133 PHE n 
2 134 LEU n 
2 135 ALA n 
2 136 VAL n 
2 137 VAL n 
2 138 VAL n 
2 139 SER n 
2 140 ALA n 
2 141 LEU n 
2 142 GLY n 
2 143 LYS n 
2 144 GLN n 
2 145 TYR n 
2 146 HIS n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? 'emerald rockcod' 'Trematomus bernacchii' 40690 Trematomus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? 'emerald rockcod' 'Trematomus bernacchii' 40690 Trematomus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP HBA_PAGBE P80043 1 
;SLSDKDKAAVRALWSKIGKSADAIGNDALSRMIVVYPQTKTYFSHWPDVTPGSPHIKAHGKKVMGGIALAVSKIDDLKTG
LMELSEQHAYKLRVDPANFKILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR
;
1 ? 
2 UNP HBB_PAGBE P80044 2 
;MVEWTDKERSIISDIFSHMDYDDIGPKALSRCLIVYPWTQRHFSGFGNLYNAEAIIGNANVAAHGIKVLHGLDRGVKNMD
NIAATYADLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAVVVSALGKQYH
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2PEG A 2 ? 143 ? P80043 1 ? 142 ? 1 142 
2 2 2PEG B 1 ? 146 ? P80044 2 ? 147 ? 1 146 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'                    ?    'C2 H4 O'          44.053  
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?    'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?    'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2PEG 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.28 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   62.55 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'LIQUID DIFFUSION' 
_exptl_crystal_grow.pH              7.6 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    'PEG MME 5000, TRIS-HCL, pH 7.6, LIQUID DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2005-04-01 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    MIRRORS 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.20000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ELETTRA BEAMLINE 5.2R' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.20000 
_diffrn_source.pdbx_synchrotron_site       ELETTRA 
_diffrn_source.pdbx_synchrotron_beamline   5.2R 
# 
_reflns.entry_id                     2PEG 
_reflns.d_resolution_high            1.48 
_reflns.d_resolution_low             30.000 
_reflns.number_obs                   74461 
_reflns.pdbx_Rmerge_I_obs            0.035 
_reflns.pdbx_netI_over_sigmaI        29 
_reflns.pdbx_chi_squared             2.764 
_reflns.percent_possible_obs         99.4 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.48 
_reflns_shell.d_res_low              1.53 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.227 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       0.676 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2PEG 
_refine.ls_d_res_high                            1.48 
_refine.ls_d_res_low                             30.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     74461 
_refine.ls_number_reflns_obs                     68285 
_refine.ls_number_reflns_R_free                  7517 
_refine.ls_percent_reflns_obs                    99.4 
_refine.ls_R_factor_all                          0.207 
_refine.ls_R_factor_obs                          0.203 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.234 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1S5Y' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2236 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         89 
_refine_hist.number_atoms_solvent             215 
_refine_hist.number_atoms_total               2540 
_refine_hist.d_res_high                       1.48 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d    0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg 0.900 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2PEG 
_struct.title                     'Crystal structure of Trematomus bernacchii hemoglobin in a partial hemichrome state' 
_struct.pdbx_descriptor           'Hemoglobin subunit alpha, Hemoglobin subunit beta' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2PEG 
_struct_keywords.pdbx_keywords   'OXYGEN STORAGE/TRANSPORT' 
_struct_keywords.text            'hemichrome, R/Tintermediate quaternary structure, OXYGEN STORAGE-TRANSPORT COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 4   ? GLY A 19  ? SER A 3   GLY A 18  1 ? 16 
HELX_P HELX_P2  2  SER A 21  ? TYR A 37  ? SER A 20  TYR A 36  1 ? 17 
HELX_P HELX_P3  3  PRO A 38  ? SER A 45  ? PRO A 37  SER A 44  5 ? 8  
HELX_P HELX_P4  4  SER A 54  ? LYS A 74  ? SER A 53  LYS A 73  1 ? 21 
HELX_P HELX_P5  5  ASP A 77  ? LEU A 82  ? ASP A 76  LEU A 81  1 ? 6  
HELX_P HELX_P6  6  LEU A 82  ? LYS A 92  ? LEU A 81  LYS A 91  1 ? 11 
HELX_P HELX_P7  7  ASP A 96  ? ALA A 98  ? ASP A 95  ALA A 97  5 ? 3  
HELX_P HELX_P8  8  ASN A 99  ? PHE A 115 ? ASN A 98  PHE A 114 1 ? 17 
HELX_P HELX_P9  9  THR A 120 ? ALA A 139 ? THR A 119 ALA A 138 1 ? 20 
HELX_P HELX_P10 10 GLU A 140 ? ARG A 143 ? GLU A 139 ARG A 142 5 ? 4  
HELX_P HELX_P11 11 THR B 4   ? HIS B 17  ? THR B 4   HIS B 17  1 ? 14 
HELX_P HELX_P12 12 ASP B 19  ? TYR B 35  ? ASP B 19  TYR B 35  1 ? 17 
HELX_P HELX_P13 13 PRO B 36  ? SER B 43  ? PRO B 36  SER B 43  5 ? 8  
HELX_P HELX_P14 14 ASN B 50  ? ASN B 57  ? ASN B 50  ASN B 57  1 ? 8  
HELX_P HELX_P15 15 ASN B 57  ? ASN B 77  ? ASN B 57  ASN B 77  1 ? 21 
HELX_P HELX_P16 16 ASN B 80  ? TYR B 85  ? ASN B 80  TYR B 85  1 ? 6  
HELX_P HELX_P17 17 TYR B 85  ? LYS B 95  ? TYR B 85  LYS B 95  1 ? 11 
HELX_P HELX_P18 18 ASP B 101 ? GLY B 119 ? ASP B 101 GLY B 119 1 ? 19 
HELX_P HELX_P19 19 HIS B 120 ? PHE B 122 ? HIS B 120 PHE B 122 5 ? 3  
HELX_P HELX_P20 20 THR B 123 ? LYS B 143 ? THR B 123 LYS B 143 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ?    ? A HIS 89 NE2 ? ? ? 1_555 C HEM . FE ? ? A HIS 88  A HEM 200  1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc2 metalc ?    ? B HIS 63 NE2 ? ? ? 1_555 D HEM . FE ? ? B HIS 63  B HEM 400  1_555 ? ? ? ? ? ? ? 2.018 ? 
metalc3 metalc ?    ? B HIS 92 NE2 ? ? ? 1_555 D HEM . FE ? ? B HIS 92  B HEM 400  1_555 ? ? ? ? ? ? ? 1.982 ? 
covale1 covale both ? A ACE 1  C   ? ? ? 1_555 A SER 2 N  ? ? A ACE 0   A SER 1    1_555 ? ? ? ? ? ? ? 1.321 ? 
metalc4 metalc ?    ? C HEM .  FE  ? ? ? 1_555 E HOH . O  ? ? A HEM 200 A HOH 1072 1_555 ? ? ? ? ? ? ? 2.010 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE HEM A 200' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE HEM B 400' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 TYR A 43  ? TYR A 42   . ? 1_555 ? 
2  AC1 15 PHE A 44  ? PHE A 43   . ? 1_555 ? 
3  AC1 15 HIS A 46  ? HIS A 45   . ? 1_555 ? 
4  AC1 15 TRP A 47  ? TRP A 46   . ? 1_555 ? 
5  AC1 15 HIS A 60  ? HIS A 59   . ? 1_555 ? 
6  AC1 15 LYS A 63  ? LYS A 62   . ? 1_555 ? 
7  AC1 15 VAL A 64  ? VAL A 63   . ? 1_555 ? 
8  AC1 15 GLN A 88  ? GLN A 87   . ? 1_555 ? 
9  AC1 15 HIS A 89  ? HIS A 88   . ? 1_555 ? 
10 AC1 15 LEU A 93  ? LEU A 92   . ? 1_555 ? 
11 AC1 15 VAL A 95  ? VAL A 94   . ? 1_555 ? 
12 AC1 15 ASN A 99  ? ASN A 98   . ? 1_555 ? 
13 AC1 15 LEU A 103 ? LEU A 102  . ? 1_555 ? 
14 AC1 15 LEU A 138 ? LEU A 137  . ? 1_555 ? 
15 AC1 15 HOH E .   ? HOH A 1072 . ? 1_555 ? 
16 AC2 11 HIS B 41  ? HIS B 41   . ? 1_555 ? 
17 AC2 11 PHE B 42  ? PHE B 42   . ? 1_555 ? 
18 AC2 11 HIS B 63  ? HIS B 63   . ? 1_555 ? 
19 AC2 11 LYS B 66  ? LYS B 66   . ? 1_555 ? 
20 AC2 11 VAL B 67  ? VAL B 67   . ? 1_555 ? 
21 AC2 11 LEU B 91  ? LEU B 91   . ? 1_555 ? 
22 AC2 11 HIS B 92  ? HIS B 92   . ? 1_555 ? 
23 AC2 11 LEU B 96  ? LEU B 96   . ? 1_555 ? 
24 AC2 11 PHE B 103 ? PHE B 103  . ? 1_555 ? 
25 AC2 11 LEU B 141 ? LEU B 141  . ? 1_555 ? 
26 AC2 11 HOH F .   ? HOH B 1054 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2PEG 
_atom_sites.fract_transf_matrix[1][1]   0.011473 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001543 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011397 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018220 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1    C  C   . ACE A 1 1   ? 4.131   -16.305 -4.953  1.00 19.41 ? 0    ACE A C   1 
HETATM 2    O  O   . ACE A 1 1   ? 5.069   -16.133 -4.109  1.00 19.66 ? 0    ACE A O   1 
HETATM 3    C  CH3 . ACE A 1 1   ? 3.409   -15.138 -5.663  1.00 19.20 ? 0    ACE A CH3 1 
ATOM   4    N  N   . SER A 1 2   ? 3.718   -17.513 -5.292  1.00 18.65 ? 1    SER A N   1 
ATOM   5    C  CA  . SER A 1 2   ? 4.330   -18.695 -4.699  1.00 18.03 ? 1    SER A CA  1 
ATOM   6    C  C   . SER A 1 2   ? 5.796   -18.848 -5.181  1.00 17.31 ? 1    SER A C   1 
ATOM   7    O  O   . SER A 1 2   ? 6.164   -18.387 -6.267  1.00 17.21 ? 1    SER A O   1 
ATOM   8    C  CB  . SER A 1 2   ? 3.504   -19.934 -5.075  1.00 18.15 ? 1    SER A CB  1 
ATOM   9    O  OG  . SER A 1 2   ? 3.693   -20.211 -6.437  1.00 17.81 ? 1    SER A OG  1 
ATOM   10   N  N   . LEU A 1 3   ? 6.626   -19.482 -4.355  1.00 16.49 ? 2    LEU A N   1 
ATOM   11   C  CA  . LEU A 1 3   ? 8.017   -19.696 -4.655  1.00 15.80 ? 2    LEU A CA  1 
ATOM   12   C  C   . LEU A 1 3   ? 8.227   -20.904 -5.535  1.00 16.08 ? 2    LEU A C   1 
ATOM   13   O  O   . LEU A 1 3   ? 7.799   -22.012 -5.208  1.00 16.29 ? 2    LEU A O   1 
ATOM   14   C  CB  . LEU A 1 3   ? 8.795   -19.873 -3.372  1.00 15.43 ? 2    LEU A CB  1 
ATOM   15   C  CG  . LEU A 1 3   ? 8.714   -18.668 -2.441  1.00 15.14 ? 2    LEU A CG  1 
ATOM   16   C  CD1 . LEU A 1 3   ? 9.428   -18.988 -1.105  1.00 14.68 ? 2    LEU A CD1 1 
ATOM   17   C  CD2 . LEU A 1 3   ? 9.365   -17.446 -3.144  1.00 15.61 ? 2    LEU A CD2 1 
ATOM   18   N  N   . SER A 1 4   ? 8.882   -20.697 -6.672  1.00 15.94 ? 3    SER A N   1 
ATOM   19   C  CA  . SER A 1 4   ? 9.149   -21.795 -7.594  1.00 16.00 ? 3    SER A CA  1 
ATOM   20   C  C   . SER A 1 4   ? 10.430  -22.518 -7.208  1.00 16.22 ? 3    SER A C   1 
ATOM   21   O  O   . SER A 1 4   ? 11.170  -22.086 -6.336  1.00 15.90 ? 3    SER A O   1 
ATOM   22   C  CB  . SER A 1 4   ? 9.277   -21.227 -8.998  1.00 16.30 ? 3    SER A CB  1 
ATOM   23   O  OG  . SER A 1 4   ? 10.438  -20.423 -9.078  1.00 16.49 ? 3    SER A OG  1 
ATOM   24   N  N   . ASP A 1 5   ? 10.725  -23.639 -7.833  1.00 16.61 ? 4    ASP A N   1 
ATOM   25   C  CA  . ASP A 1 5   ? 11.978  -24.281 -7.464  1.00 17.10 ? 4    ASP A CA  1 
ATOM   26   C  C   . ASP A 1 5   ? 13.144  -23.366 -7.753  1.00 16.65 ? 4    ASP A C   1 
ATOM   27   O  O   . ASP A 1 5   ? 14.134  -23.373 -7.016  1.00 15.96 ? 4    ASP A O   1 
ATOM   28   C  CB  . ASP A 1 5   ? 12.171  -25.568 -8.221  1.00 18.82 ? 4    ASP A CB  1 
ATOM   29   C  CG  . ASP A 1 5   ? 11.273  -26.675 -7.706  1.00 20.34 ? 4    ASP A CG  1 
ATOM   30   O  OD1 . ASP A 1 5   ? 11.274  -27.732 -8.380  1.00 22.42 ? 4    ASP A OD1 1 
ATOM   31   O  OD2 . ASP A 1 5   ? 10.597  -26.519 -6.654  1.00 21.10 ? 4    ASP A OD2 1 
ATOM   32   N  N   . LYS A 1 6   ? 13.005  -22.565 -8.820  1.00 16.38 ? 5    LYS A N   1 
ATOM   33   C  CA  . LYS A 1 6   ? 14.034  -21.575 -9.203  1.00 16.12 ? 5    LYS A CA  1 
ATOM   34   C  C   . LYS A 1 6   ? 14.247  -20.546 -8.075  1.00 15.19 ? 5    LYS A C   1 
ATOM   35   O  O   . LYS A 1 6   ? 15.383  -20.225 -7.721  1.00 14.75 ? 5    LYS A O   1 
ATOM   36   C  CB  . LYS A 1 6   ? 13.626  -20.808 -10.450 1.00 16.82 ? 5    LYS A CB  1 
ATOM   37   C  CG  . LYS A 1 6   ? 14.646  -19.762 -10.839 1.00 18.17 ? 5    LYS A CG  1 
ATOM   38   C  CD  . LYS A 1 6   ? 14.129  -18.982 -12.021 1.00 19.59 ? 5    LYS A CD  1 
ATOM   39   C  CE  . LYS A 1 6   ? 15.145  -17.966 -12.503 1.00 20.38 ? 5    LYS A CE  1 
ATOM   40   N  NZ  . LYS A 1 6   ? 14.500  -17.131 -13.552 1.00 21.77 ? 5    LYS A NZ  1 
ATOM   41   N  N   . ASP A 1 7   ? 13.130  -20.039 -7.544  1.00 14.55 ? 6    ASP A N   1 
ATOM   42   C  CA  . ASP A 1 7   ? 13.164  -19.067 -6.434  1.00 14.03 ? 6    ASP A CA  1 
ATOM   43   C  C   . ASP A 1 7   ? 13.806  -19.693 -5.204  1.00 13.75 ? 6    ASP A C   1 
ATOM   44   O  O   . ASP A 1 7   ? 14.611  -19.045 -4.514  1.00 13.39 ? 6    ASP A O   1 
ATOM   45   C  CB  . ASP A 1 7   ? 11.752  -18.613 -5.996  1.00 13.79 ? 6    ASP A CB  1 
ATOM   46   C  CG  . ASP A 1 7   ? 11.049  -17.707 -7.025  1.00 13.20 ? 6    ASP A CG  1 
ATOM   47   O  OD1 . ASP A 1 7   ? 9.818   -17.883 -7.197  1.00 13.14 ? 6    ASP A OD1 1 
ATOM   48   O  OD2 . ASP A 1 7   ? 11.724  -16.825 -7.604  1.00 13.49 ? 6    ASP A OD2 1 
ATOM   49   N  N   . LYS A 1 8   ? 13.424  -20.934 -4.893  1.00 13.57 ? 7    LYS A N   1 
ATOM   50   C  CA  . LYS A 1 8   ? 13.985  -21.577 -3.698  1.00 13.69 ? 7    LYS A CA  1 
ATOM   51   C  C   . LYS A 1 8   ? 15.471  -21.780 -3.808  1.00 13.46 ? 7    LYS A C   1 
ATOM   52   O  O   . LYS A 1 8   ? 16.212  -21.520 -2.877  1.00 13.78 ? 7    LYS A O   1 
ATOM   53   C  CB  . LYS A 1 8   ? 13.267  -22.901 -3.417  1.00 14.03 ? 7    LYS A CB  1 
ATOM   54   C  CG  . LYS A 1 8   ? 11.792  -22.704 -3.013  1.00 14.21 ? 7    LYS A CG  1 
ATOM   55   C  CD  . LYS A 1 8   ? 11.100  -24.008 -2.931  1.00 15.09 ? 7    LYS A CD  1 
ATOM   56   C  CE  . LYS A 1 8   ? 9.666   -23.838 -2.625  1.00 15.73 ? 7    LYS A CE  1 
ATOM   57   N  NZ  . LYS A 1 8   ? 8.995   -25.220 -2.572  1.00 16.30 ? 7    LYS A NZ  1 
ATOM   58   N  N   . ALA A 1 9   ? 15.920  -22.222 -4.966  1.00 13.54 ? 8    ALA A N   1 
ATOM   59   C  CA  . ALA A 1 9   ? 17.329  -22.419 -5.184  1.00 13.55 ? 8    ALA A CA  1 
ATOM   60   C  C   . ALA A 1 9   ? 18.111  -21.082 -5.081  1.00 13.59 ? 8    ALA A C   1 
ATOM   61   O  O   . ALA A 1 9   ? 19.196  -21.025 -4.473  1.00 13.53 ? 8    ALA A O   1 
ATOM   62   C  CB  . ALA A 1 9   ? 17.520  -23.055 -6.556  1.00 14.07 ? 8    ALA A CB  1 
ATOM   63   N  N   . ALA A 1 10  ? 17.542  -20.004 -5.634  1.00 13.36 ? 9    ALA A N   1 
ATOM   64   C  CA  . ALA A 1 10  ? 18.218  -18.697 -5.588  1.00 13.48 ? 9    ALA A CA  1 
ATOM   65   C  C   . ALA A 1 10  ? 18.351  -18.184 -4.154  1.00 13.58 ? 9    ALA A C   1 
ATOM   66   O  O   . ALA A 1 10  ? 19.406  -17.658 -3.759  1.00 14.13 ? 9    ALA A O   1 
ATOM   67   C  CB  . ALA A 1 10  ? 17.465  -17.641 -6.481  1.00 13.11 ? 9    ALA A CB  1 
ATOM   68   N  N   . VAL A 1 11  ? 17.286  -18.359 -3.367  1.00 13.39 ? 10   VAL A N   1 
ATOM   69   C  CA  . VAL A 1 11  ? 17.315  -17.908 -1.985  1.00 13.19 ? 10   VAL A CA  1 
ATOM   70   C  C   . VAL A 1 11  ? 18.333  -18.755 -1.208  1.00 13.05 ? 10   VAL A C   1 
ATOM   71   O  O   . VAL A 1 11  ? 19.108  -18.215 -0.431  1.00 13.16 ? 10   VAL A O   1 
ATOM   72   C  CB  . VAL A 1 11  ? 15.892  -17.996 -1.299  1.00 13.12 ? 10   VAL A CB  1 
ATOM   73   C  CG1 . VAL A 1 11  ? 16.008  -17.640 0.216   1.00 13.13 ? 10   VAL A CG1 1 
ATOM   74   C  CG2 . VAL A 1 11  ? 14.899  -17.050 -2.020  1.00 13.01 ? 10   VAL A CG2 1 
ATOM   75   N  N   . ARG A 1 12  ? 18.336  -20.081 -1.395  1.00 12.98 ? 11   ARG A N   1 
ATOM   76   C  CA  . ARG A 1 12  ? 19.321  -20.897 -0.660  1.00 13.01 ? 11   ARG A CA  1 
ATOM   77   C  C   . ARG A 1 12  ? 20.745  -20.530 -1.038  1.00 12.79 ? 11   ARG A C   1 
ATOM   78   O  O   . ARG A 1 12  ? 21.596  -20.503 -0.178  1.00 12.77 ? 11   ARG A O   1 
ATOM   79   C  CB  A ARG A 1 12  ? 19.067  -22.392 -0.900  0.53 12.73 ? 11   ARG A CB  1 
ATOM   80   C  CB  B ARG A 1 12  ? 19.181  -22.372 -0.986  0.47 13.10 ? 11   ARG A CB  1 
ATOM   81   C  CG  A ARG A 1 12  ? 17.857  -22.942 -0.131  0.53 12.80 ? 11   ARG A CG  1 
ATOM   82   C  CG  B ARG A 1 12  ? 17.887  -22.989 -0.651  0.47 13.69 ? 11   ARG A CG  1 
ATOM   83   C  CD  A ARG A 1 12  ? 17.601  -24.392 -0.561  0.53 12.99 ? 11   ARG A CD  1 
ATOM   84   C  CD  B ARG A 1 12  ? 18.028  -24.423 -1.071  0.47 14.21 ? 11   ARG A CD  1 
ATOM   85   N  NE  A ARG A 1 12  ? 16.618  -25.093 0.257   0.53 13.17 ? 11   ARG A NE  1 
ATOM   86   N  NE  B ARG A 1 12  ? 16.764  -25.103 -1.135  0.47 14.60 ? 11   ARG A NE  1 
ATOM   87   C  CZ  A ARG A 1 12  ? 15.466  -25.586 -0.193  0.53 13.09 ? 11   ARG A CZ  1 
ATOM   88   C  CZ  B ARG A 1 12  ? 16.213  -25.568 -2.247  0.47 14.47 ? 11   ARG A CZ  1 
ATOM   89   N  NH1 A ARG A 1 12  ? 15.157  -25.438 -1.450  0.53 13.21 ? 11   ARG A NH1 1 
ATOM   90   N  NH1 B ARG A 1 12  ? 16.792  -25.429 -3.454  0.47 14.38 ? 11   ARG A NH1 1 
ATOM   91   N  NH2 A ARG A 1 12  ? 14.637  -26.257 0.617   0.53 13.65 ? 11   ARG A NH2 1 
ATOM   92   N  NH2 B ARG A 1 12  ? 15.086  -26.233 -2.120  0.47 14.82 ? 11   ARG A NH2 1 
ATOM   93   N  N   . ALA A 1 13  ? 20.992  -20.289 -2.336  1.00 12.93 ? 12   ALA A N   1 
ATOM   94   C  CA  . ALA A 1 13  ? 22.350  -19.913 -2.818  1.00 12.92 ? 12   ALA A CA  1 
ATOM   95   C  C   . ALA A 1 13  ? 22.775  -18.555 -2.235  1.00 12.79 ? 12   ALA A C   1 
ATOM   96   O  O   . ALA A 1 13  ? 23.908  -18.400 -1.798  1.00 12.65 ? 12   ALA A O   1 
ATOM   97   C  CB  . ALA A 1 13  ? 22.403  -19.867 -4.349  1.00 12.89 ? 12   ALA A CB  1 
ATOM   98   N  N   . LEU A 1 14  ? 21.857  -17.582 -2.213  1.00 12.64 ? 13   LEU A N   1 
ATOM   99   C  CA  . LEU A 1 14  ? 22.204  -16.275 -1.650  1.00 12.57 ? 13   LEU A CA  1 
ATOM   100  C  C   . LEU A 1 14  ? 22.487  -16.404 -0.164  1.00 12.76 ? 13   LEU A C   1 
ATOM   101  O  O   . LEU A 1 14  ? 23.501  -15.888 0.323   1.00 12.90 ? 13   LEU A O   1 
ATOM   102  C  CB  . LEU A 1 14  ? 21.072  -15.259 -1.861  1.00 12.45 ? 13   LEU A CB  1 
ATOM   103  C  CG  . LEU A 1 14  ? 21.339  -13.861 -1.281  1.00 12.41 ? 13   LEU A CG  1 
ATOM   104  C  CD1 . LEU A 1 14  ? 22.473  -13.179 -2.106  1.00 12.70 ? 13   LEU A CD1 1 
ATOM   105  C  CD2 . LEU A 1 14  ? 20.063  -13.046 -1.266  1.00 12.68 ? 13   LEU A CD2 1 
ATOM   106  N  N   . TRP A 1 15  ? 21.601  -17.101 0.574   1.00 12.85 ? 14   TRP A N   1 
ATOM   107  C  CA  . TRP A 1 15  ? 21.781  -17.254 2.020   1.00 12.90 ? 14   TRP A CA  1 
ATOM   108  C  C   . TRP A 1 15  ? 23.095  -17.989 2.316   1.00 12.97 ? 14   TRP A C   1 
ATOM   109  O  O   . TRP A 1 15  ? 23.791  -17.696 3.282   1.00 12.96 ? 14   TRP A O   1 
ATOM   110  C  CB  . TRP A 1 15  ? 20.584  -17.991 2.645   1.00 13.12 ? 14   TRP A CB  1 
ATOM   111  C  CG  . TRP A 1 15  ? 20.583  -17.872 4.165   1.00 13.94 ? 14   TRP A CG  1 
ATOM   112  C  CD1 . TRP A 1 15  ? 20.731  -18.896 5.090   1.00 13.74 ? 14   TRP A CD1 1 
ATOM   113  C  CD2 . TRP A 1 15  ? 20.545  -16.646 4.932   1.00 14.04 ? 14   TRP A CD2 1 
ATOM   114  N  NE1 . TRP A 1 15  ? 20.802  -18.379 6.367   1.00 14.26 ? 14   TRP A NE1 1 
ATOM   115  C  CE2 . TRP A 1 15  ? 20.692  -17.007 6.311   1.00 14.29 ? 14   TRP A CE2 1 
ATOM   116  C  CE3 . TRP A 1 15  ? 20.397  -15.279 4.592   1.00 14.14 ? 14   TRP A CE3 1 
ATOM   117  C  CZ2 . TRP A 1 15  ? 20.699  -16.043 7.354   1.00 14.22 ? 14   TRP A CZ2 1 
ATOM   118  C  CZ3 . TRP A 1 15  ? 20.406  -14.317 5.618   1.00 14.28 ? 14   TRP A CZ3 1 
ATOM   119  C  CH2 . TRP A 1 15  ? 20.557  -14.707 6.992   1.00 14.32 ? 14   TRP A CH2 1 
ATOM   120  N  N   . SER A 1 16  ? 23.433  -18.959 1.464   1.00 13.22 ? 15   SER A N   1 
ATOM   121  C  CA  . SER A 1 16  ? 24.687  -19.689 1.620   1.00 13.22 ? 15   SER A CA  1 
ATOM   122  C  C   . SER A 1 16  ? 25.847  -18.690 1.624   1.00 13.54 ? 15   SER A C   1 
ATOM   123  O  O   . SER A 1 16  ? 26.816  -18.835 2.387   1.00 13.30 ? 15   SER A O   1 
ATOM   124  C  CB  . SER A 1 16  ? 24.852  -20.672 0.442   1.00 13.18 ? 15   SER A CB  1 
ATOM   125  O  OG  . SER A 1 16  ? 26.125  -21.305 0.433   1.00 13.13 ? 15   SER A OG  1 
ATOM   126  N  N   . LYS A 1 17  ? 25.737  -17.678 0.743   1.00 13.74 ? 16   LYS A N   1 
ATOM   127  C  CA  . LYS A 1 17  ? 26.770  -16.648 0.595   1.00 14.32 ? 16   LYS A CA  1 
ATOM   128  C  C   . LYS A 1 17  ? 26.746  -15.587 1.666   1.00 14.58 ? 16   LYS A C   1 
ATOM   129  O  O   . LYS A 1 17  ? 27.804  -15.221 2.159   1.00 15.41 ? 16   LYS A O   1 
ATOM   130  C  CB  . LYS A 1 17  ? 26.702  -15.940 -0.782  1.00 14.18 ? 16   LYS A CB  1 
ATOM   131  C  CG  . LYS A 1 17  ? 26.845  -16.865 -1.979  1.00 14.17 ? 16   LYS A CG  1 
ATOM   132  C  CD  . LYS A 1 17  ? 26.495  -16.216 -3.302  1.00 14.54 ? 16   LYS A CD  1 
ATOM   133  C  CE  . LYS A 1 17  ? 26.468  -17.275 -4.409  1.00 15.21 ? 16   LYS A CE  1 
ATOM   134  N  NZ  . LYS A 1 17  ? 26.004  -16.773 -5.725  1.00 15.15 ? 16   LYS A NZ  1 
ATOM   135  N  N   . ILE A 1 18  ? 25.591  -15.111 2.080   1.00 14.47 ? 17   ILE A N   1 
ATOM   136  C  CA  . ILE A 1 18  ? 25.591  -14.013 3.046   1.00 14.65 ? 17   ILE A CA  1 
ATOM   137  C  C   . ILE A 1 18  ? 25.314  -14.371 4.517   1.00 15.10 ? 17   ILE A C   1 
ATOM   138  O  O   . ILE A 1 18  ? 25.491  -13.522 5.422   1.00 14.95 ? 17   ILE A O   1 
ATOM   139  C  CB  . ILE A 1 18  ? 24.538  -12.932 2.600   1.00 14.51 ? 17   ILE A CB  1 
ATOM   140  C  CG1 . ILE A 1 18  ? 23.098  -13.440 2.779   1.00 14.37 ? 17   ILE A CG1 1 
ATOM   141  C  CG2 . ILE A 1 18  ? 24.779  -12.557 1.117   1.00 14.91 ? 17   ILE A CG2 1 
ATOM   142  C  CD1 . ILE A 1 18  ? 22.030  -12.384 2.509   1.00 14.29 ? 17   ILE A CD1 1 
ATOM   143  N  N   . GLY A 1 19  ? 24.872  -15.631 4.721   1.00 15.44 ? 18   GLY A N   1 
ATOM   144  C  CA  . GLY A 1 19  ? 24.453  -16.128 6.021   1.00 15.74 ? 18   GLY A CA  1 
ATOM   145  C  C   . GLY A 1 19  ? 25.431  -15.896 7.122   1.00 16.03 ? 18   GLY A C   1 
ATOM   146  O  O   . GLY A 1 19  ? 25.032  -15.711 8.264   1.00 16.11 ? 18   GLY A O   1 
ATOM   147  N  N   . LYS A 1 20  ? 26.703  -15.909 6.776   1.00 16.49 ? 19   LYS A N   1 
ATOM   148  C  CA  . LYS A 1 20  ? 27.773  -15.683 7.754   1.00 17.46 ? 19   LYS A CA  1 
ATOM   149  C  C   . LYS A 1 20  ? 27.634  -14.320 8.456   1.00 16.92 ? 19   LYS A C   1 
ATOM   150  O  O   . LYS A 1 20  ? 28.019  -14.173 9.613   1.00 17.29 ? 19   LYS A O   1 
ATOM   151  C  CB  . LYS A 1 20  ? 29.123  -15.761 7.049   1.00 18.38 ? 19   LYS A CB  1 
ATOM   152  C  CG  . LYS A 1 20  ? 29.195  -14.833 5.860   1.00 20.36 ? 19   LYS A CG  1 
ATOM   153  C  CD  . LYS A 1 20  ? 30.560  -14.791 5.252   1.00 22.09 ? 19   LYS A CD  1 
ATOM   154  C  CE  . LYS A 1 20  ? 30.524  -13.820 4.101   1.00 23.52 ? 19   LYS A CE  1 
ATOM   155  N  NZ  . LYS A 1 20  ? 31.915  -13.434 3.745   1.00 24.84 ? 19   LYS A NZ  1 
ATOM   156  N  N   . SER A 1 21  ? 27.062  -13.345 7.748   1.00 16.33 ? 20   SER A N   1 
ATOM   157  C  CA  . SER A 1 21  ? 26.859  -12.004 8.291   1.00 15.69 ? 20   SER A CA  1 
ATOM   158  C  C   . SER A 1 21  ? 25.437  -11.701 8.824   1.00 15.10 ? 20   SER A C   1 
ATOM   159  O  O   . SER A 1 21  ? 25.068  -10.547 9.023   1.00 14.60 ? 20   SER A O   1 
ATOM   160  C  CB  . SER A 1 21  ? 27.230  -10.986 7.217   1.00 16.00 ? 20   SER A CB  1 
ATOM   161  O  OG  . SER A 1 21  ? 28.609  -11.119 6.896   1.00 16.73 ? 20   SER A OG  1 
ATOM   162  N  N   . ALA A 1 22  ? 24.674  -12.755 9.098   1.00 14.62 ? 21   ALA A N   1 
ATOM   163  C  CA  . ALA A 1 22  ? 23.300  -12.616 9.558   1.00 14.50 ? 21   ALA A CA  1 
ATOM   164  C  C   . ALA A 1 22  ? 23.179  -11.662 10.751  1.00 14.59 ? 21   ALA A C   1 
ATOM   165  O  O   . ALA A 1 22  ? 22.313  -10.777 10.753  1.00 14.62 ? 21   ALA A O   1 
ATOM   166  C  CB  . ALA A 1 22  ? 22.714  -13.985 9.915   1.00 14.01 ? 21   ALA A CB  1 
ATOM   167  N  N   . ASP A 1 23  ? 24.050  -11.807 11.754  1.00 14.67 ? 22   ASP A N   1 
ATOM   168  C  CA  . ASP A 1 23  ? 23.950  -10.959 12.931  1.00 14.62 ? 22   ASP A CA  1 
ATOM   169  C  C   . ASP A 1 23  ? 24.094  -9.507  12.585  1.00 14.30 ? 22   ASP A C   1 
ATOM   170  O  O   . ASP A 1 23  ? 23.315  -8.668  13.043  1.00 14.60 ? 22   ASP A O   1 
ATOM   171  C  CB  . ASP A 1 23  ? 25.012  -11.311 13.921  1.00 15.51 ? 22   ASP A CB  1 
ATOM   172  C  CG  . ASP A 1 23  ? 24.778  -12.655 14.556  1.00 16.66 ? 22   ASP A CG  1 
ATOM   173  O  OD1 . ASP A 1 23  ? 25.734  -13.098 15.256  1.00 18.10 ? 22   ASP A OD1 1 
ATOM   174  O  OD2 . ASP A 1 23  ? 23.693  -13.285 14.384  1.00 16.98 ? 22   ASP A OD2 1 
ATOM   175  N  N   . ALA A 1 24  ? 25.089  -9.206  11.775  1.00 14.00 ? 23   ALA A N   1 
ATOM   176  C  CA  . ALA A 1 24  ? 25.330  -7.830  11.391  1.00 14.05 ? 23   ALA A CA  1 
ATOM   177  C  C   . ALA A 1 24  ? 24.161  -7.280  10.527  1.00 14.07 ? 23   ALA A C   1 
ATOM   178  O  O   . ALA A 1 24  ? 23.743  -6.092  10.663  1.00 13.83 ? 23   ALA A O   1 
ATOM   179  C  CB  . ALA A 1 24  ? 26.625  -7.743  10.657  1.00 13.97 ? 23   ALA A CB  1 
ATOM   180  N  N   . ILE A 1 25  ? 23.633  -8.138  9.641   1.00 13.74 ? 24   ILE A N   1 
ATOM   181  C  CA  . ILE A 1 25  ? 22.491  -7.711  8.807   1.00 13.52 ? 24   ILE A CA  1 
ATOM   182  C  C   . ILE A 1 25  ? 21.312  -7.338  9.712   1.00 13.73 ? 24   ILE A C   1 
ATOM   183  O  O   . ILE A 1 25  ? 20.694  -6.295  9.513   1.00 13.74 ? 24   ILE A O   1 
ATOM   184  C  CB  . ILE A 1 25  ? 22.035  -8.830  7.814   1.00 13.43 ? 24   ILE A CB  1 
ATOM   185  C  CG1 . ILE A 1 25  ? 23.113  -9.053  6.750   1.00 13.60 ? 24   ILE A CG1 1 
ATOM   186  C  CG2 . ILE A 1 25  ? 20.706  -8.440  7.122   1.00 13.28 ? 24   ILE A CG2 1 
ATOM   187  C  CD1 . ILE A 1 25  ? 22.928  -10.365 5.956   1.00 14.03 ? 24   ILE A CD1 1 
ATOM   188  N  N   . GLY A 1 26  ? 21.021  -8.153  10.724  1.00 13.46 ? 25   GLY A N   1 
ATOM   189  C  CA  . GLY A 1 26  ? 19.879  -7.852  11.578  1.00 13.82 ? 25   GLY A CA  1 
ATOM   190  C  C   . GLY A 1 26  ? 20.048  -6.591  12.439  1.00 14.37 ? 25   GLY A C   1 
ATOM   191  O  O   . GLY A 1 26  ? 19.119  -5.796  12.620  1.00 13.90 ? 25   GLY A O   1 
ATOM   192  N  N   . ASN A 1 27  ? 21.243  -6.404  12.982  1.00 14.76 ? 26   ASN A N   1 
ATOM   193  C  CA  . ASN A 1 27  ? 21.471  -5.245  13.808  1.00 15.48 ? 26   ASN A CA  1 
ATOM   194  C  C   . ASN A 1 27  ? 21.198  -4.007  12.952  1.00 15.84 ? 26   ASN A C   1 
ATOM   195  O  O   . ASN A 1 27  ? 20.531  -3.083  13.360  1.00 16.00 ? 26   ASN A O   1 
ATOM   196  C  CB  . ASN A 1 27  ? 22.926  -5.266  14.276  1.00 15.96 ? 26   ASN A CB  1 
ATOM   197  C  CG  . ASN A 1 27  ? 23.332  -3.990  14.959  1.00 16.50 ? 26   ASN A CG  1 
ATOM   198  O  OD1 . ASN A 1 27  ? 22.808  -3.631  15.995  1.00 17.21 ? 26   ASN A OD1 1 
ATOM   199  N  ND2 . ASN A 1 27  ? 24.254  -3.282  14.353  1.00 17.18 ? 26   ASN A ND2 1 
ATOM   200  N  N   . ASP A 1 28  ? 21.727  -4.019  11.736  1.00 16.21 ? 27   ASP A N   1 
ATOM   201  C  CA  . ASP A 1 28  ? 21.636  -2.880  10.807  1.00 16.88 ? 27   ASP A CA  1 
ATOM   202  C  C   . ASP A 1 28  ? 20.184  -2.635  10.320  1.00 16.60 ? 27   ASP A C   1 
ATOM   203  O  O   . ASP A 1 28  ? 19.707  -1.480  10.268  1.00 16.83 ? 27   ASP A O   1 
ATOM   204  C  CB  . ASP A 1 28  ? 22.596  -3.196  9.654   1.00 18.18 ? 27   ASP A CB  1 
ATOM   205  C  CG  . ASP A 1 28  ? 22.984  -1.983  8.829   1.00 19.98 ? 27   ASP A CG  1 
ATOM   206  O  OD1 . ASP A 1 28  ? 23.965  -2.123  8.047   1.00 21.34 ? 27   ASP A OD1 1 
ATOM   207  O  OD2 . ASP A 1 28  ? 22.331  -0.907  8.918   1.00 21.15 ? 27   ASP A OD2 1 
ATOM   208  N  N   . ALA A 1 29  ? 19.472  -3.720  10.014  1.00 15.88 ? 28   ALA A N   1 
ATOM   209  C  CA  . ALA A 1 29  ? 18.085  -3.634  9.524   1.00 15.91 ? 28   ALA A CA  1 
ATOM   210  C  C   . ALA A 1 29  ? 17.156  -3.112  10.589  1.00 15.98 ? 28   ALA A C   1 
ATOM   211  O  O   . ALA A 1 29  ? 16.303  -2.281  10.319  1.00 15.93 ? 28   ALA A O   1 
ATOM   212  C  CB  . ALA A 1 29  ? 17.607  -4.996  9.056   1.00 15.20 ? 28   ALA A CB  1 
ATOM   213  N  N   . LEU A 1 30  ? 17.349  -3.587  11.804  1.00 16.37 ? 29   LEU A N   1 
ATOM   214  C  CA  . LEU A 1 30  ? 16.549  -3.173  12.955  1.00 17.44 ? 29   LEU A CA  1 
ATOM   215  C  C   . LEU A 1 30  ? 16.781  -1.676  13.282  1.00 17.75 ? 29   LEU A C   1 
ATOM   216  O  O   . LEU A 1 30  ? 15.806  -0.938  13.577  1.00 17.78 ? 29   LEU A O   1 
ATOM   217  C  CB  . LEU A 1 30  ? 16.932  -4.036  14.158  1.00 17.98 ? 29   LEU A CB  1 
ATOM   218  C  CG  . LEU A 1 30  ? 15.958  -4.035  15.306  1.00 18.91 ? 29   LEU A CG  1 
ATOM   219  C  CD1 . LEU A 1 30  ? 14.610  -4.640  14.866  1.00 19.34 ? 29   LEU A CD1 1 
ATOM   220  C  CD2 . LEU A 1 30  ? 16.574  -4.922  16.365  1.00 19.57 ? 29   LEU A CD2 1 
ATOM   221  N  N   . SER A 1 31  ? 18.052  -1.251  13.203  1.00 17.98 ? 30   SER A N   1 
ATOM   222  C  CA  . SER A 1 31  ? 18.469  0.140   13.460  1.00 18.68 ? 30   SER A CA  1 
ATOM   223  C  C   . SER A 1 31  ? 17.777  1.100   12.489  1.00 18.64 ? 30   SER A C   1 
ATOM   224  O  O   . SER A 1 31  ? 17.238  2.152   12.894  1.00 19.12 ? 30   SER A O   1 
ATOM   225  C  CB  . SER A 1 31  ? 19.979  0.299   13.257  1.00 18.62 ? 30   SER A CB  1 
ATOM   226  O  OG  . SER A 1 31  ? 20.688  -0.377  14.245  1.00 20.82 ? 30   SER A OG  1 
ATOM   227  N  N   . ARG A 1 32  ? 17.819  0.735   11.213  1.00 18.34 ? 31   ARG A N   1 
ATOM   228  C  CA  . ARG A 1 32  ? 17.210  1.514   10.144  1.00 17.99 ? 31   ARG A CA  1 
ATOM   229  C  C   . ARG A 1 32  ? 15.708  1.584   10.318  1.00 17.31 ? 31   ARG A C   1 
ATOM   230  O  O   . ARG A 1 32  ? 15.090  2.626   10.168  1.00 17.21 ? 31   ARG A O   1 
ATOM   231  C  CB  . ARG A 1 32  ? 17.447  0.847   8.787   1.00 18.31 ? 31   ARG A CB  1 
ATOM   232  C  CG  . ARG A 1 32  ? 18.833  0.878   8.413   1.00 19.73 ? 31   ARG A CG  1 
ATOM   233  C  CD  . ARG A 1 32  ? 19.112  0.172   7.138   1.00 19.26 ? 31   ARG A CD  1 
ATOM   234  N  NE  . ARG A 1 32  ? 20.542  0.303   6.936   1.00 19.95 ? 31   ARG A NE  1 
ATOM   235  C  CZ  . ARG A 1 32  ? 21.134  1.320   6.315   1.00 19.67 ? 31   ARG A CZ  1 
ATOM   236  N  NH1 . ARG A 1 32  ? 20.422  2.321   5.788   1.00 18.63 ? 31   ARG A NH1 1 
ATOM   237  N  NH2 . ARG A 1 32  ? 22.450  1.338   6.264   1.00 20.02 ? 31   ARG A NH2 1 
ATOM   238  N  N   . MET A 1 33  ? 15.100  0.450   10.604  1.00 16.54 ? 32   MET A N   1 
ATOM   239  C  CA  . MET A 1 33  ? 13.668  0.460   10.734  1.00 15.99 ? 32   MET A CA  1 
ATOM   240  C  C   . MET A 1 33  ? 13.236  1.482   11.763  1.00 16.20 ? 32   MET A C   1 
ATOM   241  O  O   . MET A 1 33  ? 12.393  2.345   11.491  1.00 15.85 ? 32   MET A O   1 
ATOM   242  C  CB  . MET A 1 33  ? 13.138  -0.912  11.138  1.00 15.40 ? 32   MET A CB  1 
ATOM   243  C  CG  . MET A 1 33  ? 11.635  -0.936  11.137  1.00 15.06 ? 32   MET A CG  1 
ATOM   244  S  SD  . MET A 1 33  ? 10.921  -2.588  11.489  1.00 15.48 ? 32   MET A SD  1 
ATOM   245  C  CE  . MET A 1 33  ? 11.502  -2.891  13.131  1.00 14.37 ? 32   MET A CE  1 
ATOM   246  N  N   . ILE A 1 34  ? 13.843  1.385   12.944  1.00 16.36 ? 33   ILE A N   1 
ATOM   247  C  CA  . ILE A 1 34  ? 13.441  2.264   14.017  1.00 17.30 ? 33   ILE A CA  1 
ATOM   248  C  C   . ILE A 1 34  ? 13.599  3.743   13.704  1.00 17.42 ? 33   ILE A C   1 
ATOM   249  O  O   . ILE A 1 34  ? 12.711  4.534   14.021  1.00 17.87 ? 33   ILE A O   1 
ATOM   250  C  CB  . ILE A 1 34  ? 14.138  1.816   15.329  1.00 17.69 ? 33   ILE A CB  1 
ATOM   251  C  CG1 . ILE A 1 34  ? 13.388  0.570   15.844  1.00 17.71 ? 33   ILE A CG1 1 
ATOM   252  C  CG2 . ILE A 1 34  ? 14.150  2.943   16.376  1.00 17.97 ? 33   ILE A CG2 1 
ATOM   253  C  CD1 . ILE A 1 34  ? 13.986  -0.027  17.096  1.00 18.79 ? 33   ILE A CD1 1 
ATOM   254  N  N   . VAL A 1 35  ? 14.683  4.089   13.034  1.00 17.14 ? 34   VAL A N   1 
ATOM   255  C  CA  . VAL A 1 35  ? 14.961  5.440   12.634  1.00 17.15 ? 34   VAL A CA  1 
ATOM   256  C  C   . VAL A 1 35  ? 14.078  5.913   11.450  1.00 17.12 ? 34   VAL A C   1 
ATOM   257  O  O   . VAL A 1 35  ? 13.481  6.973   11.499  1.00 17.23 ? 34   VAL A O   1 
ATOM   258  C  CB  . VAL A 1 35  ? 16.440  5.505   12.233  1.00 17.49 ? 34   VAL A CB  1 
ATOM   259  C  CG1 . VAL A 1 35  ? 16.750  6.818   11.494  1.00 17.72 ? 34   VAL A CG1 1 
ATOM   260  C  CG2 . VAL A 1 35  ? 17.321  5.331   13.481  1.00 17.76 ? 34   VAL A CG2 1 
ATOM   261  N  N   . VAL A 1 36  ? 13.975  5.121   10.392  1.00 16.77 ? 35   VAL A N   1 
ATOM   262  C  CA  . VAL A 1 36  ? 13.250  5.552   9.206   1.00 16.65 ? 35   VAL A CA  1 
ATOM   263  C  C   . VAL A 1 36  ? 11.737  5.408   9.313   1.00 17.00 ? 35   VAL A C   1 
ATOM   264  O  O   . VAL A 1 36  ? 11.000  6.164   8.676   1.00 16.89 ? 35   VAL A O   1 
ATOM   265  C  CB  . VAL A 1 36  ? 13.826  4.820   7.914   1.00 16.66 ? 35   VAL A CB  1 
ATOM   266  C  CG1 . VAL A 1 36  ? 13.043  5.199   6.635   1.00 16.69 ? 35   VAL A CG1 1 
ATOM   267  C  CG2 . VAL A 1 36  ? 15.314  5.200   7.715   1.00 16.06 ? 35   VAL A CG2 1 
ATOM   268  N  N   . TYR A 1 37  ? 11.259  4.469   10.135  1.00 17.00 ? 36   TYR A N   1 
ATOM   269  C  CA  . TYR A 1 37  ? 9.816   4.256   10.308  1.00 17.40 ? 36   TYR A CA  1 
ATOM   270  C  C   . TYR A 1 37  ? 9.580   4.342   11.811  1.00 18.07 ? 36   TYR A C   1 
ATOM   271  O  O   . TYR A 1 37  ? 9.440   3.341   12.506  1.00 17.78 ? 36   TYR A O   1 
ATOM   272  C  CB  . TYR A 1 37  ? 9.436   2.894   9.763   1.00 16.57 ? 36   TYR A CB  1 
ATOM   273  C  CG  . TYR A 1 37  ? 9.924   2.721   8.339   1.00 16.04 ? 36   TYR A CG  1 
ATOM   274  C  CD1 . TYR A 1 37  ? 11.232  2.253   8.061   1.00 15.34 ? 36   TYR A CD1 1 
ATOM   275  C  CD2 . TYR A 1 37  ? 9.055   2.984   7.251   1.00 15.97 ? 36   TYR A CD2 1 
ATOM   276  C  CE1 . TYR A 1 37  ? 11.647  2.047   6.734   1.00 15.36 ? 36   TYR A CE1 1 
ATOM   277  C  CE2 . TYR A 1 37  ? 9.473   2.769   5.918   1.00 15.48 ? 36   TYR A CE2 1 
ATOM   278  C  CZ  . TYR A 1 37  ? 10.777  2.295   5.678   1.00 15.15 ? 36   TYR A CZ  1 
ATOM   279  O  OH  . TYR A 1 37  ? 11.166  2.043   4.378   1.00 15.43 ? 36   TYR A OH  1 
ATOM   280  N  N   . PRO A 1 38  ? 9.545   5.579   12.327  1.00 19.04 ? 37   PRO A N   1 
ATOM   281  C  CA  . PRO A 1 38  ? 9.355   5.830   13.765  1.00 19.37 ? 37   PRO A CA  1 
ATOM   282  C  C   . PRO A 1 38  ? 8.146   5.160   14.422  1.00 19.40 ? 37   PRO A C   1 
ATOM   283  O  O   . PRO A 1 38  ? 8.139   4.976   15.626  1.00 19.77 ? 37   PRO A O   1 
ATOM   284  C  CB  . PRO A 1 38  ? 9.347   7.364   13.850  1.00 19.75 ? 37   PRO A CB  1 
ATOM   285  C  CG  . PRO A 1 38  ? 8.750   7.776   12.471  1.00 19.81 ? 37   PRO A CG  1 
ATOM   286  C  CD  . PRO A 1 38  ? 9.463   6.823   11.520  1.00 19.31 ? 37   PRO A CD  1 
ATOM   287  N  N   . GLN A 1 39  ? 7.135   4.759   13.653  1.00 19.52 ? 38   GLN A N   1 
ATOM   288  C  CA  . GLN A 1 39  ? 6.000   4.119   14.278  1.00 19.20 ? 38   GLN A CA  1 
ATOM   289  C  C   . GLN A 1 39  ? 6.424   2.768   14.840  1.00 19.11 ? 38   GLN A C   1 
ATOM   290  O  O   . GLN A 1 39  ? 5.661   2.141   15.609  1.00 19.79 ? 38   GLN A O   1 
ATOM   291  C  CB  . GLN A 1 39  ? 4.841   3.915   13.287  1.00 19.49 ? 38   GLN A CB  1 
ATOM   292  C  CG  . GLN A 1 39  ? 5.076   2.924   12.103  1.00 19.69 ? 38   GLN A CG  1 
ATOM   293  C  CD  . GLN A 1 39  ? 5.629   3.641   10.876  1.00 19.71 ? 38   GLN A CD  1 
ATOM   294  O  OE1 . GLN A 1 39  ? 6.428   4.564   10.971  1.00 20.10 ? 38   GLN A OE1 1 
ATOM   295  N  NE2 . GLN A 1 39  ? 5.198   3.219   9.730   1.00 20.00 ? 38   GLN A NE2 1 
ATOM   296  N  N   . THR A 1 40  ? 7.615   2.294   14.483  1.00 18.32 ? 39   THR A N   1 
ATOM   297  C  CA  . THR A 1 40  ? 8.025   0.955   14.959  1.00 17.83 ? 39   THR A CA  1 
ATOM   298  C  C   . THR A 1 40  ? 8.778   0.989   16.306  1.00 18.33 ? 39   THR A C   1 
ATOM   299  O  O   . THR A 1 40  ? 8.906   -0.040  17.009  1.00 18.22 ? 39   THR A O   1 
ATOM   300  C  CB  . THR A 1 40  ? 8.933   0.216   13.916  1.00 17.38 ? 39   THR A CB  1 
ATOM   301  O  OG1 . THR A 1 40  ? 10.168  0.946   13.724  1.00 16.24 ? 39   THR A OG1 1 
ATOM   302  C  CG2 . THR A 1 40  ? 8.164   0.022   12.549  1.00 16.76 ? 39   THR A CG2 1 
ATOM   303  N  N   . LYS A 1 41  ? 9.246   2.186   16.676  1.00 18.85 ? 40   LYS A N   1 
ATOM   304  C  CA  . LYS A 1 41  ? 10.042  2.318   17.876  1.00 19.47 ? 40   LYS A CA  1 
ATOM   305  C  C   . LYS A 1 41  ? 9.296   1.873   19.124  1.00 19.27 ? 40   LYS A C   1 
ATOM   306  O  O   . LYS A 1 41  ? 9.884   1.284   20.042  1.00 19.17 ? 40   LYS A O   1 
ATOM   307  C  CB  . LYS A 1 41  ? 10.495  3.763   18.026  1.00 20.69 ? 40   LYS A CB  1 
ATOM   308  C  CG  . LYS A 1 41  ? 11.637  3.919   19.019  1.00 22.83 ? 40   LYS A CG  1 
ATOM   309  C  CD  . LYS A 1 41  ? 12.027  5.413   19.298  1.00 24.60 ? 40   LYS A CD  1 
ATOM   310  C  CE  . LYS A 1 41  ? 12.429  6.155   18.026  1.00 26.05 ? 40   LYS A CE  1 
ATOM   311  N  NZ  . LYS A 1 41  ? 11.347  7.050   17.449  1.00 27.83 ? 40   LYS A NZ  1 
ATOM   312  N  N   . THR A 1 42  ? 7.995   2.125   19.145  1.00 19.18 ? 41   THR A N   1 
ATOM   313  C  CA  . THR A 1 42  ? 7.197   1.794   20.314  1.00 19.16 ? 41   THR A CA  1 
ATOM   314  C  C   . THR A 1 42  ? 7.273   0.329   20.770  1.00 18.81 ? 41   THR A C   1 
ATOM   315  O  O   . THR A 1 42  ? 7.216   0.030   21.956  1.00 18.86 ? 41   THR A O   1 
ATOM   316  C  CB  . THR A 1 42  ? 5.738   2.228   20.085  1.00 19.55 ? 41   THR A CB  1 
ATOM   317  O  OG1 . THR A 1 42  ? 4.987   1.935   21.271  1.00 20.27 ? 41   THR A OG1 1 
ATOM   318  C  CG2 . THR A 1 42  ? 5.133   1.519   18.888  1.00 19.23 ? 41   THR A CG2 1 
ATOM   319  N  N   . TYR A 1 43  ? 7.447   -0.596  19.843  1.00 18.24 ? 42   TYR A N   1 
ATOM   320  C  CA  . TYR A 1 43  ? 7.532   -2.010  20.220  1.00 17.76 ? 42   TYR A CA  1 
ATOM   321  C  C   . TYR A 1 43  ? 8.804   -2.370  20.987  1.00 17.56 ? 42   TYR A C   1 
ATOM   322  O  O   . TYR A 1 43  ? 8.921   -3.434  21.575  1.00 17.73 ? 42   TYR A O   1 
ATOM   323  C  CB  . TYR A 1 43  ? 7.468   -2.871  18.942  1.00 17.40 ? 42   TYR A CB  1 
ATOM   324  C  CG  . TYR A 1 43  ? 6.187   -2.634  18.180  1.00 17.39 ? 42   TYR A CG  1 
ATOM   325  C  CD1 . TYR A 1 43  ? 5.009   -3.252  18.593  1.00 17.41 ? 42   TYR A CD1 1 
ATOM   326  C  CD2 . TYR A 1 43  ? 6.138   -1.792  17.059  1.00 17.36 ? 42   TYR A CD2 1 
ATOM   327  C  CE1 . TYR A 1 43  ? 3.833   -3.058  17.923  1.00 17.78 ? 42   TYR A CE1 1 
ATOM   328  C  CE2 . TYR A 1 43  ? 4.964   -1.597  16.389  1.00 17.36 ? 42   TYR A CE2 1 
ATOM   329  C  CZ  . TYR A 1 43  ? 3.808   -2.241  16.828  1.00 17.83 ? 42   TYR A CZ  1 
ATOM   330  O  OH  . TYR A 1 43  ? 2.579   -2.115  16.195  1.00 18.69 ? 42   TYR A OH  1 
ATOM   331  N  N   . PHE A 1 44  ? 9.773   -1.490  20.972  1.00 17.45 ? 43   PHE A N   1 
ATOM   332  C  CA  . PHE A 1 44  ? 11.038  -1.807  21.607  1.00 17.91 ? 43   PHE A CA  1 
ATOM   333  C  C   . PHE A 1 44  ? 11.336  -0.805  22.735  1.00 18.09 ? 43   PHE A C   1 
ATOM   334  O  O   . PHE A 1 44  ? 12.446  -0.720  23.186  1.00 18.33 ? 43   PHE A O   1 
ATOM   335  C  CB  . PHE A 1 44  ? 12.171  -1.735  20.565  1.00 17.30 ? 43   PHE A CB  1 
ATOM   336  C  CG  . PHE A 1 44  ? 11.906  -2.530  19.307  1.00 17.30 ? 43   PHE A CG  1 
ATOM   337  C  CD1 . PHE A 1 44  ? 11.439  -1.894  18.147  1.00 17.32 ? 43   PHE A CD1 1 
ATOM   338  C  CD2 . PHE A 1 44  ? 12.063  -3.917  19.293  1.00 17.18 ? 43   PHE A CD2 1 
ATOM   339  C  CE1 . PHE A 1 44  ? 11.130  -2.624  16.999  1.00 17.06 ? 43   PHE A CE1 1 
ATOM   340  C  CE2 . PHE A 1 44  ? 11.752  -4.652  18.141  1.00 17.14 ? 43   PHE A CE2 1 
ATOM   341  C  CZ  . PHE A 1 44  ? 11.285  -3.995  16.998  1.00 17.10 ? 43   PHE A CZ  1 
ATOM   342  N  N   . SER A 1 45  ? 10.321  -0.092  23.184  1.00 18.72 ? 44   SER A N   1 
ATOM   343  C  CA  . SER A 1 45  ? 10.505  0.923   24.201  1.00 19.45 ? 44   SER A CA  1 
ATOM   344  C  C   . SER A 1 45  ? 10.826  0.360   25.571  1.00 20.03 ? 44   SER A C   1 
ATOM   345  O  O   . SER A 1 45  ? 11.209  1.116   26.446  1.00 20.53 ? 44   SER A O   1 
ATOM   346  C  CB  . SER A 1 45  ? 9.275   1.801   24.270  1.00 19.06 ? 44   SER A CB  1 
ATOM   347  O  OG  . SER A 1 45  ? 8.137   1.063   24.647  1.00 19.59 ? 44   SER A OG  1 
ATOM   348  N  N   . HIS A 1 46  ? 10.683  -0.942  25.768  1.00 20.55 ? 45   HIS A N   1 
ATOM   349  C  CA  . HIS A 1 46  ? 10.997  -1.531  27.043  1.00 21.28 ? 45   HIS A CA  1 
ATOM   350  C  C   . HIS A 1 46  ? 12.521  -1.680  27.183  1.00 22.31 ? 45   HIS A C   1 
ATOM   351  O  O   . HIS A 1 46  ? 13.077  -1.967  28.273  1.00 22.14 ? 45   HIS A O   1 
ATOM   352  C  CB  . HIS A 1 46  ? 10.278  -2.866  27.179  1.00 20.92 ? 45   HIS A CB  1 
ATOM   353  C  CG  . HIS A 1 46  ? 10.525  -3.814  26.049  1.00 20.85 ? 45   HIS A CG  1 
ATOM   354  N  ND1 . HIS A 1 46  ? 10.021  -3.609  24.783  1.00 20.62 ? 45   HIS A ND1 1 
ATOM   355  C  CD2 . HIS A 1 46  ? 11.168  -5.007  26.009  1.00 20.68 ? 45   HIS A CD2 1 
ATOM   356  C  CE1 . HIS A 1 46  ? 10.337  -4.635  24.017  1.00 20.39 ? 45   HIS A CE1 1 
ATOM   357  N  NE2 . HIS A 1 46  ? 11.031  -5.496  24.736  1.00 20.23 ? 45   HIS A NE2 1 
ATOM   358  N  N   . TRP A 1 47  ? 13.223  -1.464  26.077  1.00 23.66 ? 46   TRP A N   1 
ATOM   359  C  CA  . TRP A 1 47  ? 14.678  -1.557  26.123  1.00 25.41 ? 46   TRP A CA  1 
ATOM   360  C  C   . TRP A 1 47  ? 15.245  -0.238  26.606  1.00 26.74 ? 46   TRP A C   1 
ATOM   361  O  O   . TRP A 1 47  ? 14.813  0.857   26.229  1.00 26.76 ? 46   TRP A O   1 
ATOM   362  C  CB  . TRP A 1 47  ? 15.328  -1.880  24.745  1.00 24.94 ? 46   TRP A CB  1 
ATOM   363  C  CG  . TRP A 1 47  ? 15.035  -3.251  24.205  1.00 25.07 ? 46   TRP A CG  1 
ATOM   364  C  CD1 . TRP A 1 47  ? 14.578  -4.331  24.899  1.00 24.98 ? 46   TRP A CD1 1 
ATOM   365  C  CD2 . TRP A 1 47  ? 15.135  -3.668  22.828  1.00 25.05 ? 46   TRP A CD2 1 
ATOM   366  N  NE1 . TRP A 1 47  ? 14.379  -5.398  24.048  1.00 25.11 ? 46   TRP A NE1 1 
ATOM   367  C  CE2 . TRP A 1 47  ? 14.708  -5.022  22.771  1.00 25.25 ? 46   TRP A CE2 1 
ATOM   368  C  CE3 . TRP A 1 47  ? 15.545  -3.028  21.640  1.00 25.16 ? 46   TRP A CE3 1 
ATOM   369  C  CZ2 . TRP A 1 47  ? 14.669  -5.751  21.567  1.00 24.88 ? 46   TRP A CZ2 1 
ATOM   370  C  CZ3 . TRP A 1 47  ? 15.510  -3.751  20.433  1.00 25.20 ? 46   TRP A CZ3 1 
ATOM   371  C  CH2 . TRP A 1 47  ? 15.071  -5.104  20.417  1.00 25.17 ? 46   TRP A CH2 1 
ATOM   372  N  N   . PRO A 1 48  ? 16.263  -0.337  27.431  1.00 28.40 ? 47   PRO A N   1 
ATOM   373  C  CA  . PRO A 1 48  ? 16.903  0.868   27.954  1.00 29.84 ? 47   PRO A CA  1 
ATOM   374  C  C   . PRO A 1 48  ? 17.413  1.761   26.804  1.00 31.08 ? 47   PRO A C   1 
ATOM   375  O  O   . PRO A 1 48  ? 17.273  2.986   26.819  1.00 31.76 ? 47   PRO A O   1 
ATOM   376  C  CB  . PRO A 1 48  ? 18.044  0.311   28.789  1.00 29.58 ? 47   PRO A CB  1 
ATOM   377  C  CG  . PRO A 1 48  ? 17.608  -1.157  29.114  1.00 29.51 ? 47   PRO A CG  1 
ATOM   378  C  CD  . PRO A 1 48  ? 16.937  -1.578  27.857  1.00 28.68 ? 47   PRO A CD  1 
ATOM   379  N  N   . ASP A 1 49  ? 17.972  1.157   25.765  1.00 32.09 ? 48   ASP A N   1 
ATOM   380  C  CA  . ASP A 1 49  ? 18.520  1.971   24.699  1.00 32.93 ? 48   ASP A CA  1 
ATOM   381  C  C   . ASP A 1 49  ? 18.117  1.422   23.348  1.00 33.49 ? 48   ASP A C   1 
ATOM   382  O  O   . ASP A 1 49  ? 18.368  0.251   23.027  1.00 33.11 ? 48   ASP A O   1 
ATOM   383  C  CB  . ASP A 1 49  ? 20.055  2.016   24.855  1.00 33.38 ? 48   ASP A CB  1 
ATOM   384  C  CG  . ASP A 1 49  ? 20.767  2.823   23.758  1.00 33.64 ? 48   ASP A CG  1 
ATOM   385  O  OD1 . ASP A 1 49  ? 20.176  3.625   22.997  1.00 33.82 ? 48   ASP A OD1 1 
ATOM   386  O  OD2 . ASP A 1 49  ? 21.995  2.637   23.678  1.00 34.58 ? 48   ASP A OD2 1 
ATOM   387  N  N   . VAL A 1 50  ? 17.467  2.278   22.569  1.00 34.24 ? 49   VAL A N   1 
ATOM   388  C  CA  . VAL A 1 50  ? 17.048  1.857   21.262  1.00 35.25 ? 49   VAL A CA  1 
ATOM   389  C  C   . VAL A 1 50  ? 17.604  2.718   20.148  1.00 35.83 ? 49   VAL A C   1 
ATOM   390  O  O   . VAL A 1 50  ? 16.831  3.250   19.357  1.00 36.10 ? 49   VAL A O   1 
ATOM   391  C  CB  . VAL A 1 50  ? 15.515  1.833   21.104  1.00 35.21 ? 49   VAL A CB  1 
ATOM   392  C  CG1 . VAL A 1 50  ? 15.199  1.002   19.891  1.00 35.39 ? 49   VAL A CG1 1 
ATOM   393  C  CG2 . VAL A 1 50  ? 14.827  1.236   22.344  1.00 35.21 ? 49   VAL A CG2 1 
ATOM   394  N  N   . THR A 1 51  ? 18.928  2.874   20.084  1.00 36.31 ? 50   THR A N   1 
ATOM   395  C  CA  . THR A 1 51  ? 19.512  3.638   18.994  1.00 36.66 ? 50   THR A CA  1 
ATOM   396  C  C   . THR A 1 51  ? 20.416  2.736   18.169  1.00 36.66 ? 50   THR A C   1 
ATOM   397  O  O   . THR A 1 51  ? 20.806  1.625   18.617  1.00 36.49 ? 50   THR A O   1 
ATOM   398  C  CB  . THR A 1 51  ? 20.332  4.835   19.456  1.00 37.06 ? 50   THR A CB  1 
ATOM   399  O  OG1 . THR A 1 51  ? 21.593  4.371   19.975  1.00 37.88 ? 50   THR A OG1 1 
ATOM   400  C  CG2 . THR A 1 51  ? 19.548  5.619   20.516  1.00 37.25 ? 50   THR A CG2 1 
ATOM   401  N  N   . PRO A 1 52  ? 20.789  3.212   16.945  1.00 36.50 ? 51   PRO A N   1 
ATOM   402  C  CA  . PRO A 1 52  ? 21.645  2.372   16.105  1.00 35.86 ? 51   PRO A CA  1 
ATOM   403  C  C   . PRO A 1 52  ? 22.781  1.747   16.854  1.00 35.14 ? 51   PRO A C   1 
ATOM   404  O  O   . PRO A 1 52  ? 23.086  0.566   16.620  1.00 35.38 ? 51   PRO A O   1 
ATOM   405  C  CB  . PRO A 1 52  ? 22.058  3.322   14.984  1.00 36.22 ? 51   PRO A CB  1 
ATOM   406  C  CG  . PRO A 1 52  ? 20.700  4.094   14.749  1.00 36.26 ? 51   PRO A CG  1 
ATOM   407  C  CD  . PRO A 1 52  ? 20.443  4.471   16.238  1.00 36.48 ? 51   PRO A CD  1 
ATOM   408  N  N   . GLY A 1 53  ? 23.365  2.488   17.794  1.00 33.89 ? 52   GLY A N   1 
ATOM   409  C  CA  . GLY A 1 53  ? 24.474  1.897   18.526  1.00 32.56 ? 52   GLY A CA  1 
ATOM   410  C  C   . GLY A 1 53  ? 24.149  0.850   19.599  1.00 31.41 ? 52   GLY A C   1 
ATOM   411  O  O   . GLY A 1 53  ? 25.013  0.013   19.940  1.00 31.68 ? 52   GLY A O   1 
ATOM   412  N  N   . SER A 1 54  ? 22.914  0.891   20.120  1.00 29.89 ? 53   SER A N   1 
ATOM   413  C  CA  . SER A 1 54  ? 22.427  0.027   21.201  1.00 28.08 ? 53   SER A CA  1 
ATOM   414  C  C   . SER A 1 54  ? 22.770  -1.450  21.279  1.00 26.94 ? 53   SER A C   1 
ATOM   415  O  O   . SER A 1 54  ? 22.672  -2.174  20.305  1.00 27.06 ? 53   SER A O   1 
ATOM   416  C  CB  . SER A 1 54  ? 20.917  0.122   21.270  1.00 27.92 ? 53   SER A CB  1 
ATOM   417  O  OG  . SER A 1 54  ? 20.430  -0.805  22.210  1.00 28.33 ? 53   SER A OG  1 
ATOM   418  N  N   . PRO A 1 55  ? 23.159  -1.925  22.459  1.00 25.77 ? 54   PRO A N   1 
ATOM   419  C  CA  . PRO A 1 55  ? 23.480  -3.348  22.633  1.00 24.93 ? 54   PRO A CA  1 
ATOM   420  C  C   . PRO A 1 55  ? 22.210  -4.256  22.511  1.00 24.16 ? 54   PRO A C   1 
ATOM   421  O  O   . PRO A 1 55  ? 22.287  -5.426  22.134  1.00 23.51 ? 54   PRO A O   1 
ATOM   422  C  CB  . PRO A 1 55  ? 24.116  -3.383  24.037  1.00 25.05 ? 54   PRO A CB  1 
ATOM   423  C  CG  . PRO A 1 55  ? 23.594  -2.142  24.699  1.00 25.08 ? 54   PRO A CG  1 
ATOM   424  C  CD  . PRO A 1 55  ? 23.628  -1.134  23.617  1.00 25.49 ? 54   PRO A CD  1 
ATOM   425  N  N   . HIS A 1 56  ? 21.050  -3.685  22.838  1.00 23.60 ? 55   HIS A N   1 
ATOM   426  C  CA  . HIS A 1 56  ? 19.772  -4.391  22.734  1.00 23.42 ? 55   HIS A CA  1 
ATOM   427  C  C   . HIS A 1 56  ? 19.371  -4.643  21.298  1.00 22.66 ? 55   HIS A C   1 
ATOM   428  O  O   . HIS A 1 56  ? 18.810  -5.688  20.977  1.00 22.28 ? 55   HIS A O   1 
ATOM   429  C  CB  . HIS A 1 56  ? 18.687  -3.571  23.381  1.00 24.32 ? 55   HIS A CB  1 
ATOM   430  C  CG  . HIS A 1 56  ? 18.908  -3.430  24.827  1.00 25.61 ? 55   HIS A CG  1 
ATOM   431  N  ND1 . HIS A 1 56  ? 19.857  -2.572  25.330  1.00 26.43 ? 55   HIS A ND1 1 
ATOM   432  C  CD2 . HIS A 1 56  ? 18.491  -4.192  25.855  1.00 26.05 ? 55   HIS A CD2 1 
ATOM   433  C  CE1 . HIS A 1 56  ? 20.026  -2.822  26.611  1.00 26.52 ? 55   HIS A CE1 1 
ATOM   434  N  NE2 . HIS A 1 56  ? 19.208  -3.801  26.953  1.00 26.91 ? 55   HIS A NE2 1 
ATOM   435  N  N   . ILE A 1 57  ? 19.641  -3.637  20.474  1.00 21.85 ? 56   ILE A N   1 
ATOM   436  C  CA  . ILE A 1 57  ? 19.364  -3.680  19.057  1.00 21.41 ? 56   ILE A CA  1 
ATOM   437  C  C   . ILE A 1 57  ? 20.201  -4.797  18.434  1.00 20.79 ? 56   ILE A C   1 
ATOM   438  O  O   . ILE A 1 57  ? 19.714  -5.589  17.627  1.00 20.42 ? 56   ILE A O   1 
ATOM   439  C  CB  . ILE A 1 57  ? 19.755  -2.346  18.385  1.00 21.61 ? 56   ILE A CB  1 
ATOM   440  C  CG1 . ILE A 1 57  ? 18.795  -1.245  18.799  1.00 21.99 ? 56   ILE A CG1 1 
ATOM   441  C  CG2 . ILE A 1 57  ? 19.700  -2.498  16.859  1.00 21.91 ? 56   ILE A CG2 1 
ATOM   442  C  CD1 . ILE A 1 57  ? 17.466  -1.399  18.201  1.00 22.54 ? 56   ILE A CD1 1 
ATOM   443  N  N   . LYS A 1 58  ? 21.468  -4.826  18.836  1.00 20.22 ? 57   LYS A N   1 
ATOM   444  C  CA  . LYS A 1 58  ? 22.433  -5.799  18.352  1.00 19.80 ? 57   LYS A CA  1 
ATOM   445  C  C   . LYS A 1 58  ? 22.024  -7.231  18.702  1.00 18.76 ? 57   LYS A C   1 
ATOM   446  O  O   . LYS A 1 58  ? 22.019  -8.129  17.834  1.00 18.25 ? 57   LYS A O   1 
ATOM   447  C  CB  . LYS A 1 58  ? 23.826  -5.477  18.925  1.00 20.81 ? 57   LYS A CB  1 
ATOM   448  C  CG  . LYS A 1 58  ? 24.839  -6.432  18.444  1.00 22.45 ? 57   LYS A CG  1 
ATOM   449  C  CD  . LYS A 1 58  ? 26.211  -6.037  18.853  1.00 24.38 ? 57   LYS A CD  1 
ATOM   450  C  CE  . LYS A 1 58  ? 27.177  -7.215  18.569  1.00 25.91 ? 57   LYS A CE  1 
ATOM   451  N  NZ  . LYS A 1 58  ? 28.668  -6.917  18.917  1.00 27.25 ? 57   LYS A NZ  1 
ATOM   452  N  N   . ALA A 1 59  ? 21.684  -7.445  19.972  1.00 17.71 ? 58   ALA A N   1 
ATOM   453  C  CA  . ALA A 1 59  ? 21.260  -8.769  20.401  1.00 17.25 ? 58   ALA A CA  1 
ATOM   454  C  C   . ALA A 1 59  ? 19.978  -9.220  19.673  1.00 16.84 ? 58   ALA A C   1 
ATOM   455  O  O   . ALA A 1 59  ? 19.853  -10.353 19.227  1.00 16.79 ? 58   ALA A O   1 
ATOM   456  C  CB  . ALA A 1 59  ? 21.043  -8.793  21.933  1.00 17.26 ? 58   ALA A CB  1 
ATOM   457  N  N   . HIS A 1 60  ? 19.016  -8.319  19.558  1.00 16.59 ? 59   HIS A N   1 
ATOM   458  C  CA  . HIS A 1 60  ? 17.762  -8.695  18.902  1.00 16.35 ? 59   HIS A CA  1 
ATOM   459  C  C   . HIS A 1 60  ? 17.956  -8.897  17.381  1.00 16.21 ? 59   HIS A C   1 
ATOM   460  O  O   . HIS A 1 60  ? 17.284  -9.731  16.767  1.00 16.31 ? 59   HIS A O   1 
ATOM   461  C  CB  . HIS A 1 60  ? 16.642  -7.652  19.199  1.00 16.04 ? 59   HIS A CB  1 
ATOM   462  C  CG  . HIS A 1 60  ? 15.300  -8.094  18.708  1.00 15.54 ? 59   HIS A CG  1 
ATOM   463  N  ND1 . HIS A 1 60  ? 14.695  -9.233  19.177  1.00 15.76 ? 59   HIS A ND1 1 
ATOM   464  C  CD2 . HIS A 1 60  ? 14.507  -7.624  17.719  1.00 15.58 ? 59   HIS A CD2 1 
ATOM   465  C  CE1 . HIS A 1 60  ? 13.586  -9.454  18.496  1.00 15.75 ? 59   HIS A CE1 1 
ATOM   466  N  NE2 . HIS A 1 60  ? 13.452  -8.489  17.607  1.00 15.62 ? 59   HIS A NE2 1 
ATOM   467  N  N   . GLY A 1 61  ? 18.852  -8.117  16.782  1.00 16.53 ? 60   GLY A N   1 
ATOM   468  C  CA  . GLY A 1 61  ? 19.139  -8.281  15.358  1.00 16.97 ? 60   GLY A CA  1 
ATOM   469  C  C   . GLY A 1 61  ? 19.563  -9.733  15.024  1.00 17.54 ? 60   GLY A C   1 
ATOM   470  O  O   . GLY A 1 61  ? 19.291  -10.253 13.925  1.00 17.34 ? 60   GLY A O   1 
ATOM   471  N  N   . LYS A 1 62  ? 20.254  -10.384 15.971  1.00 17.74 ? 61   LYS A N   1 
ATOM   472  C  CA  . LYS A 1 62  ? 20.674  -11.760 15.795  1.00 18.10 ? 61   LYS A CA  1 
ATOM   473  C  C   . LYS A 1 62  ? 19.418  -12.625 15.788  1.00 17.62 ? 61   LYS A C   1 
ATOM   474  O  O   . LYS A 1 62  ? 19.322  -13.567 14.997  1.00 17.31 ? 61   LYS A O   1 
ATOM   475  C  CB  . LYS A 1 62  ? 21.577  -12.198 16.948  1.00 19.30 ? 61   LYS A CB  1 
ATOM   476  C  CG  . LYS A 1 62  ? 22.255  -11.001 17.503  1.00 21.39 ? 61   LYS A CG  1 
ATOM   477  C  CD  . LYS A 1 62  ? 23.682  -11.046 17.235  1.00 23.20 ? 61   LYS A CD  1 
ATOM   478  C  CE  . LYS A 1 62  ? 24.294  -12.012 18.228  1.00 23.69 ? 61   LYS A CE  1 
ATOM   479  N  NZ  . LYS A 1 62  ? 25.667  -11.524 18.545  1.00 25.00 ? 61   LYS A NZ  1 
ATOM   480  N  N   . LYS A 1 63  ? 18.472  -12.328 16.674  1.00 16.96 ? 62   LYS A N   1 
ATOM   481  C  CA  . LYS A 1 63  ? 17.259  -13.111 16.698  1.00 16.94 ? 62   LYS A CA  1 
ATOM   482  C  C   . LYS A 1 63  ? 16.389  -12.915 15.442  1.00 16.43 ? 62   LYS A C   1 
ATOM   483  O  O   . LYS A 1 63  ? 15.825  -13.882 14.906  1.00 16.18 ? 62   LYS A O   1 
ATOM   484  C  CB  . LYS A 1 63  ? 16.454  -12.793 17.951  1.00 18.19 ? 62   LYS A CB  1 
ATOM   485  C  CG  . LYS A 1 63  ? 17.123  -13.215 19.277  1.00 19.49 ? 62   LYS A CG  1 
ATOM   486  C  CD  . LYS A 1 63  ? 16.221  -12.874 20.466  1.00 21.05 ? 62   LYS A CD  1 
ATOM   487  C  CE  . LYS A 1 63  ? 15.892  -11.344 20.524  1.00 22.44 ? 62   LYS A CE  1 
ATOM   488  N  NZ  . LYS A 1 63  ? 15.156  -10.608 21.732  1.00 21.82 ? 62   LYS A NZ  1 
ATOM   489  N  N   . VAL A 1 64  ? 16.286  -11.684 14.949  1.00 15.78 ? 63   VAL A N   1 
ATOM   490  C  CA  . VAL A 1 64  ? 15.512  -11.453 13.731  1.00 15.52 ? 63   VAL A CA  1 
ATOM   491  C  C   . VAL A 1 64  ? 16.074  -12.257 12.527  1.00 15.21 ? 63   VAL A C   1 
ATOM   492  O  O   . VAL A 1 64  ? 15.298  -12.892 11.785  1.00 15.22 ? 63   VAL A O   1 
ATOM   493  C  CB  . VAL A 1 64  ? 15.513  -9.949  13.309  1.00 15.85 ? 63   VAL A CB  1 
ATOM   494  C  CG1 . VAL A 1 64  ? 14.811  -9.780  11.943  1.00 16.01 ? 63   VAL A CG1 1 
ATOM   495  C  CG2 . VAL A 1 64  ? 14.863  -9.102  14.368  1.00 16.00 ? 63   VAL A CG2 1 
ATOM   496  N  N   . MET A 1 65  ? 17.407  -12.208 12.299  1.00 14.78 ? 64   MET A N   1 
ATOM   497  C  CA  . MET A 1 65  ? 17.994  -12.937 11.178  1.00 14.41 ? 64   MET A CA  1 
ATOM   498  C  C   . MET A 1 65  ? 18.056  -14.438 11.431  1.00 14.05 ? 64   MET A C   1 
ATOM   499  O  O   . MET A 1 65  ? 18.126  -15.222 10.499  1.00 14.16 ? 64   MET A O   1 
ATOM   500  C  CB  . MET A 1 65  ? 19.349  -12.340 10.759  1.00 14.60 ? 64   MET A CB  1 
ATOM   501  C  CG  . MET A 1 65  ? 19.237  -10.886 10.214  1.00 15.06 ? 64   MET A CG  1 
ATOM   502  S  SD  . MET A 1 65  ? 17.935  -10.597 8.945   1.00 15.20 ? 64   MET A SD  1 
ATOM   503  C  CE  . MET A 1 65  ? 18.644  -11.416 7.506   1.00 15.53 ? 64   MET A CE  1 
ATOM   504  N  N   . GLY A 1 66  ? 18.020  -14.842 12.691  1.00 13.89 ? 65   GLY A N   1 
ATOM   505  C  CA  . GLY A 1 66  ? 17.903  -16.264 12.960  1.00 13.73 ? 65   GLY A CA  1 
ATOM   506  C  C   . GLY A 1 66  ? 16.491  -16.693 12.511  1.00 13.60 ? 65   GLY A C   1 
ATOM   507  O  O   . GLY A 1 66  ? 16.342  -17.792 12.016  1.00 13.99 ? 65   GLY A O   1 
ATOM   508  N  N   . GLY A 1 67  ? 15.454  -15.858 12.695  1.00 13.31 ? 66   GLY A N   1 
ATOM   509  C  CA  . GLY A 1 67  ? 14.103  -16.170 12.208  1.00 12.94 ? 66   GLY A CA  1 
ATOM   510  C  C   . GLY A 1 67  ? 14.117  -16.232 10.648  1.00 12.83 ? 66   GLY A C   1 
ATOM   511  O  O   . GLY A 1 67  ? 13.406  -17.060 10.029  1.00 12.83 ? 66   GLY A O   1 
ATOM   512  N  N   . ILE A 1 68  ? 14.898  -15.352 10.001  1.00 12.55 ? 67   ILE A N   1 
ATOM   513  C  CA  . ILE A 1 68  ? 15.008  -15.392 8.555   1.00 12.53 ? 67   ILE A CA  1 
ATOM   514  C  C   . ILE A 1 68  ? 15.745  -16.723 8.161   1.00 12.58 ? 67   ILE A C   1 
ATOM   515  O  O   . ILE A 1 68  ? 15.345  -17.418 7.216   1.00 12.42 ? 67   ILE A O   1 
ATOM   516  C  CB  . ILE A 1 68  ? 15.738  -14.100 7.972   1.00 12.34 ? 67   ILE A CB  1 
ATOM   517  C  CG1 . ILE A 1 68  ? 14.837  -12.876 8.090   1.00 12.34 ? 67   ILE A CG1 1 
ATOM   518  C  CG2 . ILE A 1 68  ? 16.082  -14.285 6.503   1.00 12.65 ? 67   ILE A CG2 1 
ATOM   519  C  CD1 . ILE A 1 68  ? 13.504  -12.982 7.424   1.00 12.03 ? 67   ILE A CD1 1 
ATOM   520  N  N   . ALA A 1 69  ? 16.775  -17.096 8.908   1.00 12.81 ? 68   ALA A N   1 
ATOM   521  C  CA  . ALA A 1 69  ? 17.482  -18.342 8.625   1.00 13.16 ? 68   ALA A CA  1 
ATOM   522  C  C   . ALA A 1 69  ? 16.496  -19.521 8.776   1.00 13.29 ? 68   ALA A C   1 
ATOM   523  O  O   . ALA A 1 69  ? 16.481  -20.452 7.954   1.00 13.34 ? 68   ALA A O   1 
ATOM   524  C  CB  . ALA A 1 69  ? 18.701  -18.491 9.561   1.00 13.23 ? 68   ALA A CB  1 
ATOM   525  N  N   . LEU A 1 70  ? 15.652  -19.470 9.806   1.00 13.20 ? 69   LEU A N   1 
ATOM   526  C  CA  . LEU A 1 70  ? 14.635  -20.512 9.994   1.00 13.15 ? 69   LEU A CA  1 
ATOM   527  C  C   . LEU A 1 70  ? 13.725  -20.529 8.746   1.00 13.05 ? 69   LEU A C   1 
ATOM   528  O  O   . LEU A 1 70  ? 13.409  -21.583 8.191   1.00 13.05 ? 69   LEU A O   1 
ATOM   529  C  CB  . LEU A 1 70  ? 13.814  -20.203 11.230  1.00 12.82 ? 69   LEU A CB  1 
ATOM   530  C  CG  . LEU A 1 70  ? 12.644  -21.131 11.413  1.00 13.19 ? 69   LEU A CG  1 
ATOM   531  C  CD1 . LEU A 1 70  ? 13.068  -22.574 11.714  1.00 13.14 ? 69   LEU A CD1 1 
ATOM   532  C  CD2 . LEU A 1 70  ? 11.849  -20.565 12.544  1.00 13.55 ? 69   LEU A CD2 1 
ATOM   533  N  N   . ALA A 1 71  ? 13.297  -19.339 8.312   1.00 12.77 ? 70   ALA A N   1 
ATOM   534  C  CA  . ALA A 1 71  ? 12.436  -19.242 7.139   1.00 13.21 ? 70   ALA A CA  1 
ATOM   535  C  C   . ALA A 1 71  ? 13.103  -19.930 5.899   1.00 13.33 ? 70   ALA A C   1 
ATOM   536  O  O   . ALA A 1 71  ? 12.441  -20.654 5.140   1.00 13.18 ? 70   ALA A O   1 
ATOM   537  C  CB  . ALA A 1 71  ? 12.131  -17.739 6.846   1.00 12.91 ? 70   ALA A CB  1 
ATOM   538  N  N   . VAL A 1 72  ? 14.414  -19.702 5.723   1.00 13.67 ? 71   VAL A N   1 
ATOM   539  C  CA  . VAL A 1 72  ? 15.146  -20.310 4.592   1.00 14.29 ? 71   VAL A CA  1 
ATOM   540  C  C   . VAL A 1 72  ? 15.078  -21.861 4.735   1.00 14.94 ? 71   VAL A C   1 
ATOM   541  O  O   . VAL A 1 72  ? 14.779  -22.557 3.770   1.00 15.09 ? 71   VAL A O   1 
ATOM   542  C  CB  . VAL A 1 72  ? 16.636  -19.860 4.511   1.00 14.08 ? 71   VAL A CB  1 
ATOM   543  C  CG1 . VAL A 1 72  ? 17.328  -20.626 3.370   1.00 13.82 ? 71   VAL A CG1 1 
ATOM   544  C  CG2 . VAL A 1 72  ? 16.720  -18.330 4.218   1.00 13.92 ? 71   VAL A CG2 1 
ATOM   545  N  N   . SER A 1 73  ? 15.325  -22.381 5.937   1.00 15.51 ? 72   SER A N   1 
ATOM   546  C  CA  . SER A 1 73  ? 15.245  -23.838 6.145   1.00 16.37 ? 72   SER A CA  1 
ATOM   547  C  C   . SER A 1 73  ? 13.803  -24.361 5.939   1.00 16.36 ? 72   SER A C   1 
ATOM   548  O  O   . SER A 1 73  ? 13.629  -25.456 5.449   1.00 16.79 ? 72   SER A O   1 
ATOM   549  C  CB  . SER A 1 73  ? 15.790  -24.206 7.543   1.00 17.07 ? 72   SER A CB  1 
ATOM   550  O  OG  . SER A 1 73  ? 14.879  -23.861 8.573   1.00 19.92 ? 72   SER A OG  1 
ATOM   551  N  N   . LYS A 1 74  ? 12.772  -23.549 6.227   1.00 16.01 ? 73   LYS A N   1 
ATOM   552  C  CA  . LYS A 1 74  ? 11.368  -23.950 6.093   1.00 15.61 ? 73   LYS A CA  1 
ATOM   553  C  C   . LYS A 1 74  ? 10.711  -23.421 4.797   1.00 15.53 ? 73   LYS A C   1 
ATOM   554  O  O   . LYS A 1 74  ? 9.451   -23.367 4.687   1.00 15.16 ? 73   LYS A O   1 
ATOM   555  C  CB  . LYS A 1 74  ? 10.579  -23.389 7.291   1.00 16.19 ? 73   LYS A CB  1 
ATOM   556  C  CG  . LYS A 1 74  ? 11.147  -23.763 8.649   1.00 17.00 ? 73   LYS A CG  1 
ATOM   557  C  CD  . LYS A 1 74  ? 11.303  -25.298 8.743   1.00 18.46 ? 73   LYS A CD  1 
ATOM   558  C  CE  . LYS A 1 74  ? 11.947  -25.753 10.086  1.00 19.45 ? 73   LYS A CE  1 
ATOM   559  N  NZ  . LYS A 1 74  ? 11.989  -27.267 10.078  1.00 20.67 ? 73   LYS A NZ  1 
ATOM   560  N  N   . ILE A 1 75  ? 11.556  -23.033 3.837   1.00 15.50 ? 74   ILE A N   1 
ATOM   561  C  CA  . ILE A 1 75  ? 11.090  -22.425 2.602   1.00 15.69 ? 74   ILE A CA  1 
ATOM   562  C  C   . ILE A 1 75  ? 9.976   -23.169 1.851   1.00 16.27 ? 74   ILE A C   1 
ATOM   563  O  O   . ILE A 1 75  ? 9.149   -22.569 1.158   1.00 16.08 ? 74   ILE A O   1 
ATOM   564  C  CB  . ILE A 1 75  ? 12.312  -22.135 1.695   1.00 15.58 ? 74   ILE A CB  1 
ATOM   565  C  CG1 . ILE A 1 75  ? 11.980  -21.045 0.616   1.00 15.45 ? 74   ILE A CG1 1 
ATOM   566  C  CG2 . ILE A 1 75  ? 12.778  -23.428 1.067   1.00 15.39 ? 74   ILE A CG2 1 
ATOM   567  C  CD1 . ILE A 1 75  ? 13.235  -20.406 0.036   1.00 14.31 ? 74   ILE A CD1 1 
ATOM   568  N  N   . ASP A 1 76  ? 9.941   -24.491 2.005   1.00 16.83 ? 75   ASP A N   1 
ATOM   569  C  CA  . ASP A 1 76  ? 8.929   -25.301 1.356   1.00 17.26 ? 75   ASP A CA  1 
ATOM   570  C  C   . ASP A 1 76  ? 7.552   -25.156 1.982   1.00 17.03 ? 75   ASP A C   1 
ATOM   571  O  O   . ASP A 1 76  ? 6.553   -25.452 1.345   1.00 16.75 ? 75   ASP A O   1 
ATOM   572  C  CB  . ASP A 1 76  ? 9.410   -26.769 1.331   1.00 18.05 ? 75   ASP A CB  1 
ATOM   573  C  CG  . ASP A 1 76  ? 10.685  -26.916 0.496   1.00 18.82 ? 75   ASP A CG  1 
ATOM   574  O  OD1 . ASP A 1 76  ? 10.676  -26.533 -0.683  1.00 18.97 ? 75   ASP A OD1 1 
ATOM   575  O  OD2 . ASP A 1 76  ? 11.736  -27.350 0.998   1.00 20.45 ? 75   ASP A OD2 1 
ATOM   576  N  N   . ASP A 1 77  ? 7.490   -24.669 3.214   1.00 16.87 ? 76   ASP A N   1 
ATOM   577  C  CA  . ASP A 1 77  ? 6.205   -24.496 3.873   1.00 17.07 ? 76   ASP A CA  1 
ATOM   578  C  C   . ASP A 1 77  ? 6.359   -23.451 4.971   1.00 16.88 ? 76   ASP A C   1 
ATOM   579  O  O   . ASP A 1 77  ? 6.533   -23.744 6.146   1.00 17.40 ? 76   ASP A O   1 
ATOM   580  C  CB  . ASP A 1 77  ? 5.708   -25.825 4.425   1.00 17.41 ? 76   ASP A CB  1 
ATOM   581  C  CG  . ASP A 1 77  ? 4.376   -25.693 5.114   1.00 18.39 ? 76   ASP A CG  1 
ATOM   582  O  OD1 . ASP A 1 77  ? 3.722   -24.607 5.121   1.00 18.43 ? 76   ASP A OD1 1 
ATOM   583  O  OD2 . ASP A 1 77  ? 3.968   -26.717 5.671   1.00 19.17 ? 76   ASP A OD2 1 
ATOM   584  N  N   . LEU A 1 78  ? 6.292   -22.203 4.543   1.00 16.70 ? 77   LEU A N   1 
ATOM   585  C  CA  . LEU A 1 78  ? 6.496   -21.075 5.427   1.00 16.42 ? 77   LEU A CA  1 
ATOM   586  C  C   . LEU A 1 78  ? 5.430   -20.988 6.496   1.00 16.33 ? 77   LEU A C   1 
ATOM   587  O  O   . LEU A 1 78  ? 5.731   -20.659 7.660   1.00 16.28 ? 77   LEU A O   1 
ATOM   588  C  CB  . LEU A 1 78  ? 6.608   -19.770 4.578   1.00 15.81 ? 77   LEU A CB  1 
ATOM   589  C  CG  . LEU A 1 78  ? 7.909   -19.695 3.737   1.00 15.44 ? 77   LEU A CG  1 
ATOM   590  C  CD1 . LEU A 1 78  ? 7.893   -18.477 2.856   1.00 15.33 ? 77   LEU A CD1 1 
ATOM   591  C  CD2 . LEU A 1 78  ? 9.139   -19.601 4.650   1.00 14.96 ? 77   LEU A CD2 1 
ATOM   592  N  N   . LYS A 1 79  ? 4.202   -21.318 6.123   1.00 16.52 ? 78   LYS A N   1 
ATOM   593  C  CA  . LYS A 1 79  ? 3.088   -21.250 7.068   1.00 17.13 ? 78   LYS A CA  1 
ATOM   594  C  C   . LYS A 1 79  ? 3.331   -22.140 8.291   1.00 16.98 ? 78   LYS A C   1 
ATOM   595  O  O   . LYS A 1 79  ? 3.218   -21.706 9.444   1.00 16.93 ? 78   LYS A O   1 
ATOM   596  C  CB  . LYS A 1 79  ? 1.763   -21.650 6.384   1.00 17.72 ? 78   LYS A CB  1 
ATOM   597  C  CG  . LYS A 1 79  ? 0.614   -21.685 7.353   1.00 19.12 ? 78   LYS A CG  1 
ATOM   598  C  CD  . LYS A 1 79  ? -0.700  -22.090 6.684   1.00 20.21 ? 78   LYS A CD  1 
ATOM   599  C  CE  . LYS A 1 79  ? -1.735  -22.444 7.767   1.00 20.73 ? 78   LYS A CE  1 
ATOM   600  N  NZ  . LYS A 1 79  ? -3.060  -22.835 7.156   1.00 21.64 ? 78   LYS A NZ  1 
ATOM   601  N  N   . THR A 1 80  ? 3.686   -23.385 8.046   1.00 16.98 ? 79   THR A N   1 
ATOM   602  C  CA  . THR A 1 80  ? 3.949   -24.283 9.157   1.00 17.02 ? 79   THR A CA  1 
ATOM   603  C  C   . THR A 1 80  ? 5.262   -23.905 9.857   1.00 16.62 ? 79   THR A C   1 
ATOM   604  O  O   . THR A 1 80  ? 5.335   -23.887 11.083  1.00 16.76 ? 79   THR A O   1 
ATOM   605  C  CB  . THR A 1 80  ? 4.064   -25.745 8.667   1.00 17.57 ? 79   THR A CB  1 
ATOM   606  O  OG1 . THR A 1 80  ? 2.854   -26.110 7.984   1.00 17.72 ? 79   THR A OG1 1 
ATOM   607  C  CG2 . THR A 1 80  ? 4.302   -26.694 9.884   1.00 17.55 ? 79   THR A CG2 1 
ATOM   608  N  N   . GLY A 1 81  ? 6.284   -23.586 9.085   1.00 16.16 ? 80   GLY A N   1 
ATOM   609  C  CA  . GLY A 1 81  ? 7.550   -23.262 9.686   1.00 15.69 ? 80   GLY A CA  1 
ATOM   610  C  C   . GLY A 1 81  ? 7.520   -22.018 10.540  1.00 15.82 ? 80   GLY A C   1 
ATOM   611  O  O   . GLY A 1 81  ? 8.246   -21.944 11.549  1.00 15.58 ? 80   GLY A O   1 
ATOM   612  N  N   . LEU A 1 82  ? 6.700   -21.025 10.193  1.00 15.35 ? 81   LEU A N   1 
ATOM   613  C  CA  . LEU A 1 82  ? 6.756   -19.806 11.008  1.00 15.63 ? 81   LEU A CA  1 
ATOM   614  C  C   . LEU A 1 82  ? 5.544   -19.593 11.911  1.00 15.81 ? 81   LEU A C   1 
ATOM   615  O  O   . LEU A 1 82  ? 5.348   -18.532 12.480  1.00 15.07 ? 81   LEU A O   1 
ATOM   616  C  CB  . LEU A 1 82  ? 6.919   -18.573 10.088  1.00 15.45 ? 81   LEU A CB  1 
ATOM   617  C  CG  . LEU A 1 82  ? 8.167   -18.564 9.211   1.00 15.62 ? 81   LEU A CG  1 
ATOM   618  C  CD1 . LEU A 1 82  ? 8.141   -17.315 8.294   1.00 14.91 ? 81   LEU A CD1 1 
ATOM   619  C  CD2 . LEU A 1 82  ? 9.461   -18.677 10.167  1.00 15.28 ? 81   LEU A CD2 1 
ATOM   620  N  N   . MET A 1 83  ? 4.742   -20.622 12.032  1.00 16.46 ? 82   MET A N   1 
ATOM   621  C  CA  . MET A 1 83  ? 3.544   -20.532 12.811  1.00 17.72 ? 82   MET A CA  1 
ATOM   622  C  C   . MET A 1 83  ? 3.765   -20.037 14.275  1.00 17.79 ? 82   MET A C   1 
ATOM   623  O  O   . MET A 1 83  ? 3.014   -19.211 14.784  1.00 17.03 ? 82   MET A O   1 
ATOM   624  C  CB  . MET A 1 83  ? 2.878   -21.920 12.771  1.00 19.65 ? 82   MET A CB  1 
ATOM   625  C  CG  . MET A 1 83  ? 1.548   -22.062 13.496  1.00 22.12 ? 82   MET A CG  1 
ATOM   626  S  SD  . MET A 1 83  ? 0.186   -21.228 12.650  1.00 25.79 ? 82   MET A SD  1 
ATOM   627  C  CE  . MET A 1 83  ? -0.047  -22.334 11.118  1.00 23.99 ? 82   MET A CE  1 
ATOM   628  N  N   . GLU A 1 84  ? 4.798   -20.525 14.937  1.00 17.87 ? 83   GLU A N   1 
ATOM   629  C  CA  . GLU A 1 84  ? 5.012   -20.136 16.312  1.00 18.86 ? 83   GLU A CA  1 
ATOM   630  C  C   . GLU A 1 84  ? 5.423   -18.660 16.362  1.00 18.01 ? 83   GLU A C   1 
ATOM   631  O  O   . GLU A 1 84  ? 4.992   -17.924 17.245  1.00 17.69 ? 83   GLU A O   1 
ATOM   632  C  CB  . GLU A 1 84  ? 6.066   -21.076 16.930  1.00 21.06 ? 83   GLU A CB  1 
ATOM   633  C  CG  . GLU A 1 84  ? 6.220   -21.058 18.462  1.00 25.16 ? 83   GLU A CG  1 
ATOM   634  C  CD  . GLU A 1 84  ? 7.373   -22.024 19.001  1.00 27.26 ? 83   GLU A CD  1 
ATOM   635  O  OE1 . GLU A 1 84  ? 8.594   -21.812 18.676  1.00 28.68 ? 83   GLU A OE1 1 
ATOM   636  O  OE2 . GLU A 1 84  ? 7.047   -22.986 19.766  1.00 29.08 ? 83   GLU A OE2 1 
ATOM   637  N  N   . LEU A 1 85  ? 6.236   -18.203 15.410  1.00 17.25 ? 84   LEU A N   1 
ATOM   638  C  CA  . LEU A 1 85  ? 6.607   -16.780 15.416  1.00 16.56 ? 84   LEU A CA  1 
ATOM   639  C  C   . LEU A 1 85  ? 5.381   -15.930 15.065  1.00 16.18 ? 84   LEU A C   1 
ATOM   640  O  O   . LEU A 1 85  ? 5.260   -14.802 15.549  1.00 16.10 ? 84   LEU A O   1 
ATOM   641  C  CB  . LEU A 1 85  ? 7.699   -16.468 14.406  1.00 16.66 ? 84   LEU A CB  1 
ATOM   642  C  CG  . LEU A 1 85  ? 9.067   -16.920 14.842  1.00 17.18 ? 84   LEU A CG  1 
ATOM   643  C  CD1 . LEU A 1 85  ? 10.068  -16.696 13.689  1.00 17.31 ? 84   LEU A CD1 1 
ATOM   644  C  CD2 . LEU A 1 85  ? 9.458   -16.132 16.134  1.00 17.74 ? 84   LEU A CD2 1 
ATOM   645  N  N   . SER A 1 86  ? 4.480   -16.452 14.230  1.00 15.45 ? 85   SER A N   1 
ATOM   646  C  CA  . SER A 1 86  ? 3.277   -15.706 13.891  1.00 15.24 ? 85   SER A CA  1 
ATOM   647  C  C   . SER A 1 86  ? 2.438   -15.519 15.163  1.00 15.77 ? 85   SER A C   1 
ATOM   648  O  O   . SER A 1 86  ? 1.936   -14.432 15.453  1.00 16.06 ? 85   SER A O   1 
ATOM   649  C  CB  . SER A 1 86  ? 2.449   -16.450 12.859  1.00 14.60 ? 85   SER A CB  1 
ATOM   650  O  OG  . SER A 1 86  ? 1.318   -15.653 12.570  1.00 14.01 ? 85   SER A OG  1 
ATOM   651  N  N   . GLU A 1 87  ? 2.258   -16.588 15.912  1.00 16.17 ? 86   GLU A N   1 
ATOM   652  C  CA  . GLU A 1 87  ? 1.479   -16.558 17.135  1.00 17.05 ? 86   GLU A CA  1 
ATOM   653  C  C   . GLU A 1 87  ? 2.048   -15.548 18.113  1.00 16.80 ? 86   GLU A C   1 
ATOM   654  O  O   . GLU A 1 87  ? 1.330   -14.796 18.778  1.00 16.68 ? 86   GLU A O   1 
ATOM   655  C  CB  . GLU A 1 87  ? 1.549   -17.957 17.749  1.00 18.48 ? 86   GLU A CB  1 
ATOM   656  C  CG  . GLU A 1 87  ? 0.852   -18.086 19.055  1.00 21.26 ? 86   GLU A CG  1 
ATOM   657  C  CD  . GLU A 1 87  ? -0.618  -17.874 18.937  1.00 22.98 ? 86   GLU A CD  1 
ATOM   658  O  OE1 . GLU A 1 87  ? -1.227  -18.282 17.908  1.00 24.45 ? 86   GLU A OE1 1 
ATOM   659  O  OE2 . GLU A 1 87  ? -1.179  -17.304 19.896  1.00 25.09 ? 86   GLU A OE2 1 
ATOM   660  N  N   . GLN A 1 88  ? 3.366   -15.535 18.189  1.00 16.92 ? 87   GLN A N   1 
ATOM   661  C  CA  . GLN A 1 88  ? 4.028   -14.654 19.115  1.00 17.21 ? 87   GLN A CA  1 
ATOM   662  C  C   . GLN A 1 88  ? 3.859   -13.180 18.781  1.00 16.61 ? 87   GLN A C   1 
ATOM   663  O  O   . GLN A 1 88  ? 3.624   -12.348 19.673  1.00 16.04 ? 87   GLN A O   1 
ATOM   664  C  CB  . GLN A 1 88  ? 5.504   -15.022 19.214  1.00 18.33 ? 87   GLN A CB  1 
ATOM   665  C  CG  . GLN A 1 88  ? 6.177   -14.021 20.074  1.00 21.43 ? 87   GLN A CG  1 
ATOM   666  C  CD  . GLN A 1 88  ? 7.613   -14.337 20.359  1.00 23.10 ? 87   GLN A CD  1 
ATOM   667  O  OE1 . GLN A 1 88  ? 8.253   -13.647 21.194  1.00 25.01 ? 87   GLN A OE1 1 
ATOM   668  N  NE2 . GLN A 1 88  ? 8.154   -15.365 19.689  1.00 23.91 ? 87   GLN A NE2 1 
ATOM   669  N  N   . HIS A 1 89  ? 3.993   -12.859 17.493  1.00 15.95 ? 88   HIS A N   1 
ATOM   670  C  CA  . HIS A 1 89  ? 3.861   -11.476 17.074  1.00 15.88 ? 88   HIS A CA  1 
ATOM   671  C  C   . HIS A 1 89  ? 2.404   -11.033 17.153  1.00 16.36 ? 88   HIS A C   1 
ATOM   672  O  O   . HIS A 1 89  ? 2.136   -9.902  17.594  1.00 16.18 ? 88   HIS A O   1 
ATOM   673  C  CB  . HIS A 1 89  ? 4.458   -11.254 15.671  1.00 15.17 ? 88   HIS A CB  1 
ATOM   674  C  CG  . HIS A 1 89  ? 5.972   -11.271 15.666  1.00 15.02 ? 88   HIS A CG  1 
ATOM   675  N  ND1 . HIS A 1 89  ? 6.733   -12.423 15.671  1.00 14.31 ? 88   HIS A ND1 1 
ATOM   676  C  CD2 . HIS A 1 89  ? 6.863   -10.243 15.714  1.00 14.50 ? 88   HIS A CD2 1 
ATOM   677  C  CE1 . HIS A 1 89  ? 8.026   -12.073 15.715  1.00 14.50 ? 88   HIS A CE1 1 
ATOM   678  N  NE2 . HIS A 1 89  ? 8.161   -10.758 15.743  1.00 14.88 ? 88   HIS A NE2 1 
ATOM   679  N  N   . ALA A 1 90  ? 1.469   -11.938 16.816  1.00 16.93 ? 89   ALA A N   1 
ATOM   680  C  CA  . ALA A 1 90  ? 0.042   -11.580 16.829  1.00 17.77 ? 89   ALA A CA  1 
ATOM   681  C  C   . ALA A 1 90  ? -0.518  -11.462 18.213  1.00 18.59 ? 89   ALA A C   1 
ATOM   682  O  O   . ALA A 1 90  ? -1.157  -10.455 18.533  1.00 18.57 ? 89   ALA A O   1 
ATOM   683  C  CB  . ALA A 1 90  ? -0.807  -12.590 16.031  1.00 16.91 ? 89   ALA A CB  1 
ATOM   684  N  N   . TYR A 1 91  ? -0.278  -12.489 19.029  1.00 19.83 ? 90   TYR A N   1 
ATOM   685  C  CA  . TYR A 1 91  ? -0.875  -12.542 20.369  1.00 21.49 ? 90   TYR A CA  1 
ATOM   686  C  C   . TYR A 1 91  ? -0.098  -12.017 21.516  1.00 21.59 ? 90   TYR A C   1 
ATOM   687  O  O   . TYR A 1 91  ? -0.645  -11.373 22.387  1.00 21.84 ? 90   TYR A O   1 
ATOM   688  C  CB  . TYR A 1 91  ? -1.288  -13.972 20.718  1.00 23.18 ? 90   TYR A CB  1 
ATOM   689  C  CG  . TYR A 1 91  ? -2.376  -14.453 19.818  1.00 25.77 ? 90   TYR A CG  1 
ATOM   690  C  CD1 . TYR A 1 91  ? -3.715  -14.483 20.234  1.00 27.23 ? 90   TYR A CD1 1 
ATOM   691  C  CD2 . TYR A 1 91  ? -2.086  -14.824 18.509  1.00 26.71 ? 90   TYR A CD2 1 
ATOM   692  C  CE1 . TYR A 1 91  ? -4.743  -14.888 19.327  1.00 28.69 ? 90   TYR A CE1 1 
ATOM   693  C  CE2 . TYR A 1 91  ? -3.073  -15.205 17.622  1.00 27.97 ? 90   TYR A CE2 1 
ATOM   694  C  CZ  . TYR A 1 91  ? -4.374  -15.238 18.013  1.00 28.61 ? 90   TYR A CZ  1 
ATOM   695  O  OH  . TYR A 1 91  ? -5.318  -15.595 17.061  1.00 30.57 ? 90   TYR A OH  1 
ATOM   696  N  N   . LYS A 1 92  ? 1.178   -12.297 21.551  1.00 21.51 ? 91   LYS A N   1 
ATOM   697  C  CA  . LYS A 1 92  ? 1.902   -11.833 22.671  1.00 21.56 ? 91   LYS A CA  1 
ATOM   698  C  C   . LYS A 1 92  ? 2.512   -10.444 22.512  1.00 20.89 ? 91   LYS A C   1 
ATOM   699  O  O   . LYS A 1 92  ? 2.471   -9.632  23.426  1.00 21.01 ? 91   LYS A O   1 
ATOM   700  C  CB  . LYS A 1 92  ? 2.920   -12.881 22.993  1.00 22.91 ? 91   LYS A CB  1 
ATOM   701  C  CG  . LYS A 1 92  ? 4.051   -12.331 23.689  1.00 25.13 ? 91   LYS A CG  1 
ATOM   702  C  CD  . LYS A 1 92  ? 5.308   -12.611 22.871  1.00 27.11 ? 91   LYS A CD  1 
ATOM   703  C  CE  . LYS A 1 92  ? 6.328   -13.051 23.887  1.00 28.07 ? 91   LYS A CE  1 
ATOM   704  N  NZ  . LYS A 1 92  ? 5.521   -13.756 25.015  1.00 28.94 ? 91   LYS A NZ  1 
ATOM   705  N  N   . LEU A 1 93  ? 3.036   -10.130 21.348  1.00 19.76 ? 92   LEU A N   1 
ATOM   706  C  CA  . LEU A 1 93  ? 3.663   -8.829  21.172  1.00 19.06 ? 92   LEU A CA  1 
ATOM   707  C  C   . LEU A 1 93  ? 2.710   -7.824  20.556  1.00 19.00 ? 92   LEU A C   1 
ATOM   708  O  O   . LEU A 1 93  ? 2.943   -6.610  20.658  1.00 19.13 ? 92   LEU A O   1 
ATOM   709  C  CB  . LEU A 1 93  ? 4.888   -8.966  20.282  1.00 18.16 ? 92   LEU A CB  1 
ATOM   710  C  CG  . LEU A 1 93  ? 5.914   -9.997  20.770  1.00 17.58 ? 92   LEU A CG  1 
ATOM   711  C  CD1 . LEU A 1 93  ? 6.853   -10.326 19.601  1.00 17.60 ? 92   LEU A CD1 1 
ATOM   712  C  CD2 . LEU A 1 93  ? 6.652   -9.479  22.015  1.00 17.12 ? 92   LEU A CD2 1 
ATOM   713  N  N   . ARG A 1 94  ? 1.652   -8.332  19.925  1.00 18.93 ? 93   ARG A N   1 
ATOM   714  C  CA  . ARG A 1 94  ? 0.650   -7.506  19.245  1.00 19.01 ? 93   ARG A CA  1 
ATOM   715  C  C   . ARG A 1 94  ? 1.306   -6.474  18.303  1.00 18.08 ? 93   ARG A C   1 
ATOM   716  O  O   . ARG A 1 94  ? 1.011   -5.282  18.331  1.00 18.03 ? 93   ARG A O   1 
ATOM   717  C  CB  . ARG A 1 94  ? -0.303  -6.856  20.277  1.00 20.42 ? 93   ARG A CB  1 
ATOM   718  C  CG  . ARG A 1 94  ? -1.233  -7.938  20.975  1.00 22.89 ? 93   ARG A CG  1 
ATOM   719  C  CD  . ARG A 1 94  ? -2.530  -7.328  21.564  1.00 25.41 ? 93   ARG A CD  1 
ATOM   720  N  NE  . ARG A 1 94  ? -3.787  -7.130  20.713  1.00 28.40 ? 93   ARG A NE  1 
ATOM   721  C  CZ  . ARG A 1 94  ? -3.945  -6.774  19.388  1.00 28.77 ? 93   ARG A CZ  1 
ATOM   722  N  NH1 . ARG A 1 94  ? -2.925  -6.551  18.531  1.00 28.01 ? 93   ARG A NH1 1 
ATOM   723  N  NH2 . ARG A 1 94  ? -5.213  -6.541  18.938  1.00 29.47 ? 93   ARG A NH2 1 
ATOM   724  N  N   . VAL A 1 95  ? 2.226   -6.961  17.473  1.00 17.09 ? 94   VAL A N   1 
ATOM   725  C  CA  . VAL A 1 95  ? 2.918   -6.112  16.492  1.00 16.17 ? 94   VAL A CA  1 
ATOM   726  C  C   . VAL A 1 95  ? 1.962   -5.913  15.319  1.00 15.93 ? 94   VAL A C   1 
ATOM   727  O  O   . VAL A 1 95  ? 1.465   -6.888  14.750  1.00 15.80 ? 94   VAL A O   1 
ATOM   728  C  CB  . VAL A 1 95  ? 4.218   -6.812  15.992  1.00 16.04 ? 94   VAL A CB  1 
ATOM   729  C  CG1 . VAL A 1 95  ? 4.765   -6.090  14.753  1.00 15.35 ? 94   VAL A CG1 1 
ATOM   730  C  CG2 . VAL A 1 95  ? 5.245   -6.867  17.140  1.00 15.67 ? 94   VAL A CG2 1 
ATOM   731  N  N   . ASP A 1 96  ? 1.671   -4.662  14.964  1.00 15.69 ? 95   ASP A N   1 
ATOM   732  C  CA  . ASP A 1 96  ? 0.745   -4.419  13.850  1.00 15.54 ? 95   ASP A CA  1 
ATOM   733  C  C   . ASP A 1 96  ? 1.423   -5.060  12.624  1.00 15.29 ? 95   ASP A C   1 
ATOM   734  O  O   . ASP A 1 96  ? 2.594   -4.748  12.319  1.00 15.13 ? 95   ASP A O   1 
ATOM   735  C  CB  . ASP A 1 96  ? 0.535   -2.912  13.681  1.00 15.80 ? 95   ASP A CB  1 
ATOM   736  C  CG  . ASP A 1 96  ? -0.559  -2.588  12.703  1.00 16.25 ? 95   ASP A CG  1 
ATOM   737  O  OD1 . ASP A 1 96  ? -0.292  -2.787  11.471  1.00 16.18 ? 95   ASP A OD1 1 
ATOM   738  O  OD2 . ASP A 1 96  ? -1.669  -2.166  13.188  1.00 16.36 ? 95   ASP A OD2 1 
ATOM   739  N  N   . PRO A 1 97  ? 0.695   -5.955  11.903  1.00 14.88 ? 96   PRO A N   1 
ATOM   740  C  CA  . PRO A 1 97  ? 1.226   -6.668  10.729  1.00 14.71 ? 96   PRO A CA  1 
ATOM   741  C  C   . PRO A 1 97  ? 1.677   -5.837  9.526   1.00 14.87 ? 96   PRO A C   1 
ATOM   742  O  O   . PRO A 1 97  ? 2.420   -6.345  8.651   1.00 14.94 ? 96   PRO A O   1 
ATOM   743  C  CB  . PRO A 1 97  ? 0.126   -7.677  10.402  1.00 14.66 ? 96   PRO A CB  1 
ATOM   744  C  CG  . PRO A 1 97  ? -1.131  -6.922  10.818  1.00 14.48 ? 96   PRO A CG  1 
ATOM   745  C  CD  . PRO A 1 97  ? -0.737  -6.236  12.101  1.00 14.65 ? 96   PRO A CD  1 
ATOM   746  N  N   . ALA A 1 98  ? 1.262   -4.564  9.490   1.00 14.76 ? 97   ALA A N   1 
ATOM   747  C  CA  . ALA A 1 98  ? 1.679   -3.664  8.403   1.00 14.45 ? 97   ALA A CA  1 
ATOM   748  C  C   . ALA A 1 98  ? 3.213   -3.474  8.427   1.00 14.22 ? 97   ALA A C   1 
ATOM   749  O  O   . ALA A 1 98  ? 3.852   -3.081  7.425   1.00 14.53 ? 97   ALA A O   1 
ATOM   750  C  CB  . ALA A 1 98  ? 0.978   -2.291  8.577   1.00 14.40 ? 97   ALA A CB  1 
ATOM   751  N  N   . ASN A 1 99  ? 3.812   -3.743  9.573   1.00 13.84 ? 98   ASN A N   1 
ATOM   752  C  CA  . ASN A 1 99  ? 5.246   -3.535  9.704   1.00 13.55 ? 98   ASN A CA  1 
ATOM   753  C  C   . ASN A 1 99  ? 6.158   -4.639  9.170   1.00 13.12 ? 98   ASN A C   1 
ATOM   754  O  O   . ASN A 1 99  ? 7.356   -4.416  9.023   1.00 12.54 ? 98   ASN A O   1 
ATOM   755  C  CB  . ASN A 1 99  ? 5.541   -3.227  11.168  1.00 14.65 ? 98   ASN A CB  1 
ATOM   756  C  CG  . ASN A 1 99  ? 4.807   -1.931  11.633  1.00 15.79 ? 98   ASN A CG  1 
ATOM   757  O  OD1 . ASN A 1 99  ? 3.889   -1.981  12.501  1.00 16.92 ? 98   ASN A OD1 1 
ATOM   758  N  ND2 . ASN A 1 99  ? 5.167   -0.794  11.014  1.00 15.17 ? 98   ASN A ND2 1 
ATOM   759  N  N   . PHE A 1 100 ? 5.607   -5.813  8.854   1.00 12.71 ? 99   PHE A N   1 
ATOM   760  C  CA  . PHE A 1 100 ? 6.470   -6.849  8.347   1.00 12.97 ? 99   PHE A CA  1 
ATOM   761  C  C   . PHE A 1 100 ? 7.132   -6.437  7.017   1.00 13.11 ? 99   PHE A C   1 
ATOM   762  O  O   . PHE A 1 100 ? 8.351   -6.642  6.803   1.00 12.83 ? 99   PHE A O   1 
ATOM   763  C  CB  . PHE A 1 100 ? 5.706   -8.189  8.184   1.00 13.07 ? 99   PHE A CB  1 
ATOM   764  C  CG  . PHE A 1 100 ? 5.202   -8.752  9.487   1.00 13.34 ? 99   PHE A CG  1 
ATOM   765  C  CD1 . PHE A 1 100 ? 6.064   -8.866  10.588  1.00 13.66 ? 99   PHE A CD1 1 
ATOM   766  C  CD2 . PHE A 1 100 ? 3.855   -9.151  9.628   1.00 13.47 ? 99   PHE A CD2 1 
ATOM   767  C  CE1 . PHE A 1 100 ? 5.586   -9.365  11.824  1.00 14.07 ? 99   PHE A CE1 1 
ATOM   768  C  CE2 . PHE A 1 100 ? 3.366   -9.654  10.851  1.00 13.46 ? 99   PHE A CE2 1 
ATOM   769  C  CZ  . PHE A 1 100 ? 4.216   -9.762  11.946  1.00 13.84 ? 99   PHE A CZ  1 
ATOM   770  N  N   . LYS A 1 101 ? 6.348   -5.850  6.123   1.00 13.37 ? 100  LYS A N   1 
ATOM   771  C  CA  . LYS A 1 101 ? 6.926   -5.448  4.849   1.00 13.87 ? 100  LYS A CA  1 
ATOM   772  C  C   . LYS A 1 101 ? 7.975   -4.323  5.020   1.00 13.45 ? 100  LYS A C   1 
ATOM   773  O  O   . LYS A 1 101 ? 8.896   -4.184  4.206   1.00 12.99 ? 100  LYS A O   1 
ATOM   774  C  CB  . LYS A 1 101 ? 5.810   -5.024  3.897   1.00 15.28 ? 100  LYS A CB  1 
ATOM   775  C  CG  . LYS A 1 101 ? 4.980   -3.879  4.364   1.00 17.14 ? 100  LYS A CG  1 
ATOM   776  C  CD  . LYS A 1 101 ? 3.831   -3.622  3.328   1.00 19.11 ? 100  LYS A CD  1 
ATOM   777  C  CE  . LYS A 1 101 ? 3.068   -2.282  3.628   1.00 20.66 ? 100  LYS A CE  1 
ATOM   778  N  NZ  . LYS A 1 101 ? 2.679   -1.996  5.098   1.00 21.74 ? 100  LYS A NZ  1 
ATOM   779  N  N   . ILE A 1 102 ? 7.830   -3.533  6.092   1.00 13.00 ? 101  ILE A N   1 
ATOM   780  C  CA  . ILE A 1 102 ? 8.796   -2.459  6.372   1.00 12.96 ? 101  ILE A CA  1 
ATOM   781  C  C   . ILE A 1 102 ? 10.164  -3.053  6.759   1.00 12.22 ? 101  ILE A C   1 
ATOM   782  O  O   . ILE A 1 102 ? 11.194  -2.679  6.229   1.00 11.92 ? 101  ILE A O   1 
ATOM   783  C  CB  . ILE A 1 102 ? 8.252   -1.512  7.516   1.00 13.58 ? 101  ILE A CB  1 
ATOM   784  C  CG1 . ILE A 1 102 ? 7.082   -0.705  6.970   1.00 14.18 ? 101  ILE A CG1 1 
ATOM   785  C  CG2 . ILE A 1 102 ? 9.358   -0.558  8.034   1.00 13.75 ? 101  ILE A CG2 1 
ATOM   786  C  CD1 . ILE A 1 102 ? 6.405   0.132   8.022   1.00 14.85 ? 101  ILE A CD1 1 
ATOM   787  N  N   . LEU A 1 103 ? 10.167  -4.021  7.672   1.00 12.09 ? 102  LEU A N   1 
ATOM   788  C  CA  . LEU A 1 103 ? 11.429  -4.628  8.079   1.00 11.73 ? 102  LEU A CA  1 
ATOM   789  C  C   . LEU A 1 103 ? 12.023  -5.350  6.872   1.00 11.65 ? 102  LEU A C   1 
ATOM   790  O  O   . LEU A 1 103 ? 13.229  -5.330  6.667   1.00 11.84 ? 102  LEU A O   1 
ATOM   791  C  CB  . LEU A 1 103 ? 11.198  -5.573  9.271   1.00 11.88 ? 102  LEU A CB  1 
ATOM   792  C  CG  . LEU A 1 103 ? 12.445  -6.247  9.855   1.00 12.21 ? 102  LEU A CG  1 
ATOM   793  C  CD1 . LEU A 1 103 ? 13.498  -5.202  10.121  1.00 12.21 ? 102  LEU A CD1 1 
ATOM   794  C  CD2 . LEU A 1 103 ? 12.096  -6.992  11.142  1.00 11.93 ? 102  LEU A CD2 1 
ATOM   795  N  N   . ASN A 1 104 ? 11.175  -5.972  6.054   1.00 11.76 ? 103  ASN A N   1 
ATOM   796  C  CA  . ASN A 1 104 ? 11.657  -6.690  4.878   1.00 11.77 ? 103  ASN A CA  1 
ATOM   797  C  C   . ASN A 1 104 ? 12.395  -5.736  3.982   1.00 11.47 ? 103  ASN A C   1 
ATOM   798  O  O   . ASN A 1 104 ? 13.443  -6.069  3.503   1.00 11.38 ? 103  ASN A O   1 
ATOM   799  C  CB  . ASN A 1 104 ? 10.488  -7.306  4.104   1.00 12.62 ? 103  ASN A CB  1 
ATOM   800  C  CG  . ASN A 1 104 ? 9.978   -8.577  4.745   1.00 12.93 ? 103  ASN A CG  1 
ATOM   801  O  OD1 . ASN A 1 104 ? 10.666  -9.156  5.610   1.00 13.62 ? 103  ASN A OD1 1 
ATOM   802  N  ND2 . ASN A 1 104 ? 8.787   -9.031  4.329   1.00 13.26 ? 103  ASN A ND2 1 
ATOM   803  N  N   . HIS A 1 105 ? 11.845  -4.556  3.740   1.00 11.39 ? 104  HIS A N   1 
ATOM   804  C  CA  . HIS A 1 105 ? 12.515  -3.560  2.893   1.00 11.65 ? 104  HIS A CA  1 
ATOM   805  C  C   . HIS A 1 105 ? 13.832  -3.157  3.518   1.00 11.66 ? 104  HIS A C   1 
ATOM   806  O  O   . HIS A 1 105 ? 14.831  -3.039  2.821   1.00 11.74 ? 104  HIS A O   1 
ATOM   807  C  CB  . HIS A 1 105 ? 11.641  -2.299  2.687   1.00 12.07 ? 104  HIS A CB  1 
ATOM   808  C  CG  . HIS A 1 105 ? 12.304  -1.204  1.900   1.00 12.49 ? 104  HIS A CG  1 
ATOM   809  N  ND1 . HIS A 1 105 ? 12.608  -1.315  0.555   1.00 12.40 ? 104  HIS A ND1 1 
ATOM   810  C  CD2 . HIS A 1 105 ? 12.751  0.026   2.276   1.00 12.96 ? 104  HIS A CD2 1 
ATOM   811  C  CE1 . HIS A 1 105 ? 13.211  -0.213  0.138   1.00 12.25 ? 104  HIS A CE1 1 
ATOM   812  N  NE2 . HIS A 1 105 ? 13.317  0.617   1.159   1.00 12.78 ? 104  HIS A NE2 1 
ATOM   813  N  N   . CYS A 1 106 ? 13.865  -2.977  4.841   1.00 11.61 ? 105  CYS A N   1 
ATOM   814  C  CA  . CYS A 1 106 ? 15.123  -2.622  5.467   1.00 11.84 ? 105  CYS A CA  1 
ATOM   815  C  C   . CYS A 1 106 ? 16.142  -3.740  5.321   1.00 11.96 ? 105  CYS A C   1 
ATOM   816  O  O   . CYS A 1 106 ? 17.328  -3.448  5.184   1.00 12.66 ? 105  CYS A O   1 
ATOM   817  C  CB  . CYS A 1 106 ? 14.929  -2.281  6.934   1.00 11.98 ? 105  CYS A CB  1 
ATOM   818  S  SG  . CYS A 1 106 ? 13.959  -0.746  7.169   1.00 13.16 ? 105  CYS A SG  1 
ATOM   819  N  N   . ILE A 1 107 ? 15.710  -5.003  5.379   1.00 11.65 ? 106  ILE A N   1 
ATOM   820  C  CA  . ILE A 1 107 ? 16.642  -6.126  5.197   1.00 11.46 ? 106  ILE A CA  1 
ATOM   821  C  C   . ILE A 1 107 ? 17.202  -6.074  3.768   1.00 11.29 ? 106  ILE A C   1 
ATOM   822  O  O   . ILE A 1 107 ? 18.387  -6.248  3.575   1.00 11.41 ? 106  ILE A O   1 
ATOM   823  C  CB  . ILE A 1 107 ? 15.936  -7.503  5.500   1.00 11.57 ? 106  ILE A CB  1 
ATOM   824  C  CG1 . ILE A 1 107 ? 15.680  -7.618  7.016   1.00 11.62 ? 106  ILE A CG1 1 
ATOM   825  C  CG2 . ILE A 1 107 ? 16.835  -8.714  5.040   1.00 11.45 ? 106  ILE A CG2 1 
ATOM   826  C  CD1 . ILE A 1 107 ? 14.669  -8.710  7.392   1.00 12.01 ? 106  ILE A CD1 1 
ATOM   827  N  N   . LEU A 1 108 ? 16.372  -5.825  2.761   1.00 11.32 ? 107  LEU A N   1 
ATOM   828  C  CA  . LEU A 1 108 ? 16.883  -5.737  1.372   1.00 11.54 ? 107  LEU A CA  1 
ATOM   829  C  C   . LEU A 1 108 ? 17.921  -4.626  1.263   1.00 11.62 ? 107  LEU A C   1 
ATOM   830  O  O   . LEU A 1 108 ? 18.987  -4.818  0.682   1.00 12.08 ? 107  LEU A O   1 
ATOM   831  C  CB  . LEU A 1 108 ? 15.739  -5.473  0.392   1.00 11.70 ? 107  LEU A CB  1 
ATOM   832  C  CG  . LEU A 1 108 ? 14.673  -6.598  0.332   1.00 12.14 ? 107  LEU A CG  1 
ATOM   833  C  CD1 . LEU A 1 108 ? 13.696  -6.198  -0.733  1.00 13.11 ? 107  LEU A CD1 1 
ATOM   834  C  CD2 . LEU A 1 108 ? 15.260  -7.986  0.004   1.00 12.29 ? 107  LEU A CD2 1 
ATOM   835  N  N   . VAL A 1 109 ? 17.619  -3.468  1.856   1.00 11.61 ? 108  VAL A N   1 
ATOM   836  C  CA  . VAL A 1 109 ? 18.552  -2.335  1.829   1.00 11.68 ? 108  VAL A CA  1 
ATOM   837  C  C   . VAL A 1 109 ? 19.904  -2.721  2.458   1.00 12.00 ? 108  VAL A C   1 
ATOM   838  O  O   . VAL A 1 109 ? 20.972  -2.475  1.874   1.00 12.21 ? 108  VAL A O   1 
ATOM   839  C  CB  . VAL A 1 109 ? 17.932  -1.085  2.583   1.00 11.56 ? 108  VAL A CB  1 
ATOM   840  C  CG1 . VAL A 1 109 ? 19.024  -0.037  2.904   1.00 11.53 ? 108  VAL A CG1 1 
ATOM   841  C  CG2 . VAL A 1 109 ? 16.818  -0.460  1.719   1.00 11.19 ? 108  VAL A CG2 1 
ATOM   842  N  N   . VAL A 1 110 ? 19.864  -3.336  3.640   1.00 12.14 ? 109  VAL A N   1 
ATOM   843  C  CA  . VAL A 1 110 ? 21.100  -3.756  4.325   1.00 12.66 ? 109  VAL A CA  1 
ATOM   844  C  C   . VAL A 1 110 ? 21.914  -4.792  3.505   1.00 12.67 ? 109  VAL A C   1 
ATOM   845  O  O   . VAL A 1 110 ? 23.137  -4.663  3.344   1.00 12.58 ? 109  VAL A O   1 
ATOM   846  C  CB  . VAL A 1 110 ? 20.801  -4.319  5.766   1.00 12.51 ? 109  VAL A CB  1 
ATOM   847  C  CG1 . VAL A 1 110 ? 22.122  -4.845  6.434   1.00 12.59 ? 109  VAL A CG1 1 
ATOM   848  C  CG2 . VAL A 1 110 ? 20.150  -3.214  6.611   1.00 12.78 ? 109  VAL A CG2 1 
ATOM   849  N  N   . ILE A 1 111 ? 21.232  -5.810  2.986   1.00 12.67 ? 110  ILE A N   1 
ATOM   850  C  CA  . ILE A 1 111 ? 21.928  -6.815  2.157   1.00 12.83 ? 110  ILE A CA  1 
ATOM   851  C  C   . ILE A 1 111 ? 22.563  -6.116  0.961   1.00 13.07 ? 110  ILE A C   1 
ATOM   852  O  O   . ILE A 1 111 ? 23.689  -6.425  0.597   1.00 13.35 ? 110  ILE A O   1 
ATOM   853  C  CB  . ILE A 1 111 ? 20.956  -7.918  1.690   1.00 12.76 ? 110  ILE A CB  1 
ATOM   854  C  CG1 . ILE A 1 111 ? 20.526  -8.775  2.917   1.00 12.47 ? 110  ILE A CG1 1 
ATOM   855  C  CG2 . ILE A 1 111 ? 21.608  -8.745  0.587   1.00 12.92 ? 110  ILE A CG2 1 
ATOM   856  C  CD1 . ILE A 1 111 ? 19.398  -9.734  2.604   1.00 12.44 ? 110  ILE A CD1 1 
ATOM   857  N  N   . SER A 1 112 ? 21.866  -5.142  0.369   1.00 13.26 ? 111  SER A N   1 
ATOM   858  C  CA  . SER A 1 112 ? 22.433  -4.401  -0.775  1.00 13.68 ? 111  SER A CA  1 
ATOM   859  C  C   . SER A 1 112 ? 23.703  -3.595  -0.370  1.00 14.16 ? 111  SER A C   1 
ATOM   860  O  O   . SER A 1 112 ? 24.726  -3.577  -1.115  1.00 14.40 ? 111  SER A O   1 
ATOM   861  C  CB  . SER A 1 112 ? 21.364  -3.488  -1.364  1.00 13.55 ? 111  SER A CB  1 
ATOM   862  O  OG  . SER A 1 112 ? 21.778  -3.004  -2.637  1.00 14.62 ? 111  SER A OG  1 
ATOM   863  N  N   . THR A 1 113 ? 23.681  -2.974  0.820   1.00 14.42 ? 112  THR A N   1 
ATOM   864  C  CA  . THR A 1 113 ? 24.868  -2.233  1.247   1.00 14.85 ? 112  THR A CA  1 
ATOM   865  C  C   . THR A 1 113 ? 26.031  -3.159  1.550   1.00 15.13 ? 112  THR A C   1 
ATOM   866  O  O   . THR A 1 113 ? 27.177  -2.777  1.327   1.00 15.73 ? 112  THR A O   1 
ATOM   867  C  CB  . THR A 1 113 ? 24.642  -1.331  2.535   1.00 14.90 ? 112  THR A CB  1 
ATOM   868  O  OG1 . THR A 1 113 ? 24.423  -2.148  3.694   1.00 15.00 ? 112  THR A OG1 1 
ATOM   869  C  CG2 . THR A 1 113 ? 23.476  -0.366  2.328   1.00 14.94 ? 112  THR A CG2 1 
ATOM   870  N  N   . MET A 1 114 ? 25.744  -4.353  2.057   1.00 15.02 ? 113  MET A N   1 
ATOM   871  C  CA  . MET A 1 114 ? 26.795  -5.295  2.414   1.00 15.50 ? 113  MET A CA  1 
ATOM   872  C  C   . MET A 1 114 ? 27.263  -6.266  1.342   1.00 15.60 ? 113  MET A C   1 
ATOM   873  O  O   . MET A 1 114 ? 28.420  -6.671  1.361   1.00 15.85 ? 113  MET A O   1 
ATOM   874  C  CB  . MET A 1 114 ? 26.396  -6.095  3.660   1.00 15.49 ? 113  MET A CB  1 
ATOM   875  C  CG  . MET A 1 114 ? 26.180  -5.211  4.886   1.00 16.40 ? 113  MET A CG  1 
ATOM   876  S  SD  . MET A 1 114 ? 25.604  -6.150  6.334   1.00 17.93 ? 113  MET A SD  1 
ATOM   877  C  CE  . MET A 1 114 ? 25.624  -4.637  7.721   1.00 18.68 ? 113  MET A CE  1 
ATOM   878  N  N   . PHE A 1 115 ? 26.393  -6.651  0.426   1.00 15.84 ? 114  PHE A N   1 
ATOM   879  C  CA  . PHE A 1 115 ? 26.752  -7.609  -0.615  1.00 16.19 ? 114  PHE A CA  1 
ATOM   880  C  C   . PHE A 1 115 ? 26.313  -7.134  -1.986  1.00 16.80 ? 114  PHE A C   1 
ATOM   881  O  O   . PHE A 1 115 ? 25.534  -7.794  -2.669  1.00 16.86 ? 114  PHE A O   1 
ATOM   882  C  CB  . PHE A 1 115 ? 26.145  -8.987  -0.312  1.00 16.02 ? 114  PHE A CB  1 
ATOM   883  C  CG  . PHE A 1 115 ? 26.558  -9.540  1.036   1.00 16.07 ? 114  PHE A CG  1 
ATOM   884  C  CD1 . PHE A 1 115 ? 25.835  -9.229  2.208   1.00 15.92 ? 114  PHE A CD1 1 
ATOM   885  C  CD2 . PHE A 1 115 ? 27.688  -10.355 1.145   1.00 16.03 ? 114  PHE A CD2 1 
ATOM   886  C  CE1 . PHE A 1 115 ? 26.231  -9.727  3.467   1.00 15.53 ? 114  PHE A CE1 1 
ATOM   887  C  CE2 . PHE A 1 115 ? 28.096  -10.852 2.413   1.00 16.07 ? 114  PHE A CE2 1 
ATOM   888  C  CZ  . PHE A 1 115 ? 27.346  -10.528 3.576   1.00 15.97 ? 114  PHE A CZ  1 
ATOM   889  N  N   . PRO A 1 116 ? 26.833  -5.976  -2.427  1.00 17.47 ? 115  PRO A N   1 
ATOM   890  C  CA  . PRO A 1 116 ? 26.472  -5.438  -3.745  1.00 17.83 ? 115  PRO A CA  1 
ATOM   891  C  C   . PRO A 1 116 ? 26.712  -6.434  -4.893  1.00 18.47 ? 115  PRO A C   1 
ATOM   892  O  O   . PRO A 1 116 ? 25.926  -6.502  -5.842  1.00 19.05 ? 115  PRO A O   1 
ATOM   893  C  CB  . PRO A 1 116 ? 27.347  -4.195  -3.864  1.00 17.75 ? 115  PRO A CB  1 
ATOM   894  C  CG  . PRO A 1 116 ? 28.562  -4.510  -3.006  1.00 17.70 ? 115  PRO A CG  1 
ATOM   895  C  CD  . PRO A 1 116 ? 27.910  -5.180  -1.791  1.00 17.48 ? 115  PRO A CD  1 
ATOM   896  N  N   . LYS A 1 117 ? 27.760  -7.240  -4.787  1.00 18.59 ? 116  LYS A N   1 
ATOM   897  C  CA  . LYS A 1 117 ? 28.099  -8.188  -5.824  1.00 19.22 ? 116  LYS A CA  1 
ATOM   898  C  C   . LYS A 1 117 ? 27.115  -9.362  -5.894  1.00 18.77 ? 116  LYS A C   1 
ATOM   899  O  O   . LYS A 1 117 ? 26.648  -9.773  -6.974  1.00 18.57 ? 116  LYS A O   1 
ATOM   900  C  CB  . LYS A 1 117 ? 29.518  -8.712  -5.562  1.00 20.96 ? 116  LYS A CB  1 
ATOM   901  C  CG  . LYS A 1 117 ? 30.202  -9.393  -6.755  1.00 23.89 ? 116  LYS A CG  1 
ATOM   902  C  CD  . LYS A 1 117 ? 29.582  -10.773 -7.166  1.00 25.98 ? 116  LYS A CD  1 
ATOM   903  C  CE  . LYS A 1 117 ? 30.239  -11.258 -8.475  1.00 27.15 ? 116  LYS A CE  1 
ATOM   904  N  NZ  . LYS A 1 117 ? 30.116  -10.149 -9.548  1.00 28.50 ? 116  LYS A NZ  1 
ATOM   905  N  N   . GLU A 1 118 ? 26.815  -9.916  -4.733  1.00 17.97 ? 117  GLU A N   1 
ATOM   906  C  CA  . GLU A 1 118 ? 25.910  -11.033 -4.670  1.00 17.72 ? 117  GLU A CA  1 
ATOM   907  C  C   . GLU A 1 118 ? 24.451  -10.642 -4.870  1.00 16.90 ? 117  GLU A C   1 
ATOM   908  O  O   . GLU A 1 118 ? 23.661  -11.413 -5.406  1.00 16.77 ? 117  GLU A O   1 
ATOM   909  C  CB  . GLU A 1 118 ? 26.057  -11.764 -3.321  1.00 18.41 ? 117  GLU A CB  1 
ATOM   910  C  CG  . GLU A 1 118 ? 27.405  -12.396 -3.092  1.00 19.77 ? 117  GLU A CG  1 
ATOM   911  C  CD  . GLU A 1 118 ? 28.510  -11.397 -2.637  1.00 21.36 ? 117  GLU A CD  1 
ATOM   912  O  OE1 . GLU A 1 118 ? 28.268  -10.164 -2.541  1.00 21.89 ? 117  GLU A OE1 1 
ATOM   913  O  OE2 . GLU A 1 118 ? 29.648  -11.858 -2.354  1.00 22.38 ? 117  GLU A OE2 1 
ATOM   914  N  N   . PHE A 1 119 ? 24.084  -9.450  -4.434  1.00 16.03 ? 118  PHE A N   1 
ATOM   915  C  CA  . PHE A 1 119 ? 22.677  -9.051  -4.508  1.00 15.30 ? 118  PHE A CA  1 
ATOM   916  C  C   . PHE A 1 119 ? 22.279  -8.473  -5.840  1.00 14.92 ? 118  PHE A C   1 
ATOM   917  O  O   . PHE A 1 119 ? 21.955  -7.282  -5.960  1.00 14.46 ? 118  PHE A O   1 
ATOM   918  C  CB  . PHE A 1 119 ? 22.341  -8.049  -3.356  1.00 15.06 ? 118  PHE A CB  1 
ATOM   919  C  CG  . PHE A 1 119 ? 20.865  -7.916  -3.088  1.00 14.46 ? 118  PHE A CG  1 
ATOM   920  C  CD1 . PHE A 1 119 ? 20.098  -9.058  -2.817  1.00 14.79 ? 118  PHE A CD1 1 
ATOM   921  C  CD2 . PHE A 1 119 ? 20.239  -6.677  -3.122  1.00 14.81 ? 118  PHE A CD2 1 
ATOM   922  C  CE1 . PHE A 1 119 ? 18.706  -8.957  -2.575  1.00 14.85 ? 118  PHE A CE1 1 
ATOM   923  C  CE2 . PHE A 1 119 ? 18.847  -6.550  -2.881  1.00 14.72 ? 118  PHE A CE2 1 
ATOM   924  C  CZ  . PHE A 1 119 ? 18.081  -7.683  -2.608  1.00 15.02 ? 118  PHE A CZ  1 
ATOM   925  N  N   . THR A 1 120 ? 22.308  -9.342  -6.838  1.00 14.64 ? 119  THR A N   1 
ATOM   926  C  CA  . THR A 1 120 ? 21.950  -8.970  -8.194  1.00 14.98 ? 119  THR A CA  1 
ATOM   927  C  C   . THR A 1 120 ? 20.435  -8.828  -8.332  1.00 14.83 ? 119  THR A C   1 
ATOM   928  O  O   . THR A 1 120 ? 19.689  -9.194  -7.431  1.00 14.42 ? 119  THR A O   1 
ATOM   929  C  CB  . THR A 1 120 ? 22.330  -10.072 -9.150  1.00 15.08 ? 119  THR A CB  1 
ATOM   930  O  OG1 . THR A 1 120 ? 21.603  -11.248 -8.763  1.00 15.94 ? 119  THR A OG1 1 
ATOM   931  C  CG2 . THR A 1 120 ? 23.906  -10.328 -9.144  1.00 15.22 ? 119  THR A CG2 1 
ATOM   932  N  N   . PRO A 1 121 ? 19.967  -8.306  -9.489  1.00 14.90 ? 120  PRO A N   1 
ATOM   933  C  CA  . PRO A 1 121 ? 18.521  -8.166  -9.687  1.00 15.04 ? 120  PRO A CA  1 
ATOM   934  C  C   . PRO A 1 121 ? 17.856  -9.553  -9.616  1.00 15.21 ? 120  PRO A C   1 
ATOM   935  O  O   . PRO A 1 121 ? 16.730  -9.704  -9.081  1.00 15.03 ? 120  PRO A O   1 
ATOM   936  C  CB  . PRO A 1 121 ? 18.387  -7.530  -11.099 1.00 15.01 ? 120  PRO A CB  1 
ATOM   937  C  CG  . PRO A 1 121 ? 19.586  -6.684  -11.215 1.00 15.26 ? 120  PRO A CG  1 
ATOM   938  C  CD  . PRO A 1 121 ? 20.716  -7.564  -10.536 1.00 15.17 ? 120  PRO A CD  1 
ATOM   939  N  N   . GLU A 1 122 ? 18.534  -10.575 -10.152 1.00 15.05 ? 121  GLU A N   1 
ATOM   940  C  CA  . GLU A 1 122 ? 17.919  -11.919 -10.108 1.00 15.17 ? 121  GLU A CA  1 
ATOM   941  C  C   . GLU A 1 122 ? 17.856  -12.474 -8.652  1.00 14.82 ? 121  GLU A C   1 
ATOM   942  O  O   . GLU A 1 122 ? 16.893  -13.122 -8.277  1.00 15.14 ? 121  GLU A O   1 
ATOM   943  C  CB  A GLU A 1 122 ? 18.747  -12.835 -11.022 0.50 15.64 ? 121  GLU A CB  1 
ATOM   944  C  CB  B GLU A 1 122 ? 18.640  -12.897 -11.048 0.50 15.38 ? 121  GLU A CB  1 
ATOM   945  C  CG  A GLU A 1 122 ? 18.921  -12.329 -12.482 0.50 16.40 ? 121  GLU A CG  1 
ATOM   946  C  CG  B GLU A 1 122 ? 18.226  -12.724 -12.503 0.50 15.60 ? 121  GLU A CG  1 
ATOM   947  C  CD  A GLU A 1 122 ? 19.713  -10.995 -12.670 0.50 16.76 ? 121  GLU A CD  1 
ATOM   948  C  CD  B GLU A 1 122 ? 19.134  -13.469 -13.464 0.50 16.14 ? 121  GLU A CD  1 
ATOM   949  O  OE1 A GLU A 1 122 ? 20.650  -10.640 -11.925 0.50 16.63 ? 121  GLU A OE1 1 
ATOM   950  O  OE1 B GLU A 1 122 ? 18.747  -14.561 -13.940 0.50 16.71 ? 121  GLU A OE1 1 
ATOM   951  O  OE2 A GLU A 1 122 ? 19.405  -10.289 -13.642 0.50 17.96 ? 121  GLU A OE2 1 
ATOM   952  O  OE2 B GLU A 1 122 ? 20.239  -12.956 -13.743 0.50 16.03 ? 121  GLU A OE2 1 
ATOM   953  N  N   . ALA A 1 123 ? 18.860  -12.185 -7.822  1.00 14.41 ? 122  ALA A N   1 
ATOM   954  C  CA  . ALA A 1 123 ? 18.842  -12.589 -6.386  1.00 14.00 ? 122  ALA A CA  1 
ATOM   955  C  C   . ALA A 1 123 ? 17.714  -11.800 -5.669  1.00 13.44 ? 122  ALA A C   1 
ATOM   956  O  O   . ALA A 1 123 ? 16.995  -12.316 -4.844  1.00 13.60 ? 122  ALA A O   1 
ATOM   957  C  CB  . ALA A 1 123 ? 20.235  -12.266 -5.685  1.00 13.74 ? 122  ALA A CB  1 
ATOM   958  N  N   . HIS A 1 124 ? 17.588  -10.530 -6.018  1.00 12.99 ? 123  HIS A N   1 
ATOM   959  C  CA  . HIS A 1 124 ? 16.589  -9.628  -5.456  1.00 12.40 ? 123  HIS A CA  1 
ATOM   960  C  C   . HIS A 1 124 ? 15.109  -10.075 -5.760  1.00 12.15 ? 123  HIS A C   1 
ATOM   961  O  O   . HIS A 1 124 ? 14.269  -10.108 -4.845  1.00 11.88 ? 123  HIS A O   1 
ATOM   962  C  CB  . HIS A 1 124 ? 16.922  -8.235  -6.029  1.00 12.37 ? 123  HIS A CB  1 
ATOM   963  C  CG  . HIS A 1 124 ? 16.072  -7.102  -5.500  1.00 13.04 ? 123  HIS A CG  1 
ATOM   964  N  ND1 . HIS A 1 124 ? 16.411  -5.789  -5.772  1.00 12.84 ? 123  HIS A ND1 1 
ATOM   965  C  CD2 . HIS A 1 124 ? 14.907  -7.125  -4.784  1.00 12.50 ? 123  HIS A CD2 1 
ATOM   966  C  CE1 . HIS A 1 124 ? 15.455  -5.052  -5.227  1.00 12.64 ? 123  HIS A CE1 1 
ATOM   967  N  NE2 . HIS A 1 124 ? 14.527  -5.811  -4.620  1.00 12.43 ? 123  HIS A NE2 1 
ATOM   968  N  N   . VAL A 1 125 ? 14.794  -10.437 -7.022  1.00 11.69 ? 124  VAL A N   1 
ATOM   969  C  CA  . VAL A 1 125 ? 13.422  -10.813 -7.305  1.00 11.44 ? 124  VAL A CA  1 
ATOM   970  C  C   . VAL A 1 125 ? 13.009  -12.045 -6.417  1.00 11.56 ? 124  VAL A C   1 
ATOM   971  O  O   . VAL A 1 125 ? 11.938  -12.047 -5.773  1.00 11.35 ? 124  VAL A O   1 
ATOM   972  C  CB  . VAL A 1 125 ? 13.168  -11.044 -8.858  1.00 11.25 ? 124  VAL A CB  1 
ATOM   973  C  CG1 . VAL A 1 125 ? 13.956  -12.258 -9.416  1.00 11.23 ? 124  VAL A CG1 1 
ATOM   974  C  CG2 . VAL A 1 125 ? 11.661  -11.185 -9.098  1.00 11.21 ? 124  VAL A CG2 1 
ATOM   975  N  N   . SER A 1 126 ? 13.874  -13.068 -6.371  1.00 11.56 ? 125  SER A N   1 
ATOM   976  C  CA  . SER A 1 126 ? 13.530  -14.279 -5.613  1.00 11.87 ? 125  SER A CA  1 
ATOM   977  C  C   . SER A 1 126 ? 13.526  -14.004 -4.136  1.00 11.73 ? 125  SER A C   1 
ATOM   978  O  O   . SER A 1 126 ? 12.644  -14.494 -3.442  1.00 11.82 ? 125  SER A O   1 
ATOM   979  C  CB  . SER A 1 126 ? 14.476  -15.457 -5.979  1.00 12.04 ? 125  SER A CB  1 
ATOM   980  O  OG  . SER A 1 126 ? 14.262  -15.854 -7.319  1.00 11.73 ? 125  SER A OG  1 
ATOM   981  N  N   . LEU A 1 127 ? 14.454  -13.177 -3.660  1.00 11.69 ? 126  LEU A N   1 
ATOM   982  C  CA  . LEU A 1 127 ? 14.441  -12.880 -2.224  1.00 11.86 ? 126  LEU A CA  1 
ATOM   983  C  C   . LEU A 1 127 ? 13.224  -12.042 -1.837  1.00 11.86 ? 126  LEU A C   1 
ATOM   984  O  O   . LEU A 1 127 ? 12.677  -12.201 -0.726  1.00 11.87 ? 126  LEU A O   1 
ATOM   985  C  CB  . LEU A 1 127 ? 15.701  -12.152 -1.774  1.00 12.02 ? 126  LEU A CB  1 
ATOM   986  C  CG  . LEU A 1 127 ? 15.910  -12.125 -0.226  1.00 12.63 ? 126  LEU A CG  1 
ATOM   987  C  CD1 . LEU A 1 127 ? 16.177  -13.564 0.329   1.00 11.85 ? 126  LEU A CD1 1 
ATOM   988  C  CD2 . LEU A 1 127 ? 17.094  -11.160 0.085   1.00 11.88 ? 126  LEU A CD2 1 
ATOM   989  N  N   . ASP A 1 128 ? 12.818  -11.141 -2.724  1.00 11.57 ? 127  ASP A N   1 
ATOM   990  C  CA  . ASP A 1 128 ? 11.636  -10.334 -2.451  1.00 11.57 ? 127  ASP A CA  1 
ATOM   991  C  C   . ASP A 1 128 ? 10.370  -11.205 -2.419  1.00 11.59 ? 127  ASP A C   1 
ATOM   992  O  O   . ASP A 1 128 ? 9.489   -11.018 -1.565  1.00 11.51 ? 127  ASP A O   1 
ATOM   993  C  CB  . ASP A 1 128 ? 11.487  -9.236  -3.504  1.00 12.18 ? 127  ASP A CB  1 
ATOM   994  C  CG  . ASP A 1 128 ? 10.408  -8.267  -3.144  1.00 12.63 ? 127  ASP A CG  1 
ATOM   995  O  OD1 . ASP A 1 128 ? 10.410  -7.803  -1.986  1.00 13.30 ? 127  ASP A OD1 1 
ATOM   996  O  OD2 . ASP A 1 128 ? 9.576   -7.968  -4.003  1.00 13.85 ? 127  ASP A OD2 1 
ATOM   997  N  N   . LYS A 1 129 ? 10.238  -12.138 -3.364  1.00 11.24 ? 128  LYS A N   1 
ATOM   998  C  CA  . LYS A 1 129 ? 9.057   -13.052 -3.337  1.00 11.30 ? 128  LYS A CA  1 
ATOM   999  C  C   . LYS A 1 129 ? 9.088   -13.871 -2.008  1.00 11.11 ? 128  LYS A C   1 
ATOM   1000 O  O   . LYS A 1 129 ? 8.065   -14.071 -1.359  1.00 10.90 ? 128  LYS A O   1 
ATOM   1001 C  CB  . LYS A 1 129 ? 9.075   -14.045 -4.534  1.00 11.13 ? 128  LYS A CB  1 
ATOM   1002 C  CG  . LYS A 1 129 ? 8.827   -13.398 -5.888  1.00 10.83 ? 128  LYS A CG  1 
ATOM   1003 C  CD  . LYS A 1 129 ? 8.860   -14.435 -6.996  1.00 11.10 ? 128  LYS A CD  1 
ATOM   1004 C  CE  . LYS A 1 129 ? 7.645   -15.333 -6.947  1.00 11.53 ? 128  LYS A CE  1 
ATOM   1005 N  NZ  . LYS A 1 129 ? 7.710   -16.334 -8.078  1.00 12.24 ? 128  LYS A NZ  1 
ATOM   1006 N  N   . PHE A 1 130 ? 10.288  -14.331 -1.646  1.00 11.31 ? 129  PHE A N   1 
ATOM   1007 C  CA  . PHE A 1 130 ? 10.512  -15.069 -0.379  1.00 11.52 ? 129  PHE A CA  1 
ATOM   1008 C  C   . PHE A 1 130 ? 10.088  -14.200 0.857   1.00 11.68 ? 129  PHE A C   1 
ATOM   1009 O  O   . PHE A 1 130 ? 9.321   -14.668 1.699   1.00 11.86 ? 129  PHE A O   1 
ATOM   1010 C  CB  . PHE A 1 130 ? 12.007  -15.456 -0.283  1.00 11.72 ? 129  PHE A CB  1 
ATOM   1011 C  CG  . PHE A 1 130 ? 12.431  -15.991 1.072   1.00 11.55 ? 129  PHE A CG  1 
ATOM   1012 C  CD1 . PHE A 1 130 ? 12.117  -17.317 1.472   1.00 11.89 ? 129  PHE A CD1 1 
ATOM   1013 C  CD2 . PHE A 1 130 ? 13.136  -15.177 1.938   1.00 11.55 ? 129  PHE A CD2 1 
ATOM   1014 C  CE1 . PHE A 1 130 ? 12.514  -17.826 2.738   1.00 11.73 ? 129  PHE A CE1 1 
ATOM   1015 C  CE2 . PHE A 1 130 ? 13.530  -15.657 3.180   1.00 11.48 ? 129  PHE A CE2 1 
ATOM   1016 C  CZ  . PHE A 1 130 ? 13.218  -16.989 3.584   1.00 11.65 ? 129  PHE A CZ  1 
ATOM   1017 N  N   . LEU A 1 131 ? 10.581  -12.952 0.959   1.00 11.52 ? 130  LEU A N   1 
ATOM   1018 C  CA  . LEU A 1 131 ? 10.214  -12.078 2.072   1.00 11.43 ? 130  LEU A CA  1 
ATOM   1019 C  C   . LEU A 1 131 ? 8.700   -11.764 2.072   1.00 11.25 ? 130  LEU A C   1 
ATOM   1020 O  O   . LEU A 1 131 ? 8.068   -11.674 3.127   1.00 11.03 ? 130  LEU A O   1 
ATOM   1021 C  CB  . LEU A 1 131 ? 11.102  -10.816 2.063   1.00 11.66 ? 130  LEU A CB  1 
ATOM   1022 C  CG  . LEU A 1 131 ? 12.590  -11.043 2.442   1.00 11.61 ? 130  LEU A CG  1 
ATOM   1023 C  CD1 . LEU A 1 131 ? 13.354  -9.730  2.382   1.00 11.83 ? 130  LEU A CD1 1 
ATOM   1024 C  CD2 . LEU A 1 131 ? 12.685  -11.660 3.849   1.00 12.01 ? 130  LEU A CD2 1 
ATOM   1025 N  N   . SER A 1 132 ? 8.099   -11.644 0.888   1.00 11.82 ? 131  SER A N   1 
ATOM   1026 C  CA  . SER A 1 132 ? 6.641   -11.470 0.870   1.00 12.27 ? 131  SER A CA  1 
ATOM   1027 C  C   . SER A 1 132 ? 5.959   -12.711 1.471   1.00 12.31 ? 131  SER A C   1 
ATOM   1028 O  O   . SER A 1 132 ? 4.975   -12.596 2.215   1.00 12.18 ? 131  SER A O   1 
ATOM   1029 C  CB  . SER A 1 132 ? 6.123   -11.269 -0.544  1.00 13.04 ? 131  SER A CB  1 
ATOM   1030 O  OG  . SER A 1 132 ? 6.534   -9.983  -0.999  1.00 14.99 ? 131  SER A OG  1 
ATOM   1031 N  N   . GLY A 1 133 ? 6.466   -13.900 1.113   1.00 12.11 ? 132  GLY A N   1 
ATOM   1032 C  CA  . GLY A 1 133 ? 5.926   -15.139 1.661   1.00 12.21 ? 132  GLY A CA  1 
ATOM   1033 C  C   . GLY A 1 133 ? 6.131   -15.191 3.185   1.00 12.43 ? 132  GLY A C   1 
ATOM   1034 O  O   . GLY A 1 133 ? 5.250   -15.643 3.929   1.00 12.42 ? 132  GLY A O   1 
ATOM   1035 N  N   . VAL A 1 134 ? 7.293   -14.713 3.645   1.00 12.34 ? 133  VAL A N   1 
ATOM   1036 C  CA  . VAL A 1 134 ? 7.605   -14.696 5.064   1.00 12.35 ? 133  VAL A CA  1 
ATOM   1037 C  C   . VAL A 1 134 ? 6.606   -13.764 5.762   1.00 12.37 ? 133  VAL A C   1 
ATOM   1038 O  O   . VAL A 1 134 ? 6.026   -14.115 6.807   1.00 12.58 ? 133  VAL A O   1 
ATOM   1039 C  CB  . VAL A 1 134 ? 9.039   -14.221 5.298   1.00 12.36 ? 133  VAL A CB  1 
ATOM   1040 C  CG1 . VAL A 1 134 ? 9.277   -13.969 6.794   1.00 12.56 ? 133  VAL A CG1 1 
ATOM   1041 C  CG2 . VAL A 1 134 ? 10.002  -15.278 4.802   1.00 12.58 ? 133  VAL A CG2 1 
ATOM   1042 N  N   . ALA A 1 135 ? 6.370   -12.584 5.182   1.00 12.57 ? 134  ALA A N   1 
ATOM   1043 C  CA  . ALA A 1 135 ? 5.399   -11.629 5.795   1.00 12.65 ? 134  ALA A CA  1 
ATOM   1044 C  C   . ALA A 1 135 ? 3.984   -12.232 5.859   1.00 12.84 ? 134  ALA A C   1 
ATOM   1045 O  O   . ALA A 1 135 ? 3.272   -12.064 6.869   1.00 13.30 ? 134  ALA A O   1 
ATOM   1046 C  CB  . ALA A 1 135 ? 5.366   -10.306 5.004   1.00 12.10 ? 134  ALA A CB  1 
ATOM   1047 N  N   . LEU A 1 136 ? 3.577   -12.926 4.790   1.00 12.99 ? 135  LEU A N   1 
ATOM   1048 C  CA  . LEU A 1 136 ? 2.239   -13.517 4.742   1.00 13.37 ? 135  LEU A CA  1 
ATOM   1049 C  C   . LEU A 1 136 ? 2.137   -14.624 5.804   1.00 13.32 ? 135  LEU A C   1 
ATOM   1050 O  O   . LEU A 1 136 ? 1.078   -14.795 6.448   1.00 13.59 ? 135  LEU A O   1 
ATOM   1051 C  CB  . LEU A 1 136 ? 1.965   -14.070 3.354   1.00 13.91 ? 135  LEU A CB  1 
ATOM   1052 C  CG  . LEU A 1 136 ? 0.542   -14.588 3.148   1.00 15.12 ? 135  LEU A CG  1 
ATOM   1053 C  CD1 . LEU A 1 136 ? -0.499  -13.476 3.503   1.00 16.15 ? 135  LEU A CD1 1 
ATOM   1054 C  CD2 . LEU A 1 136 ? 0.421   -15.036 1.679   1.00 15.80 ? 135  LEU A CD2 1 
ATOM   1055 N  N   . ALA A 1 137 ? 3.233   -15.380 5.979   1.00 12.97 ? 136  ALA A N   1 
ATOM   1056 C  CA  . ALA A 1 137 ? 3.273   -16.464 6.980   1.00 12.89 ? 136  ALA A CA  1 
ATOM   1057 C  C   . ALA A 1 137 ? 3.224   -15.864 8.384   1.00 12.63 ? 136  ALA A C   1 
ATOM   1058 O  O   . ALA A 1 137 ? 2.554   -16.399 9.258   1.00 12.23 ? 136  ALA A O   1 
ATOM   1059 C  CB  . ALA A 1 137 ? 4.559   -17.330 6.803   1.00 12.96 ? 136  ALA A CB  1 
ATOM   1060 N  N   . LEU A 1 138 ? 3.929   -14.765 8.609   1.00 12.26 ? 137  LEU A N   1 
ATOM   1061 C  CA  . LEU A 1 138 ? 3.908   -14.149 9.941   1.00 12.49 ? 137  LEU A CA  1 
ATOM   1062 C  C   . LEU A 1 138 ? 2.514   -13.575 10.225  1.00 12.87 ? 137  LEU A C   1 
ATOM   1063 O  O   . LEU A 1 138 ? 2.064   -13.435 11.386  1.00 12.75 ? 137  LEU A O   1 
ATOM   1064 C  CB  . LEU A 1 138 ? 4.992   -13.052 10.060  1.00 12.48 ? 137  LEU A CB  1 
ATOM   1065 C  CG  . LEU A 1 138 ? 6.403   -13.616 10.119  1.00 12.26 ? 137  LEU A CG  1 
ATOM   1066 C  CD1 . LEU A 1 138 ? 7.466   -12.504 10.075  1.00 13.11 ? 137  LEU A CD1 1 
ATOM   1067 C  CD2 . LEU A 1 138 ? 6.532   -14.417 11.405  1.00 13.32 ? 137  LEU A CD2 1 
ATOM   1068 N  N   . ALA A 1 139 ? 1.815   -13.256 9.155   1.00 12.85 ? 138  ALA A N   1 
ATOM   1069 C  CA  . ALA A 1 139 ? 0.481   -12.736 9.324   1.00 13.33 ? 138  ALA A CA  1 
ATOM   1070 C  C   . ALA A 1 139 ? -0.550  -13.847 9.557   1.00 13.34 ? 138  ALA A C   1 
ATOM   1071 O  O   . ALA A 1 139 ? -1.711  -13.538 9.814   1.00 13.26 ? 138  ALA A O   1 
ATOM   1072 C  CB  . ALA A 1 139 ? 0.099   -11.914 8.089   1.00 13.45 ? 138  ALA A CB  1 
ATOM   1073 N  N   . GLU A 1 140 ? -0.155  -15.108 9.483   1.00 13.38 ? 139  GLU A N   1 
ATOM   1074 C  CA  . GLU A 1 140 ? -1.086  -16.244 9.631   1.00 14.38 ? 139  GLU A CA  1 
ATOM   1075 C  C   . GLU A 1 140 ? -2.100  -16.199 10.787  1.00 14.72 ? 139  GLU A C   1 
ATOM   1076 O  O   . GLU A 1 140 ? -3.306  -16.413 10.573  1.00 14.86 ? 139  GLU A O   1 
ATOM   1077 C  CB  . GLU A 1 140 ? -0.294  -17.560 9.721   1.00 14.81 ? 139  GLU A CB  1 
ATOM   1078 C  CG  . GLU A 1 140 ? -1.109  -18.817 9.958   1.00 16.38 ? 139  GLU A CG  1 
ATOM   1079 C  CD  . GLU A 1 140 ? -2.202  -19.075 8.897   1.00 17.67 ? 139  GLU A CD  1 
ATOM   1080 O  OE1 . GLU A 1 140 ? -2.121  -18.578 7.731   1.00 17.82 ? 139  GLU A OE1 1 
ATOM   1081 O  OE2 . GLU A 1 140 ? -3.166  -19.805 9.259   1.00 18.53 ? 139  GLU A OE2 1 
ATOM   1082 N  N   . ARG A 1 141 ? -1.611  -15.892 11.992  1.00 14.90 ? 140  ARG A N   1 
ATOM   1083 C  CA  . ARG A 1 141 ? -2.425  -15.886 13.192  1.00 15.06 ? 140  ARG A CA  1 
ATOM   1084 C  C   . ARG A 1 141 ? -3.096  -14.590 13.460  1.00 14.64 ? 140  ARG A C   1 
ATOM   1085 O  O   . ARG A 1 141 ? -3.710  -14.437 14.499  1.00 14.97 ? 140  ARG A O   1 
ATOM   1086 C  CB  . ARG A 1 141 ? -1.553  -16.269 14.395  1.00 16.35 ? 140  ARG A CB  1 
ATOM   1087 C  CG  . ARG A 1 141 ? -0.859  -17.631 14.218  1.00 18.07 ? 140  ARG A CG  1 
ATOM   1088 C  CD  . ARG A 1 141 ? -1.846  -18.758 14.308  1.00 20.35 ? 140  ARG A CD  1 
ATOM   1089 N  NE  . ARG A 1 141 ? -2.538  -18.547 15.558  1.00 23.06 ? 140  ARG A NE  1 
ATOM   1090 C  CZ  . ARG A 1 141 ? -3.856  -18.632 15.731  1.00 25.00 ? 140  ARG A CZ  1 
ATOM   1091 N  NH1 . ARG A 1 141 ? -4.684  -18.958 14.706  1.00 26.25 ? 140  ARG A NH1 1 
ATOM   1092 N  NH2 . ARG A 1 141 ? -4.372  -18.328 16.934  1.00 26.13 ? 140  ARG A NH2 1 
ATOM   1093 N  N   . TYR A 1 142 ? -3.031  -13.647 12.547  1.00 14.02 ? 141  TYR A N   1 
ATOM   1094 C  CA  . TYR A 1 142 ? -3.650  -12.355 12.829  1.00 13.92 ? 141  TYR A CA  1 
ATOM   1095 C  C   . TYR A 1 142 ? -5.156  -12.260 12.641  1.00 14.18 ? 141  TYR A C   1 
ATOM   1096 O  O   . TYR A 1 142 ? -5.797  -11.453 13.320  1.00 14.68 ? 141  TYR A O   1 
ATOM   1097 C  CB  . TYR A 1 142 ? -2.984  -11.254 12.002  1.00 13.54 ? 141  TYR A CB  1 
ATOM   1098 C  CG  . TYR A 1 142 ? -1.683  -10.762 12.616  1.00 13.20 ? 141  TYR A CG  1 
ATOM   1099 C  CD1 . TYR A 1 142 ? -1.658  -9.626  13.442  1.00 12.99 ? 141  TYR A CD1 1 
ATOM   1100 C  CD2 . TYR A 1 142 ? -0.475  -11.457 12.392  1.00 13.41 ? 141  TYR A CD2 1 
ATOM   1101 C  CE1 . TYR A 1 142 ? -0.486  -9.167  14.040  1.00 12.69 ? 141  TYR A CE1 1 
ATOM   1102 C  CE2 . TYR A 1 142 ? 0.716   -11.022 12.986  1.00 13.17 ? 141  TYR A CE2 1 
ATOM   1103 C  CZ  . TYR A 1 142 ? 0.699   -9.866  13.814  1.00 13.20 ? 141  TYR A CZ  1 
ATOM   1104 O  OH  . TYR A 1 142 ? 1.874   -9.447  14.402  1.00 13.35 ? 141  TYR A OH  1 
ATOM   1105 N  N   . ARG A 1 143 ? -5.746  -13.018 11.726  1.00 14.12 ? 142  ARG A N   1 
ATOM   1106 C  CA  . ARG A 1 143 ? -7.206  -12.904 11.550  1.00 14.61 ? 142  ARG A CA  1 
ATOM   1107 C  C   . ARG A 1 143 ? -7.820  -14.094 10.797  1.00 15.25 ? 142  ARG A C   1 
ATOM   1108 O  O   . ARG A 1 143 ? -7.015  -14.941 10.347  1.00 15.89 ? 142  ARG A O   1 
ATOM   1109 C  CB  . ARG A 1 143 ? -7.576  -11.605 10.824  1.00 13.80 ? 142  ARG A CB  1 
ATOM   1110 C  CG  . ARG A 1 143 ? -7.113  -11.554 9.356   1.00 13.47 ? 142  ARG A CG  1 
ATOM   1111 C  CD  . ARG A 1 143 ? -7.755  -10.387 8.637   1.00 12.94 ? 142  ARG A CD  1 
ATOM   1112 N  NE  . ARG A 1 143 ? -7.355  -10.330 7.239   1.00 12.85 ? 142  ARG A NE  1 
ATOM   1113 C  CZ  . ARG A 1 143 ? -7.953  -9.590  6.294   1.00 12.67 ? 142  ARG A CZ  1 
ATOM   1114 N  NH1 . ARG A 1 143 ? -8.980  -8.812  6.574   1.00 12.19 ? 142  ARG A NH1 1 
ATOM   1115 N  NH2 . ARG A 1 143 ? -7.535  -9.691  5.036   1.00 12.56 ? 142  ARG A NH2 1 
ATOM   1116 O  OXT . ARG A 1 143 ? -9.084  -14.121 10.659  1.00 16.14 ? 142  ARG A OXT 1 
ATOM   1117 N  N   . VAL B 2 1   ? 5.864   18.345  3.129   1.00 24.68 ? 1    VAL B N   1 
ATOM   1118 C  CA  . VAL B 2 1   ? 7.007   18.176  4.068   1.00 24.59 ? 1    VAL B CA  1 
ATOM   1119 C  C   . VAL B 2 1   ? 7.643   19.528  4.390   1.00 24.34 ? 1    VAL B C   1 
ATOM   1120 O  O   . VAL B 2 1   ? 7.601   20.441  3.576   1.00 24.89 ? 1    VAL B O   1 
ATOM   1121 C  CB  . VAL B 2 1   ? 8.084   17.284  3.420   1.00 24.46 ? 1    VAL B CB  1 
ATOM   1122 C  CG1 . VAL B 2 1   ? 9.336   17.320  4.246   1.00 24.44 ? 1    VAL B CG1 1 
ATOM   1123 C  CG2 . VAL B 2 1   ? 7.557   15.862  3.254   1.00 24.54 ? 1    VAL B CG2 1 
ATOM   1124 N  N   . GLU B 2 2   ? 8.201   19.654  5.581   1.00 24.11 ? 2    GLU B N   1 
ATOM   1125 C  CA  . GLU B 2 2   ? 8.921   20.858  5.985   1.00 23.94 ? 2    GLU B CA  1 
ATOM   1126 C  C   . GLU B 2 2   ? 10.368  20.329  6.080   1.00 22.43 ? 2    GLU B C   1 
ATOM   1127 O  O   . GLU B 2 2   ? 10.710  19.660  7.046   1.00 22.72 ? 2    GLU B O   1 
ATOM   1128 C  CB  . GLU B 2 2   ? 8.474   21.323  7.370   1.00 25.86 ? 2    GLU B CB  1 
ATOM   1129 C  CG  . GLU B 2 2   ? 7.401   22.360  7.356   1.00 29.26 ? 2    GLU B CG  1 
ATOM   1130 C  CD  . GLU B 2 2   ? 6.222   21.949  6.476   1.00 31.26 ? 2    GLU B CD  1 
ATOM   1131 O  OE1 . GLU B 2 2   ? 5.473   21.018  6.930   1.00 32.51 ? 2    GLU B OE1 1 
ATOM   1132 O  OE2 . GLU B 2 2   ? 6.057   22.550  5.332   1.00 32.66 ? 2    GLU B OE2 1 
ATOM   1133 N  N   . TRP B 2 3   ? 11.217  20.595  5.112   1.00 20.38 ? 3    TRP B N   1 
ATOM   1134 C  CA  . TRP B 2 3   ? 12.559  20.061  5.190   1.00 18.61 ? 3    TRP B CA  1 
ATOM   1135 C  C   . TRP B 2 3   ? 13.465  20.664  6.273   1.00 18.23 ? 3    TRP B C   1 
ATOM   1136 O  O   . TRP B 2 3   ? 13.485  21.899  6.512   1.00 17.88 ? 3    TRP B O   1 
ATOM   1137 C  CB  . TRP B 2 3   ? 13.220  20.247  3.854   1.00 17.70 ? 3    TRP B CB  1 
ATOM   1138 C  CG  . TRP B 2 3   ? 12.435  19.646  2.776   1.00 17.30 ? 3    TRP B CG  1 
ATOM   1139 C  CD1 . TRP B 2 3   ? 11.632  20.288  1.883   1.00 17.12 ? 3    TRP B CD1 1 
ATOM   1140 C  CD2 . TRP B 2 3   ? 12.379  18.248  2.445   1.00 17.04 ? 3    TRP B CD2 1 
ATOM   1141 N  NE1 . TRP B 2 3   ? 11.080  19.374  1.000   1.00 17.16 ? 3    TRP B NE1 1 
ATOM   1142 C  CE2 . TRP B 2 3   ? 11.528  18.117  1.322   1.00 17.03 ? 3    TRP B CE2 1 
ATOM   1143 C  CE3 . TRP B 2 3   ? 12.970  17.098  2.984   1.00 16.64 ? 3    TRP B CE3 1 
ATOM   1144 C  CZ2 . TRP B 2 3   ? 11.264  16.876  0.721   1.00 17.04 ? 3    TRP B CZ2 1 
ATOM   1145 C  CZ3 . TRP B 2 3   ? 12.704  15.862  2.393   1.00 16.72 ? 3    TRP B CZ3 1 
ATOM   1146 C  CH2 . TRP B 2 3   ? 11.858  15.762  1.267   1.00 17.09 ? 3    TRP B CH2 1 
ATOM   1147 N  N   . THR B 2 4   ? 14.230  19.814  6.946   1.00 17.52 ? 4    THR B N   1 
ATOM   1148 C  CA  . THR B 2 4   ? 15.190  20.342  7.897   1.00 17.09 ? 4    THR B CA  1 
ATOM   1149 C  C   . THR B 2 4   ? 16.452  20.722  7.066   1.00 17.09 ? 4    THR B C   1 
ATOM   1150 O  O   . THR B 2 4   ? 16.645  20.212  5.940   1.00 16.79 ? 4    THR B O   1 
ATOM   1151 C  CB  . THR B 2 4   ? 15.594  19.275  8.959   1.00 17.38 ? 4    THR B CB  1 
ATOM   1152 O  OG1 . THR B 2 4   ? 16.251  18.167  8.315   1.00 16.96 ? 4    THR B OG1 1 
ATOM   1153 C  CG2 . THR B 2 4   ? 14.372  18.794  9.710   1.00 16.95 ? 4    THR B CG2 1 
ATOM   1154 N  N   . ASP B 2 5   ? 17.313  21.582  7.604   1.00 16.84 ? 5    ASP B N   1 
ATOM   1155 C  CA  . ASP B 2 5   ? 18.512  21.937  6.882   1.00 16.85 ? 5    ASP B CA  1 
ATOM   1156 C  C   . ASP B 2 5   ? 19.355  20.688  6.654   1.00 16.92 ? 5    ASP B C   1 
ATOM   1157 O  O   . ASP B 2 5   ? 19.993  20.540  5.576   1.00 16.74 ? 5    ASP B O   1 
ATOM   1158 C  CB  . ASP B 2 5   ? 19.334  22.950  7.651   1.00 17.41 ? 5    ASP B CB  1 
ATOM   1159 C  CG  . ASP B 2 5   ? 18.783  24.378  7.529   1.00 17.78 ? 5    ASP B CG  1 
ATOM   1160 O  OD1 . ASP B 2 5   ? 19.362  25.289  8.196   1.00 18.48 ? 5    ASP B OD1 1 
ATOM   1161 O  OD2 . ASP B 2 5   ? 17.787  24.587  6.783   1.00 17.58 ? 5    ASP B OD2 1 
ATOM   1162 N  N   . LYS B 2 6   ? 19.361  19.781  7.636   1.00 16.72 ? 6    LYS B N   1 
ATOM   1163 C  CA  . LYS B 2 6   ? 20.135  18.551  7.488   1.00 16.63 ? 6    LYS B CA  1 
ATOM   1164 C  C   . LYS B 2 6   ? 19.608  17.669  6.309   1.00 15.85 ? 6    LYS B C   1 
ATOM   1165 O  O   . LYS B 2 6   ? 20.380  17.068  5.556   1.00 15.64 ? 6    LYS B O   1 
ATOM   1166 C  CB  . LYS B 2 6   ? 20.158  17.758  8.803   1.00 17.57 ? 6    LYS B CB  1 
ATOM   1167 C  CG  . LYS B 2 6   ? 21.029  16.543  8.680   1.00 19.19 ? 6    LYS B CG  1 
ATOM   1168 C  CD  . LYS B 2 6   ? 21.443  15.989  10.014  1.00 21.42 ? 6    LYS B CD  1 
ATOM   1169 C  CE  . LYS B 2 6   ? 22.843  15.302  9.873   1.00 23.15 ? 6    LYS B CE  1 
ATOM   1170 N  NZ  . LYS B 2 6   ? 23.443  14.880  11.221  1.00 25.29 ? 6    LYS B NZ  1 
ATOM   1171 N  N   . GLU B 2 7   ? 18.301  17.616  6.141   1.00 15.41 ? 7    GLU B N   1 
ATOM   1172 C  CA  . GLU B 2 7   ? 17.747  16.849  5.036   1.00 15.19 ? 7    GLU B CA  1 
ATOM   1173 C  C   . GLU B 2 7   ? 18.158  17.439  3.701   1.00 14.99 ? 7    GLU B C   1 
ATOM   1174 O  O   . GLU B 2 7   ? 18.504  16.715  2.763   1.00 14.88 ? 7    GLU B O   1 
ATOM   1175 C  CB  . GLU B 2 7   ? 16.220  16.808  5.120   1.00 14.95 ? 7    GLU B CB  1 
ATOM   1176 C  CG  . GLU B 2 7   ? 15.762  15.934  6.274   1.00 16.04 ? 7    GLU B CG  1 
ATOM   1177 C  CD  . GLU B 2 7   ? 14.272  16.029  6.585   1.00 15.87 ? 7    GLU B CD  1 
ATOM   1178 O  OE1 . GLU B 2 7   ? 13.653  17.104  6.466   1.00 15.82 ? 7    GLU B OE1 1 
ATOM   1179 O  OE2 . GLU B 2 7   ? 13.733  14.965  6.967   1.00 16.90 ? 7    GLU B OE2 1 
ATOM   1180 N  N   . ARG B 2 8   ? 18.098  18.769  3.603   1.00 14.93 ? 8    ARG B N   1 
ATOM   1181 C  CA  . ARG B 2 8   ? 18.476  19.444  2.352   1.00 14.66 ? 8    ARG B CA  1 
ATOM   1182 C  C   . ARG B 2 8   ? 19.940  19.135  2.043   1.00 14.63 ? 8    ARG B C   1 
ATOM   1183 O  O   . ARG B 2 8   ? 20.282  18.866  0.924   1.00 14.63 ? 8    ARG B O   1 
ATOM   1184 C  CB  . ARG B 2 8   ? 18.308  20.964  2.466   1.00 14.66 ? 8    ARG B CB  1 
ATOM   1185 C  CG  . ARG B 2 8   ? 16.871  21.439  2.676   1.00 14.46 ? 8    ARG B CG  1 
ATOM   1186 C  CD  . ARG B 2 8   ? 16.839  22.935  2.921   1.00 14.88 ? 8    ARG B CD  1 
ATOM   1187 N  NE  . ARG B 2 8   ? 15.463  23.449  3.016   1.00 15.72 ? 8    ARG B NE  1 
ATOM   1188 C  CZ  . ARG B 2 8   ? 14.670  23.755  1.983   1.00 15.59 ? 8    ARG B CZ  1 
ATOM   1189 N  NH1 . ARG B 2 8   ? 13.455  24.211  2.231   1.00 16.46 ? 8    ARG B NH1 1 
ATOM   1190 N  NH2 . ARG B 2 8   ? 15.077  23.638  0.725   1.00 15.67 ? 8    ARG B NH2 1 
ATOM   1191 N  N   . SER B 2 9   ? 20.786  19.154  3.057   1.00 14.81 ? 9    SER B N   1 
ATOM   1192 C  CA  . SER B 2 9   ? 22.193  18.918  2.863   1.00 15.47 ? 9    SER B CA  1 
ATOM   1193 C  C   . SER B 2 9   ? 22.472  17.476  2.432   1.00 15.46 ? 9    SER B C   1 
ATOM   1194 O  O   . SER B 2 9   ? 23.291  17.217  1.537   1.00 15.08 ? 9    SER B O   1 
ATOM   1195 C  CB  . SER B 2 9   ? 22.929  19.252  4.140   1.00 16.17 ? 9    SER B CB  1 
ATOM   1196 O  OG  . SER B 2 9   ? 24.311  19.145  3.860   1.00 19.43 ? 9    SER B OG  1 
ATOM   1197 N  N   . ILE B 2 10  ? 21.768  16.538  3.067   1.00 15.28 ? 10   ILE B N   1 
ATOM   1198 C  CA  . ILE B 2 10  ? 21.936  15.116  2.720   1.00 15.42 ? 10   ILE B CA  1 
ATOM   1199 C  C   . ILE B 2 10  ? 21.541  14.865  1.251   1.00 15.30 ? 10   ILE B C   1 
ATOM   1200 O  O   . ILE B 2 10  ? 22.278  14.231  0.495   1.00 15.34 ? 10   ILE B O   1 
ATOM   1201 C  CB  . ILE B 2 10  ? 21.051  14.187  3.657   1.00 15.34 ? 10   ILE B CB  1 
ATOM   1202 C  CG1 . ILE B 2 10  ? 21.626  14.191  5.088   1.00 15.74 ? 10   ILE B CG1 1 
ATOM   1203 C  CG2 . ILE B 2 10  ? 20.998  12.751  3.107   1.00 15.07 ? 10   ILE B CG2 1 
ATOM   1204 C  CD1 . ILE B 2 10  ? 20.746  13.507  6.150   1.00 16.25 ? 10   ILE B CD1 1 
ATOM   1205 N  N   . ILE B 2 11  ? 20.371  15.362  0.859   1.00 15.42 ? 11   ILE B N   1 
ATOM   1206 C  CA  . ILE B 2 11  ? 19.873  15.144  -0.481  1.00 15.97 ? 11   ILE B CA  1 
ATOM   1207 C  C   . ILE B 2 11  ? 20.777  15.815  -1.484  1.00 16.16 ? 11   ILE B C   1 
ATOM   1208 O  O   . ILE B 2 11  ? 21.063  15.259  -2.535  1.00 15.97 ? 11   ILE B O   1 
ATOM   1209 C  CB  . ILE B 2 11  ? 18.434  15.652  -0.574  1.00 16.34 ? 11   ILE B CB  1 
ATOM   1210 C  CG1 . ILE B 2 11  ? 17.578  14.746  0.337   1.00 17.03 ? 11   ILE B CG1 1 
ATOM   1211 C  CG2 . ILE B 2 11  ? 17.942  15.710  -2.052  1.00 16.04 ? 11   ILE B CG2 1 
ATOM   1212 C  CD1 . ILE B 2 11  ? 16.218  15.366  0.780   1.00 18.70 ? 11   ILE B CD1 1 
ATOM   1213 N  N   . SER B 2 12  ? 21.231  17.015  -1.146  1.00 16.38 ? 12   SER B N   1 
ATOM   1214 C  CA  . SER B 2 12  ? 22.128  17.733  -2.048  1.00 17.15 ? 12   SER B CA  1 
ATOM   1215 C  C   . SER B 2 12  ? 23.450  16.924  -2.239  1.00 17.33 ? 12   SER B C   1 
ATOM   1216 O  O   . SER B 2 12  ? 23.962  16.744  -3.351  1.00 16.99 ? 12   SER B O   1 
ATOM   1217 C  CB  . SER B 2 12  ? 22.424  19.136  -1.479  1.00 16.85 ? 12   SER B CB  1 
ATOM   1218 O  OG  . SER B 2 12  ? 23.320  19.835  -2.340  1.00 17.57 ? 12   SER B OG  1 
ATOM   1219 N  N   . ASP B 2 13  ? 23.986  16.440  -1.132  1.00 17.88 ? 13   ASP B N   1 
ATOM   1220 C  CA  . ASP B 2 13  ? 25.218  15.668  -1.182  1.00 18.72 ? 13   ASP B CA  1 
ATOM   1221 C  C   . ASP B 2 13  ? 25.082  14.361  -2.044  1.00 18.70 ? 13   ASP B C   1 
ATOM   1222 O  O   . ASP B 2 13  ? 25.909  14.088  -2.925  1.00 18.33 ? 13   ASP B O   1 
ATOM   1223 C  CB  . ASP B 2 13  ? 25.617  15.321  0.238   1.00 19.91 ? 13   ASP B CB  1 
ATOM   1224 C  CG  . ASP B 2 13  ? 26.966  14.628  0.314   1.00 21.19 ? 13   ASP B CG  1 
ATOM   1225 O  OD1 . ASP B 2 13  ? 27.171  13.967  1.338   1.00 22.80 ? 13   ASP B OD1 1 
ATOM   1226 O  OD2 . ASP B 2 13  ? 27.807  14.761  -0.609  1.00 22.45 ? 13   ASP B OD2 1 
ATOM   1227 N  N   . ILE B 2 14  ? 24.027  13.588  -1.782  1.00 18.48 ? 14   ILE B N   1 
ATOM   1228 C  CA  . ILE B 2 14  ? 23.783  12.341  -2.506  1.00 18.39 ? 14   ILE B CA  1 
ATOM   1229 C  C   . ILE B 2 14  ? 23.746  12.589  -3.994  1.00 18.66 ? 14   ILE B C   1 
ATOM   1230 O  O   . ILE B 2 14  ? 24.434  11.898  -4.754  1.00 18.60 ? 14   ILE B O   1 
ATOM   1231 C  CB  . ILE B 2 14  ? 22.397  11.701  -2.076  1.00 18.07 ? 14   ILE B CB  1 
ATOM   1232 C  CG1 . ILE B 2 14  ? 22.521  11.135  -0.681  1.00 17.89 ? 14   ILE B CG1 1 
ATOM   1233 C  CG2 . ILE B 2 14  ? 21.904  10.667  -3.103  1.00 17.64 ? 14   ILE B CG2 1 
ATOM   1234 C  CD1 . ILE B 2 14  ? 21.218  10.699  -0.083  1.00 17.16 ? 14   ILE B CD1 1 
ATOM   1235 N  N   . PHE B 2 15  ? 22.927  13.561  -4.419  1.00 18.78 ? 15   PHE B N   1 
ATOM   1236 C  CA  . PHE B 2 15  ? 22.798  13.864  -5.833  1.00 19.35 ? 15   PHE B CA  1 
ATOM   1237 C  C   . PHE B 2 15  ? 24.058  14.415  -6.491  1.00 20.28 ? 15   PHE B C   1 
ATOM   1238 O  O   . PHE B 2 15  ? 24.299  14.144  -7.665  1.00 20.89 ? 15   PHE B O   1 
ATOM   1239 C  CB  . PHE B 2 15  ? 21.594  14.771  -6.090  1.00 18.81 ? 15   PHE B CB  1 
ATOM   1240 C  CG  . PHE B 2 15  ? 20.276  14.005  -6.161  1.00 18.98 ? 15   PHE B CG  1 
ATOM   1241 C  CD1 . PHE B 2 15  ? 19.794  13.502  -7.387  1.00 18.94 ? 15   PHE B CD1 1 
ATOM   1242 C  CD2 . PHE B 2 15  ? 19.585  13.672  -4.986  1.00 18.46 ? 15   PHE B CD2 1 
ATOM   1243 C  CE1 . PHE B 2 15  ? 18.645  12.670  -7.428  1.00 18.84 ? 15   PHE B CE1 1 
ATOM   1244 C  CE2 . PHE B 2 15  ? 18.443  12.844  -5.020  1.00 18.18 ? 15   PHE B CE2 1 
ATOM   1245 C  CZ  . PHE B 2 15  ? 17.976  12.346  -6.231  1.00 18.46 ? 15   PHE B CZ  1 
ATOM   1246 N  N   . SER B 2 16  ? 24.888  15.136  -5.739  1.00 20.98 ? 16   SER B N   1 
ATOM   1247 C  CA  . SER B 2 16  ? 26.111  15.686  -6.308  1.00 21.74 ? 16   SER B CA  1 
ATOM   1248 C  C   . SER B 2 16  ? 27.169  14.588  -6.501  1.00 22.50 ? 16   SER B C   1 
ATOM   1249 O  O   . SER B 2 16  ? 28.063  14.725  -7.331  1.00 23.01 ? 16   SER B O   1 
ATOM   1250 C  CB  A SER B 2 16  ? 26.643  16.844  -5.440  0.54 21.65 ? 16   SER B CB  1 
ATOM   1251 C  CB  B SER B 2 16  ? 26.710  16.739  -5.370  0.46 21.63 ? 16   SER B CB  1 
ATOM   1252 O  OG  A SER B 2 16  ? 27.116  16.409  -4.188  0.54 21.69 ? 16   SER B OG  1 
ATOM   1253 O  OG  B SER B 2 16  ? 25.784  17.746  -5.062  0.46 21.61 ? 16   SER B OG  1 
ATOM   1254 N  N   . HIS B 2 17  ? 27.083  13.498  -5.747  1.00 23.11 ? 17   HIS B N   1 
ATOM   1255 C  CA  . HIS B 2 17  ? 28.068  12.439  -5.889  1.00 23.85 ? 17   HIS B CA  1 
ATOM   1256 C  C   . HIS B 2 17  ? 27.542  11.213  -6.658  1.00 23.44 ? 17   HIS B C   1 
ATOM   1257 O  O   . HIS B 2 17  ? 28.229  10.197  -6.771  1.00 23.95 ? 17   HIS B O   1 
ATOM   1258 C  CB  . HIS B 2 17  ? 28.550  11.989  -4.490  1.00 25.28 ? 17   HIS B CB  1 
ATOM   1259 C  CG  . HIS B 2 17  ? 29.458  12.983  -3.805  1.00 27.32 ? 17   HIS B CG  1 
ATOM   1260 N  ND1 . HIS B 2 17  ? 28.989  13.994  -2.979  1.00 28.29 ? 17   HIS B ND1 1 
ATOM   1261 C  CD2 . HIS B 2 17  ? 30.807  13.141  -3.857  1.00 27.93 ? 17   HIS B CD2 1 
ATOM   1262 C  CE1 . HIS B 2 17  ? 30.008  14.725  -2.554  1.00 28.62 ? 17   HIS B CE1 1 
ATOM   1263 N  NE2 . HIS B 2 17  ? 31.123  14.228  -3.069  1.00 28.53 ? 17   HIS B NE2 1 
ATOM   1264 N  N   . MET B 2 18  ? 26.328  11.269  -7.154  1.00 22.52 ? 18   MET B N   1 
ATOM   1265 C  CA  . MET B 2 18  ? 25.783  10.117  -7.836  1.00 21.74 ? 18   MET B CA  1 
ATOM   1266 C  C   . MET B 2 18  ? 26.195  10.155  -9.311  1.00 20.80 ? 18   MET B C   1 
ATOM   1267 O  O   . MET B 2 18  ? 26.180  11.215  -9.922  1.00 20.36 ? 18   MET B O   1 
ATOM   1268 C  CB  . MET B 2 18  ? 24.273  10.190  -7.725  1.00 22.72 ? 18   MET B CB  1 
ATOM   1269 C  CG  . MET B 2 18  ? 23.583  8.924   -7.813  1.00 24.61 ? 18   MET B CG  1 
ATOM   1270 S  SD  . MET B 2 18  ? 21.866  9.156   -7.215  1.00 26.85 ? 18   MET B SD  1 
ATOM   1271 C  CE  . MET B 2 18  ? 21.984  8.371   -5.900  1.00 26.81 ? 18   MET B CE  1 
ATOM   1272 N  N   . ASP B 2 19  ? 26.580  9.024   -9.878  1.00 19.59 ? 19   ASP B N   1 
ATOM   1273 C  CA  . ASP B 2 19  ? 26.888  8.993   -11.299 1.00 19.15 ? 19   ASP B CA  1 
ATOM   1274 C  C   . ASP B 2 19  ? 25.571  8.514   -11.958 1.00 18.66 ? 19   ASP B C   1 
ATOM   1275 O  O   . ASP B 2 19  ? 25.244  7.337   -11.892 1.00 18.22 ? 19   ASP B O   1 
ATOM   1276 C  CB  . ASP B 2 19  ? 28.024  8.023   -11.555 1.00 19.51 ? 19   ASP B CB  1 
ATOM   1277 C  CG  . ASP B 2 19  ? 28.244  7.743   -13.033 1.00 19.78 ? 19   ASP B CG  1 
ATOM   1278 O  OD1 . ASP B 2 19  ? 27.567  8.294   -13.928 1.00 20.13 ? 19   ASP B OD1 1 
ATOM   1279 O  OD2 . ASP B 2 19  ? 29.130  6.915   -13.277 1.00 21.01 ? 19   ASP B OD2 1 
ATOM   1280 N  N   . TYR B 2 20  ? 24.842  9.444   -12.575 1.00 18.50 ? 20   TYR B N   1 
ATOM   1281 C  CA  . TYR B 2 20  ? 23.546  9.149   -13.163 1.00 18.98 ? 20   TYR B CA  1 
ATOM   1282 C  C   . TYR B 2 20  ? 23.586  8.088   -14.248 1.00 19.58 ? 20   TYR B C   1 
ATOM   1283 O  O   . TYR B 2 20  ? 22.633  7.270   -14.409 1.00 19.72 ? 20   TYR B O   1 
ATOM   1284 C  CB  . TYR B 2 20  ? 22.894  10.428  -13.735 1.00 19.04 ? 20   TYR B CB  1 
ATOM   1285 C  CG  . TYR B 2 20  ? 22.468  11.491  -12.729 1.00 18.72 ? 20   TYR B CG  1 
ATOM   1286 C  CD1 . TYR B 2 20  ? 21.745  12.593  -13.137 1.00 19.10 ? 20   TYR B CD1 1 
ATOM   1287 C  CD2 . TYR B 2 20  ? 22.849  11.428  -11.397 1.00 19.12 ? 20   TYR B CD2 1 
ATOM   1288 C  CE1 . TYR B 2 20  ? 21.417  13.623  -12.261 1.00 19.00 ? 20   TYR B CE1 1 
ATOM   1289 C  CE2 . TYR B 2 20  ? 22.527  12.458  -10.517 1.00 19.31 ? 20   TYR B CE2 1 
ATOM   1290 C  CZ  . TYR B 2 20  ? 21.814  13.550  -10.972 1.00 19.08 ? 20   TYR B CZ  1 
ATOM   1291 O  OH  . TYR B 2 20  ? 21.540  14.587  -10.125 1.00 19.61 ? 20   TYR B OH  1 
ATOM   1292 N  N   . ASP B 2 21  ? 24.691  8.091   -14.990 1.00 19.60 ? 21   ASP B N   1 
ATOM   1293 C  CA  . ASP B 2 21  ? 24.837  7.171   -16.071 1.00 19.80 ? 21   ASP B CA  1 
ATOM   1294 C  C   . ASP B 2 21  ? 25.004  5.783   -15.617 1.00 19.68 ? 21   ASP B C   1 
ATOM   1295 O  O   . ASP B 2 21  ? 24.784  4.850   -16.375 1.00 19.73 ? 21   ASP B O   1 
ATOM   1296 C  CB  . ASP B 2 21  ? 26.008  7.556   -16.921 1.00 21.11 ? 21   ASP B CB  1 
ATOM   1297 C  CG  . ASP B 2 21  ? 25.666  8.641   -17.893 1.00 22.47 ? 21   ASP B CG  1 
ATOM   1298 O  OD1 . ASP B 2 21  ? 24.562  9.237   -17.815 1.00 23.27 ? 21   ASP B OD1 1 
ATOM   1299 O  OD2 . ASP B 2 21  ? 26.519  8.923   -18.765 1.00 24.39 ? 21   ASP B OD2 1 
ATOM   1300 N  N   . ASP B 2 22  ? 25.416  5.622   -14.382 1.00 19.36 ? 22   ASP B N   1 
ATOM   1301 C  CA  . ASP B 2 22  ? 25.605  4.293   -13.857 1.00 19.14 ? 22   ASP B CA  1 
ATOM   1302 C  C   . ASP B 2 22  ? 24.390  3.899   -13.047 1.00 18.57 ? 22   ASP B C   1 
ATOM   1303 O  O   . ASP B 2 22  ? 23.842  2.833   -13.207 1.00 18.49 ? 22   ASP B O   1 
ATOM   1304 C  CB  . ASP B 2 22  ? 26.858  4.278   -12.966 1.00 20.00 ? 22   ASP B CB  1 
ATOM   1305 C  CG  . ASP B 2 22  ? 27.030  2.987   -12.237 1.00 20.38 ? 22   ASP B CG  1 
ATOM   1306 O  OD1 . ASP B 2 22  ? 26.734  2.894   -11.041 1.00 21.14 ? 22   ASP B OD1 1 
ATOM   1307 O  OD2 . ASP B 2 22  ? 27.463  2.042   -12.893 1.00 21.84 ? 22   ASP B OD2 1 
ATOM   1308 N  N   . ILE B 2 23  ? 23.979  4.789   -12.160 1.00 17.97 ? 23   ILE B N   1 
ATOM   1309 C  CA  . ILE B 2 23  ? 22.858  4.499   -11.261 1.00 17.22 ? 23   ILE B CA  1 
ATOM   1310 C  C   . ILE B 2 23  ? 21.513  4.395   -11.969 1.00 16.41 ? 23   ILE B C   1 
ATOM   1311 O  O   . ILE B 2 23  ? 20.691  3.517   -11.626 1.00 16.15 ? 23   ILE B O   1 
ATOM   1312 C  CB  . ILE B 2 23  ? 22.735  5.588   -10.129 1.00 17.20 ? 23   ILE B CB  1 
ATOM   1313 C  CG1 . ILE B 2 23  ? 23.979  5.600   -9.255  1.00 17.56 ? 23   ILE B CG1 1 
ATOM   1314 C  CG2 . ILE B 2 23  ? 21.539  5.292   -9.254  1.00 17.43 ? 23   ILE B CG2 1 
ATOM   1315 C  CD1 . ILE B 2 23  ? 24.130  4.342   -8.445  1.00 17.80 ? 23   ILE B CD1 1 
ATOM   1316 N  N   . GLY B 2 24  ? 21.286  5.275   -12.952 1.00 15.73 ? 24   GLY B N   1 
ATOM   1317 C  CA  . GLY B 2 24  ? 20.007  5.290   -13.650 1.00 14.69 ? 24   GLY B CA  1 
ATOM   1318 C  C   . GLY B 2 24  ? 19.624  3.986   -14.318 1.00 14.44 ? 24   GLY B C   1 
ATOM   1319 O  O   . GLY B 2 24  ? 18.541  3.419   -14.101 1.00 13.87 ? 24   GLY B O   1 
ATOM   1320 N  N   . PRO B 2 25  ? 20.508  3.496   -15.185 1.00 14.23 ? 25   PRO B N   1 
ATOM   1321 C  CA  . PRO B 2 25  ? 20.244  2.231   -15.896 1.00 14.29 ? 25   PRO B CA  1 
ATOM   1322 C  C   . PRO B 2 25  ? 20.117  1.038   -14.919 1.00 14.18 ? 25   PRO B C   1 
ATOM   1323 O  O   . PRO B 2 25  ? 19.294  0.148   -15.097 1.00 14.36 ? 25   PRO B O   1 
ATOM   1324 C  CB  . PRO B 2 25  ? 21.442  2.104   -16.871 1.00 14.21 ? 25   PRO B CB  1 
ATOM   1325 C  CG  . PRO B 2 25  ? 21.781  3.584   -17.167 1.00 14.26 ? 25   PRO B CG  1 
ATOM   1326 C  CD  . PRO B 2 25  ? 21.665  4.212   -15.745 1.00 14.36 ? 25   PRO B CD  1 
ATOM   1327 N  N   . LYS B 2 26  ? 20.925  1.046   -13.875 1.00 14.23 ? 26   LYS B N   1 
ATOM   1328 C  CA  . LYS B 2 26  ? 20.878  -0.025  -12.905 1.00 14.37 ? 26   LYS B CA  1 
ATOM   1329 C  C   . LYS B 2 26  ? 19.534  -0.080  -12.188 1.00 14.12 ? 26   LYS B C   1 
ATOM   1330 O  O   . LYS B 2 26  ? 18.966  -1.154  -12.036 1.00 13.81 ? 26   LYS B O   1 
ATOM   1331 C  CB  . LYS B 2 26  ? 22.021  0.127   -11.895 1.00 14.77 ? 26   LYS B CB  1 
ATOM   1332 C  CG  . LYS B 2 26  ? 23.273  -0.521  -12.443 1.00 16.15 ? 26   LYS B CG  1 
ATOM   1333 C  CD  . LYS B 2 26  ? 24.444  -0.246  -11.573 1.00 17.47 ? 26   LYS B CD  1 
ATOM   1334 C  CE  . LYS B 2 26  ? 25.676  -0.815  -12.227 1.00 18.16 ? 26   LYS B CE  1 
ATOM   1335 N  NZ  . LYS B 2 26  ? 26.894  -0.511  -11.407 1.00 20.02 ? 26   LYS B NZ  1 
ATOM   1336 N  N   . ALA B 2 27  ? 19.049  1.091   -11.756 1.00 13.85 ? 27   ALA B N   1 
ATOM   1337 C  CA  . ALA B 2 27  ? 17.803  1.160   -11.003 1.00 13.82 ? 27   ALA B CA  1 
ATOM   1338 C  C   . ALA B 2 27  ? 16.615  0.681   -11.848 1.00 13.75 ? 27   ALA B C   1 
ATOM   1339 O  O   . ALA B 2 27  ? 15.773  -0.110  -11.371 1.00 13.58 ? 27   ALA B O   1 
ATOM   1340 C  CB  . ALA B 2 27  ? 17.571  2.596   -10.501 1.00 13.37 ? 27   ALA B CB  1 
ATOM   1341 N  N   . LEU B 2 28  ? 16.572  1.154   -13.105 1.00 13.72 ? 28   LEU B N   1 
ATOM   1342 C  CA  . LEU B 2 28  ? 15.482  0.779   -14.018 1.00 13.82 ? 28   LEU B CA  1 
ATOM   1343 C  C   . LEU B 2 28  ? 15.584  -0.700  -14.430 1.00 13.58 ? 28   LEU B C   1 
ATOM   1344 O  O   . LEU B 2 28  ? 14.560  -1.391  -14.445 1.00 13.54 ? 28   LEU B O   1 
ATOM   1345 C  CB  . LEU B 2 28  ? 15.466  1.678   -15.267 1.00 14.20 ? 28   LEU B CB  1 
ATOM   1346 C  CG  . LEU B 2 28  ? 14.193  1.452   -16.112 1.00 15.40 ? 28   LEU B CG  1 
ATOM   1347 C  CD1 . LEU B 2 28  ? 13.013  1.898   -15.241 1.00 16.17 ? 28   LEU B CD1 1 
ATOM   1348 C  CD2 . LEU B 2 28  ? 14.169  2.284   -17.484 1.00 15.86 ? 28   LEU B CD2 1 
ATOM   1349 N  N   . SER B 2 29  ? 16.790  -1.200  -14.764 1.00 13.53 ? 29   SER B N   1 
ATOM   1350 C  CA  . SER B 2 29  ? 16.854  -2.612  -15.134 1.00 13.58 ? 29   SER B CA  1 
ATOM   1351 C  C   . SER B 2 29  ? 16.497  -3.466  -13.906 1.00 13.60 ? 29   SER B C   1 
ATOM   1352 O  O   . SER B 2 29  ? 15.854  -4.521  -14.040 1.00 13.71 ? 29   SER B O   1 
ATOM   1353 C  CB  A SER B 2 29  ? 18.263  -2.987  -15.582 0.30 13.61 ? 29   SER B CB  1 
ATOM   1354 C  CB  B SER B 2 29  ? 18.217  -2.985  -15.731 0.70 13.85 ? 29   SER B CB  1 
ATOM   1355 O  OG  A SER B 2 29  ? 18.653  -2.230  -16.698 0.30 13.38 ? 29   SER B OG  1 
ATOM   1356 O  OG  B SER B 2 29  ? 19.279  -2.682  -14.869 0.70 13.96 ? 29   SER B OG  1 
ATOM   1357 N  N   . ARG B 2 30  ? 16.884  -3.008  -12.714 1.00 13.33 ? 30   ARG B N   1 
ATOM   1358 C  CA  . ARG B 2 30  ? 16.562  -3.766  -11.512 1.00 13.21 ? 30   ARG B CA  1 
ATOM   1359 C  C   . ARG B 2 30  ? 15.045  -3.792  -11.342 1.00 13.23 ? 30   ARG B C   1 
ATOM   1360 O  O   . ARG B 2 30  ? 14.466  -4.843  -11.045 1.00 13.28 ? 30   ARG B O   1 
ATOM   1361 C  CB  . ARG B 2 30  ? 17.249  -3.168  -10.274 1.00 13.02 ? 30   ARG B CB  1 
ATOM   1362 C  CG  . ARG B 2 30  ? 16.897  -3.960  -8.966  1.00 13.18 ? 30   ARG B CG  1 
ATOM   1363 C  CD  . ARG B 2 30  ? 17.826  -3.566  -7.800  1.00 13.18 ? 30   ARG B CD  1 
ATOM   1364 N  NE  . ARG B 2 30  ? 19.231  -3.957  -8.062  1.00 13.27 ? 30   ARG B NE  1 
ATOM   1365 C  CZ  . ARG B 2 30  ? 19.841  -5.008  -7.522  1.00 12.95 ? 30   ARG B CZ  1 
ATOM   1366 N  NH1 . ARG B 2 30  ? 19.188  -5.792  -6.667  1.00 13.34 ? 30   ARG B NH1 1 
ATOM   1367 N  NH2 . ARG B 2 30  ? 21.097  -5.291  -7.862  1.00 12.99 ? 30   ARG B NH2 1 
ATOM   1368 N  N   . CYS B 2 31  ? 14.407  -2.640  -11.546 1.00 13.43 ? 31   CYS B N   1 
ATOM   1369 C  CA  . CYS B 2 31  ? 12.956  -2.536  -11.454 1.00 13.56 ? 31   CYS B CA  1 
ATOM   1370 C  C   . CYS B 2 31  ? 12.275  -3.483  -12.464 1.00 13.84 ? 31   CYS B C   1 
ATOM   1371 O  O   . CYS B 2 31  ? 11.304  -4.175  -12.127 1.00 13.73 ? 31   CYS B O   1 
ATOM   1372 C  CB  . CYS B 2 31  ? 12.509  -1.095  -11.730 1.00 13.44 ? 31   CYS B CB  1 
ATOM   1373 S  SG  . CYS B 2 31  ? 10.692  -0.905  -11.531 1.00 14.49 ? 31   CYS B SG  1 
ATOM   1374 N  N   . LEU B 2 32  ? 12.800  -3.532  -13.703 1.00 13.78 ? 32   LEU B N   1 
ATOM   1375 C  CA  . LEU B 2 32  ? 12.204  -4.394  -14.735 1.00 13.92 ? 32   LEU B CA  1 
ATOM   1376 C  C   . LEU B 2 32  ? 12.332  -5.899  -14.446 1.00 13.65 ? 32   LEU B C   1 
ATOM   1377 O  O   . LEU B 2 32  ? 11.520  -6.669  -14.916 1.00 14.12 ? 32   LEU B O   1 
ATOM   1378 C  CB  . LEU B 2 32  ? 12.800  -4.079  -16.116 1.00 13.89 ? 32   LEU B CB  1 
ATOM   1379 C  CG  . LEU B 2 32  ? 12.027  -3.028  -16.912 1.00 14.45 ? 32   LEU B CG  1 
ATOM   1380 C  CD1 . LEU B 2 32  ? 11.756  -1.832  -16.107 1.00 14.16 ? 32   LEU B CD1 1 
ATOM   1381 C  CD2 . LEU B 2 32  ? 12.847  -2.665  -18.183 1.00 14.61 ? 32   LEU B CD2 1 
ATOM   1382 N  N   . ILE B 2 33  ? 13.347  -6.299  -13.682 1.00 13.61 ? 33   ILE B N   1 
ATOM   1383 C  CA  . ILE B 2 33  ? 13.545  -7.705  -13.341 1.00 13.32 ? 33   ILE B CA  1 
ATOM   1384 C  C   . ILE B 2 33  ? 12.790  -8.098  -12.063 1.00 13.18 ? 33   ILE B C   1 
ATOM   1385 O  O   . ILE B 2 33  ? 12.242  -9.190  -11.964 1.00 13.15 ? 33   ILE B O   1 
ATOM   1386 C  CB  . ILE B 2 33  ? 15.037  -7.981  -13.195 1.00 13.77 ? 33   ILE B CB  1 
ATOM   1387 C  CG1 . ILE B 2 33  ? 15.672  -7.928  -14.611 1.00 13.93 ? 33   ILE B CG1 1 
ATOM   1388 C  CG2 . ILE B 2 33  ? 15.289  -9.336  -12.464 1.00 13.32 ? 33   ILE B CG2 1 
ATOM   1389 C  CD1 . ILE B 2 33  ? 17.157  -7.586  -14.628 1.00 14.68 ? 33   ILE B CD1 1 
ATOM   1390 N  N   . VAL B 2 34  ? 12.749  -7.185  -11.087 1.00 12.99 ? 34   VAL B N   1 
ATOM   1391 C  CA  . VAL B 2 34  ? 12.089  -7.472  -9.816  1.00 12.84 ? 34   VAL B CA  1 
ATOM   1392 C  C   . VAL B 2 34  ? 10.538  -7.368  -9.942  1.00 13.08 ? 34   VAL B C   1 
ATOM   1393 O  O   . VAL B 2 34  ? 9.806   -8.113  -9.277  1.00 12.78 ? 34   VAL B O   1 
ATOM   1394 C  CB  . VAL B 2 34  ? 12.674  -6.528  -8.657  1.00 12.69 ? 34   VAL B CB  1 
ATOM   1395 C  CG1 . VAL B 2 34  ? 11.899  -6.761  -7.294  1.00 12.09 ? 34   VAL B CG1 1 
ATOM   1396 C  CG2 . VAL B 2 34  ? 14.188  -6.802  -8.469  1.00 12.30 ? 34   VAL B CG2 1 
ATOM   1397 N  N   . TYR B 2 35  ? 10.045  -6.454  -10.793 1.00 13.64 ? 35   TYR B N   1 
ATOM   1398 C  CA  . TYR B 2 35  ? 8.583   -6.231  -11.013 1.00 13.77 ? 35   TYR B CA  1 
ATOM   1399 C  C   . TYR B 2 35  ? 8.496   -6.248  -12.541 1.00 14.48 ? 35   TYR B C   1 
ATOM   1400 O  O   . TYR B 2 35  ? 8.265   -5.232  -13.223 1.00 14.27 ? 35   TYR B O   1 
ATOM   1401 C  CB  . TYR B 2 35  ? 8.216   -4.863  -10.443 1.00 13.68 ? 35   TYR B CB  1 
ATOM   1402 C  CG  . TYR B 2 35  ? 8.629   -4.699  -8.967  1.00 13.44 ? 35   TYR B CG  1 
ATOM   1403 C  CD1 . TYR B 2 35  ? 7.995   -5.438  -7.970  1.00 13.51 ? 35   TYR B CD1 1 
ATOM   1404 C  CD2 . TYR B 2 35  ? 9.634   -3.786  -8.581  1.00 13.32 ? 35   TYR B CD2 1 
ATOM   1405 C  CE1 . TYR B 2 35  ? 8.333   -5.268  -6.603  1.00 13.58 ? 35   TYR B CE1 1 
ATOM   1406 C  CE2 . TYR B 2 35  ? 9.990   -3.610  -7.212  1.00 13.53 ? 35   TYR B CE2 1 
ATOM   1407 C  CZ  . TYR B 2 35  ? 9.322   -4.360  -6.238  1.00 13.67 ? 35   TYR B CZ  1 
ATOM   1408 O  OH  . TYR B 2 35  ? 9.618   -4.220  -4.898  1.00 14.05 ? 35   TYR B OH  1 
ATOM   1409 N  N   . PRO B 2 36  ? 8.635   -7.441  -13.095 1.00 15.32 ? 36   PRO B N   1 
ATOM   1410 C  CA  . PRO B 2 36  ? 8.627   -7.532  -14.545 1.00 15.76 ? 36   PRO B CA  1 
ATOM   1411 C  C   . PRO B 2 36  ? 7.457   -7.040  -15.292 1.00 16.30 ? 36   PRO B C   1 
ATOM   1412 O  O   . PRO B 2 36  ? 7.560   -6.881  -16.497 1.00 16.84 ? 36   PRO B O   1 
ATOM   1413 C  CB  . PRO B 2 36  ? 8.987   -8.997  -14.822 1.00 15.89 ? 36   PRO B CB  1 
ATOM   1414 C  CG  . PRO B 2 36  ? 8.566   -9.736  -13.550 1.00 15.73 ? 36   PRO B CG  1 
ATOM   1415 C  CD  . PRO B 2 36  ? 8.748   -8.756  -12.429 1.00 15.27 ? 36   PRO B CD  1 
ATOM   1416 N  N   . TRP B 2 37  ? 6.336   -6.792  -14.656 1.00 16.54 ? 37   TRP B N   1 
ATOM   1417 C  CA  . TRP B 2 37  ? 5.236   -6.248  -15.442 1.00 17.35 ? 37   TRP B CA  1 
ATOM   1418 C  C   . TRP B 2 37  ? 5.576   -4.813  -15.946 1.00 18.16 ? 37   TRP B C   1 
ATOM   1419 O  O   . TRP B 2 37  ? 4.889   -4.277  -16.817 1.00 19.16 ? 37   TRP B O   1 
ATOM   1420 C  CB  . TRP B 2 37  ? 3.925   -6.249  -14.633 1.00 16.61 ? 37   TRP B CB  1 
ATOM   1421 C  CG  . TRP B 2 37  ? 4.093   -5.748  -13.184 1.00 15.99 ? 37   TRP B CG  1 
ATOM   1422 C  CD1 . TRP B 2 37  ? 3.851   -4.496  -12.712 1.00 15.52 ? 37   TRP B CD1 1 
ATOM   1423 C  CD2 . TRP B 2 37  ? 4.509   -6.538  -12.039 1.00 15.62 ? 37   TRP B CD2 1 
ATOM   1424 N  NE1 . TRP B 2 37  ? 4.072   -4.443  -11.352 1.00 15.61 ? 37   TRP B NE1 1 
ATOM   1425 C  CE2 . TRP B 2 37  ? 4.478   -5.677  -10.907 1.00 15.26 ? 37   TRP B CE2 1 
ATOM   1426 C  CE3 . TRP B 2 37  ? 4.891   -7.890  -11.863 1.00 15.18 ? 37   TRP B CE3 1 
ATOM   1427 C  CZ2 . TRP B 2 37  ? 4.818   -6.123  -9.603  1.00 15.17 ? 37   TRP B CZ2 1 
ATOM   1428 C  CZ3 . TRP B 2 37  ? 5.221   -8.347  -10.563 1.00 14.70 ? 37   TRP B CZ3 1 
ATOM   1429 C  CH2 . TRP B 2 37  ? 5.179   -7.460  -9.450  1.00 15.06 ? 37   TRP B CH2 1 
ATOM   1430 N  N   . THR B 2 38  ? 6.634   -4.192  -15.424 1.00 18.10 ? 38   THR B N   1 
ATOM   1431 C  CA  . THR B 2 38  ? 6.981   -2.834  -15.863 1.00 18.54 ? 38   THR B CA  1 
ATOM   1432 C  C   . THR B 2 38  ? 7.733   -2.873  -17.201 1.00 19.46 ? 38   THR B C   1 
ATOM   1433 O  O   . THR B 2 38  ? 7.958   -1.845  -17.873 1.00 19.30 ? 38   THR B O   1 
ATOM   1434 C  CB  . THR B 2 38  ? 7.868   -2.073  -14.766 1.00 18.06 ? 38   THR B CB  1 
ATOM   1435 O  OG1 . THR B 2 38  ? 9.087   -2.820  -14.480 1.00 17.15 ? 38   THR B OG1 1 
ATOM   1436 C  CG2 . THR B 2 38  ? 7.049   -1.830  -13.492 1.00 17.28 ? 38   THR B CG2 1 
ATOM   1437 N  N   . GLN B 2 39  ? 8.152   -4.072  -17.568 1.00 20.55 ? 39   GLN B N   1 
ATOM   1438 C  CA  . GLN B 2 39  ? 8.866   -4.243  -18.813 1.00 21.83 ? 39   GLN B CA  1 
ATOM   1439 C  C   . GLN B 2 39  ? 7.978   -3.792  -19.993 1.00 23.02 ? 39   GLN B C   1 
ATOM   1440 O  O   . GLN B 2 39  ? 8.520   -3.288  -21.001 1.00 23.00 ? 39   GLN B O   1 
ATOM   1441 C  CB  . GLN B 2 39  ? 9.279   -5.719  -19.003 1.00 21.48 ? 39   GLN B CB  1 
ATOM   1442 C  CG  . GLN B 2 39  ? 10.412  -6.198  -18.078 1.00 21.42 ? 39   GLN B CG  1 
ATOM   1443 C  CD  . GLN B 2 39  ? 10.655  -7.703  -18.205 1.00 21.81 ? 39   GLN B CD  1 
ATOM   1444 O  OE1 . GLN B 2 39  ? 10.410  -8.272  -19.266 1.00 22.59 ? 39   GLN B OE1 1 
ATOM   1445 N  NE2 . GLN B 2 39  ? 11.131  -8.349  -17.149 1.00 21.02 ? 39   GLN B NE2 1 
ATOM   1446 N  N   . ARG B 2 40  ? 6.652   -3.956  -19.885 1.00 24.10 ? 40   ARG B N   1 
ATOM   1447 C  CA  . ARG B 2 40  ? 5.770   -3.581  -21.007 1.00 25.41 ? 40   ARG B CA  1 
ATOM   1448 C  C   . ARG B 2 40  ? 6.090   -2.197  -21.577 1.00 26.00 ? 40   ARG B C   1 
ATOM   1449 O  O   . ARG B 2 40  ? 5.970   -1.956  -22.765 1.00 25.94 ? 40   ARG B O   1 
ATOM   1450 C  CB  . ARG B 2 40  ? 4.278   -3.656  -20.616 1.00 26.04 ? 40   ARG B CB  1 
ATOM   1451 C  CG  . ARG B 2 40  ? 3.832   -2.774  -19.446 1.00 27.69 ? 40   ARG B CG  1 
ATOM   1452 C  CD  . ARG B 2 40  ? 2.313   -2.922  -18.991 1.00 29.19 ? 40   ARG B CD  1 
ATOM   1453 N  NE  . ARG B 2 40  ? 1.959   -4.149  -18.189 1.00 31.23 ? 40   ARG B NE  1 
ATOM   1454 C  CZ  . ARG B 2 40  ? 1.800   -4.262  -16.827 1.00 31.56 ? 40   ARG B CZ  1 
ATOM   1455 N  NH1 . ARG B 2 40  ? 1.967   -3.197  -15.967 1.00 31.75 ? 40   ARG B NH1 1 
ATOM   1456 N  NH2 . ARG B 2 40  ? 1.445   -5.456  -16.317 1.00 31.00 ? 40   ARG B NH2 1 
ATOM   1457 N  N   . HIS B 2 41  ? 6.573   -1.292  -20.754 1.00 26.58 ? 41   HIS B N   1 
ATOM   1458 C  CA  . HIS B 2 41  ? 6.831   0.051   -21.260 1.00 27.56 ? 41   HIS B CA  1 
ATOM   1459 C  C   . HIS B 2 41  ? 8.048   0.259   -22.066 1.00 28.25 ? 41   HIS B C   1 
ATOM   1460 O  O   . HIS B 2 41  ? 8.162   1.282   -22.730 1.00 28.37 ? 41   HIS B O   1 
ATOM   1461 C  CB  . HIS B 2 41  ? 6.878   1.025   -20.095 1.00 27.34 ? 41   HIS B CB  1 
ATOM   1462 C  CG  . HIS B 2 41  ? 5.626   1.018   -19.308 1.00 27.36 ? 41   HIS B CG  1 
ATOM   1463 N  ND1 . HIS B 2 41  ? 4.474   1.628   -19.763 1.00 27.70 ? 41   HIS B ND1 1 
ATOM   1464 C  CD2 . HIS B 2 41  ? 5.298   0.391   -18.157 1.00 27.29 ? 41   HIS B CD2 1 
ATOM   1465 C  CE1 . HIS B 2 41  ? 3.484   1.381   -18.923 1.00 27.45 ? 41   HIS B CE1 1 
ATOM   1466 N  NE2 . HIS B 2 41  ? 3.958   0.631   -17.942 1.00 27.61 ? 41   HIS B NE2 1 
ATOM   1467 N  N   . PHE B 2 42  ? 8.972   -0.677  -21.985 1.00 29.31 ? 42   PHE B N   1 
ATOM   1468 C  CA  . PHE B 2 42  ? 10.220  -0.502  -22.679 1.00 30.93 ? 42   PHE B CA  1 
ATOM   1469 C  C   . PHE B 2 42  ? 10.459  -1.460  -23.786 1.00 32.25 ? 42   PHE B C   1 
ATOM   1470 O  O   . PHE B 2 42  ? 11.565  -1.502  -24.326 1.00 32.82 ? 42   PHE B O   1 
ATOM   1471 C  CB  . PHE B 2 42  ? 11.374  -0.472  -21.677 1.00 30.20 ? 42   PHE B CB  1 
ATOM   1472 C  CG  . PHE B 2 42  ? 11.229  0.624   -20.668 1.00 29.79 ? 42   PHE B CG  1 
ATOM   1473 C  CD1 . PHE B 2 42  ? 11.597  1.931   -20.979 1.00 29.52 ? 42   PHE B CD1 1 
ATOM   1474 C  CD2 . PHE B 2 42  ? 10.580  0.388   -19.462 1.00 29.43 ? 42   PHE B CD2 1 
ATOM   1475 C  CE1 . PHE B 2 42  ? 11.300  2.981   -20.092 1.00 29.55 ? 42   PHE B CE1 1 
ATOM   1476 C  CE2 . PHE B 2 42  ? 10.280  1.435   -18.576 1.00 29.40 ? 42   PHE B CE2 1 
ATOM   1477 C  CZ  . PHE B 2 42  ? 10.636  2.729   -18.889 1.00 29.20 ? 42   PHE B CZ  1 
ATOM   1478 N  N   . SER B 2 43  ? 9.420   -2.230  -24.102 1.00 33.76 ? 43   SER B N   1 
ATOM   1479 C  CA  . SER B 2 43  ? 9.437   -3.135  -25.250 1.00 35.67 ? 43   SER B CA  1 
ATOM   1480 C  C   . SER B 2 43  ? 8.660   -2.215  -26.287 1.00 36.80 ? 43   SER B C   1 
ATOM   1481 O  O   . SER B 2 43  ? 7.998   -2.654  -27.280 1.00 37.20 ? 43   SER B O   1 
ATOM   1482 C  CB  . SER B 2 43  ? 8.707   -4.454  -24.907 1.00 35.55 ? 43   SER B CB  1 
ATOM   1483 O  OG  . SER B 2 43  ? 7.391   -4.270  -24.407 1.00 36.15 ? 43   SER B OG  1 
ATOM   1484 N  N   . GLY B 2 44  ? 8.813   -0.905  -26.003 1.00 37.64 ? 44   GLY B N   1 
ATOM   1485 C  CA  . GLY B 2 44  ? 8.180   0.175   -26.729 1.00 38.11 ? 44   GLY B CA  1 
ATOM   1486 C  C   . GLY B 2 44  ? 7.159   0.797   -25.783 1.00 38.45 ? 44   GLY B C   1 
ATOM   1487 O  O   . GLY B 2 44  ? 6.364   0.074   -25.148 1.00 38.75 ? 44   GLY B O   1 
ATOM   1488 N  N   . ASN B 2 50  ? 15.346  -11.349 -21.597 1.00 36.99 ? 50   ASN B N   1 
ATOM   1489 C  CA  . ASN B 2 50  ? 15.797  -11.924 -20.332 1.00 36.77 ? 50   ASN B CA  1 
ATOM   1490 C  C   . ASN B 2 50  ? 16.519  -10.868 -19.481 1.00 36.41 ? 50   ASN B C   1 
ATOM   1491 O  O   . ASN B 2 50  ? 16.730  -9.742  -19.919 1.00 36.45 ? 50   ASN B O   1 
ATOM   1492 C  CB  . ASN B 2 50  ? 16.731  -13.104 -20.610 1.00 37.19 ? 50   ASN B CB  1 
ATOM   1493 C  CG  . ASN B 2 50  ? 18.133  -12.665 -21.003 1.00 37.70 ? 50   ASN B CG  1 
ATOM   1494 O  OD1 . ASN B 2 50  ? 18.321  -11.619 -21.614 1.00 38.21 ? 50   ASN B OD1 1 
ATOM   1495 N  ND2 . ASN B 2 50  ? 19.124  -13.474 -20.658 1.00 38.07 ? 50   ASN B ND2 1 
ATOM   1496 N  N   . ALA B 2 51  ? 16.915  -11.242 -18.266 1.00 35.86 ? 51   ALA B N   1 
ATOM   1497 C  CA  . ALA B 2 51  ? 17.596  -10.319 -17.361 1.00 35.08 ? 51   ALA B CA  1 
ATOM   1498 C  C   . ALA B 2 51  ? 18.855  -9.672  -18.015 1.00 34.47 ? 51   ALA B C   1 
ATOM   1499 O  O   . ALA B 2 51  ? 19.036  -8.438  -17.998 1.00 34.07 ? 51   ALA B O   1 
ATOM   1500 C  CB  . ALA B 2 51  ? 17.956  -11.075 -16.054 1.00 35.08 ? 51   ALA B CB  1 
ATOM   1501 N  N   . GLU B 2 52  ? 19.706  -10.515 -18.600 1.00 33.83 ? 52   GLU B N   1 
ATOM   1502 C  CA  . GLU B 2 52  ? 20.923  -10.060 -19.279 1.00 33.30 ? 52   GLU B CA  1 
ATOM   1503 C  C   . GLU B 2 52  ? 20.567  -9.016  -20.351 1.00 32.01 ? 52   GLU B C   1 
ATOM   1504 O  O   . GLU B 2 52  ? 21.157  -7.930  -20.412 1.00 31.85 ? 52   GLU B O   1 
ATOM   1505 C  CB  . GLU B 2 52  ? 21.609  -11.261 -19.914 1.00 34.46 ? 52   GLU B CB  1 
ATOM   1506 C  CG  . GLU B 2 52  ? 22.819  -10.943 -20.739 1.00 36.36 ? 52   GLU B CG  1 
ATOM   1507 C  CD  . GLU B 2 52  ? 23.427  -12.213 -21.363 1.00 37.59 ? 52   GLU B CD  1 
ATOM   1508 O  OE1 . GLU B 2 52  ? 22.666  -13.218 -21.510 1.00 38.48 ? 52   GLU B OE1 1 
ATOM   1509 O  OE2 . GLU B 2 52  ? 24.650  -12.201 -21.706 1.00 38.41 ? 52   GLU B OE2 1 
ATOM   1510 N  N   . ALA B 2 53  ? 19.589  -9.368  -21.176 1.00 30.59 ? 53   ALA B N   1 
ATOM   1511 C  CA  . ALA B 2 53  ? 19.055  -8.497  -22.233 1.00 29.37 ? 53   ALA B CA  1 
ATOM   1512 C  C   . ALA B 2 53  ? 18.587  -7.130  -21.699 1.00 28.30 ? 53   ALA B C   1 
ATOM   1513 O  O   . ALA B 2 53  ? 18.906  -6.082  -22.259 1.00 28.47 ? 53   ALA B O   1 
ATOM   1514 C  CB  . ALA B 2 53  ? 17.853  -9.195  -22.918 1.00 29.19 ? 53   ALA B CB  1 
ATOM   1515 N  N   . ILE B 2 54  ? 17.797  -7.160  -20.638 1.00 26.97 ? 54   ILE B N   1 
ATOM   1516 C  CA  . ILE B 2 54  ? 17.265  -5.958  -20.011 1.00 25.78 ? 54   ILE B CA  1 
ATOM   1517 C  C   . ILE B 2 54  ? 18.388  -5.059  -19.504 1.00 25.24 ? 54   ILE B C   1 
ATOM   1518 O  O   . ILE B 2 54  ? 18.436  -3.842  -19.762 1.00 24.97 ? 54   ILE B O   1 
ATOM   1519 C  CB  . ILE B 2 54  ? 16.372  -6.358  -18.809 1.00 26.03 ? 54   ILE B CB  1 
ATOM   1520 C  CG1 . ILE B 2 54  ? 15.100  -7.048  -19.346 1.00 25.53 ? 54   ILE B CG1 1 
ATOM   1521 C  CG2 . ILE B 2 54  ? 16.107  -5.119  -17.884 1.00 25.71 ? 54   ILE B CG2 1 
ATOM   1522 C  CD1 . ILE B 2 54  ? 14.243  -7.671  -18.305 1.00 25.58 ? 54   ILE B CD1 1 
ATOM   1523 N  N   . ILE B 2 55  ? 19.312  -5.667  -18.787 1.00 24.54 ? 55   ILE B N   1 
ATOM   1524 C  CA  . ILE B 2 55  ? 20.425  -4.917  -18.235 1.00 23.95 ? 55   ILE B CA  1 
ATOM   1525 C  C   . ILE B 2 55  ? 21.268  -4.162  -19.301 1.00 23.70 ? 55   ILE B C   1 
ATOM   1526 O  O   . ILE B 2 55  ? 21.797  -3.067  -19.042 1.00 23.83 ? 55   ILE B O   1 
ATOM   1527 C  CB  . ILE B 2 55  ? 21.300  -5.849  -17.384 1.00 23.82 ? 55   ILE B CB  1 
ATOM   1528 C  CG1 . ILE B 2 55  ? 20.464  -6.379  -16.200 1.00 23.43 ? 55   ILE B CG1 1 
ATOM   1529 C  CG2 . ILE B 2 55  ? 22.563  -5.087  -16.971 1.00 24.03 ? 55   ILE B CG2 1 
ATOM   1530 C  CD1 . ILE B 2 55  ? 21.083  -7.475  -15.331 1.00 23.61 ? 55   ILE B CD1 1 
ATOM   1531 N  N   . GLY B 2 56  ? 21.370  -4.712  -20.508 1.00 22.94 ? 56   GLY B N   1 
ATOM   1532 C  CA  . GLY B 2 56  ? 22.143  -4.017  -21.518 1.00 21.83 ? 56   GLY B CA  1 
ATOM   1533 C  C   . GLY B 2 56  ? 21.331  -3.207  -22.508 1.00 21.09 ? 56   GLY B C   1 
ATOM   1534 O  O   . GLY B 2 56  ? 21.904  -2.525  -23.355 1.00 21.45 ? 56   GLY B O   1 
ATOM   1535 N  N   . ASN B 2 57  ? 20.013  -3.259  -22.395 1.00 19.74 ? 57   ASN B N   1 
ATOM   1536 C  CA  . ASN B 2 57  ? 19.127  -2.562  -23.308 1.00 18.53 ? 57   ASN B CA  1 
ATOM   1537 C  C   . ASN B 2 57  ? 19.300  -1.030  -23.236 1.00 17.90 ? 57   ASN B C   1 
ATOM   1538 O  O   . ASN B 2 57  ? 19.058  -0.413  -22.168 1.00 17.49 ? 57   ASN B O   1 
ATOM   1539 C  CB  . ASN B 2 57  ? 17.694  -2.981  -22.984 1.00 18.23 ? 57   ASN B CB  1 
ATOM   1540 C  CG  . ASN B 2 57  ? 16.691  -2.352  -23.902 1.00 18.16 ? 57   ASN B CG  1 
ATOM   1541 O  OD1 . ASN B 2 57  ? 16.635  -1.165  -24.038 1.00 18.30 ? 57   ASN B OD1 1 
ATOM   1542 N  ND2 . ASN B 2 57  ? 15.884  -3.156  -24.533 1.00 18.40 ? 57   ASN B ND2 1 
ATOM   1543 N  N   . ALA B 2 58  ? 19.726  -0.434  -24.362 1.00 16.98 ? 58   ALA B N   1 
ATOM   1544 C  CA  . ALA B 2 58  ? 19.968  1.009   -24.446 1.00 16.65 ? 58   ALA B CA  1 
ATOM   1545 C  C   . ALA B 2 58  ? 18.742  1.865   -24.195 1.00 16.56 ? 58   ALA B C   1 
ATOM   1546 O  O   . ALA B 2 58  ? 18.853  3.012   -23.710 1.00 16.31 ? 58   ALA B O   1 
ATOM   1547 C  CB  . ALA B 2 58  ? 20.561  1.366   -25.779 1.00 16.80 ? 58   ALA B CB  1 
ATOM   1548 N  N   . ASN B 2 59  ? 17.569  1.335   -24.543 1.00 16.46 ? 59   ASN B N   1 
ATOM   1549 C  CA  . ASN B 2 59  ? 16.327  2.081   -24.308 1.00 16.68 ? 59   ASN B CA  1 
ATOM   1550 C  C   . ASN B 2 59  ? 16.047  2.156   -22.809 1.00 16.25 ? 59   ASN B C   1 
ATOM   1551 O  O   . ASN B 2 59  ? 15.657  3.214   -22.248 1.00 16.25 ? 59   ASN B O   1 
ATOM   1552 C  CB  . ASN B 2 59  ? 15.169  1.421   -25.034 1.00 17.36 ? 59   ASN B CB  1 
ATOM   1553 C  CG  . ASN B 2 59  ? 15.319  1.526   -26.514 1.00 18.56 ? 59   ASN B CG  1 
ATOM   1554 O  OD1 . ASN B 2 59  ? 15.584  2.616   -27.023 1.00 19.69 ? 59   ASN B OD1 1 
ATOM   1555 N  ND2 . ASN B 2 59  ? 15.170  0.417   -27.225 1.00 18.93 ? 59   ASN B ND2 1 
ATOM   1556 N  N   . VAL B 2 60  ? 16.252  1.028   -22.153 1.00 15.87 ? 60   VAL B N   1 
ATOM   1557 C  CA  . VAL B 2 60  ? 16.083  0.999   -20.715 1.00 15.82 ? 60   VAL B CA  1 
ATOM   1558 C  C   . VAL B 2 60  ? 17.077  1.956   -20.070 1.00 15.70 ? 60   VAL B C   1 
ATOM   1559 O  O   . VAL B 2 60  ? 16.720  2.726   -19.205 1.00 16.00 ? 60   VAL B O   1 
ATOM   1560 C  CB  . VAL B 2 60  ? 16.297  -0.419  -20.196 1.00 15.44 ? 60   VAL B CB  1 
ATOM   1561 C  CG1 . VAL B 2 60  ? 16.501  -0.434  -18.675 1.00 15.44 ? 60   VAL B CG1 1 
ATOM   1562 C  CG2 . VAL B 2 60  ? 15.081  -1.224  -20.616 1.00 15.48 ? 60   VAL B CG2 1 
ATOM   1563 N  N   . ALA B 2 61  ? 18.313  1.930   -20.517 1.00 15.50 ? 61   ALA B N   1 
ATOM   1564 C  CA  . ALA B 2 61  ? 19.333  2.804   -19.962 1.00 15.49 ? 61   ALA B CA  1 
ATOM   1565 C  C   . ALA B 2 61  ? 19.014  4.275   -20.142 1.00 15.44 ? 61   ALA B C   1 
ATOM   1566 O  O   . ALA B 2 61  ? 19.199  5.059   -19.209 1.00 15.50 ? 61   ALA B O   1 
ATOM   1567 C  CB  . ALA B 2 61  ? 20.699  2.491   -20.603 1.00 15.39 ? 61   ALA B CB  1 
ATOM   1568 N  N   . ALA B 2 62  ? 18.545  4.636   -21.328 1.00 15.15 ? 62   ALA B N   1 
ATOM   1569 C  CA  . ALA B 2 62  ? 18.233  6.009   -21.612 1.00 15.26 ? 62   ALA B CA  1 
ATOM   1570 C  C   . ALA B 2 62  ? 17.178  6.549   -20.670 1.00 15.32 ? 62   ALA B C   1 
ATOM   1571 O  O   . ALA B 2 62  ? 17.331  7.641   -20.110 1.00 15.34 ? 62   ALA B O   1 
ATOM   1572 C  CB  . ALA B 2 62  ? 17.767  6.154   -23.061 1.00 15.33 ? 62   ALA B CB  1 
ATOM   1573 N  N   . HIS B 2 63  ? 16.095  5.792   -20.484 1.00 15.19 ? 63   HIS B N   1 
ATOM   1574 C  CA  . HIS B 2 63  ? 15.037  6.298   -19.596 1.00 15.20 ? 63   HIS B CA  1 
ATOM   1575 C  C   . HIS B 2 63  ? 15.506  6.325   -18.117 1.00 14.97 ? 63   HIS B C   1 
ATOM   1576 O  O   . HIS B 2 63  ? 15.147  7.234   -17.368 1.00 15.04 ? 63   HIS B O   1 
ATOM   1577 C  CB  . HIS B 2 63  ? 13.734  5.487   -19.773 1.00 15.35 ? 63   HIS B CB  1 
ATOM   1578 C  CG  . HIS B 2 63  ? 12.680  5.842   -18.769 1.00 15.65 ? 63   HIS B CG  1 
ATOM   1579 N  ND1 . HIS B 2 63  ? 12.496  5.166   -17.575 1.00 15.82 ? 63   HIS B ND1 1 
ATOM   1580 C  CD2 . HIS B 2 63  ? 11.828  6.894   -18.737 1.00 15.50 ? 63   HIS B CD2 1 
ATOM   1581 C  CE1 . HIS B 2 63  ? 11.565  5.826   -16.852 1.00 15.82 ? 63   HIS B CE1 1 
ATOM   1582 N  NE2 . HIS B 2 63  ? 11.122  6.882   -17.501 1.00 15.88 ? 63   HIS B NE2 1 
ATOM   1583 N  N   . GLY B 2 64  ? 16.318  5.348   -17.714 1.00 14.93 ? 64   GLY B N   1 
ATOM   1584 C  CA  . GLY B 2 64  ? 16.851  5.328   -16.353 1.00 14.99 ? 64   GLY B CA  1 
ATOM   1585 C  C   . GLY B 2 64  ? 17.654  6.579   -16.066 1.00 15.36 ? 64   GLY B C   1 
ATOM   1586 O  O   . GLY B 2 64  ? 17.622  7.138   -14.952 1.00 14.96 ? 64   GLY B O   1 
ATOM   1587 N  N   . ILE B 2 65  ? 18.393  7.031   -17.086 1.00 15.50 ? 65   ILE B N   1 
ATOM   1588 C  CA  . ILE B 2 65  ? 19.181  8.242   -16.929 1.00 15.98 ? 65   ILE B CA  1 
ATOM   1589 C  C   . ILE B 2 65  ? 18.257  9.450   -16.881 1.00 16.12 ? 65   ILE B C   1 
ATOM   1590 O  O   . ILE B 2 65  ? 18.466  10.364  -16.077 1.00 16.42 ? 65   ILE B O   1 
ATOM   1591 C  CB  . ILE B 2 65  ? 20.271  8.324   -18.042 1.00 16.26 ? 65   ILE B CB  1 
ATOM   1592 C  CG1 . ILE B 2 65  ? 21.252  7.166   -17.811 1.00 15.70 ? 65   ILE B CG1 1 
ATOM   1593 C  CG2 . ILE B 2 65  ? 20.983  9.733   -18.048 1.00 15.89 ? 65   ILE B CG2 1 
ATOM   1594 C  CD1 . ILE B 2 65  ? 22.204  6.976   -18.976 1.00 15.70 ? 65   ILE B CD1 1 
ATOM   1595 N  N   . LYS B 2 66  ? 17.217  9.449   -17.705 1.00 16.33 ? 66   LYS B N   1 
ATOM   1596 C  CA  . LYS B 2 66  ? 16.211  10.522  -17.691 1.00 16.58 ? 66   LYS B CA  1 
ATOM   1597 C  C   . LYS B 2 66  ? 15.550  10.597  -16.328 1.00 15.91 ? 66   LYS B C   1 
ATOM   1598 O  O   . LYS B 2 66  ? 15.262  11.673  -15.853 1.00 16.00 ? 66   LYS B O   1 
ATOM   1599 C  CB  . LYS B 2 66  ? 15.088  10.252  -18.703 1.00 17.57 ? 66   LYS B CB  1 
ATOM   1600 C  CG  . LYS B 2 66  ? 15.473  10.547  -20.107 1.00 19.68 ? 66   LYS B CG  1 
ATOM   1601 C  CD  . LYS B 2 66  ? 14.306  10.275  -20.998 1.00 21.06 ? 66   LYS B CD  1 
ATOM   1602 C  CE  . LYS B 2 66  ? 14.795  10.255  -22.425 1.00 22.37 ? 66   LYS B CE  1 
ATOM   1603 N  NZ  . LYS B 2 66  ? 13.598  10.068  -23.289 1.00 23.50 ? 66   LYS B NZ  1 
ATOM   1604 N  N   . VAL B 2 67  ? 15.240  9.457   -15.727 1.00 15.24 ? 67   VAL B N   1 
ATOM   1605 C  CA  . VAL B 2 67  ? 14.624  9.481   -14.406 1.00 14.73 ? 67   VAL B CA  1 
ATOM   1606 C  C   . VAL B 2 67  ? 15.470  10.269  -13.402 1.00 15.08 ? 67   VAL B C   1 
ATOM   1607 O  O   . VAL B 2 67  ? 14.952  11.102  -12.672 1.00 14.71 ? 67   VAL B O   1 
ATOM   1608 C  CB  . VAL B 2 67  ? 14.432  8.054   -13.884 1.00 14.42 ? 67   VAL B CB  1 
ATOM   1609 C  CG1 . VAL B 2 67  ? 14.057  8.066   -12.401 1.00 13.76 ? 67   VAL B CG1 1 
ATOM   1610 C  CG2 . VAL B 2 67  ? 13.331  7.372   -14.705 1.00 13.59 ? 67   VAL B CG2 1 
ATOM   1611 N  N   . LEU B 2 68  ? 16.776  9.997   -13.360 1.00 15.41 ? 68   LEU B N   1 
ATOM   1612 C  CA  . LEU B 2 68  ? 17.666  10.681  -12.427 1.00 16.10 ? 68   LEU B CA  1 
ATOM   1613 C  C   . LEU B 2 68  ? 17.787  12.179  -12.706 1.00 16.27 ? 68   LEU B C   1 
ATOM   1614 O  O   . LEU B 2 68  ? 17.816  12.981  -11.776 1.00 16.12 ? 68   LEU B O   1 
ATOM   1615 C  CB  . LEU B 2 68  ? 19.025  10.008  -12.431 1.00 16.94 ? 68   LEU B CB  1 
ATOM   1616 C  CG  . LEU B 2 68  ? 19.211  8.919   -11.371 1.00 18.24 ? 68   LEU B CG  1 
ATOM   1617 C  CD1 . LEU B 2 68  ? 18.014  8.065   -11.129 1.00 18.72 ? 68   LEU B CD1 1 
ATOM   1618 C  CD2 . LEU B 2 68  ? 20.309  8.067   -11.819 1.00 19.07 ? 68   LEU B CD2 1 
ATOM   1619 N  N   . HIS B 2 69  ? 17.868  12.562  -13.976 1.00 16.68 ? 69   HIS B N   1 
ATOM   1620 C  CA  . HIS B 2 69  ? 17.891  13.974  -14.284 1.00 17.21 ? 69   HIS B CA  1 
ATOM   1621 C  C   . HIS B 2 69  ? 16.523  14.576  -13.920 1.00 17.19 ? 69   HIS B C   1 
ATOM   1622 O  O   . HIS B 2 69  ? 16.408  15.755  -13.496 1.00 17.55 ? 69   HIS B O   1 
ATOM   1623 C  CB  . HIS B 2 69  ? 18.206  14.173  -15.746 1.00 17.91 ? 69   HIS B CB  1 
ATOM   1624 C  CG  . HIS B 2 69  ? 19.655  14.023  -16.044 1.00 18.76 ? 69   HIS B CG  1 
ATOM   1625 N  ND1 . HIS B 2 69  ? 20.589  14.941  -15.625 1.00 19.16 ? 69   HIS B ND1 1 
ATOM   1626 C  CD2 . HIS B 2 69  ? 20.336  13.035  -16.662 1.00 18.84 ? 69   HIS B CD2 1 
ATOM   1627 C  CE1 . HIS B 2 69  ? 21.790  14.521  -15.975 1.00 19.12 ? 69   HIS B CE1 1 
ATOM   1628 N  NE2 . HIS B 2 69  ? 21.659  13.368  -16.603 1.00 19.20 ? 69   HIS B NE2 1 
ATOM   1629 N  N   . GLY B 2 70  ? 15.483  13.781  -14.070 1.00 16.81 ? 70   GLY B N   1 
ATOM   1630 C  CA  . GLY B 2 70  ? 14.170  14.257  -13.677 1.00 17.44 ? 70   GLY B CA  1 
ATOM   1631 C  C   . GLY B 2 70  ? 14.046  14.570  -12.176 1.00 18.01 ? 70   GLY B C   1 
ATOM   1632 O  O   . GLY B 2 70  ? 13.320  15.474  -11.788 1.00 18.00 ? 70   GLY B O   1 
ATOM   1633 N  N   . LEU B 2 71  ? 14.754  13.820  -11.337 1.00 18.56 ? 71   LEU B N   1 
ATOM   1634 C  CA  . LEU B 2 71  ? 14.718  13.995  -9.882  1.00 19.46 ? 71   LEU B CA  1 
ATOM   1635 C  C   . LEU B 2 71  ? 15.478  15.249  -9.520  1.00 20.50 ? 71   LEU B C   1 
ATOM   1636 O  O   . LEU B 2 71  ? 15.175  15.907  -8.526  1.00 20.27 ? 71   LEU B O   1 
ATOM   1637 C  CB  . LEU B 2 71  ? 15.348  12.800  -9.166  1.00 18.87 ? 71   LEU B CB  1 
ATOM   1638 C  CG  . LEU B 2 71  ? 14.562  11.524  -9.359  1.00 18.59 ? 71   LEU B CG  1 
ATOM   1639 C  CD1 . LEU B 2 71  ? 15.253  10.340  -8.773  1.00 18.49 ? 71   LEU B CD1 1 
ATOM   1640 C  CD2 . LEU B 2 71  ? 13.241  11.742  -8.742  1.00 18.46 ? 71   LEU B CD2 1 
ATOM   1641 N  N   . ASP B 2 72  ? 16.447  15.602  -10.357 1.00 21.78 ? 72   ASP B N   1 
ATOM   1642 C  CA  . ASP B 2 72  ? 17.261  16.782  -10.092 1.00 23.11 ? 72   ASP B CA  1 
ATOM   1643 C  C   . ASP B 2 72  ? 16.449  18.098  -10.026 1.00 23.04 ? 72   ASP B C   1 
ATOM   1644 O  O   . ASP B 2 72  ? 16.737  18.979  -9.215  1.00 23.02 ? 72   ASP B O   1 
ATOM   1645 C  CB  . ASP B 2 72  ? 18.354  16.837  -11.142 1.00 25.08 ? 72   ASP B CB  1 
ATOM   1646 C  CG  . ASP B 2 72  ? 19.726  17.138  -10.575 1.00 26.61 ? 72   ASP B CG  1 
ATOM   1647 O  OD1 . ASP B 2 72  ? 19.992  17.139  -9.322  1.00 27.57 ? 72   ASP B OD1 1 
ATOM   1648 O  OD2 . ASP B 2 72  ? 20.567  17.401  -11.459 1.00 28.40 ? 72   ASP B OD2 1 
ATOM   1649 N  N   . ARG B 2 73  ? 15.404  18.248  -10.838 1.00 23.01 ? 73   ARG B N   1 
ATOM   1650 C  CA  . ARG B 2 73  ? 14.651  19.486  -10.750 1.00 22.82 ? 73   ARG B CA  1 
ATOM   1651 C  C   . ARG B 2 73  ? 13.906  19.522  -9.431  1.00 21.86 ? 73   ARG B C   1 
ATOM   1652 O  O   . ARG B 2 73  ? 13.572  20.588  -8.938  1.00 21.63 ? 73   ARG B O   1 
ATOM   1653 C  CB  . ARG B 2 73  ? 13.696  19.601  -11.919 1.00 24.60 ? 73   ARG B CB  1 
ATOM   1654 C  CG  . ARG B 2 73  ? 12.540  18.666  -11.805 1.00 27.11 ? 73   ARG B CG  1 
ATOM   1655 C  CD  . ARG B 2 73  ? 11.660  18.804  -13.027 1.00 28.87 ? 73   ARG B CD  1 
ATOM   1656 N  NE  . ARG B 2 73  ? 12.176  18.048  -14.155 1.00 29.98 ? 73   ARG B NE  1 
ATOM   1657 C  CZ  . ARG B 2 73  ? 11.498  17.973  -15.282 1.00 30.70 ? 73   ARG B CZ  1 
ATOM   1658 N  NH1 . ARG B 2 73  ? 10.356  18.644  -15.356 1.00 31.22 ? 73   ARG B NH1 1 
ATOM   1659 N  NH2 . ARG B 2 73  ? 11.892  17.180  -16.293 1.00 31.43 ? 73   ARG B NH2 1 
ATOM   1660 N  N   . GLY B 2 74  ? 13.631  18.340  -8.868  1.00 20.67 ? 74   GLY B N   1 
ATOM   1661 C  CA  . GLY B 2 74  ? 12.974  18.302  -7.589  1.00 19.43 ? 74   GLY B CA  1 
ATOM   1662 C  C   . GLY B 2 74  ? 13.964  18.726  -6.528  1.00 19.07 ? 74   GLY B C   1 
ATOM   1663 O  O   . GLY B 2 74  ? 13.609  19.463  -5.617  1.00 18.49 ? 74   GLY B O   1 
ATOM   1664 N  N   . VAL B 2 75  ? 15.212  18.273  -6.662  1.00 18.77 ? 75   VAL B N   1 
ATOM   1665 C  CA  . VAL B 2 75  ? 16.272  18.607  -5.732  1.00 19.03 ? 75   VAL B CA  1 
ATOM   1666 C  C   . VAL B 2 75  ? 16.529  20.128  -5.758  1.00 19.82 ? 75   VAL B C   1 
ATOM   1667 O  O   . VAL B 2 75  ? 16.796  20.733  -4.701  1.00 19.21 ? 75   VAL B O   1 
ATOM   1668 C  CB  . VAL B 2 75  ? 17.533  17.876  -6.111  1.00 18.86 ? 75   VAL B CB  1 
ATOM   1669 C  CG1 . VAL B 2 75  ? 18.699  18.378  -5.259  1.00 19.21 ? 75   VAL B CG1 1 
ATOM   1670 C  CG2 . VAL B 2 75  ? 17.336  16.386  -5.896  1.00 18.55 ? 75   VAL B CG2 1 
ATOM   1671 N  N   . LYS B 2 76  ? 16.424  20.726  -6.953  1.00 20.83 ? 76   LYS B N   1 
ATOM   1672 C  CA  . LYS B 2 76  ? 16.594  22.174  -7.131  1.00 22.37 ? 76   LYS B CA  1 
ATOM   1673 C  C   . LYS B 2 76  ? 15.544  22.998  -6.415  1.00 22.75 ? 76   LYS B C   1 
ATOM   1674 O  O   . LYS B 2 76  ? 15.875  24.087  -5.967  1.00 23.74 ? 76   LYS B O   1 
ATOM   1675 C  CB  . LYS B 2 76  ? 16.600  22.584  -8.594  1.00 23.23 ? 76   LYS B CB  1 
ATOM   1676 C  CG  . LYS B 2 76  ? 18.033  22.761  -9.138  1.00 25.70 ? 76   LYS B CG  1 
ATOM   1677 C  CD  . LYS B 2 76  ? 18.676  24.164  -8.735  1.00 26.95 ? 76   LYS B CD  1 
ATOM   1678 C  CE  . LYS B 2 76  ? 20.058  24.061  -7.907  1.00 27.76 ? 76   LYS B CE  1 
ATOM   1679 N  NZ  . LYS B 2 76  ? 21.400  24.242  -8.618  1.00 27.49 ? 76   LYS B NZ  1 
ATOM   1680 N  N   . ASN B 2 77  ? 14.293  22.538  -6.337  1.00 22.74 ? 77   ASN B N   1 
ATOM   1681 C  CA  . ASN B 2 77  ? 13.275  23.254  -5.544  1.00 22.71 ? 77   ASN B CA  1 
ATOM   1682 C  C   . ASN B 2 77  ? 12.467  22.321  -4.690  1.00 22.43 ? 77   ASN B C   1 
ATOM   1683 O  O   . ASN B 2 77  ? 11.313  21.969  -5.014  1.00 22.28 ? 77   ASN B O   1 
ATOM   1684 C  CB  A ASN B 2 77  ? 12.302  23.958  -6.494  0.45 22.99 ? 77   ASN B CB  1 
ATOM   1685 C  CB  B ASN B 2 77  ? 12.317  24.171  -6.311  0.55 22.95 ? 77   ASN B CB  1 
ATOM   1686 C  CG  A ASN B 2 77  ? 12.004  23.127  -7.729  0.45 22.82 ? 77   ASN B CG  1 
ATOM   1687 C  CG  B ASN B 2 77  ? 11.434  24.994  -5.348  0.55 22.65 ? 77   ASN B CG  1 
ATOM   1688 O  OD1 A ASN B 2 77  ? 12.509  23.427  -8.813  0.45 23.03 ? 77   ASN B OD1 1 
ATOM   1689 O  OD1 B ASN B 2 77  ? 11.732  25.124  -4.159  0.55 22.22 ? 77   ASN B OD1 1 
ATOM   1690 N  ND2 A ASN B 2 77  ? 11.207  22.066  -7.570  0.45 22.70 ? 77   ASN B ND2 1 
ATOM   1691 N  ND2 B ASN B 2 77  ? 10.356  25.531  -5.862  0.55 23.04 ? 77   ASN B ND2 1 
ATOM   1692 N  N   . MET B 2 78  ? 13.054  22.010  -3.552  1.00 22.23 ? 78   MET B N   1 
ATOM   1693 C  CA  . MET B 2 78  ? 12.448  21.078  -2.658  1.00 22.27 ? 78   MET B CA  1 
ATOM   1694 C  C   . MET B 2 78  ? 11.132  21.535  -2.090  1.00 22.13 ? 78   MET B C   1 
ATOM   1695 O  O   . MET B 2 78  ? 10.371  20.735  -1.599  1.00 21.66 ? 78   MET B O   1 
ATOM   1696 C  CB  . MET B 2 78  ? 13.472  20.670  -1.597  1.00 22.60 ? 78   MET B CB  1 
ATOM   1697 C  CG  . MET B 2 78  ? 14.390  19.514  -2.103  1.00 22.71 ? 78   MET B CG  1 
ATOM   1698 S  SD  . MET B 2 78  ? 15.699  19.290  -0.927  1.00 24.06 ? 78   MET B SD  1 
ATOM   1699 C  CE  . MET B 2 78  ? 14.905  18.203  0.300   1.00 23.43 ? 78   MET B CE  1 
ATOM   1700 N  N   . ASP B 2 79  ? 10.816  22.808  -2.204  1.00 22.18 ? 79   ASP B N   1 
ATOM   1701 C  CA  . ASP B 2 79  ? 9.545   23.198  -1.672  1.00 22.79 ? 79   ASP B CA  1 
ATOM   1702 C  C   . ASP B 2 79  ? 8.465   23.328  -2.715  1.00 23.13 ? 79   ASP B C   1 
ATOM   1703 O  O   . ASP B 2 79  ? 7.349   23.719  -2.375  1.00 23.76 ? 79   ASP B O   1 
ATOM   1704 C  CB  . ASP B 2 79  ? 9.648   24.475  -0.864  1.00 22.84 ? 79   ASP B CB  1 
ATOM   1705 C  CG  . ASP B 2 79  ? 10.482  24.286  0.387   1.00 23.22 ? 79   ASP B CG  1 
ATOM   1706 O  OD1 . ASP B 2 79  ? 10.253  23.322  1.141   1.00 23.71 ? 79   ASP B OD1 1 
ATOM   1707 O  OD2 . ASP B 2 79  ? 11.385  25.099  0.639   1.00 23.73 ? 79   ASP B OD2 1 
ATOM   1708 N  N   . ASN B 2 80  ? 8.745   22.971  -3.963  1.00 23.10 ? 80   ASN B N   1 
ATOM   1709 C  CA  . ASN B 2 80  ? 7.716   23.062  -4.982  1.00 23.33 ? 80   ASN B CA  1 
ATOM   1710 C  C   . ASN B 2 80  ? 7.618   21.770  -5.841  1.00 22.75 ? 80   ASN B C   1 
ATOM   1711 O  O   . ASN B 2 80  ? 7.382   21.808  -7.040  1.00 22.18 ? 80   ASN B O   1 
ATOM   1712 C  CB  . ASN B 2 80  ? 8.024   24.262  -5.849  1.00 24.68 ? 80   ASN B CB  1 
ATOM   1713 C  CG  . ASN B 2 80  ? 6.928   24.535  -6.829  1.00 26.29 ? 80   ASN B CG  1 
ATOM   1714 O  OD1 . ASN B 2 80  ? 5.725   24.495  -6.458  1.00 27.58 ? 80   ASN B OD1 1 
ATOM   1715 N  ND2 . ASN B 2 80  ? 7.302   24.825  -8.096  1.00 27.26 ? 80   ASN B ND2 1 
ATOM   1716 N  N   . ILE B 2 81  ? 7.771   20.628  -5.178  1.00 22.41 ? 81   ILE B N   1 
ATOM   1717 C  CA  . ILE B 2 81  ? 7.808   19.339  -5.859  1.00 22.03 ? 81   ILE B CA  1 
ATOM   1718 C  C   . ILE B 2 81  ? 6.505   18.895  -6.556  1.00 22.43 ? 81   ILE B C   1 
ATOM   1719 O  O   . ILE B 2 81  ? 6.494   18.455  -7.724  1.00 22.12 ? 81   ILE B O   1 
ATOM   1720 C  CB  . ILE B 2 81  ? 8.312   18.263  -4.875  1.00 21.45 ? 81   ILE B CB  1 
ATOM   1721 C  CG1 . ILE B 2 81  ? 9.764   18.573  -4.508  1.00 21.29 ? 81   ILE B CG1 1 
ATOM   1722 C  CG2 . ILE B 2 81  ? 8.150   16.877  -5.476  1.00 21.19 ? 81   ILE B CG2 1 
ATOM   1723 C  CD1 . ILE B 2 81  ? 10.373  17.695  -3.417  1.00 21.06 ? 81   ILE B CD1 1 
ATOM   1724 N  N   . ALA B 2 82  ? 5.391   18.999  -5.852  1.00 22.78 ? 82   ALA B N   1 
ATOM   1725 C  CA  . ALA B 2 82  ? 4.185   18.565  -6.486  1.00 23.25 ? 82   ALA B CA  1 
ATOM   1726 C  C   . ALA B 2 82  ? 3.995   19.412  -7.754  1.00 23.69 ? 82   ALA B C   1 
ATOM   1727 O  O   . ALA B 2 82  ? 3.666   18.860  -8.827  1.00 24.16 ? 82   ALA B O   1 
ATOM   1728 C  CB  . ALA B 2 82  ? 3.004   18.693  -5.529  1.00 22.97 ? 82   ALA B CB  1 
ATOM   1729 N  N   . ALA B 2 83  ? 4.258   20.722  -7.697  1.00 23.94 ? 83   ALA B N   1 
ATOM   1730 C  CA  . ALA B 2 83  ? 4.029   21.560  -8.900  1.00 24.03 ? 83   ALA B CA  1 
ATOM   1731 C  C   . ALA B 2 83  ? 4.958   21.209  -10.018 1.00 23.96 ? 83   ALA B C   1 
ATOM   1732 O  O   . ALA B 2 83  ? 4.584   21.165  -11.179 1.00 24.13 ? 83   ALA B O   1 
ATOM   1733 C  CB  . ALA B 2 83  ? 4.202   23.031  -8.573  1.00 24.35 ? 83   ALA B CB  1 
ATOM   1734 N  N   . THR B 2 84  ? 6.190   20.948  -9.634  1.00 23.79 ? 84   THR B N   1 
ATOM   1735 C  CA  . THR B 2 84  ? 7.267   20.620  -10.552 1.00 23.70 ? 84   THR B CA  1 
ATOM   1736 C  C   . THR B 2 84  ? 7.024   19.398  -11.416 1.00 23.22 ? 84   THR B C   1 
ATOM   1737 O  O   . THR B 2 84  ? 7.417   19.363  -12.594 1.00 23.10 ? 84   THR B O   1 
ATOM   1738 C  CB  . THR B 2 84  ? 8.588   20.443  -9.731  1.00 24.11 ? 84   THR B CB  1 
ATOM   1739 O  OG1 . THR B 2 84  ? 8.981   21.731  -9.206  1.00 24.75 ? 84   THR B OG1 1 
ATOM   1740 C  CG2 . THR B 2 84  ? 9.700   19.827  -10.568 1.00 24.32 ? 84   THR B CG2 1 
ATOM   1741 N  N   . TYR B 2 85  ? 6.374   18.396  -10.828 1.00 22.55 ? 85   TYR B N   1 
ATOM   1742 C  CA  . TYR B 2 85  ? 6.107   17.150  -11.541 1.00 22.10 ? 85   TYR B CA  1 
ATOM   1743 C  C   . TYR B 2 85  ? 4.718   16.993  -12.167 1.00 22.24 ? 85   TYR B C   1 
ATOM   1744 O  O   . TYR B 2 85  ? 4.400   15.935  -12.700 1.00 22.31 ? 85   TYR B O   1 
ATOM   1745 C  CB  . TYR B 2 85  ? 6.393   15.973  -10.612 1.00 21.02 ? 85   TYR B CB  1 
ATOM   1746 C  CG  . TYR B 2 85  ? 7.872   15.898  -10.330 1.00 20.33 ? 85   TYR B CG  1 
ATOM   1747 C  CD1 . TYR B 2 85  ? 8.406   16.371  -9.132  1.00 19.98 ? 85   TYR B CD1 1 
ATOM   1748 C  CD2 . TYR B 2 85  ? 8.749   15.402  -11.282 1.00 19.71 ? 85   TYR B CD2 1 
ATOM   1749 C  CE1 . TYR B 2 85  ? 9.805   16.352  -8.905  1.00 19.69 ? 85   TYR B CE1 1 
ATOM   1750 C  CE2 . TYR B 2 85  ? 10.133  15.368  -11.063 1.00 19.77 ? 85   TYR B CE2 1 
ATOM   1751 C  CZ  . TYR B 2 85  ? 10.654  15.840  -9.880  1.00 19.34 ? 85   TYR B CZ  1 
ATOM   1752 O  OH  . TYR B 2 85  ? 12.002  15.773  -9.663  1.00 19.01 ? 85   TYR B OH  1 
ATOM   1753 N  N   . ALA B 2 86  ? 3.913   18.054  -12.108 1.00 22.50 ? 86   ALA B N   1 
ATOM   1754 C  CA  . ALA B 2 86  ? 2.552   18.025  -12.627 1.00 22.70 ? 86   ALA B CA  1 
ATOM   1755 C  C   . ALA B 2 86  ? 2.543   17.600  -14.075 1.00 23.05 ? 86   ALA B C   1 
ATOM   1756 O  O   . ALA B 2 86  ? 1.810   16.709  -14.474 1.00 23.34 ? 86   ALA B O   1 
ATOM   1757 C  CB  . ALA B 2 86  ? 1.953   19.375  -12.495 1.00 22.77 ? 86   ALA B CB  1 
ATOM   1758 N  N   . ASP B 2 87  ? 3.362   18.232  -14.884 1.00 23.42 ? 87   ASP B N   1 
ATOM   1759 C  CA  . ASP B 2 87  ? 3.382   17.852  -16.265 1.00 23.75 ? 87   ASP B CA  1 
ATOM   1760 C  C   . ASP B 2 87  ? 3.867   16.441  -16.558 1.00 23.44 ? 87   ASP B C   1 
ATOM   1761 O  O   . ASP B 2 87  ? 3.303   15.750  -17.445 1.00 23.42 ? 87   ASP B O   1 
ATOM   1762 C  CB  . ASP B 2 87  ? 4.255   18.796  -17.038 1.00 25.27 ? 87   ASP B CB  1 
ATOM   1763 C  CG  . ASP B 2 87  ? 3.612   20.112  -17.259 1.00 26.48 ? 87   ASP B CG  1 
ATOM   1764 O  OD1 . ASP B 2 87  ? 2.405   20.263  -16.906 1.00 27.18 ? 87   ASP B OD1 1 
ATOM   1765 O  OD2 . ASP B 2 87  ? 4.354   20.979  -17.799 1.00 27.52 ? 87   ASP B OD2 1 
ATOM   1766 N  N   . LEU B 2 88  ? 4.952   16.040  -15.887 1.00 22.53 ? 88   LEU B N   1 
ATOM   1767 C  CA  . LEU B 2 88  ? 5.497   14.709  -16.087 1.00 21.91 ? 88   LEU B CA  1 
ATOM   1768 C  C   . LEU B 2 88  ? 4.454   13.700  -15.609 1.00 21.19 ? 88   LEU B C   1 
ATOM   1769 O  O   . LEU B 2 88  ? 4.371   12.612  -16.122 1.00 20.84 ? 88   LEU B O   1 
ATOM   1770 C  CB  . LEU B 2 88  ? 6.799   14.508  -15.293 1.00 22.14 ? 88   LEU B CB  1 
ATOM   1771 C  CG  . LEU B 2 88  ? 8.163   14.716  -15.980 1.00 22.90 ? 88   LEU B CG  1 
ATOM   1772 C  CD1 . LEU B 2 88  ? 9.303   14.295  -14.982 1.00 22.81 ? 88   LEU B CD1 1 
ATOM   1773 C  CD2 . LEU B 2 88  ? 8.243   13.879  -17.279 1.00 22.44 ? 88   LEU B CD2 1 
ATOM   1774 N  N   . SER B 2 89  ? 3.659   14.069  -14.625 1.00 20.71 ? 89   SER B N   1 
ATOM   1775 C  CA  . SER B 2 89  ? 2.662   13.159  -14.116 1.00 20.61 ? 89   SER B CA  1 
ATOM   1776 C  C   . SER B 2 89  ? 1.629   12.865  -15.209 1.00 20.67 ? 89   SER B C   1 
ATOM   1777 O  O   . SER B 2 89  ? 1.264   11.718  -15.492 1.00 20.38 ? 89   SER B O   1 
ATOM   1778 C  CB  . SER B 2 89  ? 2.008   13.798  -12.899 1.00 20.43 ? 89   SER B CB  1 
ATOM   1779 O  OG  . SER B 2 89  ? 0.965   12.984  -12.417 1.00 21.18 ? 89   SER B OG  1 
ATOM   1780 N  N   . THR B 2 90  ? 1.173   13.928  -15.837 1.00 20.74 ? 90   THR B N   1 
ATOM   1781 C  CA  . THR B 2 90  ? 0.199   13.804  -16.883 1.00 21.16 ? 90   THR B CA  1 
ATOM   1782 C  C   . THR B 2 90  ? 0.672   13.000  -18.034 1.00 21.05 ? 90   THR B C   1 
ATOM   1783 O  O   . THR B 2 90  ? -0.071  12.215  -18.598 1.00 21.25 ? 90   THR B O   1 
ATOM   1784 C  CB  . THR B 2 90  ? -0.131  15.141  -17.347 1.00 21.67 ? 90   THR B CB  1 
ATOM   1785 O  OG1 . THR B 2 90  ? -0.760  15.826  -16.250 1.00 22.85 ? 90   THR B OG1 1 
ATOM   1786 C  CG2 . THR B 2 90  ? -1.064  15.073  -18.572 1.00 22.39 ? 90   THR B CG2 1 
ATOM   1787 N  N   . LEU B 2 91  ? 1.920   13.217  -18.406 1.00 20.99 ? 91   LEU B N   1 
ATOM   1788 C  CA  . LEU B 2 91  ? 2.546   12.490  -19.502 1.00 21.07 ? 91   LEU B CA  1 
ATOM   1789 C  C   . LEU B 2 91  ? 2.493   10.989  -19.225 1.00 21.29 ? 91   LEU B C   1 
ATOM   1790 O  O   . LEU B 2 91  ? 1.960   10.222  -20.021 1.00 21.35 ? 91   LEU B O   1 
ATOM   1791 C  CB  . LEU B 2 91  ? 4.009   12.909  -19.634 1.00 21.58 ? 91   LEU B CB  1 
ATOM   1792 C  CG  . LEU B 2 91  ? 4.782   12.130  -20.676 1.00 22.10 ? 91   LEU B CG  1 
ATOM   1793 C  CD1 . LEU B 2 91  ? 4.241   12.524  -22.023 1.00 22.97 ? 91   LEU B CD1 1 
ATOM   1794 C  CD2 . LEU B 2 91  ? 6.262   12.395  -20.605 1.00 22.83 ? 91   LEU B CD2 1 
ATOM   1795 N  N   . HIS B 2 92  ? 3.056   10.564  -18.084 1.00 21.08 ? 92   HIS B N   1 
ATOM   1796 C  CA  . HIS B 2 92  ? 3.092   9.138   -17.717 1.00 21.18 ? 92   HIS B CA  1 
ATOM   1797 C  C   . HIS B 2 92  ? 1.691   8.487   -17.593 1.00 21.76 ? 92   HIS B C   1 
ATOM   1798 O  O   . HIS B 2 92  ? 1.531   7.337   -17.994 1.00 21.56 ? 92   HIS B O   1 
ATOM   1799 C  CB  . HIS B 2 92  ? 3.915   8.921   -16.421 1.00 20.05 ? 92   HIS B CB  1 
ATOM   1800 C  CG  . HIS B 2 92  ? 5.397   9.058   -16.629 1.00 19.56 ? 92   HIS B CG  1 
ATOM   1801 N  ND1 . HIS B 2 92  ? 6.055   10.261  -16.766 1.00 19.42 ? 92   HIS B ND1 1 
ATOM   1802 C  CD2 . HIS B 2 92  ? 6.359   8.107   -16.755 1.00 19.15 ? 92   HIS B CD2 1 
ATOM   1803 C  CE1 . HIS B 2 92  ? 7.369   10.019  -16.969 1.00 18.93 ? 92   HIS B CE1 1 
ATOM   1804 N  NE2 . HIS B 2 92  ? 7.617   8.720   -16.967 1.00 18.91 ? 92   HIS B NE2 1 
ATOM   1805 N  N   . SER B 2 93  ? 0.691   9.208   -17.070 1.00 22.54 ? 93   SER B N   1 
ATOM   1806 C  CA  . SER B 2 93  ? -0.629  8.588   -16.964 1.00 23.84 ? 93   SER B CA  1 
ATOM   1807 C  C   . SER B 2 93  ? -1.373  8.669   -18.286 1.00 24.62 ? 93   SER B C   1 
ATOM   1808 O  O   . SER B 2 93  ? -1.708  7.633   -18.886 1.00 24.64 ? 93   SER B O   1 
ATOM   1809 C  CB  . SER B 2 93  ? -1.493  9.232   -15.869 1.00 23.76 ? 93   SER B CB  1 
ATOM   1810 O  OG  . SER B 2 93  ? -1.504  10.624  -16.014 1.00 24.81 ? 93   SER B OG  1 
ATOM   1811 N  N   . GLU B 2 94  ? -1.565  9.907   -18.755 1.00 25.53 ? 94   GLU B N   1 
ATOM   1812 C  CA  . GLU B 2 94  ? -2.334  10.162  -19.972 1.00 26.60 ? 94   GLU B CA  1 
ATOM   1813 C  C   . GLU B 2 94  ? -1.807  9.563   -21.237 1.00 26.39 ? 94   GLU B C   1 
ATOM   1814 O  O   . GLU B 2 94  ? -2.555  8.923   -21.964 1.00 27.03 ? 94   GLU B O   1 
ATOM   1815 C  CB  . GLU B 2 94  ? -2.517  11.652  -20.208 1.00 27.77 ? 94   GLU B CB  1 
ATOM   1816 C  CG  . GLU B 2 94  ? -3.387  12.361  -19.181 1.00 30.17 ? 94   GLU B CG  1 
ATOM   1817 C  CD  . GLU B 2 94  ? -3.805  13.782  -19.683 1.00 31.78 ? 94   GLU B CD  1 
ATOM   1818 O  OE1 . GLU B 2 94  ? -4.545  14.526  -18.945 1.00 32.47 ? 94   GLU B OE1 1 
ATOM   1819 O  OE2 . GLU B 2 94  ? -3.371  14.144  -20.835 1.00 32.99 ? 94   GLU B OE2 1 
ATOM   1820 N  N   . LYS B 2 95  ? -0.526  9.747   -21.492 1.00 25.71 ? 95   LYS B N   1 
ATOM   1821 C  CA  . LYS B 2 95  ? 0.082   9.296   -22.717 1.00 25.31 ? 95   LYS B CA  1 
ATOM   1822 C  C   . LYS B 2 95  ? 0.802   7.971   -22.611 1.00 24.97 ? 95   LYS B C   1 
ATOM   1823 O  O   . LYS B 2 95  ? 0.851   7.180   -23.579 1.00 25.22 ? 95   LYS B O   1 
ATOM   1824 C  CB  A LYS B 2 95  ? 1.062   10.377  -23.219 0.54 25.26 ? 95   LYS B CB  1 
ATOM   1825 C  CB  B LYS B 2 95  ? 1.058   10.360  -23.236 0.46 25.44 ? 95   LYS B CB  1 
ATOM   1826 C  CG  A LYS B 2 95  ? 0.377   11.672  -23.714 0.54 25.27 ? 95   LYS B CG  1 
ATOM   1827 C  CG  B LYS B 2 95  ? 0.422   11.735  -23.421 0.46 25.65 ? 95   LYS B CG  1 
ATOM   1828 C  CD  A LYS B 2 95  ? 0.080   12.705  -22.601 0.54 25.08 ? 95   LYS B CD  1 
ATOM   1829 C  CD  B LYS B 2 95  ? -0.917  11.666  -24.159 0.46 25.66 ? 95   LYS B CD  1 
ATOM   1830 C  CE  A LYS B 2 95  ? 1.237   13.711  -22.413 0.54 24.85 ? 95   LYS B CE  1 
ATOM   1831 C  CE  B LYS B 2 95  ? -1.507  13.041  -24.367 0.46 25.74 ? 95   LYS B CE  1 
ATOM   1832 N  NZ  A LYS B 2 95  ? 0.884   14.817  -21.483 0.54 24.49 ? 95   LYS B NZ  1 
ATOM   1833 N  NZ  B LYS B 2 95  ? -1.606  13.783  -23.066 0.46 26.21 ? 95   LYS B NZ  1 
ATOM   1834 N  N   . LEU B 2 96  ? 1.372   7.695   -21.449 1.00 23.87 ? 96   LEU B N   1 
ATOM   1835 C  CA  . LEU B 2 96  ? 2.094   6.455   -21.359 1.00 22.96 ? 96   LEU B CA  1 
ATOM   1836 C  C   . LEU B 2 96  ? 1.332   5.318   -20.659 1.00 22.29 ? 96   LEU B C   1 
ATOM   1837 O  O   . LEU B 2 96  ? 1.735   4.166   -20.773 1.00 22.45 ? 96   LEU B O   1 
ATOM   1838 C  CB  . LEU B 2 96  ? 3.447   6.728   -20.677 1.00 22.72 ? 96   LEU B CB  1 
ATOM   1839 C  CG  . LEU B 2 96  ? 4.277   7.820   -21.374 1.00 22.52 ? 96   LEU B CG  1 
ATOM   1840 C  CD1 . LEU B 2 96  ? 5.535   8.153   -20.549 1.00 22.45 ? 96   LEU B CD1 1 
ATOM   1841 C  CD2 . LEU B 2 96  ? 4.638   7.331   -22.768 1.00 22.22 ? 96   LEU B CD2 1 
ATOM   1842 N  N   . HIS B 2 97  ? 0.243   5.635   -19.967 1.00 21.68 ? 97   HIS B N   1 
ATOM   1843 C  CA  . HIS B 2 97  ? -0.499  4.616   -19.235 1.00 21.28 ? 97   HIS B CA  1 
ATOM   1844 C  C   . HIS B 2 97  ? 0.340   3.848   -18.234 1.00 20.64 ? 97   HIS B C   1 
ATOM   1845 O  O   . HIS B 2 97  ? 0.203   2.640   -18.085 1.00 20.70 ? 97   HIS B O   1 
ATOM   1846 C  CB  . HIS B 2 97  ? -1.111  3.622   -20.172 1.00 22.20 ? 97   HIS B CB  1 
ATOM   1847 C  CG  . HIS B 2 97  ? -1.990  4.261   -21.160 1.00 23.25 ? 97   HIS B CG  1 
ATOM   1848 N  ND1 . HIS B 2 97  ? -3.039  5.069   -20.781 1.00 24.03 ? 97   HIS B ND1 1 
ATOM   1849 C  CD2 . HIS B 2 97  ? -1.929  4.312   -22.505 1.00 23.88 ? 97   HIS B CD2 1 
ATOM   1850 C  CE1 . HIS B 2 97  ? -3.591  5.598   -21.856 1.00 24.27 ? 97   HIS B CE1 1 
ATOM   1851 N  NE2 . HIS B 2 97  ? -2.933  5.154   -22.915 1.00 24.61 ? 97   HIS B NE2 1 
ATOM   1852 N  N   . VAL B 2 98  ? 1.231   4.542   -17.560 1.00 19.65 ? 98   VAL B N   1 
ATOM   1853 C  CA  . VAL B 2 98  ? 2.042   3.906   -16.554 1.00 18.65 ? 98   VAL B CA  1 
ATOM   1854 C  C   . VAL B 2 98  ? 1.138   3.814   -15.334 1.00 17.98 ? 98   VAL B C   1 
ATOM   1855 O  O   . VAL B 2 98  ? 0.540   4.806   -14.955 1.00 17.71 ? 98   VAL B O   1 
ATOM   1856 C  CB  . VAL B 2 98  ? 3.278   4.771   -16.240 1.00 18.51 ? 98   VAL B CB  1 
ATOM   1857 C  CG1 . VAL B 2 98  ? 4.033   4.234   -15.001 1.00 18.38 ? 98   VAL B CG1 1 
ATOM   1858 C  CG2 . VAL B 2 98  ? 4.168   4.804   -17.485 1.00 18.31 ? 98   VAL B CG2 1 
ATOM   1859 N  N   . ASP B 2 99  ? 1.034   2.619   -14.729 1.00 17.45 ? 99   ASP B N   1 
ATOM   1860 C  CA  . ASP B 2 99  ? 0.221   2.455   -13.514 1.00 16.77 ? 99   ASP B CA  1 
ATOM   1861 C  C   . ASP B 2 99  ? 0.846   3.283   -12.379 1.00 16.66 ? 99   ASP B C   1 
ATOM   1862 O  O   . ASP B 2 99  ? 2.059   3.289   -12.165 1.00 16.59 ? 99   ASP B O   1 
ATOM   1863 C  CB  . ASP B 2 99  ? 0.120   1.001   -13.063 0.58 15.85 ? 99   ASP B CB  1 
ATOM   1864 C  CG  . ASP B 2 99  ? -0.978  0.811   -12.032 0.58 15.22 ? 99   ASP B CG  1 
ATOM   1865 O  OD1 . ASP B 2 99  ? -2.111  0.464   -12.436 0.58 15.27 ? 99   ASP B OD1 1 
ATOM   1866 O  OD2 . ASP B 2 99  ? -0.721  1.039   -10.842 0.58 14.47 ? 99   ASP B OD2 1 
ATOM   1867 N  N   . PRO B 2 100 ? 0.013   4.000   -11.637 1.00 16.88 ? 100  PRO B N   1 
ATOM   1868 C  CA  . PRO B 2 100 ? 0.631   4.789   -10.580 1.00 17.21 ? 100  PRO B CA  1 
ATOM   1869 C  C   . PRO B 2 100 ? 1.381   3.996   -9.502  1.00 17.25 ? 100  PRO B C   1 
ATOM   1870 O  O   . PRO B 2 100 ? 2.251   4.538   -8.843  1.00 17.44 ? 100  PRO B O   1 
ATOM   1871 C  CB  . PRO B 2 100 ? -0.534  5.629   -10.070 1.00 17.46 ? 100  PRO B CB  1 
ATOM   1872 C  CG  . PRO B 2 100 ? -1.717  4.757   -10.365 1.00 17.49 ? 100  PRO B CG  1 
ATOM   1873 C  CD  . PRO B 2 100 ? -1.438  4.235   -11.716 1.00 17.02 ? 100  PRO B CD  1 
ATOM   1874 N  N   . ASP B 2 101 ? 1.075   2.716   -9.333  1.00 16.93 ? 101  ASP B N   1 
ATOM   1875 C  CA  . ASP B 2 101 ? 1.809   1.931   -8.355  1.00 17.06 ? 101  ASP B CA  1 
ATOM   1876 C  C   . ASP B 2 101 ? 3.309   1.741   -8.756  1.00 16.59 ? 101  ASP B C   1 
ATOM   1877 O  O   . ASP B 2 101 ? 4.211   1.539   -7.917  1.00 16.35 ? 101  ASP B O   1 
ATOM   1878 C  CB  . ASP B 2 101 ? 1.153   0.571   -8.251  1.00 17.89 ? 101  ASP B CB  1 
ATOM   1879 C  CG  . ASP B 2 101 ? 1.803   -0.273  -7.212  1.00 19.18 ? 101  ASP B CG  1 
ATOM   1880 O  OD1 . ASP B 2 101 ? 1.750   0.103   -6.018  1.00 20.49 ? 101  ASP B OD1 1 
ATOM   1881 O  OD2 . ASP B 2 101 ? 2.393   -1.301  -7.569  1.00 19.55 ? 101  ASP B OD2 1 
ATOM   1882 N  N   . ASN B 2 102 ? 3.578   1.827   -10.060 1.00 16.26 ? 102  ASN B N   1 
ATOM   1883 C  CA  . ASN B 2 102 ? 4.932   1.626   -10.566 1.00 16.18 ? 102  ASN B CA  1 
ATOM   1884 C  C   . ASN B 2 102 ? 5.975   2.611   -10.047 1.00 15.58 ? 102  ASN B C   1 
ATOM   1885 O  O   . ASN B 2 102 ? 7.140   2.255   -9.970  1.00 15.06 ? 102  ASN B O   1 
ATOM   1886 C  CB  . ASN B 2 102 ? 4.968   1.703   -12.091 1.00 16.94 ? 102  ASN B CB  1 
ATOM   1887 C  CG  . ASN B 2 102 ? 4.205   0.587   -12.762 1.00 17.97 ? 102  ASN B CG  1 
ATOM   1888 O  OD1 . ASN B 2 102 ? 3.716   -0.373  -12.118 1.00 18.44 ? 102  ASN B OD1 1 
ATOM   1889 N  ND2 . ASN B 2 102 ? 4.088   0.705   -14.082 1.00 18.44 ? 102  ASN B ND2 1 
ATOM   1890 N  N   . PHE B 2 103 ? 5.571   3.841   -9.724  1.00 15.33 ? 103  PHE B N   1 
ATOM   1891 C  CA  . PHE B 2 103 ? 6.558   4.842   -9.241  1.00 15.14 ? 103  PHE B CA  1 
ATOM   1892 C  C   . PHE B 2 103 ? 7.165   4.430   -7.904  1.00 15.09 ? 103  PHE B C   1 
ATOM   1893 O  O   . PHE B 2 103 ? 8.344   4.634   -7.680  1.00 14.70 ? 103  PHE B O   1 
ATOM   1894 C  CB  . PHE B 2 103 ? 5.919   6.224   -9.135  1.00 14.98 ? 103  PHE B CB  1 
ATOM   1895 C  CG  . PHE B 2 103 ? 5.412   6.716   -10.436 1.00 15.56 ? 103  PHE B CG  1 
ATOM   1896 C  CD1 . PHE B 2 103 ? 6.306   7.020   -11.476 1.00 16.24 ? 103  PHE B CD1 1 
ATOM   1897 C  CD2 . PHE B 2 103 ? 4.042   6.775   -10.671 1.00 16.09 ? 103  PHE B CD2 1 
ATOM   1898 C  CE1 . PHE B 2 103 ? 5.840   7.377   -12.761 1.00 16.49 ? 103  PHE B CE1 1 
ATOM   1899 C  CE2 . PHE B 2 103 ? 3.537   7.117   -11.920 1.00 16.61 ? 103  PHE B CE2 1 
ATOM   1900 C  CZ  . PHE B 2 103 ? 4.448   7.422   -12.985 1.00 16.74 ? 103  PHE B CZ  1 
ATOM   1901 N  N   . LYS B 2 104 ? 6.355   3.834   -7.032  1.00 15.27 ? 104  LYS B N   1 
ATOM   1902 C  CA  . LYS B 2 104 ? 6.851   3.386   -5.738  1.00 15.73 ? 104  LYS B CA  1 
ATOM   1903 C  C   . LYS B 2 104 ? 7.800   2.186   -5.937  1.00 15.35 ? 104  LYS B C   1 
ATOM   1904 O  O   . LYS B 2 104 ? 8.849   2.102   -5.291  1.00 15.28 ? 104  LYS B O   1 
ATOM   1905 C  CB  . LYS B 2 104 ? 5.669   2.992   -4.838  1.00 17.31 ? 104  LYS B CB  1 
ATOM   1906 C  CG  . LYS B 2 104 ? 6.069   2.459   -3.471  1.00 19.77 ? 104  LYS B CG  1 
ATOM   1907 C  CD  . LYS B 2 104 ? 7.366   3.159   -2.887  1.00 21.88 ? 104  LYS B CD  1 
ATOM   1908 C  CE  . LYS B 2 104 ? 7.748   2.538   -1.520  1.00 23.23 ? 104  LYS B CE  1 
ATOM   1909 N  NZ  . LYS B 2 104 ? 6.469   1.762   -1.055  1.00 24.35 ? 104  LYS B NZ  1 
ATOM   1910 N  N   . LEU B 2 105 ? 7.431   1.256   -6.824  1.00 14.69 ? 105  LEU B N   1 
ATOM   1911 C  CA  . LEU B 2 105 ? 8.288   0.098   -7.079  1.00 14.01 ? 105  LEU B CA  1 
ATOM   1912 C  C   . LEU B 2 105 ? 9.644   0.604   -7.568  1.00 13.62 ? 105  LEU B C   1 
ATOM   1913 O  O   . LEU B 2 105 ? 10.684  0.192   -7.088  1.00 13.25 ? 105  LEU B O   1 
ATOM   1914 C  CB  . LEU B 2 105 ? 7.640   -0.795  -8.150  1.00 14.34 ? 105  LEU B CB  1 
ATOM   1915 C  CG  . LEU B 2 105 ? 6.209   -1.270  -7.832  1.00 14.89 ? 105  LEU B CG  1 
ATOM   1916 C  CD1 . LEU B 2 105 ? 5.678   -2.146  -8.946  1.00 14.73 ? 105  LEU B CD1 1 
ATOM   1917 C  CD2 . LEU B 2 105 ? 6.208   -2.008  -6.473  1.00 15.24 ? 105  LEU B CD2 1 
ATOM   1918 N  N   . LEU B 2 106 ? 9.638   1.516   -8.531  1.00 13.40 ? 106  LEU B N   1 
ATOM   1919 C  CA  . LEU B 2 106 ? 10.904  2.033   -9.071  1.00 13.42 ? 106  LEU B CA  1 
ATOM   1920 C  C   . LEU B 2 106 ? 11.701  2.775   -7.998  1.00 13.03 ? 106  LEU B C   1 
ATOM   1921 O  O   . LEU B 2 106 ? 12.935  2.636   -7.948  1.00 12.98 ? 106  LEU B O   1 
ATOM   1922 C  CB  . LEU B 2 106 ? 10.645  2.980   -10.277 1.00 13.68 ? 106  LEU B CB  1 
ATOM   1923 C  CG  . LEU B 2 106 ? 11.882  3.681   -10.813 1.00 14.41 ? 106  LEU B CG  1 
ATOM   1924 C  CD1 . LEU B 2 106 ? 12.978  2.640   -11.204 1.00 14.11 ? 106  LEU B CD1 1 
ATOM   1925 C  CD2 . LEU B 2 106 ? 11.458  4.578   -12.018 1.00 14.49 ? 106  LEU B CD2 1 
ATOM   1926 N  N   . SER B 2 107 ? 11.002  3.549   -7.159  1.00 12.71 ? 107  SER B N   1 
ATOM   1927 C  CA  . SER B 2 107 ? 11.659  4.317   -6.089  1.00 12.88 ? 107  SER B CA  1 
ATOM   1928 C  C   A SER B 2 107 ? 12.413  3.360   -5.143  1.00 12.60 ? 107  SER B C   1 
ATOM   1929 O  O   B SER B 2 107 ? 13.558  3.619   -4.798  1.00 12.61 ? 107  SER B O   1 
ATOM   1930 C  CB  A SER B 2 107 ? 10.578  5.103   -5.335  0.46 12.88 ? 107  SER B CB  1 
ATOM   1931 C  CB  B SER B 2 107 ? 10.674  5.224   -5.332  0.54 12.85 ? 107  SER B CB  1 
ATOM   1932 O  OG  A SER B 2 107 ? 11.035  5.574   -4.097  0.46 13.25 ? 107  SER B OG  1 
ATOM   1933 O  OG  B SER B 2 107 ? 9.806   4.489   -4.521  0.54 13.12 ? 107  SER B OG  1 
ATOM   1934 N  N   . ASP B 2 108 ? 11.803  2.234   -4.773  1.00 12.57 ? 108  ASP B N   1 
ATOM   1935 C  CA  . ASP B 2 108 ? 12.494  1.239   -3.931  1.00 12.68 ? 108  ASP B CA  1 
ATOM   1936 C  C   . ASP B 2 108 ? 13.740  0.685   -4.628  1.00 11.88 ? 108  ASP B C   1 
ATOM   1937 O  O   . ASP B 2 108 ? 14.736  0.398   -3.966  1.00 11.80 ? 108  ASP B O   1 
ATOM   1938 C  CB  . ASP B 2 108 ? 11.569  0.078   -3.569  1.00 13.87 ? 108  ASP B CB  1 
ATOM   1939 C  CG  . ASP B 2 108 ? 10.616  0.450   -2.481  1.00 15.27 ? 108  ASP B CG  1 
ATOM   1940 O  OD1 . ASP B 2 108 ? 10.768  1.571   -1.917  1.00 16.04 ? 108  ASP B OD1 1 
ATOM   1941 O  OD2 . ASP B 2 108 ? 9.721   -0.374  -2.183  1.00 16.78 ? 108  ASP B OD2 1 
ATOM   1942 N  N   . CYS B 2 109 ? 13.682  0.528   -5.954  1.00 11.58 ? 109  CYS B N   1 
ATOM   1943 C  CA  . CYS B 2 109 ? 14.845  0.012   -6.720  1.00 11.48 ? 109  CYS B CA  1 
ATOM   1944 C  C   . CYS B 2 109 ? 15.974  1.055   -6.780  1.00 11.52 ? 109  CYS B C   1 
ATOM   1945 O  O   . CYS B 2 109 ? 17.160  0.684   -6.688  1.00 11.67 ? 109  CYS B O   1 
ATOM   1946 C  CB  . CYS B 2 109 ? 14.434  -0.437  -8.123  1.00 11.59 ? 109  CYS B CB  1 
ATOM   1947 S  SG  . CYS B 2 109 ? 13.426  -1.934  -8.075  1.00 12.36 ? 109  CYS B SG  1 
ATOM   1948 N  N   . ILE B 2 110 ? 15.600  2.340   -6.906  1.00 11.31 ? 110  ILE B N   1 
ATOM   1949 C  CA  . ILE B 2 110 ? 16.598  3.413   -6.893  1.00 11.42 ? 110  ILE B CA  1 
ATOM   1950 C  C   . ILE B 2 110 ? 17.307  3.395   -5.509  1.00 11.32 ? 110  ILE B C   1 
ATOM   1951 O  O   . ILE B 2 110 ? 18.518  3.434   -5.419  1.00 11.25 ? 110  ILE B O   1 
ATOM   1952 C  CB  . ILE B 2 110 ? 15.972  4.820   -7.112  1.00 11.57 ? 110  ILE B CB  1 
ATOM   1953 C  CG1 . ILE B 2 110 ? 15.341  4.941   -8.508  1.00 11.80 ? 110  ILE B CG1 1 
ATOM   1954 C  CG2 . ILE B 2 110 ? 17.065  5.924   -7.038  1.00 11.90 ? 110  ILE B CG2 1 
ATOM   1955 C  CD1 . ILE B 2 110 ? 14.638  6.278   -8.707  1.00 11.55 ? 110  ILE B CD1 1 
ATOM   1956 N  N   . THR B 2 111 ? 16.539  3.325   -4.440  1.00 11.37 ? 111  THR B N   1 
ATOM   1957 C  CA  . THR B 2 111 ? 17.102  3.292   -3.102  1.00 11.56 ? 111  THR B CA  1 
ATOM   1958 C  C   . THR B 2 111 ? 18.037  2.109   -2.926  1.00 11.51 ? 111  THR B C   1 
ATOM   1959 O  O   . THR B 2 111 ? 19.120  2.252   -2.374  1.00 11.77 ? 111  THR B O   1 
ATOM   1960 C  CB  . THR B 2 111 ? 15.947  3.221   -2.069  1.00 11.89 ? 111  THR B CB  1 
ATOM   1961 O  OG1 . THR B 2 111 ? 15.208  4.434   -2.150  1.00 11.94 ? 111  THR B OG1 1 
ATOM   1962 C  CG2 . THR B 2 111 ? 16.453  3.002   -0.636  1.00 12.27 ? 111  THR B CG2 1 
ATOM   1963 N  N   . ILE B 2 112 ? 17.627  0.946   -3.412  1.00 11.46 ? 112  ILE B N   1 
ATOM   1964 C  CA  . ILE B 2 112 ? 18.439  -0.258  -3.257  1.00 11.77 ? 112  ILE B CA  1 
ATOM   1965 C  C   . ILE B 2 112 ? 19.729  -0.182  -4.067  1.00 12.22 ? 112  ILE B C   1 
ATOM   1966 O  O   . ILE B 2 112 ? 20.779  -0.607  -3.583  1.00 12.25 ? 112  ILE B O   1 
ATOM   1967 C  CB  . ILE B 2 112 ? 17.549  -1.556  -3.545  1.00 11.67 ? 112  ILE B CB  1 
ATOM   1968 C  CG1 . ILE B 2 112 ? 16.621  -1.784  -2.315  1.00 11.95 ? 112  ILE B CG1 1 
ATOM   1969 C  CG2 . ILE B 2 112 ? 18.385  -2.808  -3.765  1.00 11.43 ? 112  ILE B CG2 1 
ATOM   1970 C  CD1 . ILE B 2 112 ? 15.405  -2.729  -2.552  1.00 11.82 ? 112  ILE B CD1 1 
ATOM   1971 N  N   . VAL B 2 113 ? 19.677  0.393   -5.265  1.00 12.54 ? 113  VAL B N   1 
ATOM   1972 C  CA  . VAL B 2 113 ? 20.890  0.503   -6.084  1.00 13.32 ? 113  VAL B CA  1 
ATOM   1973 C  C   . VAL B 2 113 ? 21.822  1.542   -5.438  1.00 13.73 ? 113  VAL B C   1 
ATOM   1974 O  O   . VAL B 2 113 ? 23.029  1.338   -5.384  1.00 14.29 ? 113  VAL B O   1 
ATOM   1975 C  CB  . VAL B 2 113 ? 20.531  0.897   -7.561  1.00 13.12 ? 113  VAL B CB  1 
ATOM   1976 C  CG1 . VAL B 2 113 ? 21.774  1.407   -8.288  1.00 13.71 ? 113  VAL B CG1 1 
ATOM   1977 C  CG2 . VAL B 2 113 ? 19.932  -0.304  -8.270  1.00 12.86 ? 113  VAL B CG2 1 
ATOM   1978 N  N   . LEU B 2 114 ? 21.260  2.636   -4.932  1.00 13.93 ? 114  LEU B N   1 
ATOM   1979 C  CA  . LEU B 2 114 ? 22.066  3.647   -4.260  1.00 14.50 ? 114  LEU B CA  1 
ATOM   1980 C  C   . LEU B 2 114 ? 22.755  3.046   -3.019  1.00 14.43 ? 114  LEU B C   1 
ATOM   1981 O  O   . LEU B 2 114 ? 23.907  3.331   -2.725  1.00 14.73 ? 114  LEU B O   1 
ATOM   1982 C  CB  . LEU B 2 114 ? 21.181  4.824   -3.780  1.00 14.87 ? 114  LEU B CB  1 
ATOM   1983 C  CG  . LEU B 2 114 ? 21.974  6.001   -3.178  1.00 15.49 ? 114  LEU B CG  1 
ATOM   1984 C  CD1 . LEU B 2 114 ? 23.094  6.480   -4.142  1.00 15.12 ? 114  LEU B CD1 1 
ATOM   1985 C  CD2 . LEU B 2 114 ? 20.959  7.121   -2.802  1.00 15.38 ? 114  LEU B CD2 1 
ATOM   1986 N  N   . ALA B 2 115 ? 22.001  2.254   -2.265  1.00 14.18 ? 115  ALA B N   1 
ATOM   1987 C  CA  . ALA B 2 115 ? 22.513  1.602   -1.056  1.00 14.31 ? 115  ALA B CA  1 
ATOM   1988 C  C   . ALA B 2 115 ? 23.739  0.750   -1.453  1.00 14.43 ? 115  ALA B C   1 
ATOM   1989 O  O   . ALA B 2 115 ? 24.749  0.745   -0.728  1.00 14.60 ? 115  ALA B O   1 
ATOM   1990 C  CB  . ALA B 2 115 ? 21.390  0.699   -0.425  1.00 13.69 ? 115  ALA B CB  1 
ATOM   1991 N  N   . ALA B 2 116 ? 23.643  0.048   -2.602  1.00 14.73 ? 116  ALA B N   1 
ATOM   1992 C  CA  . ALA B 2 116 ? 24.732  -0.807  -3.073  1.00 15.41 ? 116  ALA B CA  1 
ATOM   1993 C  C   . ALA B 2 116 ? 25.965  0.023   -3.430  1.00 16.02 ? 116  ALA B C   1 
ATOM   1994 O  O   . ALA B 2 116 ? 27.090  -0.404  -3.160  1.00 16.24 ? 116  ALA B O   1 
ATOM   1995 C  CB  . ALA B 2 116 ? 24.279  -1.663  -4.275  1.00 15.13 ? 116  ALA B CB  1 
ATOM   1996 N  N   . LYS B 2 117 ? 25.748  1.198   -4.024  1.00 16.76 ? 117  LYS B N   1 
ATOM   1997 C  CA  . LYS B 2 117 ? 26.846  2.090   -4.430  1.00 17.93 ? 117  LYS B CA  1 
ATOM   1998 C  C   . LYS B 2 117 ? 27.473  2.714   -3.203  1.00 18.19 ? 117  LYS B C   1 
ATOM   1999 O  O   . LYS B 2 117 ? 28.708  2.677   -3.044  1.00 18.48 ? 117  LYS B O   1 
ATOM   2000 C  CB  . LYS B 2 117 ? 26.331  3.213   -5.354  1.00 18.79 ? 117  LYS B CB  1 
ATOM   2001 C  CG  . LYS B 2 117 ? 27.304  4.433   -5.585  1.00 20.71 ? 117  LYS B CG  1 
ATOM   2002 C  CD  . LYS B 2 117 ? 26.675  5.781   -4.964  1.00 22.50 ? 117  LYS B CD  1 
ATOM   2003 C  CE  . LYS B 2 117 ? 27.455  7.146   -5.150  1.00 22.78 ? 117  LYS B CE  1 
ATOM   2004 N  NZ  . LYS B 2 117 ? 28.618  7.329   -4.187  1.00 23.53 ? 117  LYS B NZ  1 
ATOM   2005 N  N   . MET B 2 118 ? 26.643  3.286   -2.337  1.00 18.19 ? 118  MET B N   1 
ATOM   2006 C  CA  . MET B 2 118 ? 27.142  3.950   -1.151  1.00 18.41 ? 118  MET B CA  1 
ATOM   2007 C  C   . MET B 2 118 ? 27.608  3.054   -0.034  1.00 18.72 ? 118  MET B C   1 
ATOM   2008 O  O   . MET B 2 118 ? 28.361  3.491   0.827   1.00 18.81 ? 118  MET B O   1 
ATOM   2009 C  CB  . MET B 2 118 ? 26.089  4.901   -0.626  1.00 18.55 ? 118  MET B CB  1 
ATOM   2010 C  CG  . MET B 2 118 ? 25.877  6.065   -1.537  1.00 18.79 ? 118  MET B CG  1 
ATOM   2011 S  SD  . MET B 2 118 ? 24.719  7.229   -0.903  1.00 20.35 ? 118  MET B SD  1 
ATOM   2012 C  CE  . MET B 2 118 ? 25.698  7.995   0.453   1.00 19.60 ? 118  MET B CE  1 
ATOM   2013 N  N   . GLY B 2 119 ? 27.183  1.803   -0.027  1.00 19.02 ? 119  GLY B N   1 
ATOM   2014 C  CA  . GLY B 2 119 ? 27.602  0.918   1.033   1.00 19.90 ? 119  GLY B CA  1 
ATOM   2015 C  C   . GLY B 2 119 ? 27.324  1.459   2.434   1.00 20.79 ? 119  GLY B C   1 
ATOM   2016 O  O   . GLY B 2 119 ? 26.241  1.977   2.728   1.00 20.50 ? 119  GLY B O   1 
ATOM   2017 N  N   . HIS B 2 120 ? 28.306  1.381   3.332   1.00 21.65 ? 120  HIS B N   1 
ATOM   2018 C  CA  . HIS B 2 120 ? 28.008  1.867   4.669   1.00 22.47 ? 120  HIS B CA  1 
ATOM   2019 C  C   . HIS B 2 120 ? 27.777  3.349   4.860   1.00 21.82 ? 120  HIS B C   1 
ATOM   2020 O  O   . HIS B 2 120 ? 27.257  3.748   5.890   1.00 22.09 ? 120  HIS B O   1 
ATOM   2021 C  CB  . HIS B 2 120 ? 29.008  1.285   5.633   1.00 24.50 ? 120  HIS B CB  1 
ATOM   2022 C  CG  . HIS B 2 120 ? 28.771  -0.182  5.833   1.00 26.58 ? 120  HIS B CG  1 
ATOM   2023 N  ND1 . HIS B 2 120 ? 27.567  -0.670  6.311   1.00 27.25 ? 120  HIS B ND1 1 
ATOM   2024 C  CD2 . HIS B 2 120 ? 29.505  -1.265  5.478   1.00 27.29 ? 120  HIS B CD2 1 
ATOM   2025 C  CE1 . HIS B 2 120 ? 27.571  -1.986  6.236   1.00 27.84 ? 120  HIS B CE1 1 
ATOM   2026 N  NE2 . HIS B 2 120 ? 28.734  -2.373  5.732   1.00 28.36 ? 120  HIS B NE2 1 
ATOM   2027 N  N   . ALA B 2 121 ? 28.100  4.137   3.838   1.00 20.78 ? 121  ALA B N   1 
ATOM   2028 C  CA  . ALA B 2 121 ? 27.844  5.562   3.869   1.00 20.00 ? 121  ALA B CA  1 
ATOM   2029 C  C   . ALA B 2 121 ? 26.326  5.781   3.742   1.00 19.32 ? 121  ALA B C   1 
ATOM   2030 O  O   . ALA B 2 121 ? 25.845  6.876   3.998   1.00 19.33 ? 121  ALA B O   1 
ATOM   2031 C  CB  . ALA B 2 121 ? 28.547  6.256   2.731   1.00 19.88 ? 121  ALA B CB  1 
ATOM   2032 N  N   . PHE B 2 122 ? 25.571  4.759   3.314   1.00 18.60 ? 122  PHE B N   1 
ATOM   2033 C  CA  . PHE B 2 122 ? 24.102  4.893   3.216   1.00 17.47 ? 122  PHE B CA  1 
ATOM   2034 C  C   . PHE B 2 122 ? 23.514  4.606   4.605   1.00 17.18 ? 122  PHE B C   1 
ATOM   2035 O  O   . PHE B 2 122 ? 22.842  3.591   4.849   1.00 16.95 ? 122  PHE B O   1 
ATOM   2036 C  CB  . PHE B 2 122 ? 23.527  3.905   2.196   1.00 16.85 ? 122  PHE B CB  1 
ATOM   2037 C  CG  . PHE B 2 122 ? 22.127  4.247   1.756   1.00 15.81 ? 122  PHE B CG  1 
ATOM   2038 C  CD1 . PHE B 2 122 ? 21.882  5.419   1.030   1.00 15.54 ? 122  PHE B CD1 1 
ATOM   2039 C  CD2 . PHE B 2 122 ? 21.067  3.409   2.040   1.00 15.39 ? 122  PHE B CD2 1 
ATOM   2040 C  CE1 . PHE B 2 122 ? 20.589  5.743   0.586   1.00 15.27 ? 122  PHE B CE1 1 
ATOM   2041 C  CE2 . PHE B 2 122 ? 19.758  3.733   1.599   1.00 15.25 ? 122  PHE B CE2 1 
ATOM   2042 C  CZ  . PHE B 2 122 ? 19.522  4.894   0.873   1.00 14.98 ? 122  PHE B CZ  1 
ATOM   2043 N  N   . THR B 2 123 ? 23.775  5.512   5.530   1.00 16.94 ? 123  THR B N   1 
ATOM   2044 C  CA  . THR B 2 123 ? 23.331  5.326   6.886   1.00 16.95 ? 123  THR B CA  1 
ATOM   2045 C  C   . THR B 2 123 ? 21.821  5.406   7.001   1.00 16.83 ? 123  THR B C   1 
ATOM   2046 O  O   . THR B 2 123 ? 21.150  5.779   6.050   1.00 16.51 ? 123  THR B O   1 
ATOM   2047 C  CB  . THR B 2 123 ? 23.979  6.408   7.773   1.00 17.36 ? 123  THR B CB  1 
ATOM   2048 O  OG1 . THR B 2 123 ? 23.471  7.693   7.400   1.00 17.27 ? 123  THR B OG1 1 
ATOM   2049 C  CG2 . THR B 2 123 ? 25.478  6.412   7.574   1.00 17.16 ? 123  THR B CG2 1 
ATOM   2050 N  N   . ALA B 2 124 ? 21.286  5.067   8.170   1.00 16.70 ? 124  ALA B N   1 
ATOM   2051 C  CA  . ALA B 2 124 ? 19.851  5.155   8.390   1.00 16.84 ? 124  ALA B CA  1 
ATOM   2052 C  C   . ALA B 2 124 ? 19.364  6.592   8.116   1.00 17.18 ? 124  ALA B C   1 
ATOM   2053 O  O   . ALA B 2 124 ? 18.348  6.800   7.473   1.00 16.88 ? 124  ALA B O   1 
ATOM   2054 C  CB  . ALA B 2 124 ? 19.509  4.785   9.824   1.00 16.85 ? 124  ALA B CB  1 
ATOM   2055 N  N   . GLU B 2 125 ? 20.105  7.581   8.597   1.00 17.42 ? 125  GLU B N   1 
ATOM   2056 C  CA  . GLU B 2 125 ? 19.688  8.956   8.435   1.00 17.84 ? 125  GLU B CA  1 
ATOM   2057 C  C   . GLU B 2 125 ? 19.668  9.325   6.978   1.00 16.96 ? 125  GLU B C   1 
ATOM   2058 O  O   . GLU B 2 125 ? 18.831  10.103  6.533   1.00 16.77 ? 125  GLU B O   1 
ATOM   2059 C  CB  . GLU B 2 125 ? 20.644  9.855   9.188   1.00 19.21 ? 125  GLU B CB  1 
ATOM   2060 C  CG  . GLU B 2 125 ? 20.286  11.288  9.025   1.00 22.50 ? 125  GLU B CG  1 
ATOM   2061 C  CD  . GLU B 2 125 ? 21.050  12.196  10.005  1.00 24.55 ? 125  GLU B CD  1 
ATOM   2062 O  OE1 . GLU B 2 125 ? 22.161  11.752  10.458  1.00 25.13 ? 125  GLU B OE1 1 
ATOM   2063 O  OE2 . GLU B 2 125 ? 20.545  13.341  10.300  1.00 26.00 ? 125  GLU B OE2 1 
ATOM   2064 N  N   . THR B 2 126 ? 20.615  8.777   6.237   1.00 16.27 ? 126  THR B N   1 
ATOM   2065 C  CA  . THR B 2 126 ? 20.702  9.026   4.814   1.00 15.93 ? 126  THR B CA  1 
ATOM   2066 C  C   . THR B 2 126 ? 19.536  8.396   4.063   1.00 15.39 ? 126  THR B C   1 
ATOM   2067 O  O   . THR B 2 126 ? 18.895  9.010   3.165   1.00 15.40 ? 126  THR B O   1 
ATOM   2068 C  CB  . THR B 2 126 ? 22.006  8.471   4.245   1.00 16.48 ? 126  THR B CB  1 
ATOM   2069 O  OG1 . THR B 2 126 ? 23.090  9.120   4.921   1.00 17.51 ? 126  THR B OG1 1 
ATOM   2070 C  CG2 . THR B 2 126 ? 22.129  8.768   2.696   1.00 16.77 ? 126  THR B CG2 1 
ATOM   2071 N  N   . GLN B 2 127 ? 19.269  7.148   4.418   1.00 14.68 ? 127  GLN B N   1 
ATOM   2072 C  CA  . GLN B 2 127 ? 18.169  6.429   3.807   1.00 14.16 ? 127  GLN B CA  1 
ATOM   2073 C  C   . GLN B 2 127 ? 16.857  7.182   4.099   1.00 14.01 ? 127  GLN B C   1 
ATOM   2074 O  O   . GLN B 2 127 ? 16.026  7.313   3.220   1.00 14.00 ? 127  GLN B O   1 
ATOM   2075 C  CB  . GLN B 2 127 ? 18.076  4.999   4.371   1.00 13.66 ? 127  GLN B CB  1 
ATOM   2076 C  CG  . GLN B 2 127 ? 16.820  4.301   3.930   1.00 14.13 ? 127  GLN B CG  1 
ATOM   2077 C  CD  . GLN B 2 127 ? 16.660  2.965   4.620   1.00 14.57 ? 127  GLN B CD  1 
ATOM   2078 O  OE1 . GLN B 2 127 ? 17.479  2.624   5.472   1.00 15.30 ? 127  GLN B OE1 1 
ATOM   2079 N  NE2 . GLN B 2 127 ? 15.600  2.214   4.282   1.00 14.40 ? 127  GLN B NE2 1 
ATOM   2080 N  N   . GLY B 2 128 ? 16.658  7.625   5.348   1.00 14.04 ? 128  GLY B N   1 
ATOM   2081 C  CA  . GLY B 2 128 ? 15.448  8.362   5.690   1.00 13.46 ? 128  GLY B CA  1 
ATOM   2082 C  C   . GLY B 2 128 ? 15.237  9.635   4.861   1.00 13.22 ? 128  GLY B C   1 
ATOM   2083 O  O   . GLY B 2 128 ? 14.125  9.891   4.359   1.00 13.53 ? 128  GLY B O   1 
ATOM   2084 N  N   . ALA B 2 129 ? 16.278  10.437  4.693   1.00 12.76 ? 129  ALA B N   1 
ATOM   2085 C  CA  . ALA B 2 129 ? 16.134  11.669  3.926   1.00 12.77 ? 129  ALA B CA  1 
ATOM   2086 C  C   . ALA B 2 129 ? 15.879  11.336  2.438   1.00 12.74 ? 129  ALA B C   1 
ATOM   2087 O  O   . ALA B 2 129 ? 15.000  11.941  1.787   1.00 12.57 ? 129  ALA B O   1 
ATOM   2088 C  CB  . ALA B 2 129 ? 17.405  12.563  4.085   1.00 12.50 ? 129  ALA B CB  1 
ATOM   2089 N  N   . PHE B 2 130 ? 16.645  10.364  1.922   1.00 12.47 ? 130  PHE B N   1 
ATOM   2090 C  CA  . PHE B 2 130 ? 16.503  9.994   0.522   1.00 12.19 ? 130  PHE B CA  1 
ATOM   2091 C  C   . PHE B 2 130 ? 15.126  9.428   0.235   1.00 12.00 ? 130  PHE B C   1 
ATOM   2092 O  O   . PHE B 2 130 ? 14.474  9.839   -0.697  1.00 12.12 ? 130  PHE B O   1 
ATOM   2093 C  CB  . PHE B 2 130 ? 17.597  8.993   0.142   1.00 12.47 ? 130  PHE B CB  1 
ATOM   2094 C  CG  . PHE B 2 130 ? 17.651  8.694   -1.328  1.00 12.43 ? 130  PHE B CG  1 
ATOM   2095 C  CD1 . PHE B 2 130 ? 17.239  7.450   -1.824  1.00 12.92 ? 130  PHE B CD1 1 
ATOM   2096 C  CD2 . PHE B 2 130 ? 18.099  9.648   -2.226  1.00 12.76 ? 130  PHE B CD2 1 
ATOM   2097 C  CE1 . PHE B 2 130 ? 17.262  7.147   -3.198  1.00 12.50 ? 130  PHE B CE1 1 
ATOM   2098 C  CE2 . PHE B 2 130 ? 18.130  9.368   -3.610  1.00 13.15 ? 130  PHE B CE2 1 
ATOM   2099 C  CZ  . PHE B 2 130 ? 17.705  8.098   -4.096  1.00 13.22 ? 130  PHE B CZ  1 
ATOM   2100 N  N   . GLN B 2 131 ? 14.672  8.483   1.051   1.00 11.73 ? 131  GLN B N   1 
ATOM   2101 C  CA  . GLN B 2 131 ? 13.365  7.916   0.824   1.00 11.36 ? 131  GLN B CA  1 
ATOM   2102 C  C   . GLN B 2 131 ? 12.292  8.966   0.982   1.00 11.84 ? 131  GLN B C   1 
ATOM   2103 O  O   . GLN B 2 131 ? 11.280  8.893   0.293   1.00 12.10 ? 131  GLN B O   1 
ATOM   2104 C  CB  . GLN B 2 131 ? 13.069  6.757   1.799   0.65 10.16 ? 131  GLN B CB  1 
ATOM   2105 C  CG  . GLN B 2 131 ? 13.853  5.495   1.485   0.65 9.11  ? 131  GLN B CG  1 
ATOM   2106 C  CD  . GLN B 2 131 ? 13.502  4.259   2.350   0.65 8.46  ? 131  GLN B CD  1 
ATOM   2107 O  OE1 . GLN B 2 131 ? 14.119  3.221   2.179   0.65 8.25  ? 131  GLN B OE1 1 
ATOM   2108 N  NE2 . GLN B 2 131 ? 12.533  4.370   3.238   0.65 8.05  ? 131  GLN B NE2 1 
ATOM   2109 N  N   . LYS B 2 132 ? 12.462  9.911   1.910   1.00 12.09 ? 132  LYS B N   1 
ATOM   2110 C  CA  . LYS B 2 132 ? 11.404  10.927  2.093   1.00 12.59 ? 132  LYS B CA  1 
ATOM   2111 C  C   . LYS B 2 132 ? 11.281  11.782  0.837   1.00 12.51 ? 132  LYS B C   1 
ATOM   2112 O  O   . LYS B 2 132 ? 10.173  12.051  0.397   1.00 12.45 ? 132  LYS B O   1 
ATOM   2113 C  CB  A LYS B 2 132 ? 11.668  11.802  3.312   0.47 12.84 ? 132  LYS B CB  1 
ATOM   2114 C  CB  B LYS B 2 132 ? 11.718  11.818  3.315   0.53 12.76 ? 132  LYS B CB  1 
ATOM   2115 C  CG  A LYS B 2 132 ? 10.473  12.650  3.649   0.47 13.30 ? 132  LYS B CG  1 
ATOM   2116 C  CG  B LYS B 2 132 ? 10.743  12.975  3.540   0.53 13.15 ? 132  LYS B CG  1 
ATOM   2117 C  CD  A LYS B 2 132 ? 10.699  13.336  4.946   0.47 13.72 ? 132  LYS B CD  1 
ATOM   2118 C  CD  B LYS B 2 132 ? 11.093  13.761  4.805   0.53 13.33 ? 132  LYS B CD  1 
ATOM   2119 C  CE  A LYS B 2 132 ? 10.407  14.773  4.800   0.47 13.91 ? 132  LYS B CE  1 
ATOM   2120 C  CE  B LYS B 2 132 ? 10.971  12.891  6.057   0.53 13.69 ? 132  LYS B CE  1 
ATOM   2121 N  NZ  A LYS B 2 132 ? 10.748  15.493  6.035   0.47 14.64 ? 132  LYS B NZ  1 
ATOM   2122 N  NZ  B LYS B 2 132 ? 11.185  13.693  7.299   0.53 13.95 ? 132  LYS B NZ  1 
ATOM   2123 N  N   . PHE B 2 133 ? 12.418  12.169  0.242   1.00 12.45 ? 133  PHE B N   1 
ATOM   2124 C  CA  . PHE B 2 133 ? 12.403  12.946  -1.000  1.00 12.62 ? 133  PHE B CA  1 
ATOM   2125 C  C   . PHE B 2 133 ? 11.729  12.083  -2.119  1.00 12.60 ? 133  PHE B C   1 
ATOM   2126 O  O   . PHE B 2 133 ? 10.882  12.565  -2.847  1.00 12.93 ? 133  PHE B O   1 
ATOM   2127 C  CB  . PHE B 2 133 ? 13.832  13.303  -1.391  1.00 12.64 ? 133  PHE B CB  1 
ATOM   2128 C  CG  . PHE B 2 133 ? 13.949  13.913  -2.761  1.00 13.17 ? 133  PHE B CG  1 
ATOM   2129 C  CD1 . PHE B 2 133 ? 13.510  15.212  -2.992  1.00 13.22 ? 133  PHE B CD1 1 
ATOM   2130 C  CD2 . PHE B 2 133 ? 14.442  13.159  -3.828  1.00 13.17 ? 133  PHE B CD2 1 
ATOM   2131 C  CE1 . PHE B 2 133 ? 13.548  15.770  -4.266  1.00 13.89 ? 133  PHE B CE1 1 
ATOM   2132 C  CE2 . PHE B 2 133 ? 14.484  13.682  -5.091  1.00 13.53 ? 133  PHE B CE2 1 
ATOM   2133 C  CZ  . PHE B 2 133 ? 14.038  15.008  -5.330  1.00 13.91 ? 133  PHE B CZ  1 
ATOM   2134 N  N   . LEU B 2 134 ? 12.091  10.808  -2.264  1.00 12.72 ? 134  LEU B N   1 
ATOM   2135 C  CA  . LEU B 2 134 ? 11.445  10.029  -3.331  1.00 12.84 ? 134  LEU B CA  1 
ATOM   2136 C  C   . LEU B 2 134 ? 9.964   9.889   -3.101  1.00 13.11 ? 134  LEU B C   1 
ATOM   2137 O  O   . LEU B 2 134 ? 9.205   9.909   -4.051  1.00 13.27 ? 134  LEU B O   1 
ATOM   2138 C  CB  . LEU B 2 134 ? 12.064  8.627   -3.483  1.00 12.69 ? 134  LEU B CB  1 
ATOM   2139 C  CG  . LEU B 2 134 ? 13.512  8.602   -4.010  1.00 12.81 ? 134  LEU B CG  1 
ATOM   2140 C  CD1 . LEU B 2 134 ? 13.975  7.191   -4.204  1.00 12.51 ? 134  LEU B CD1 1 
ATOM   2141 C  CD2 . LEU B 2 134 ? 13.614  9.380   -5.311  1.00 12.77 ? 134  LEU B CD2 1 
ATOM   2142 N  N   . ALA B 2 135 ? 9.543   9.765   -1.841  1.00 13.54 ? 135  ALA B N   1 
ATOM   2143 C  CA  . ALA B 2 135 ? 8.114   9.619   -1.514  1.00 14.02 ? 135  ALA B CA  1 
ATOM   2144 C  C   . ALA B 2 135 ? 7.302   10.826  -2.038  1.00 14.38 ? 135  ALA B C   1 
ATOM   2145 O  O   . ALA B 2 135 ? 6.211   10.687  -2.653  1.00 14.37 ? 135  ALA B O   1 
ATOM   2146 C  CB  . ALA B 2 135 ? 7.932   9.484   0.007   1.00 13.63 ? 135  ALA B CB  1 
ATOM   2147 N  N   . VAL B 2 136 ? 7.852   12.024  -1.797  1.00 14.54 ? 136  VAL B N   1 
ATOM   2148 C  CA  . VAL B 2 136 ? 7.188   13.236  -2.231  1.00 14.76 ? 136  VAL B CA  1 
ATOM   2149 C  C   . VAL B 2 136 ? 7.077   13.273  -3.765  1.00 15.27 ? 136  VAL B C   1 
ATOM   2150 O  O   . VAL B 2 136 ? 6.040   13.664  -4.309  1.00 15.67 ? 136  VAL B O   1 
ATOM   2151 C  CB  . VAL B 2 136 ? 7.960   14.472  -1.710  1.00 14.88 ? 136  VAL B CB  1 
ATOM   2152 C  CG1 . VAL B 2 136 ? 7.343   15.754  -2.291  1.00 14.66 ? 136  VAL B CG1 1 
ATOM   2153 C  CG2 . VAL B 2 136 ? 7.955   14.466  -0.149  1.00 13.98 ? 136  VAL B CG2 1 
ATOM   2154 N  N   . VAL B 2 137 ? 8.135   12.858  -4.465  1.00 15.32 ? 137  VAL B N   1 
ATOM   2155 C  CA  . VAL B 2 137 ? 8.126   12.842  -5.929  1.00 15.69 ? 137  VAL B CA  1 
ATOM   2156 C  C   . VAL B 2 137 ? 7.126   11.829  -6.448  1.00 15.82 ? 137  VAL B C   1 
ATOM   2157 O  O   . VAL B 2 137 ? 6.366   12.117  -7.386  1.00 16.05 ? 137  VAL B O   1 
ATOM   2158 C  CB  . VAL B 2 137 ? 9.570   12.539  -6.497  1.00 15.42 ? 137  VAL B CB  1 
ATOM   2159 C  CG1 . VAL B 2 137 ? 9.536   12.345  -8.018  1.00 15.56 ? 137  VAL B CG1 1 
ATOM   2160 C  CG2 . VAL B 2 137 ? 10.505  13.718  -6.145  1.00 15.48 ? 137  VAL B CG2 1 
ATOM   2161 N  N   . VAL B 2 138 ? 7.134   10.642  -5.828  1.00 16.32 ? 138  VAL B N   1 
ATOM   2162 C  CA  . VAL B 2 138 ? 6.230   9.514   -6.173  1.00 16.59 ? 138  VAL B CA  1 
ATOM   2163 C  C   . VAL B 2 138 ? 4.776   9.940   -5.991  1.00 17.03 ? 138  VAL B C   1 
ATOM   2164 O  O   . VAL B 2 138 ? 3.935   9.637   -6.833  1.00 17.37 ? 138  VAL B O   1 
ATOM   2165 C  CB  . VAL B 2 138 ? 6.541   8.262   -5.316  1.00 16.21 ? 138  VAL B CB  1 
ATOM   2166 C  CG1 . VAL B 2 138 ? 5.402   7.297   -5.359  1.00 16.36 ? 138  VAL B CG1 1 
ATOM   2167 C  CG2 . VAL B 2 138 ? 7.744   7.574   -5.864  1.00 16.11 ? 138  VAL B CG2 1 
ATOM   2168 N  N   . SER B 2 139 ? 4.483   10.667  -4.912  1.00 17.77 ? 139  SER B N   1 
ATOM   2169 C  CA  . SER B 2 139 ? 3.112   11.181  -4.671  1.00 18.48 ? 139  SER B CA  1 
ATOM   2170 C  C   A SER B 2 139 ? 2.680   12.122  -5.791  1.00 18.98 ? 139  SER B C   1 
ATOM   2171 O  O   B SER B 2 139 ? 1.532   12.051  -6.259  1.00 19.82 ? 139  SER B O   1 
ATOM   2172 C  CB  A SER B 2 139 ? 3.022   11.952  -3.351  0.50 18.77 ? 139  SER B CB  1 
ATOM   2173 C  CB  B SER B 2 139 ? 3.032   11.946  -3.347  0.50 18.07 ? 139  SER B CB  1 
ATOM   2174 O  OG  A SER B 2 139 ? 3.328   11.105  -2.266  0.50 19.79 ? 139  SER B OG  1 
ATOM   2175 O  OG  B SER B 2 139 ? 1.742   12.481  -3.166  0.50 17.08 ? 139  SER B OG  1 
ATOM   2176 N  N   . ALA B 2 140 ? 3.586   13.009  -6.209  1.00 19.37 ? 140  ALA B N   1 
ATOM   2177 C  CA  . ALA B 2 140 ? 3.275   13.979  -7.279  1.00 20.14 ? 140  ALA B CA  1 
ATOM   2178 C  C   . ALA B 2 140 ? 3.089   13.273  -8.653  1.00 20.66 ? 140  ALA B C   1 
ATOM   2179 O  O   . ALA B 2 140 ? 2.182   13.595  -9.436  1.00 21.48 ? 140  ALA B O   1 
ATOM   2180 C  CB  . ALA B 2 140 ? 4.383   15.049  -7.344  1.00 19.89 ? 140  ALA B CB  1 
ATOM   2181 N  N   . LEU B 2 141 ? 3.940   12.287  -8.943  1.00 20.79 ? 141  LEU B N   1 
ATOM   2182 C  CA  . LEU B 2 141 ? 3.833   11.555  -10.191 1.00 20.62 ? 141  LEU B CA  1 
ATOM   2183 C  C   . LEU B 2 141 ? 2.568   10.692  -10.241 1.00 21.34 ? 141  LEU B C   1 
ATOM   2184 O  O   . LEU B 2 141 ? 1.879   10.657  -11.249 1.00 21.28 ? 141  LEU B O   1 
ATOM   2185 C  CB  . LEU B 2 141 ? 5.095   10.679  -10.360 1.00 19.92 ? 141  LEU B CB  1 
ATOM   2186 C  CG  . LEU B 2 141 ? 6.372   11.445  -10.739 1.00 19.04 ? 141  LEU B CG  1 
ATOM   2187 C  CD1 . LEU B 2 141 ? 7.549   10.493  -10.775 1.00 18.37 ? 141  LEU B CD1 1 
ATOM   2188 C  CD2 . LEU B 2 141 ? 6.179   12.129  -12.113 1.00 18.75 ? 141  LEU B CD2 1 
ATOM   2189 N  N   . GLY B 2 142 ? 2.293   9.967   -9.156  1.00 22.26 ? 142  GLY B N   1 
ATOM   2190 C  CA  . GLY B 2 142 ? 1.151   9.079   -9.110  1.00 23.75 ? 142  GLY B CA  1 
ATOM   2191 C  C   . GLY B 2 142 ? -0.082  9.872   -8.817  1.00 25.11 ? 142  GLY B C   1 
ATOM   2192 O  O   . GLY B 2 142 ? -1.159  9.332   -8.890  1.00 25.36 ? 142  GLY B O   1 
ATOM   2193 N  N   . LYS B 2 143 ? 0.079   11.152  -8.491  1.00 26.36 ? 143  LYS B N   1 
ATOM   2194 C  CA  . LYS B 2 143 ? -1.037  12.039  -8.186  1.00 27.89 ? 143  LYS B CA  1 
ATOM   2195 C  C   . LYS B 2 143 ? -1.903  11.536  -7.017  1.00 28.39 ? 143  LYS B C   1 
ATOM   2196 O  O   . LYS B 2 143 ? -3.130  11.333  -7.160  1.00 28.45 ? 143  LYS B O   1 
ATOM   2197 C  CB  . LYS B 2 143 ? -1.912  12.180  -9.407  1.00 28.91 ? 143  LYS B CB  1 
ATOM   2198 C  CG  . LYS B 2 143 ? -1.128  12.173  -10.726 1.00 30.38 ? 143  LYS B CG  1 
ATOM   2199 C  CD  . LYS B 2 143 ? -1.709  11.142  -11.705 1.00 31.22 ? 143  LYS B CD  1 
ATOM   2200 C  CE  . LYS B 2 143 ? -1.345  11.479  -13.169 1.00 31.83 ? 143  LYS B CE  1 
ATOM   2201 N  NZ  . LYS B 2 143 ? -1.986  12.764  -13.582 1.00 32.31 ? 143  LYS B NZ  1 
ATOM   2202 N  N   . GLN B 2 144 ? -1.261  11.318  -5.867  1.00 28.70 ? 144  GLN B N   1 
ATOM   2203 C  CA  . GLN B 2 144 ? -1.950  10.865  -4.648  1.00 28.79 ? 144  GLN B CA  1 
ATOM   2204 C  C   . GLN B 2 144 ? -2.818  11.991  -4.015  1.00 28.56 ? 144  GLN B C   1 
ATOM   2205 O  O   . GLN B 2 144 ? -2.459  13.182  -4.097  1.00 28.67 ? 144  GLN B O   1 
ATOM   2206 C  CB  . GLN B 2 144 ? -0.925  10.423  -3.610  1.00 29.14 ? 144  GLN B CB  1 
ATOM   2207 C  CG  . GLN B 2 144 ? -0.014  9.296   -4.024  1.00 30.05 ? 144  GLN B CG  1 
ATOM   2208 C  CD  . GLN B 2 144 ? 1.014   8.943   -2.915  1.00 30.57 ? 144  GLN B CD  1 
ATOM   2209 O  OE1 . GLN B 2 144 ? 0.979   9.508   -1.799  1.00 30.82 ? 144  GLN B OE1 1 
ATOM   2210 N  NE2 . GLN B 2 144 ? 1.936   8.003   -3.224  1.00 30.78 ? 144  GLN B NE2 1 
ATOM   2211 N  N   . TYR B 2 145 ? -3.938  11.608  -3.378  1.00 28.07 ? 145  TYR B N   1 
ATOM   2212 C  CA  . TYR B 2 145 ? -4.843  12.561  -2.714  1.00 27.78 ? 145  TYR B CA  1 
ATOM   2213 C  C   . TYR B 2 145 ? -4.251  12.965  -1.397  1.00 27.51 ? 145  TYR B C   1 
ATOM   2214 O  O   . TYR B 2 145 ? -3.946  12.110  -0.580  1.00 27.46 ? 145  TYR B O   1 
ATOM   2215 C  CB  . TYR B 2 145 ? -6.208  11.934  -2.374  1.00 27.77 ? 145  TYR B CB  1 
ATOM   2216 C  CG  . TYR B 2 145 ? -6.968  11.493  -3.567  1.00 28.17 ? 145  TYR B CG  1 
ATOM   2217 C  CD1 . TYR B 2 145 ? -7.648  10.272  -3.563  1.00 28.32 ? 145  TYR B CD1 1 
ATOM   2218 C  CD2 . TYR B 2 145 ? -6.963  12.259  -4.738  1.00 28.23 ? 145  TYR B CD2 1 
ATOM   2219 C  CE1 . TYR B 2 145 ? -8.294  9.819   -4.699  1.00 28.43 ? 145  TYR B CE1 1 
ATOM   2220 C  CE2 . TYR B 2 145 ? -7.602  11.813  -5.874  1.00 28.57 ? 145  TYR B CE2 1 
ATOM   2221 C  CZ  . TYR B 2 145 ? -8.253  10.593  -5.839  1.00 28.76 ? 145  TYR B CZ  1 
ATOM   2222 O  OH  . TYR B 2 145 ? -8.806  10.125  -6.995  1.00 29.84 ? 145  TYR B OH  1 
ATOM   2223 N  N   . HIS B 2 146 ? -4.107  14.265  -1.182  1.00 27.12 ? 146  HIS B N   1 
ATOM   2224 C  CA  . HIS B 2 146 ? -3.617  14.766  0.090   1.00 27.06 ? 146  HIS B CA  1 
ATOM   2225 C  C   . HIS B 2 146 ? -4.132  16.184  0.241   1.00 27.21 ? 146  HIS B C   1 
ATOM   2226 O  O   . HIS B 2 146 ? -4.058  16.694  1.384   1.00 27.15 ? 146  HIS B O   1 
ATOM   2227 C  CB  A HIS B 2 146 ? -2.094  14.860  0.102   0.50 27.10 ? 146  HIS B CB  1 
ATOM   2228 C  CB  B HIS B 2 146 ? -2.093  14.677  0.176   0.50 27.15 ? 146  HIS B CB  1 
ATOM   2229 C  CG  A HIS B 2 146 ? -1.386  13.562  -0.105  0.50 27.07 ? 146  HIS B CG  1 
ATOM   2230 C  CG  B HIS B 2 146 ? -1.365  15.508  -0.825  0.50 27.00 ? 146  HIS B CG  1 
ATOM   2231 N  ND1 A HIS B 2 146 ? -0.822  13.209  -1.312  0.50 26.96 ? 146  HIS B ND1 1 
ATOM   2232 N  ND1 B HIS B 2 146 ? -0.775  16.706  -0.495  0.50 27.01 ? 146  HIS B ND1 1 
ATOM   2233 C  CD2 A HIS B 2 146 ? -1.069  12.575  0.763   0.50 26.95 ? 146  HIS B CD2 1 
ATOM   2234 C  CD2 B HIS B 2 146 ? -1.101  15.304  -2.135  0.50 27.08 ? 146  HIS B CD2 1 
ATOM   2235 C  CE1 A HIS B 2 146 ? -0.184  12.065  -1.175  0.50 26.83 ? 146  HIS B CE1 1 
ATOM   2236 C  CE1 B HIS B 2 146 ? -0.173  17.206  -1.557  0.50 27.17 ? 146  HIS B CE1 1 
ATOM   2237 N  NE2 A HIS B 2 146 ? -0.317  11.661  0.074   0.50 26.96 ? 146  HIS B NE2 1 
ATOM   2238 N  NE2 B HIS B 2 146 ? -0.355  16.375  -2.567  0.50 27.15 ? 146  HIS B NE2 1 
ATOM   2239 O  OXT . HIS B 2 146 ? -4.582  16.765  -0.796  1.00 27.05 ? 146  HIS B OXT 1 
HETATM 2240 C  CHA . HEM C 3 .   ? 10.596  -11.029 18.835  1.00 16.18 ? 200  HEM A CHA 1 
HETATM 2241 C  CHB . HEM C 3 .   ? 11.653  -12.573 14.276  1.00 14.99 ? 200  HEM A CHB 1 
HETATM 2242 C  CHC . HEM C 3 .   ? 9.281   -8.683  12.463  1.00 14.37 ? 200  HEM A CHC 1 
HETATM 2243 C  CHD . HEM C 3 .   ? 8.875   -6.850  16.942  1.00 15.01 ? 200  HEM A CHD 1 
HETATM 2244 C  C1A . HEM C 3 .   ? 10.990  -11.808 17.734  1.00 16.43 ? 200  HEM A C1A 1 
HETATM 2245 C  C2A . HEM C 3 .   ? 11.822  -13.036 17.790  1.00 17.66 ? 200  HEM A C2A 1 
HETATM 2246 C  C3A . HEM C 3 .   ? 12.158  -13.481 16.557  1.00 16.52 ? 200  HEM A C3A 1 
HETATM 2247 C  C4A . HEM C 3 .   ? 11.622  -12.454 15.665  1.00 15.59 ? 200  HEM A C4A 1 
HETATM 2248 C  CMA . HEM C 3 .   ? 12.948  -14.687 16.217  1.00 16.18 ? 200  HEM A CMA 1 
HETATM 2249 C  CAA . HEM C 3 .   ? 12.266  -13.709 19.106  1.00 19.99 ? 200  HEM A CAA 1 
HETATM 2250 C  CBA . HEM C 3 .   ? 11.038  -14.598 19.334  1.00 23.56 ? 200  HEM A CBA 1 
HETATM 2251 C  CGA . HEM C 3 .   ? 11.178  -15.492 20.576  1.00 25.58 ? 200  HEM A CGA 1 
HETATM 2252 O  O1A . HEM C 3 .   ? 11.494  -14.927 21.648  1.00 26.75 ? 200  HEM A O1A 1 
HETATM 2253 O  O2A . HEM C 3 .   ? 10.970  -16.740 20.470  1.00 27.38 ? 200  HEM A O2A 1 
HETATM 2254 C  C1B . HEM C 3 .   ? 11.053  -11.654 13.373  1.00 14.64 ? 200  HEM A C1B 1 
HETATM 2255 C  C2B . HEM C 3 .   ? 11.153  -11.774 11.932  1.00 14.43 ? 200  HEM A C2B 1 
HETATM 2256 C  C3B . HEM C 3 .   ? 10.523  -10.682 11.421  1.00 14.55 ? 200  HEM A C3B 1 
HETATM 2257 C  C4B . HEM C 3 .   ? 10.002  -9.885  12.576  1.00 14.38 ? 200  HEM A C4B 1 
HETATM 2258 C  CMB . HEM C 3 .   ? 11.714  -13.001 11.171  1.00 14.51 ? 200  HEM A CMB 1 
HETATM 2259 C  CAB . HEM C 3 .   ? 10.259  -10.349 10.032  1.00 14.25 ? 200  HEM A CAB 1 
HETATM 2260 C  CBB . HEM C 3 .   ? 11.247  -10.359 9.090   1.00 14.58 ? 200  HEM A CBB 1 
HETATM 2261 C  C1C . HEM C 3 .   ? 8.902   -7.851  13.552  1.00 14.31 ? 200  HEM A C1C 1 
HETATM 2262 C  C2C . HEM C 3 .   ? 8.508   -6.468  13.369  1.00 13.75 ? 200  HEM A C2C 1 
HETATM 2263 C  C3C . HEM C 3 .   ? 8.436   -5.905  14.642  1.00 13.84 ? 200  HEM A C3C 1 
HETATM 2264 C  C4C . HEM C 3 .   ? 8.810   -6.981  15.553  1.00 14.40 ? 200  HEM A C4C 1 
HETATM 2265 C  CMC . HEM C 3 .   ? 8.163   -5.886  12.026  1.00 13.48 ? 200  HEM A CMC 1 
HETATM 2266 C  CAC . HEM C 3 .   ? 7.997   -4.662  15.069  1.00 13.65 ? 200  HEM A CAC 1 
HETATM 2267 C  CBC . HEM C 3 .   ? 7.860   -3.495  14.349  1.00 13.89 ? 200  HEM A CBC 1 
HETATM 2268 C  C1D . HEM C 3 .   ? 9.375   -7.816  17.816  1.00 15.11 ? 200  HEM A C1D 1 
HETATM 2269 C  C2D . HEM C 3 .   ? 9.532   -7.537  19.267  1.00 15.80 ? 200  HEM A C2D 1 
HETATM 2270 C  C3D . HEM C 3 .   ? 9.961   -8.692  19.770  1.00 16.28 ? 200  HEM A C3D 1 
HETATM 2271 C  C4D . HEM C 3 .   ? 10.095  -9.697  18.689  1.00 16.00 ? 200  HEM A C4D 1 
HETATM 2272 C  CMD . HEM C 3 .   ? 9.228   -6.217  20.000  1.00 15.44 ? 200  HEM A CMD 1 
HETATM 2273 C  CAD . HEM C 3 .   ? 10.281  -8.930  21.217  1.00 17.89 ? 200  HEM A CAD 1 
HETATM 2274 C  CBD . HEM C 3 .   ? 11.566  -8.179  21.549  1.00 20.49 ? 200  HEM A CBD 1 
HETATM 2275 C  CGD . HEM C 3 .   ? 12.002  -8.334  23.005  1.00 21.11 ? 200  HEM A CGD 1 
HETATM 2276 O  O1D . HEM C 3 .   ? 13.147  -8.698  23.231  1.00 23.14 ? 200  HEM A O1D 1 
HETATM 2277 O  O2D . HEM C 3 .   ? 11.221  -8.100  23.915  1.00 22.61 ? 200  HEM A O2D 1 
HETATM 2278 N  NA  . HEM C 3 .   ? 10.918  -11.437 16.386  1.00 15.76 ? 200  HEM A NA  1 
HETATM 2279 N  NB  . HEM C 3 .   ? 10.330  -10.494 13.755  1.00 14.53 ? 200  HEM A NB  1 
HETATM 2280 N  NC  . HEM C 3 .   ? 9.137   -8.156  14.905  1.00 14.30 ? 200  HEM A NC  1 
HETATM 2281 N  ND  . HEM C 3 .   ? 9.800   -9.076  17.474  1.00 15.31 ? 200  HEM A ND  1 
HETATM 2282 FE FE  . HEM C 3 .   ? 9.985   -9.802  15.610  1.00 14.58 ? 200  HEM A FE  1 
HETATM 2283 C  CHA . HEM D 3 .   ? 9.600   9.202   -20.376 1.00 19.45 ? 400  HEM B CHA 1 
HETATM 2284 C  CHB . HEM D 3 .   ? 11.027  10.704  -15.968 1.00 18.39 ? 400  HEM B CHB 1 
HETATM 2285 C  CHC . HEM D 3 .   ? 9.045   6.714   -13.919 1.00 17.69 ? 400  HEM B CHC 1 
HETATM 2286 C  CHD . HEM D 3 .   ? 7.998   5.004   -18.345 1.00 18.78 ? 400  HEM B CHD 1 
HETATM 2287 C  C1A . HEM D 3 .   ? 10.095  9.995   -19.313 1.00 19.47 ? 400  HEM B C1A 1 
HETATM 2288 C  C2A . HEM D 3 .   ? 10.815  11.216  -19.520 1.00 20.26 ? 400  HEM B C2A 1 
HETATM 2289 C  C3A . HEM D 3 .   ? 11.278  11.594  -18.271 1.00 19.60 ? 400  HEM B C3A 1 
HETATM 2290 C  C4A . HEM D 3 .   ? 10.827  10.615  -17.310 1.00 18.81 ? 400  HEM B C4A 1 
HETATM 2291 C  CMA . HEM D 3 .   ? 12.151  12.837  -17.932 1.00 19.75 ? 400  HEM B CMA 1 
HETATM 2292 C  CAA . HEM D 3 .   ? 10.961  11.934  -20.902 1.00 21.67 ? 400  HEM B CAA 1 
HETATM 2293 C  CBA . HEM D 3 .   ? 9.676   12.707  -20.770 1.00 24.21 ? 400  HEM B CBA 1 
HETATM 2294 C  CGA . HEM D 3 .   ? 9.418   13.631  -21.909 1.00 25.83 ? 400  HEM B CGA 1 
HETATM 2295 O  O1A . HEM D 3 .   ? 8.834   14.746  -21.695 1.00 26.86 ? 400  HEM B O1A 1 
HETATM 2296 O  O2A . HEM D 3 .   ? 9.784   13.226  -23.034 1.00 27.15 ? 400  HEM B O2A 1 
HETATM 2297 C  C1B . HEM D 3 .   ? 10.596  9.785   -15.019 1.00 17.99 ? 400  HEM B C1B 1 
HETATM 2298 C  C2B . HEM D 3 .   ? 10.696  10.054  -13.593 1.00 18.05 ? 400  HEM B C2B 1 
HETATM 2299 C  C3B . HEM D 3 .   ? 10.135  8.876   -13.069 1.00 18.20 ? 400  HEM B C3B 1 
HETATM 2300 C  C4B . HEM D 3 .   ? 9.713   7.944   -14.125 1.00 17.95 ? 400  HEM B C4B 1 
HETATM 2301 C  CMB . HEM D 3 .   ? 11.337  11.290  -12.869 1.00 17.47 ? 400  HEM B CMB 1 
HETATM 2302 C  CAB . HEM D 3 .   ? 9.957   8.457   -11.723 1.00 18.38 ? 400  HEM B CAB 1 
HETATM 2303 C  CBB . HEM D 3 .   ? 10.706  8.927   -10.681 1.00 19.41 ? 400  HEM B CBB 1 
HETATM 2304 C  C1C . HEM D 3 .   ? 8.614   5.864   -14.893 1.00 17.86 ? 400  HEM B C1C 1 
HETATM 2305 C  C2C . HEM D 3 .   ? 8.072   4.527   -14.652 1.00 18.21 ? 400  HEM B C2C 1 
HETATM 2306 C  C3C . HEM D 3 .   ? 7.823   4.036   -15.974 1.00 18.25 ? 400  HEM B C3C 1 
HETATM 2307 C  C4C . HEM D 3 .   ? 8.215   5.048   -16.932 1.00 18.25 ? 400  HEM B C4C 1 
HETATM 2308 C  CMC . HEM D 3 .   ? 8.061   3.750   -13.294 1.00 17.58 ? 400  HEM B CMC 1 
HETATM 2309 C  CAC . HEM D 3 .   ? 7.352   2.798   -16.402 1.00 18.37 ? 400  HEM B CAC 1 
HETATM 2310 C  CBC . HEM D 3 .   ? 7.472   1.676   -15.651 1.00 19.37 ? 400  HEM B CBC 1 
HETATM 2311 C  C1D . HEM D 3 .   ? 8.266   6.038   -19.289 1.00 19.20 ? 400  HEM B C1D 1 
HETATM 2312 C  C2D . HEM D 3 .   ? 8.257   5.875   -20.777 1.00 19.82 ? 400  HEM B C2D 1 
HETATM 2313 C  C3D . HEM D 3 .   ? 8.721   7.046   -21.299 1.00 20.23 ? 400  HEM B C3D 1 
HETATM 2314 C  C4D . HEM D 3 .   ? 9.010   7.953   -20.217 1.00 19.67 ? 400  HEM B C4D 1 
HETATM 2315 C  CMD . HEM D 3 .   ? 7.704   4.712   -21.529 1.00 20.04 ? 400  HEM B CMD 1 
HETATM 2316 C  CAD . HEM D 3 .   ? 8.850   7.332   -22.766 1.00 21.37 ? 400  HEM B CAD 1 
HETATM 2317 C  CBD . HEM D 3 .   ? 10.154  6.675   -23.212 1.00 22.96 ? 400  HEM B CBD 1 
HETATM 2318 C  CGD . HEM D 3 .   ? 11.371  7.513   -22.846 1.00 23.99 ? 400  HEM B CGD 1 
HETATM 2319 O  O1D . HEM D 3 .   ? 11.294  8.755   -22.993 1.00 25.47 ? 400  HEM B O1D 1 
HETATM 2320 O  O2D . HEM D 3 .   ? 12.414  6.964   -22.430 1.00 25.29 ? 400  HEM B O2D 1 
HETATM 2321 N  NA  . HEM D 3 .   ? 10.138  9.639   -17.955 1.00 18.76 ? 400  HEM B NA  1 
HETATM 2322 N  NB  . HEM D 3 .   ? 9.986   8.554   -15.327 1.00 18.12 ? 400  HEM B NB  1 
HETATM 2323 N  NC  . HEM D 3 .   ? 8.705   6.153   -16.270 1.00 18.17 ? 400  HEM B NC  1 
HETATM 2324 N  ND  . HEM D 3 .   ? 8.775   7.294   -18.952 1.00 18.98 ? 400  HEM B ND  1 
HETATM 2325 FE FE  . HEM D 3 .   ? 9.397   7.866   -17.141 1.00 17.40 ? 400  HEM B FE  1 
HETATM 2326 O  O   . HOH E 4 .   ? -4.649  -11.690 6.850   1.00 14.40 ? 1001 HOH A O   1 
HETATM 2327 O  O   . HOH E 4 .   ? 15.741  -24.868 2.579   1.00 19.56 ? 1002 HOH A O   1 
HETATM 2328 O  O   . HOH E 4 .   ? 23.204  -21.748 4.176   1.00 23.37 ? 1003 HOH A O   1 
HETATM 2329 O  O   . HOH E 4 .   ? 9.846   -18.529 -10.839 1.00 16.02 ? 1004 HOH A O   1 
HETATM 2330 O  O   . HOH E 4 .   ? 11.522  -2.999  -1.268  1.00 13.78 ? 1005 HOH A O   1 
HETATM 2331 O  O   . HOH E 4 .   ? 12.342  -4.311  -3.730  1.00 13.05 ? 1006 HOH A O   1 
HETATM 2332 O  O   . HOH E 4 .   ? 10.872  -16.060 -10.004 1.00 16.15 ? 1007 HOH A O   1 
HETATM 2333 O  O   . HOH E 4 .   ? 29.707  -7.969  -2.443  1.00 18.10 ? 1008 HOH A O   1 
HETATM 2334 O  O   . HOH E 4 .   ? 23.655  -8.363  15.760  1.00 15.10 ? 1009 HOH A O   1 
HETATM 2335 O  O   . HOH E 4 .   ? 4.803   -8.019  1.826   1.00 19.75 ? 1010 HOH A O   1 
HETATM 2336 O  O   . HOH E 4 .   ? 21.400  -16.529 11.450  1.00 25.75 ? 1011 HOH A O   1 
HETATM 2337 O  O   . HOH E 4 .   ? 2.287   -19.132 10.025  1.00 20.34 ? 1012 HOH A O   1 
HETATM 2338 O  O   . HOH E 4 .   ? 26.180  -14.021 11.866  1.00 23.11 ? 1013 HOH A O   1 
HETATM 2339 O  O   . HOH E 4 .   ? -5.431  -11.818 4.146   1.00 16.87 ? 1014 HOH A O   1 
HETATM 2340 O  O   . HOH E 4 .   ? 5.482   -20.189 -1.697  1.00 17.27 ? 1015 HOH A O   1 
HETATM 2341 O  O   . HOH E 4 .   ? 17.549  -14.932 -3.754  1.00 25.42 ? 1016 HOH A O   1 
HETATM 2342 O  O   . HOH E 4 .   ? 1.715   -11.864 -0.450  1.00 28.63 ? 1017 HOH A O   1 
HETATM 2343 O  O   . HOH E 4 .   ? 22.552  -4.577  -4.878  1.00 24.89 ? 1018 HOH A O   1 
HETATM 2344 O  O   . HOH E 4 .   ? 8.447   -4.959  1.429   1.00 26.40 ? 1019 HOH A O   1 
HETATM 2345 O  O   . HOH E 4 .   ? 27.594  -10.859 11.544  1.00 17.35 ? 1020 HOH A O   1 
HETATM 2346 O  O   . HOH E 4 .   ? 23.825  -7.060  -12.745 1.00 31.99 ? 1021 HOH A O   1 
HETATM 2347 O  O   . HOH E 4 .   ? 18.062  -17.120 -10.110 1.00 26.25 ? 1022 HOH A O   1 
HETATM 2348 O  O   . HOH E 4 .   ? 20.325  -20.264 -7.979  1.00 28.33 ? 1023 HOH A O   1 
HETATM 2349 O  O   . HOH E 4 .   ? 17.664  3.414   16.267  1.00 46.53 ? 1024 HOH A O   1 
HETATM 2350 O  O   . HOH E 4 .   ? 20.398  -15.414 -7.932  1.00 26.08 ? 1025 HOH A O   1 
HETATM 2351 O  O   . HOH E 4 .   ? 0.857   -18.412 4.255   1.00 35.47 ? 1026 HOH A O   1 
HETATM 2352 O  O   . HOH E 4 .   ? 23.537  -15.616 -5.118  1.00 23.04 ? 1027 HOH A O   1 
HETATM 2353 O  O   . HOH E 4 .   ? 13.552  8.795   13.581  1.00 28.83 ? 1028 HOH A O   1 
HETATM 2354 O  O   . HOH E 4 .   ? 1.322   -10.005 3.811   1.00 29.59 ? 1029 HOH A O   1 
HETATM 2355 O  O   . HOH E 4 .   ? 9.864   -4.891  -0.807  1.00 36.79 ? 1030 HOH A O   1 
HETATM 2356 O  O   . HOH E 4 .   ? 25.487  -4.361  11.771  1.00 19.54 ? 1031 HOH A O   1 
HETATM 2357 O  O   . HOH E 4 .   ? 23.884  -14.240 -6.219  1.00 45.38 ? 1032 HOH A O   1 
HETATM 2358 O  O   . HOH E 4 .   ? 3.300   -14.144 -0.726  1.00 20.68 ? 1033 HOH A O   1 
HETATM 2359 O  O   . HOH E 4 .   ? 24.252  -4.446  -6.602  1.00 22.21 ? 1034 HOH A O   1 
HETATM 2360 O  O   . HOH E 4 .   ? 26.239  -7.896  -9.023  1.00 35.28 ? 1035 HOH A O   1 
HETATM 2361 O  O   . HOH E 4 .   ? 24.689  -1.037  6.050   1.00 26.17 ? 1036 HOH A O   1 
HETATM 2362 O  O   . HOH E 4 .   ? -4.384  -13.768 8.755   1.00 15.94 ? 1037 HOH A O   1 
HETATM 2363 O  O   . HOH E 4 .   ? 11.354  -23.104 -11.156 1.00 23.41 ? 1038 HOH A O   1 
HETATM 2364 O  O   . HOH E 4 .   ? -0.534  -17.336 6.111   1.00 24.22 ? 1039 HOH A O   1 
HETATM 2365 O  O   . HOH E 4 .   ? 15.832  -15.398 -9.355  1.00 15.56 ? 1040 HOH A O   1 
HETATM 2366 O  O   . HOH E 4 .   ? 21.360  -13.906 13.055  1.00 16.64 ? 1041 HOH A O   1 
HETATM 2367 O  O   . HOH E 4 .   ? 7.642   -7.776  1.961   1.00 18.50 ? 1042 HOH A O   1 
HETATM 2368 O  O   . HOH E 4 .   ? 15.921  -16.359 15.910  1.00 21.42 ? 1043 HOH A O   1 
HETATM 2369 O  O   . HOH E 4 .   ? 17.580  -20.317 -9.148  1.00 21.75 ? 1044 HOH A O   1 
HETATM 2370 O  O   . HOH E 4 .   ? 28.127  -1.611  -0.940  1.00 21.38 ? 1045 HOH A O   1 
HETATM 2371 O  O   . HOH E 4 .   ? 3.494   -6.061  6.188   1.00 19.39 ? 1046 HOH A O   1 
HETATM 2372 O  O   . HOH E 4 .   ? 22.876  -9.389  -13.087 1.00 34.74 ? 1047 HOH A O   1 
HETATM 2373 O  O   . HOH E 4 .   ? 27.058  -5.634  13.930  1.00 29.70 ? 1048 HOH A O   1 
HETATM 2374 O  O   . HOH E 4 .   ? 20.790  -16.101 -5.641  1.00 24.56 ? 1049 HOH A O   1 
HETATM 2375 O  O   . HOH E 4 .   ? 26.192  -7.632  15.169  1.00 28.63 ? 1050 HOH A O   1 
HETATM 2376 O  O   . HOH E 4 .   ? 22.045  -13.848 -9.303  1.00 24.74 ? 1051 HOH A O   1 
HETATM 2377 O  O   . HOH E 4 .   ? -5.653  -13.903 2.770   1.00 18.32 ? 1052 HOH A O   1 
HETATM 2378 O  O   . HOH E 4 .   ? 1.950   -9.661  6.294   1.00 34.73 ? 1053 HOH A O   1 
HETATM 2379 O  O   . HOH E 4 .   ? 3.168   -10.600 1.847   1.00 16.70 ? 1054 HOH A O   1 
HETATM 2380 O  O   . HOH E 4 .   ? 6.953   -22.182 -0.306  1.00 21.24 ? 1055 HOH A O   1 
HETATM 2381 O  O   . HOH E 4 .   ? 21.774  -18.582 -8.057  1.00 30.07 ? 1056 HOH A O   1 
HETATM 2382 O  O   . HOH E 4 .   ? 11.619  8.793   7.678   1.00 24.64 ? 1057 HOH A O   1 
HETATM 2383 O  O   . HOH E 4 .   ? 3.433   -17.551 2.792   1.00 22.66 ? 1058 HOH A O   1 
HETATM 2384 O  O   . HOH E 4 .   ? 17.377  -20.406 12.891  1.00 34.07 ? 1059 HOH A O   1 
HETATM 2385 O  O   . HOH E 4 .   ? 30.217  -14.523 -1.562  1.00 34.79 ? 1060 HOH A O   1 
HETATM 2386 O  O   . HOH E 4 .   ? 5.413   -17.508 -1.060  1.00 22.70 ? 1061 HOH A O   1 
HETATM 2387 O  O   . HOH E 4 .   ? 17.742  -22.443 -10.636 1.00 31.26 ? 1062 HOH A O   1 
HETATM 2388 O  O   . HOH E 4 .   ? 24.912  -23.047 2.637   1.00 25.16 ? 1063 HOH A O   1 
HETATM 2389 O  O   . HOH E 4 .   ? 13.313  -15.648 -11.496 1.00 37.53 ? 1064 HOH A O   1 
HETATM 2390 O  O   . HOH E 4 .   ? 6.085   -23.019 14.048  1.00 26.45 ? 1065 HOH A O   1 
HETATM 2391 O  O   . HOH E 4 .   ? 7.832   -20.346 13.902  1.00 18.97 ? 1066 HOH A O   1 
HETATM 2392 O  O   . HOH E 4 .   ? 3.016   -16.800 -0.070  1.00 26.46 ? 1067 HOH A O   1 
HETATM 2393 O  O   . HOH E 4 .   ? 1.917   -21.689 17.240  1.00 32.88 ? 1068 HOH A O   1 
HETATM 2394 O  O   . HOH E 4 .   ? -7.085  -15.857 14.401  1.00 35.88 ? 1069 HOH A O   1 
HETATM 2395 O  O   . HOH E 4 .   ? 2.528   0.196   21.443  1.00 48.76 ? 1070 HOH A O   1 
HETATM 2396 O  O   . HOH E 4 .   ? 3.677   -16.862 21.372  1.00 35.50 ? 1071 HOH A O   1 
HETATM 2397 O  O   . HOH E 4 .   ? 11.740  -8.830  15.488  1.00 15.19 ? 1072 HOH A O   1 
HETATM 2398 O  O   . HOH E 4 .   ? 8.697   -24.736 -9.503  1.00 24.96 ? 1073 HOH A O   1 
HETATM 2399 O  O   . HOH E 4 .   ? 14.979  -25.730 -6.011  1.00 22.85 ? 1074 HOH A O   1 
HETATM 2400 O  O   . HOH E 4 .   ? 6.284   -24.450 -1.563  1.00 30.51 ? 1075 HOH A O   1 
HETATM 2401 O  O   . HOH E 4 .   ? 7.202   -2.434  24.438  1.00 24.82 ? 1076 HOH A O   1 
HETATM 2402 O  O   . HOH E 4 .   ? 11.706  -26.481 3.665   1.00 16.56 ? 1077 HOH A O   1 
HETATM 2403 O  O   . HOH E 4 .   ? 9.457   -27.514 5.305   1.00 23.60 ? 1078 HOH A O   1 
HETATM 2404 O  O   . HOH E 4 .   ? 7.954   -25.843 7.115   1.00 20.53 ? 1079 HOH A O   1 
HETATM 2405 O  O   . HOH E 4 .   ? 16.295  5.847   16.644  1.00 42.06 ? 1080 HOH A O   1 
HETATM 2406 O  O   . HOH E 4 .   ? 6.697   -5.522  22.475  1.00 27.12 ? 1081 HOH A O   1 
HETATM 2407 O  O   . HOH E 4 .   ? 4.871   -16.591 -8.291  1.00 17.95 ? 1082 HOH A O   1 
HETATM 2408 O  O   . HOH E 4 .   ? 9.611   -24.197 12.646  1.00 20.66 ? 1083 HOH A O   1 
HETATM 2409 O  O   . HOH E 4 .   ? 5.452   -21.670 1.761   1.00 21.06 ? 1084 HOH A O   1 
HETATM 2410 O  O   . HOH E 4 .   ? -10.541 -13.368 12.741  1.00 18.31 ? 1085 HOH A O   1 
HETATM 2411 O  O   . HOH E 4 .   ? -4.972  -10.039 15.549  1.00 24.90 ? 1086 HOH A O   1 
HETATM 2412 O  O   . HOH E 4 .   ? 7.151   -18.590 -10.540 1.00 21.56 ? 1087 HOH A O   1 
HETATM 2413 O  O   . HOH E 4 .   ? -5.785  -16.678 11.921  1.00 21.34 ? 1088 HOH A O   1 
HETATM 2414 O  O   . HOH E 4 .   ? 5.848   -19.753 -8.547  1.00 24.55 ? 1089 HOH A O   1 
HETATM 2415 O  O   . HOH E 4 .   ? -2.689  -8.667  16.934  1.00 28.11 ? 1090 HOH A O   1 
HETATM 2416 O  O   . HOH E 4 .   ? 20.845  -12.322 20.627  1.00 25.76 ? 1091 HOH A O   1 
HETATM 2417 O  O   . HOH E 4 .   ? 3.281   -22.028 3.250   1.00 37.87 ? 1092 HOH A O   1 
HETATM 2418 O  O   . HOH E 4 .   ? 9.945   -20.560 16.049  1.00 26.30 ? 1093 HOH A O   1 
HETATM 2419 O  O   . HOH E 4 .   ? 24.390  -6.882  22.280  1.00 31.76 ? 1094 HOH A O   1 
HETATM 2420 O  O   . HOH E 4 .   ? 1.098   -25.186 5.158   1.00 32.55 ? 1095 HOH A O   1 
HETATM 2421 O  O   . HOH E 4 .   ? -5.903  -22.715 8.796   1.00 29.50 ? 1096 HOH A O   1 
HETATM 2422 O  O   . HOH E 4 .   ? 14.903  -16.580 18.836  1.00 31.59 ? 1097 HOH A O   1 
HETATM 2423 O  O   . HOH E 4 .   ? 23.152  -17.374 9.883   1.00 30.39 ? 1098 HOH A O   1 
HETATM 2424 O  O   . HOH E 4 .   ? 9.099   1.731   2.311   1.00 48.53 ? 1099 HOH A O   1 
HETATM 2425 O  O   . HOH E 4 .   ? 8.756   6.259   6.727   1.00 35.72 ? 1100 HOH A O   1 
HETATM 2426 O  O   . HOH E 4 .   ? -3.874  -20.353 11.714  1.00 29.86 ? 1101 HOH A O   1 
HETATM 2427 O  O   . HOH E 4 .   ? 27.597  -14.497 -6.116  1.00 33.58 ? 1102 HOH A O   1 
HETATM 2428 O  O   . HOH E 4 .   ? 12.901  -26.893 -4.676  1.00 38.11 ? 1103 HOH A O   1 
HETATM 2429 O  O   . HOH E 4 .   ? 11.790  3.516   25.946  1.00 44.82 ? 1104 HOH A O   1 
HETATM 2430 O  O   . HOH E 4 .   ? 2.706   0.225   14.820  1.00 32.21 ? 1105 HOH A O   1 
HETATM 2431 O  O   . HOH E 4 .   ? 12.732  -27.165 -1.903  1.00 28.40 ? 1106 HOH A O   1 
HETATM 2432 O  O   . HOH E 4 .   ? 3.015   2.197   16.607  1.00 34.81 ? 1107 HOH A O   1 
HETATM 2433 O  O   . HOH E 4 .   ? 19.238  -11.659 23.292  1.00 32.70 ? 1108 HOH A O   1 
HETATM 2434 O  O   . HOH E 4 .   ? 21.013  -14.927 19.815  1.00 37.87 ? 1109 HOH A O   1 
HETATM 2435 O  O   . HOH E 4 .   ? 18.868  -17.126 16.664  1.00 38.92 ? 1110 HOH A O   1 
HETATM 2436 O  O   . HOH E 4 .   ? 5.690   -29.152 5.992   1.00 37.40 ? 1111 HOH A O   1 
HETATM 2437 O  O   . HOH E 4 .   ? 14.200  -18.258 14.942  1.00 24.95 ? 1112 HOH A O   1 
HETATM 2438 O  O   . HOH E 4 .   ? 24.543  -9.408  20.889  1.00 32.49 ? 1113 HOH A O   1 
HETATM 2439 O  O   . HOH E 4 .   ? 23.450  -1.675  17.742  1.00 28.94 ? 1114 HOH A O   1 
HETATM 2440 O  O   . HOH E 4 .   ? -2.985  -10.228 2.864   1.00 38.54 ? 1115 HOH A O   1 
HETATM 2441 O  O   . HOH E 4 .   ? 8.553   -25.262 -5.458  1.00 28.77 ? 1116 HOH A O   1 
HETATM 2442 O  O   . HOH E 4 .   ? 19.297  -21.813 7.241   1.00 35.47 ? 1117 HOH A O   1 
HETATM 2443 O  O   . HOH E 4 .   ? 4.282   -19.094 19.781  1.00 30.62 ? 1118 HOH A O   1 
HETATM 2444 O  O   . HOH E 4 .   ? -2.943  -9.483  6.857   1.00 30.42 ? 1119 HOH A O   1 
HETATM 2445 O  O   . HOH E 4 .   ? 2.301   -25.027 12.752  1.00 43.16 ? 1120 HOH A O   1 
HETATM 2446 O  O   . HOH E 4 .   ? 21.007  -22.776 -7.511  1.00 31.85 ? 1121 HOH A O   1 
HETATM 2447 O  O   . HOH E 4 .   ? 7.603   -6.888  24.858  1.00 42.82 ? 1122 HOH A O   1 
HETATM 2448 O  O   . HOH F 4 .   ? 8.274   -5.614  -3.167  1.00 17.81 ? 1007 HOH B O   1 
HETATM 2449 O  O   . HOH F 4 .   ? 11.768  8.583   4.941   1.00 17.71 ? 1008 HOH B O   1 
HETATM 2450 O  O   . HOH F 4 .   ? 2.654   -2.230  -10.040 1.00 18.86 ? 1009 HOH B O   1 
HETATM 2451 O  O   . HOH F 4 .   ? 4.698   8.541   -1.972  1.00 18.88 ? 1010 HOH B O   1 
HETATM 2452 O  O   . HOH F 4 .   ? 10.583  6.423   4.135   1.00 20.27 ? 1011 HOH B O   1 
HETATM 2453 O  O   . HOH F 4 .   ? 16.331  10.494  10.202  1.00 29.32 ? 1012 HOH B O   1 
HETATM 2454 O  O   . HOH F 4 .   ? 22.140  7.382   10.712  1.00 23.68 ? 1013 HOH B O   1 
HETATM 2455 O  O   . HOH F 4 .   ? 10.506  6.286   -0.647  1.00 20.17 ? 1014 HOH B O   1 
HETATM 2456 O  O   . HOH F 4 .   ? 1.808   9.515   -13.823 1.00 17.54 ? 1015 HOH B O   1 
HETATM 2457 O  O   . HOH F 4 .   ? 24.702  0.223   -7.315  1.00 21.51 ? 1016 HOH B O   1 
HETATM 2458 O  O   . HOH F 4 .   ? 26.071  14.074  -10.369 1.00 40.44 ? 1017 HOH B O   1 
HETATM 2459 O  O   . HOH F 4 .   ? 16.780  16.173  9.907   1.00 17.25 ? 1018 HOH B O   1 
HETATM 2460 O  O   . HOH F 4 .   ? 12.516  4.075   -1.507  1.00 24.47 ? 1019 HOH B O   1 
HETATM 2461 O  O   . HOH F 4 .   ? 14.118  14.784  10.230  1.00 26.51 ? 1020 HOH B O   1 
HETATM 2462 O  O   . HOH F 4 .   ? 0.287   7.121   -13.476 1.00 18.96 ? 1021 HOH B O   1 
HETATM 2463 O  O   . HOH F 4 .   ? 19.817  -1.069  -19.271 1.00 28.57 ? 1022 HOH B O   1 
HETATM 2464 O  O   . HOH F 4 .   ? -3.246  9.452   -0.389  1.00 22.93 ? 1023 HOH B O   1 
HETATM 2465 O  O   . HOH F 4 .   ? 23.051  3.657   9.911   1.00 34.20 ? 1024 HOH B O   1 
HETATM 2466 O  O   . HOH F 4 .   ? 8.505   -1.748  -3.860  1.00 21.56 ? 1025 HOH B O   1 
HETATM 2467 O  O   . HOH F 4 .   ? 24.839  0.896   -15.411 1.00 30.39 ? 1026 HOH B O   1 
HETATM 2468 O  O   . HOH F 4 .   ? 3.219   4.810   -6.492  1.00 27.13 ? 1027 HOH B O   1 
HETATM 2469 O  O   . HOH F 4 .   ? 1.790   15.268  -4.440  1.00 36.31 ? 1028 HOH B O   1 
HETATM 2470 O  O   . HOH F 4 .   ? 19.653  -13.731 -18.100 1.00 35.61 ? 1029 HOH B O   1 
HETATM 2471 O  O   . HOH F 4 .   ? 24.042  -6.328  -8.708  1.00 22.38 ? 1030 HOH B O   1 
HETATM 2472 O  O   . HOH F 4 .   ? 24.273  9.850   8.620   1.00 31.91 ? 1031 HOH B O   1 
HETATM 2473 O  O   . HOH F 4 .   ? 25.814  9.592   -3.849  1.00 26.40 ? 1032 HOH B O   1 
HETATM 2474 O  O   . HOH F 4 .   ? 27.861  4.655   -9.487  1.00 29.65 ? 1033 HOH B O   1 
HETATM 2475 O  O   . HOH F 4 .   ? 30.608  -0.245  2.550   1.00 30.22 ? 1034 HOH B O   1 
HETATM 2476 O  O   . HOH F 4 .   ? 7.492   17.695  7.664   1.00 33.32 ? 1035 HOH B O   1 
HETATM 2477 O  O   . HOH F 4 .   ? 13.526  24.885  -1.361  1.00 26.74 ? 1036 HOH B O   1 
HETATM 2478 O  O   . HOH F 4 .   ? 22.508  22.394  -2.403  1.00 15.07 ? 1037 HOH B O   1 
HETATM 2479 O  O   . HOH F 4 .   ? 14.759  12.386  6.884   1.00 15.22 ? 1038 HOH B O   1 
HETATM 2480 O  O   . HOH F 4 .   ? 21.631  -3.065  -9.971  1.00 14.32 ? 1039 HOH B O   1 
HETATM 2481 O  O   . HOH F 4 .   ? 17.133  12.080  7.672   1.00 19.45 ? 1040 HOH B O   1 
HETATM 2482 O  O   . HOH F 4 .   ? 18.707  20.356  10.282  1.00 23.10 ? 1041 HOH B O   1 
HETATM 2483 O  O   . HOH F 4 .   ? 18.929  24.409  -5.273  1.00 20.99 ? 1042 HOH B O   1 
HETATM 2484 O  O   . HOH F 4 .   ? 18.662  14.217  9.012   1.00 22.14 ? 1043 HOH B O   1 
HETATM 2485 O  O   . HOH F 4 .   ? 8.641   6.150   -2.612  1.00 23.46 ? 1044 HOH B O   1 
HETATM 2486 O  O   . HOH F 4 .   ? 20.772  -3.857  -12.964 1.00 23.31 ? 1045 HOH B O   1 
HETATM 2487 O  O   . HOH F 4 .   ? 11.476  17.279  7.724   1.00 26.69 ? 1046 HOH B O   1 
HETATM 2488 O  O   . HOH F 4 .   ? 7.384   20.235  -1.918  1.00 28.12 ? 1047 HOH B O   1 
HETATM 2489 O  O   . HOH F 4 .   ? -5.330  19.225  2.630   1.00 22.24 ? 1048 HOH B O   1 
HETATM 2490 O  O   . HOH F 4 .   ? -3.258  0.872   -9.715  1.00 21.02 ? 1049 HOH B O   1 
HETATM 2491 O  O   . HOH F 4 .   ? 6.050   6.216   -1.894  1.00 22.53 ? 1050 HOH B O   1 
HETATM 2492 O  O   . HOH F 4 .   ? 17.846  17.973  11.611  1.00 31.01 ? 1051 HOH B O   1 
HETATM 2493 O  O   . HOH F 4 .   ? 12.084  16.114  10.413  1.00 38.26 ? 1052 HOH B O   1 
HETATM 2494 O  O   . HOH F 4 .   ? 6.571   16.113  -19.226 1.00 27.50 ? 1053 HOH B O   1 
HETATM 2495 O  O   . HOH F 4 .   ? 13.849  4.933   -23.354 1.00 34.12 ? 1054 HOH B O   1 
HETATM 2496 O  O   . HOH F 4 .   ? 23.399  -2.012  -8.163  1.00 36.23 ? 1055 HOH B O   1 
HETATM 2497 O  O   . HOH F 4 .   ? 25.237  2.115   7.109   1.00 28.74 ? 1056 HOH B O   1 
HETATM 2498 O  O   . HOH F 4 .   ? 4.083   3.100   -22.099 1.00 31.22 ? 1057 HOH B O   1 
HETATM 2499 O  O   . HOH F 4 .   ? 13.934  -1.891  -26.419 1.00 32.85 ? 1058 HOH B O   1 
HETATM 2500 O  O   . HOH F 4 .   ? 4.331   19.764  5.436   1.00 36.33 ? 1059 HOH B O   1 
HETATM 2501 O  O   . HOH F 4 .   ? -4.092  4.333   -17.940 1.00 39.68 ? 1060 HOH B O   1 
HETATM 2502 O  O   . HOH F 4 .   ? -2.707  1.232   -6.875  1.00 30.06 ? 1061 HOH B O   1 
HETATM 2503 O  O   . HOH F 4 .   ? 2.037   0.301   -15.899 1.00 31.87 ? 1062 HOH B O   1 
HETATM 2504 O  O   . HOH F 4 .   ? 15.639  22.734  -3.299  1.00 21.06 ? 1063 HOH B O   1 
HETATM 2505 O  O   . HOH F 4 .   ? 10.429  23.022  3.822   1.00 24.48 ? 1064 HOH B O   1 
HETATM 2506 O  O   . HOH F 4 .   ? 4.488   22.260  -5.486  1.00 30.83 ? 1065 HOH B O   1 
HETATM 2507 O  O   . HOH F 4 .   ? 4.894   20.603  -14.058 1.00 29.36 ? 1066 HOH B O   1 
HETATM 2508 O  O   . HOH F 4 .   ? 2.357   16.731  -19.654 1.00 26.16 ? 1067 HOH B O   1 
HETATM 2509 O  O   . HOH F 4 .   ? 4.828   16.920  -20.542 1.00 50.50 ? 1068 HOH B O   1 
HETATM 2510 O  O   . HOH F 4 .   ? 27.088  6.905   -8.124  1.00 30.29 ? 1069 HOH B O   1 
HETATM 2511 O  O   . HOH F 4 .   ? -4.260  15.978  -3.806  1.00 31.46 ? 1070 HOH B O   1 
HETATM 2512 O  O   . HOH F 4 .   ? 12.356  -11.350 -13.468 1.00 16.32 ? 1071 HOH B O   1 
HETATM 2513 O  O   . HOH F 4 .   ? 15.301  23.800  5.848   1.00 15.84 ? 1072 HOH B O   1 
HETATM 2514 O  O   . HOH F 4 .   ? 15.797  26.388  -4.716  1.00 18.83 ? 1073 HOH B O   1 
HETATM 2515 O  O   . HOH F 4 .   ? 18.958  9.647   -21.388 1.00 22.21 ? 1074 HOH B O   1 
HETATM 2516 O  O   . HOH F 4 .   ? 15.229  14.169  -17.294 1.00 23.83 ? 1075 HOH B O   1 
HETATM 2517 O  O   . HOH F 4 .   ? 25.052  4.467   -19.195 1.00 28.18 ? 1076 HOH B O   1 
HETATM 2518 O  O   . HOH F 4 .   ? 16.415  23.010  9.929   1.00 24.84 ? 1077 HOH B O   1 
HETATM 2519 O  O   . HOH F 4 .   ? 8.045   21.819  1.394   1.00 28.07 ? 1078 HOH B O   1 
HETATM 2520 O  O   . HOH F 4 .   ? 14.640  -12.907 -13.369 1.00 24.62 ? 1079 HOH B O   1 
HETATM 2521 O  O   . HOH F 4 .   ? -2.113  4.723   -15.816 1.00 36.50 ? 1080 HOH B O   1 
HETATM 2522 O  O   . HOH F 4 .   ? 30.941  4.443   0.250   1.00 47.49 ? 1081 HOH B O   1 
HETATM 2523 O  O   . HOH F 4 .   ? 20.974  4.605   -24.395 1.00 35.76 ? 1082 HOH B O   1 
HETATM 2524 O  O   . HOH F 4 .   ? 24.165  11.887  -17.048 1.00 41.32 ? 1083 HOH B O   1 
HETATM 2525 O  O   . HOH F 4 .   ? 12.378  -10.997 -16.380 1.00 44.66 ? 1084 HOH B O   1 
HETATM 2526 O  O   . HOH F 4 .   ? 22.250  23.486  -11.453 1.00 42.41 ? 1085 HOH B O   1 
HETATM 2527 O  O   . HOH F 4 .   ? 25.606  12.858  -13.093 1.00 39.76 ? 1086 HOH B O   1 
HETATM 2528 O  O   . HOH F 4 .   ? 25.424  14.189  3.721   1.00 33.44 ? 1087 HOH B O   1 
HETATM 2529 O  O   . HOH F 4 .   ? 19.297  -5.677  -24.994 1.00 30.75 ? 1088 HOH B O   1 
HETATM 2530 O  O   . HOH F 4 .   ? 21.589  -1.798  -16.564 1.00 39.42 ? 1089 HOH B O   1 
HETATM 2531 O  O   . HOH F 4 .   ? 26.663  1.036   -8.895  1.00 31.18 ? 1090 HOH B O   1 
HETATM 2532 O  O   . HOH F 4 .   ? 19.423  16.341  -19.056 1.00 42.24 ? 1091 HOH B O   1 
HETATM 2533 O  O   . HOH F 4 .   ? 1.578   16.890  -9.074  1.00 37.32 ? 1092 HOH B O   1 
HETATM 2534 O  O   . HOH F 4 .   ? 17.557  13.804  -19.479 1.00 42.93 ? 1093 HOH B O   1 
HETATM 2535 O  O   . HOH F 4 .   ? 4.205   15.626  -4.054  1.00 24.11 ? 1094 HOH B O   1 
HETATM 2536 O  O   . HOH F 4 .   ? 6.836   18.053  -14.792 1.00 21.32 ? 1095 HOH B O   1 
HETATM 2537 O  O   . HOH F 4 .   ? -6.574  4.241   -17.883 1.00 25.96 ? 1096 HOH B O   1 
HETATM 2538 O  O   . HOH F 4 .   ? 10.114  2.811   -24.462 1.00 38.05 ? 1097 HOH B O   1 
HETATM 2539 O  O   . HOH F 4 .   ? 7.978   18.170  -17.542 1.00 32.01 ? 1098 HOH B O   1 
HETATM 2540 O  O   . HOH F 4 .   ? 21.556  6.174   -22.374 1.00 33.48 ? 1099 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ACE 1   0   0   ACE ACE A . n 
A 1 2   SER 2   1   1   SER SER A . n 
A 1 3   LEU 3   2   2   LEU LEU A . n 
A 1 4   SER 4   3   3   SER SER A . n 
A 1 5   ASP 5   4   4   ASP ASP A . n 
A 1 6   LYS 6   5   5   LYS LYS A . n 
A 1 7   ASP 7   6   6   ASP ASP A . n 
A 1 8   LYS 8   7   7   LYS LYS A . n 
A 1 9   ALA 9   8   8   ALA ALA A . n 
A 1 10  ALA 10  9   9   ALA ALA A . n 
A 1 11  VAL 11  10  10  VAL VAL A . n 
A 1 12  ARG 12  11  11  ARG ARG A . n 
A 1 13  ALA 13  12  12  ALA ALA A . n 
A 1 14  LEU 14  13  13  LEU LEU A . n 
A 1 15  TRP 15  14  14  TRP TRP A . n 
A 1 16  SER 16  15  15  SER SER A . n 
A 1 17  LYS 17  16  16  LYS LYS A . n 
A 1 18  ILE 18  17  17  ILE ILE A . n 
A 1 19  GLY 19  18  18  GLY GLY A . n 
A 1 20  LYS 20  19  19  LYS LYS A . n 
A 1 21  SER 21  20  20  SER SER A . n 
A 1 22  ALA 22  21  21  ALA ALA A . n 
A 1 23  ASP 23  22  22  ASP ASP A . n 
A 1 24  ALA 24  23  23  ALA ALA A . n 
A 1 25  ILE 25  24  24  ILE ILE A . n 
A 1 26  GLY 26  25  25  GLY GLY A . n 
A 1 27  ASN 27  26  26  ASN ASN A . n 
A 1 28  ASP 28  27  27  ASP ASP A . n 
A 1 29  ALA 29  28  28  ALA ALA A . n 
A 1 30  LEU 30  29  29  LEU LEU A . n 
A 1 31  SER 31  30  30  SER SER A . n 
A 1 32  ARG 32  31  31  ARG ARG A . n 
A 1 33  MET 33  32  32  MET MET A . n 
A 1 34  ILE 34  33  33  ILE ILE A . n 
A 1 35  VAL 35  34  34  VAL VAL A . n 
A 1 36  VAL 36  35  35  VAL VAL A . n 
A 1 37  TYR 37  36  36  TYR TYR A . n 
A 1 38  PRO 38  37  37  PRO PRO A . n 
A 1 39  GLN 39  38  38  GLN GLN A . n 
A 1 40  THR 40  39  39  THR THR A . n 
A 1 41  LYS 41  40  40  LYS LYS A . n 
A 1 42  THR 42  41  41  THR THR A . n 
A 1 43  TYR 43  42  42  TYR TYR A . n 
A 1 44  PHE 44  43  43  PHE PHE A . n 
A 1 45  SER 45  44  44  SER SER A . n 
A 1 46  HIS 46  45  45  HIS HIS A . n 
A 1 47  TRP 47  46  46  TRP TRP A . n 
A 1 48  PRO 48  47  47  PRO PRO A . n 
A 1 49  ASP 49  48  48  ASP ASP A . n 
A 1 50  VAL 50  49  49  VAL VAL A . n 
A 1 51  THR 51  50  50  THR THR A . n 
A 1 52  PRO 52  51  51  PRO PRO A . n 
A 1 53  GLY 53  52  52  GLY GLY A . n 
A 1 54  SER 54  53  53  SER SER A . n 
A 1 55  PRO 55  54  54  PRO PRO A . n 
A 1 56  HIS 56  55  55  HIS HIS A . n 
A 1 57  ILE 57  56  56  ILE ILE A . n 
A 1 58  LYS 58  57  57  LYS LYS A . n 
A 1 59  ALA 59  58  58  ALA ALA A . n 
A 1 60  HIS 60  59  59  HIS HIS A . n 
A 1 61  GLY 61  60  60  GLY GLY A . n 
A 1 62  LYS 62  61  61  LYS LYS A . n 
A 1 63  LYS 63  62  62  LYS LYS A . n 
A 1 64  VAL 64  63  63  VAL VAL A . n 
A 1 65  MET 65  64  64  MET MET A . n 
A 1 66  GLY 66  65  65  GLY GLY A . n 
A 1 67  GLY 67  66  66  GLY GLY A . n 
A 1 68  ILE 68  67  67  ILE ILE A . n 
A 1 69  ALA 69  68  68  ALA ALA A . n 
A 1 70  LEU 70  69  69  LEU LEU A . n 
A 1 71  ALA 71  70  70  ALA ALA A . n 
A 1 72  VAL 72  71  71  VAL VAL A . n 
A 1 73  SER 73  72  72  SER SER A . n 
A 1 74  LYS 74  73  73  LYS LYS A . n 
A 1 75  ILE 75  74  74  ILE ILE A . n 
A 1 76  ASP 76  75  75  ASP ASP A . n 
A 1 77  ASP 77  76  76  ASP ASP A . n 
A 1 78  LEU 78  77  77  LEU LEU A . n 
A 1 79  LYS 79  78  78  LYS LYS A . n 
A 1 80  THR 80  79  79  THR THR A . n 
A 1 81  GLY 81  80  80  GLY GLY A . n 
A 1 82  LEU 82  81  81  LEU LEU A . n 
A 1 83  MET 83  82  82  MET MET A . n 
A 1 84  GLU 84  83  83  GLU GLU A . n 
A 1 85  LEU 85  84  84  LEU LEU A . n 
A 1 86  SER 86  85  85  SER SER A . n 
A 1 87  GLU 87  86  86  GLU GLU A . n 
A 1 88  GLN 88  87  87  GLN GLN A . n 
A 1 89  HIS 89  88  88  HIS HIS A . n 
A 1 90  ALA 90  89  89  ALA ALA A . n 
A 1 91  TYR 91  90  90  TYR TYR A . n 
A 1 92  LYS 92  91  91  LYS LYS A . n 
A 1 93  LEU 93  92  92  LEU LEU A . n 
A 1 94  ARG 94  93  93  ARG ARG A . n 
A 1 95  VAL 95  94  94  VAL VAL A . n 
A 1 96  ASP 96  95  95  ASP ASP A . n 
A 1 97  PRO 97  96  96  PRO PRO A . n 
A 1 98  ALA 98  97  97  ALA ALA A . n 
A 1 99  ASN 99  98  98  ASN ASN A . n 
A 1 100 PHE 100 99  99  PHE PHE A . n 
A 1 101 LYS 101 100 100 LYS LYS A . n 
A 1 102 ILE 102 101 101 ILE ILE A . n 
A 1 103 LEU 103 102 102 LEU LEU A . n 
A 1 104 ASN 104 103 103 ASN ASN A . n 
A 1 105 HIS 105 104 104 HIS HIS A . n 
A 1 106 CYS 106 105 105 CYS CYS A . n 
A 1 107 ILE 107 106 106 ILE ILE A . n 
A 1 108 LEU 108 107 107 LEU LEU A . n 
A 1 109 VAL 109 108 108 VAL VAL A . n 
A 1 110 VAL 110 109 109 VAL VAL A . n 
A 1 111 ILE 111 110 110 ILE ILE A . n 
A 1 112 SER 112 111 111 SER SER A . n 
A 1 113 THR 113 112 112 THR THR A . n 
A 1 114 MET 114 113 113 MET MET A . n 
A 1 115 PHE 115 114 114 PHE PHE A . n 
A 1 116 PRO 116 115 115 PRO PRO A . n 
A 1 117 LYS 117 116 116 LYS LYS A . n 
A 1 118 GLU 118 117 117 GLU GLU A . n 
A 1 119 PHE 119 118 118 PHE PHE A . n 
A 1 120 THR 120 119 119 THR THR A . n 
A 1 121 PRO 121 120 120 PRO PRO A . n 
A 1 122 GLU 122 121 121 GLU GLU A . n 
A 1 123 ALA 123 122 122 ALA ALA A . n 
A 1 124 HIS 124 123 123 HIS HIS A . n 
A 1 125 VAL 125 124 124 VAL VAL A . n 
A 1 126 SER 126 125 125 SER SER A . n 
A 1 127 LEU 127 126 126 LEU LEU A . n 
A 1 128 ASP 128 127 127 ASP ASP A . n 
A 1 129 LYS 129 128 128 LYS LYS A . n 
A 1 130 PHE 130 129 129 PHE PHE A . n 
A 1 131 LEU 131 130 130 LEU LEU A . n 
A 1 132 SER 132 131 131 SER SER A . n 
A 1 133 GLY 133 132 132 GLY GLY A . n 
A 1 134 VAL 134 133 133 VAL VAL A . n 
A 1 135 ALA 135 134 134 ALA ALA A . n 
A 1 136 LEU 136 135 135 LEU LEU A . n 
A 1 137 ALA 137 136 136 ALA ALA A . n 
A 1 138 LEU 138 137 137 LEU LEU A . n 
A 1 139 ALA 139 138 138 ALA ALA A . n 
A 1 140 GLU 140 139 139 GLU GLU A . n 
A 1 141 ARG 141 140 140 ARG ARG A . n 
A 1 142 TYR 142 141 141 TYR TYR A . n 
A 1 143 ARG 143 142 142 ARG ARG A . n 
B 2 1   VAL 1   1   1   VAL VAL B . n 
B 2 2   GLU 2   2   2   GLU GLU B . n 
B 2 3   TRP 3   3   3   TRP TRP B . n 
B 2 4   THR 4   4   4   THR THR B . n 
B 2 5   ASP 5   5   0   ASP ASP B . n 
B 2 6   LYS 6   6   6   LYS LYS B . n 
B 2 7   GLU 7   7   7   GLU GLU B . n 
B 2 8   ARG 8   8   8   ARG ARG B . n 
B 2 9   SER 9   9   9   SER SER B . n 
B 2 10  ILE 10  10  10  ILE ILE B . n 
B 2 11  ILE 11  11  11  ILE ILE B . n 
B 2 12  SER 12  12  12  SER SER B . n 
B 2 13  ASP 13  13  13  ASP ASP B . n 
B 2 14  ILE 14  14  14  ILE ILE B . n 
B 2 15  PHE 15  15  15  PHE PHE B . n 
B 2 16  SER 16  16  16  SER SER B . n 
B 2 17  HIS 17  17  17  HIS HIS B . n 
B 2 18  MET 18  18  18  MET MET B . n 
B 2 19  ASP 19  19  19  ASP ASP B . n 
B 2 20  TYR 20  20  20  TYR TYR B . n 
B 2 21  ASP 21  21  21  ASP ASP B . n 
B 2 22  ASP 22  22  22  ASP ASP B . n 
B 2 23  ILE 23  23  23  ILE ILE B . n 
B 2 24  GLY 24  24  24  GLY GLY B . n 
B 2 25  PRO 25  25  25  PRO PRO B . n 
B 2 26  LYS 26  26  26  LYS LYS B . n 
B 2 27  ALA 27  27  27  ALA ALA B . n 
B 2 28  LEU 28  28  28  LEU LEU B . n 
B 2 29  SER 29  29  29  SER SER B . n 
B 2 30  ARG 30  30  30  ARG ARG B . n 
B 2 31  CYS 31  31  31  CYS CYS B . n 
B 2 32  LEU 32  32  32  LEU LEU B . n 
B 2 33  ILE 33  33  33  ILE ILE B . n 
B 2 34  VAL 34  34  34  VAL VAL B . n 
B 2 35  TYR 35  35  35  TYR TYR B . n 
B 2 36  PRO 36  36  36  PRO PRO B . n 
B 2 37  TRP 37  37  37  TRP TRP B . n 
B 2 38  THR 38  38  38  THR THR B . n 
B 2 39  GLN 39  39  39  GLN GLN B . n 
B 2 40  ARG 40  40  40  ARG ARG B . n 
B 2 41  HIS 41  41  41  HIS HIS B . n 
B 2 42  PHE 42  42  42  PHE PHE B . n 
B 2 43  SER 43  43  43  SER SER B . n 
B 2 44  GLY 44  44  44  GLY GLY B . n 
B 2 45  PHE 45  45  ?   ?   ?   B . n 
B 2 46  GLY 46  46  ?   ?   ?   B . n 
B 2 47  ASN 47  47  ?   ?   ?   B . n 
B 2 48  LEU 48  48  ?   ?   ?   B . n 
B 2 49  TYR 49  49  ?   ?   ?   B . n 
B 2 50  ASN 50  50  50  ASN ASN B . n 
B 2 51  ALA 51  51  51  ALA ALA B . n 
B 2 52  GLU 52  52  52  GLU GLU B . n 
B 2 53  ALA 53  53  53  ALA ALA B . n 
B 2 54  ILE 54  54  54  ILE ILE B . n 
B 2 55  ILE 55  55  55  ILE ILE B . n 
B 2 56  GLY 56  56  56  GLY GLY B . n 
B 2 57  ASN 57  57  57  ASN ASN B . n 
B 2 58  ALA 58  58  58  ALA ALA B . n 
B 2 59  ASN 59  59  59  ASN ASN B . n 
B 2 60  VAL 60  60  60  VAL VAL B . n 
B 2 61  ALA 61  61  61  ALA ALA B . n 
B 2 62  ALA 62  62  62  ALA ALA B . n 
B 2 63  HIS 63  63  63  HIS HIS B . n 
B 2 64  GLY 64  64  64  GLY GLY B . n 
B 2 65  ILE 65  65  65  ILE ILE B . n 
B 2 66  LYS 66  66  66  LYS LYS B . n 
B 2 67  VAL 67  67  67  VAL VAL B . n 
B 2 68  LEU 68  68  68  LEU LEU B . n 
B 2 69  HIS 69  69  69  HIS HIS B . n 
B 2 70  GLY 70  70  70  GLY GLY B . n 
B 2 71  LEU 71  71  71  LEU LEU B . n 
B 2 72  ASP 72  72  72  ASP ASP B . n 
B 2 73  ARG 73  73  73  ARG ARG B . n 
B 2 74  GLY 74  74  74  GLY GLY B . n 
B 2 75  VAL 75  75  75  VAL VAL B . n 
B 2 76  LYS 76  76  76  LYS LYS B . n 
B 2 77  ASN 77  77  77  ASN ASN B . n 
B 2 78  MET 78  78  78  MET MET B . n 
B 2 79  ASP 79  79  79  ASP ASP B . n 
B 2 80  ASN 80  80  80  ASN ASN B . n 
B 2 81  ILE 81  81  81  ILE ILE B . n 
B 2 82  ALA 82  82  82  ALA ALA B . n 
B 2 83  ALA 83  83  83  ALA ALA B . n 
B 2 84  THR 84  84  84  THR THR B . n 
B 2 85  TYR 85  85  85  TYR TYR B . n 
B 2 86  ALA 86  86  86  ALA ALA B . n 
B 2 87  ASP 87  87  87  ASP ASP B . n 
B 2 88  LEU 88  88  88  LEU LEU B . n 
B 2 89  SER 89  89  89  SER SER B . n 
B 2 90  THR 90  90  90  THR THR B . n 
B 2 91  LEU 91  91  91  LEU LEU B . n 
B 2 92  HIS 92  92  92  HIS HIS B . n 
B 2 93  SER 93  93  93  SER SER B . n 
B 2 94  GLU 94  94  94  GLU GLU B . n 
B 2 95  LYS 95  95  95  LYS LYS B . n 
B 2 96  LEU 96  96  96  LEU LEU B . n 
B 2 97  HIS 97  97  97  HIS HIS B . n 
B 2 98  VAL 98  98  98  VAL VAL B . n 
B 2 99  ASP 99  99  99  ASP ASP B . n 
B 2 100 PRO 100 100 100 PRO PRO B . n 
B 2 101 ASP 101 101 101 ASP ASP B . n 
B 2 102 ASN 102 102 102 ASN ASN B . n 
B 2 103 PHE 103 103 103 PHE PHE B . n 
B 2 104 LYS 104 104 104 LYS LYS B . n 
B 2 105 LEU 105 105 105 LEU LEU B . n 
B 2 106 LEU 106 106 106 LEU LEU B . n 
B 2 107 SER 107 107 107 SER SER B . n 
B 2 108 ASP 108 108 108 ASP ASP B . n 
B 2 109 CYS 109 109 109 CYS CYS B . n 
B 2 110 ILE 110 110 110 ILE ILE B . n 
B 2 111 THR 111 111 111 THR THR B . n 
B 2 112 ILE 112 112 112 ILE ILE B . n 
B 2 113 VAL 113 113 113 VAL VAL B . n 
B 2 114 LEU 114 114 114 LEU LEU B . n 
B 2 115 ALA 115 115 115 ALA ALA B . n 
B 2 116 ALA 116 116 116 ALA ALA B . n 
B 2 117 LYS 117 117 117 LYS LYS B . n 
B 2 118 MET 118 118 118 MET MET B . n 
B 2 119 GLY 119 119 119 GLY GLY B . n 
B 2 120 HIS 120 120 120 HIS HIS B . n 
B 2 121 ALA 121 121 121 ALA ALA B . n 
B 2 122 PHE 122 122 122 PHE PHE B . n 
B 2 123 THR 123 123 123 THR THR B . n 
B 2 124 ALA 124 124 124 ALA ALA B . n 
B 2 125 GLU 125 125 125 GLU GLU B . n 
B 2 126 THR 126 126 126 THR THR B . n 
B 2 127 GLN 127 127 127 GLN GLN B . n 
B 2 128 GLY 128 128 128 GLY GLY B . n 
B 2 129 ALA 129 129 129 ALA ALA B . n 
B 2 130 PHE 130 130 130 PHE PHE B . n 
B 2 131 GLN 131 131 131 GLN GLN B . n 
B 2 132 LYS 132 132 132 LYS LYS B . n 
B 2 133 PHE 133 133 133 PHE PHE B . n 
B 2 134 LEU 134 134 134 LEU LEU B . n 
B 2 135 ALA 135 135 135 ALA ALA B . n 
B 2 136 VAL 136 136 136 VAL VAL B . n 
B 2 137 VAL 137 137 137 VAL VAL B . n 
B 2 138 VAL 138 138 138 VAL VAL B . n 
B 2 139 SER 139 139 139 SER SER B . n 
B 2 140 ALA 140 140 140 ALA ALA B . n 
B 2 141 LEU 141 141 141 LEU LEU B . n 
B 2 142 GLY 142 142 142 GLY GLY B . n 
B 2 143 LYS 143 143 143 LYS LYS B . n 
B 2 144 GLN 144 144 144 GLN GLN B . n 
B 2 145 TYR 145 145 145 TYR TYR B . n 
B 2 146 HIS 146 146 146 HIS HIS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HEM 1   200  200  HEM HEM A . 
D 3 HEM 1   400  400  HEM HEM B . 
E 4 HOH 1   1001 1001 HOH HOH A . 
E 4 HOH 2   1002 1002 HOH HOH A . 
E 4 HOH 3   1003 1003 HOH HOH A . 
E 4 HOH 4   1004 1004 HOH HOH A . 
E 4 HOH 5   1005 1005 HOH HOH A . 
E 4 HOH 6   1006 1008 HOH HOH A . 
E 4 HOH 7   1007 1009 HOH HOH A . 
E 4 HOH 8   1008 1010 HOH HOH A . 
E 4 HOH 9   1009 1015 HOH HOH A . 
E 4 HOH 10  1010 1019 HOH HOH A . 
E 4 HOH 11  1011 1020 HOH HOH A . 
E 4 HOH 12  1012 1021 HOH HOH A . 
E 4 HOH 13  1013 1026 HOH HOH A . 
E 4 HOH 14  1014 1028 HOH HOH A . 
E 4 HOH 15  1015 1035 HOH HOH A . 
E 4 HOH 16  1016 1040 HOH HOH A . 
E 4 HOH 17  1017 1042 HOH HOH A . 
E 4 HOH 18  1018 1045 HOH HOH A . 
E 4 HOH 19  1019 1047 HOH HOH A . 
E 4 HOH 20  1020 1048 HOH HOH A . 
E 4 HOH 21  1021 1057 HOH HOH A . 
E 4 HOH 22  1022 1062 HOH HOH A . 
E 4 HOH 23  1023 1063 HOH HOH A . 
E 4 HOH 24  1024 1065 HOH HOH A . 
E 4 HOH 25  1025 1066 HOH HOH A . 
E 4 HOH 26  1026 1074 HOH HOH A . 
E 4 HOH 27  1027 1087 HOH HOH A . 
E 4 HOH 28  1028 1089 HOH HOH A . 
E 4 HOH 29  1029 1092 HOH HOH A . 
E 4 HOH 30  1030 1097 HOH HOH A . 
E 4 HOH 31  1031 1108 HOH HOH A . 
E 4 HOH 32  1032 1109 HOH HOH A . 
E 4 HOH 33  1033 1132 HOH HOH A . 
E 4 HOH 34  1034 1134 HOH HOH A . 
E 4 HOH 35  1035 1153 HOH HOH A . 
E 4 HOH 36  1036 1155 HOH HOH A . 
E 4 HOH 37  1037 1160 HOH HOH A . 
E 4 HOH 38  1038 1163 HOH HOH A . 
E 4 HOH 39  1039 1167 HOH HOH A . 
E 4 HOH 40  1040 1168 HOH HOH A . 
E 4 HOH 41  1041 1170 HOH HOH A . 
E 4 HOH 42  1042 1171 HOH HOH A . 
E 4 HOH 43  1043 1174 HOH HOH A . 
E 4 HOH 44  1044 1176 HOH HOH A . 
E 4 HOH 45  1045 1181 HOH HOH A . 
E 4 HOH 46  1046 1182 HOH HOH A . 
E 4 HOH 47  1047 1184 HOH HOH A . 
E 4 HOH 48  1048 1188 HOH HOH A . 
E 4 HOH 49  1049 1189 HOH HOH A . 
E 4 HOH 50  1050 1194 HOH HOH A . 
E 4 HOH 51  1051 1195 HOH HOH A . 
E 4 HOH 52  1052 1197 HOH HOH A . 
E 4 HOH 53  1053 1199 HOH HOH A . 
E 4 HOH 54  1054 1200 HOH HOH A . 
E 4 HOH 55  1055 1206 HOH HOH A . 
E 4 HOH 56  1056 1207 HOH HOH A . 
E 4 HOH 57  1057 1212 HOH HOH A . 
E 4 HOH 58  1058 1214 HOH HOH A . 
E 4 HOH 59  1059 1216 HOH HOH A . 
E 4 HOH 60  1060 1217 HOH HOH A . 
E 4 HOH 61  1061 1222 HOH HOH A . 
E 4 HOH 62  1062 1228 HOH HOH A . 
E 4 HOH 63  1063 1231 HOH HOH A . 
E 4 HOH 64  1064 1234 HOH HOH A . 
E 4 HOH 65  1065 1238 HOH HOH A . 
E 4 HOH 66  1066 1239 HOH HOH A . 
E 4 HOH 67  1067 1250 HOH HOH A . 
E 4 HOH 68  1068 1252 HOH HOH A . 
E 4 HOH 69  1069 1262 HOH HOH A . 
E 4 HOH 70  1070 1263 HOH HOH A . 
E 4 HOH 71  1071 1270 HOH HOH A . 
E 4 HOH 72  1072 1400 HOH HOH A . 
E 4 HOH 73  1073 1271 HOH HOH A . 
E 4 HOH 74  1074 1272 HOH HOH A . 
E 4 HOH 75  1075 1273 HOH HOH A . 
E 4 HOH 76  1076 1280 HOH HOH A . 
E 4 HOH 77  1077 1281 HOH HOH A . 
E 4 HOH 78  1078 1282 HOH HOH A . 
E 4 HOH 79  1079 1283 HOH HOH A . 
E 4 HOH 80  1080 1284 HOH HOH A . 
E 4 HOH 81  1081 1289 HOH HOH A . 
E 4 HOH 82  1082 1290 HOH HOH A . 
E 4 HOH 83  1083 1294 HOH HOH A . 
E 4 HOH 84  1084 1295 HOH HOH A . 
E 4 HOH 85  1085 1297 HOH HOH A . 
E 4 HOH 86  1086 1298 HOH HOH A . 
E 4 HOH 87  1087 1299 HOH HOH A . 
E 4 HOH 88  1088 1300 HOH HOH A . 
E 4 HOH 89  1089 1301 HOH HOH A . 
E 4 HOH 90  1090 1302 HOH HOH A . 
E 4 HOH 91  1091 1303 HOH HOH A . 
E 4 HOH 92  1092 1305 HOH HOH A . 
E 4 HOH 93  1093 1307 HOH HOH A . 
E 4 HOH 94  1094 1311 HOH HOH A . 
E 4 HOH 95  1095 1313 HOH HOH A . 
E 4 HOH 96  1096 1314 HOH HOH A . 
E 4 HOH 97  1097 1315 HOH HOH A . 
E 4 HOH 98  1098 1318 HOH HOH A . 
E 4 HOH 99  1099 1321 HOH HOH A . 
E 4 HOH 100 1100 1323 HOH HOH A . 
E 4 HOH 101 1101 1327 HOH HOH A . 
E 4 HOH 102 1102 1330 HOH HOH A . 
E 4 HOH 103 1103 1331 HOH HOH A . 
E 4 HOH 104 1104 1333 HOH HOH A . 
E 4 HOH 105 1105 1334 HOH HOH A . 
E 4 HOH 106 1106 1335 HOH HOH A . 
E 4 HOH 107 1107 1337 HOH HOH A . 
E 4 HOH 108 1108 1338 HOH HOH A . 
E 4 HOH 109 1109 1340 HOH HOH A . 
E 4 HOH 110 1110 1341 HOH HOH A . 
E 4 HOH 111 1111 1343 HOH HOH A . 
E 4 HOH 112 1112 1345 HOH HOH A . 
E 4 HOH 113 1113 1347 HOH HOH A . 
E 4 HOH 114 1114 1349 HOH HOH A . 
E 4 HOH 115 1115 1351 HOH HOH A . 
E 4 HOH 116 1116 1353 HOH HOH A . 
E 4 HOH 117 1117 1354 HOH HOH A . 
E 4 HOH 118 1118 1355 HOH HOH A . 
E 4 HOH 119 1119 1356 HOH HOH A . 
E 4 HOH 120 1120 1357 HOH HOH A . 
E 4 HOH 121 1121 1358 HOH HOH A . 
E 4 HOH 122 1122 1359 HOH HOH A . 
F 4 HOH 1   1007 1007 HOH HOH B . 
F 4 HOH 2   1008 1011 HOH HOH B . 
F 4 HOH 3   1009 1012 HOH HOH B . 
F 4 HOH 4   1010 1018 HOH HOH B . 
F 4 HOH 5   1011 1023 HOH HOH B . 
F 4 HOH 6   1012 1025 HOH HOH B . 
F 4 HOH 7   1013 1033 HOH HOH B . 
F 4 HOH 8   1014 1034 HOH HOH B . 
F 4 HOH 9   1015 1037 HOH HOH B . 
F 4 HOH 10  1016 1044 HOH HOH B . 
F 4 HOH 11  1017 1046 HOH HOH B . 
F 4 HOH 12  1018 1050 HOH HOH B . 
F 4 HOH 13  1019 1053 HOH HOH B . 
F 4 HOH 14  1020 1055 HOH HOH B . 
F 4 HOH 15  1021 1056 HOH HOH B . 
F 4 HOH 16  1022 1059 HOH HOH B . 
F 4 HOH 17  1023 1060 HOH HOH B . 
F 4 HOH 18  1024 1064 HOH HOH B . 
F 4 HOH 19  1025 1068 HOH HOH B . 
F 4 HOH 20  1026 1070 HOH HOH B . 
F 4 HOH 21  1027 1073 HOH HOH B . 
F 4 HOH 22  1028 1075 HOH HOH B . 
F 4 HOH 23  1029 1076 HOH HOH B . 
F 4 HOH 24  1030 1088 HOH HOH B . 
F 4 HOH 25  1031 1091 HOH HOH B . 
F 4 HOH 26  1032 1101 HOH HOH B . 
F 4 HOH 27  1033 1110 HOH HOH B . 
F 4 HOH 28  1034 1122 HOH HOH B . 
F 4 HOH 29  1035 1142 HOH HOH B . 
F 4 HOH 30  1036 1152 HOH HOH B . 
F 4 HOH 31  1037 1161 HOH HOH B . 
F 4 HOH 32  1038 1169 HOH HOH B . 
F 4 HOH 33  1039 1172 HOH HOH B . 
F 4 HOH 34  1040 1173 HOH HOH B . 
F 4 HOH 35  1041 1177 HOH HOH B . 
F 4 HOH 36  1042 1178 HOH HOH B . 
F 4 HOH 37  1043 1179 HOH HOH B . 
F 4 HOH 38  1044 1180 HOH HOH B . 
F 4 HOH 39  1045 1183 HOH HOH B . 
F 4 HOH 40  1046 1202 HOH HOH B . 
F 4 HOH 41  1047 1203 HOH HOH B . 
F 4 HOH 42  1048 1205 HOH HOH B . 
F 4 HOH 43  1049 1210 HOH HOH B . 
F 4 HOH 44  1050 1215 HOH HOH B . 
F 4 HOH 45  1051 1244 HOH HOH B . 
F 4 HOH 46  1052 1248 HOH HOH B . 
F 4 HOH 47  1053 1251 HOH HOH B . 
F 4 HOH 48  1054 1253 HOH HOH B . 
F 4 HOH 49  1055 1254 HOH HOH B . 
F 4 HOH 50  1056 1256 HOH HOH B . 
F 4 HOH 51  1057 1257 HOH HOH B . 
F 4 HOH 52  1058 1258 HOH HOH B . 
F 4 HOH 53  1059 1266 HOH HOH B . 
F 4 HOH 54  1060 1269 HOH HOH B . 
F 4 HOH 55  1061 1274 HOH HOH B . 
F 4 HOH 56  1062 1275 HOH HOH B . 
F 4 HOH 57  1063 1276 HOH HOH B . 
F 4 HOH 58  1064 1277 HOH HOH B . 
F 4 HOH 59  1065 1278 HOH HOH B . 
F 4 HOH 60  1066 1279 HOH HOH B . 
F 4 HOH 61  1067 1285 HOH HOH B . 
F 4 HOH 62  1068 1286 HOH HOH B . 
F 4 HOH 63  1069 1287 HOH HOH B . 
F 4 HOH 64  1070 1288 HOH HOH B . 
F 4 HOH 65  1071 1291 HOH HOH B . 
F 4 HOH 66  1072 1292 HOH HOH B . 
F 4 HOH 67  1073 1293 HOH HOH B . 
F 4 HOH 68  1074 1296 HOH HOH B . 
F 4 HOH 69  1075 1304 HOH HOH B . 
F 4 HOH 70  1076 1306 HOH HOH B . 
F 4 HOH 71  1077 1308 HOH HOH B . 
F 4 HOH 72  1078 1309 HOH HOH B . 
F 4 HOH 73  1079 1310 HOH HOH B . 
F 4 HOH 74  1080 1312 HOH HOH B . 
F 4 HOH 75  1081 1316 HOH HOH B . 
F 4 HOH 76  1082 1317 HOH HOH B . 
F 4 HOH 77  1083 1319 HOH HOH B . 
F 4 HOH 78  1084 1320 HOH HOH B . 
F 4 HOH 79  1085 1322 HOH HOH B . 
F 4 HOH 80  1086 1325 HOH HOH B . 
F 4 HOH 81  1087 1326 HOH HOH B . 
F 4 HOH 82  1088 1328 HOH HOH B . 
F 4 HOH 83  1089 1329 HOH HOH B . 
F 4 HOH 84  1090 1332 HOH HOH B . 
F 4 HOH 85  1091 1336 HOH HOH B . 
F 4 HOH 86  1092 1339 HOH HOH B . 
F 4 HOH 87  1093 1342 HOH HOH B . 
F 4 HOH 88  1094 1344 HOH HOH B . 
F 4 HOH 89  1095 1346 HOH HOH B . 
F 4 HOH 90  1096 1348 HOH HOH B . 
F 4 HOH 91  1097 1350 HOH HOH B . 
F 4 HOH 92  1098 1352 HOH HOH B . 
F 4 HOH 93  1099 1360 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 89 ? A HIS 88  ? 1_555 FE ? C HEM . ? A HEM 200 ? 1_555 NA  ? C HEM .  ? A HEM 200  ? 1_555 90.5  ? 
2  NE2 ? A HIS 89 ? A HIS 88  ? 1_555 FE ? C HEM . ? A HEM 200 ? 1_555 NB  ? C HEM .  ? A HEM 200  ? 1_555 93.0  ? 
3  NA  ? C HEM .  ? A HEM 200 ? 1_555 FE ? C HEM . ? A HEM 200 ? 1_555 NB  ? C HEM .  ? A HEM 200  ? 1_555 89.8  ? 
4  NE2 ? A HIS 89 ? A HIS 88  ? 1_555 FE ? C HEM . ? A HEM 200 ? 1_555 NC  ? C HEM .  ? A HEM 200  ? 1_555 91.7  ? 
5  NA  ? C HEM .  ? A HEM 200 ? 1_555 FE ? C HEM . ? A HEM 200 ? 1_555 NC  ? C HEM .  ? A HEM 200  ? 1_555 177.2 ? 
6  NB  ? C HEM .  ? A HEM 200 ? 1_555 FE ? C HEM . ? A HEM 200 ? 1_555 NC  ? C HEM .  ? A HEM 200  ? 1_555 91.8  ? 
7  NE2 ? A HIS 89 ? A HIS 88  ? 1_555 FE ? C HEM . ? A HEM 200 ? 1_555 ND  ? C HEM .  ? A HEM 200  ? 1_555 91.5  ? 
8  NA  ? C HEM .  ? A HEM 200 ? 1_555 FE ? C HEM . ? A HEM 200 ? 1_555 ND  ? C HEM .  ? A HEM 200  ? 1_555 88.8  ? 
9  NB  ? C HEM .  ? A HEM 200 ? 1_555 FE ? C HEM . ? A HEM 200 ? 1_555 ND  ? C HEM .  ? A HEM 200  ? 1_555 175.3 ? 
10 NC  ? C HEM .  ? A HEM 200 ? 1_555 FE ? C HEM . ? A HEM 200 ? 1_555 ND  ? C HEM .  ? A HEM 200  ? 1_555 89.5  ? 
11 NE2 ? A HIS 89 ? A HIS 88  ? 1_555 FE ? C HEM . ? A HEM 200 ? 1_555 O   ? E HOH .  ? A HOH 1072 ? 1_555 178.7 ? 
12 NA  ? C HEM .  ? A HEM 200 ? 1_555 FE ? C HEM . ? A HEM 200 ? 1_555 O   ? E HOH .  ? A HOH 1072 ? 1_555 90.7  ? 
13 NB  ? C HEM .  ? A HEM 200 ? 1_555 FE ? C HEM . ? A HEM 200 ? 1_555 O   ? E HOH .  ? A HOH 1072 ? 1_555 87.7  ? 
14 NC  ? C HEM .  ? A HEM 200 ? 1_555 FE ? C HEM . ? A HEM 200 ? 1_555 O   ? E HOH .  ? A HOH 1072 ? 1_555 87.2  ? 
15 ND  ? C HEM .  ? A HEM 200 ? 1_555 FE ? C HEM . ? A HEM 200 ? 1_555 O   ? E HOH .  ? A HOH 1072 ? 1_555 87.8  ? 
16 NE2 ? B HIS 63 ? B HIS 63  ? 1_555 FE ? D HEM . ? B HEM 400 ? 1_555 NA  ? D HEM .  ? B HEM 400  ? 1_555 92.4  ? 
17 NE2 ? B HIS 63 ? B HIS 63  ? 1_555 FE ? D HEM . ? B HEM 400 ? 1_555 NB  ? D HEM .  ? B HEM 400  ? 1_555 94.4  ? 
18 NA  ? D HEM .  ? B HEM 400 ? 1_555 FE ? D HEM . ? B HEM 400 ? 1_555 NB  ? D HEM .  ? B HEM 400  ? 1_555 87.6  ? 
19 NE2 ? B HIS 63 ? B HIS 63  ? 1_555 FE ? D HEM . ? B HEM 400 ? 1_555 NC  ? D HEM .  ? B HEM 400  ? 1_555 87.5  ? 
20 NA  ? D HEM .  ? B HEM 400 ? 1_555 FE ? D HEM . ? B HEM 400 ? 1_555 NC  ? D HEM .  ? B HEM 400  ? 1_555 177.6 ? 
21 NB  ? D HEM .  ? B HEM 400 ? 1_555 FE ? D HEM . ? B HEM 400 ? 1_555 NC  ? D HEM .  ? B HEM 400  ? 1_555 90.1  ? 
22 NE2 ? B HIS 63 ? B HIS 63  ? 1_555 FE ? D HEM . ? B HEM 400 ? 1_555 ND  ? D HEM .  ? B HEM 400  ? 1_555 88.0  ? 
23 NA  ? D HEM .  ? B HEM 400 ? 1_555 FE ? D HEM . ? B HEM 400 ? 1_555 ND  ? D HEM .  ? B HEM 400  ? 1_555 90.0  ? 
24 NB  ? D HEM .  ? B HEM 400 ? 1_555 FE ? D HEM . ? B HEM 400 ? 1_555 ND  ? D HEM .  ? B HEM 400  ? 1_555 176.7 ? 
25 NC  ? D HEM .  ? B HEM 400 ? 1_555 FE ? D HEM . ? B HEM 400 ? 1_555 ND  ? D HEM .  ? B HEM 400  ? 1_555 92.3  ? 
26 NE2 ? B HIS 63 ? B HIS 63  ? 1_555 FE ? D HEM . ? B HEM 400 ? 1_555 NE2 ? B HIS 92 ? B HIS 92   ? 1_555 173.4 ? 
27 NA  ? D HEM .  ? B HEM 400 ? 1_555 FE ? D HEM . ? B HEM 400 ? 1_555 NE2 ? B HIS 92 ? B HIS 92   ? 1_555 89.3  ? 
28 NB  ? D HEM .  ? B HEM 400 ? 1_555 FE ? D HEM . ? B HEM 400 ? 1_555 NE2 ? B HIS 92 ? B HIS 92   ? 1_555 92.1  ? 
29 NC  ? D HEM .  ? B HEM 400 ? 1_555 FE ? D HEM . ? B HEM 400 ? 1_555 NE2 ? B HIS 92 ? B HIS 92   ? 1_555 91.1  ? 
30 ND  ? D HEM .  ? B HEM 400 ? 1_555 FE ? D HEM . ? B HEM 400 ? 1_555 NE2 ? B HIS 92 ? B HIS 92   ? 1_555 85.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-07-24 
2 'Structure model' 1 1 2007-10-09 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
5 'Structure model' 1 4 2019-07-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
4 5 'Structure model' 'Data collection'           
5 5 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software    
2 5 'Structure model' software    
3 5 'Structure model' struct_conn 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_software.classification'            
2 5 'Structure model' '_software.contact_author'            
3 5 'Structure model' '_software.contact_author_email'      
4 5 'Structure model' '_software.location'                  
5 5 'Structure model' '_software.name'                      
6 5 'Structure model' '_software.type'                      
7 5 'Structure model' '_software.version'                   
8 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR      3.851 ?                ?       ?                    ?                        refinement        ? ?          ? 1 
SCALEPACK   .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
CNS         .     ?                package 'Axel T. Brunger'    axel.brunger@yale.edu    refinement        
http://cns.csb.yale.edu/v1.1/                    Fortran_77 ? 3 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 4 
MAR345dtb   .     ?                ?       ?                    ?                        'data collection' ? ?          ? 5 
AMoRE       .     ?                ?       ?                    ?                        phasing           ? ?          ? 6 
DENZO       .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 7 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    1027 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    1032 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.80 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 11 ? B CZ A ARG 11 ? B NH2 A ARG 11 ? B 116.92 120.30 -3.38 0.50 N 
2 1 NE A ARG 93 ? ? CZ A ARG 93 ? ? NH1 A ARG 93 ? ? 124.39 120.30 4.09  0.50 N 
3 1 CB B ASP 72 ? ? CG B ASP 72 ? ? OD2 B ASP 72 ? ? 112.77 118.30 -5.53 0.90 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     76 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -157.49 
_pdbx_validate_torsion.psi             82.02 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B PHE 45 ? B PHE 45 
2 1 Y 1 B GLY 46 ? B GLY 46 
3 1 Y 1 B ASN 47 ? B ASN 47 
4 1 Y 1 B LEU 48 ? B LEU 48 
5 1 Y 1 B TYR 49 ? B TYR 49 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PROTOPORPHYRIN IX CONTAINING FE' HEM 
4 water                             HOH 
#