data_2PFP
# 
_entry.id   2PFP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2PFP         pdb_00002pfp 10.2210/pdb2pfp/pdb 
NDB   PD0991       ?            ?                   
RCSB  RCSB042325   ?            ?                   
WWPDB D_1000042325 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2PFN 'Na in the active site of DNA Polymerase lambda'               unspecified 
PDB 2PFO 'DNA Polymerase lambda in complex with DNA and dUPNPP'         unspecified 
PDB 2PFQ 'Mn promotes catalysis in a DNA polymerase lambda-DNA crystal' unspecified 
# 
_pdbx_database_status.entry_id                        2PFP 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-05 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Garcia-Diaz, M.' 1 
'Bebenek, K.'     2 
'Krahn, J.M.'     3 
'Pedersen, L.C.'  4 
'Kunkel, T.A.'    5 
# 
_citation.id                        primary 
_citation.title                     'Role of the catalytic metal during polymerization by DNA polymerase lambda.' 
_citation.journal_abbrev            'DNA Repair' 
_citation.journal_volume            6 
_citation.page_first                1333 
_citation.page_last                 1340 
_citation.year                      2007 
_citation.journal_id_ASTM           ? 
_citation.country                   NE 
_citation.journal_id_ISSN           1568-7864 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17475573 
_citation.pdbx_database_id_DOI      10.1016/j.dnarep.2007.03.005 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Garcia-Diaz, M.' 1 ? 
primary 'Bebenek, K.'     2 ? 
primary 'Krahn, J.M.'     3 ? 
primary 'Pedersen, L.C.'  4 ? 
primary 'Kunkel, T.A.'    5 ? 
# 
_cell.entry_id           2PFP 
_cell.length_a           55.893 
_cell.length_b           62.853 
_cell.length_c           140.570 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2PFP 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Template                           3390.209  1   ?                   ?     ? ? 
2 polymer     syn Primer                             1793.219  1   ?                   ?     ? ? 
3 polymer     syn 'Downstream Primer'                1191.818  1   ?                   ?     ? ? 
4 polymer     man 'DNA polymerase lambda'            37447.688 1   '2.7.7.7, 4.2.99.-' C543A ? ? 
5 non-polymer syn 'SODIUM ION'                       22.990    5   ?                   ?     ? ? 
6 non-polymer syn 'MAGNESIUM ION'                    24.305    1   ?                   ?     ? ? 
7 non-polymer syn "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE" 467.157   1   ?                   ?     ? ? 
8 water       nat water                              18.015    331 ?                   ?     ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        'Pol Lambda, DNA polymerase kappa, DNA polymerase beta-2, Pol beta2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DC)(DG)(DG)(DC)(DG)(DG)(DT)(DA)(DC)(DT)(DG)' CGGCGGTACTG T ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DG)(DT)(DA)(DC)' CAGTAC P ? 
3 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DG)' GCCG D ? 
4 'polypeptide(L)'        no no 
;MAQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSIPGIGKRMAEKIIEILESG
HLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQ
KAAQAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLP
GPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGAKVGPGRVLPTPTEKDVF
RLLGLPYREPAERDW
;
;MAQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSIPGIGKRMAEKIIEILESG
HLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQ
KAAQAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLP
GPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGAKVGPGRVLPTPTEKDVF
RLLGLPYREPAERDW
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DG  n 
1 4   DC  n 
1 5   DG  n 
1 6   DG  n 
1 7   DT  n 
1 8   DA  n 
1 9   DC  n 
1 10  DT  n 
1 11  DG  n 
2 1   DC  n 
2 2   DA  n 
2 3   DG  n 
2 4   DT  n 
2 5   DA  n 
2 6   DC  n 
3 1   DG  n 
3 2   DC  n 
3 3   DC  n 
3 4   DG  n 
4 1   MET n 
4 2   ALA n 
4 3   GLN n 
4 4   PRO n 
4 5   SER n 
4 6   SER n 
4 7   GLN n 
4 8   LYS n 
4 9   ALA n 
4 10  THR n 
4 11  ASN n 
4 12  HIS n 
4 13  ASN n 
4 14  LEU n 
4 15  HIS n 
4 16  ILE n 
4 17  THR n 
4 18  GLU n 
4 19  LYS n 
4 20  LEU n 
4 21  GLU n 
4 22  VAL n 
4 23  LEU n 
4 24  ALA n 
4 25  LYS n 
4 26  ALA n 
4 27  TYR n 
4 28  SER n 
4 29  VAL n 
4 30  GLN n 
4 31  GLY n 
4 32  ASP n 
4 33  LYS n 
4 34  TRP n 
4 35  ARG n 
4 36  ALA n 
4 37  LEU n 
4 38  GLY n 
4 39  TYR n 
4 40  ALA n 
4 41  LYS n 
4 42  ALA n 
4 43  ILE n 
4 44  ASN n 
4 45  ALA n 
4 46  LEU n 
4 47  LYS n 
4 48  SER n 
4 49  PHE n 
4 50  HIS n 
4 51  LYS n 
4 52  PRO n 
4 53  VAL n 
4 54  THR n 
4 55  SER n 
4 56  TYR n 
4 57  GLN n 
4 58  GLU n 
4 59  ALA n 
4 60  CYS n 
4 61  SER n 
4 62  ILE n 
4 63  PRO n 
4 64  GLY n 
4 65  ILE n 
4 66  GLY n 
4 67  LYS n 
4 68  ARG n 
4 69  MET n 
4 70  ALA n 
4 71  GLU n 
4 72  LYS n 
4 73  ILE n 
4 74  ILE n 
4 75  GLU n 
4 76  ILE n 
4 77  LEU n 
4 78  GLU n 
4 79  SER n 
4 80  GLY n 
4 81  HIS n 
4 82  LEU n 
4 83  ARG n 
4 84  LYS n 
4 85  LEU n 
4 86  ASP n 
4 87  HIS n 
4 88  ILE n 
4 89  SER n 
4 90  GLU n 
4 91  SER n 
4 92  VAL n 
4 93  PRO n 
4 94  VAL n 
4 95  LEU n 
4 96  GLU n 
4 97  LEU n 
4 98  PHE n 
4 99  SER n 
4 100 ASN n 
4 101 ILE n 
4 102 TRP n 
4 103 GLY n 
4 104 ALA n 
4 105 GLY n 
4 106 THR n 
4 107 LYS n 
4 108 THR n 
4 109 ALA n 
4 110 GLN n 
4 111 MET n 
4 112 TRP n 
4 113 TYR n 
4 114 GLN n 
4 115 GLN n 
4 116 GLY n 
4 117 PHE n 
4 118 ARG n 
4 119 SER n 
4 120 LEU n 
4 121 GLU n 
4 122 ASP n 
4 123 ILE n 
4 124 ARG n 
4 125 SER n 
4 126 GLN n 
4 127 ALA n 
4 128 SER n 
4 129 LEU n 
4 130 THR n 
4 131 THR n 
4 132 GLN n 
4 133 GLN n 
4 134 ALA n 
4 135 ILE n 
4 136 GLY n 
4 137 LEU n 
4 138 LYS n 
4 139 HIS n 
4 140 TYR n 
4 141 SER n 
4 142 ASP n 
4 143 PHE n 
4 144 LEU n 
4 145 GLU n 
4 146 ARG n 
4 147 MET n 
4 148 PRO n 
4 149 ARG n 
4 150 GLU n 
4 151 GLU n 
4 152 ALA n 
4 153 THR n 
4 154 GLU n 
4 155 ILE n 
4 156 GLU n 
4 157 GLN n 
4 158 THR n 
4 159 VAL n 
4 160 GLN n 
4 161 LYS n 
4 162 ALA n 
4 163 ALA n 
4 164 GLN n 
4 165 ALA n 
4 166 PHE n 
4 167 ASN n 
4 168 SER n 
4 169 GLY n 
4 170 LEU n 
4 171 LEU n 
4 172 CYS n 
4 173 VAL n 
4 174 ALA n 
4 175 CYS n 
4 176 GLY n 
4 177 SER n 
4 178 TYR n 
4 179 ARG n 
4 180 ARG n 
4 181 GLY n 
4 182 LYS n 
4 183 ALA n 
4 184 THR n 
4 185 CYS n 
4 186 GLY n 
4 187 ASP n 
4 188 VAL n 
4 189 ASP n 
4 190 VAL n 
4 191 LEU n 
4 192 ILE n 
4 193 THR n 
4 194 HIS n 
4 195 PRO n 
4 196 ASP n 
4 197 GLY n 
4 198 ARG n 
4 199 SER n 
4 200 HIS n 
4 201 ARG n 
4 202 GLY n 
4 203 ILE n 
4 204 PHE n 
4 205 SER n 
4 206 ARG n 
4 207 LEU n 
4 208 LEU n 
4 209 ASP n 
4 210 SER n 
4 211 LEU n 
4 212 ARG n 
4 213 GLN n 
4 214 GLU n 
4 215 GLY n 
4 216 PHE n 
4 217 LEU n 
4 218 THR n 
4 219 ASP n 
4 220 ASP n 
4 221 LEU n 
4 222 VAL n 
4 223 SER n 
4 224 GLN n 
4 225 GLU n 
4 226 GLU n 
4 227 ASN n 
4 228 GLY n 
4 229 GLN n 
4 230 GLN n 
4 231 GLN n 
4 232 LYS n 
4 233 TYR n 
4 234 LEU n 
4 235 GLY n 
4 236 VAL n 
4 237 CYS n 
4 238 ARG n 
4 239 LEU n 
4 240 PRO n 
4 241 GLY n 
4 242 PRO n 
4 243 GLY n 
4 244 ARG n 
4 245 ARG n 
4 246 HIS n 
4 247 ARG n 
4 248 ARG n 
4 249 LEU n 
4 250 ASP n 
4 251 ILE n 
4 252 ILE n 
4 253 VAL n 
4 254 VAL n 
4 255 PRO n 
4 256 TYR n 
4 257 SER n 
4 258 GLU n 
4 259 PHE n 
4 260 ALA n 
4 261 CYS n 
4 262 ALA n 
4 263 LEU n 
4 264 LEU n 
4 265 TYR n 
4 266 PHE n 
4 267 THR n 
4 268 GLY n 
4 269 SER n 
4 270 ALA n 
4 271 HIS n 
4 272 PHE n 
4 273 ASN n 
4 274 ARG n 
4 275 SER n 
4 276 MET n 
4 277 ARG n 
4 278 ALA n 
4 279 LEU n 
4 280 ALA n 
4 281 LYS n 
4 282 THR n 
4 283 LYS n 
4 284 GLY n 
4 285 MET n 
4 286 SER n 
4 287 LEU n 
4 288 SER n 
4 289 GLU n 
4 290 HIS n 
4 291 ALA n 
4 292 LEU n 
4 293 SER n 
4 294 THR n 
4 295 ALA n 
4 296 VAL n 
4 297 VAL n 
4 298 ARG n 
4 299 ASN n 
4 300 THR n 
4 301 HIS n 
4 302 GLY n 
4 303 ALA n 
4 304 LYS n 
4 305 VAL n 
4 306 GLY n 
4 307 PRO n 
4 308 GLY n 
4 309 ARG n 
4 310 VAL n 
4 311 LEU n 
4 312 PRO n 
4 313 THR n 
4 314 PRO n 
4 315 THR n 
4 316 GLU n 
4 317 LYS n 
4 318 ASP n 
4 319 VAL n 
4 320 PHE n 
4 321 ARG n 
4 322 LEU n 
4 323 LEU n 
4 324 GLY n 
4 325 LEU n 
4 326 PRO n 
4 327 TYR n 
4 328 ARG n 
4 329 GLU n 
4 330 PRO n 
4 331 ALA n 
4 332 GLU n 
4 333 ARG n 
4 334 ASP n 
4 335 TRP n 
# 
_entity_src_gen.entity_id                          4 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 POLL 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOLL_HUMAN Q9UGP5 4 
;AQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSIPGIGKRMAEKIIEILESGH
LRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQK
AAQAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLPG
PGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFR
LLGLPYREPAERDW
;
242 ? 
2 PDB 2PFP        2PFP   1 ? ?   ? 
3 PDB 2PFP        2PFP   2 ? ?   ? 
4 PDB 2PFP        2PFP   3 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2PFP A 2 ? 335 ? Q9UGP5 242 ? 575 ? 242 575 
2 2 2PFP T 1 ? 11  ? 2PFP   1   ? 11  ? 1   11  
3 3 2PFP P 1 ? 6   ? 2PFP   1   ? 6   ? 1   6   
4 4 2PFP D 1 ? 4   ? 2PFP   1   ? 4   ? 1   4   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2PFP MET A 1   ? UNP Q9UGP5 ?   ?   'initiating methionine' 241 1 
1 2PFP ALA A 303 ? UNP Q9UGP5 CYS 543 'engineered mutation'   543 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'   307.197 
DCP non-polymer         . "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"   ? 'C9 H16 N3 O13 P3' 467.157 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'             24.305  
NA  non-polymer         . 'SODIUM ION'                         ? 'Na 1'             22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'      117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2PFP 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.80 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   56.04 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.temp            278 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'10-20% 2-propanol, 0.2 M sodium citrate and 0.1M sodium cacodylate , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 278K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 2-propanol          ? ? ? 
1 2 1 'sodium citrate'    ? ? ? 
1 3 1 'sodium cacodylate' ? ? ? 
1 4 2 2-propanol          ? ? ? 
1 5 2 'sodium citrate'    ? ? ? 
1 6 2 'sodium cacodylate' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RIGAKU SATURN 92' 
_diffrn_detector.pdbx_collection_date   2005-06-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     2PFP 
_reflns.d_resolution_high            2.100 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   29762 
_reflns.pdbx_Rmerge_I_obs            0.110 
_reflns.pdbx_netI_over_sigmaI        19.400 
_reflns.pdbx_chi_squared             1.075 
_reflns.pdbx_redundancy              3.300 
_reflns.percent_possible_obs         99.500 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.10 2.18  ? ? ? 0.316 ? ? 0.892 2.20 ? 2823 96.40  ? 1  
2.18 2.26  ? ? ? 0.291 ? ? 1.027 2.40 ? 2919 99.00  ? 2  
2.26 2.37  ? ? ? 0.233 ? ? 1.056 2.60 ? 2924 99.80  ? 3  
2.37 2.49  ? ? ? 0.189 ? ? 1.041 2.80 ? 2945 100.00 ? 4  
2.49 2.65  ? ? ? 0.158 ? ? 0.970 3.00 ? 2984 99.90  ? 5  
2.65 2.85  ? ? ? 0.131 ? ? 0.991 3.20 ? 2947 99.90  ? 6  
2.85 3.14  ? ? ? 0.114 ? ? 1.016 3.50 ? 2986 100.00 ? 7  
3.14 3.59  ? ? ? 0.126 ? ? 1.175 3.80 ? 2986 100.00 ? 8  
3.59 4.52  ? ? ? 0.112 ? ? 1.128 4.00 ? 3045 100.00 ? 9  
4.52 50.00 ? ? ? 0.088 ? ? 1.184 5.00 ? 3203 99.70  ? 10 
# 
_refine.entry_id                                 2PFP 
_refine.ls_d_res_high                            2.100 
_refine.ls_d_res_low                             50.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    93.300 
_refine.ls_number_reflns_obs                     27679 
_refine.ls_R_factor_R_work                       0.208 
_refine.ls_R_factor_R_free                       0.245 
_refine.ls_percent_reflns_R_free                 4.600 
_refine.ls_number_reflns_R_free                  1358 
_refine.B_iso_mean                               41.399 
_refine.solvent_model_param_bsol                 54.021 
_refine.aniso_B[1][1]                            10.562 
_refine.aniso_B[2][2]                            -13.468 
_refine.aniso_B[3][3]                            2.906 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1xsn 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2479 
_refine_hist.pdbx_number_atoms_nucleic_acid   427 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             331 
_refine_hist.number_atoms_total               3271 
_refine_hist.d_res_high                       2.100 
_refine_hist.d_res_low                        50.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_mcbond_it  ? 1.271 1.500 ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  ? 1.934 2.000 ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it ? 2.078 2.000 ? 'X-RAY DIFFRACTION' ? 
c_scangle_it ? 2.745 2.500 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 CNS_TOPPAR:protein_rep.param ? 'X-RAY DIFFRACTION' 
2 CNS_TOPPAR:dna-rna_rep.param ? 'X-RAY DIFFRACTION' 
3 CNS_TOPPAR:water_rep.param   ? 'X-RAY DIFFRACTION' 
4 dctp1.par                    ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2PFP 
_struct.title                     'DNA Polymerase lambda in complex with DNA and dCTP' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2PFP 
_struct_keywords.pdbx_keywords   'transferase, lyase/DNA' 
_struct_keywords.text            
'DNA polymerase, DNA Repair, phosphoryl transfer reaction, manganese, transferase, lyase-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 7 ? 
L N N 8 ? 
M N N 8 ? 
N N N 8 ? 
O N N 8 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               ? 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN D 13  ? GLN D 30  ? ASN A 253 GLN A 270 1 ? 18 
HELX_P HELX_P2  2  ASP D 32  ? LEU D 46  ? ASP A 272 LEU A 286 1 ? 15 
HELX_P HELX_P3  3  SER D 55  ? SER D 61  ? SER A 295 SER A 301 1 ? 7  
HELX_P HELX_P4  4  GLY D 66  ? SER D 79  ? GLY A 306 SER A 319 1 ? 14 
HELX_P HELX_P5  5  LEU D 82  ? ILE D 88  ? LEU A 322 ILE A 328 5 ? 7  
HELX_P HELX_P6  6  SER D 91  ? ASN D 100 ? SER A 331 ASN A 340 1 ? 10 
HELX_P HELX_P7  7  GLY D 105 ? GLN D 115 ? GLY A 345 GLN A 355 1 ? 11 
HELX_P HELX_P8  8  SER D 119 ? ALA D 127 ? SER A 359 ALA A 367 1 ? 9  
HELX_P HELX_P9  9  THR D 130 ? HIS D 139 ? THR A 370 HIS A 379 1 ? 10 
HELX_P HELX_P10 10 HIS D 139 ? GLU D 145 ? HIS A 379 GLU A 385 1 ? 7  
HELX_P HELX_P11 11 ARG D 149 ? PHE D 166 ? ARG A 389 PHE A 406 1 ? 18 
HELX_P HELX_P12 12 CYS D 175 ? ARG D 180 ? CYS A 415 ARG A 420 1 ? 6  
HELX_P HELX_P13 13 ILE D 203 ? GLU D 214 ? ILE A 443 GLU A 454 1 ? 12 
HELX_P HELX_P14 14 PRO D 255 ? SER D 257 ? PRO A 495 SER A 497 5 ? 3  
HELX_P HELX_P15 15 GLU D 258 ? GLY D 268 ? GLU A 498 GLY A 508 1 ? 11 
HELX_P HELX_P16 16 SER D 269 ? LYS D 283 ? SER A 509 LYS A 523 1 ? 15 
HELX_P HELX_P17 17 THR D 315 ? LEU D 323 ? THR A 555 LEU A 563 1 ? 9  
HELX_P HELX_P18 18 GLU D 329 ? ASP D 334 ? GLU A 569 ASP A 574 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? L HOH .   O   ? ? ? 1_555 I NA  . NA  ? ? T HOH 42  A NA  753 1_555 ? ? ? ? ? ? ?            2.680 ? ? 
metalc2  metalc ? ? B DA  5   OP1 ? ? ? 1_555 H NA  . NA  ? ? P DA  5   A NA  752 1_555 ? ? ? ? ? ? ?            2.390 ? ? 
metalc3  metalc ? ? M HOH .   O   ? ? ? 1_555 H NA  . NA  ? ? P HOH 10  A NA  752 1_555 ? ? ? ? ? ? ?            2.440 ? ? 
metalc4  metalc ? ? M HOH .   O   ? ? ? 1_555 H NA  . NA  ? ? P HOH 30  A NA  752 1_555 ? ? ? ? ? ? ?            2.574 ? ? 
metalc5  metalc ? ? C DG  1   OP2 ? ? ? 1_555 E NA  . NA  ? ? D DG  1   D NA  503 1_555 ? ? ? ? ? ? ?            2.358 ? ? 
metalc6  metalc ? ? D CYS 60  O   ? ? ? 1_555 J NA  . NA  ? ? A CYS 300 A NA  754 1_555 ? ? ? ? ? ? ?            2.504 ? ? 
metalc7  metalc ? ? D ILE 62  O   ? ? ? 1_555 J NA  . NA  ? ? A ILE 302 A NA  754 1_555 ? ? ? ? ? ? ?            2.241 ? ? 
metalc8  metalc ? ? D SER 99  O   ? ? ? 1_555 H NA  . NA  ? ? A SER 339 A NA  752 1_555 ? ? ? ? ? ? ?            2.372 ? ? 
metalc9  metalc ? ? D ILE 101 O   ? ? ? 1_555 H NA  . NA  ? ? A ILE 341 A NA  752 1_555 ? ? ? ? ? ? ?            2.423 ? ? 
metalc10 metalc ? ? D ALA 104 O   ? ? ? 1_555 H NA  . NA  ? ? A ALA 344 A NA  752 1_555 ? ? ? ? ? ? ?            2.270 ? ? 
metalc11 metalc ? ? D ASP 187 OD1 ? ? ? 1_555 F MG  . MG  ? ? A ASP 427 A MG  750 1_555 ? ? ? ? ? ? ?            2.217 ? ? 
metalc12 metalc ? ? D ASP 187 OD2 ? ? ? 1_555 G NA  . NA  ? ? A ASP 427 A NA  751 1_555 ? ? ? ? ? ? ?            2.191 ? ? 
metalc13 metalc ? ? D ASP 189 OD2 ? ? ? 1_555 F MG  . MG  ? ? A ASP 429 A MG  750 1_555 ? ? ? ? ? ? ?            2.215 ? ? 
metalc14 metalc ? ? D ASP 189 OD1 ? ? ? 1_555 G NA  . NA  ? ? A ASP 429 A NA  751 1_555 ? ? ? ? ? ? ?            2.391 ? ? 
metalc15 metalc ? ? D SER 223 O   ? ? ? 1_555 I NA  . NA  ? ? A SER 463 A NA  753 1_555 ? ? ? ? ? ? ?            2.044 ? ? 
metalc16 metalc ? ? D ASP 250 OD1 ? ? ? 1_555 G NA  . NA  ? ? A ASP 490 A NA  751 1_555 ? ? ? ? ? ? ?            2.587 ? ? 
metalc17 metalc ? ? F MG  .   MG  ? ? ? 1_555 K DCP . O2A ? ? A MG  750 A DCP 755 1_555 ? ? ? ? ? ? ?            1.972 ? ? 
metalc18 metalc ? ? F MG  .   MG  ? ? ? 1_555 K DCP . O2B ? ? A MG  750 A DCP 755 1_555 ? ? ? ? ? ? ?            1.883 ? ? 
metalc19 metalc ? ? F MG  .   MG  ? ? ? 1_555 K DCP . O2G ? ? A MG  750 A DCP 755 1_555 ? ? ? ? ? ? ?            2.097 ? ? 
metalc20 metalc ? ? F MG  .   MG  ? ? ? 1_555 O HOH . O   ? ? A MG  750 A HOH 776 1_555 ? ? ? ? ? ? ?            2.154 ? ? 
metalc21 metalc ? ? G NA  .   NA  ? ? ? 1_555 K DCP . O2A ? ? A NA  751 A DCP 755 1_555 ? ? ? ? ? ? ?            2.455 ? ? 
metalc22 metalc ? ? I NA  .   NA  ? ? ? 1_555 O HOH . O   ? ? A NA  753 A HOH 766 1_555 ? ? ? ? ? ? ?            2.482 ? ? 
metalc23 metalc ? ? I NA  .   NA  ? ? ? 1_555 O HOH . O   ? ? A NA  753 A HOH 781 1_555 ? ? ? ? ? ? ?            2.630 ? ? 
metalc24 metalc ? ? I NA  .   NA  ? ? ? 1_555 O HOH . O   ? ? A NA  753 A HOH 895 1_555 ? ? ? ? ? ? ?            2.888 ? ? 
metalc25 metalc ? ? I NA  .   NA  ? ? ? 1_555 O HOH . O   ? ? A NA  753 A HOH 987 1_555 ? ? ? ? ? ? ?            2.464 ? ? 
metalc26 metalc ? ? J NA  .   NA  ? ? ? 1_555 O HOH . O   ? ? A NA  754 A HOH 788 1_555 ? ? ? ? ? ? ?            2.788 ? ? 
metalc27 metalc ? ? J NA  .   NA  ? ? ? 1_555 O HOH . O   ? ? A NA  754 A HOH 992 1_555 ? ? ? ? ? ? ?            2.643 ? ? 
hydrog1  hydrog ? ? A DC  1   N3  ? ? ? 1_555 C DG  4 N1  ? ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog2  hydrog ? ? A DC  1   N4  ? ? ? 1_555 C DG  4 O6  ? ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3  hydrog ? ? A DC  1   O2  ? ? ? 1_555 C DG  4 N2  ? ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4  hydrog ? ? A DG  2   N1  ? ? ? 1_555 C DC  3 N3  ? ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog5  hydrog ? ? A DG  2   N2  ? ? ? 1_555 C DC  3 O2  ? ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6  hydrog ? ? A DG  2   O6  ? ? ? 1_555 C DC  3 N4  ? ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog7  hydrog ? ? A DG  3   N1  ? ? ? 1_555 C DC  2 N3  ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8  hydrog ? ? A DG  3   N2  ? ? ? 1_555 C DC  2 O2  ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog9  hydrog ? ? A DG  3   O6  ? ? ? 1_555 C DC  2 N4  ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog10 hydrog ? ? A DC  4   N3  ? ? ? 1_555 C DG  1 N1  ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog11 hydrog ? ? A DC  4   N4  ? ? ? 1_555 C DG  1 O6  ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12 hydrog ? ? A DC  4   O2  ? ? ? 1_555 C DG  1 N2  ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13 hydrog ? ? A DG  6   N1  ? ? ? 1_555 B DC  6 N3  ? ? T DG  6   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog14 hydrog ? ? A DG  6   N2  ? ? ? 1_555 B DC  6 O2  ? ? T DG  6   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog15 hydrog ? ? A DG  6   O6  ? ? ? 1_555 B DC  6 N4  ? ? T DG  6   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog16 hydrog ? ? A DT  7   N3  ? ? ? 1_555 B DA  5 N1  ? ? T DT  7   P DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog17 hydrog ? ? A DT  7   O4  ? ? ? 1_555 B DA  5 N6  ? ? T DT  7   P DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog18 hydrog ? ? A DA  8   N1  ? ? ? 1_555 B DT  4 N3  ? ? T DA  8   P DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog19 hydrog ? ? A DA  8   N6  ? ? ? 1_555 B DT  4 O4  ? ? T DA  8   P DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20 hydrog ? ? A DC  9   N3  ? ? ? 1_555 B DG  3 N1  ? ? T DC  9   P DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21 hydrog ? ? A DC  9   N4  ? ? ? 1_555 B DG  3 O6  ? ? T DC  9   P DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22 hydrog ? ? A DC  9   O2  ? ? ? 1_555 B DG  3 N2  ? ? T DC  9   P DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23 hydrog ? ? A DT  10  N3  ? ? ? 1_555 B DA  2 N1  ? ? T DT  10  P DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog24 hydrog ? ? A DT  10  O4  ? ? ? 1_555 B DA  2 N6  ? ? T DT  10  P DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog25 hydrog ? ? A DG  11  N1  ? ? ? 1_555 B DC  1 N3  ? ? T DG  11  P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog26 hydrog ? ? A DG  11  N2  ? ? ? 1_555 B DC  1 O2  ? ? T DG  11  P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog27 hydrog ? ? A DG  11  O6  ? ? ? 1_555 B DC  1 N4  ? ? T DG  11  P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           268 
_struct_mon_prot_cis.label_asym_id          D 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            508 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    269 
_struct_mon_prot_cis.pdbx_label_asym_id_2   D 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     509 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.16 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 3 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET D 147 ? PRO D 148 ? MET A 387 PRO A 388 
A 2 THR D 184 ? CYS D 185 ? THR A 424 CYS A 425 
B 1 LEU D 171 ? ALA D 174 ? LEU A 411 ALA A 414 
B 2 VAL D 188 ? THR D 193 ? VAL A 428 THR A 433 
B 3 ARG D 247 ? VAL D 253 ? ARG A 487 VAL A 493 
B 4 LYS D 232 ? CYS D 237 ? LYS A 472 CYS A 477 
B 5 LEU D 217 ? VAL D 222 ? LEU A 457 VAL A 462 
C 1 SER D 286 ? LEU D 287 ? SER A 526 LEU A 527 
C 2 LEU D 292 ? THR D 294 ? LEU A 532 THR A 534 
C 3 ARG D 309 ? VAL D 310 ? ARG A 549 VAL A 550 
D 1 VAL D 297 ? ARG D 298 ? VAL A 537 ARG A 538 
D 2 LYS D 304 ? GLY D 306 ? LYS A 544 GLY A 546 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N MET D 147 ? N MET A 387 O CYS D 185 ? O CYS A 425 
B 1 2 N VAL D 173 ? N VAL A 413 O LEU D 191 ? O LEU A 431 
B 2 3 N VAL D 190 ? N VAL A 430 O ASP D 250 ? O ASP A 490 
B 3 4 O LEU D 249 ? O LEU A 489 N GLY D 235 ? N GLY A 475 
B 4 5 O VAL D 236 ? O VAL A 476 N THR D 218 ? N THR A 458 
C 1 2 N SER D 286 ? N SER A 526 O SER D 293 ? O SER A 533 
C 2 3 N THR D 294 ? N THR A 534 O ARG D 309 ? O ARG A 549 
D 1 2 N VAL D 297 ? N VAL A 537 O GLY D 306 ? O GLY A 546 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  750 ? 5  'BINDING SITE FOR RESIDUE MG A 750'  
AC2 Software A NA  751 ? 6  'BINDING SITE FOR RESIDUE NA A 751'  
AC3 Software A NA  752 ? 6  'BINDING SITE FOR RESIDUE NA A 752'  
AC4 Software A NA  753 ? 7  'BINDING SITE FOR RESIDUE NA A 753'  
AC5 Software D NA  503 ? 2  'BINDING SITE FOR RESIDUE NA D 503'  
AC6 Software A NA  754 ? 7  'BINDING SITE FOR RESIDUE NA A 754'  
AC7 Software A DCP 755 ? 24 'BINDING SITE FOR RESIDUE DCP A 755' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASP D 187 ? ASP A 427 . ? 1_555 ? 
2  AC1 5  ASP D 189 ? ASP A 429 . ? 1_555 ? 
3  AC1 5  NA  G .   ? NA  A 751 . ? 1_555 ? 
4  AC1 5  DCP K .   ? DCP A 755 . ? 1_555 ? 
5  AC1 5  HOH O .   ? HOH A 776 . ? 1_555 ? 
6  AC2 6  ASP D 187 ? ASP A 427 . ? 1_555 ? 
7  AC2 6  ASP D 189 ? ASP A 429 . ? 1_555 ? 
8  AC2 6  ASP D 250 ? ASP A 490 . ? 1_555 ? 
9  AC2 6  MG  F .   ? MG  A 750 . ? 1_555 ? 
10 AC2 6  DCP K .   ? DCP A 755 . ? 1_555 ? 
11 AC2 6  DC  B 6   ? DC  P 6   . ? 1_555 ? 
12 AC3 6  SER D 99  ? SER A 339 . ? 1_555 ? 
13 AC3 6  ILE D 101 ? ILE A 341 . ? 1_555 ? 
14 AC3 6  ALA D 104 ? ALA A 344 . ? 1_555 ? 
15 AC3 6  DA  B 5   ? DA  P 5   . ? 1_555 ? 
16 AC3 6  HOH M .   ? HOH P 10  . ? 1_555 ? 
17 AC3 6  HOH M .   ? HOH P 30  . ? 1_555 ? 
18 AC4 7  SER D 223 ? SER A 463 . ? 1_555 ? 
19 AC4 7  HOH O .   ? HOH A 766 . ? 1_555 ? 
20 AC4 7  HOH O .   ? HOH A 781 . ? 1_555 ? 
21 AC4 7  HOH O .   ? HOH A 895 . ? 1_555 ? 
22 AC4 7  HOH O .   ? HOH A 987 . ? 1_555 ? 
23 AC4 7  DT  A 10  ? DT  T 10  . ? 1_555 ? 
24 AC4 7  HOH L .   ? HOH T 42  . ? 1_555 ? 
25 AC5 2  ARG D 68  ? ARG A 308 . ? 1_555 ? 
26 AC5 2  DG  C 1   ? DG  D 1   . ? 1_555 ? 
27 AC6 7  CYS D 60  ? CYS A 300 . ? 1_555 ? 
28 AC6 7  SER D 61  ? SER A 301 . ? 1_555 ? 
29 AC6 7  ILE D 62  ? ILE A 302 . ? 1_555 ? 
30 AC6 7  PRO D 63  ? PRO A 303 . ? 1_555 ? 
31 AC6 7  ILE D 65  ? ILE A 305 . ? 1_555 ? 
32 AC6 7  HOH O .   ? HOH A 788 . ? 1_555 ? 
33 AC6 7  HOH O .   ? HOH A 992 . ? 1_555 ? 
34 AC7 24 ARG D 146 ? ARG A 386 . ? 1_555 ? 
35 AC7 24 GLY D 176 ? GLY A 416 . ? 1_555 ? 
36 AC7 24 SER D 177 ? SER A 417 . ? 1_555 ? 
37 AC7 24 ARG D 180 ? ARG A 420 . ? 1_555 ? 
38 AC7 24 GLY D 186 ? GLY A 426 . ? 1_555 ? 
39 AC7 24 ASP D 187 ? ASP A 427 . ? 1_555 ? 
40 AC7 24 ASP D 189 ? ASP A 429 . ? 1_555 ? 
41 AC7 24 TYR D 265 ? TYR A 505 . ? 1_555 ? 
42 AC7 24 PHE D 266 ? PHE A 506 . ? 1_555 ? 
43 AC7 24 THR D 267 ? THR A 507 . ? 1_555 ? 
44 AC7 24 GLY D 268 ? GLY A 508 . ? 1_555 ? 
45 AC7 24 ALA D 270 ? ALA A 510 . ? 1_555 ? 
46 AC7 24 ASN D 273 ? ASN A 513 . ? 1_555 ? 
47 AC7 24 MG  F .   ? MG  A 750 . ? 1_555 ? 
48 AC7 24 NA  G .   ? NA  A 751 . ? 1_555 ? 
49 AC7 24 HOH O .   ? HOH A 759 . ? 1_555 ? 
50 AC7 24 HOH O .   ? HOH A 776 . ? 1_555 ? 
51 AC7 24 HOH O .   ? HOH A 829 . ? 1_555 ? 
52 AC7 24 HOH O .   ? HOH A 834 . ? 1_555 ? 
53 AC7 24 HOH O .   ? HOH A 866 . ? 1_555 ? 
54 AC7 24 HOH O .   ? HOH A 952 . ? 1_555 ? 
55 AC7 24 DC  B 6   ? DC  P 6   . ? 1_555 ? 
56 AC7 24 HOH M .   ? HOH P 7   . ? 1_555 ? 
57 AC7 24 DG  A 5   ? DG  T 5   . ? 1_555 ? 
# 
_atom_sites.entry_id                    2PFP 
_atom_sites.fract_transf_matrix[1][1]   0.017891 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015910 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007114 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DC  A 1 1   ? -3.971  -3.306  28.566  1.00 46.90 ? 1    DC  T "O5'" 1 
ATOM   2    C  "C5'" . DC  A 1 1   ? -5.238  -2.775  28.994  1.00 43.62 ? 1    DC  T "C5'" 1 
ATOM   3    C  "C4'" . DC  A 1 1   ? -5.106  -1.302  29.304  1.00 44.06 ? 1    DC  T "C4'" 1 
ATOM   4    O  "O4'" . DC  A 1 1   ? -3.875  -1.073  30.027  1.00 43.36 ? 1    DC  T "O4'" 1 
ATOM   5    C  "C3'" . DC  A 1 1   ? -5.056  -0.389  28.075  1.00 43.82 ? 1    DC  T "C3'" 1 
ATOM   6    O  "O3'" . DC  A 1 1   ? -5.875  0.762   28.296  1.00 44.74 ? 1    DC  T "O3'" 1 
ATOM   7    C  "C2'" . DC  A 1 1   ? -3.595  0.019   27.987  1.00 43.24 ? 1    DC  T "C2'" 1 
ATOM   8    C  "C1'" . DC  A 1 1   ? -3.180  0.018   29.445  1.00 43.24 ? 1    DC  T "C1'" 1 
ATOM   9    N  N1    . DC  A 1 1   ? -1.744  -0.193  29.683  1.00 41.18 ? 1    DC  T N1    1 
ATOM   10   C  C2    . DC  A 1 1   ? -1.011  0.809   30.328  1.00 39.32 ? 1    DC  T C2    1 
ATOM   11   O  O2    . DC  A 1 1   ? -1.577  1.874   30.622  1.00 36.92 ? 1    DC  T O2    1 
ATOM   12   N  N3    . DC  A 1 1   ? 0.294   0.596   30.608  1.00 37.30 ? 1    DC  T N3    1 
ATOM   13   C  C4    . DC  A 1 1   ? 0.874   -0.551  30.247  1.00 40.12 ? 1    DC  T C4    1 
ATOM   14   N  N4    . DC  A 1 1   ? 2.162   -0.722  30.549  1.00 40.30 ? 1    DC  T N4    1 
ATOM   15   C  C5    . DC  A 1 1   ? 0.159   -1.575  29.561  1.00 41.81 ? 1    DC  T C5    1 
ATOM   16   C  C6    . DC  A 1 1   ? -1.136  -1.356  29.301  1.00 41.58 ? 1    DC  T C6    1 
ATOM   17   P  P     . DG  A 1 2   ? -6.398  1.623   27.041  1.00 46.25 ? 2    DG  T P     1 
ATOM   18   O  OP1   . DG  A 1 2   ? -7.620  2.349   27.477  1.00 44.11 ? 2    DG  T OP1   1 
ATOM   19   O  OP2   . DG  A 1 2   ? -6.459  0.717   25.864  1.00 44.92 ? 2    DG  T OP2   1 
ATOM   20   O  "O5'" . DG  A 1 2   ? -5.245  2.699   26.804  1.00 41.90 ? 2    DG  T "O5'" 1 
ATOM   21   C  "C5'" . DG  A 1 2   ? -4.993  3.712   27.778  1.00 38.17 ? 2    DG  T "C5'" 1 
ATOM   22   C  "C4'" . DG  A 1 2   ? -3.721  4.456   27.448  1.00 36.22 ? 2    DG  T "C4'" 1 
ATOM   23   O  "O4'" . DG  A 1 2   ? -2.565  3.700   27.887  1.00 34.05 ? 2    DG  T "O4'" 1 
ATOM   24   C  "C3'" . DG  A 1 2   ? -3.498  4.720   25.953  1.00 37.84 ? 2    DG  T "C3'" 1 
ATOM   25   O  "O3'" . DG  A 1 2   ? -2.894  6.003   25.795  1.00 41.89 ? 2    DG  T "O3'" 1 
ATOM   26   C  "C2'" . DG  A 1 2   ? -2.460  3.681   25.583  1.00 35.51 ? 2    DG  T "C2'" 1 
ATOM   27   C  "C1'" . DG  A 1 2   ? -1.622  3.753   26.838  1.00 33.37 ? 2    DG  T "C1'" 1 
ATOM   28   N  N9    . DG  A 1 2   ? -0.634  2.697   27.018  1.00 30.54 ? 2    DG  T N9    1 
ATOM   29   C  C8    . DG  A 1 2   ? -0.612  1.453   26.430  1.00 29.54 ? 2    DG  T C8    1 
ATOM   30   N  N7    . DG  A 1 2   ? 0.463   0.771   26.717  1.00 29.20 ? 2    DG  T N7    1 
ATOM   31   C  C5    . DG  A 1 2   ? 1.182   1.607   27.561  1.00 29.41 ? 2    DG  T C5    1 
ATOM   32   C  C6    . DG  A 1 2   ? 2.444   1.423   28.182  1.00 28.86 ? 2    DG  T C6    1 
ATOM   33   O  O6    . DG  A 1 2   ? 3.218   0.461   28.091  1.00 31.25 ? 2    DG  T O6    1 
ATOM   34   N  N1    . DG  A 1 2   ? 2.790   2.519   28.968  1.00 28.85 ? 2    DG  T N1    1 
ATOM   35   C  C2    . DG  A 1 2   ? 2.027   3.649   29.128  1.00 27.64 ? 2    DG  T C2    1 
ATOM   36   N  N2    . DG  A 1 2   ? 2.529   4.591   29.936  1.00 29.10 ? 2    DG  T N2    1 
ATOM   37   N  N3    . DG  A 1 2   ? 0.859   3.839   28.542  1.00 28.05 ? 2    DG  T N3    1 
ATOM   38   C  C4    . DG  A 1 2   ? 0.502   2.786   27.778  1.00 29.16 ? 2    DG  T C4    1 
ATOM   39   P  P     . DG  A 1 3   ? -3.769  7.237   25.274  1.00 44.02 ? 3    DG  T P     1 
ATOM   40   O  OP1   . DG  A 1 3   ? -4.983  7.321   26.126  1.00 46.86 ? 3    DG  T OP1   1 
ATOM   41   O  OP2   . DG  A 1 3   ? -3.907  7.088   23.806  1.00 44.92 ? 3    DG  T OP2   1 
ATOM   42   O  "O5'" . DG  A 1 3   ? -2.854  8.502   25.577  1.00 42.63 ? 3    DG  T "O5'" 1 
ATOM   43   C  "C5'" . DG  A 1 3   ? -2.661  8.950   26.914  1.00 39.92 ? 3    DG  T "C5'" 1 
ATOM   44   C  "C4'" . DG  A 1 3   ? -1.216  9.332   27.139  1.00 38.41 ? 3    DG  T "C4'" 1 
ATOM   45   O  "O4'" . DG  A 1 3   ? -0.391  8.149   27.250  1.00 35.60 ? 3    DG  T "O4'" 1 
ATOM   46   C  "C3'" . DG  A 1 3   ? -0.575  10.199  26.050  1.00 37.73 ? 3    DG  T "C3'" 1 
ATOM   47   O  "O3'" . DG  A 1 3   ? 0.176   11.236  26.687  1.00 40.25 ? 3    DG  T "O3'" 1 
ATOM   48   C  "C2'" . DG  A 1 3   ? 0.371   9.240   25.344  1.00 36.73 ? 3    DG  T "C2'" 1 
ATOM   49   C  "C1'" . DG  A 1 3   ? 0.787   8.331   26.486  1.00 34.87 ? 3    DG  T "C1'" 1 
ATOM   50   N  N9    . DG  A 1 3   ? 1.260   7.008   26.096  1.00 32.10 ? 3    DG  T N9    1 
ATOM   51   C  C8    . DG  A 1 3   ? 0.616   6.098   25.294  1.00 32.05 ? 3    DG  T C8    1 
ATOM   52   N  N7    . DG  A 1 3   ? 1.267   4.973   25.169  1.00 29.77 ? 3    DG  T N7    1 
ATOM   53   C  C5    . DG  A 1 3   ? 2.414   5.156   25.927  1.00 29.42 ? 3    DG  T C5    1 
ATOM   54   C  C6    . DG  A 1 3   ? 3.496   4.277   26.177  1.00 29.04 ? 3    DG  T C6    1 
ATOM   55   O  O6    . DG  A 1 3   ? 3.650   3.116   25.777  1.00 30.84 ? 3    DG  T O6    1 
ATOM   56   N  N1    . DG  A 1 3   ? 4.460   4.869   26.986  1.00 26.73 ? 3    DG  T N1    1 
ATOM   57   C  C2    . DG  A 1 3   ? 4.383   6.141   27.503  1.00 29.71 ? 3    DG  T C2    1 
ATOM   58   N  N2    . DG  A 1 3   ? 5.406   6.534   28.276  1.00 30.25 ? 3    DG  T N2    1 
ATOM   59   N  N3    . DG  A 1 3   ? 3.375   6.968   27.282  1.00 29.59 ? 3    DG  T N3    1 
ATOM   60   C  C4    . DG  A 1 3   ? 2.433   6.413   26.492  1.00 30.79 ? 3    DG  T C4    1 
ATOM   61   P  P     . DC  A 1 4   ? 0.615   12.537  25.855  1.00 41.86 ? 4    DC  T P     1 
ATOM   62   O  OP1   . DC  A 1 4   ? 0.553   13.705  26.777  1.00 41.25 ? 4    DC  T OP1   1 
ATOM   63   O  OP2   . DC  A 1 4   ? -0.162  12.547  24.586  1.00 38.36 ? 4    DC  T OP2   1 
ATOM   64   O  "O5'" . DC  A 1 4   ? 2.147   12.274  25.516  1.00 39.72 ? 4    DC  T "O5'" 1 
ATOM   65   C  "C5'" . DC  A 1 4   ? 3.101   12.120  26.560  1.00 38.74 ? 4    DC  T "C5'" 1 
ATOM   66   C  "C4'" . DC  A 1 4   ? 4.352   11.468  26.025  1.00 38.10 ? 4    DC  T "C4'" 1 
ATOM   67   O  "O4'" . DC  A 1 4   ? 4.091   10.077  25.777  1.00 35.73 ? 4    DC  T "O4'" 1 
ATOM   68   C  "C3'" . DC  A 1 4   ? 4.837   12.014  24.681  1.00 35.26 ? 4    DC  T "C3'" 1 
ATOM   69   O  "O3'" . DC  A 1 4   ? 5.857   12.995  24.886  1.00 35.50 ? 4    DC  T "O3'" 1 
ATOM   70   C  "C2'" . DC  A 1 4   ? 5.424   10.796  23.982  1.00 33.52 ? 4    DC  T "C2'" 1 
ATOM   71   C  "C1'" . DC  A 1 4   ? 5.123   9.634   24.923  1.00 34.67 ? 4    DC  T "C1'" 1 
ATOM   72   N  N1    . DC  A 1 4   ? 4.682   8.396   24.268  1.00 30.68 ? 4    DC  T N1    1 
ATOM   73   C  C2    . DC  A 1 4   ? 5.524   7.302   24.332  1.00 31.67 ? 4    DC  T C2    1 
ATOM   74   O  O2    . DC  A 1 4   ? 6.598   7.427   24.935  1.00 32.41 ? 4    DC  T O2    1 
ATOM   75   N  N3    . DC  A 1 4   ? 5.159   6.138   23.740  1.00 30.05 ? 4    DC  T N3    1 
ATOM   76   C  C4    . DC  A 1 4   ? 3.995   6.055   23.101  1.00 29.54 ? 4    DC  T C4    1 
ATOM   77   N  N4    . DC  A 1 4   ? 3.675   4.882   22.546  1.00 29.40 ? 4    DC  T N4    1 
ATOM   78   C  C5    . DC  A 1 4   ? 3.107   7.170   23.007  1.00 29.89 ? 4    DC  T C5    1 
ATOM   79   C  C6    . DC  A 1 4   ? 3.487   8.313   23.607  1.00 30.11 ? 4    DC  T C6    1 
ATOM   80   P  P     . DG  A 1 5   ? 6.251   14.002  23.694  1.00 32.60 ? 5    DG  T P     1 
ATOM   81   O  OP1   . DG  A 1 5   ? 5.835   13.407  22.400  1.00 33.49 ? 5    DG  T OP1   1 
ATOM   82   O  OP2   . DG  A 1 5   ? 7.674   14.357  23.917  1.00 31.45 ? 5    DG  T OP2   1 
ATOM   83   O  "O5'" . DG  A 1 5   ? 5.354   15.291  23.968  1.00 30.23 ? 5    DG  T "O5'" 1 
ATOM   84   C  "C5'" . DG  A 1 5   ? 5.365   15.916  25.250  1.00 31.06 ? 5    DG  T "C5'" 1 
ATOM   85   C  "C4'" . DG  A 1 5   ? 4.866   17.339  25.154  1.00 28.90 ? 5    DG  T "C4'" 1 
ATOM   86   O  "O4'" . DG  A 1 5   ? 5.633   18.081  24.181  1.00 29.68 ? 5    DG  T "O4'" 1 
ATOM   87   C  "C3'" . DG  A 1 5   ? 3.411   17.503  24.736  1.00 29.60 ? 5    DG  T "C3'" 1 
ATOM   88   O  "O3'" . DG  A 1 5   ? 2.906   18.688  25.356  1.00 31.40 ? 5    DG  T "O3'" 1 
ATOM   89   C  "C2'" . DG  A 1 5   ? 3.506   17.664  23.228  1.00 28.79 ? 5    DG  T "C2'" 1 
ATOM   90   C  "C1'" . DG  A 1 5   ? 4.839   18.386  23.037  1.00 29.20 ? 5    DG  T "C1'" 1 
ATOM   91   N  N9    . DG  A 1 5   ? 5.610   17.977  21.867  1.00 29.77 ? 5    DG  T N9    1 
ATOM   92   C  C8    . DG  A 1 5   ? 5.670   16.722  21.308  1.00 29.91 ? 5    DG  T C8    1 
ATOM   93   N  N7    . DG  A 1 5   ? 6.532   16.637  20.332  1.00 30.14 ? 5    DG  T N7    1 
ATOM   94   C  C5    . DG  A 1 5   ? 7.059   17.917  20.224  1.00 29.56 ? 5    DG  T C5    1 
ATOM   95   C  C6    . DG  A 1 5   ? 8.063   18.429  19.359  1.00 29.15 ? 5    DG  T C6    1 
ATOM   96   O  O6    . DG  A 1 5   ? 8.719   17.830  18.499  1.00 31.50 ? 5    DG  T O6    1 
ATOM   97   N  N1    . DG  A 1 5   ? 8.286   19.782  19.580  1.00 27.21 ? 5    DG  T N1    1 
ATOM   98   C  C2    . DG  A 1 5   ? 7.636   20.548  20.519  1.00 29.03 ? 5    DG  T C2    1 
ATOM   99   N  N2    . DG  A 1 5   ? 7.997   21.844  20.581  1.00 24.44 ? 5    DG  T N2    1 
ATOM   100  N  N3    . DG  A 1 5   ? 6.707   20.080  21.339  1.00 27.05 ? 5    DG  T N3    1 
ATOM   101  C  C4    . DG  A 1 5   ? 6.475   18.766  21.141  1.00 28.41 ? 5    DG  T C4    1 
ATOM   102  P  P     . DG  A 1 6   ? 1.353   19.061  25.239  1.00 31.31 ? 6    DG  T P     1 
ATOM   103  O  OP1   . DG  A 1 6   ? 0.980   19.712  26.520  1.00 33.45 ? 6    DG  T OP1   1 
ATOM   104  O  OP2   . DG  A 1 6   ? 0.584   17.877  24.763  1.00 32.51 ? 6    DG  T OP2   1 
ATOM   105  O  "O5'" . DG  A 1 6   ? 1.322   20.195  24.125  1.00 30.09 ? 6    DG  T "O5'" 1 
ATOM   106  C  "C5'" . DG  A 1 6   ? 1.963   21.444  24.359  1.00 28.08 ? 6    DG  T "C5'" 1 
ATOM   107  C  "C4'" . DG  A 1 6   ? 1.974   22.273  23.097  1.00 27.84 ? 6    DG  T "C4'" 1 
ATOM   108  O  "O4'" . DG  A 1 6   ? 2.914   21.721  22.141  1.00 27.42 ? 6    DG  T "O4'" 1 
ATOM   109  C  "C3'" . DG  A 1 6   ? 0.630   22.371  22.367  1.00 27.96 ? 6    DG  T "C3'" 1 
ATOM   110  O  "O3'" . DG  A 1 6   ? 0.460   23.726  21.956  1.00 29.88 ? 6    DG  T "O3'" 1 
ATOM   111  C  "C2'" . DG  A 1 6   ? 0.833   21.492  21.143  1.00 26.44 ? 6    DG  T "C2'" 1 
ATOM   112  C  "C1'" . DG  A 1 6   ? 2.302   21.739  20.866  1.00 26.01 ? 6    DG  T "C1'" 1 
ATOM   113  N  N9    . DG  A 1 6   ? 2.980   20.757  20.029  1.00 26.53 ? 6    DG  T N9    1 
ATOM   114  C  C8    . DG  A 1 6   ? 2.769   19.397  19.977  1.00 25.21 ? 6    DG  T C8    1 
ATOM   115  N  N7    . DG  A 1 6   ? 3.564   18.789  19.133  1.00 24.03 ? 6    DG  T N7    1 
ATOM   116  C  C5    . DG  A 1 6   ? 4.337   19.810  18.591  1.00 25.31 ? 6    DG  T C5    1 
ATOM   117  C  C6    . DG  A 1 6   ? 5.377   19.768  17.624  1.00 25.70 ? 6    DG  T C6    1 
ATOM   118  O  O6    . DG  A 1 6   ? 5.842   18.785  17.028  1.00 27.58 ? 6    DG  T O6    1 
ATOM   119  N  N1    . DG  A 1 6   ? 5.893   21.038  17.374  1.00 26.74 ? 6    DG  T N1    1 
ATOM   120  C  C2    . DG  A 1 6   ? 5.465   22.200  17.977  1.00 26.51 ? 6    DG  T C2    1 
ATOM   121  N  N2    . DG  A 1 6   ? 6.092   23.330  17.616  1.00 25.46 ? 6    DG  T N2    1 
ATOM   122  N  N3    . DG  A 1 6   ? 4.498   22.250  18.870  1.00 24.16 ? 6    DG  T N3    1 
ATOM   123  C  C4    . DG  A 1 6   ? 3.984   21.030  19.130  1.00 25.85 ? 6    DG  T C4    1 
ATOM   124  P  P     . DT  A 1 7   ? -0.995  24.288  21.583  1.00 28.24 ? 7    DT  T P     1 
ATOM   125  O  OP1   . DT  A 1 7   ? -1.459  25.135  22.710  1.00 31.90 ? 7    DT  T OP1   1 
ATOM   126  O  OP2   . DT  A 1 7   ? -1.863  23.192  21.084  1.00 29.25 ? 7    DT  T OP2   1 
ATOM   127  O  "O5'" . DT  A 1 7   ? -0.680  25.265  20.370  1.00 32.29 ? 7    DT  T "O5'" 1 
ATOM   128  C  "C5'" . DT  A 1 7   ? -0.585  24.764  19.047  1.00 33.33 ? 7    DT  T "C5'" 1 
ATOM   129  C  "C4'" . DT  A 1 7   ? 0.735   25.164  18.435  1.00 29.84 ? 7    DT  T "C4'" 1 
ATOM   130  O  "O4'" . DT  A 1 7   ? 1.616   24.024  18.482  1.00 27.54 ? 7    DT  T "O4'" 1 
ATOM   131  C  "C3'" . DT  A 1 7   ? 0.609   25.527  16.962  1.00 28.69 ? 7    DT  T "C3'" 1 
ATOM   132  O  "O3'" . DT  A 1 7   ? 0.450   26.938  16.819  1.00 28.98 ? 7    DT  T "O3'" 1 
ATOM   133  C  "C2'" . DT  A 1 7   ? 1.923   25.064  16.363  1.00 29.30 ? 7    DT  T "C2'" 1 
ATOM   134  C  "C1'" . DT  A 1 7   ? 2.376   23.937  17.288  1.00 29.05 ? 7    DT  T "C1'" 1 
ATOM   135  N  N1    . DT  A 1 7   ? 2.231   22.567  16.755  1.00 28.79 ? 7    DT  T N1    1 
ATOM   136  C  C2    . DT  A 1 7   ? 3.089   22.177  15.752  1.00 26.57 ? 7    DT  T C2    1 
ATOM   137  O  O2    . DT  A 1 7   ? 3.891   22.938  15.237  1.00 23.57 ? 7    DT  T O2    1 
ATOM   138  N  N3    . DT  A 1 7   ? 2.973   20.860  15.375  1.00 24.79 ? 7    DT  T N3    1 
ATOM   139  C  C4    . DT  A 1 7   ? 2.103   19.921  15.887  1.00 27.25 ? 7    DT  T C4    1 
ATOM   140  O  O4    . DT  A 1 7   ? 2.154   18.758  15.491  1.00 27.71 ? 7    DT  T O4    1 
ATOM   141  C  C5    . DT  A 1 7   ? 1.186   20.414  16.901  1.00 29.54 ? 7    DT  T C5    1 
ATOM   142  C  C7    . DT  A 1 7   ? 0.168   19.478  17.478  1.00 25.53 ? 7    DT  T C7    1 
ATOM   143  C  C6    . DT  A 1 7   ? 1.294   21.697  17.276  1.00 27.22 ? 7    DT  T C6    1 
ATOM   144  P  P     . DA  A 1 8   ? -0.312  27.517  15.534  1.00 29.74 ? 8    DA  T P     1 
ATOM   145  O  OP1   . DA  A 1 8   ? -0.423  28.996  15.650  1.00 27.64 ? 8    DA  T OP1   1 
ATOM   146  O  OP2   . DA  A 1 8   ? -1.534  26.696  15.340  1.00 29.17 ? 8    DA  T OP2   1 
ATOM   147  O  "O5'" . DA  A 1 8   ? 0.679   27.186  14.335  1.00 27.43 ? 8    DA  T "O5'" 1 
ATOM   148  C  "C5'" . DA  A 1 8   ? 2.004   27.699  14.335  1.00 26.01 ? 8    DA  T "C5'" 1 
ATOM   149  C  "C4'" . DA  A 1 8   ? 2.617   27.547  12.964  1.00 27.63 ? 8    DA  T "C4'" 1 
ATOM   150  O  "O4'" . DA  A 1 8   ? 2.966   26.160  12.730  1.00 27.06 ? 8    DA  T "O4'" 1 
ATOM   151  C  "C3'" . DA  A 1 8   ? 1.701   27.969  11.817  1.00 25.68 ? 8    DA  T "C3'" 1 
ATOM   152  O  "O3'" . DA  A 1 8   ? 2.473   28.740  10.887  1.00 27.08 ? 8    DA  T "O3'" 1 
ATOM   153  C  "C2'" . DA  A 1 8   ? 1.192   26.652  11.246  1.00 26.54 ? 8    DA  T "C2'" 1 
ATOM   154  C  "C1'" . DA  A 1 8   ? 2.283   25.641  11.600  1.00 25.63 ? 8    DA  T "C1'" 1 
ATOM   155  N  N9    . DA  A 1 8   ? 1.824   24.293  11.952  1.00 25.08 ? 8    DA  T N9    1 
ATOM   156  C  C8    . DA  A 1 8   ? 0.899   23.937  12.902  1.00 22.79 ? 8    DA  T C8    1 
ATOM   157  N  N7    . DA  A 1 8   ? 0.742   22.639  13.027  1.00 25.68 ? 8    DA  T N7    1 
ATOM   158  C  C5    . DA  A 1 8   ? 1.617   22.102  12.090  1.00 24.32 ? 8    DA  T C5    1 
ATOM   159  C  C6    . DA  A 1 8   ? 1.937   20.771  11.738  1.00 24.34 ? 8    DA  T C6    1 
ATOM   160  N  N6    . DA  A 1 8   ? 1.402   19.689  12.320  1.00 22.89 ? 8    DA  T N6    1 
ATOM   161  N  N1    . DA  A 1 8   ? 2.842   20.586  10.757  1.00 24.43 ? 8    DA  T N1    1 
ATOM   162  C  C2    . DA  A 1 8   ? 3.390   21.664  10.176  1.00 25.87 ? 8    DA  T C2    1 
ATOM   163  N  N3    . DA  A 1 8   ? 3.179   22.956  10.424  1.00 25.79 ? 8    DA  T N3    1 
ATOM   164  C  C4    . DA  A 1 8   ? 2.274   23.109  11.406  1.00 24.90 ? 8    DA  T C4    1 
ATOM   165  P  P     . DC  A 1 9   ? 1.789   29.321  9.556   1.00 28.16 ? 9    DC  T P     1 
ATOM   166  O  OP1   . DC  A 1 9   ? 2.715   30.336  8.992   1.00 27.65 ? 9    DC  T OP1   1 
ATOM   167  O  OP2   . DC  A 1 9   ? 0.394   29.701  9.867   1.00 28.34 ? 9    DC  T OP2   1 
ATOM   168  O  "O5'" . DC  A 1 9   ? 1.742   28.035  8.617   1.00 29.25 ? 9    DC  T "O5'" 1 
ATOM   169  C  "C5'" . DC  A 1 9   ? 1.323   28.106  7.265   1.00 27.83 ? 9    DC  T "C5'" 1 
ATOM   170  C  "C4'" . DC  A 1 9   ? 2.171   27.180  6.424   1.00 30.56 ? 9    DC  T "C4'" 1 
ATOM   171  O  "O4'" . DC  A 1 9   ? 2.381   25.917  7.104   1.00 29.31 ? 9    DC  T "O4'" 1 
ATOM   172  C  "C3'" . DC  A 1 9   ? 1.603   26.842  5.052   1.00 28.23 ? 9    DC  T "C3'" 1 
ATOM   173  O  "O3'" . DC  A 1 9   ? 2.680   26.834  4.117   1.00 28.85 ? 9    DC  T "O3'" 1 
ATOM   174  C  "C2'" . DC  A 1 9   ? 1.022   25.448  5.240   1.00 28.80 ? 9    DC  T "C2'" 1 
ATOM   175  C  "C1'" . DC  A 1 9   ? 1.909   24.837  6.313   1.00 28.72 ? 9    DC  T "C1'" 1 
ATOM   176  N  N1    . DC  A 1 9   ? 1.217   23.889  7.210   1.00 28.68 ? 9    DC  T N1    1 
ATOM   177  C  C2    . DC  A 1 9   ? 1.467   22.514  7.067   1.00 24.75 ? 9    DC  T C2    1 
ATOM   178  O  O2    . DC  A 1 9   ? 2.268   22.137  6.206   1.00 25.38 ? 9    DC  T O2    1 
ATOM   179  N  N3    . DC  A 1 9   ? 0.831   21.637  7.871   1.00 23.99 ? 9    DC  T N3    1 
ATOM   180  C  C4    . DC  A 1 9   ? -0.020  22.076  8.799   1.00 26.02 ? 9    DC  T C4    1 
ATOM   181  N  N4    . DC  A 1 9   ? -0.617  21.162  9.580   1.00 24.54 ? 9    DC  T N4    1 
ATOM   182  C  C5    . DC  A 1 9   ? -0.295  23.470  8.974   1.00 25.96 ? 9    DC  T C5    1 
ATOM   183  C  C6    . DC  A 1 9   ? 0.343   24.333  8.164   1.00 26.99 ? 9    DC  T C6    1 
ATOM   184  P  P     . DT  A 1 10  ? 2.384   27.002  2.550   1.00 29.03 ? 10   DT  T P     1 
ATOM   185  O  OP1   . DT  A 1 10  ? 3.640   27.487  1.911   1.00 29.47 ? 10   DT  T OP1   1 
ATOM   186  O  OP2   . DT  A 1 10  ? 1.130   27.771  2.381   1.00 30.26 ? 10   DT  T OP2   1 
ATOM   187  O  "O5'" . DT  A 1 10  ? 2.120   25.508  2.071   1.00 30.11 ? 10   DT  T "O5'" 1 
ATOM   188  C  "C5'" . DT  A 1 10  ? 3.138   24.527  2.195   1.00 29.99 ? 10   DT  T "C5'" 1 
ATOM   189  C  "C4'" . DT  A 1 10  ? 2.651   23.197  1.671   1.00 28.53 ? 10   DT  T "C4'" 1 
ATOM   190  O  "O4'" . DT  A 1 10  ? 1.956   22.476  2.711   1.00 26.35 ? 10   DT  T "O4'" 1 
ATOM   191  C  "C3'" . DT  A 1 10  ? 1.711   23.252  0.468   1.00 29.29 ? 10   DT  T "C3'" 1 
ATOM   192  O  "O3'" . DT  A 1 10  ? 2.246   22.377  -0.530  1.00 33.58 ? 10   DT  T "O3'" 1 
ATOM   193  C  "C2'" . DT  A 1 10  ? 0.385   22.729  1.009   1.00 27.71 ? 10   DT  T "C2'" 1 
ATOM   194  C  "C1'" . DT  A 1 10  ? 0.811   21.850  2.178   1.00 24.46 ? 10   DT  T "C1'" 1 
ATOM   195  N  N1    . DT  A 1 10  ? -0.148  21.707  3.291   1.00 25.03 ? 10   DT  T N1    1 
ATOM   196  C  C2    . DT  A 1 10  ? -0.345  20.445  3.808   1.00 23.90 ? 10   DT  T C2    1 
ATOM   197  O  O2    . DT  A 1 10  ? 0.116   19.443  3.300   1.00 20.78 ? 10   DT  T O2    1 
ATOM   198  N  N3    . DT  A 1 10  ? -1.122  20.402  4.938   1.00 20.71 ? 10   DT  T N3    1 
ATOM   199  C  C4    . DT  A 1 10  ? -1.743  21.463  5.561   1.00 22.29 ? 10   DT  T C4    1 
ATOM   200  O  O4    . DT  A 1 10  ? -2.361  21.282  6.610   1.00 22.13 ? 10   DT  T O4    1 
ATOM   201  C  C5    . DT  A 1 10  ? -1.585  22.743  4.906   1.00 24.03 ? 10   DT  T C5    1 
ATOM   202  C  C7    . DT  A 1 10  ? -2.321  23.930  5.450   1.00 21.90 ? 10   DT  T C7    1 
ATOM   203  C  C6    . DT  A 1 10  ? -0.793  22.804  3.825   1.00 23.11 ? 10   DT  T C6    1 
ATOM   204  P  P     . DG  A 1 11  ? 1.898   22.607  -2.080  1.00 35.10 ? 11   DG  T P     1 
ATOM   205  O  OP1   . DG  A 1 11  ? 3.106   22.188  -2.840  1.00 33.27 ? 11   DG  T OP1   1 
ATOM   206  O  OP2   . DG  A 1 11  ? 1.332   23.962  -2.285  1.00 32.40 ? 11   DG  T OP2   1 
ATOM   207  O  "O5'" . DG  A 1 11  ? 0.749   21.538  -2.352  1.00 34.32 ? 11   DG  T "O5'" 1 
ATOM   208  C  "C5'" . DG  A 1 11  ? 1.010   20.145  -2.202  1.00 32.47 ? 11   DG  T "C5'" 1 
ATOM   209  C  "C4'" . DG  A 1 11  ? -0.284  19.367  -2.244  1.00 31.00 ? 11   DG  T "C4'" 1 
ATOM   210  O  "O4'" . DG  A 1 11  ? -0.918  19.447  -0.947  1.00 28.49 ? 11   DG  T "O4'" 1 
ATOM   211  C  "C3'" . DG  A 1 11  ? -1.305  19.897  -3.256  1.00 31.41 ? 11   DG  T "C3'" 1 
ATOM   212  O  "O3'" . DG  A 1 11  ? -1.845  18.800  -3.993  1.00 33.40 ? 11   DG  T "O3'" 1 
ATOM   213  C  "C2'" . DG  A 1 11  ? -2.373  20.546  -2.393  1.00 28.55 ? 11   DG  T "C2'" 1 
ATOM   214  C  "C1'" . DG  A 1 11  ? -2.292  19.718  -1.125  1.00 28.16 ? 11   DG  T "C1'" 1 
ATOM   215  N  N9    . DG  A 1 11  ? -2.782  20.387  0.076   1.00 26.45 ? 11   DG  T N9    1 
ATOM   216  C  C8    . DG  A 1 11  ? -2.975  21.738  0.258   1.00 22.73 ? 11   DG  T C8    1 
ATOM   217  N  N7    . DG  A 1 11  ? -3.469  22.027  1.428   1.00 22.54 ? 11   DG  T N7    1 
ATOM   218  C  C5    . DG  A 1 11  ? -3.605  20.796  2.060   1.00 22.15 ? 11   DG  T C5    1 
ATOM   219  C  C6    . DG  A 1 11  ? -4.108  20.469  3.345   1.00 22.02 ? 11   DG  T C6    1 
ATOM   220  O  O6    . DG  A 1 11  ? -4.565  21.226  4.215   1.00 26.29 ? 11   DG  T O6    1 
ATOM   221  N  N1    . DG  A 1 11  ? -4.059  19.099  3.580   1.00 20.84 ? 11   DG  T N1    1 
ATOM   222  C  C2    . DG  A 1 11  ? -3.599  18.160  2.692   1.00 18.51 ? 11   DG  T C2    1 
ATOM   223  N  N2    . DG  A 1 11  ? -3.652  16.882  3.101   1.00 19.41 ? 11   DG  T N2    1 
ATOM   224  N  N3    . DG  A 1 11  ? -3.129  18.450  1.494   1.00 20.13 ? 11   DG  T N3    1 
ATOM   225  C  C4    . DG  A 1 11  ? -3.166  19.777  1.244   1.00 22.18 ? 11   DG  T C4    1 
ATOM   226  O  "O5'" . DC  B 2 1   ? -8.480  15.333  10.270  1.00 30.18 ? 1    DC  P "O5'" 1 
ATOM   227  C  "C5'" . DC  B 2 1   ? -9.313  14.420  9.526   1.00 28.18 ? 1    DC  P "C5'" 1 
ATOM   228  C  "C4'" . DC  B 2 1   ? -8.616  14.007  8.250   1.00 25.58 ? 1    DC  P "C4'" 1 
ATOM   229  O  "O4'" . DC  B 2 1   ? -8.567  15.144  7.366   1.00 23.40 ? 1    DC  P "O4'" 1 
ATOM   230  C  "C3'" . DC  B 2 1   ? -7.165  13.586  8.444   1.00 25.53 ? 1    DC  P "C3'" 1 
ATOM   231  O  "O3'" . DC  B 2 1   ? -7.095  12.171  8.597   1.00 27.90 ? 1    DC  P "O3'" 1 
ATOM   232  C  "C2'" . DC  B 2 1   ? -6.497  13.999  7.147   1.00 23.78 ? 1    DC  P "C2'" 1 
ATOM   233  C  "C1'" . DC  B 2 1   ? -7.348  15.159  6.644   1.00 24.09 ? 1    DC  P "C1'" 1 
ATOM   234  N  N1    . DC  B 2 1   ? -6.767  16.497  6.799   1.00 23.16 ? 1    DC  P N1    1 
ATOM   235  C  C2    . DC  B 2 1   ? -5.899  16.969  5.817   1.00 23.25 ? 1    DC  P C2    1 
ATOM   236  O  O2    . DC  B 2 1   ? -5.562  16.205  4.901   1.00 24.37 ? 1    DC  P O2    1 
ATOM   237  N  N3    . DC  B 2 1   ? -5.441  18.242  5.895   1.00 23.73 ? 1    DC  P N3    1 
ATOM   238  C  C4    . DC  B 2 1   ? -5.801  19.020  6.922   1.00 22.69 ? 1    DC  P C4    1 
ATOM   239  N  N4    . DC  B 2 1   ? -5.353  20.283  6.942   1.00 20.31 ? 1    DC  P N4    1 
ATOM   240  C  C5    . DC  B 2 1   ? -6.642  18.542  7.969   1.00 22.50 ? 1    DC  P C5    1 
ATOM   241  C  C6    . DC  B 2 1   ? -7.099  17.284  7.867   1.00 24.19 ? 1    DC  P C6    1 
ATOM   242  P  P     . DA  B 2 2   ? -5.850  11.517  9.361   1.00 28.25 ? 2    DA  P P     1 
ATOM   243  O  OP1   . DA  B 2 2   ? -6.206  10.112  9.663   1.00 32.29 ? 2    DA  P OP1   1 
ATOM   244  O  OP2   . DA  B 2 2   ? -5.423  12.417  10.455  1.00 29.83 ? 2    DA  P OP2   1 
ATOM   245  O  "O5'" . DA  B 2 2   ? -4.684  11.530  8.276   1.00 29.79 ? 2    DA  P "O5'" 1 
ATOM   246  C  "C5'" . DA  B 2 2   ? -4.819  10.831  7.045   1.00 24.18 ? 2    DA  P "C5'" 1 
ATOM   247  C  "C4'" . DA  B 2 2   ? -3.527  10.904  6.267   1.00 24.17 ? 2    DA  P "C4'" 1 
ATOM   248  O  "O4'" . DA  B 2 2   ? -3.249  12.273  5.892   1.00 22.74 ? 2    DA  P "O4'" 1 
ATOM   249  C  "C3'" . DA  B 2 2   ? -2.295  10.419  7.028   1.00 23.49 ? 2    DA  P "C3'" 1 
ATOM   250  O  "O3'" . DA  B 2 2   ? -1.413  9.785   6.097   1.00 24.18 ? 2    DA  P "O3'" 1 
ATOM   251  C  "C2'" . DA  B 2 2   ? -1.702  11.702  7.591   1.00 20.91 ? 2    DA  P "C2'" 1 
ATOM   252  C  "C1'" . DA  B 2 2   ? -2.082  12.753  6.552   1.00 22.63 ? 2    DA  P "C1'" 1 
ATOM   253  N  N9    . DA  B 2 2   ? -2.401  14.074  7.105   1.00 22.58 ? 2    DA  P N9    1 
ATOM   254  C  C8    . DA  B 2 2   ? -3.142  14.362  8.227   1.00 22.72 ? 2    DA  P C8    1 
ATOM   255  N  N7    . DA  B 2 2   ? -3.286  15.650  8.450   1.00 22.98 ? 2    DA  P N7    1 
ATOM   256  C  C5    . DA  B 2 2   ? -2.585  16.250  7.414   1.00 22.03 ? 2    DA  P C5    1 
ATOM   257  C  C6    . DA  B 2 2   ? -2.342  17.602  7.088   1.00 22.65 ? 2    DA  P C6    1 
ATOM   258  N  N6    . DA  B 2 2   ? -2.801  18.635  7.804   1.00 21.86 ? 2    DA  P N6    1 
ATOM   259  N  N1    . DA  B 2 2   ? -1.597  17.859  5.987   1.00 21.28 ? 2    DA  P N1    1 
ATOM   260  C  C2    . DA  B 2 2   ? -1.131  16.826  5.274   1.00 20.35 ? 2    DA  P C2    1 
ATOM   261  N  N3    . DA  B 2 2   ? -1.285  15.512  5.485   1.00 21.56 ? 2    DA  P N3    1 
ATOM   262  C  C4    . DA  B 2 2   ? -2.028  15.290  6.580   1.00 20.64 ? 2    DA  P C4    1 
ATOM   263  P  P     . DG  B 2 3   ? -0.002  9.196   6.591   1.00 23.69 ? 3    DG  P P     1 
ATOM   264  O  OP1   . DG  B 2 3   ? 0.311   8.068   5.670   1.00 21.86 ? 3    DG  P OP1   1 
ATOM   265  O  OP2   . DG  B 2 3   ? -0.026  8.970   8.055   1.00 24.56 ? 3    DG  P OP2   1 
ATOM   266  O  "O5'" . DG  B 2 3   ? 1.021   10.379  6.295   1.00 21.81 ? 3    DG  P "O5'" 1 
ATOM   267  C  "C5'" . DG  B 2 3   ? 1.200   10.848  4.963   1.00 21.93 ? 3    DG  P "C5'" 1 
ATOM   268  C  "C4'" . DG  B 2 3   ? 2.115   12.047  4.955   1.00 19.98 ? 3    DG  P "C4'" 1 
ATOM   269  O  "O4'" . DG  B 2 3   ? 1.438   13.171  5.548   1.00 20.42 ? 3    DG  P "O4'" 1 
ATOM   270  C  "C3'" . DG  B 2 3   ? 3.409   11.858  5.747   1.00 21.40 ? 3    DG  P "C3'" 1 
ATOM   271  O  "O3'" . DG  B 2 3   ? 4.509   11.929  4.830   1.00 21.00 ? 3    DG  P "O3'" 1 
ATOM   272  C  "C2'" . DG  B 2 3   ? 3.414   13.009  6.749   1.00 19.40 ? 3    DG  P "C2'" 1 
ATOM   273  C  "C1'" . DG  B 2 3   ? 2.406   13.984  6.166   1.00 19.59 ? 3    DG  P "C1'" 1 
ATOM   274  N  N9    . DG  B 2 3   ? 1.712   14.820  7.140   1.00 20.49 ? 3    DG  P N9    1 
ATOM   275  C  C8    . DG  B 2 3   ? 0.982   14.398  8.226   1.00 18.17 ? 3    DG  P C8    1 
ATOM   276  N  N7    . DG  B 2 3   ? 0.472   15.388  8.915   1.00 23.07 ? 3    DG  P N7    1 
ATOM   277  C  C5    . DG  B 2 3   ? 0.892   16.531  8.243   1.00 21.36 ? 3    DG  P C5    1 
ATOM   278  C  C6    . DG  B 2 3   ? 0.654   17.911  8.521   1.00 23.46 ? 3    DG  P C6    1 
ATOM   279  O  O6    . DG  B 2 3   ? 0.018   18.414  9.462   1.00 22.73 ? 3    DG  P O6    1 
ATOM   280  N  N1    . DG  B 2 3   ? 1.256   18.735  7.571   1.00 20.39 ? 3    DG  P N1    1 
ATOM   281  C  C2    . DG  B 2 3   ? 2.003   18.294  6.504   1.00 22.26 ? 3    DG  P C2    1 
ATOM   282  N  N2    . DG  B 2 3   ? 2.508   19.243  5.702   1.00 19.71 ? 3    DG  P N2    1 
ATOM   283  N  N3    . DG  B 2 3   ? 2.238   17.017  6.242   1.00 20.73 ? 3    DG  P N3    1 
ATOM   284  C  C4    . DG  B 2 3   ? 1.656   16.197  7.142   1.00 20.31 ? 3    DG  P C4    1 
ATOM   285  P  P     . DT  B 2 4   ? 6.003   11.672  5.340   1.00 22.37 ? 4    DT  P P     1 
ATOM   286  O  OP1   . DT  B 2 4   ? 6.778   11.240  4.143   1.00 24.63 ? 4    DT  P OP1   1 
ATOM   287  O  OP2   . DT  B 2 4   ? 5.989   10.810  6.550   1.00 21.56 ? 4    DT  P OP2   1 
ATOM   288  O  "O5'" . DT  B 2 4   ? 6.508   13.124  5.754   1.00 21.59 ? 4    DT  P "O5'" 1 
ATOM   289  C  "C5'" . DT  B 2 4   ? 6.406   14.218  4.842   1.00 21.83 ? 4    DT  P "C5'" 1 
ATOM   290  C  "C4'" . DT  B 2 4   ? 6.760   15.514  5.535   1.00 23.53 ? 4    DT  P "C4'" 1 
ATOM   291  O  "O4'" . DT  B 2 4   ? 5.645   15.956  6.335   1.00 25.67 ? 4    DT  P "O4'" 1 
ATOM   292  C  "C3'" . DT  B 2 4   ? 7.958   15.435  6.490   1.00 23.93 ? 4    DT  P "C3'" 1 
ATOM   293  O  "O3'" . DT  B 2 4   ? 9.082   16.113  5.905   1.00 22.36 ? 4    DT  P "O3'" 1 
ATOM   294  C  "C2'" . DT  B 2 4   ? 7.477   16.123  7.765   1.00 23.18 ? 4    DT  P "C2'" 1 
ATOM   295  C  "C1'" . DT  B 2 4   ? 6.154   16.769  7.369   1.00 23.41 ? 4    DT  P "C1'" 1 
ATOM   296  N  N1    . DT  B 2 4   ? 5.136   16.825  8.446   1.00 22.30 ? 4    DT  P N1    1 
ATOM   297  C  C2    . DT  B 2 4   ? 4.622   18.066  8.792   1.00 21.44 ? 4    DT  P C2    1 
ATOM   298  O  O2    . DT  B 2 4   ? 4.940   19.101  8.235   1.00 23.64 ? 4    DT  P O2    1 
ATOM   299  N  N3    . DT  B 2 4   ? 3.717   18.044  9.822   1.00 19.65 ? 4    DT  P N3    1 
ATOM   300  C  C4    . DT  B 2 4   ? 3.276   16.938  10.524  1.00 20.15 ? 4    DT  P C4    1 
ATOM   301  O  O4    . DT  B 2 4   ? 2.476   17.084  11.446  1.00 19.90 ? 4    DT  P O4    1 
ATOM   302  C  C5    . DT  B 2 4   ? 3.830   15.664  10.090  1.00 19.76 ? 4    DT  P C5    1 
ATOM   303  C  C7    . DT  B 2 4   ? 3.380   14.405  10.769  1.00 18.73 ? 4    DT  P C7    1 
ATOM   304  C  C6    . DT  B 2 4   ? 4.723   15.675  9.090   1.00 17.67 ? 4    DT  P C6    1 
ATOM   305  P  P     . DA  B 2 5   ? 10.482  16.171  6.686   1.00 21.47 ? 5    DA  P P     1 
ATOM   306  O  OP1   . DA  B 2 5   ? 11.555  16.283  5.672   1.00 20.09 ? 5    DA  P OP1   1 
ATOM   307  O  OP2   . DA  B 2 5   ? 10.537  15.079  7.687   1.00 21.50 ? 5    DA  P OP2   1 
ATOM   308  O  "O5'" . DA  B 2 5   ? 10.409  17.559  7.467   1.00 23.76 ? 5    DA  P "O5'" 1 
ATOM   309  C  "C5'" . DA  B 2 5   ? 10.009  18.757  6.803   1.00 22.18 ? 5    DA  P "C5'" 1 
ATOM   310  C  "C4'" . DA  B 2 5   ? 9.626   19.810  7.817   1.00 22.87 ? 5    DA  P "C4'" 1 
ATOM   311  O  "O4'" . DA  B 2 5   ? 8.370   19.467  8.430   1.00 23.50 ? 5    DA  P "O4'" 1 
ATOM   312  C  "C3'" . DA  B 2 5   ? 10.599  19.951  8.986   1.00 23.45 ? 5    DA  P "C3'" 1 
ATOM   313  O  "O3'" . DA  B 2 5   ? 11.574  20.950  8.677   1.00 22.96 ? 5    DA  P "O3'" 1 
ATOM   314  C  "C2'" . DA  B 2 5   ? 9.713   20.410  10.137  1.00 25.21 ? 5    DA  P "C2'" 1 
ATOM   315  C  "C1'" . DA  B 2 5   ? 8.280   20.166  9.666   1.00 26.02 ? 5    DA  P "C1'" 1 
ATOM   316  N  N9    . DA  B 2 5   ? 7.503   19.348  10.598  1.00 25.11 ? 5    DA  P N9    1 
ATOM   317  C  C8    . DA  B 2 5   ? 7.515   17.983  10.737  1.00 23.48 ? 5    DA  P C8    1 
ATOM   318  N  N7    . DA  B 2 5   ? 6.710   17.539  11.674  1.00 25.79 ? 5    DA  P N7    1 
ATOM   319  C  C5    . DA  B 2 5   ? 6.128   18.687  12.188  1.00 21.83 ? 5    DA  P C5    1 
ATOM   320  C  C6    . DA  B 2 5   ? 5.184   18.895  13.207  1.00 22.57 ? 5    DA  P C6    1 
ATOM   321  N  N6    . DA  B 2 5   ? 4.622   17.907  13.924  1.00 23.43 ? 5    DA  P N6    1 
ATOM   322  N  N1    . DA  B 2 5   ? 4.821   20.170  13.473  1.00 19.60 ? 5    DA  P N1    1 
ATOM   323  C  C2    . DA  B 2 5   ? 5.372   21.160  12.752  1.00 21.24 ? 5    DA  P C2    1 
ATOM   324  N  N3    . DA  B 2 5   ? 6.265   21.091  11.767  1.00 21.52 ? 5    DA  P N3    1 
ATOM   325  C  C4    . DA  B 2 5   ? 6.606   19.812  11.531  1.00 24.66 ? 5    DA  P C4    1 
ATOM   326  P  P     . DC  B 2 6   ? 12.733  21.302  9.735   1.00 22.29 ? 6    DC  P P     1 
ATOM   327  O  OP1   . DC  B 2 6   ? 13.773  22.002  8.941   1.00 18.86 ? 6    DC  P OP1   1 
ATOM   328  O  OP2   . DC  B 2 6   ? 13.099  20.107  10.521  1.00 24.58 ? 6    DC  P OP2   1 
ATOM   329  O  "O5'" . DC  B 2 6   ? 12.025  22.307  10.742  1.00 24.29 ? 6    DC  P "O5'" 1 
ATOM   330  C  "C5'" . DC  B 2 6   ? 11.542  23.571  10.306  1.00 23.54 ? 6    DC  P "C5'" 1 
ATOM   331  C  "C4'" . DC  B 2 6   ? 10.998  24.335  11.489  1.00 24.81 ? 6    DC  P "C4'" 1 
ATOM   332  O  "O4'" . DC  B 2 6   ? 9.908   23.574  12.057  1.00 24.33 ? 6    DC  P "O4'" 1 
ATOM   333  C  "C3'" . DC  B 2 6   ? 12.029  24.525  12.604  1.00 26.93 ? 6    DC  P "C3'" 1 
ATOM   334  O  "O3'" . DC  B 2 6   ? 12.311  25.917  12.789  1.00 28.91 ? 6    DC  P "O3'" 1 
ATOM   335  C  "C2'" . DC  B 2 6   ? 11.422  23.857  13.830  1.00 25.27 ? 6    DC  P "C2'" 1 
ATOM   336  C  "C1'" . DC  B 2 6   ? 9.969   23.590  13.469  1.00 24.44 ? 6    DC  P "C1'" 1 
ATOM   337  N  N1    . DC  B 2 6   ? 9.465   22.290  13.951  1.00 22.05 ? 6    DC  P N1    1 
ATOM   338  C  C2    . DC  B 2 6   ? 8.478   22.268  14.933  1.00 22.66 ? 6    DC  P C2    1 
ATOM   339  O  O2    . DC  B 2 6   ? 8.081   23.340  15.411  1.00 24.60 ? 6    DC  P O2    1 
ATOM   340  N  N3    . DC  B 2 6   ? 7.987   21.079  15.346  1.00 25.25 ? 6    DC  P N3    1 
ATOM   341  C  C4    . DC  B 2 6   ? 8.461   19.942  14.831  1.00 21.74 ? 6    DC  P C4    1 
ATOM   342  N  N4    . DC  B 2 6   ? 7.948   18.798  15.269  1.00 22.49 ? 6    DC  P N4    1 
ATOM   343  C  C5    . DC  B 2 6   ? 9.483   19.935  13.846  1.00 20.62 ? 6    DC  P C5    1 
ATOM   344  C  C6    . DC  B 2 6   ? 9.950   21.119  13.436  1.00 23.89 ? 6    DC  P C6    1 
ATOM   345  O  OP3   . DG  C 3 1   ? 13.561  -4.419  22.723  1.00 55.34 ? 1    DG  D OP3   1 
ATOM   346  P  P     . DG  C 3 1   ? 12.904  -3.679  21.567  1.00 56.16 ? 1    DG  D P     1 
ATOM   347  O  OP1   . DG  C 3 1   ? 13.885  -3.295  20.461  1.00 53.18 ? 1    DG  D OP1   1 
ATOM   348  O  OP2   . DG  C 3 1   ? 11.669  -4.387  21.041  1.00 54.81 ? 1    DG  D OP2   1 
ATOM   349  O  "O5'" . DG  C 3 1   ? 12.361  -2.271  22.184  1.00 52.65 ? 1    DG  D "O5'" 1 
ATOM   350  C  "C5'" . DG  C 3 1   ? 12.417  -2.005  23.594  1.00 47.67 ? 1    DG  D "C5'" 1 
ATOM   351  C  "C4'" . DG  C 3 1   ? 12.725  -0.545  23.828  1.00 44.08 ? 1    DG  D "C4'" 1 
ATOM   352  O  "O4'" . DG  C 3 1   ? 11.996  0.246   22.866  1.00 41.28 ? 1    DG  D "O4'" 1 
ATOM   353  C  "C3'" . DG  C 3 1   ? 12.280  -0.017  25.185  1.00 43.46 ? 1    DG  D "C3'" 1 
ATOM   354  O  "O3'" . DG  C 3 1   ? 13.326  -0.162  26.145  1.00 45.14 ? 1    DG  D "O3'" 1 
ATOM   355  C  "C2'" . DG  C 3 1   ? 12.027  1.453   24.909  1.00 40.78 ? 1    DG  D "C2'" 1 
ATOM   356  C  "C1'" . DG  C 3 1   ? 11.538  1.452   23.469  1.00 38.37 ? 1    DG  D "C1'" 1 
ATOM   357  N  N9    . DG  C 3 1   ? 10.087  1.499   23.324  1.00 34.53 ? 1    DG  D N9    1 
ATOM   358  C  C8    . DG  C 3 1   ? 9.277   0.527   22.790  1.00 31.66 ? 1    DG  D C8    1 
ATOM   359  N  N7    . DG  C 3 1   ? 8.022   0.880   22.736  1.00 33.04 ? 1    DG  D N7    1 
ATOM   360  C  C5    . DG  C 3 1   ? 7.999   2.158   23.280  1.00 32.25 ? 1    DG  D C5    1 
ATOM   361  C  C6    . DG  C 3 1   ? 6.918   3.057   23.470  1.00 31.59 ? 1    DG  D C6    1 
ATOM   362  O  O6    . DG  C 3 1   ? 5.727   2.902   23.169  1.00 34.01 ? 1    DG  D O6    1 
ATOM   363  N  N1    . DG  C 3 1   ? 7.337   4.242   24.066  1.00 27.32 ? 1    DG  D N1    1 
ATOM   364  C  C2    . DG  C 3 1   ? 8.634   4.531   24.425  1.00 29.53 ? 1    DG  D C2    1 
ATOM   365  N  N2    . DG  C 3 1   ? 8.843   5.732   24.991  1.00 28.94 ? 1    DG  D N2    1 
ATOM   366  N  N3    . DG  C 3 1   ? 9.653   3.705   24.242  1.00 28.99 ? 1    DG  D N3    1 
ATOM   367  C  C4    . DG  C 3 1   ? 9.265   2.546   23.668  1.00 32.23 ? 1    DG  D C4    1 
ATOM   368  P  P     . DC  C 3 2   ? 12.951  -0.460  27.676  1.00 45.72 ? 2    DC  D P     1 
ATOM   369  O  OP1   . DC  C 3 2   ? 14.189  -0.844  28.406  1.00 47.86 ? 2    DC  D OP1   1 
ATOM   370  O  OP2   . DC  C 3 2   ? 11.791  -1.389  27.648  1.00 45.94 ? 2    DC  D OP2   1 
ATOM   371  O  "O5'" . DC  C 3 2   ? 12.451  0.942   28.237  1.00 44.25 ? 2    DC  D "O5'" 1 
ATOM   372  C  "C5'" . DC  C 3 2   ? 13.233  2.120   28.065  1.00 45.28 ? 2    DC  D "C5'" 1 
ATOM   373  C  "C4'" . DC  C 3 2   ? 12.570  3.285   28.761  1.00 44.94 ? 2    DC  D "C4'" 1 
ATOM   374  O  "O4'" . DC  C 3 2   ? 11.342  3.618   28.064  1.00 43.84 ? 2    DC  D "O4'" 1 
ATOM   375  C  "C3'" . DC  C 3 2   ? 12.172  2.998   30.209  1.00 46.36 ? 2    DC  D "C3'" 1 
ATOM   376  O  "O3'" . DC  C 3 2   ? 12.411  4.151   31.032  1.00 49.16 ? 2    DC  D "O3'" 1 
ATOM   377  C  "C2'" . DC  C 3 2   ? 10.689  2.683   30.113  1.00 44.87 ? 2    DC  D "C2'" 1 
ATOM   378  C  "C1'" . DC  C 3 2   ? 10.235  3.553   28.952  1.00 42.97 ? 2    DC  D "C1'" 1 
ATOM   379  N  N1    . DC  C 3 2   ? 9.090   3.004   28.203  1.00 40.50 ? 2    DC  D N1    1 
ATOM   380  C  C2    . DC  C 3 2   ? 7.930   3.778   28.065  1.00 37.65 ? 2    DC  D C2    1 
ATOM   381  O  O2    . DC  C 3 2   ? 7.896   4.904   28.576  1.00 36.85 ? 2    DC  D O2    1 
ATOM   382  N  N3    . DC  C 3 2   ? 6.878   3.275   27.377  1.00 37.29 ? 2    DC  D N3    1 
ATOM   383  C  C4    . DC  C 3 2   ? 6.956   2.055   26.838  1.00 36.58 ? 2    DC  D C4    1 
ATOM   384  N  N4    . DC  C 3 2   ? 5.896   1.596   26.163  1.00 34.60 ? 2    DC  D N4    1 
ATOM   385  C  C5    . DC  C 3 2   ? 8.123   1.249   26.965  1.00 37.01 ? 2    DC  D C5    1 
ATOM   386  C  C6    . DC  C 3 2   ? 9.155   1.757   27.648  1.00 38.92 ? 2    DC  D C6    1 
ATOM   387  P  P     . DC  C 3 3   ? 12.413  4.003   32.637  1.00 51.63 ? 3    DC  D P     1 
ATOM   388  O  OP1   . DC  C 3 3   ? 13.393  4.966   33.203  1.00 50.61 ? 3    DC  D OP1   1 
ATOM   389  O  OP2   . DC  C 3 3   ? 12.552  2.554   32.942  1.00 50.00 ? 3    DC  D OP2   1 
ATOM   390  O  "O5'" . DC  C 3 3   ? 10.951  4.477   33.059  1.00 48.64 ? 3    DC  D "O5'" 1 
ATOM   391  C  "C5'" . DC  C 3 3   ? 10.441  5.735   32.621  1.00 47.91 ? 3    DC  D "C5'" 1 
ATOM   392  C  "C4'" . DC  C 3 3   ? 8.965   5.842   32.925  1.00 47.04 ? 3    DC  D "C4'" 1 
ATOM   393  O  "O4'" . DC  C 3 3   ? 8.197   5.103   31.942  1.00 43.67 ? 3    DC  D "O4'" 1 
ATOM   394  C  "C3'" . DC  C 3 3   ? 8.540   5.290   34.291  1.00 47.15 ? 3    DC  D "C3'" 1 
ATOM   395  O  "O3'" . DC  C 3 3   ? 7.568   6.166   34.866  1.00 49.81 ? 3    DC  D "O3'" 1 
ATOM   396  C  "C2'" . DC  C 3 3   ? 7.870   3.973   33.941  1.00 44.60 ? 3    DC  D "C2'" 1 
ATOM   397  C  "C1'" . DC  C 3 3   ? 7.219   4.337   32.623  1.00 42.75 ? 3    DC  D "C1'" 1 
ATOM   398  N  N1    . DC  C 3 3   ? 6.857   3.201   31.768  1.00 38.77 ? 3    DC  D N1    1 
ATOM   399  C  C2    . DC  C 3 3   ? 5.674   3.271   31.036  1.00 38.02 ? 3    DC  D C2    1 
ATOM   400  O  O2    . DC  C 3 3   ? 4.959   4.279   31.151  1.00 37.79 ? 3    DC  D O2    1 
ATOM   401  N  N3    . DC  C 3 3   ? 5.335   2.242   30.228  1.00 37.11 ? 3    DC  D N3    1 
ATOM   402  C  C4    . DC  C 3 3   ? 6.124   1.171   30.147  1.00 36.44 ? 3    DC  D C4    1 
ATOM   403  N  N4    . DC  C 3 3   ? 5.747   0.175   29.342  1.00 37.08 ? 3    DC  D N4    1 
ATOM   404  C  C5    . DC  C 3 3   ? 7.333   1.069   30.892  1.00 38.24 ? 3    DC  D C5    1 
ATOM   405  C  C6    . DC  C 3 3   ? 7.658   2.098   31.682  1.00 38.31 ? 3    DC  D C6    1 
ATOM   406  P  P     . DG  C 3 4   ? 7.848   6.840   36.296  1.00 50.26 ? 4    DG  D P     1 
ATOM   407  O  OP1   . DG  C 3 4   ? 8.688   8.047   36.070  1.00 50.38 ? 4    DG  D OP1   1 
ATOM   408  O  OP2   . DG  C 3 4   ? 8.326   5.773   37.210  1.00 48.08 ? 4    DG  D OP2   1 
ATOM   409  O  "O5'" . DG  C 3 4   ? 6.409   7.335   36.762  1.00 48.07 ? 4    DG  D "O5'" 1 
ATOM   410  C  "C5'" . DG  C 3 4   ? 5.705   8.332   36.022  1.00 44.00 ? 4    DG  D "C5'" 1 
ATOM   411  C  "C4'" . DG  C 3 4   ? 4.229   8.012   35.989  1.00 43.48 ? 4    DG  D "C4'" 1 
ATOM   412  O  "O4'" . DG  C 3 4   ? 3.987   6.963   35.021  1.00 40.95 ? 4    DG  D "O4'" 1 
ATOM   413  C  "C3'" . DG  C 3 4   ? 3.660   7.506   37.319  1.00 42.92 ? 4    DG  D "C3'" 1 
ATOM   414  O  "O3'" . DG  C 3 4   ? 2.430   8.183   37.598  1.00 45.11 ? 4    DG  D "O3'" 1 
ATOM   415  C  "C2'" . DG  C 3 4   ? 3.410   6.028   37.073  1.00 40.93 ? 4    DG  D "C2'" 1 
ATOM   416  C  "C1'" . DG  C 3 4   ? 3.120   5.996   35.585  1.00 39.23 ? 4    DG  D "C1'" 1 
ATOM   417  N  N9    . DG  C 3 4   ? 3.404   4.713   34.949  1.00 35.23 ? 4    DG  D N9    1 
ATOM   418  C  C8    . DG  C 3 4   ? 4.504   3.915   35.153  1.00 33.47 ? 4    DG  D C8    1 
ATOM   419  N  N7    . DG  C 3 4   ? 4.472   2.811   34.458  1.00 32.74 ? 4    DG  D N7    1 
ATOM   420  C  C5    . DG  C 3 4   ? 3.280   2.886   33.749  1.00 32.25 ? 4    DG  D C5    1 
ATOM   421  C  C6    . DG  C 3 4   ? 2.690   1.966   32.840  1.00 33.15 ? 4    DG  D C6    1 
ATOM   422  O  O6    . DG  C 3 4   ? 3.122   0.866   32.464  1.00 35.37 ? 4    DG  D O6    1 
ATOM   423  N  N1    . DG  C 3 4   ? 1.471   2.433   32.358  1.00 30.64 ? 4    DG  D N1    1 
ATOM   424  C  C2    . DG  C 3 4   ? 0.892   3.627   32.704  1.00 31.64 ? 4    DG  D C2    1 
ATOM   425  N  N2    . DG  C 3 4   ? -0.291  3.899   32.129  1.00 31.64 ? 4    DG  D N2    1 
ATOM   426  N  N3    . DG  C 3 4   ? 1.431   4.493   33.551  1.00 31.52 ? 4    DG  D N3    1 
ATOM   427  C  C4    . DG  C 3 4   ? 2.614   4.058   34.033  1.00 31.73 ? 4    DG  D C4    1 
ATOM   428  N  N     . THR D 4 10  ? 31.089  13.663  28.295  1.00 82.88 ? 250  THR A N     1 
ATOM   429  C  CA    . THR D 4 10  ? 31.757  12.705  29.222  1.00 82.60 ? 250  THR A CA    1 
ATOM   430  C  C     . THR D 4 10  ? 31.186  11.302  29.044  1.00 82.18 ? 250  THR A C     1 
ATOM   431  O  O     . THR D 4 10  ? 31.080  10.534  30.003  1.00 82.80 ? 250  THR A O     1 
ATOM   432  C  CB    . THR D 4 10  ? 31.574  13.168  30.666  1.00 82.33 ? 250  THR A CB    1 
ATOM   433  N  N     . ASN D 4 11  ? 30.824  10.969  27.809  1.00 81.33 ? 251  ASN A N     1 
ATOM   434  C  CA    . ASN D 4 11  ? 30.253  9.663   27.503  1.00 80.39 ? 251  ASN A CA    1 
ATOM   435  C  C     . ASN D 4 11  ? 31.224  8.515   27.730  1.00 79.50 ? 251  ASN A C     1 
ATOM   436  O  O     . ASN D 4 11  ? 32.183  8.337   26.982  1.00 78.92 ? 251  ASN A O     1 
ATOM   437  C  CB    . ASN D 4 11  ? 29.757  9.627   26.056  1.00 80.90 ? 251  ASN A CB    1 
ATOM   438  C  CG    . ASN D 4 11  ? 29.316  8.242   25.629  1.00 80.25 ? 251  ASN A CG    1 
ATOM   439  O  OD1   . ASN D 4 11  ? 28.551  7.581   26.329  1.00 80.23 ? 251  ASN A OD1   1 
ATOM   440  N  ND2   . ASN D 4 11  ? 29.794  7.798   24.471  1.00 80.27 ? 251  ASN A ND2   1 
ATOM   441  N  N     . HIS D 4 12  ? 30.960  7.730   28.767  1.00 78.80 ? 252  HIS A N     1 
ATOM   442  C  CA    . HIS D 4 12  ? 31.798  6.589   29.095  1.00 78.87 ? 252  HIS A CA    1 
ATOM   443  C  C     . HIS D 4 12  ? 31.102  5.302   28.666  1.00 78.66 ? 252  HIS A C     1 
ATOM   444  O  O     . HIS D 4 12  ? 31.200  4.280   29.344  1.00 78.70 ? 252  HIS A O     1 
ATOM   445  C  CB    . HIS D 4 12  ? 32.076  6.564   30.594  1.00 79.11 ? 252  HIS A CB    1 
ATOM   446  N  N     . ASN D 4 13  ? 30.401  5.356   27.536  1.00 78.50 ? 253  ASN A N     1 
ATOM   447  C  CA    . ASN D 4 13  ? 29.683  4.191   27.023  1.00 77.92 ? 253  ASN A CA    1 
ATOM   448  C  C     . ASN D 4 13  ? 29.527  4.227   25.502  1.00 77.55 ? 253  ASN A C     1 
ATOM   449  O  O     . ASN D 4 13  ? 28.505  3.800   24.963  1.00 77.54 ? 253  ASN A O     1 
ATOM   450  C  CB    . ASN D 4 13  ? 28.301  4.110   27.673  1.00 77.58 ? 253  ASN A CB    1 
ATOM   451  C  CG    . ASN D 4 13  ? 28.376  3.972   29.178  1.00 77.22 ? 253  ASN A CG    1 
ATOM   452  O  OD1   . ASN D 4 13  ? 28.768  2.929   29.699  1.00 77.48 ? 253  ASN A OD1   1 
ATOM   453  N  ND2   . ASN D 4 13  ? 28.010  5.033   29.886  1.00 77.04 ? 253  ASN A ND2   1 
ATOM   454  N  N     . LEU D 4 14  ? 30.548  4.729   24.817  1.00 76.68 ? 254  LEU A N     1 
ATOM   455  C  CA    . LEU D 4 14  ? 30.518  4.826   23.365  1.00 76.67 ? 254  LEU A CA    1 
ATOM   456  C  C     . LEU D 4 14  ? 30.246  3.484   22.697  1.00 76.90 ? 254  LEU A C     1 
ATOM   457  O  O     . LEU D 4 14  ? 29.480  3.409   21.738  1.00 76.86 ? 254  LEU A O     1 
ATOM   458  C  CB    . LEU D 4 14  ? 31.830  5.402   22.856  1.00 76.46 ? 254  LEU A CB    1 
ATOM   459  N  N     . HIS D 4 15  ? 30.867  2.423   23.201  1.00 77.03 ? 255  HIS A N     1 
ATOM   460  C  CA    . HIS D 4 15  ? 30.679  1.100   22.616  1.00 77.70 ? 255  HIS A CA    1 
ATOM   461  C  C     . HIS D 4 15  ? 29.274  0.544   22.805  1.00 76.70 ? 255  HIS A C     1 
ATOM   462  O  O     . HIS D 4 15  ? 28.901  -0.454  22.184  1.00 76.75 ? 255  HIS A O     1 
ATOM   463  C  CB    . HIS D 4 15  ? 31.714  0.119   23.172  1.00 79.86 ? 255  HIS A CB    1 
ATOM   464  C  CG    . HIS D 4 15  ? 33.085  0.314   22.604  1.00 82.38 ? 255  HIS A CG    1 
ATOM   465  N  ND1   . HIS D 4 15  ? 33.329  0.337   21.247  1.00 83.12 ? 255  HIS A ND1   1 
ATOM   466  C  CD2   . HIS D 4 15  ? 34.285  0.500   23.205  1.00 83.25 ? 255  HIS A CD2   1 
ATOM   467  C  CE1   . HIS D 4 15  ? 34.619  0.529   21.036  1.00 83.90 ? 255  HIS A CE1   1 
ATOM   468  N  NE2   . HIS D 4 15  ? 35.222  0.632   22.208  1.00 83.86 ? 255  HIS A NE2   1 
ATOM   469  N  N     . ILE D 4 16  ? 28.494  1.189   23.663  1.00 74.66 ? 256  ILE A N     1 
ATOM   470  C  CA    . ILE D 4 16  ? 27.125  0.757   23.900  1.00 72.09 ? 256  ILE A CA    1 
ATOM   471  C  C     . ILE D 4 16  ? 26.178  1.601   23.054  1.00 70.16 ? 256  ILE A C     1 
ATOM   472  O  O     . ILE D 4 16  ? 25.434  1.075   22.228  1.00 69.50 ? 256  ILE A O     1 
ATOM   473  C  CB    . ILE D 4 16  ? 26.735  0.906   25.384  1.00 72.68 ? 256  ILE A CB    1 
ATOM   474  C  CG1   . ILE D 4 16  ? 27.574  -0.047  26.239  1.00 72.39 ? 256  ILE A CG1   1 
ATOM   475  C  CG2   . ILE D 4 16  ? 25.249  0.627   25.564  1.00 72.31 ? 256  ILE A CG2   1 
ATOM   476  C  CD1   . ILE D 4 16  ? 27.368  -1.512  25.916  1.00 72.53 ? 256  ILE A CD1   1 
ATOM   477  N  N     . THR D 4 17  ? 26.228  2.915   23.256  1.00 67.32 ? 257  THR A N     1 
ATOM   478  C  CA    . THR D 4 17  ? 25.366  3.834   22.527  1.00 64.85 ? 257  THR A CA    1 
ATOM   479  C  C     . THR D 4 17  ? 25.545  3.745   21.015  1.00 63.31 ? 257  THR A C     1 
ATOM   480  O  O     . THR D 4 17  ? 24.565  3.731   20.272  1.00 62.99 ? 257  THR A O     1 
ATOM   481  C  CB    . THR D 4 17  ? 25.607  5.291   22.969  1.00 64.75 ? 257  THR A CB    1 
ATOM   482  O  OG1   . THR D 4 17  ? 26.923  5.703   22.582  1.00 64.47 ? 257  THR A OG1   1 
ATOM   483  C  CG2   . THR D 4 17  ? 25.467  5.411   24.473  1.00 63.99 ? 257  THR A CG2   1 
ATOM   484  N  N     . GLU D 4 18  ? 26.792  3.683   20.560  1.00 60.96 ? 258  GLU A N     1 
ATOM   485  C  CA    . GLU D 4 18  ? 27.071  3.605   19.131  1.00 59.43 ? 258  GLU A CA    1 
ATOM   486  C  C     . GLU D 4 18  ? 26.282  2.474   18.479  1.00 58.01 ? 258  GLU A C     1 
ATOM   487  O  O     . GLU D 4 18  ? 25.873  2.578   17.325  1.00 57.88 ? 258  GLU A O     1 
ATOM   488  C  CB    . GLU D 4 18  ? 28.569  3.406   18.895  1.00 59.00 ? 258  GLU A CB    1 
ATOM   489  N  N     . LYS D 4 19  ? 26.070  1.396   19.224  1.00 56.67 ? 259  LYS A N     1 
ATOM   490  C  CA    . LYS D 4 19  ? 25.328  0.250   18.711  1.00 55.20 ? 259  LYS A CA    1 
ATOM   491  C  C     . LYS D 4 19  ? 23.821  0.500   18.791  1.00 53.87 ? 259  LYS A C     1 
ATOM   492  O  O     . LYS D 4 19  ? 23.063  0.077   17.916  1.00 53.60 ? 259  LYS A O     1 
ATOM   493  C  CB    . LYS D 4 19  ? 25.698  -1.005  19.497  1.00 54.97 ? 259  LYS A CB    1 
ATOM   494  N  N     . LEU D 4 20  ? 23.394  1.192   19.842  1.00 51.52 ? 260  LEU A N     1 
ATOM   495  C  CA    . LEU D 4 20  ? 21.980  1.496   20.033  1.00 49.84 ? 260  LEU A CA    1 
ATOM   496  C  C     . LEU D 4 20  ? 21.512  2.597   19.080  1.00 49.70 ? 260  LEU A C     1 
ATOM   497  O  O     . LEU D 4 20  ? 20.391  2.553   18.570  1.00 48.31 ? 260  LEU A O     1 
ATOM   498  C  CB    . LEU D 4 20  ? 21.721  1.921   21.485  1.00 48.22 ? 260  LEU A CB    1 
ATOM   499  C  CG    . LEU D 4 20  ? 22.005  0.870   22.563  1.00 46.14 ? 260  LEU A CG    1 
ATOM   500  C  CD1   . LEU D 4 20  ? 21.697  1.444   23.931  1.00 44.09 ? 260  LEU A CD1   1 
ATOM   501  C  CD2   . LEU D 4 20  ? 21.165  -0.374  22.307  1.00 45.77 ? 260  LEU A CD2   1 
ATOM   502  N  N     . GLU D 4 21  ? 22.376  3.578   18.838  1.00 48.97 ? 261  GLU A N     1 
ATOM   503  C  CA    . GLU D 4 21  ? 22.035  4.678   17.949  1.00 49.98 ? 261  GLU A CA    1 
ATOM   504  C  C     . GLU D 4 21  ? 21.711  4.174   16.551  1.00 48.24 ? 261  GLU A C     1 
ATOM   505  O  O     . GLU D 4 21  ? 20.881  4.755   15.854  1.00 46.79 ? 261  GLU A O     1 
ATOM   506  C  CB    . GLU D 4 21  ? 23.174  5.700   17.911  1.00 52.36 ? 261  GLU A CB    1 
ATOM   507  C  CG    . GLU D 4 21  ? 23.217  6.571   19.157  1.00 58.68 ? 261  GLU A CG    1 
ATOM   508  C  CD    . GLU D 4 21  ? 24.442  7.460   19.229  1.00 62.19 ? 261  GLU A CD    1 
ATOM   509  O  OE1   . GLU D 4 21  ? 25.556  6.936   19.446  1.00 64.96 ? 261  GLU A OE1   1 
ATOM   510  O  OE2   . GLU D 4 21  ? 24.288  8.688   19.068  1.00 65.67 ? 261  GLU A OE2   1 
ATOM   511  N  N     . VAL D 4 22  ? 22.359  3.087   16.146  1.00 47.29 ? 262  VAL A N     1 
ATOM   512  C  CA    . VAL D 4 22  ? 22.100  2.505   14.834  1.00 45.59 ? 262  VAL A CA    1 
ATOM   513  C  C     . VAL D 4 22  ? 20.697  1.921   14.846  1.00 44.51 ? 262  VAL A C     1 
ATOM   514  O  O     . VAL D 4 22  ? 19.917  2.116   13.912  1.00 45.47 ? 262  VAL A O     1 
ATOM   515  C  CB    . VAL D 4 22  ? 23.085  1.370   14.511  1.00 46.17 ? 262  VAL A CB    1 
ATOM   516  C  CG1   . VAL D 4 22  ? 22.723  0.737   13.176  1.00 46.26 ? 262  VAL A CG1   1 
ATOM   517  C  CG2   . VAL D 4 22  ? 24.506  1.909   14.480  1.00 46.64 ? 262  VAL A CG2   1 
ATOM   518  N  N     . LEU D 4 23  ? 20.380  1.206   15.918  1.00 42.15 ? 263  LEU A N     1 
ATOM   519  C  CA    . LEU D 4 23  ? 19.071  0.588   16.059  1.00 41.26 ? 263  LEU A CA    1 
ATOM   520  C  C     . LEU D 4 23  ? 17.974  1.653   16.183  1.00 39.30 ? 263  LEU A C     1 
ATOM   521  O  O     . LEU D 4 23  ? 16.864  1.470   15.693  1.00 38.67 ? 263  LEU A O     1 
ATOM   522  C  CB    . LEU D 4 23  ? 19.076  -0.336  17.279  1.00 41.17 ? 263  LEU A CB    1 
ATOM   523  C  CG    . LEU D 4 23  ? 18.186  -1.576  17.220  1.00 42.92 ? 263  LEU A CG    1 
ATOM   524  C  CD1   . LEU D 4 23  ? 18.382  -2.293  15.891  1.00 43.09 ? 263  LEU A CD1   1 
ATOM   525  C  CD2   . LEU D 4 23  ? 18.528  -2.498  18.386  1.00 43.53 ? 263  LEU A CD2   1 
ATOM   526  N  N     . ALA D 4 24  ? 18.297  2.774   16.817  1.00 38.11 ? 264  ALA A N     1 
ATOM   527  C  CA    . ALA D 4 24  ? 17.332  3.852   16.989  1.00 37.22 ? 264  ALA A CA    1 
ATOM   528  C  C     . ALA D 4 24  ? 16.970  4.487   15.647  1.00 37.80 ? 264  ALA A C     1 
ATOM   529  O  O     . ALA D 4 24  ? 15.795  4.720   15.356  1.00 37.77 ? 264  ALA A O     1 
ATOM   530  C  CB    . ALA D 4 24  ? 17.896  4.909   17.927  1.00 37.09 ? 264  ALA A CB    1 
ATOM   531  N  N     . LYS D 4 25  ? 17.984  4.767   14.834  1.00 36.93 ? 265  LYS A N     1 
ATOM   532  C  CA    . LYS D 4 25  ? 17.771  5.377   13.528  1.00 36.50 ? 265  LYS A CA    1 
ATOM   533  C  C     . LYS D 4 25  ? 16.978  4.425   12.641  1.00 35.52 ? 265  LYS A C     1 
ATOM   534  O  O     . LYS D 4 25  ? 16.120  4.852   11.866  1.00 35.58 ? 265  LYS A O     1 
ATOM   535  C  CB    . LYS D 4 25  ? 19.117  5.715   12.875  1.00 36.06 ? 265  LYS A CB    1 
ATOM   536  N  N     . ALA D 4 26  ? 17.272  3.135   12.758  1.00 33.18 ? 266  ALA A N     1 
ATOM   537  C  CA    . ALA D 4 26  ? 16.575  2.127   11.969  1.00 33.76 ? 266  ALA A CA    1 
ATOM   538  C  C     . ALA D 4 26  ? 15.075  2.218   12.247  1.00 33.78 ? 266  ALA A C     1 
ATOM   539  O  O     . ALA D 4 26  ? 14.265  2.330   11.324  1.00 32.83 ? 266  ALA A O     1 
ATOM   540  C  CB    . ALA D 4 26  ? 17.092  0.732   12.321  1.00 32.75 ? 266  ALA A CB    1 
ATOM   541  N  N     . TYR D 4 27  ? 14.713  2.175   13.525  1.00 32.65 ? 267  TYR A N     1 
ATOM   542  C  CA    . TYR D 4 27  ? 13.312  2.260   13.913  1.00 32.31 ? 267  TYR A CA    1 
ATOM   543  C  C     . TYR D 4 27  ? 12.703  3.592   13.492  1.00 31.73 ? 267  TYR A C     1 
ATOM   544  O  O     . TYR D 4 27  ? 11.557  3.644   13.063  1.00 30.12 ? 267  TYR A O     1 
ATOM   545  C  CB    . TYR D 4 27  ? 13.158  2.102   15.426  1.00 33.07 ? 267  TYR A CB    1 
ATOM   546  C  CG    . TYR D 4 27  ? 13.310  0.685   15.932  1.00 33.59 ? 267  TYR A CG    1 
ATOM   547  C  CD1   . TYR D 4 27  ? 12.504  -0.343  15.441  1.00 34.89 ? 267  TYR A CD1   1 
ATOM   548  C  CD2   . TYR D 4 27  ? 14.232  0.380   16.932  1.00 34.73 ? 267  TYR A CD2   1 
ATOM   549  C  CE1   . TYR D 4 27  ? 12.611  -1.641  15.935  1.00 36.36 ? 267  TYR A CE1   1 
ATOM   550  C  CE2   . TYR D 4 27  ? 14.349  -0.911  17.436  1.00 35.72 ? 267  TYR A CE2   1 
ATOM   551  C  CZ    . TYR D 4 27  ? 13.534  -1.917  16.932  1.00 37.52 ? 267  TYR A CZ    1 
ATOM   552  O  OH    . TYR D 4 27  ? 13.643  -3.195  17.431  1.00 41.05 ? 267  TYR A OH    1 
ATOM   553  N  N     . SER D 4 28  ? 13.473  4.667   13.614  1.00 32.18 ? 268  SER A N     1 
ATOM   554  C  CA    . SER D 4 28  ? 12.967  5.980   13.250  1.00 33.13 ? 268  SER A CA    1 
ATOM   555  C  C     . SER D 4 28  ? 12.603  6.098   11.775  1.00 32.13 ? 268  SER A C     1 
ATOM   556  O  O     . SER D 4 28  ? 11.511  6.564   11.443  1.00 32.37 ? 268  SER A O     1 
ATOM   557  C  CB    . SER D 4 28  ? 13.976  7.069   13.614  1.00 33.94 ? 268  SER A CB    1 
ATOM   558  O  OG    . SER D 4 28  ? 13.392  8.345   13.402  1.00 35.56 ? 268  SER A OG    1 
ATOM   559  N  N     . VAL D 4 29  ? 13.504  5.676   10.888  1.00 32.17 ? 269  VAL A N     1 
ATOM   560  C  CA    . VAL D 4 29  ? 13.230  5.762   9.457   1.00 31.59 ? 269  VAL A CA    1 
ATOM   561  C  C     . VAL D 4 29  ? 12.106  4.823   9.032   1.00 33.08 ? 269  VAL A C     1 
ATOM   562  O  O     . VAL D 4 29  ? 11.382  5.106   8.073   1.00 31.66 ? 269  VAL A O     1 
ATOM   563  C  CB    . VAL D 4 29  ? 14.493  5.465   8.600   1.00 34.09 ? 269  VAL A CB    1 
ATOM   564  C  CG1   . VAL D 4 29  ? 15.605  6.436   8.967   1.00 33.37 ? 269  VAL A CG1   1 
ATOM   565  C  CG2   . VAL D 4 29  ? 14.943  4.022   8.789   1.00 32.48 ? 269  VAL A CG2   1 
ATOM   566  N  N     . GLN D 4 30  ? 11.953  3.710   9.746   1.00 32.17 ? 270  GLN A N     1 
ATOM   567  C  CA    . GLN D 4 30  ? 10.896  2.754   9.424   1.00 33.16 ? 270  GLN A CA    1 
ATOM   568  C  C     . GLN D 4 30  ? 9.536   3.224   9.946   1.00 33.70 ? 270  GLN A C     1 
ATOM   569  O  O     . GLN D 4 30  ? 8.517   2.560   9.745   1.00 33.29 ? 270  GLN A O     1 
ATOM   570  C  CB    . GLN D 4 30  ? 11.236  1.382   10.003  1.00 34.40 ? 270  GLN A CB    1 
ATOM   571  C  CG    . GLN D 4 30  ? 12.444  0.741   9.349   1.00 37.95 ? 270  GLN A CG    1 
ATOM   572  C  CD    . GLN D 4 30  ? 12.912  -0.504  10.079  1.00 39.75 ? 270  GLN A CD    1 
ATOM   573  O  OE1   . GLN D 4 30  ? 13.342  -0.436  11.229  1.00 43.45 ? 270  GLN A OE1   1 
ATOM   574  N  NE2   . GLN D 4 30  ? 12.826  -1.649  9.414   1.00 36.91 ? 270  GLN A NE2   1 
ATOM   575  N  N     . GLY D 4 31  ? 9.526   4.369   10.625  1.00 33.02 ? 271  GLY A N     1 
ATOM   576  C  CA    . GLY D 4 31  ? 8.274   4.901   11.143  1.00 32.97 ? 271  GLY A CA    1 
ATOM   577  C  C     . GLY D 4 31  ? 7.872   4.475   12.549  1.00 33.51 ? 271  GLY A C     1 
ATOM   578  O  O     . GLY D 4 31  ? 6.833   4.912   13.052  1.00 33.19 ? 271  GLY A O     1 
ATOM   579  N  N     . ASP D 4 32  ? 8.665   3.620   13.192  1.00 32.49 ? 272  ASP A N     1 
ATOM   580  C  CA    . ASP D 4 32  ? 8.335   3.195   14.552  1.00 33.20 ? 272  ASP A CA    1 
ATOM   581  C  C     . ASP D 4 32  ? 8.785   4.305   15.493  1.00 32.77 ? 272  ASP A C     1 
ATOM   582  O  O     . ASP D 4 32  ? 9.737   4.148   16.258  1.00 32.14 ? 272  ASP A O     1 
ATOM   583  C  CB    . ASP D 4 32  ? 9.052   1.896   14.907  1.00 34.26 ? 272  ASP A CB    1 
ATOM   584  C  CG    . ASP D 4 32  ? 8.475   1.242   16.146  1.00 36.77 ? 272  ASP A CG    1 
ATOM   585  O  OD1   . ASP D 4 32  ? 7.877   1.965   16.976  1.00 38.16 ? 272  ASP A OD1   1 
ATOM   586  O  OD2   . ASP D 4 32  ? 8.629   0.015   16.295  1.00 35.65 ? 272  ASP A OD2   1 
ATOM   587  N  N     . LYS D 4 33  ? 8.077   5.426   15.419  1.00 32.71 ? 273  LYS A N     1 
ATOM   588  C  CA    . LYS D 4 33  ? 8.372   6.625   16.192  1.00 34.16 ? 273  LYS A CA    1 
ATOM   589  C  C     . LYS D 4 33  ? 8.529   6.478   17.701  1.00 33.37 ? 273  LYS A C     1 
ATOM   590  O  O     . LYS D 4 33  ? 9.513   6.944   18.277  1.00 33.36 ? 273  LYS A O     1 
ATOM   591  C  CB    . LYS D 4 33  ? 7.303   7.688   15.909  1.00 35.39 ? 273  LYS A CB    1 
ATOM   592  C  CG    . LYS D 4 33  ? 7.558   9.013   16.609  1.00 40.36 ? 273  LYS A CG    1 
ATOM   593  C  CD    . LYS D 4 33  ? 6.396   9.990   16.430  1.00 44.50 ? 273  LYS A CD    1 
ATOM   594  C  CE    . LYS D 4 33  ? 6.635   11.269  17.236  1.00 47.53 ? 273  LYS A CE    1 
ATOM   595  N  NZ    . LYS D 4 33  ? 5.549   12.280  17.073  1.00 49.38 ? 273  LYS A NZ    1 
ATOM   596  N  N     . TRP D 4 34  ? 7.558   5.851   18.349  1.00 32.26 ? 274  TRP A N     1 
ATOM   597  C  CA    . TRP D 4 34  ? 7.616   5.710   19.798  1.00 33.39 ? 274  TRP A CA    1 
ATOM   598  C  C     . TRP D 4 34  ? 8.737   4.803   20.280  1.00 33.27 ? 274  TRP A C     1 
ATOM   599  O  O     . TRP D 4 34  ? 9.382   5.091   21.293  1.00 33.31 ? 274  TRP A O     1 
ATOM   600  C  CB    . TRP D 4 34  ? 6.258   5.235   20.319  1.00 32.75 ? 274  TRP A CB    1 
ATOM   601  C  CG    . TRP D 4 34  ? 5.165   6.203   19.981  1.00 32.69 ? 274  TRP A CG    1 
ATOM   602  C  CD1   . TRP D 4 34  ? 3.966   5.915   19.402  1.00 33.70 ? 274  TRP A CD1   1 
ATOM   603  C  CD2   . TRP D 4 34  ? 5.179   7.625   20.192  1.00 32.97 ? 274  TRP A CD2   1 
ATOM   604  N  NE1   . TRP D 4 34  ? 3.230   7.068   19.235  1.00 35.73 ? 274  TRP A NE1   1 
ATOM   605  C  CE2   . TRP D 4 34  ? 3.952   8.131   19.711  1.00 34.79 ? 274  TRP A CE2   1 
ATOM   606  C  CE3   . TRP D 4 34  ? 6.110   8.518   20.738  1.00 32.82 ? 274  TRP A CE3   1 
ATOM   607  C  CZ2   . TRP D 4 34  ? 3.628   9.492   19.763  1.00 35.43 ? 274  TRP A CZ2   1 
ATOM   608  C  CZ3   . TRP D 4 34  ? 5.789   9.871   20.790  1.00 35.21 ? 274  TRP A CZ3   1 
ATOM   609  C  CH2   . TRP D 4 34  ? 4.558   10.344  20.303  1.00 35.42 ? 274  TRP A CH2   1 
ATOM   610  N  N     . ARG D 4 35  ? 8.989   3.717   19.559  1.00 33.69 ? 275  ARG A N     1 
ATOM   611  C  CA    . ARG D 4 35  ? 10.057  2.824   19.969  1.00 33.44 ? 275  ARG A CA    1 
ATOM   612  C  C     . ARG D 4 35  ? 11.378  3.562   19.792  1.00 33.09 ? 275  ARG A C     1 
ATOM   613  O  O     . ARG D 4 35  ? 12.287  3.437   20.617  1.00 33.27 ? 275  ARG A O     1 
ATOM   614  C  CB    . ARG D 4 35  ? 10.045  1.539   19.143  1.00 35.37 ? 275  ARG A CB    1 
ATOM   615  C  CG    . ARG D 4 35  ? 11.060  0.504   19.632  1.00 39.76 ? 275  ARG A CG    1 
ATOM   616  C  CD    . ARG D 4 35  ? 10.979  -0.781  18.831  1.00 43.51 ? 275  ARG A CD    1 
ATOM   617  N  NE    . ARG D 4 35  ? 9.667   -1.415  18.931  1.00 47.08 ? 275  ARG A NE    1 
ATOM   618  C  CZ    . ARG D 4 35  ? 9.205   -2.012  20.026  1.00 49.98 ? 275  ARG A CZ    1 
ATOM   619  N  NH1   . ARG D 4 35  ? 9.949   -2.061  21.123  1.00 53.16 ? 275  ARG A NH1   1 
ATOM   620  N  NH2   . ARG D 4 35  ? 7.999   -2.568  20.025  1.00 50.00 ? 275  ARG A NH2   1 
ATOM   621  N  N     . ALA D 4 36  ? 11.482  4.337   18.715  1.00 31.43 ? 276  ALA A N     1 
ATOM   622  C  CA    . ALA D 4 36  ? 12.703  5.113   18.478  1.00 33.63 ? 276  ALA A CA    1 
ATOM   623  C  C     . ALA D 4 36  ? 12.893  6.139   19.594  1.00 34.44 ? 276  ALA A C     1 
ATOM   624  O  O     . ALA D 4 36  ? 14.020  6.404   20.028  1.00 34.44 ? 276  ALA A O     1 
ATOM   625  C  CB    . ALA D 4 36  ? 12.647  5.847   17.106  1.00 31.58 ? 276  ALA A CB    1 
ATOM   626  N  N     . LEU D 4 37  ? 11.795  6.749   20.027  1.00 35.53 ? 277  LEU A N     1 
ATOM   627  C  CA    . LEU D 4 37  ? 11.872  7.728   21.105  1.00 37.11 ? 277  LEU A CA    1 
ATOM   628  C  C     . LEU D 4 37  ? 12.462  7.022   22.321  1.00 38.29 ? 277  LEU A C     1 
ATOM   629  O  O     . LEU D 4 37  ? 13.371  7.542   22.969  1.00 38.97 ? 277  LEU A O     1 
ATOM   630  C  CB    . LEU D 4 37  ? 10.479  8.268   21.443  1.00 37.16 ? 277  LEU A CB    1 
ATOM   631  C  CG    . LEU D 4 37  ? 10.364  9.180   22.672  1.00 37.81 ? 277  LEU A CG    1 
ATOM   632  C  CD1   . LEU D 4 37  ? 11.190  10.442  22.473  1.00 39.12 ? 277  LEU A CD1   1 
ATOM   633  C  CD2   . LEU D 4 37  ? 8.906   9.532   22.913  1.00 37.37 ? 277  LEU A CD2   1 
ATOM   634  N  N     . GLY D 4 38  ? 11.942  5.832   22.614  1.00 39.60 ? 278  GLY A N     1 
ATOM   635  C  CA    . GLY D 4 38  ? 12.427  5.057   23.745  1.00 40.46 ? 278  GLY A CA    1 
ATOM   636  C  C     . GLY D 4 38  ? 13.933  4.895   23.700  1.00 41.94 ? 278  GLY A C     1 
ATOM   637  O  O     . GLY D 4 38  ? 14.623  5.144   24.690  1.00 43.96 ? 278  GLY A O     1 
ATOM   638  N  N     . TYR D 4 39  ? 14.451  4.486   22.546  1.00 41.69 ? 279  TYR A N     1 
ATOM   639  C  CA    . TYR D 4 39  ? 15.889  4.306   22.388  1.00 43.40 ? 279  TYR A CA    1 
ATOM   640  C  C     . TYR D 4 39  ? 16.636  5.619   22.545  1.00 44.56 ? 279  TYR A C     1 
ATOM   641  O  O     . TYR D 4 39  ? 17.696  5.662   23.161  1.00 44.60 ? 279  TYR A O     1 
ATOM   642  C  CB    . TYR D 4 39  ? 16.225  3.714   21.012  1.00 41.49 ? 279  TYR A CB    1 
ATOM   643  C  CG    . TYR D 4 39  ? 16.165  2.204   20.946  1.00 41.88 ? 279  TYR A CG    1 
ATOM   644  C  CD1   . TYR D 4 39  ? 14.944  1.532   20.861  1.00 41.94 ? 279  TYR A CD1   1 
ATOM   645  C  CD2   . TYR D 4 39  ? 17.336  1.446   20.975  1.00 42.18 ? 279  TYR A CD2   1 
ATOM   646  C  CE1   . TYR D 4 39  ? 14.893  0.137   20.802  1.00 42.41 ? 279  TYR A CE1   1 
ATOM   647  C  CE2   . TYR D 4 39  ? 17.298  0.056   20.922  1.00 42.66 ? 279  TYR A CE2   1 
ATOM   648  C  CZ    . TYR D 4 39  ? 16.077  -0.592  20.834  1.00 43.49 ? 279  TYR A CZ    1 
ATOM   649  O  OH    . TYR D 4 39  ? 16.042  -1.966  20.782  1.00 43.77 ? 279  TYR A OH    1 
ATOM   650  N  N     . ALA D 4 40  ? 16.082  6.685   21.976  1.00 45.95 ? 280  ALA A N     1 
ATOM   651  C  CA    . ALA D 4 40  ? 16.709  7.999   22.035  1.00 48.62 ? 280  ALA A CA    1 
ATOM   652  C  C     . ALA D 4 40  ? 17.000  8.439   23.461  1.00 50.19 ? 280  ALA A C     1 
ATOM   653  O  O     . ALA D 4 40  ? 18.089  8.930   23.755  1.00 50.74 ? 280  ALA A O     1 
ATOM   654  C  CB    . ALA D 4 40  ? 15.825  9.029   21.344  1.00 49.41 ? 280  ALA A CB    1 
ATOM   655  N  N     . LYS D 4 41  ? 16.028  8.262   24.347  1.00 51.48 ? 281  LYS A N     1 
ATOM   656  C  CA    . LYS D 4 41  ? 16.201  8.659   25.733  1.00 53.60 ? 281  LYS A CA    1 
ATOM   657  C  C     . LYS D 4 41  ? 17.213  7.771   26.443  1.00 55.28 ? 281  LYS A C     1 
ATOM   658  O  O     . LYS D 4 41  ? 18.004  8.254   27.256  1.00 55.19 ? 281  LYS A O     1 
ATOM   659  C  CB    . LYS D 4 41  ? 14.856  8.630   26.461  1.00 53.86 ? 281  LYS A CB    1 
ATOM   660  C  CG    . LYS D 4 41  ? 13.862  9.646   25.914  1.00 55.56 ? 281  LYS A CG    1 
ATOM   661  C  CD    . LYS D 4 41  ? 12.590  9.715   26.746  1.00 57.20 ? 281  LYS A CD    1 
ATOM   662  C  CE    . LYS D 4 41  ? 11.636  10.773  26.198  1.00 58.61 ? 281  LYS A CE    1 
ATOM   663  N  NZ    . LYS D 4 41  ? 10.394  10.914  27.017  1.00 59.00 ? 281  LYS A NZ    1 
ATOM   664  N  N     . ALA D 4 42  ? 17.192  6.478   26.133  1.00 56.56 ? 282  ALA A N     1 
ATOM   665  C  CA    . ALA D 4 42  ? 18.124  5.536   26.743  1.00 58.52 ? 282  ALA A CA    1 
ATOM   666  C  C     . ALA D 4 42  ? 19.550  5.900   26.338  1.00 60.37 ? 282  ALA A C     1 
ATOM   667  O  O     . ALA D 4 42  ? 20.447  5.977   27.179  1.00 60.06 ? 282  ALA A O     1 
ATOM   668  C  CB    . ALA D 4 42  ? 17.799  4.115   26.304  1.00 57.32 ? 282  ALA A CB    1 
ATOM   669  N  N     . ILE D 4 43  ? 19.745  6.130   25.043  1.00 62.69 ? 283  ILE A N     1 
ATOM   670  C  CA    . ILE D 4 43  ? 21.048  6.495   24.502  1.00 64.57 ? 283  ILE A CA    1 
ATOM   671  C  C     . ILE D 4 43  ? 21.529  7.804   25.115  1.00 66.56 ? 283  ILE A C     1 
ATOM   672  O  O     . ILE D 4 43  ? 22.715  7.967   25.410  1.00 67.10 ? 283  ILE A O     1 
ATOM   673  C  CB    . ILE D 4 43  ? 20.982  6.659   22.967  1.00 64.27 ? 283  ILE A CB    1 
ATOM   674  C  CG1   . ILE D 4 43  ? 20.701  5.301   22.315  1.00 64.09 ? 283  ILE A CG1   1 
ATOM   675  C  CG2   . ILE D 4 43  ? 22.281  7.256   22.444  1.00 63.94 ? 283  ILE A CG2   1 
ATOM   676  C  CD1   . ILE D 4 43  ? 20.482  5.366   20.823  1.00 64.24 ? 283  ILE A CD1   1 
ATOM   677  N  N     . ASN D 4 44  ? 20.597  8.734   25.297  1.00 68.42 ? 284  ASN A N     1 
ATOM   678  C  CA    . ASN D 4 44  ? 20.903  10.034  25.878  1.00 69.92 ? 284  ASN A CA    1 
ATOM   679  C  C     . ASN D 4 44  ? 21.379  9.822   27.314  1.00 71.69 ? 284  ASN A C     1 
ATOM   680  O  O     . ASN D 4 44  ? 22.368  10.416  27.754  1.00 71.14 ? 284  ASN A O     1 
ATOM   681  C  CB    . ASN D 4 44  ? 19.649  10.910  25.861  1.00 69.86 ? 284  ASN A CB    1 
ATOM   682  C  CG    . ASN D 4 44  ? 19.943  12.360  26.182  1.00 71.01 ? 284  ASN A CG    1 
ATOM   683  O  OD1   . ASN D 4 44  ? 20.446  12.683  27.260  1.00 70.36 ? 284  ASN A OD1   1 
ATOM   684  N  ND2   . ASN D 4 44  ? 19.626  13.247  25.245  1.00 71.91 ? 284  ASN A ND2   1 
ATOM   685  N  N     . ALA D 4 45  ? 20.669  8.962   28.035  1.00 72.59 ? 285  ALA A N     1 
ATOM   686  C  CA    . ALA D 4 45  ? 21.016  8.655   29.412  1.00 74.58 ? 285  ALA A CA    1 
ATOM   687  C  C     . ALA D 4 45  ? 22.424  8.072   29.479  1.00 76.41 ? 285  ALA A C     1 
ATOM   688  O  O     . ALA D 4 45  ? 23.273  8.565   30.222  1.00 77.03 ? 285  ALA A O     1 
ATOM   689  C  CB    . ALA D 4 45  ? 20.012  7.667   29.992  1.00 74.09 ? 285  ALA A CB    1 
ATOM   690  N  N     . LEU D 4 46  ? 22.666  7.027   28.691  1.00 78.00 ? 286  LEU A N     1 
ATOM   691  C  CA    . LEU D 4 46  ? 23.965  6.360   28.658  1.00 79.85 ? 286  LEU A CA    1 
ATOM   692  C  C     . LEU D 4 46  ? 25.127  7.300   28.342  1.00 81.31 ? 286  LEU A C     1 
ATOM   693  O  O     . LEU D 4 46  ? 26.292  6.924   28.484  1.00 81.66 ? 286  LEU A O     1 
ATOM   694  C  CB    . LEU D 4 46  ? 23.951  5.216   27.638  1.00 79.49 ? 286  LEU A CB    1 
ATOM   695  C  CG    . LEU D 4 46  ? 23.011  4.034   27.893  1.00 79.90 ? 286  LEU A CG    1 
ATOM   696  C  CD1   . LEU D 4 46  ? 23.154  3.025   26.766  1.00 79.96 ? 286  LEU A CD1   1 
ATOM   697  C  CD2   . LEU D 4 46  ? 23.337  3.384   29.227  1.00 79.98 ? 286  LEU A CD2   1 
ATOM   698  N  N     . LYS D 4 47  ? 24.817  8.516   27.906  1.00 82.48 ? 287  LYS A N     1 
ATOM   699  C  CA    . LYS D 4 47  ? 25.860  9.481   27.582  1.00 83.77 ? 287  LYS A CA    1 
ATOM   700  C  C     . LYS D 4 47  ? 26.020  10.517  28.688  1.00 84.59 ? 287  LYS A C     1 
ATOM   701  O  O     . LYS D 4 47  ? 26.861  11.413  28.600  1.00 84.86 ? 287  LYS A O     1 
ATOM   702  C  CB    . LYS D 4 47  ? 25.548  10.168  26.251  1.00 82.98 ? 287  LYS A CB    1 
ATOM   703  C  CG    . LYS D 4 47  ? 25.588  9.221   25.064  1.00 82.54 ? 287  LYS A CG    1 
ATOM   704  C  CD    . LYS D 4 47  ? 25.372  9.952   23.757  1.00 82.01 ? 287  LYS A CD    1 
ATOM   705  C  CE    . LYS D 4 47  ? 25.516  9.005   22.578  1.00 82.29 ? 287  LYS A CE    1 
ATOM   706  N  NZ    . LYS D 4 47  ? 25.358  9.717   21.281  1.00 82.77 ? 287  LYS A NZ    1 
ATOM   707  N  N     . SER D 4 48  ? 25.211  10.382  29.733  1.00 85.33 ? 288  SER A N     1 
ATOM   708  C  CA    . SER D 4 48  ? 25.257  11.296  30.865  1.00 86.45 ? 288  SER A CA    1 
ATOM   709  C  C     . SER D 4 48  ? 25.746  10.559  32.110  1.00 87.19 ? 288  SER A C     1 
ATOM   710  O  O     . SER D 4 48  ? 26.138  11.181  33.099  1.00 87.16 ? 288  SER A O     1 
ATOM   711  C  CB    . SER D 4 48  ? 23.872  11.893  31.112  1.00 86.31 ? 288  SER A CB    1 
ATOM   712  N  N     . PHE D 4 49  ? 25.719  9.229   32.052  1.00 87.88 ? 289  PHE A N     1 
ATOM   713  C  CA    . PHE D 4 49  ? 26.162  8.399   33.168  1.00 88.68 ? 289  PHE A CA    1 
ATOM   714  C  C     . PHE D 4 49  ? 27.683  8.309   33.195  1.00 89.31 ? 289  PHE A C     1 
ATOM   715  O  O     . PHE D 4 49  ? 28.273  7.393   32.619  1.00 89.79 ? 289  PHE A O     1 
ATOM   716  C  CB    . PHE D 4 49  ? 25.557  7.003   33.060  1.00 87.85 ? 289  PHE A CB    1 
ATOM   717  N  N     . HIS D 4 50  ? 28.307  9.275   33.856  1.00 89.91 ? 290  HIS A N     1 
ATOM   718  C  CA    . HIS D 4 50  ? 29.760  9.380   34.011  1.00 90.17 ? 290  HIS A CA    1 
ATOM   719  C  C     . HIS D 4 50  ? 30.518  8.039   34.119  1.00 90.37 ? 290  HIS A C     1 
ATOM   720  O  O     . HIS D 4 50  ? 31.613  7.891   33.568  1.00 90.40 ? 290  HIS A O     1 
ATOM   721  C  CB    . HIS D 4 50  ? 30.045  10.220  35.255  1.00 90.00 ? 290  HIS A CB    1 
ATOM   722  N  N     . LYS D 4 51  ? 29.924  7.076   34.820  1.00 90.53 ? 291  LYS A N     1 
ATOM   723  C  CA    . LYS D 4 51  ? 30.544  5.781   35.052  1.00 90.41 ? 291  LYS A CA    1 
ATOM   724  C  C     . LYS D 4 51  ? 29.963  4.801   34.043  1.00 90.72 ? 291  LYS A C     1 
ATOM   725  O  O     . LYS D 4 51  ? 28.765  4.817   33.761  1.00 90.61 ? 291  LYS A O     1 
ATOM   726  C  CB    . LYS D 4 51  ? 30.286  5.242   36.460  1.00 89.82 ? 291  LYS A CB    1 
ATOM   727  C  CG    . LYS D 4 51  ? 30.679  3.785   36.624  1.00 89.88 ? 291  LYS A CG    1 
ATOM   728  C  CD    . LYS D 4 51  ? 30.083  3.174   37.874  1.00 89.88 ? 291  LYS A CD    1 
ATOM   729  C  CE    . LYS D 4 51  ? 30.409  1.690   37.955  1.00 90.38 ? 291  LYS A CE    1 
ATOM   730  N  NZ    . LYS D 4 51  ? 29.935  0.943   36.753  1.00 90.40 ? 291  LYS A NZ    1 
ATOM   731  N  N     . PRO D 4 52  ? 30.815  3.935   33.481  1.00 91.18 ? 292  PRO A N     1 
ATOM   732  C  CA    . PRO D 4 52  ? 30.383  2.935   32.502  1.00 91.44 ? 292  PRO A CA    1 
ATOM   733  C  C     . PRO D 4 52  ? 29.582  1.838   33.200  1.00 91.28 ? 292  PRO A C     1 
ATOM   734  O  O     . PRO D 4 52  ? 30.123  1.107   34.031  1.00 91.49 ? 292  PRO A O     1 
ATOM   735  C  CB    . PRO D 4 52  ? 31.702  2.403   31.944  1.00 91.58 ? 292  PRO A CB    1 
ATOM   736  C  CG    . PRO D 4 52  ? 32.641  3.561   32.118  1.00 91.58 ? 292  PRO A CG    1 
ATOM   737  C  CD    . PRO D 4 52  ? 32.283  4.045   33.495  1.00 91.58 ? 292  PRO A CD    1 
ATOM   738  N  N     . VAL D 4 53  ? 28.298  1.732   32.872  1.00 91.15 ? 293  VAL A N     1 
ATOM   739  C  CA    . VAL D 4 53  ? 27.441  0.716   33.476  1.00 91.26 ? 293  VAL A CA    1 
ATOM   740  C  C     . VAL D 4 53  ? 28.205  -0.601  33.530  1.00 91.10 ? 293  VAL A C     1 
ATOM   741  O  O     . VAL D 4 53  ? 28.886  -0.967  32.573  1.00 91.02 ? 293  VAL A O     1 
ATOM   742  C  CB    . VAL D 4 53  ? 26.163  0.553   32.659  1.00 90.39 ? 293  VAL A CB    1 
ATOM   743  N  N     . THR D 4 54  ? 28.099  -1.309  34.650  1.00 91.14 ? 294  THR A N     1 
ATOM   744  C  CA    . THR D 4 54  ? 28.807  -2.573  34.804  1.00 91.05 ? 294  THR A CA    1 
ATOM   745  C  C     . THR D 4 54  ? 27.892  -3.744  35.148  1.00 90.75 ? 294  THR A C     1 
ATOM   746  O  O     . THR D 4 54  ? 28.312  -4.899  35.091  1.00 90.81 ? 294  THR A O     1 
ATOM   747  C  CB    . THR D 4 54  ? 29.892  -2.429  35.869  1.00 90.47 ? 294  THR A CB    1 
ATOM   748  N  N     . SER D 4 55  ? 26.643  -3.452  35.496  1.00 90.44 ? 295  SER A N     1 
ATOM   749  C  CA    . SER D 4 55  ? 25.700  -4.505  35.858  1.00 90.28 ? 295  SER A CA    1 
ATOM   750  C  C     . SER D 4 55  ? 24.326  -4.356  35.208  1.00 90.20 ? 295  SER A C     1 
ATOM   751  O  O     . SER D 4 55  ? 23.936  -3.265  34.791  1.00 90.46 ? 295  SER A O     1 
ATOM   752  C  CB    . SER D 4 55  ? 25.537  -4.548  37.381  1.00 90.09 ? 295  SER A CB    1 
ATOM   753  O  OG    . SER D 4 55  ? 24.560  -5.497  37.771  1.00 90.32 ? 295  SER A OG    1 
ATOM   754  N  N     . TYR D 4 56  ? 23.600  -5.467  35.120  1.00 89.91 ? 296  TYR A N     1 
ATOM   755  C  CA    . TYR D 4 56  ? 22.258  -5.470  34.551  1.00 89.41 ? 296  TYR A CA    1 
ATOM   756  C  C     . TYR D 4 56  ? 21.368  -4.649  35.475  1.00 88.98 ? 296  TYR A C     1 
ATOM   757  O  O     . TYR D 4 56  ? 20.339  -4.115  35.060  1.00 89.18 ? 296  TYR A O     1 
ATOM   758  C  CB    . TYR D 4 56  ? 21.727  -6.901  34.460  1.00 89.92 ? 296  TYR A CB    1 
ATOM   759  C  CG    . TYR D 4 56  ? 20.250  -6.997  34.147  1.00 90.76 ? 296  TYR A CG    1 
ATOM   760  C  CD1   . TYR D 4 56  ? 19.749  -6.607  32.906  1.00 91.02 ? 296  TYR A CD1   1 
ATOM   761  C  CD2   . TYR D 4 56  ? 19.352  -7.483  35.096  1.00 90.85 ? 296  TYR A CD2   1 
ATOM   762  C  CE1   . TYR D 4 56  ? 18.388  -6.702  32.616  1.00 91.16 ? 296  TYR A CE1   1 
ATOM   763  C  CE2   . TYR D 4 56  ? 17.991  -7.581  34.818  1.00 91.41 ? 296  TYR A CE2   1 
ATOM   764  C  CZ    . TYR D 4 56  ? 17.515  -7.190  33.578  1.00 91.48 ? 296  TYR A CZ    1 
ATOM   765  O  OH    . TYR D 4 56  ? 16.169  -7.296  33.301  1.00 91.08 ? 296  TYR A OH    1 
ATOM   766  N  N     . GLN D 4 57  ? 21.782  -4.560  36.736  1.00 88.19 ? 297  GLN A N     1 
ATOM   767  C  CA    . GLN D 4 57  ? 21.054  -3.804  37.746  1.00 86.77 ? 297  GLN A CA    1 
ATOM   768  C  C     . GLN D 4 57  ? 21.454  -2.337  37.659  1.00 85.80 ? 297  GLN A C     1 
ATOM   769  O  O     . GLN D 4 57  ? 20.605  -1.449  37.712  1.00 86.17 ? 297  GLN A O     1 
ATOM   770  C  CB    . GLN D 4 57  ? 21.366  -4.352  39.135  1.00 86.65 ? 297  GLN A CB    1 
ATOM   771  N  N     . GLU D 4 58  ? 22.753  -2.089  37.523  1.00 84.43 ? 298  GLU A N     1 
ATOM   772  C  CA    . GLU D 4 58  ? 23.263  -0.728  37.419  1.00 83.33 ? 298  GLU A CA    1 
ATOM   773  C  C     . GLU D 4 58  ? 22.571  -0.017  36.262  1.00 83.02 ? 298  GLU A C     1 
ATOM   774  O  O     . GLU D 4 58  ? 22.364  1.198   36.296  1.00 83.11 ? 298  GLU A O     1 
ATOM   775  C  CB    . GLU D 4 58  ? 24.770  -0.748  37.195  1.00 82.94 ? 298  GLU A CB    1 
ATOM   776  N  N     . ALA D 4 59  ? 22.213  -0.788  35.239  1.00 81.99 ? 299  ALA A N     1 
ATOM   777  C  CA    . ALA D 4 59  ? 21.541  -0.248  34.063  1.00 80.58 ? 299  ALA A CA    1 
ATOM   778  C  C     . ALA D 4 59  ? 20.117  0.146   34.423  1.00 79.67 ? 299  ALA A C     1 
ATOM   779  O  O     . ALA D 4 59  ? 19.742  1.315   34.320  1.00 79.54 ? 299  ALA A O     1 
ATOM   780  C  CB    . ALA D 4 59  ? 21.530  -1.281  32.946  1.00 80.33 ? 299  ALA A CB    1 
ATOM   781  N  N     . CYS D 4 60  ? 19.329  -0.837  34.849  1.00 78.28 ? 300  CYS A N     1 
ATOM   782  C  CA    . CYS D 4 60  ? 17.943  -0.599  35.229  1.00 77.15 ? 300  CYS A CA    1 
ATOM   783  C  C     . CYS D 4 60  ? 17.840  0.609   36.150  1.00 76.69 ? 300  CYS A C     1 
ATOM   784  O  O     . CYS D 4 60  ? 16.865  1.360   36.105  1.00 77.26 ? 300  CYS A O     1 
ATOM   785  C  CB    . CYS D 4 60  ? 17.377  -1.825  35.942  1.00 76.30 ? 300  CYS A CB    1 
ATOM   786  S  SG    . CYS D 4 60  ? 17.499  -3.355  35.000  1.00 76.01 ? 300  CYS A SG    1 
ATOM   787  N  N     . SER D 4 61  ? 18.863  0.790   36.977  1.00 75.91 ? 301  SER A N     1 
ATOM   788  C  CA    . SER D 4 61  ? 18.910  1.887   37.935  1.00 75.14 ? 301  SER A CA    1 
ATOM   789  C  C     . SER D 4 61  ? 18.986  3.258   37.280  1.00 74.12 ? 301  SER A C     1 
ATOM   790  O  O     . SER D 4 61  ? 18.813  4.280   37.944  1.00 73.72 ? 301  SER A O     1 
ATOM   791  C  CB    . SER D 4 61  ? 20.112  1.706   38.864  1.00 75.56 ? 301  SER A CB    1 
ATOM   792  O  OG    . SER D 4 61  ? 20.070  0.443   39.505  1.00 76.23 ? 301  SER A OG    1 
ATOM   793  N  N     . ILE D 4 62  ? 19.241  3.281   35.977  1.00 73.22 ? 302  ILE A N     1 
ATOM   794  C  CA    . ILE D 4 62  ? 19.355  4.541   35.254  1.00 72.50 ? 302  ILE A CA    1 
ATOM   795  C  C     . ILE D 4 62  ? 18.048  4.976   34.596  1.00 71.54 ? 302  ILE A C     1 
ATOM   796  O  O     . ILE D 4 62  ? 17.426  4.208   33.863  1.00 71.67 ? 302  ILE A O     1 
ATOM   797  C  CB    . ILE D 4 62  ? 20.426  4.448   34.161  1.00 72.72 ? 302  ILE A CB    1 
ATOM   798  C  CG1   . ILE D 4 62  ? 21.720  3.889   34.751  1.00 72.86 ? 302  ILE A CG1   1 
ATOM   799  C  CG2   . ILE D 4 62  ? 20.662  5.825   33.554  1.00 72.99 ? 302  ILE A CG2   1 
ATOM   800  C  CD1   . ILE D 4 62  ? 22.811  3.665   33.726  1.00 72.37 ? 302  ILE A CD1   1 
ATOM   801  N  N     . PRO D 4 63  ? 17.616  6.221   34.851  1.00 70.45 ? 303  PRO A N     1 
ATOM   802  C  CA    . PRO D 4 63  ? 16.376  6.737   34.264  1.00 69.20 ? 303  PRO A CA    1 
ATOM   803  C  C     . PRO D 4 63  ? 16.449  6.672   32.742  1.00 68.00 ? 303  PRO A C     1 
ATOM   804  O  O     . PRO D 4 63  ? 17.417  7.138   32.138  1.00 67.41 ? 303  PRO A O     1 
ATOM   805  C  CB    . PRO D 4 63  ? 16.327  8.174   34.774  1.00 69.29 ? 303  PRO A CB    1 
ATOM   806  C  CG    . PRO D 4 63  ? 17.032  8.090   36.084  1.00 69.98 ? 303  PRO A CG    1 
ATOM   807  C  CD    . PRO D 4 63  ? 18.215  7.216   35.757  1.00 70.25 ? 303  PRO A CD    1 
ATOM   808  N  N     . GLY D 4 64  ? 15.427  6.089   32.128  1.00 66.88 ? 304  GLY A N     1 
ATOM   809  C  CA    . GLY D 4 64  ? 15.407  5.976   30.682  1.00 66.17 ? 304  GLY A CA    1 
ATOM   810  C  C     . GLY D 4 64  ? 15.827  4.598   30.213  1.00 66.03 ? 304  GLY A C     1 
ATOM   811  O  O     . GLY D 4 64  ? 15.786  4.300   29.019  1.00 66.09 ? 304  GLY A O     1 
ATOM   812  N  N     . ILE D 4 65  ? 16.231  3.752   31.155  1.00 65.62 ? 305  ILE A N     1 
ATOM   813  C  CA    . ILE D 4 65  ? 16.656  2.399   30.828  1.00 65.65 ? 305  ILE A CA    1 
ATOM   814  C  C     . ILE D 4 65  ? 15.805  1.372   31.562  1.00 65.46 ? 305  ILE A C     1 
ATOM   815  O  O     . ILE D 4 65  ? 15.651  1.435   32.780  1.00 66.40 ? 305  ILE A O     1 
ATOM   816  C  CB    . ILE D 4 65  ? 18.132  2.175   31.203  1.00 65.69 ? 305  ILE A CB    1 
ATOM   817  C  CG1   . ILE D 4 65  ? 18.996  3.261   30.564  1.00 66.45 ? 305  ILE A CG1   1 
ATOM   818  C  CG2   . ILE D 4 65  ? 18.587  0.802   30.727  1.00 65.42 ? 305  ILE A CG2   1 
ATOM   819  C  CD1   . ILE D 4 65  ? 20.462  3.162   30.916  1.00 67.88 ? 305  ILE A CD1   1 
ATOM   820  N  N     . GLY D 4 66  ? 15.249  0.429   30.812  1.00 65.10 ? 306  GLY A N     1 
ATOM   821  C  CA    . GLY D 4 66  ? 14.427  -0.600  31.415  1.00 65.35 ? 306  GLY A CA    1 
ATOM   822  C  C     . GLY D 4 66  ? 15.094  -1.952  31.286  1.00 65.93 ? 306  GLY A C     1 
ATOM   823  O  O     . GLY D 4 66  ? 16.253  -2.041  30.882  1.00 65.85 ? 306  GLY A O     1 
ATOM   824  N  N     . LYS D 4 67  ? 14.363  -3.007  31.625  1.00 66.08 ? 307  LYS A N     1 
ATOM   825  C  CA    . LYS D 4 67  ? 14.891  -4.363  31.545  1.00 66.62 ? 307  LYS A CA    1 
ATOM   826  C  C     . LYS D 4 67  ? 15.295  -4.701  30.115  1.00 67.16 ? 307  LYS A C     1 
ATOM   827  O  O     . LYS D 4 67  ? 16.398  -5.189  29.869  1.00 67.16 ? 307  LYS A O     1 
ATOM   828  C  CB    . LYS D 4 67  ? 13.846  -5.359  32.045  1.00 66.48 ? 307  LYS A CB    1 
ATOM   829  N  N     . ARG D 4 68  ? 14.392  -4.436  29.175  1.00 67.14 ? 308  ARG A N     1 
ATOM   830  C  CA    . ARG D 4 68  ? 14.643  -4.714  27.769  1.00 66.93 ? 308  ARG A CA    1 
ATOM   831  C  C     . ARG D 4 68  ? 15.908  -4.020  27.281  1.00 66.07 ? 308  ARG A C     1 
ATOM   832  O  O     . ARG D 4 68  ? 16.762  -4.642  26.651  1.00 64.81 ? 308  ARG A O     1 
ATOM   833  C  CB    . ARG D 4 68  ? 13.452  -4.261  26.926  1.00 69.21 ? 308  ARG A CB    1 
ATOM   834  C  CG    . ARG D 4 68  ? 12.145  -4.951  27.282  1.00 71.57 ? 308  ARG A CG    1 
ATOM   835  C  CD    . ARG D 4 68  ? 10.999  -4.435  26.425  1.00 73.95 ? 308  ARG A CD    1 
ATOM   836  N  NE    . ARG D 4 68  ? 11.223  -4.663  24.998  1.00 76.77 ? 308  ARG A NE    1 
ATOM   837  C  CZ    . ARG D 4 68  ? 11.363  -5.864  24.444  1.00 77.90 ? 308  ARG A CZ    1 
ATOM   838  N  NH1   . ARG D 4 68  ? 11.305  -6.957  25.193  1.00 79.01 ? 308  ARG A NH1   1 
ATOM   839  N  NH2   . ARG D 4 68  ? 11.553  -5.974  23.138  1.00 78.77 ? 308  ARG A NH2   1 
ATOM   840  N  N     . MET D 4 69  ? 16.024  -2.730  27.580  1.00 65.32 ? 309  MET A N     1 
ATOM   841  C  CA    . MET D 4 69  ? 17.184  -1.955  27.162  1.00 65.54 ? 309  MET A CA    1 
ATOM   842  C  C     . MET D 4 69  ? 18.444  -2.496  27.829  1.00 67.24 ? 309  MET A C     1 
ATOM   843  O  O     . MET D 4 69  ? 19.453  -2.735  27.167  1.00 67.36 ? 309  MET A O     1 
ATOM   844  C  CB    . MET D 4 69  ? 16.997  -0.482  27.533  1.00 64.33 ? 309  MET A CB    1 
ATOM   845  C  CG    . MET D 4 69  ? 17.888  0.481   26.763  1.00 62.81 ? 309  MET A CG    1 
ATOM   846  S  SD    . MET D 4 69  ? 17.415  0.653   25.023  1.00 62.13 ? 309  MET A SD    1 
ATOM   847  C  CE    . MET D 4 69  ? 18.442  -0.550  24.268  1.00 62.26 ? 309  MET A CE    1 
ATOM   848  N  N     . ALA D 4 70  ? 18.378  -2.690  29.143  1.00 68.67 ? 310  ALA A N     1 
ATOM   849  C  CA    . ALA D 4 70  ? 19.510  -3.202  29.906  1.00 70.09 ? 310  ALA A CA    1 
ATOM   850  C  C     . ALA D 4 70  ? 19.996  -4.537  29.353  1.00 71.53 ? 310  ALA A C     1 
ATOM   851  O  O     . ALA D 4 70  ? 21.193  -4.728  29.142  1.00 71.69 ? 310  ALA A O     1 
ATOM   852  C  CB    . ALA D 4 70  ? 19.123  -3.357  31.371  1.00 70.76 ? 310  ALA A CB    1 
ATOM   853  N  N     . GLU D 4 71  ? 19.060  -5.453  29.120  1.00 72.65 ? 311  GLU A N     1 
ATOM   854  C  CA    . GLU D 4 71  ? 19.382  -6.774  28.592  1.00 74.70 ? 311  GLU A CA    1 
ATOM   855  C  C     . GLU D 4 71  ? 20.360  -6.717  27.426  1.00 75.53 ? 311  GLU A C     1 
ATOM   856  O  O     . GLU D 4 71  ? 21.383  -7.403  27.430  1.00 76.15 ? 311  GLU A O     1 
ATOM   857  C  CB    . GLU D 4 71  ? 18.108  -7.491  28.138  1.00 75.81 ? 311  GLU A CB    1 
ATOM   858  C  CG    . GLU D 4 71  ? 17.185  -7.909  29.264  1.00 78.15 ? 311  GLU A CG    1 
ATOM   859  C  CD    . GLU D 4 71  ? 15.880  -8.490  28.754  1.00 79.90 ? 311  GLU A CD    1 
ATOM   860  O  OE1   . GLU D 4 71  ? 15.927  -9.481  27.995  1.00 80.62 ? 311  GLU A OE1   1 
ATOM   861  O  OE2   . GLU D 4 71  ? 14.808  -7.956  29.112  1.00 81.18 ? 311  GLU A OE2   1 
ATOM   862  N  N     . LYS D 4 72  ? 20.059  -5.888  26.442  1.00 76.10 ? 312  LYS A N     1 
ATOM   863  C  CA    . LYS D 4 72  ? 20.905  -5.782  25.259  1.00 77.00 ? 312  LYS A CA    1 
ATOM   864  C  C     . LYS D 4 72  ? 22.169  -4.983  25.556  1.00 77.57 ? 312  LYS A C     1 
ATOM   865  O  O     . LYS D 4 72  ? 23.098  -4.989  24.715  1.00 78.08 ? 312  LYS A O     1 
ATOM   866  C  CB    . LYS D 4 72  ? 20.133  -5.150  24.110  1.00 76.68 ? 312  LYS A CB    1 
ATOM   867  N  N     . ILE D 4 73  ? 22.230  -4.303  26.671  1.00 77.90 ? 313  ILE A N     1 
ATOM   868  C  CA    . ILE D 4 73  ? 23.427  -3.552  27.030  1.00 78.46 ? 313  ILE A CA    1 
ATOM   869  C  C     . ILE D 4 73  ? 24.423  -4.597  27.522  1.00 79.31 ? 313  ILE A C     1 
ATOM   870  O  O     . ILE D 4 73  ? 25.637  -4.418  27.433  1.00 79.37 ? 313  ILE A O     1 
ATOM   871  C  CB    . ILE D 4 73  ? 23.164  -2.543  28.163  1.00 78.12 ? 313  ILE A CB    1 
ATOM   872  C  CG1   . ILE D 4 73  ? 22.129  -1.511  27.717  1.00 78.21 ? 313  ILE A CG1   1 
ATOM   873  C  CG2   . ILE D 4 73  ? 24.460  -1.840  28.536  1.00 78.34 ? 313  ILE A CG2   1 
ATOM   874  C  CD1   . ILE D 4 73  ? 21.803  -0.470  28.770  1.00 78.01 ? 313  ILE A CD1   1 
ATOM   875  N  N     . ILE D 4 74  ? 23.881  -5.695  28.040  1.00 80.30 ? 314  ILE A N     1 
ATOM   876  C  CA    . ILE D 4 74  ? 24.682  -6.804  28.535  1.00 81.62 ? 314  ILE A CA    1 
ATOM   877  C  C     . ILE D 4 74  ? 25.286  -7.557  27.356  1.00 82.53 ? 314  ILE A C     1 
ATOM   878  O  O     . ILE D 4 74  ? 26.487  -7.814  27.329  1.00 83.12 ? 314  ILE A O     1 
ATOM   879  C  CB    . ILE D 4 74  ? 23.825  -7.785  29.377  1.00 81.82 ? 314  ILE A CB    1 
ATOM   880  C  CG1   . ILE D 4 74  ? 23.707  -7.279  30.815  1.00 81.87 ? 314  ILE A CG1   1 
ATOM   881  C  CG2   . ILE D 4 74  ? 24.441  -9.172  29.363  1.00 81.46 ? 314  ILE A CG2   1 
ATOM   882  C  CD1   . ILE D 4 74  ? 23.045  -5.930  30.950  1.00 82.51 ? 314  ILE A CD1   1 
ATOM   883  N  N     . GLU D 4 75  ? 24.447  -7.908  26.384  1.00 83.08 ? 315  GLU A N     1 
ATOM   884  C  CA    . GLU D 4 75  ? 24.915  -8.628  25.206  1.00 83.76 ? 315  GLU A CA    1 
ATOM   885  C  C     . GLU D 4 75  ? 26.054  -7.873  24.534  1.00 84.26 ? 315  GLU A C     1 
ATOM   886  O  O     . GLU D 4 75  ? 26.915  -8.475  23.893  1.00 84.39 ? 315  GLU A O     1 
ATOM   887  C  CB    . GLU D 4 75  ? 23.771  -8.833  24.209  1.00 84.01 ? 315  GLU A CB    1 
ATOM   888  C  CG    . GLU D 4 75  ? 24.215  -9.437  22.880  1.00 84.48 ? 315  GLU A CG    1 
ATOM   889  C  CD    . GLU D 4 75  ? 23.051  -9.793  21.977  1.00 85.03 ? 315  GLU A CD    1 
ATOM   890  O  OE1   . GLU D 4 75  ? 22.157  -8.941  21.796  1.00 85.96 ? 315  GLU A OE1   1 
ATOM   891  O  OE2   . GLU D 4 75  ? 23.033  -10.922 21.440  1.00 85.01 ? 315  GLU A OE2   1 
ATOM   892  N  N     . ILE D 4 76  ? 26.055  -6.552  24.681  1.00 84.69 ? 316  ILE A N     1 
ATOM   893  C  CA    . ILE D 4 76  ? 27.102  -5.727  24.093  1.00 84.94 ? 316  ILE A CA    1 
ATOM   894  C  C     . ILE D 4 76  ? 28.302  -5.699  25.034  1.00 85.37 ? 316  ILE A C     1 
ATOM   895  O  O     . ILE D 4 76  ? 29.443  -5.538  24.599  1.00 85.78 ? 316  ILE A O     1 
ATOM   896  C  CB    . ILE D 4 76  ? 26.614  -4.278  23.850  1.00 84.77 ? 316  ILE A CB    1 
ATOM   897  C  CG1   . ILE D 4 76  ? 25.417  -4.282  22.895  1.00 84.59 ? 316  ILE A CG1   1 
ATOM   898  C  CG2   . ILE D 4 76  ? 27.742  -3.440  23.261  1.00 85.04 ? 316  ILE A CG2   1 
ATOM   899  C  CD1   . ILE D 4 76  ? 24.878  -2.902  22.576  1.00 84.29 ? 316  ILE A CD1   1 
ATOM   900  N  N     . LEU D 4 77  ? 28.035  -5.864  26.326  1.00 85.49 ? 317  LEU A N     1 
ATOM   901  C  CA    . LEU D 4 77  ? 29.090  -5.864  27.332  1.00 85.63 ? 317  LEU A CA    1 
ATOM   902  C  C     . LEU D 4 77  ? 29.777  -7.226  27.392  1.00 86.09 ? 317  LEU A C     1 
ATOM   903  O  O     . LEU D 4 77  ? 30.984  -7.310  27.621  1.00 86.00 ? 317  LEU A O     1 
ATOM   904  C  CB    . LEU D 4 77  ? 28.509  -5.508  28.695  1.00 85.01 ? 317  LEU A CB    1 
ATOM   905  N  N     . GLU D 4 78  ? 29.003  -8.288  27.181  1.00 86.45 ? 318  GLU A N     1 
ATOM   906  C  CA    . GLU D 4 78  ? 29.527  -9.651  27.214  1.00 86.61 ? 318  GLU A CA    1 
ATOM   907  C  C     . GLU D 4 78  ? 29.941  -10.131 25.829  1.00 86.74 ? 318  GLU A C     1 
ATOM   908  O  O     . GLU D 4 78  ? 31.093  -10.509 25.610  1.00 86.93 ? 318  GLU A O     1 
ATOM   909  C  CB    . GLU D 4 78  ? 28.476  -10.613 27.770  1.00 86.78 ? 318  GLU A CB    1 
ATOM   910  C  CG    . GLU D 4 78  ? 27.929  -10.236 29.131  1.00 87.80 ? 318  GLU A CG    1 
ATOM   911  C  CD    . GLU D 4 78  ? 26.959  -11.270 29.668  1.00 88.63 ? 318  GLU A CD    1 
ATOM   912  O  OE1   . GLU D 4 78  ? 25.984  -11.596 28.959  1.00 89.43 ? 318  GLU A OE1   1 
ATOM   913  O  OE2   . GLU D 4 78  ? 27.170  -11.757 30.799  1.00 89.45 ? 318  GLU A OE2   1 
ATOM   914  N  N     . SER D 4 79  ? 28.989  -10.121 24.900  1.00 86.72 ? 319  SER A N     1 
ATOM   915  C  CA    . SER D 4 79  ? 29.238  -10.564 23.533  1.00 86.25 ? 319  SER A CA    1 
ATOM   916  C  C     . SER D 4 79  ? 29.925  -9.494  22.689  1.00 85.83 ? 319  SER A C     1 
ATOM   917  O  O     . SER D 4 79  ? 30.339  -9.760  21.559  1.00 86.47 ? 319  SER A O     1 
ATOM   918  C  CB    . SER D 4 79  ? 27.925  -10.987 22.876  1.00 86.40 ? 319  SER A CB    1 
ATOM   919  N  N     . GLY D 4 80  ? 30.044  -8.287  23.236  1.00 84.66 ? 320  GLY A N     1 
ATOM   920  C  CA    . GLY D 4 80  ? 30.683  -7.205  22.507  1.00 83.10 ? 320  GLY A CA    1 
ATOM   921  C  C     . GLY D 4 80  ? 29.983  -6.880  21.199  1.00 81.78 ? 320  GLY A C     1 
ATOM   922  O  O     . GLY D 4 80  ? 30.468  -6.071  20.407  1.00 81.44 ? 320  GLY A O     1 
ATOM   923  N  N     A HIS D 4 81  ? 28.823  -7.499  20.997  0.50 80.54 ? 321  HIS A N     1 
ATOM   924  N  N     B HIS D 4 81  ? 28.843  -7.643  21.024  0.50 82.83 ? 321  HIS A N     1 
ATOM   925  C  CA    A HIS D 4 81  ? 28.036  -7.301  19.792  0.50 78.86 ? 321  HIS A CA    1 
ATOM   926  C  CA    B HIS D 4 81  ? 28.051  -7.376  19.789  0.50 82.54 ? 321  HIS A CA    1 
ATOM   927  C  C     A HIS D 4 81  ? 26.550  -7.329  20.108  0.50 77.88 ? 321  HIS A C     1 
ATOM   928  C  C     B HIS D 4 81  ? 26.576  -7.203  20.138  0.50 82.62 ? 321  HIS A C     1 
ATOM   929  O  O     A HIS D 4 81  ? 26.138  -7.770  21.184  0.50 77.81 ? 321  HIS A O     1 
ATOM   930  O  O     B HIS D 4 81  ? 26.125  -7.634  21.200  0.50 82.43 ? 321  HIS A O     1 
ATOM   931  C  CB    A HIS D 4 81  ? 28.376  -8.392  18.782  0.50 78.49 ? 321  HIS A CB    1 
ATOM   932  C  CB    B HIS D 4 81  ? 28.216  -8.534  18.797  0.50 82.25 ? 321  HIS A CB    1 
ATOM   933  C  CG    A HIS D 4 81  ? 29.811  -8.379  18.355  0.50 77.94 ? 321  HIS A CG    1 
ATOM   934  C  CG    B HIS D 4 81  ? 27.660  -8.252  17.435  0.50 81.89 ? 321  HIS A CG    1 
ATOM   935  N  ND1   A HIS D 4 81  ? 30.329  -7.411  17.520  0.50 77.67 ? 321  HIS A ND1   1 
ATOM   936  N  ND1   B HIS D 4 81  ? 27.672  -9.184  16.419  0.50 81.51 ? 321  HIS A ND1   1 
ATOM   937  C  CD2   A HIS D 4 81  ? 30.846  -9.197  18.671  0.50 77.58 ? 321  HIS A CD2   1 
ATOM   938  C  CD2   B HIS D 4 81  ? 27.092  -7.137  16.915  0.50 81.71 ? 321  HIS A CD2   1 
ATOM   939  C  CE1   A HIS D 4 81  ? 31.619  -7.634  17.339  0.50 77.40 ? 321  HIS A CE1   1 
ATOM   940  C  CE1   B HIS D 4 81  ? 27.136  -8.656  15.333  0.50 81.62 ? 321  HIS A CE1   1 
ATOM   941  N  NE2   A HIS D 4 81  ? 31.958  -8.711  18.026  0.50 77.28 ? 321  HIS A NE2   1 
ATOM   942  N  NE2   B HIS D 4 81  ? 26.776  -7.415  15.607  0.50 81.76 ? 321  HIS A NE2   1 
ATOM   943  N  N     . LEU D 4 82  ? 25.747  -6.850  19.166  1.00 76.46 ? 322  LEU A N     1 
ATOM   944  C  CA    . LEU D 4 82  ? 24.303  -6.835  19.360  1.00 75.18 ? 322  LEU A CA    1 
ATOM   945  C  C     . LEU D 4 82  ? 23.629  -7.628  18.250  1.00 74.29 ? 322  LEU A C     1 
ATOM   946  O  O     . LEU D 4 82  ? 23.512  -7.159  17.118  1.00 73.85 ? 322  LEU A O     1 
ATOM   947  C  CB    . LEU D 4 82  ? 23.777  -5.397  19.362  1.00 75.21 ? 322  LEU A CB    1 
ATOM   948  C  CG    . LEU D 4 82  ? 22.275  -5.220  19.598  1.00 74.77 ? 322  LEU A CG    1 
ATOM   949  C  CD1   . LEU D 4 82  ? 21.890  -5.809  20.949  1.00 74.33 ? 322  LEU A CD1   1 
ATOM   950  C  CD2   . LEU D 4 82  ? 21.922  -3.741  19.540  1.00 74.69 ? 322  LEU A CD2   1 
ATOM   951  N  N     . ARG D 4 83  ? 23.189  -8.834  18.588  1.00 73.65 ? 323  ARG A N     1 
ATOM   952  C  CA    . ARG D 4 83  ? 22.535  -9.722  17.636  1.00 73.03 ? 323  ARG A CA    1 
ATOM   953  C  C     . ARG D 4 83  ? 21.513  -9.007  16.760  1.00 72.19 ? 323  ARG A C     1 
ATOM   954  O  O     . ARG D 4 83  ? 21.463  -9.222  15.549  1.00 71.95 ? 323  ARG A O     1 
ATOM   955  C  CB    . ARG D 4 83  ? 21.867  -10.873 18.382  1.00 72.90 ? 323  ARG A CB    1 
ATOM   956  N  N     . LYS D 4 84  ? 20.704  -8.153  17.377  1.00 71.63 ? 324  LYS A N     1 
ATOM   957  C  CA    . LYS D 4 84  ? 19.664  -7.419  16.661  1.00 70.98 ? 324  LYS A CA    1 
ATOM   958  C  C     . LYS D 4 84  ? 20.186  -6.644  15.452  1.00 70.13 ? 324  LYS A C     1 
ATOM   959  O  O     . LYS D 4 84  ? 19.577  -6.664  14.381  1.00 69.84 ? 324  LYS A O     1 
ATOM   960  C  CB    . LYS D 4 84  ? 18.953  -6.463  17.622  1.00 70.80 ? 324  LYS A CB    1 
ATOM   961  C  CG    . LYS D 4 84  ? 17.646  -5.900  17.089  1.00 71.28 ? 324  LYS A CG    1 
ATOM   962  C  CD    . LYS D 4 84  ? 16.721  -7.017  16.636  1.00 71.80 ? 324  LYS A CD    1 
ATOM   963  C  CE    . LYS D 4 84  ? 15.288  -6.535  16.496  1.00 72.09 ? 324  LYS A CE    1 
ATOM   964  N  NZ    . LYS D 4 84  ? 14.725  -6.144  17.818  1.00 71.90 ? 324  LYS A NZ    1 
ATOM   965  N  N     . LEU D 4 85  ? 21.313  -5.963  15.625  1.00 68.94 ? 325  LEU A N     1 
ATOM   966  C  CA    . LEU D 4 85  ? 21.905  -5.182  14.546  1.00 68.44 ? 325  LEU A CA    1 
ATOM   967  C  C     . LEU D 4 85  ? 22.144  -6.014  13.288  1.00 68.25 ? 325  LEU A C     1 
ATOM   968  O  O     . LEU D 4 85  ? 22.203  -5.477  12.181  1.00 69.14 ? 325  LEU A O     1 
ATOM   969  C  CB    . LEU D 4 85  ? 23.226  -4.564  15.009  1.00 67.34 ? 325  LEU A CB    1 
ATOM   970  C  CG    . LEU D 4 85  ? 23.152  -3.624  16.212  1.00 67.01 ? 325  LEU A CG    1 
ATOM   971  C  CD1   . LEU D 4 85  ? 24.530  -3.053  16.487  1.00 66.60 ? 325  LEU A CD1   1 
ATOM   972  C  CD2   . LEU D 4 85  ? 22.160  -2.504  15.940  1.00 66.84 ? 325  LEU A CD2   1 
ATOM   973  N  N     . ASP D 4 86  ? 22.278  -7.325  13.461  1.00 67.11 ? 326  ASP A N     1 
ATOM   974  C  CA    . ASP D 4 86  ? 22.518  -8.221  12.336  1.00 66.45 ? 326  ASP A CA    1 
ATOM   975  C  C     . ASP D 4 86  ? 21.245  -8.550  11.568  1.00 64.99 ? 326  ASP A C     1 
ATOM   976  O  O     . ASP D 4 86  ? 21.291  -9.220  10.536  1.00 65.41 ? 326  ASP A O     1 
ATOM   977  C  CB    . ASP D 4 86  ? 23.155  -9.525  12.824  1.00 68.06 ? 326  ASP A CB    1 
ATOM   978  C  CG    . ASP D 4 86  ? 24.486  -9.302  13.511  1.00 69.44 ? 326  ASP A CG    1 
ATOM   979  O  OD1   . ASP D 4 86  ? 25.377  -8.680  12.892  1.00 69.43 ? 326  ASP A OD1   1 
ATOM   980  O  OD2   . ASP D 4 86  ? 24.640  -9.753  14.668  1.00 70.81 ? 326  ASP A OD2   1 
ATOM   981  N  N     . HIS D 4 87  ? 20.106  -8.086  12.068  1.00 62.81 ? 327  HIS A N     1 
ATOM   982  C  CA    . HIS D 4 87  ? 18.846  -8.366  11.401  1.00 60.51 ? 327  HIS A CA    1 
ATOM   983  C  C     . HIS D 4 87  ? 18.057  -7.125  11.020  1.00 58.00 ? 327  HIS A C     1 
ATOM   984  O  O     . HIS D 4 87  ? 16.835  -7.173  10.898  1.00 57.93 ? 327  HIS A O     1 
ATOM   985  C  CB    . HIS D 4 87  ? 17.996  -9.298  12.267  1.00 61.79 ? 327  HIS A CB    1 
ATOM   986  C  CG    . HIS D 4 87  ? 18.577  -10.670 12.407  1.00 63.87 ? 327  HIS A CG    1 
ATOM   987  N  ND1   . HIS D 4 87  ? 18.781  -11.502 11.327  1.00 64.75 ? 327  HIS A ND1   1 
ATOM   988  C  CD2   . HIS D 4 87  ? 19.045  -11.335 13.489  1.00 64.33 ? 327  HIS A CD2   1 
ATOM   989  C  CE1   . HIS D 4 87  ? 19.354  -12.620 11.738  1.00 64.88 ? 327  HIS A CE1   1 
ATOM   990  N  NE2   . HIS D 4 87  ? 19.526  -12.543 13.045  1.00 64.84 ? 327  HIS A NE2   1 
ATOM   991  N  N     . ILE D 4 88  ? 18.761  -6.014  10.830  1.00 55.11 ? 328  ILE A N     1 
ATOM   992  C  CA    . ILE D 4 88  ? 18.115  -4.770  10.425  1.00 52.87 ? 328  ILE A CA    1 
ATOM   993  C  C     . ILE D 4 88  ? 17.836  -4.863  8.930   1.00 51.05 ? 328  ILE A C     1 
ATOM   994  O  O     . ILE D 4 88  ? 18.724  -5.202  8.153   1.00 51.55 ? 328  ILE A O     1 
ATOM   995  C  CB    . ILE D 4 88  ? 19.018  -3.545  10.682  1.00 52.63 ? 328  ILE A CB    1 
ATOM   996  C  CG1   . ILE D 4 88  ? 19.230  -3.359  12.185  1.00 52.52 ? 328  ILE A CG1   1 
ATOM   997  C  CG2   . ILE D 4 88  ? 18.390  -2.297  10.069  1.00 52.80 ? 328  ILE A CG2   1 
ATOM   998  C  CD1   . ILE D 4 88  ? 20.042  -2.125  12.540  1.00 51.75 ? 328  ILE A CD1   1 
ATOM   999  N  N     . SER D 4 89  ? 16.606  -4.564  8.529   1.00 49.70 ? 329  SER A N     1 
ATOM   1000 C  CA    . SER D 4 89  ? 16.241  -4.632  7.120   1.00 47.52 ? 329  SER A CA    1 
ATOM   1001 C  C     . SER D 4 89  ? 17.246  -3.914  6.227   1.00 46.66 ? 329  SER A C     1 
ATOM   1002 O  O     . SER D 4 89  ? 17.764  -2.852  6.577   1.00 44.95 ? 329  SER A O     1 
ATOM   1003 C  CB    . SER D 4 89  ? 14.855  -4.035  6.895   1.00 48.76 ? 329  SER A CB    1 
ATOM   1004 O  OG    . SER D 4 89  ? 14.520  -4.086  5.517   1.00 52.02 ? 329  SER A OG    1 
ATOM   1005 N  N     . GLU D 4 90  ? 17.509  -4.508  5.068   1.00 45.05 ? 330  GLU A N     1 
ATOM   1006 C  CA    . GLU D 4 90  ? 18.446  -3.958  4.098   1.00 43.47 ? 330  GLU A CA    1 
ATOM   1007 C  C     . GLU D 4 90  ? 17.898  -2.645  3.541   1.00 39.51 ? 330  GLU A C     1 
ATOM   1008 O  O     . GLU D 4 90  ? 18.627  -1.859  2.943   1.00 38.71 ? 330  GLU A O     1 
ATOM   1009 C  CB    . GLU D 4 90  ? 18.637  -4.952  2.948   1.00 47.10 ? 330  GLU A CB    1 
ATOM   1010 C  CG    . GLU D 4 90  ? 17.363  -5.161  2.128   1.00 52.09 ? 330  GLU A CG    1 
ATOM   1011 C  CD    . GLU D 4 90  ? 17.539  -6.134  0.975   1.00 56.57 ? 330  GLU A CD    1 
ATOM   1012 O  OE1   . GLU D 4 90  ? 18.496  -5.968  0.188   1.00 57.84 ? 330  GLU A OE1   1 
ATOM   1013 O  OE2   . GLU D 4 90  ? 16.708  -7.059  0.850   1.00 58.45 ? 330  GLU A OE2   1 
ATOM   1014 N  N     . SER D 4 91  ? 16.604  -2.421  3.736   1.00 36.44 ? 331  SER A N     1 
ATOM   1015 C  CA    . SER D 4 91  ? 15.962  -1.214  3.233   1.00 34.00 ? 331  SER A CA    1 
ATOM   1016 C  C     . SER D 4 91  ? 16.350  0.040   3.998   1.00 30.89 ? 331  SER A C     1 
ATOM   1017 O  O     . SER D 4 91  ? 16.305  1.129   3.452   1.00 31.58 ? 331  SER A O     1 
ATOM   1018 C  CB    . SER D 4 91  ? 14.439  -1.366  3.272   1.00 32.86 ? 331  SER A CB    1 
ATOM   1019 O  OG    . SER D 4 91  ? 13.969  -1.508  4.600   1.00 31.83 ? 331  SER A OG    1 
ATOM   1020 N  N     . VAL D 4 92  ? 16.743  -0.123  5.255   1.00 30.92 ? 332  VAL A N     1 
ATOM   1021 C  CA    . VAL D 4 92  ? 17.083  1.009   6.114   1.00 30.02 ? 332  VAL A CA    1 
ATOM   1022 C  C     . VAL D 4 92  ? 18.029  2.066   5.528   1.00 31.00 ? 332  VAL A C     1 
ATOM   1023 O  O     . VAL D 4 92  ? 17.695  3.249   5.511   1.00 30.77 ? 332  VAL A O     1 
ATOM   1024 C  CB    . VAL D 4 92  ? 17.601  0.506   7.477   1.00 28.65 ? 332  VAL A CB    1 
ATOM   1025 C  CG1   . VAL D 4 92  ? 18.233  1.651   8.282   1.00 28.24 ? 332  VAL A CG1   1 
ATOM   1026 C  CG2   . VAL D 4 92  ? 16.441  -0.086  8.252   1.00 28.50 ? 332  VAL A CG2   1 
ATOM   1027 N  N     . PRO D 4 93  ? 19.211  1.660   5.036   1.00 30.70 ? 333  PRO A N     1 
ATOM   1028 C  CA    . PRO D 4 93  ? 20.119  2.665   4.471   1.00 30.23 ? 333  PRO A CA    1 
ATOM   1029 C  C     . PRO D 4 93  ? 19.415  3.489   3.397   1.00 28.72 ? 333  PRO A C     1 
ATOM   1030 O  O     . PRO D 4 93  ? 19.606  4.698   3.298   1.00 29.29 ? 333  PRO A O     1 
ATOM   1031 C  CB    . PRO D 4 93  ? 21.249  1.822   3.882   1.00 30.91 ? 333  PRO A CB    1 
ATOM   1032 C  CG    . PRO D 4 93  ? 21.274  0.620   4.777   1.00 31.16 ? 333  PRO A CG    1 
ATOM   1033 C  CD    . PRO D 4 93  ? 19.803  0.313   4.960   1.00 31.12 ? 333  PRO A CD    1 
ATOM   1034 N  N     . VAL D 4 94  ? 18.595  2.820   2.594   1.00 26.48 ? 334  VAL A N     1 
ATOM   1035 C  CA    . VAL D 4 94  ? 17.875  3.490   1.521   1.00 23.84 ? 334  VAL A CA    1 
ATOM   1036 C  C     . VAL D 4 94  ? 16.768  4.394   2.059   1.00 24.61 ? 334  VAL A C     1 
ATOM   1037 O  O     . VAL D 4 94  ? 16.557  5.488   1.540   1.00 22.90 ? 334  VAL A O     1 
ATOM   1038 C  CB    . VAL D 4 94  ? 17.280  2.465   0.540   1.00 24.32 ? 334  VAL A CB    1 
ATOM   1039 C  CG1   . VAL D 4 94  ? 16.397  3.160   -0.487  1.00 23.79 ? 334  VAL A CG1   1 
ATOM   1040 C  CG2   . VAL D 4 94  ? 18.409  1.724   -0.160  1.00 26.04 ? 334  VAL A CG2   1 
ATOM   1041 N  N     . LEU D 4 95  ? 16.066  3.943   3.095   1.00 23.41 ? 335  LEU A N     1 
ATOM   1042 C  CA    . LEU D 4 95  ? 14.995  4.751   3.678   1.00 24.18 ? 335  LEU A CA    1 
ATOM   1043 C  C     . LEU D 4 95  ? 15.579  6.026   4.298   1.00 22.91 ? 335  LEU A C     1 
ATOM   1044 O  O     . LEU D 4 95  ? 14.963  7.092   4.252   1.00 21.42 ? 335  LEU A O     1 
ATOM   1045 C  CB    . LEU D 4 95  ? 14.228  3.947   4.736   1.00 22.47 ? 335  LEU A CB    1 
ATOM   1046 C  CG    . LEU D 4 95  ? 13.439  2.733   4.207   1.00 26.00 ? 335  LEU A CG    1 
ATOM   1047 C  CD1   . LEU D 4 95  ? 12.771  1.986   5.356   1.00 25.98 ? 335  LEU A CD1   1 
ATOM   1048 C  CD2   . LEU D 4 95  ? 12.392  3.195   3.207   1.00 25.70 ? 335  LEU A CD2   1 
ATOM   1049 N  N     . GLU D 4 96  ? 16.768  5.898   4.875   1.00 21.22 ? 336  GLU A N     1 
ATOM   1050 C  CA    . GLU D 4 96  ? 17.460  7.022   5.491   1.00 24.17 ? 336  GLU A CA    1 
ATOM   1051 C  C     . GLU D 4 96  ? 17.930  7.995   4.407   1.00 23.88 ? 336  GLU A C     1 
ATOM   1052 O  O     . GLU D 4 96  ? 17.864  9.214   4.580   1.00 22.27 ? 336  GLU A O     1 
ATOM   1053 C  CB    . GLU D 4 96  ? 18.654  6.510   6.298   1.00 26.92 ? 336  GLU A CB    1 
ATOM   1054 C  CG    . GLU D 4 96  ? 19.604  7.596   6.766   1.00 33.77 ? 336  GLU A CG    1 
ATOM   1055 C  CD    . GLU D 4 96  ? 20.678  7.062   7.703   1.00 39.04 ? 336  GLU A CD    1 
ATOM   1056 O  OE1   . GLU D 4 96  ? 20.337  6.667   8.839   1.00 44.38 ? 336  GLU A OE1   1 
ATOM   1057 O  OE2   . GLU D 4 96  ? 21.858  7.026   7.304   1.00 42.30 ? 336  GLU A OE2   1 
ATOM   1058 N  N     . LEU D 4 97  ? 18.402  7.446   3.289   1.00 22.19 ? 337  LEU A N     1 
ATOM   1059 C  CA    . LEU D 4 97  ? 18.849  8.265   2.171   1.00 23.78 ? 337  LEU A CA    1 
ATOM   1060 C  C     . LEU D 4 97  ? 17.677  9.108   1.687   1.00 24.21 ? 337  LEU A C     1 
ATOM   1061 O  O     . LEU D 4 97  ? 17.799  10.319  1.509   1.00 24.67 ? 337  LEU A O     1 
ATOM   1062 C  CB    . LEU D 4 97  ? 19.335  7.393   1.009   1.00 21.87 ? 337  LEU A CB    1 
ATOM   1063 C  CG    . LEU D 4 97  ? 19.684  8.116   -0.305  1.00 23.47 ? 337  LEU A CG    1 
ATOM   1064 C  CD1   . LEU D 4 97  ? 21.065  8.773   -0.199  1.00 21.67 ? 337  LEU A CD1   1 
ATOM   1065 C  CD2   . LEU D 4 97  ? 19.681  7.129   -1.457  1.00 23.88 ? 337  LEU A CD2   1 
ATOM   1066 N  N     . PHE D 4 98  ? 16.538  8.450   1.484   1.00 23.46 ? 338  PHE A N     1 
ATOM   1067 C  CA    . PHE D 4 98  ? 15.332  9.108   0.998   1.00 23.36 ? 338  PHE A CA    1 
ATOM   1068 C  C     . PHE D 4 98  ? 14.755  10.135  1.977   1.00 22.85 ? 338  PHE A C     1 
ATOM   1069 O  O     . PHE D 4 98  ? 14.422  11.261  1.588   1.00 22.37 ? 338  PHE A O     1 
ATOM   1070 C  CB    . PHE D 4 98  ? 14.254  8.063   0.676   1.00 23.18 ? 338  PHE A CB    1 
ATOM   1071 C  CG    . PHE D 4 98  ? 14.544  7.216   -0.547  1.00 24.49 ? 338  PHE A CG    1 
ATOM   1072 C  CD1   . PHE D 4 98  ? 13.753  6.103   -0.832  1.00 23.08 ? 338  PHE A CD1   1 
ATOM   1073 C  CD2   . PHE D 4 98  ? 15.588  7.528   -1.414  1.00 23.93 ? 338  PHE A CD2   1 
ATOM   1074 C  CE1   . PHE D 4 98  ? 13.995  5.314   -1.954  1.00 21.76 ? 338  PHE A CE1   1 
ATOM   1075 C  CE2   . PHE D 4 98  ? 15.838  6.747   -2.539  1.00 23.21 ? 338  PHE A CE2   1 
ATOM   1076 C  CZ    . PHE D 4 98  ? 15.040  5.636   -2.810  1.00 24.09 ? 338  PHE A CZ    1 
ATOM   1077 N  N     . SER D 4 99  ? 14.620  9.748   3.241   1.00 20.86 ? 339  SER A N     1 
ATOM   1078 C  CA    . SER D 4 99  ? 14.059  10.660  4.224   1.00 23.96 ? 339  SER A CA    1 
ATOM   1079 C  C     . SER D 4 99  ? 14.981  11.826  4.551   1.00 22.18 ? 339  SER A C     1 
ATOM   1080 O  O     . SER D 4 99  ? 14.602  12.710  5.297   1.00 21.70 ? 339  SER A O     1 
ATOM   1081 C  CB    . SER D 4 99  ? 13.676  9.914   5.505   1.00 25.13 ? 339  SER A CB    1 
ATOM   1082 O  OG    . SER D 4 99  ? 14.791  9.266   6.069   1.00 29.63 ? 339  SER A OG    1 
ATOM   1083 N  N     . ASN D 4 100 ? 16.195  11.822  4.006   1.00 21.95 ? 340  ASN A N     1 
ATOM   1084 C  CA    . ASN D 4 100 ? 17.103  12.935  4.237   1.00 20.87 ? 340  ASN A CA    1 
ATOM   1085 C  C     . ASN D 4 100 ? 16.826  14.047  3.221   1.00 19.92 ? 340  ASN A C     1 
ATOM   1086 O  O     . ASN D 4 100 ? 17.510  15.068  3.195   1.00 21.39 ? 340  ASN A O     1 
ATOM   1087 C  CB    . ASN D 4 100 ? 18.566  12.486  4.180   1.00 22.72 ? 340  ASN A CB    1 
ATOM   1088 C  CG    . ASN D 4 100 ? 19.074  12.023  5.539   1.00 26.98 ? 340  ASN A CG    1 
ATOM   1089 O  OD1   . ASN D 4 100 ? 18.554  12.437  6.575   1.00 27.10 ? 340  ASN A OD1   1 
ATOM   1090 N  ND2   . ASN D 4 100 ? 20.095  11.178  5.542   1.00 26.72 ? 340  ASN A ND2   1 
ATOM   1091 N  N     . ILE D 4 101 ? 15.823  13.827  2.376   1.00 17.52 ? 341  ILE A N     1 
ATOM   1092 C  CA    . ILE D 4 101 ? 15.397  14.839  1.418   1.00 19.60 ? 341  ILE A CA    1 
ATOM   1093 C  C     . ILE D 4 101 ? 14.399  15.682  2.217   1.00 18.72 ? 341  ILE A C     1 
ATOM   1094 O  O     . ILE D 4 101 ? 13.477  15.141  2.820   1.00 18.54 ? 341  ILE A O     1 
ATOM   1095 C  CB    . ILE D 4 101 ? 14.645  14.235  0.210   1.00 17.71 ? 341  ILE A CB    1 
ATOM   1096 C  CG1   . ILE D 4 101 ? 15.579  13.342  -0.605  1.00 18.93 ? 341  ILE A CG1   1 
ATOM   1097 C  CG2   . ILE D 4 101 ? 14.094  15.354  -0.680  1.00 19.79 ? 341  ILE A CG2   1 
ATOM   1098 C  CD1   . ILE D 4 101 ? 14.897  12.718  -1.841  1.00 17.21 ? 341  ILE A CD1   1 
ATOM   1099 N  N     . TRP D 4 102 ? 14.597  16.994  2.244   1.00 19.58 ? 342  TRP A N     1 
ATOM   1100 C  CA    . TRP D 4 102 ? 13.703  17.883  2.990   1.00 19.70 ? 342  TRP A CA    1 
ATOM   1101 C  C     . TRP D 4 102 ? 12.321  17.817  2.365   1.00 20.84 ? 342  TRP A C     1 
ATOM   1102 O  O     . TRP D 4 102 ? 12.173  18.037  1.167   1.00 19.81 ? 342  TRP A O     1 
ATOM   1103 C  CB    . TRP D 4 102 ? 14.211  19.324  2.936   1.00 18.57 ? 342  TRP A CB    1 
ATOM   1104 C  CG    . TRP D 4 102 ? 13.663  20.193  4.014   1.00 19.10 ? 342  TRP A CG    1 
ATOM   1105 C  CD1   . TRP D 4 102 ? 14.301  20.569  5.165   1.00 19.40 ? 342  TRP A CD1   1 
ATOM   1106 C  CD2   . TRP D 4 102 ? 12.352  20.785  4.069   1.00 20.54 ? 342  TRP A CD2   1 
ATOM   1107 N  NE1   . TRP D 4 102 ? 13.472  21.353  5.931   1.00 19.26 ? 342  TRP A NE1   1 
ATOM   1108 C  CE2   . TRP D 4 102 ? 12.272  21.506  5.285   1.00 18.50 ? 342  TRP A CE2   1 
ATOM   1109 C  CE3   . TRP D 4 102 ? 11.241  20.777  3.211   1.00 17.95 ? 342  TRP A CE3   1 
ATOM   1110 C  CZ2   . TRP D 4 102 ? 11.122  22.217  5.666   1.00 18.61 ? 342  TRP A CZ2   1 
ATOM   1111 C  CZ3   . TRP D 4 102 ? 10.094  21.484  3.590   1.00 20.03 ? 342  TRP A CZ3   1 
ATOM   1112 C  CH2   . TRP D 4 102 ? 10.047  22.195  4.809   1.00 19.12 ? 342  TRP A CH2   1 
ATOM   1113 N  N     . GLY D 4 103 ? 11.311  17.509  3.177   1.00 20.07 ? 343  GLY A N     1 
ATOM   1114 C  CA    . GLY D 4 103 ? 9.963   17.409  2.657   1.00 19.90 ? 343  GLY A CA    1 
ATOM   1115 C  C     . GLY D 4 103 ? 9.512   15.971  2.492   1.00 20.19 ? 343  GLY A C     1 
ATOM   1116 O  O     . GLY D 4 103 ? 8.338   15.710  2.263   1.00 21.55 ? 343  GLY A O     1 
ATOM   1117 N  N     . ALA D 4 104 ? 10.450  15.033  2.590   1.00 19.47 ? 344  ALA A N     1 
ATOM   1118 C  CA    . ALA D 4 104 ? 10.121  13.616  2.486   1.00 20.82 ? 344  ALA A CA    1 
ATOM   1119 C  C     . ALA D 4 104 ? 10.343  13.008  3.868   1.00 20.70 ? 344  ALA A C     1 
ATOM   1120 O  O     . ALA D 4 104 ? 11.380  13.241  4.490   1.00 20.80 ? 344  ALA A O     1 
ATOM   1121 C  CB    . ALA D 4 104 ? 11.026  12.921  1.455   1.00 17.34 ? 344  ALA A CB    1 
ATOM   1122 N  N     . GLY D 4 105 ? 9.367   12.246  4.348   1.00 20.17 ? 345  GLY A N     1 
ATOM   1123 C  CA    . GLY D 4 105 ? 9.493   11.616  5.649   1.00 20.50 ? 345  GLY A CA    1 
ATOM   1124 C  C     . GLY D 4 105 ? 9.419   10.106  5.518   1.00 24.14 ? 345  GLY A C     1 
ATOM   1125 O  O     . GLY D 4 105 ? 9.566   9.560   4.419   1.00 22.68 ? 345  GLY A O     1 
ATOM   1126 N  N     . THR D 4 106 ? 9.173   9.423   6.633   1.00 23.88 ? 346  THR A N     1 
ATOM   1127 C  CA    . THR D 4 106 ? 9.099   7.967   6.624   1.00 24.60 ? 346  THR A CA    1 
ATOM   1128 C  C     . THR D 4 106 ? 8.061   7.411   5.637   1.00 24.96 ? 346  THR A C     1 
ATOM   1129 O  O     . THR D 4 106 ? 8.347   6.468   4.902   1.00 24.97 ? 346  THR A O     1 
ATOM   1130 C  CB    . THR D 4 106 ? 8.820   7.421   8.057   1.00 25.98 ? 346  THR A CB    1 
ATOM   1131 O  OG1   . THR D 4 106 ? 8.745   5.988   8.019   1.00 28.82 ? 346  THR A OG1   1 
ATOM   1132 C  CG2   . THR D 4 106 ? 7.508   7.979   8.605   1.00 24.93 ? 346  THR A CG2   1 
ATOM   1133 N  N     . LYS D 4 107 ? 6.868   7.999   5.604   1.00 24.10 ? 347  LYS A N     1 
ATOM   1134 C  CA    . LYS D 4 107 ? 5.819   7.531   4.699   1.00 23.62 ? 347  LYS A CA    1 
ATOM   1135 C  C     . LYS D 4 107 ? 6.215   7.597   3.230   1.00 23.36 ? 347  LYS A C     1 
ATOM   1136 O  O     . LYS D 4 107 ? 6.011   6.638   2.478   1.00 21.98 ? 347  LYS A O     1 
ATOM   1137 C  CB    . LYS D 4 107 ? 4.533   8.329   4.915   1.00 25.29 ? 347  LYS A CB    1 
ATOM   1138 C  CG    . LYS D 4 107 ? 3.925   8.129   6.288   1.00 26.91 ? 347  LYS A CG    1 
ATOM   1139 C  CD    . LYS D 4 107 ? 3.571   6.663   6.514   1.00 26.49 ? 347  LYS A CD    1 
ATOM   1140 C  CE    . LYS D 4 107 ? 2.894   6.466   7.858   1.00 27.01 ? 347  LYS A CE    1 
ATOM   1141 N  NZ    . LYS D 4 107 ? 2.493   5.048   8.038   1.00 28.90 ? 347  LYS A NZ    1 
ATOM   1142 N  N     . THR D 4 108 ? 6.769   8.731   2.820   1.00 20.28 ? 348  THR A N     1 
ATOM   1143 C  CA    . THR D 4 108 ? 7.200   8.911   1.441   1.00 20.27 ? 348  THR A CA    1 
ATOM   1144 C  C     . THR D 4 108 ? 8.389   8.000   1.124   1.00 22.16 ? 348  THR A C     1 
ATOM   1145 O  O     . THR D 4 108 ? 8.477   7.425   0.035   1.00 22.72 ? 348  THR A O     1 
ATOM   1146 C  CB    . THR D 4 108 ? 7.619   10.366  1.179   1.00 19.74 ? 348  THR A CB    1 
ATOM   1147 O  OG1   . THR D 4 108 ? 6.495   11.233  1.375   1.00 18.57 ? 348  THR A OG1   1 
ATOM   1148 C  CG2   . THR D 4 108 ? 8.136   10.518  -0.235  1.00 20.45 ? 348  THR A CG2   1 
ATOM   1149 N  N     . ALA D 4 109 ? 9.305   7.872   2.077   1.00 21.16 ? 349  ALA A N     1 
ATOM   1150 C  CA    . ALA D 4 109 ? 10.468  7.021   1.876   1.00 23.68 ? 349  ALA A CA    1 
ATOM   1151 C  C     . ALA D 4 109 ? 10.043  5.571   1.647   1.00 22.98 ? 349  ALA A C     1 
ATOM   1152 O  O     . ALA D 4 109 ? 10.521  4.933   0.715   1.00 21.80 ? 349  ALA A O     1 
ATOM   1153 C  CB    . ALA D 4 109 ? 11.405  7.109   3.075   1.00 20.87 ? 349  ALA A CB    1 
ATOM   1154 N  N     . GLN D 4 110 ? 9.143   5.056   2.484   1.00 23.30 ? 350  GLN A N     1 
ATOM   1155 C  CA    . GLN D 4 110 ? 8.697   3.670   2.338   1.00 26.03 ? 350  GLN A CA    1 
ATOM   1156 C  C     . GLN D 4 110 ? 7.923   3.455   1.047   1.00 26.54 ? 350  GLN A C     1 
ATOM   1157 O  O     . GLN D 4 110 ? 8.002   2.389   0.435   1.00 24.72 ? 350  GLN A O     1 
ATOM   1158 C  CB    . GLN D 4 110 ? 7.835   3.252   3.530   1.00 30.57 ? 350  GLN A CB    1 
ATOM   1159 C  CG    . GLN D 4 110 ? 8.491   3.514   4.866   1.00 35.11 ? 350  GLN A CG    1 
ATOM   1160 C  CD    . GLN D 4 110 ? 7.974   2.606   5.955   1.00 42.14 ? 350  GLN A CD    1 
ATOM   1161 O  OE1   . GLN D 4 110 ? 8.438   1.472   6.103   1.00 46.95 ? 350  GLN A OE1   1 
ATOM   1162 N  NE2   . GLN D 4 110 ? 7.002   3.090   6.720   1.00 43.48 ? 350  GLN A NE2   1 
ATOM   1163 N  N     . MET D 4 111 ? 7.167   4.467   0.632   1.00 25.06 ? 351  MET A N     1 
ATOM   1164 C  CA    . MET D 4 111 ? 6.409   4.360   -0.602  1.00 24.93 ? 351  MET A CA    1 
ATOM   1165 C  C     . MET D 4 111 ? 7.390   4.236   -1.762  1.00 24.56 ? 351  MET A C     1 
ATOM   1166 O  O     . MET D 4 111 ? 7.260   3.345   -2.605  1.00 25.20 ? 351  MET A O     1 
ATOM   1167 C  CB    . MET D 4 111 ? 5.529   5.595   -0.812  1.00 27.45 ? 351  MET A CB    1 
ATOM   1168 C  CG    . MET D 4 111 ? 4.745   5.551   -2.104  1.00 28.23 ? 351  MET A CG    1 
ATOM   1169 S  SD    . MET D 4 111 ? 3.832   7.071   -2.406  1.00 36.09 ? 351  MET A SD    1 
ATOM   1170 C  CE    . MET D 4 111 ? 5.108   8.058   -3.235  1.00 29.56 ? 351  MET A CE    1 
ATOM   1171 N  N     . TRP D 4 112 ? 8.363   5.143   -1.807  1.00 23.63 ? 352  TRP A N     1 
ATOM   1172 C  CA    . TRP D 4 112 ? 9.366   5.119   -2.860  1.00 25.39 ? 352  TRP A CA    1 
ATOM   1173 C  C     . TRP D 4 112 ? 10.121  3.790   -2.889  1.00 25.15 ? 352  TRP A C     1 
ATOM   1174 O  O     . TRP D 4 112 ? 10.387  3.250   -3.961  1.00 28.26 ? 352  TRP A O     1 
ATOM   1175 C  CB    . TRP D 4 112 ? 10.369  6.259   -2.686  1.00 23.62 ? 352  TRP A CB    1 
ATOM   1176 C  CG    . TRP D 4 112 ? 9.838   7.600   -3.058  1.00 25.31 ? 352  TRP A CG    1 
ATOM   1177 C  CD1   . TRP D 4 112 ? 8.840   7.872   -3.957  1.00 24.82 ? 352  TRP A CD1   1 
ATOM   1178 C  CD2   . TRP D 4 112 ? 10.354  8.868   -2.635  1.00 22.90 ? 352  TRP A CD2   1 
ATOM   1179 N  NE1   . TRP D 4 112 ? 8.711   9.232   -4.126  1.00 25.31 ? 352  TRP A NE1   1 
ATOM   1180 C  CE2   . TRP D 4 112 ? 9.628   9.867   -3.328  1.00 24.29 ? 352  TRP A CE2   1 
ATOM   1181 C  CE3   . TRP D 4 112 ? 11.363  9.256   -1.744  1.00 22.44 ? 352  TRP A CE3   1 
ATOM   1182 C  CZ2   . TRP D 4 112 ? 9.882   11.231  -3.157  1.00 21.93 ? 352  TRP A CZ2   1 
ATOM   1183 C  CZ3   . TRP D 4 112 ? 11.616  10.611  -1.572  1.00 23.75 ? 352  TRP A CZ3   1 
ATOM   1184 C  CH2   . TRP D 4 112 ? 10.875  11.586  -2.278  1.00 23.89 ? 352  TRP A CH2   1 
ATOM   1185 N  N     . TYR D 4 113 ? 10.469  3.272   -1.717  1.00 23.68 ? 353  TYR A N     1 
ATOM   1186 C  CA    . TYR D 4 113 ? 11.181  2.006   -1.639  1.00 27.98 ? 353  TYR A CA    1 
ATOM   1187 C  C     . TYR D 4 113 ? 10.292  0.873   -2.170  1.00 30.38 ? 353  TYR A C     1 
ATOM   1188 O  O     . TYR D 4 113 ? 10.757  -0.035  -2.864  1.00 29.83 ? 353  TYR A O     1 
ATOM   1189 C  CB    . TYR D 4 113 ? 11.586  1.717   -0.196  1.00 27.76 ? 353  TYR A CB    1 
ATOM   1190 C  CG    . TYR D 4 113 ? 12.514  0.534   -0.066  1.00 28.94 ? 353  TYR A CG    1 
ATOM   1191 C  CD1   . TYR D 4 113 ? 12.017  -0.767  0.024   1.00 29.41 ? 353  TYR A CD1   1 
ATOM   1192 C  CD2   . TYR D 4 113 ? 13.894  0.710   -0.095  1.00 30.53 ? 353  TYR A CD2   1 
ATOM   1193 C  CE1   . TYR D 4 113 ? 12.879  -1.867  0.077   1.00 31.08 ? 353  TYR A CE1   1 
ATOM   1194 C  CE2   . TYR D 4 113 ? 14.765  -0.382  -0.046  1.00 31.67 ? 353  TYR A CE2   1 
ATOM   1195 C  CZ    . TYR D 4 113 ? 14.249  -1.665  0.037   1.00 32.19 ? 353  TYR A CZ    1 
ATOM   1196 O  OH    . TYR D 4 113 ? 15.105  -2.740  0.057   1.00 34.30 ? 353  TYR A OH    1 
ATOM   1197 N  N     . GLN D 4 114 ? 9.011   0.946   -1.829  1.00 32.15 ? 354  GLN A N     1 
ATOM   1198 C  CA    . GLN D 4 114 ? 8.031   -0.036  -2.257  1.00 33.50 ? 354  GLN A CA    1 
ATOM   1199 C  C     . GLN D 4 114 ? 7.912   -0.011  -3.779  1.00 33.10 ? 354  GLN A C     1 
ATOM   1200 O  O     . GLN D 4 114 ? 7.741   -1.049  -4.411  1.00 32.53 ? 354  GLN A O     1 
ATOM   1201 C  CB    . GLN D 4 114 ? 6.684   0.277   -1.595  1.00 37.11 ? 354  GLN A CB    1 
ATOM   1202 C  CG    . GLN D 4 114 ? 5.462   -0.312  -2.278  1.00 42.60 ? 354  GLN A CG    1 
ATOM   1203 C  CD    . GLN D 4 114 ? 5.551   -1.803  -2.448  1.00 45.41 ? 354  GLN A CD    1 
ATOM   1204 O  OE1   . GLN D 4 114 ? 5.928   -2.525  -1.519  1.00 47.90 ? 354  GLN A OE1   1 
ATOM   1205 N  NE2   . GLN D 4 114 ? 5.195   -2.284  -3.638  1.00 46.89 ? 354  GLN A NE2   1 
ATOM   1206 N  N     . GLN D 4 115 ? 8.024   1.177   -4.365  1.00 31.70 ? 355  GLN A N     1 
ATOM   1207 C  CA    . GLN D 4 115 ? 7.928   1.316   -5.813  1.00 31.23 ? 355  GLN A CA    1 
ATOM   1208 C  C     . GLN D 4 115 ? 9.212   0.904   -6.535  1.00 30.23 ? 355  GLN A C     1 
ATOM   1209 O  O     . GLN D 4 115 ? 9.311   1.048   -7.745  1.00 31.65 ? 355  GLN A O     1 
ATOM   1210 C  CB    . GLN D 4 115 ? 7.558   2.759   -6.189  1.00 31.06 ? 355  GLN A CB    1 
ATOM   1211 C  CG    . GLN D 4 115 ? 6.254   3.242   -5.560  1.00 32.58 ? 355  GLN A CG    1 
ATOM   1212 C  CD    . GLN D 4 115 ? 5.914   4.688   -5.913  1.00 34.03 ? 355  GLN A CD    1 
ATOM   1213 O  OE1   . GLN D 4 115 ? 6.806   5.533   -6.067  1.00 32.46 ? 355  GLN A OE1   1 
ATOM   1214 N  NE2   . GLN D 4 115 ? 4.616   4.983   -6.017  1.00 30.13 ? 355  GLN A NE2   1 
ATOM   1215 N  N     . GLY D 4 116 ? 10.196  0.405   -5.792  1.00 30.56 ? 356  GLY A N     1 
ATOM   1216 C  CA    . GLY D 4 116 ? 11.435  -0.033  -6.412  1.00 30.40 ? 356  GLY A CA    1 
ATOM   1217 C  C     . GLY D 4 116 ? 12.611  0.935   -6.437  1.00 32.84 ? 356  GLY A C     1 
ATOM   1218 O  O     . GLY D 4 116 ? 13.712  0.554   -6.843  1.00 32.59 ? 356  GLY A O     1 
ATOM   1219 N  N     . PHE D 4 117 ? 12.400  2.174   -6.001  1.00 31.50 ? 357  PHE A N     1 
ATOM   1220 C  CA    . PHE D 4 117 ? 13.474  3.170   -5.999  1.00 30.51 ? 357  PHE A CA    1 
ATOM   1221 C  C     . PHE D 4 117 ? 14.538  2.820   -4.968  1.00 28.10 ? 357  PHE A C     1 
ATOM   1222 O  O     . PHE D 4 117 ? 14.226  2.376   -3.865  1.00 29.14 ? 357  PHE A O     1 
ATOM   1223 C  CB    . PHE D 4 117 ? 12.887  4.558   -5.733  1.00 31.61 ? 357  PHE A CB    1 
ATOM   1224 C  CG    . PHE D 4 117 ? 11.848  4.968   -6.738  1.00 34.25 ? 357  PHE A CG    1 
ATOM   1225 C  CD1   . PHE D 4 117 ? 10.904  5.942   -6.429  1.00 35.38 ? 357  PHE A CD1   1 
ATOM   1226 C  CD2   . PHE D 4 117 ? 11.802  4.365   -7.994  1.00 36.25 ? 357  PHE A CD2   1 
ATOM   1227 C  CE1   . PHE D 4 117 ? 9.924   6.310   -7.353  1.00 36.62 ? 357  PHE A CE1   1 
ATOM   1228 C  CE2   . PHE D 4 117 ? 10.828  4.723   -8.928  1.00 39.04 ? 357  PHE A CE2   1 
ATOM   1229 C  CZ    . PHE D 4 117 ? 9.884   5.701   -8.603  1.00 38.98 ? 357  PHE A CZ    1 
ATOM   1230 N  N     . ARG D 4 118 ? 15.801  3.011   -5.334  1.00 29.04 ? 358  ARG A N     1 
ATOM   1231 C  CA    . ARG D 4 118 ? 16.900  2.681   -4.434  1.00 28.04 ? 358  ARG A CA    1 
ATOM   1232 C  C     . ARG D 4 118 ? 17.969  3.760   -4.331  1.00 27.29 ? 358  ARG A C     1 
ATOM   1233 O  O     . ARG D 4 118 ? 18.825  3.699   -3.449  1.00 28.53 ? 358  ARG A O     1 
ATOM   1234 C  CB    . ARG D 4 118 ? 17.567  1.371   -4.890  1.00 30.78 ? 358  ARG A CB    1 
ATOM   1235 C  CG    . ARG D 4 118 ? 16.668  0.139   -4.841  1.00 27.93 ? 358  ARG A CG    1 
ATOM   1236 C  CD    . ARG D 4 118 ? 16.506  -0.360  -3.427  1.00 30.50 ? 358  ARG A CD    1 
ATOM   1237 N  NE    . ARG D 4 118 ? 15.601  -1.506  -3.333  1.00 32.38 ? 358  ARG A NE    1 
ATOM   1238 C  CZ    . ARG D 4 118 ? 14.276  -1.437  -3.445  1.00 34.92 ? 358  ARG A CZ    1 
ATOM   1239 N  NH1   . ARG D 4 118 ? 13.676  -0.269  -3.660  1.00 34.10 ? 358  ARG A NH1   1 
ATOM   1240 N  NH2   . ARG D 4 118 ? 13.544  -2.540  -3.330  1.00 34.12 ? 358  ARG A NH2   1 
ATOM   1241 N  N     . SER D 4 119 ? 17.929  4.746   -5.219  1.00 24.66 ? 359  SER A N     1 
ATOM   1242 C  CA    . SER D 4 119 ? 18.949  5.788   -5.210  1.00 23.54 ? 359  SER A CA    1 
ATOM   1243 C  C     . SER D 4 119 ? 18.355  7.153   -5.521  1.00 22.63 ? 359  SER A C     1 
ATOM   1244 O  O     . SER D 4 119 ? 17.220  7.249   -5.978  1.00 23.70 ? 359  SER A O     1 
ATOM   1245 C  CB    . SER D 4 119 ? 20.028  5.462   -6.251  1.00 21.61 ? 359  SER A CB    1 
ATOM   1246 O  OG    . SER D 4 119 ? 19.568  5.765   -7.558  1.00 23.27 ? 359  SER A OG    1 
ATOM   1247 N  N     . LEU D 4 120 ? 19.128  8.210   -5.285  1.00 22.46 ? 360  LEU A N     1 
ATOM   1248 C  CA    . LEU D 4 120 ? 18.640  9.554   -5.566  1.00 23.92 ? 360  LEU A CA    1 
ATOM   1249 C  C     . LEU D 4 120 ? 18.479  9.702   -7.077  1.00 25.35 ? 360  LEU A C     1 
ATOM   1250 O  O     . LEU D 4 120 ? 17.638  10.463  -7.550  1.00 26.90 ? 360  LEU A O     1 
ATOM   1251 C  CB    . LEU D 4 120 ? 19.592  10.616  -4.992  1.00 21.37 ? 360  LEU A CB    1 
ATOM   1252 C  CG    . LEU D 4 120 ? 19.634  10.660  -3.450  1.00 21.91 ? 360  LEU A CG    1 
ATOM   1253 C  CD1   . LEU D 4 120 ? 20.476  11.848  -2.960  1.00 20.75 ? 360  LEU A CD1   1 
ATOM   1254 C  CD2   . LEU D 4 120 ? 18.217  10.795  -2.911  1.00 20.85 ? 360  LEU A CD2   1 
ATOM   1255 N  N     . GLU D 4 121 ? 19.277  8.959   -7.837  1.00 27.13 ? 361  GLU A N     1 
ATOM   1256 C  CA    . GLU D 4 121 ? 19.167  8.994   -9.292  1.00 28.14 ? 361  GLU A CA    1 
ATOM   1257 C  C     . GLU D 4 121 ? 17.778  8.453   -9.668  1.00 27.75 ? 361  GLU A C     1 
ATOM   1258 O  O     . GLU D 4 121 ? 17.111  8.992   -10.550 1.00 27.53 ? 361  GLU A O     1 
ATOM   1259 C  CB    . GLU D 4 121 ? 20.276  8.144   -9.922  1.00 32.20 ? 361  GLU A CB    1 
ATOM   1260 C  CG    . GLU D 4 121 ? 20.178  7.966   -11.437 1.00 35.03 ? 361  GLU A CG    1 
ATOM   1261 C  CD    . GLU D 4 121 ? 19.984  9.279   -12.172 1.00 39.40 ? 361  GLU A CD    1 
ATOM   1262 O  OE1   . GLU D 4 121 ? 20.561  10.308  -11.743 1.00 36.96 ? 361  GLU A OE1   1 
ATOM   1263 O  OE2   . GLU D 4 121 ? 19.257  9.275   -13.191 1.00 41.65 ? 361  GLU A OE2   1 
ATOM   1264 N  N     . ASP D 4 122 ? 17.345  7.389   -8.993  1.00 26.83 ? 362  ASP A N     1 
ATOM   1265 C  CA    . ASP D 4 122 ? 16.014  6.824   -9.237  1.00 26.60 ? 362  ASP A CA    1 
ATOM   1266 C  C     . ASP D 4 122 ? 14.949  7.874   -8.884  1.00 27.61 ? 362  ASP A C     1 
ATOM   1267 O  O     . ASP D 4 122 ? 13.970  8.060   -9.611  1.00 25.99 ? 362  ASP A O     1 
ATOM   1268 C  CB    . ASP D 4 122 ? 15.791  5.588   -8.367  1.00 27.24 ? 362  ASP A CB    1 
ATOM   1269 C  CG    . ASP D 4 122 ? 16.611  4.402   -8.817  1.00 28.18 ? 362  ASP A CG    1 
ATOM   1270 O  OD1   . ASP D 4 122 ? 16.722  3.427   -8.045  1.00 29.64 ? 362  ASP A OD1   1 
ATOM   1271 O  OD2   . ASP D 4 122 ? 17.135  4.441   -9.948  1.00 30.48 ? 362  ASP A OD2   1 
ATOM   1272 N  N     . ILE D 4 123 ? 15.147  8.557   -7.761  1.00 25.87 ? 363  ILE A N     1 
ATOM   1273 C  CA    . ILE D 4 123 ? 14.205  9.589   -7.315  1.00 24.99 ? 363  ILE A CA    1 
ATOM   1274 C  C     . ILE D 4 123 ? 14.153  10.716  -8.339  1.00 24.31 ? 363  ILE A C     1 
ATOM   1275 O  O     . ILE D 4 123 ? 13.085  11.097  -8.815  1.00 24.46 ? 363  ILE A O     1 
ATOM   1276 C  CB    . ILE D 4 123 ? 14.630  10.182  -5.938  1.00 23.05 ? 363  ILE A CB    1 
ATOM   1277 C  CG1   . ILE D 4 123 ? 14.680  9.075   -4.881  1.00 22.20 ? 363  ILE A CG1   1 
ATOM   1278 C  CG2   . ILE D 4 123 ? 13.652  11.260  -5.503  1.00 23.85 ? 363  ILE A CG2   1 
ATOM   1279 C  CD1   . ILE D 4 123 ? 13.341  8.341   -4.688  1.00 24.26 ? 363  ILE A CD1   1 
ATOM   1280 N  N     . ARG D 4 124 ? 15.322  11.241  -8.676  1.00 25.64 ? 364  ARG A N     1 
ATOM   1281 C  CA    . ARG D 4 124 ? 15.429  12.331  -9.636  1.00 28.97 ? 364  ARG A CA    1 
ATOM   1282 C  C     . ARG D 4 124 ? 14.758  12.021  -10.975 1.00 30.07 ? 364  ARG A C     1 
ATOM   1283 O  O     . ARG D 4 124 ? 14.028  12.842  -11.519 1.00 30.94 ? 364  ARG A O     1 
ATOM   1284 C  CB    . ARG D 4 124 ? 16.902  12.643  -9.892  1.00 30.17 ? 364  ARG A CB    1 
ATOM   1285 C  CG    . ARG D 4 124 ? 17.125  13.744  -10.911 1.00 36.29 ? 364  ARG A CG    1 
ATOM   1286 C  CD    . ARG D 4 124 ? 18.541  13.689  -11.462 1.00 38.77 ? 364  ARG A CD    1 
ATOM   1287 N  NE    . ARG D 4 124 ? 18.711  12.600  -12.417 1.00 42.30 ? 364  ARG A NE    1 
ATOM   1288 C  CZ    . ARG D 4 124 ? 18.149  12.572  -13.623 1.00 45.13 ? 364  ARG A CZ    1 
ATOM   1289 N  NH1   . ARG D 4 124 ? 17.379  13.578  -14.025 1.00 43.96 ? 364  ARG A NH1   1 
ATOM   1290 N  NH2   . ARG D 4 124 ? 18.352  11.535  -14.428 1.00 45.19 ? 364  ARG A NH2   1 
ATOM   1291 N  N     . SER D 4 125 ? 15.010  10.833  -11.505 1.00 29.79 ? 365  SER A N     1 
ATOM   1292 C  CA    . SER D 4 125 ? 14.454  10.468  -12.800 1.00 33.78 ? 365  SER A CA    1 
ATOM   1293 C  C     . SER D 4 125 ? 13.046  9.895   -12.826 1.00 34.55 ? 365  SER A C     1 
ATOM   1294 O  O     . SER D 4 125 ? 12.328  10.090  -13.807 1.00 35.88 ? 365  SER A O     1 
ATOM   1295 C  CB    . SER D 4 125 ? 15.389  9.482   -13.513 1.00 33.96 ? 365  SER A CB    1 
ATOM   1296 O  OG    . SER D 4 125 ? 15.478  8.252   -12.811 1.00 35.94 ? 365  SER A OG    1 
ATOM   1297 N  N     . GLN D 4 126 ? 12.627  9.209   -11.768 1.00 35.40 ? 366  GLN A N     1 
ATOM   1298 C  CA    . GLN D 4 126 ? 11.302  8.591   -11.797 1.00 35.79 ? 366  GLN A CA    1 
ATOM   1299 C  C     . GLN D 4 126 ? 10.296  8.934   -10.698 1.00 35.73 ? 366  GLN A C     1 
ATOM   1300 O  O     . GLN D 4 126 ? 9.097   8.709   -10.868 1.00 34.40 ? 366  GLN A O     1 
ATOM   1301 C  CB    . GLN D 4 126 ? 11.465  7.071   -11.842 1.00 38.50 ? 366  GLN A CB    1 
ATOM   1302 C  CG    . GLN D 4 126 ? 12.433  6.582   -12.904 1.00 41.14 ? 366  GLN A CG    1 
ATOM   1303 C  CD    . GLN D 4 126 ? 12.609  5.084   -12.863 1.00 44.21 ? 366  GLN A CD    1 
ATOM   1304 O  OE1   . GLN D 4 126 ? 11.680  4.335   -13.154 1.00 48.94 ? 366  GLN A OE1   1 
ATOM   1305 N  NE2   . GLN D 4 126 ? 13.801  4.635   -12.489 1.00 45.62 ? 366  GLN A NE2   1 
ATOM   1306 N  N     . ALA D 4 127 ? 10.756  9.473   -9.577  1.00 34.60 ? 367  ALA A N     1 
ATOM   1307 C  CA    . ALA D 4 127 ? 9.829   9.779   -8.492  1.00 34.80 ? 367  ALA A CA    1 
ATOM   1308 C  C     . ALA D 4 127 ? 8.987   11.023  -8.720  1.00 35.09 ? 367  ALA A C     1 
ATOM   1309 O  O     . ALA D 4 127 ? 9.413   11.976  -9.372  1.00 35.19 ? 367  ALA A O     1 
ATOM   1310 C  CB    . ALA D 4 127 ? 10.587  9.903   -7.180  1.00 34.08 ? 367  ALA A CB    1 
ATOM   1311 N  N     . SER D 4 128 ? 7.772   10.995  -8.186  1.00 35.94 ? 368  SER A N     1 
ATOM   1312 C  CA    . SER D 4 128 ? 6.873   12.135  -8.284  1.00 36.77 ? 368  SER A CA    1 
ATOM   1313 C  C     . SER D 4 128 ? 7.235   12.954  -7.045  1.00 35.51 ? 368  SER A C     1 
ATOM   1314 O  O     . SER D 4 128 ? 7.126   12.463  -5.922  1.00 37.34 ? 368  SER A O     1 
ATOM   1315 C  CB    . SER D 4 128 ? 5.414   11.672  -8.220  1.00 38.21 ? 368  SER A CB    1 
ATOM   1316 O  OG    . SER D 4 128 ? 4.537   12.742  -8.518  1.00 42.10 ? 368  SER A OG    1 
ATOM   1317 N  N     . LEU D 4 129 ? 7.684   14.188  -7.243  1.00 32.70 ? 369  LEU A N     1 
ATOM   1318 C  CA    . LEU D 4 129 ? 8.106   15.013  -6.120  1.00 30.15 ? 369  LEU A CA    1 
ATOM   1319 C  C     . LEU D 4 129 ? 7.247   16.240  -5.872  1.00 29.57 ? 369  LEU A C     1 
ATOM   1320 O  O     . LEU D 4 129 ? 6.723   16.853  -6.801  1.00 29.10 ? 369  LEU A O     1 
ATOM   1321 C  CB    . LEU D 4 129 ? 9.547   15.468  -6.337  1.00 28.83 ? 369  LEU A CB    1 
ATOM   1322 C  CG    . LEU D 4 129 ? 10.598  14.398  -6.619  1.00 27.12 ? 369  LEU A CG    1 
ATOM   1323 C  CD1   . LEU D 4 129 ? 11.850  15.061  -7.154  1.00 26.41 ? 369  LEU A CD1   1 
ATOM   1324 C  CD2   . LEU D 4 129 ? 10.896  13.609  -5.355  1.00 25.19 ? 369  LEU A CD2   1 
ATOM   1325 N  N     . THR D 4 130 ? 7.097   16.593  -4.605  1.00 27.63 ? 370  THR A N     1 
ATOM   1326 C  CA    . THR D 4 130 ? 6.341   17.787  -4.268  1.00 26.45 ? 370  THR A CA    1 
ATOM   1327 C  C     . THR D 4 130 ? 7.323   18.937  -4.506  1.00 27.09 ? 370  THR A C     1 
ATOM   1328 O  O     . THR D 4 130 ? 8.530   18.718  -4.667  1.00 25.48 ? 370  THR A O     1 
ATOM   1329 C  CB    . THR D 4 130 ? 5.911   17.803  -2.779  1.00 25.94 ? 370  THR A CB    1 
ATOM   1330 O  OG1   . THR D 4 130 ? 7.080   17.793  -1.943  1.00 24.15 ? 370  THR A OG1   1 
ATOM   1331 C  CG2   . THR D 4 130 ? 5.036   16.585  -2.455  1.00 18.61 ? 370  THR A CG2   1 
ATOM   1332 N  N     . THR D 4 131 ? 6.811   20.156  -4.528  1.00 25.65 ? 371  THR A N     1 
ATOM   1333 C  CA    . THR D 4 131 ? 7.661   21.313  -4.731  1.00 26.46 ? 371  THR A CA    1 
ATOM   1334 C  C     . THR D 4 131 ? 8.778   21.347  -3.690  1.00 24.75 ? 371  THR A C     1 
ATOM   1335 O  O     . THR D 4 131 ? 9.931   21.639  -4.012  1.00 26.19 ? 371  THR A O     1 
ATOM   1336 C  CB    . THR D 4 131 ? 6.852   22.598  -4.616  1.00 27.31 ? 371  THR A CB    1 
ATOM   1337 O  OG1   . THR D 4 131 ? 5.794   22.571  -5.582  1.00 29.90 ? 371  THR A OG1   1 
ATOM   1338 C  CG2   . THR D 4 131 ? 7.748   23.815  -4.860  1.00 30.00 ? 371  THR A CG2   1 
ATOM   1339 N  N     . GLN D 4 132 ? 8.428   21.058  -2.442  1.00 24.70 ? 372  GLN A N     1 
ATOM   1340 C  CA    . GLN D 4 132 ? 9.408   21.063  -1.356  1.00 24.22 ? 372  GLN A CA    1 
ATOM   1341 C  C     . GLN D 4 132 ? 10.482  20.001  -1.572  1.00 22.06 ? 372  GLN A C     1 
ATOM   1342 O  O     . GLN D 4 132 ? 11.666  20.275  -1.429  1.00 22.29 ? 372  GLN A O     1 
ATOM   1343 C  CB    . GLN D 4 132 ? 8.715   20.825  -0.006  1.00 23.44 ? 372  GLN A CB    1 
ATOM   1344 C  CG    . GLN D 4 132 ? 7.727   21.928  0.392   1.00 24.39 ? 372  GLN A CG    1 
ATOM   1345 C  CD    . GLN D 4 132 ? 6.914   21.567  1.613   1.00 24.35 ? 372  GLN A CD    1 
ATOM   1346 O  OE1   . GLN D 4 132 ? 6.769   20.392  1.943   1.00 25.01 ? 372  GLN A OE1   1 
ATOM   1347 N  NE2   . GLN D 4 132 ? 6.360   22.576  2.287   1.00 23.06 ? 372  GLN A NE2   1 
ATOM   1348 N  N     . GLN D 4 133 ? 10.063  18.790  -1.919  1.00 22.92 ? 373  GLN A N     1 
ATOM   1349 C  CA    . GLN D 4 133 ? 11.004  17.693  -2.129  1.00 22.73 ? 373  GLN A CA    1 
ATOM   1350 C  C     . GLN D 4 133 ? 11.960  17.957  -3.279  1.00 22.78 ? 373  GLN A C     1 
ATOM   1351 O  O     . GLN D 4 133 ? 13.124  17.565  -3.215  1.00 24.52 ? 373  GLN A O     1 
ATOM   1352 C  CB    . GLN D 4 133 ? 10.233  16.385  -2.350  1.00 23.17 ? 373  GLN A CB    1 
ATOM   1353 C  CG    . GLN D 4 133 ? 9.319   16.049  -1.172  1.00 22.31 ? 373  GLN A CG    1 
ATOM   1354 C  CD    . GLN D 4 133 ? 8.353   14.909  -1.454  1.00 23.56 ? 373  GLN A CD    1 
ATOM   1355 O  OE1   . GLN D 4 133 ? 8.104   14.558  -2.607  1.00 21.96 ? 373  GLN A OE1   1 
ATOM   1356 N  NE2   . GLN D 4 133 ? 7.787   14.340  -0.395  1.00 20.47 ? 373  GLN A NE2   1 
ATOM   1357 N  N     . ALA D 4 134 ? 11.485  18.627  -4.329  1.00 22.88 ? 374  ALA A N     1 
ATOM   1358 C  CA    . ALA D 4 134 ? 12.349  18.934  -5.467  1.00 23.08 ? 374  ALA A CA    1 
ATOM   1359 C  C     . ALA D 4 134 ? 13.433  19.918  -5.008  1.00 23.38 ? 374  ALA A C     1 
ATOM   1360 O  O     . ALA D 4 134 ? 14.591  19.828  -5.420  1.00 22.65 ? 374  ALA A O     1 
ATOM   1361 C  CB    . ALA D 4 134 ? 11.529  19.540  -6.611  1.00 22.55 ? 374  ALA A CB    1 
ATOM   1362 N  N     . ILE D 4 135 ? 13.054  20.856  -4.146  1.00 22.52 ? 375  ILE A N     1 
ATOM   1363 C  CA    . ILE D 4 135 ? 14.011  21.828  -3.629  1.00 22.21 ? 375  ILE A CA    1 
ATOM   1364 C  C     . ILE D 4 135 ? 14.983  21.108  -2.698  1.00 22.21 ? 375  ILE A C     1 
ATOM   1365 O  O     . ILE D 4 135 ? 16.180  21.371  -2.709  1.00 21.15 ? 375  ILE A O     1 
ATOM   1366 C  CB    . ILE D 4 135 ? 13.294  22.960  -2.850  1.00 23.19 ? 375  ILE A CB    1 
ATOM   1367 C  CG1   . ILE D 4 135 ? 12.472  23.814  -3.830  1.00 23.51 ? 375  ILE A CG1   1 
ATOM   1368 C  CG2   . ILE D 4 135 ? 14.326  23.813  -2.092  1.00 23.98 ? 375  ILE A CG2   1 
ATOM   1369 C  CD1   . ILE D 4 135 ? 11.543  24.809  -3.171  1.00 19.83 ? 375  ILE A CD1   1 
ATOM   1370 N  N     . GLY D 4 136 ? 14.460  20.182  -1.900  1.00 21.15 ? 376  GLY A N     1 
ATOM   1371 C  CA    . GLY D 4 136 ? 15.312  19.456  -0.982  1.00 19.36 ? 376  GLY A CA    1 
ATOM   1372 C  C     . GLY D 4 136 ? 16.332  18.572  -1.676  1.00 18.90 ? 376  GLY A C     1 
ATOM   1373 O  O     . GLY D 4 136 ? 17.458  18.432  -1.211  1.00 20.14 ? 376  GLY A O     1 
ATOM   1374 N  N     . LEU D 4 137 ? 15.933  17.965  -2.784  1.00 18.30 ? 377  LEU A N     1 
ATOM   1375 C  CA    . LEU D 4 137 ? 16.828  17.092  -3.525  1.00 20.45 ? 377  LEU A CA    1 
ATOM   1376 C  C     . LEU D 4 137 ? 17.906  17.933  -4.208  1.00 21.79 ? 377  LEU A C     1 
ATOM   1377 O  O     . LEU D 4 137 ? 19.074  17.549  -4.247  1.00 22.63 ? 377  LEU A O     1 
ATOM   1378 C  CB    . LEU D 4 137 ? 16.032  16.280  -4.557  1.00 19.64 ? 377  LEU A CB    1 
ATOM   1379 C  CG    . LEU D 4 137 ? 16.822  15.383  -5.520  1.00 23.69 ? 377  LEU A CG    1 
ATOM   1380 C  CD1   . LEU D 4 137 ? 17.726  14.435  -4.746  1.00 19.67 ? 377  LEU A CD1   1 
ATOM   1381 C  CD2   . LEU D 4 137 ? 15.844  14.609  -6.391  1.00 24.16 ? 377  LEU A CD2   1 
ATOM   1382 N  N     . LYS D 4 138 ? 17.513  19.096  -4.721  1.00 23.21 ? 378  LYS A N     1 
ATOM   1383 C  CA    . LYS D 4 138 ? 18.450  19.994  -5.389  1.00 25.26 ? 378  LYS A CA    1 
ATOM   1384 C  C     . LYS D 4 138 ? 19.532  20.481  -4.426  1.00 24.26 ? 378  LYS A C     1 
ATOM   1385 O  O     . LYS D 4 138 ? 20.630  20.838  -4.846  1.00 25.27 ? 378  LYS A O     1 
ATOM   1386 C  CB    . LYS D 4 138 ? 17.705  21.203  -5.975  1.00 29.57 ? 378  LYS A CB    1 
ATOM   1387 C  CG    . LYS D 4 138 ? 18.625  22.250  -6.584  1.00 37.14 ? 378  LYS A CG    1 
ATOM   1388 C  CD    . LYS D 4 138 ? 17.851  23.441  -7.124  1.00 41.45 ? 378  LYS A CD    1 
ATOM   1389 C  CE    . LYS D 4 138 ? 17.092  24.160  -6.016  1.00 44.89 ? 378  LYS A CE    1 
ATOM   1390 N  NZ    . LYS D 4 138 ? 16.410  25.385  -6.523  1.00 46.81 ? 378  LYS A NZ    1 
ATOM   1391 N  N     . HIS D 4 139 ? 19.224  20.490  -3.133  1.00 22.78 ? 379  HIS A N     1 
ATOM   1392 C  CA    . HIS D 4 139 ? 20.189  20.935  -2.133  1.00 22.23 ? 379  HIS A CA    1 
ATOM   1393 C  C     . HIS D 4 139 ? 20.488  19.806  -1.164  1.00 22.76 ? 379  HIS A C     1 
ATOM   1394 O  O     . HIS D 4 139 ? 20.829  20.047  -0.002  1.00 23.87 ? 379  HIS A O     1 
ATOM   1395 C  CB    . HIS D 4 139 ? 19.630  22.136  -1.365  1.00 20.81 ? 379  HIS A CB    1 
ATOM   1396 C  CG    . HIS D 4 139 ? 19.324  23.314  -2.234  1.00 20.43 ? 379  HIS A CG    1 
ATOM   1397 N  ND1   . HIS D 4 139 ? 20.277  23.915  -3.029  1.00 20.40 ? 379  HIS A ND1   1 
ATOM   1398 C  CD2   . HIS D 4 139 ? 18.178  24.007  -2.429  1.00 21.16 ? 379  HIS A CD2   1 
ATOM   1399 C  CE1   . HIS D 4 139 ? 19.731  24.931  -3.674  1.00 22.51 ? 379  HIS A CE1   1 
ATOM   1400 N  NE2   . HIS D 4 139 ? 18.458  25.009  -3.327  1.00 22.60 ? 379  HIS A NE2   1 
ATOM   1401 N  N     . TYR D 4 140 ? 20.370  18.570  -1.643  1.00 22.36 ? 380  TYR A N     1 
ATOM   1402 C  CA    . TYR D 4 140 ? 20.603  17.418  -0.784  1.00 21.46 ? 380  TYR A CA    1 
ATOM   1403 C  C     . TYR D 4 140 ? 21.878  17.512  0.058   1.00 21.88 ? 380  TYR A C     1 
ATOM   1404 O  O     . TYR D 4 140 ? 21.824  17.394  1.277   1.00 23.70 ? 380  TYR A O     1 
ATOM   1405 C  CB    . TYR D 4 140 ? 20.637  16.130  -1.600  1.00 21.26 ? 380  TYR A CB    1 
ATOM   1406 C  CG    . TYR D 4 140 ? 20.545  14.897  -0.731  1.00 20.91 ? 380  TYR A CG    1 
ATOM   1407 C  CD1   . TYR D 4 140 ? 19.310  14.462  -0.224  1.00 20.24 ? 380  TYR A CD1   1 
ATOM   1408 C  CD2   . TYR D 4 140 ? 21.685  14.152  -0.425  1.00 18.80 ? 380  TYR A CD2   1 
ATOM   1409 C  CE1   . TYR D 4 140 ? 19.222  13.298  0.562   1.00 21.10 ? 380  TYR A CE1   1 
ATOM   1410 C  CE2   . TYR D 4 140 ? 21.607  12.992  0.359   1.00 16.91 ? 380  TYR A CE2   1 
ATOM   1411 C  CZ    . TYR D 4 140 ? 20.376  12.572  0.840   1.00 19.46 ? 380  TYR A CZ    1 
ATOM   1412 O  OH    . TYR D 4 140 ? 20.296  11.406  1.563   1.00 22.30 ? 380  TYR A OH    1 
ATOM   1413 N  N     . SER D 4 141 ? 23.024  17.711  -0.579  1.00 22.15 ? 381  SER A N     1 
ATOM   1414 C  CA    . SER D 4 141 ? 24.268  17.806  0.181   1.00 24.76 ? 381  SER A CA    1 
ATOM   1415 C  C     . SER D 4 141 ? 24.312  19.044  1.082   1.00 24.82 ? 381  SER A C     1 
ATOM   1416 O  O     . SER D 4 141 ? 24.680  18.946  2.245   1.00 22.95 ? 381  SER A O     1 
ATOM   1417 C  CB    . SER D 4 141 ? 25.478  17.813  -0.753  1.00 23.04 ? 381  SER A CB    1 
ATOM   1418 O  OG    . SER D 4 141 ? 25.685  16.537  -1.330  1.00 25.28 ? 381  SER A OG    1 
ATOM   1419 N  N     . ASP D 4 142 ? 23.938  20.199  0.544   1.00 24.12 ? 382  ASP A N     1 
ATOM   1420 C  CA    . ASP D 4 142 ? 23.955  21.424  1.329   1.00 26.44 ? 382  ASP A CA    1 
ATOM   1421 C  C     . ASP D 4 142 ? 23.148  21.315  2.611   1.00 25.99 ? 382  ASP A C     1 
ATOM   1422 O  O     . ASP D 4 142 ? 23.607  21.746  3.669   1.00 26.29 ? 382  ASP A O     1 
ATOM   1423 C  CB    . ASP D 4 142 ? 23.437  22.610  0.512   1.00 26.65 ? 382  ASP A CB    1 
ATOM   1424 C  CG    . ASP D 4 142 ? 24.453  23.109  -0.484  1.00 30.78 ? 382  ASP A CG    1 
ATOM   1425 O  OD1   . ASP D 4 142 ? 25.664  22.995  -0.195  1.00 31.10 ? 382  ASP A OD1   1 
ATOM   1426 O  OD2   . ASP D 4 142 ? 24.046  23.626  -1.543  1.00 34.43 ? 382  ASP A OD2   1 
ATOM   1427 N  N     . PHE D 4 143 ? 21.961  20.723  2.523   1.00 25.09 ? 383  PHE A N     1 
ATOM   1428 C  CA    . PHE D 4 143 ? 21.100  20.591  3.691   1.00 24.89 ? 383  PHE A CA    1 
ATOM   1429 C  C     . PHE D 4 143 ? 21.597  19.593  4.724   1.00 26.96 ? 383  PHE A C     1 
ATOM   1430 O  O     . PHE D 4 143 ? 21.081  19.546  5.839   1.00 28.98 ? 383  PHE A O     1 
ATOM   1431 C  CB    . PHE D 4 143 ? 19.672  20.242  3.260   1.00 24.38 ? 383  PHE A CB    1 
ATOM   1432 C  CG    . PHE D 4 143 ? 18.948  21.380  2.571   1.00 25.22 ? 383  PHE A CG    1 
ATOM   1433 C  CD1   . PHE D 4 143 ? 19.598  22.584  2.305   1.00 22.48 ? 383  PHE A CD1   1 
ATOM   1434 C  CD2   . PHE D 4 143 ? 17.617  21.247  2.199   1.00 24.83 ? 383  PHE A CD2   1 
ATOM   1435 C  CE1   . PHE D 4 143 ? 18.927  23.639  1.678   1.00 25.74 ? 383  PHE A CE1   1 
ATOM   1436 C  CE2   . PHE D 4 143 ? 16.941  22.293  1.572   1.00 27.16 ? 383  PHE A CE2   1 
ATOM   1437 C  CZ    . PHE D 4 143 ? 17.599  23.490  1.312   1.00 24.05 ? 383  PHE A CZ    1 
ATOM   1438 N  N     . LEU D 4 144 ? 22.591  18.788  4.371   1.00 25.95 ? 384  LEU A N     1 
ATOM   1439 C  CA    . LEU D 4 144 ? 23.119  17.843  5.349   1.00 28.17 ? 384  LEU A CA    1 
ATOM   1440 C  C     . LEU D 4 144 ? 24.347  18.434  6.043   1.00 27.63 ? 384  LEU A C     1 
ATOM   1441 O  O     . LEU D 4 144 ? 24.860  17.871  7.005   1.00 27.26 ? 384  LEU A O     1 
ATOM   1442 C  CB    . LEU D 4 144 ? 23.463  16.510  4.679   1.00 25.92 ? 384  LEU A CB    1 
ATOM   1443 C  CG    . LEU D 4 144 ? 22.207  15.716  4.297   1.00 27.66 ? 384  LEU A CG    1 
ATOM   1444 C  CD1   . LEU D 4 144 ? 22.584  14.479  3.497   1.00 25.31 ? 384  LEU A CD1   1 
ATOM   1445 C  CD2   . LEU D 4 144 ? 21.443  15.338  5.566   1.00 23.80 ? 384  LEU A CD2   1 
ATOM   1446 N  N     . GLU D 4 145 ? 24.803  19.580  5.551   1.00 28.87 ? 385  GLU A N     1 
ATOM   1447 C  CA    . GLU D 4 145 ? 25.966  20.246  6.122   1.00 33.44 ? 385  GLU A CA    1 
ATOM   1448 C  C     . GLU D 4 145 ? 25.581  21.292  7.158   1.00 33.19 ? 385  GLU A C     1 
ATOM   1449 O  O     . GLU D 4 145 ? 24.484  21.857  7.120   1.00 33.50 ? 385  GLU A O     1 
ATOM   1450 C  CB    . GLU D 4 145 ? 26.785  20.937  5.027   1.00 36.48 ? 385  GLU A CB    1 
ATOM   1451 C  CG    . GLU D 4 145 ? 27.576  20.011  4.129   1.00 44.37 ? 385  GLU A CG    1 
ATOM   1452 C  CD    . GLU D 4 145 ? 28.568  20.771  3.261   1.00 50.42 ? 385  GLU A CD    1 
ATOM   1453 O  OE1   . GLU D 4 145 ? 29.376  20.112  2.571   1.00 54.57 ? 385  GLU A OE1   1 
ATOM   1454 O  OE2   . GLU D 4 145 ? 28.540  22.026  3.272   1.00 52.41 ? 385  GLU A OE2   1 
ATOM   1455 N  N     . ARG D 4 146 ? 26.497  21.540  8.086   1.00 32.48 ? 386  ARG A N     1 
ATOM   1456 C  CA    . ARG D 4 146 ? 26.290  22.541  9.122   1.00 32.30 ? 386  ARG A CA    1 
ATOM   1457 C  C     . ARG D 4 146 ? 27.266  23.667  8.809   1.00 31.46 ? 386  ARG A C     1 
ATOM   1458 O  O     . ARG D 4 146 ? 28.351  23.428  8.281   1.00 32.35 ? 386  ARG A O     1 
ATOM   1459 C  CB    . ARG D 4 146 ? 26.565  21.949  10.505  1.00 29.91 ? 386  ARG A CB    1 
ATOM   1460 C  CG    . ARG D 4 146 ? 25.606  20.823  10.878  1.00 30.55 ? 386  ARG A CG    1 
ATOM   1461 C  CD    . ARG D 4 146 ? 25.918  20.242  12.246  1.00 28.40 ? 386  ARG A CD    1 
ATOM   1462 N  NE    . ARG D 4 146 ? 25.648  21.188  13.326  1.00 31.86 ? 386  ARG A NE    1 
ATOM   1463 C  CZ    . ARG D 4 146 ? 24.433  21.493  13.776  1.00 31.93 ? 386  ARG A CZ    1 
ATOM   1464 N  NH1   . ARG D 4 146 ? 23.353  20.922  13.243  1.00 30.45 ? 386  ARG A NH1   1 
ATOM   1465 N  NH2   . ARG D 4 146 ? 24.296  22.371  14.763  1.00 27.41 ? 386  ARG A NH2   1 
ATOM   1466 N  N     . MET D 4 147 ? 26.867  24.895  9.099   1.00 30.21 ? 387  MET A N     1 
ATOM   1467 C  CA    . MET D 4 147 ? 27.719  26.040  8.827   1.00 29.69 ? 387  MET A CA    1 
ATOM   1468 C  C     . MET D 4 147 ? 28.392  26.500  10.109  1.00 30.14 ? 387  MET A C     1 
ATOM   1469 O  O     . MET D 4 147 ? 27.915  26.211  11.209  1.00 32.03 ? 387  MET A O     1 
ATOM   1470 C  CB    . MET D 4 147 ? 26.883  27.189  8.263   1.00 27.21 ? 387  MET A CB    1 
ATOM   1471 C  CG    . MET D 4 147 ? 25.977  27.843  9.308   1.00 27.44 ? 387  MET A CG    1 
ATOM   1472 S  SD    . MET D 4 147 ? 24.775  28.987  8.603   1.00 30.18 ? 387  MET A SD    1 
ATOM   1473 C  CE    . MET D 4 147 ? 23.367  27.910  8.440   1.00 20.54 ? 387  MET A CE    1 
ATOM   1474 N  N     . PRO D 4 148 ? 29.526  27.206  9.985   1.00 30.41 ? 388  PRO A N     1 
ATOM   1475 C  CA    . PRO D 4 148 ? 30.219  27.697  11.179  1.00 30.96 ? 388  PRO A CA    1 
ATOM   1476 C  C     . PRO D 4 148 ? 29.293  28.782  11.724  1.00 30.72 ? 388  PRO A C     1 
ATOM   1477 O  O     . PRO D 4 148 ? 28.621  29.457  10.943  1.00 29.09 ? 388  PRO A O     1 
ATOM   1478 C  CB    . PRO D 4 148 ? 31.526  28.256  10.615  1.00 31.53 ? 388  PRO A CB    1 
ATOM   1479 C  CG    . PRO D 4 148 ? 31.127  28.737  9.247   1.00 32.19 ? 388  PRO A CG    1 
ATOM   1480 C  CD    . PRO D 4 148 ? 30.219  27.627  8.752   1.00 32.55 ? 388  PRO A CD    1 
ATOM   1481 N  N     . ARG D 4 149 ? 29.234  28.951  13.040  1.00 32.11 ? 389  ARG A N     1 
ATOM   1482 C  CA    . ARG D 4 149 ? 28.317  29.945  13.583  1.00 34.08 ? 389  ARG A CA    1 
ATOM   1483 C  C     . ARG D 4 149 ? 28.552  31.335  13.027  1.00 33.47 ? 389  ARG A C     1 
ATOM   1484 O  O     . ARG D 4 149 ? 27.614  32.119  12.889  1.00 35.70 ? 389  ARG A O     1 
ATOM   1485 C  CB    . ARG D 4 149 ? 28.345  29.959  15.121  1.00 35.77 ? 389  ARG A CB    1 
ATOM   1486 C  CG    . ARG D 4 149 ? 29.619  30.433  15.770  1.00 34.37 ? 389  ARG A CG    1 
ATOM   1487 C  CD    . ARG D 4 149 ? 29.460  30.466  17.293  1.00 36.41 ? 389  ARG A CD    1 
ATOM   1488 N  NE    . ARG D 4 149 ? 28.508  31.475  17.764  1.00 37.19 ? 389  ARG A NE    1 
ATOM   1489 C  CZ    . ARG D 4 149 ? 27.323  31.212  18.318  1.00 39.76 ? 389  ARG A CZ    1 
ATOM   1490 N  NH1   . ARG D 4 149 ? 26.909  29.958  18.483  1.00 37.34 ? 389  ARG A NH1   1 
ATOM   1491 N  NH2   . ARG D 4 149 ? 26.553  32.211  18.730  1.00 39.40 ? 389  ARG A NH2   1 
ATOM   1492 N  N     . GLU D 4 150 ? 29.799  31.630  12.681  1.00 33.71 ? 390  GLU A N     1 
ATOM   1493 C  CA    . GLU D 4 150 ? 30.145  32.929  12.121  1.00 34.15 ? 390  GLU A CA    1 
ATOM   1494 C  C     . GLU D 4 150 ? 29.280  33.236  10.899  1.00 33.85 ? 390  GLU A C     1 
ATOM   1495 O  O     . GLU D 4 150 ? 28.861  34.376  10.698  1.00 33.39 ? 390  GLU A O     1 
ATOM   1496 C  CB    . GLU D 4 150 ? 31.629  32.966  11.722  1.00 38.44 ? 390  GLU A CB    1 
ATOM   1497 C  CG    . GLU D 4 150 ? 32.622  32.906  12.890  1.00 43.48 ? 390  GLU A CG    1 
ATOM   1498 C  CD    . GLU D 4 150 ? 32.823  31.500  13.464  1.00 46.96 ? 390  GLU A CD    1 
ATOM   1499 O  OE1   . GLU D 4 150 ? 33.472  31.387  14.531  1.00 49.73 ? 390  GLU A OE1   1 
ATOM   1500 O  OE2   . GLU D 4 150 ? 32.347  30.512  12.857  1.00 42.58 ? 390  GLU A OE2   1 
ATOM   1501 N  N     . GLU D 4 151 ? 29.020  32.219  10.078  1.00 31.44 ? 391  GLU A N     1 
ATOM   1502 C  CA    . GLU D 4 151 ? 28.195  32.407  8.882   1.00 30.75 ? 391  GLU A CA    1 
ATOM   1503 C  C     . GLU D 4 151 ? 26.737  32.617  9.284   1.00 28.55 ? 391  GLU A C     1 
ATOM   1504 O  O     . GLU D 4 151 ? 26.000  33.356  8.631   1.00 27.75 ? 391  GLU A O     1 
ATOM   1505 C  CB    . GLU D 4 151 ? 28.302  31.194  7.950   1.00 28.37 ? 391  GLU A CB    1 
ATOM   1506 C  CG    . GLU D 4 151 ? 27.368  31.257  6.748   1.00 27.16 ? 391  GLU A CG    1 
ATOM   1507 C  CD    . GLU D 4 151 ? 27.668  30.180  5.713   1.00 30.69 ? 391  GLU A CD    1 
ATOM   1508 O  OE1   . GLU D 4 151 ? 28.271  29.149  6.081   1.00 30.69 ? 391  GLU A OE1   1 
ATOM   1509 O  OE2   . GLU D 4 151 ? 27.291  30.358  4.532   1.00 31.65 ? 391  GLU A OE2   1 
ATOM   1510 N  N     . ALA D 4 152 ? 26.328  31.949  10.355  1.00 28.23 ? 392  ALA A N     1 
ATOM   1511 C  CA    . ALA D 4 152 ? 24.970  32.087  10.860  1.00 29.05 ? 392  ALA A CA    1 
ATOM   1512 C  C     . ALA D 4 152 ? 24.781  33.549  11.267  1.00 28.89 ? 392  ALA A C     1 
ATOM   1513 O  O     . ALA D 4 152 ? 23.735  34.143  11.024  1.00 26.67 ? 392  ALA A O     1 
ATOM   1514 C  CB    . ALA D 4 152 ? 24.769  31.176  12.057  1.00 28.42 ? 392  ALA A CB    1 
ATOM   1515 N  N     . THR D 4 153 ? 25.810  34.124  11.884  1.00 30.88 ? 393  THR A N     1 
ATOM   1516 C  CA    . THR D 4 153 ? 25.755  35.524  12.296  1.00 30.46 ? 393  THR A CA    1 
ATOM   1517 C  C     . THR D 4 153 ? 25.498  36.394  11.073  1.00 31.39 ? 393  THR A C     1 
ATOM   1518 O  O     . THR D 4 153 ? 24.617  37.255  11.084  1.00 31.95 ? 393  THR A O     1 
ATOM   1519 C  CB    . THR D 4 153 ? 27.077  35.975  12.949  1.00 29.74 ? 393  THR A CB    1 
ATOM   1520 O  OG1   . THR D 4 153 ? 27.321  35.196  14.129  1.00 31.71 ? 393  THR A OG1   1 
ATOM   1521 C  CG2   . THR D 4 153 ? 27.010  37.444  13.330  1.00 30.51 ? 393  THR A CG2   1 
ATOM   1522 N  N     . GLU D 4 154 ? 26.260  36.153  10.011  1.00 31.67 ? 394  GLU A N     1 
ATOM   1523 C  CA    . GLU D 4 154 ? 26.121  36.925  8.787   1.00 33.52 ? 394  GLU A CA    1 
ATOM   1524 C  C     . GLU D 4 154 ? 24.704  36.837  8.243   1.00 34.41 ? 394  GLU A C     1 
ATOM   1525 O  O     . GLU D 4 154 ? 24.150  37.825  7.750   1.00 33.78 ? 394  GLU A O     1 
ATOM   1526 C  CB    . GLU D 4 154 ? 27.087  36.415  7.723   1.00 37.41 ? 394  GLU A CB    1 
ATOM   1527 C  CG    . GLU D 4 154 ? 28.525  36.299  8.173   1.00 42.52 ? 394  GLU A CG    1 
ATOM   1528 C  CD    . GLU D 4 154 ? 29.435  35.835  7.049   1.00 44.85 ? 394  GLU A CD    1 
ATOM   1529 O  OE1   . GLU D 4 154 ? 29.703  36.641  6.130   1.00 43.70 ? 394  GLU A OE1   1 
ATOM   1530 O  OE2   . GLU D 4 154 ? 29.866  34.660  7.084   1.00 47.26 ? 394  GLU A OE2   1 
ATOM   1531 N  N     . ILE D 4 155 ? 24.119  35.646  8.326   1.00 33.88 ? 395  ILE A N     1 
ATOM   1532 C  CA    . ILE D 4 155 ? 22.767  35.447  7.836   1.00 32.32 ? 395  ILE A CA    1 
ATOM   1533 C  C     . ILE D 4 155 ? 21.761  36.193  8.707   1.00 32.91 ? 395  ILE A C     1 
ATOM   1534 O  O     . ILE D 4 155 ? 20.853  36.840  8.193   1.00 31.40 ? 395  ILE A O     1 
ATOM   1535 C  CB    . ILE D 4 155 ? 22.420  33.939  7.764   1.00 30.34 ? 395  ILE A CB    1 
ATOM   1536 C  CG1   . ILE D 4 155 ? 23.232  33.287  6.632   1.00 29.04 ? 395  ILE A CG1   1 
ATOM   1537 C  CG2   . ILE D 4 155 ? 20.924  33.751  7.523   1.00 26.70 ? 395  ILE A CG2   1 
ATOM   1538 C  CD1   . ILE D 4 155 ? 23.149  31.774  6.588   1.00 27.24 ? 395  ILE A CD1   1 
ATOM   1539 N  N     . GLU D 4 156 ? 21.920  36.109  10.022  1.00 34.28 ? 396  GLU A N     1 
ATOM   1540 C  CA    . GLU D 4 156 ? 21.010  36.815  10.916  1.00 37.24 ? 396  GLU A CA    1 
ATOM   1541 C  C     . GLU D 4 156 ? 21.134  38.313  10.624  1.00 38.07 ? 396  GLU A C     1 
ATOM   1542 O  O     . GLU D 4 156 ? 20.134  39.010  10.485  1.00 38.15 ? 396  GLU A O     1 
ATOM   1543 C  CB    . GLU D 4 156 ? 21.370  36.522  12.374  1.00 37.12 ? 396  GLU A CB    1 
ATOM   1544 C  CG    . GLU D 4 156 ? 20.453  37.149  13.421  1.00 39.45 ? 396  GLU A CG    1 
ATOM   1545 C  CD    . GLU D 4 156 ? 20.690  38.638  13.607  1.00 42.17 ? 396  GLU A CD    1 
ATOM   1546 O  OE1   . GLU D 4 156 ? 21.870  39.056  13.602  1.00 43.20 ? 396  GLU A OE1   1 
ATOM   1547 O  OE2   . GLU D 4 156 ? 19.699  39.385  13.773  1.00 42.33 ? 396  GLU A OE2   1 
ATOM   1548 N  N     . GLN D 4 157 ? 22.368  38.793  10.512  1.00 38.61 ? 397  GLN A N     1 
ATOM   1549 C  CA    . GLN D 4 157 ? 22.617  40.201  10.234  1.00 39.68 ? 397  GLN A CA    1 
ATOM   1550 C  C     . GLN D 4 157 ? 21.971  40.640  8.929   1.00 38.56 ? 397  GLN A C     1 
ATOM   1551 O  O     . GLN D 4 157 ? 21.444  41.746  8.830   1.00 37.31 ? 397  GLN A O     1 
ATOM   1552 C  CB    . GLN D 4 157 ? 24.124  40.473  10.181  1.00 42.82 ? 397  GLN A CB    1 
ATOM   1553 C  CG    . GLN D 4 157 ? 24.818  40.411  11.538  1.00 46.93 ? 397  GLN A CG    1 
ATOM   1554 C  CD    . GLN D 4 157 ? 24.391  41.538  12.467  1.00 52.30 ? 397  GLN A CD    1 
ATOM   1555 O  OE1   . GLN D 4 157 ? 24.503  42.719  12.123  1.00 53.79 ? 397  GLN A OE1   1 
ATOM   1556 N  NE2   . GLN D 4 157 ? 23.903  41.179  13.653  1.00 54.12 ? 397  GLN A NE2   1 
ATOM   1557 N  N     . THR D 4 158 ? 22.006  39.768  7.927   1.00 37.31 ? 398  THR A N     1 
ATOM   1558 C  CA    . THR D 4 158 ? 21.421  40.088  6.633   1.00 35.32 ? 398  THR A CA    1 
ATOM   1559 C  C     . THR D 4 158 ? 19.913  40.238  6.765   1.00 36.22 ? 398  THR A C     1 
ATOM   1560 O  O     . THR D 4 158 ? 19.309  41.149  6.186   1.00 34.87 ? 398  THR A O     1 
ATOM   1561 C  CB    . THR D 4 158 ? 21.716  38.990  5.605   1.00 35.58 ? 398  THR A CB    1 
ATOM   1562 O  OG1   . THR D 4 158 ? 23.132  38.762  5.545   1.00 34.62 ? 398  THR A OG1   1 
ATOM   1563 C  CG2   . THR D 4 158 ? 21.208  39.405  4.229   1.00 33.83 ? 398  THR A CG2   1 
ATOM   1564 N  N     . VAL D 4 159 ? 19.302  39.342  7.531   1.00 35.13 ? 399  VAL A N     1 
ATOM   1565 C  CA    . VAL D 4 159 ? 17.861  39.395  7.727   1.00 34.89 ? 399  VAL A CA    1 
ATOM   1566 C  C     . VAL D 4 159 ? 17.507  40.622  8.568   1.00 36.08 ? 399  VAL A C     1 
ATOM   1567 O  O     . VAL D 4 159 ? 16.585  41.368  8.227   1.00 36.55 ? 399  VAL A O     1 
ATOM   1568 C  CB    . VAL D 4 159 ? 17.339  38.103  8.419   1.00 33.20 ? 399  VAL A CB    1 
ATOM   1569 C  CG1   . VAL D 4 159 ? 15.860  38.258  8.789   1.00 30.05 ? 399  VAL A CG1   1 
ATOM   1570 C  CG2   . VAL D 4 159 ? 17.517  36.907  7.476   1.00 32.04 ? 399  VAL A CG2   1 
ATOM   1571 N  N     . GLN D 4 160 ? 18.257  40.836  9.648   1.00 36.68 ? 400  GLN A N     1 
ATOM   1572 C  CA    . GLN D 4 160 ? 18.022  41.971  10.537  1.00 38.49 ? 400  GLN A CA    1 
ATOM   1573 C  C     . GLN D 4 160 ? 18.170  43.306  9.812   1.00 39.45 ? 400  GLN A C     1 
ATOM   1574 O  O     . GLN D 4 160 ? 17.363  44.220  10.002  1.00 39.11 ? 400  GLN A O     1 
ATOM   1575 C  CB    . GLN D 4 160 ? 18.989  41.936  11.721  1.00 39.98 ? 400  GLN A CB    1 
ATOM   1576 C  CG    . GLN D 4 160 ? 18.720  43.028  12.759  1.00 40.75 ? 400  GLN A CG    1 
ATOM   1577 C  CD    . GLN D 4 160 ? 19.739  43.039  13.880  1.00 42.87 ? 400  GLN A CD    1 
ATOM   1578 O  OE1   . GLN D 4 160 ? 19.991  42.017  14.522  1.00 45.64 ? 400  GLN A OE1   1 
ATOM   1579 N  NE2   . GLN D 4 160 ? 20.326  44.203  14.129  1.00 43.46 ? 400  GLN A NE2   1 
ATOM   1580 N  N     . LYS D 4 161 ? 19.205  43.421  8.988   1.00 39.91 ? 401  LYS A N     1 
ATOM   1581 C  CA    . LYS D 4 161 ? 19.440  44.651  8.247   1.00 41.89 ? 401  LYS A CA    1 
ATOM   1582 C  C     . LYS D 4 161 ? 18.237  44.976  7.374   1.00 42.32 ? 401  LYS A C     1 
ATOM   1583 O  O     . LYS D 4 161 ? 17.747  46.106  7.376   1.00 43.90 ? 401  LYS A O     1 
ATOM   1584 C  CB    . LYS D 4 161 ? 20.694  44.522  7.389   1.00 43.45 ? 401  LYS A CB    1 
ATOM   1585 N  N     . ALA D 4 162 ? 17.750  43.978  6.644   1.00 42.25 ? 402  ALA A N     1 
ATOM   1586 C  CA    . ALA D 4 162 ? 16.605  44.163  5.761   1.00 41.01 ? 402  ALA A CA    1 
ATOM   1587 C  C     . ALA D 4 162 ? 15.321  44.474  6.526   1.00 41.54 ? 402  ALA A C     1 
ATOM   1588 O  O     . ALA D 4 162 ? 14.445  45.180  6.018   1.00 40.39 ? 402  ALA A O     1 
ATOM   1589 C  CB    . ALA D 4 162 ? 16.410  42.925  4.899   1.00 41.64 ? 402  ALA A CB    1 
ATOM   1590 N  N     . ALA D 4 163 ? 15.209  43.944  7.741   1.00 40.08 ? 403  ALA A N     1 
ATOM   1591 C  CA    . ALA D 4 163 ? 14.029  44.169  8.565   1.00 42.31 ? 403  ALA A CA    1 
ATOM   1592 C  C     . ALA D 4 163 ? 14.034  45.569  9.172   1.00 43.59 ? 403  ALA A C     1 
ATOM   1593 O  O     . ALA D 4 163 ? 13.054  46.306  9.063   1.00 42.69 ? 403  ALA A O     1 
ATOM   1594 C  CB    . ALA D 4 163 ? 13.959  43.128  9.674   1.00 42.01 ? 403  ALA A CB    1 
ATOM   1595 N  N     . GLN D 4 164 ? 15.143  45.930  9.811   1.00 44.52 ? 404  GLN A N     1 
ATOM   1596 C  CA    . GLN D 4 164 ? 15.267  47.237  10.442  1.00 47.54 ? 404  GLN A CA    1 
ATOM   1597 C  C     . GLN D 4 164 ? 15.307  48.361  9.419   1.00 48.93 ? 404  GLN A C     1 
ATOM   1598 O  O     . GLN D 4 164 ? 15.219  49.530  9.782   1.00 50.40 ? 404  GLN A O     1 
ATOM   1599 C  CB    . GLN D 4 164 ? 16.521  47.289  11.317  1.00 47.10 ? 404  GLN A CB    1 
ATOM   1600 C  CG    . GLN D 4 164 ? 16.530  46.245  12.412  1.00 49.59 ? 404  GLN A CG    1 
ATOM   1601 C  CD    . GLN D 4 164 ? 17.717  46.375  13.341  1.00 50.98 ? 404  GLN A CD    1 
ATOM   1602 O  OE1   . GLN D 4 164 ? 18.860  46.490  12.899  1.00 51.58 ? 404  GLN A OE1   1 
ATOM   1603 N  NE2   . GLN D 4 164 ? 17.452  46.340  14.642  1.00 53.47 ? 404  GLN A NE2   1 
ATOM   1604 N  N     . ALA D 4 165 ? 15.438  48.006  8.145   1.00 50.13 ? 405  ALA A N     1 
ATOM   1605 C  CA    . ALA D 4 165 ? 15.477  48.998  7.080   1.00 52.14 ? 405  ALA A CA    1 
ATOM   1606 C  C     . ALA D 4 165 ? 14.148  49.738  6.995   1.00 54.59 ? 405  ALA A C     1 
ATOM   1607 O  O     . ALA D 4 165 ? 14.125  50.967  6.938   1.00 56.32 ? 405  ALA A O     1 
ATOM   1608 C  CB    . ALA D 4 165 ? 15.789  48.333  5.745   1.00 52.11 ? 405  ALA A CB    1 
ATOM   1609 N  N     . PHE D 4 166 ? 13.040  49.001  6.989   1.00 55.77 ? 406  PHE A N     1 
ATOM   1610 C  CA    . PHE D 4 166 ? 11.734  49.646  6.911   1.00 57.26 ? 406  PHE A CA    1 
ATOM   1611 C  C     . PHE D 4 166 ? 11.057  49.845  8.269   1.00 56.88 ? 406  PHE A C     1 
ATOM   1612 O  O     . PHE D 4 166 ? 9.895   50.244  8.337   1.00 58.46 ? 406  PHE A O     1 
ATOM   1613 C  CB    . PHE D 4 166 ? 10.803  48.887  5.953   1.00 58.73 ? 406  PHE A CB    1 
ATOM   1614 C  CG    . PHE D 4 166 ? 10.580  47.448  6.319   1.00 61.47 ? 406  PHE A CG    1 
ATOM   1615 C  CD1   . PHE D 4 166 ? 11.620  46.526  6.253   1.00 62.20 ? 406  PHE A CD1   1 
ATOM   1616 C  CD2   . PHE D 4 166 ? 9.318   47.010  6.714   1.00 61.70 ? 406  PHE A CD2   1 
ATOM   1617 C  CE1   . PHE D 4 166 ? 11.407  45.188  6.575   1.00 62.67 ? 406  PHE A CE1   1 
ATOM   1618 C  CE2   . PHE D 4 166 ? 9.094   45.675  7.038   1.00 62.37 ? 406  PHE A CE2   1 
ATOM   1619 C  CZ    . PHE D 4 166 ? 10.140  44.762  6.968   1.00 63.09 ? 406  PHE A CZ    1 
ATOM   1620 N  N     . ASN D 4 167 ? 11.793  49.572  9.343   1.00 55.96 ? 407  ASN A N     1 
ATOM   1621 C  CA    . ASN D 4 167 ? 11.305  49.754  10.712  1.00 55.44 ? 407  ASN A CA    1 
ATOM   1622 C  C     . ASN D 4 167 ? 12.421  49.404  11.685  1.00 55.32 ? 407  ASN A C     1 
ATOM   1623 O  O     . ASN D 4 167 ? 12.587  48.242  12.067  1.00 55.63 ? 407  ASN A O     1 
ATOM   1624 C  CB    . ASN D 4 167 ? 10.084  48.876  11.006  1.00 55.66 ? 407  ASN A CB    1 
ATOM   1625 C  CG    . ASN D 4 167 ? 9.398   49.254  12.319  1.00 56.21 ? 407  ASN A CG    1 
ATOM   1626 O  OD1   . ASN D 4 167 ? 10.030  49.303  13.377  1.00 55.14 ? 407  ASN A OD1   1 
ATOM   1627 N  ND2   . ASN D 4 167 ? 8.100   49.527  12.252  1.00 56.59 ? 407  ASN A ND2   1 
ATOM   1628 N  N     . SER D 4 168 ? 13.182  50.420  12.082  1.00 53.93 ? 408  SER A N     1 
ATOM   1629 C  CA    . SER D 4 168 ? 14.303  50.244  12.996  1.00 53.20 ? 408  SER A CA    1 
ATOM   1630 C  C     . SER D 4 168 ? 13.878  49.725  14.361  1.00 51.94 ? 408  SER A C     1 
ATOM   1631 O  O     . SER D 4 168 ? 14.722  49.364  15.182  1.00 52.54 ? 408  SER A O     1 
ATOM   1632 C  CB    . SER D 4 168 ? 15.054  51.570  13.164  1.00 54.45 ? 408  SER A CB    1 
ATOM   1633 O  OG    . SER D 4 168 ? 14.205  52.575  13.697  1.00 56.74 ? 408  SER A OG    1 
ATOM   1634 N  N     . GLY D 4 169 ? 12.572  49.692  14.607  1.00 50.01 ? 409  GLY A N     1 
ATOM   1635 C  CA    . GLY D 4 169 ? 12.081  49.211  15.884  1.00 47.76 ? 409  GLY A CA    1 
ATOM   1636 C  C     . GLY D 4 169 ? 12.057  47.695  15.986  1.00 46.94 ? 409  GLY A C     1 
ATOM   1637 O  O     . GLY D 4 169 ? 12.056  47.136  17.086  1.00 47.15 ? 409  GLY A O     1 
ATOM   1638 N  N     . LEU D 4 170 ? 12.037  47.023  14.839  1.00 44.99 ? 410  LEU A N     1 
ATOM   1639 C  CA    . LEU D 4 170 ? 12.004  45.566  14.816  1.00 43.63 ? 410  LEU A CA    1 
ATOM   1640 C  C     . LEU D 4 170 ? 13.187  44.930  15.530  1.00 42.32 ? 410  LEU A C     1 
ATOM   1641 O  O     . LEU D 4 170 ? 14.339  45.254  15.264  1.00 43.14 ? 410  LEU A O     1 
ATOM   1642 C  CB    . LEU D 4 170 ? 11.939  45.060  13.373  1.00 41.22 ? 410  LEU A CB    1 
ATOM   1643 C  CG    . LEU D 4 170 ? 10.602  45.341  12.682  1.00 43.50 ? 410  LEU A CG    1 
ATOM   1644 C  CD1   . LEU D 4 170 ? 10.666  44.947  11.217  1.00 42.40 ? 410  LEU A CD1   1 
ATOM   1645 C  CD2   . LEU D 4 170 ? 9.494   44.579  13.403  1.00 42.92 ? 410  LEU A CD2   1 
ATOM   1646 N  N     . LEU D 4 171 ? 12.878  44.026  16.449  1.00 41.93 ? 411  LEU A N     1 
ATOM   1647 C  CA    . LEU D 4 171 ? 13.882  43.309  17.212  1.00 42.71 ? 411  LEU A CA    1 
ATOM   1648 C  C     . LEU D 4 171 ? 14.131  41.967  16.506  1.00 43.05 ? 411  LEU A C     1 
ATOM   1649 O  O     . LEU D 4 171 ? 13.184  41.243  16.192  1.00 43.27 ? 411  LEU A O     1 
ATOM   1650 C  CB    . LEU D 4 171 ? 13.363  43.079  18.630  1.00 44.80 ? 411  LEU A CB    1 
ATOM   1651 C  CG    . LEU D 4 171 ? 14.284  42.405  19.643  1.00 47.86 ? 411  LEU A CG    1 
ATOM   1652 C  CD1   . LEU D 4 171 ? 15.538  43.247  19.846  1.00 49.07 ? 411  LEU A CD1   1 
ATOM   1653 C  CD2   . LEU D 4 171 ? 13.537  42.237  20.954  1.00 48.57 ? 411  LEU A CD2   1 
ATOM   1654 N  N     . CYS D 4 172 ? 15.397  41.647  16.252  1.00 41.65 ? 412  CYS A N     1 
ATOM   1655 C  CA    . CYS D 4 172 ? 15.758  40.404  15.569  1.00 40.91 ? 412  CYS A CA    1 
ATOM   1656 C  C     . CYS D 4 172 ? 16.774  39.604  16.367  1.00 40.04 ? 412  CYS A C     1 
ATOM   1657 O  O     . CYS D 4 172 ? 17.792  40.140  16.805  1.00 41.37 ? 412  CYS A O     1 
ATOM   1658 C  CB    . CYS D 4 172 ? 16.336  40.708  14.187  1.00 37.95 ? 412  CYS A CB    1 
ATOM   1659 S  SG    . CYS D 4 172 ? 15.225  41.624  13.105  1.00 40.10 ? 412  CYS A SG    1 
ATOM   1660 N  N     . VAL D 4 173 ? 16.505  38.317  16.547  1.00 38.25 ? 413  VAL A N     1 
ATOM   1661 C  CA    . VAL D 4 173 ? 17.411  37.464  17.302  1.00 37.14 ? 413  VAL A CA    1 
ATOM   1662 C  C     . VAL D 4 173 ? 17.525  36.076  16.689  1.00 35.21 ? 413  VAL A C     1 
ATOM   1663 O  O     . VAL D 4 173 ? 16.516  35.458  16.339  1.00 32.65 ? 413  VAL A O     1 
ATOM   1664 C  CB    . VAL D 4 173 ? 16.933  37.285  18.753  1.00 39.61 ? 413  VAL A CB    1 
ATOM   1665 C  CG1   . VAL D 4 173 ? 18.003  36.569  19.568  1.00 41.28 ? 413  VAL A CG1   1 
ATOM   1666 C  CG2   . VAL D 4 173 ? 16.597  38.629  19.360  1.00 42.89 ? 413  VAL A CG2   1 
ATOM   1667 N  N     . ALA D 4 174 ? 18.760  35.595  16.570  1.00 32.48 ? 414  ALA A N     1 
ATOM   1668 C  CA    . ALA D 4 174 ? 19.026  34.266  16.033  1.00 31.01 ? 414  ALA A CA    1 
ATOM   1669 C  C     . ALA D 4 174 ? 18.839  33.334  17.224  1.00 30.75 ? 414  ALA A C     1 
ATOM   1670 O  O     . ALA D 4 174 ? 19.415  33.556  18.288  1.00 29.74 ? 414  ALA A O     1 
ATOM   1671 C  CB    . ALA D 4 174 ? 20.437  34.200  15.470  1.00 31.69 ? 414  ALA A CB    1 
ATOM   1672 N  N     . CYS D 4 175 ? 18.119  32.246  17.032  1.00 28.65 ? 415  CYS A N     1 
ATOM   1673 C  CA    . CYS D 4 175 ? 17.804  31.347  18.131  1.00 26.66 ? 415  CYS A CA    1 
ATOM   1674 C  C     . CYS D 4 175 ? 18.407  29.974  17.843  1.00 26.66 ? 415  CYS A C     1 
ATOM   1675 O  O     . CYS D 4 175 ? 19.566  29.877  17.449  1.00 26.21 ? 415  CYS A O     1 
ATOM   1676 C  CB    . CYS D 4 175 ? 16.298  31.245  18.383  1.00 27.16 ? 415  CYS A CB    1 
ATOM   1677 S  SG    . CYS D 4 175 ? 15.518  32.887  18.665  1.00 31.75 ? 415  CYS A SG    1 
ATOM   1678 N  N     . GLY D 4 176 ? 17.624  28.919  18.047  1.00 26.51 ? 416  GLY A N     1 
ATOM   1679 C  CA    . GLY D 4 176 ? 18.109  27.573  17.797  1.00 26.70 ? 416  GLY A CA    1 
ATOM   1680 C  C     . GLY D 4 176 ? 19.475  27.294  18.397  1.00 28.52 ? 416  GLY A C     1 
ATOM   1681 O  O     . GLY D 4 176 ? 19.856  27.891  19.405  1.00 29.59 ? 416  GLY A O     1 
ATOM   1682 N  N     . SER D 4 177 ? 20.222  26.395  17.763  1.00 28.51 ? 417  SER A N     1 
ATOM   1683 C  CA    . SER D 4 177 ? 21.549  26.014  18.231  1.00 28.57 ? 417  SER A CA    1 
ATOM   1684 C  C     . SER D 4 177 ? 22.504  27.199  18.347  1.00 29.38 ? 417  SER A C     1 
ATOM   1685 O  O     . SER D 4 177 ? 23.452  27.165  19.131  1.00 28.99 ? 417  SER A O     1 
ATOM   1686 C  CB    . SER D 4 177 ? 22.154  24.953  17.297  1.00 27.40 ? 417  SER A CB    1 
ATOM   1687 O  OG    . SER D 4 177 ? 22.262  25.430  15.964  1.00 27.10 ? 417  SER A OG    1 
ATOM   1688 N  N     . TYR D 4 178 ? 22.259  28.242  17.563  1.00 28.85 ? 418  TYR A N     1 
ATOM   1689 C  CA    . TYR D 4 178 ? 23.109  29.425  17.598  1.00 30.27 ? 418  TYR A CA    1 
ATOM   1690 C  C     . TYR D 4 178 ? 23.066  30.080  18.983  1.00 31.74 ? 418  TYR A C     1 
ATOM   1691 O  O     . TYR D 4 178 ? 24.104  30.318  19.601  1.00 31.56 ? 418  TYR A O     1 
ATOM   1692 C  CB    . TYR D 4 178 ? 22.645  30.431  16.545  1.00 30.97 ? 418  TYR A CB    1 
ATOM   1693 C  CG    . TYR D 4 178 ? 23.454  31.708  16.507  1.00 34.70 ? 418  TYR A CG    1 
ATOM   1694 C  CD1   . TYR D 4 178 ? 24.650  31.780  15.791  1.00 34.29 ? 418  TYR A CD1   1 
ATOM   1695 C  CD2   . TYR D 4 178 ? 23.027  32.845  17.189  1.00 33.44 ? 418  TYR A CD2   1 
ATOM   1696 C  CE1   . TYR D 4 178 ? 25.395  32.953  15.755  1.00 35.85 ? 418  TYR A CE1   1 
ATOM   1697 C  CE2   . TYR D 4 178 ? 23.763  34.020  17.162  1.00 35.42 ? 418  TYR A CE2   1 
ATOM   1698 C  CZ    . TYR D 4 178 ? 24.946  34.071  16.442  1.00 38.17 ? 418  TYR A CZ    1 
ATOM   1699 O  OH    . TYR D 4 178 ? 25.672  35.242  16.400  1.00 40.26 ? 418  TYR A OH    1 
ATOM   1700 N  N     . ARG D 4 179 ? 21.861  30.368  19.466  1.00 32.87 ? 419  ARG A N     1 
ATOM   1701 C  CA    . ARG D 4 179 ? 21.695  31.005  20.771  1.00 32.41 ? 419  ARG A CA    1 
ATOM   1702 C  C     . ARG D 4 179 ? 22.128  30.080  21.896  1.00 32.56 ? 419  ARG A C     1 
ATOM   1703 O  O     . ARG D 4 179 ? 22.469  30.539  22.982  1.00 33.36 ? 419  ARG A O     1 
ATOM   1704 C  CB    . ARG D 4 179 ? 20.239  31.442  20.981  1.00 32.55 ? 419  ARG A CB    1 
ATOM   1705 C  CG    . ARG D 4 179 ? 19.997  32.176  22.295  1.00 32.59 ? 419  ARG A CG    1 
ATOM   1706 C  CD    . ARG D 4 179 ? 18.615  32.824  22.346  1.00 32.15 ? 419  ARG A CD    1 
ATOM   1707 N  NE    . ARG D 4 179 ? 18.427  33.573  23.590  1.00 35.05 ? 419  ARG A NE    1 
ATOM   1708 C  CZ    . ARG D 4 179 ? 17.608  33.213  24.575  1.00 36.72 ? 419  ARG A CZ    1 
ATOM   1709 N  NH1   . ARG D 4 179 ? 16.877  32.105  24.477  1.00 35.26 ? 419  ARG A NH1   1 
ATOM   1710 N  NH2   . ARG D 4 179 ? 17.531  33.956  25.672  1.00 35.90 ? 419  ARG A NH2   1 
ATOM   1711 N  N     . ARG D 4 180 ? 22.117  28.775  21.644  1.00 31.96 ? 420  ARG A N     1 
ATOM   1712 C  CA    . ARG D 4 180 ? 22.543  27.830  22.667  1.00 31.33 ? 420  ARG A CA    1 
ATOM   1713 C  C     . ARG D 4 180 ? 24.071  27.790  22.710  1.00 32.19 ? 420  ARG A C     1 
ATOM   1714 O  O     . ARG D 4 180 ? 24.662  27.092  23.532  1.00 32.17 ? 420  ARG A O     1 
ATOM   1715 C  CB    . ARG D 4 180 ? 21.966  26.429  22.409  1.00 30.34 ? 420  ARG A CB    1 
ATOM   1716 C  CG    . ARG D 4 180 ? 20.432  26.362  22.513  1.00 29.31 ? 420  ARG A CG    1 
ATOM   1717 C  CD    . ARG D 4 180 ? 19.948  24.972  22.955  1.00 28.76 ? 420  ARG A CD    1 
ATOM   1718 N  NE    . ARG D 4 180 ? 20.430  23.904  22.079  1.00 27.37 ? 420  ARG A NE    1 
ATOM   1719 C  CZ    . ARG D 4 180 ? 20.007  23.693  20.834  1.00 29.76 ? 420  ARG A CZ    1 
ATOM   1720 N  NH1   . ARG D 4 180 ? 19.075  24.476  20.295  1.00 24.93 ? 420  ARG A NH1   1 
ATOM   1721 N  NH2   . ARG D 4 180 ? 20.532  22.705  20.116  1.00 28.37 ? 420  ARG A NH2   1 
ATOM   1722 N  N     . GLY D 4 181 ? 24.701  28.543  21.810  1.00 32.74 ? 421  GLY A N     1 
ATOM   1723 C  CA    . GLY D 4 181 ? 26.153  28.629  21.780  1.00 34.16 ? 421  GLY A CA    1 
ATOM   1724 C  C     . GLY D 4 181 ? 26.945  27.588  21.010  1.00 36.54 ? 421  GLY A C     1 
ATOM   1725 O  O     . GLY D 4 181 ? 28.149  27.463  21.219  1.00 36.86 ? 421  GLY A O     1 
ATOM   1726 N  N     . LYS D 4 182 ? 26.299  26.848  20.115  1.00 36.20 ? 422  LYS A N     1 
ATOM   1727 C  CA    . LYS D 4 182 ? 27.005  25.825  19.351  1.00 36.20 ? 422  LYS A CA    1 
ATOM   1728 C  C     . LYS D 4 182 ? 28.001  26.407  18.349  1.00 35.76 ? 422  LYS A C     1 
ATOM   1729 O  O     . LYS D 4 182 ? 27.824  27.521  17.846  1.00 35.97 ? 422  LYS A O     1 
ATOM   1730 C  CB    . LYS D 4 182 ? 25.997  24.925  18.636  1.00 37.57 ? 422  LYS A CB    1 
ATOM   1731 C  CG    . LYS D 4 182 ? 25.190  24.068  19.582  1.00 39.75 ? 422  LYS A CG    1 
ATOM   1732 C  CD    . LYS D 4 182 ? 26.105  23.118  20.332  1.00 46.25 ? 422  LYS A CD    1 
ATOM   1733 C  CE    . LYS D 4 182 ? 25.335  22.255  21.312  1.00 49.21 ? 422  LYS A CE    1 
ATOM   1734 N  NZ    . LYS D 4 182 ? 26.219  21.227  21.925  1.00 50.42 ? 422  LYS A NZ    1 
ATOM   1735 N  N     . ALA D 4 183 ? 29.055  25.646  18.066  1.00 35.15 ? 423  ALA A N     1 
ATOM   1736 C  CA    . ALA D 4 183 ? 30.085  26.089  17.129  1.00 34.80 ? 423  ALA A CA    1 
ATOM   1737 C  C     . ALA D 4 183 ? 29.582  26.091  15.687  1.00 33.12 ? 423  ALA A C     1 
ATOM   1738 O  O     . ALA D 4 183 ? 29.994  26.931  14.879  1.00 31.51 ? 423  ALA A O     1 
ATOM   1739 C  CB    . ALA D 4 183 ? 31.327  25.202  17.256  1.00 35.06 ? 423  ALA A CB    1 
ATOM   1740 N  N     . THR D 4 184 ? 28.702  25.142  15.365  1.00 31.57 ? 424  THR A N     1 
ATOM   1741 C  CA    . THR D 4 184 ? 28.138  25.053  14.021  1.00 30.54 ? 424  THR A CA    1 
ATOM   1742 C  C     . THR D 4 184 ? 26.621  24.995  14.105  1.00 30.69 ? 424  THR A C     1 
ATOM   1743 O  O     . THR D 4 184 ? 26.068  24.517  15.101  1.00 27.97 ? 424  THR A O     1 
ATOM   1744 C  CB    . THR D 4 184 ? 28.611  23.794  13.283  1.00 31.49 ? 424  THR A CB    1 
ATOM   1745 O  OG1   . THR D 4 184 ? 28.095  22.633  13.948  1.00 31.07 ? 424  THR A OG1   1 
ATOM   1746 C  CG2   . THR D 4 184 ? 30.137  23.738  13.247  1.00 30.29 ? 424  THR A CG2   1 
ATOM   1747 N  N     . CYS D 4 185 ? 25.962  25.468  13.047  1.00 29.41 ? 425  CYS A N     1 
ATOM   1748 C  CA    . CYS D 4 185 ? 24.500  25.487  12.973  1.00 28.95 ? 425  CYS A CA    1 
ATOM   1749 C  C     . CYS D 4 185 ? 23.970  24.778  11.730  1.00 27.78 ? 425  CYS A C     1 
ATOM   1750 O  O     . CYS D 4 185 ? 24.523  24.931  10.637  1.00 26.96 ? 425  CYS A O     1 
ATOM   1751 C  CB    . CYS D 4 185 ? 24.005  26.934  12.976  1.00 29.35 ? 425  CYS A CB    1 
ATOM   1752 S  SG    . CYS D 4 185 ? 24.549  27.858  14.425  1.00 34.95 ? 425  CYS A SG    1 
ATOM   1753 N  N     . GLY D 4 186 ? 22.894  24.010  11.910  1.00 29.28 ? 426  GLY A N     1 
ATOM   1754 C  CA    . GLY D 4 186 ? 22.283  23.284  10.805  1.00 29.16 ? 426  GLY A CA    1 
ATOM   1755 C  C     . GLY D 4 186 ? 21.567  24.252  9.885   1.00 30.68 ? 426  GLY A C     1 
ATOM   1756 O  O     . GLY D 4 186 ? 21.482  24.050  8.670   1.00 31.12 ? 426  GLY A O     1 
ATOM   1757 N  N     . ASP D 4 187 ? 21.034  25.311  10.480  1.00 30.79 ? 427  ASP A N     1 
ATOM   1758 C  CA    . ASP D 4 187 ? 20.346  26.354  9.733   1.00 32.08 ? 427  ASP A CA    1 
ATOM   1759 C  C     . ASP D 4 187 ? 20.294  27.589  10.620  1.00 31.87 ? 427  ASP A C     1 
ATOM   1760 O  O     . ASP D 4 187 ? 20.865  27.601  11.710  1.00 33.10 ? 427  ASP A O     1 
ATOM   1761 C  CB    . ASP D 4 187 ? 18.935  25.912  9.345   1.00 33.06 ? 427  ASP A CB    1 
ATOM   1762 C  CG    . ASP D 4 187 ? 17.998  25.825  10.526  1.00 35.40 ? 427  ASP A CG    1 
ATOM   1763 O  OD1   . ASP D 4 187 ? 18.418  26.129  11.665  1.00 37.52 ? 427  ASP A OD1   1 
ATOM   1764 O  OD2   . ASP D 4 187 ? 16.829  25.452  10.308  1.00 36.46 ? 427  ASP A OD2   1 
ATOM   1765 N  N     . VAL D 4 188 ? 19.611  28.626  10.164  1.00 30.43 ? 428  VAL A N     1 
ATOM   1766 C  CA    . VAL D 4 188 ? 19.529  29.844  10.949  1.00 30.61 ? 428  VAL A CA    1 
ATOM   1767 C  C     . VAL D 4 188 ? 18.087  30.123  11.329  1.00 29.21 ? 428  VAL A C     1 
ATOM   1768 O  O     . VAL D 4 188 ? 17.215  30.214  10.468  1.00 30.29 ? 428  VAL A O     1 
ATOM   1769 C  CB    . VAL D 4 188 ? 20.116  31.045  10.166  1.00 30.65 ? 428  VAL A CB    1 
ATOM   1770 C  CG1   . VAL D 4 188 ? 20.097  32.288  11.033  1.00 29.65 ? 428  VAL A CG1   1 
ATOM   1771 C  CG2   . VAL D 4 188 ? 21.546  30.725  9.729   1.00 29.54 ? 428  VAL A CG2   1 
ATOM   1772 N  N     . ASP D 4 189 ? 17.849  30.243  12.630  1.00 28.41 ? 429  ASP A N     1 
ATOM   1773 C  CA    . ASP D 4 189 ? 16.521  30.506  13.157  1.00 29.67 ? 429  ASP A CA    1 
ATOM   1774 C  C     . ASP D 4 189 ? 16.417  31.951  13.636  1.00 29.67 ? 429  ASP A C     1 
ATOM   1775 O  O     . ASP D 4 189 ? 16.961  32.317  14.672  1.00 27.84 ? 429  ASP A O     1 
ATOM   1776 C  CB    . ASP D 4 189 ? 16.246  29.530  14.295  1.00 29.92 ? 429  ASP A CB    1 
ATOM   1777 C  CG    . ASP D 4 189 ? 16.503  28.093  13.881  1.00 30.16 ? 429  ASP A CG    1 
ATOM   1778 O  OD1   . ASP D 4 189 ? 15.775  27.604  12.995  1.00 26.94 ? 429  ASP A OD1   1 
ATOM   1779 O  OD2   . ASP D 4 189 ? 17.434  27.464  14.424  1.00 28.34 ? 429  ASP A OD2   1 
ATOM   1780 N  N     . VAL D 4 190 ? 15.709  32.770  12.871  1.00 31.66 ? 430  VAL A N     1 
ATOM   1781 C  CA    . VAL D 4 190 ? 15.564  34.179  13.218  1.00 32.08 ? 430  VAL A CA    1 
ATOM   1782 C  C     . VAL D 4 190 ? 14.173  34.532  13.726  1.00 31.21 ? 430  VAL A C     1 
ATOM   1783 O  O     . VAL D 4 190 ? 13.184  34.380  13.013  1.00 29.72 ? 430  VAL A O     1 
ATOM   1784 C  CB    . VAL D 4 190 ? 15.889  35.086  11.999  1.00 32.11 ? 430  VAL A CB    1 
ATOM   1785 C  CG1   . VAL D 4 190 ? 15.749  36.556  12.382  1.00 30.86 ? 430  VAL A CG1   1 
ATOM   1786 C  CG2   . VAL D 4 190 ? 17.303  34.797  11.498  1.00 30.95 ? 430  VAL A CG2   1 
ATOM   1787 N  N     . LEU D 4 191 ? 14.108  34.989  14.970  1.00 32.00 ? 431  LEU A N     1 
ATOM   1788 C  CA    . LEU D 4 191 ? 12.850  35.404  15.576  1.00 32.04 ? 431  LEU A CA    1 
ATOM   1789 C  C     . LEU D 4 191 ? 12.752  36.921  15.411  1.00 34.21 ? 431  LEU A C     1 
ATOM   1790 O  O     . LEU D 4 191 ? 13.746  37.635  15.551  1.00 35.45 ? 431  LEU A O     1 
ATOM   1791 C  CB    . LEU D 4 191 ? 12.819  35.022  17.059  1.00 33.10 ? 431  LEU A CB    1 
ATOM   1792 C  CG    . LEU D 4 191 ? 11.685  35.553  17.956  1.00 34.75 ? 431  LEU A CG    1 
ATOM   1793 C  CD1   . LEU D 4 191 ? 10.335  35.177  17.394  1.00 35.94 ? 431  LEU A CD1   1 
ATOM   1794 C  CD2   . LEU D 4 191 ? 11.837  34.972  19.352  1.00 36.34 ? 431  LEU A CD2   1 
ATOM   1795 N  N     . ILE D 4 192 ? 11.561  37.405  15.086  1.00 34.64 ? 432  ILE A N     1 
ATOM   1796 C  CA    . ILE D 4 192 ? 11.345  38.829  14.902  1.00 35.76 ? 432  ILE A CA    1 
ATOM   1797 C  C     . ILE D 4 192 ? 10.073  39.262  15.609  1.00 37.63 ? 432  ILE A C     1 
ATOM   1798 O  O     . ILE D 4 192 ? 9.021   38.637  15.456  1.00 36.41 ? 432  ILE A O     1 
ATOM   1799 C  CB    . ILE D 4 192 ? 11.213  39.191  13.419  1.00 35.07 ? 432  ILE A CB    1 
ATOM   1800 C  CG1   . ILE D 4 192 ? 12.469  38.756  12.665  1.00 34.74 ? 432  ILE A CG1   1 
ATOM   1801 C  CG2   . ILE D 4 192 ? 11.000  40.690  13.267  1.00 35.26 ? 432  ILE A CG2   1 
ATOM   1802 C  CD1   . ILE D 4 192 ? 12.403  39.016  11.177  1.00 31.42 ? 432  ILE A CD1   1 
ATOM   1803 N  N     . THR D 4 193 ? 10.182  40.330  16.390  1.00 39.05 ? 433  THR A N     1 
ATOM   1804 C  CA    . THR D 4 193 ? 9.048   40.869  17.124  1.00 40.47 ? 433  THR A CA    1 
ATOM   1805 C  C     . THR D 4 193 ? 9.242   42.378  17.256  1.00 43.70 ? 433  THR A C     1 
ATOM   1806 O  O     . THR D 4 193 ? 10.261  42.912  16.813  1.00 44.63 ? 433  THR A O     1 
ATOM   1807 C  CB    . THR D 4 193 ? 8.941   40.224  18.523  1.00 39.12 ? 433  THR A CB    1 
ATOM   1808 O  OG1   . THR D 4 193 ? 7.696   40.594  19.127  1.00 39.97 ? 433  THR A OG1   1 
ATOM   1809 C  CG2   . THR D 4 193 ? 10.091  40.671  19.416  1.00 37.81 ? 433  THR A CG2   1 
ATOM   1810 N  N     . HIS D 4 194 ? 8.268   43.068  17.842  1.00 45.83 ? 434  HIS A N     1 
ATOM   1811 C  CA    . HIS D 4 194 ? 8.374   44.517  18.018  1.00 48.51 ? 434  HIS A CA    1 
ATOM   1812 C  C     . HIS D 4 194 ? 7.834   44.940  19.382  1.00 50.17 ? 434  HIS A C     1 
ATOM   1813 O  O     . HIS D 4 194 ? 6.726   44.566  19.764  1.00 50.38 ? 434  HIS A O     1 
ATOM   1814 C  CB    . HIS D 4 194 ? 7.607   45.251  16.919  1.00 49.63 ? 434  HIS A CB    1 
ATOM   1815 C  CG    . HIS D 4 194 ? 7.979   46.695  16.792  1.00 50.11 ? 434  HIS A CG    1 
ATOM   1816 N  ND1   . HIS D 4 194 ? 8.061   47.540  17.879  1.00 49.87 ? 434  HIS A ND1   1 
ATOM   1817 C  CD2   . HIS D 4 194 ? 8.305   47.441  15.709  1.00 48.50 ? 434  HIS A CD2   1 
ATOM   1818 C  CE1   . HIS D 4 194 ? 8.423   48.744  17.470  1.00 49.74 ? 434  HIS A CE1   1 
ATOM   1819 N  NE2   . HIS D 4 194 ? 8.577   48.710  16.158  1.00 48.49 ? 434  HIS A NE2   1 
ATOM   1820 N  N     . PRO D 4 195 ? 8.619   45.724  20.136  1.00 52.63 ? 435  PRO A N     1 
ATOM   1821 C  CA    . PRO D 4 195 ? 8.258   46.219  21.470  1.00 54.20 ? 435  PRO A CA    1 
ATOM   1822 C  C     . PRO D 4 195 ? 6.961   47.025  21.569  1.00 55.29 ? 435  PRO A C     1 
ATOM   1823 O  O     . PRO D 4 195 ? 6.422   47.184  22.663  1.00 56.18 ? 435  PRO A O     1 
ATOM   1824 C  CB    . PRO D 4 195 ? 9.479   47.039  21.870  1.00 54.19 ? 435  PRO A CB    1 
ATOM   1825 C  CG    . PRO D 4 195 ? 10.594  46.289  21.218  1.00 55.04 ? 435  PRO A CG    1 
ATOM   1826 C  CD    . PRO D 4 195 ? 10.026  46.043  19.837  1.00 53.38 ? 435  PRO A CD    1 
ATOM   1827 N  N     . ASP D 4 196 ? 6.457   47.540  20.450  1.00 56.71 ? 436  ASP A N     1 
ATOM   1828 C  CA    . ASP D 4 196 ? 5.213   48.306  20.508  1.00 58.92 ? 436  ASP A CA    1 
ATOM   1829 C  C     . ASP D 4 196 ? 4.003   47.377  20.410  1.00 59.63 ? 436  ASP A C     1 
ATOM   1830 O  O     . ASP D 4 196 ? 2.857   47.825  20.436  1.00 60.01 ? 436  ASP A O     1 
ATOM   1831 C  CB    . ASP D 4 196 ? 5.156   49.371  19.399  1.00 59.11 ? 436  ASP A CB    1 
ATOM   1832 C  CG    . ASP D 4 196 ? 4.998   48.779  18.012  1.00 60.47 ? 436  ASP A CG    1 
ATOM   1833 O  OD1   . ASP D 4 196 ? 4.214   47.822  17.843  1.00 60.05 ? 436  ASP A OD1   1 
ATOM   1834 O  OD2   . ASP D 4 196 ? 5.646   49.290  17.077  1.00 61.47 ? 436  ASP A OD2   1 
ATOM   1835 N  N     . GLY D 4 197 ? 4.249   46.073  20.319  1.00 59.75 ? 437  GLY A N     1 
ATOM   1836 C  CA    . GLY D 4 197 ? 3.156   45.118  20.242  1.00 59.45 ? 437  GLY A CA    1 
ATOM   1837 C  C     . GLY D 4 197 ? 2.216   45.143  19.041  1.00 59.63 ? 437  GLY A C     1 
ATOM   1838 O  O     . GLY D 4 197 ? 1.184   44.471  19.082  1.00 60.38 ? 437  GLY A O     1 
ATOM   1839 N  N     . ARG D 4 198 ? 2.552   45.865  17.972  1.00 59.16 ? 438  ARG A N     1 
ATOM   1840 C  CA    . ARG D 4 198 ? 1.660   45.909  16.810  1.00 58.80 ? 438  ARG A CA    1 
ATOM   1841 C  C     . ARG D 4 198 ? 2.309   46.074  15.426  1.00 58.86 ? 438  ARG A C     1 
ATOM   1842 O  O     . ARG D 4 198 ? 1.752   45.637  14.414  1.00 56.85 ? 438  ARG A O     1 
ATOM   1843 C  CB    . ARG D 4 198 ? 0.626   47.030  17.007  1.00 58.74 ? 438  ARG A CB    1 
ATOM   1844 N  N     . SER D 4 199 ? 3.489   46.676  15.382  1.00 59.64 ? 439  SER A N     1 
ATOM   1845 C  CA    . SER D 4 199 ? 4.130   46.975  14.107  1.00 60.47 ? 439  SER A CA    1 
ATOM   1846 C  C     . SER D 4 199 ? 4.703   45.694  13.509  1.00 61.84 ? 439  SER A C     1 
ATOM   1847 O  O     . SER D 4 199 ? 5.277   45.717  12.420  1.00 62.30 ? 439  SER A O     1 
ATOM   1848 C  CB    . SER D 4 199 ? 5.240   48.007  14.275  1.00 59.87 ? 439  SER A CB    1 
ATOM   1849 O  OG    . SER D 4 199 ? 4.706   49.235  14.738  1.00 61.37 ? 439  SER A OG    1 
ATOM   1850 N  N     . HIS D 4 200 ? 4.542   44.579  14.214  1.00 62.95 ? 440  HIS A N     1 
ATOM   1851 C  CA    . HIS D 4 200 ? 5.053   43.297  13.738  1.00 64.40 ? 440  HIS A CA    1 
ATOM   1852 C  C     . HIS D 4 200 ? 4.084   42.612  12.779  1.00 64.67 ? 440  HIS A C     1 
ATOM   1853 O  O     . HIS D 4 200 ? 4.323   41.480  12.360  1.00 65.28 ? 440  HIS A O     1 
ATOM   1854 C  CB    . HIS D 4 200 ? 5.312   42.355  14.913  1.00 65.52 ? 440  HIS A CB    1 
ATOM   1855 C  CG    . HIS D 4 200 ? 4.063   41.882  15.588  1.00 66.72 ? 440  HIS A CG    1 
ATOM   1856 N  ND1   . HIS D 4 200 ? 3.298   42.697  16.395  1.00 67.12 ? 440  HIS A ND1   1 
ATOM   1857 C  CD2   . HIS D 4 200 ? 3.425   40.689  15.546  1.00 66.88 ? 440  HIS A CD2   1 
ATOM   1858 C  CE1   . HIS D 4 200 ? 2.244   42.026  16.822  1.00 67.52 ? 440  HIS A CE1   1 
ATOM   1859 N  NE2   . HIS D 4 200 ? 2.297   40.804  16.321  1.00 67.87 ? 440  HIS A NE2   1 
ATOM   1860 N  N     . ARG D 4 201 ? 3.014   43.313  12.395  1.00 63.76 ? 441  ARG A N     1 
ATOM   1861 C  CA    . ARG D 4 201 ? 2.006   42.704  11.535  1.00 63.53 ? 441  ARG A CA    1 
ATOM   1862 C  C     . ARG D 4 201 ? 2.214   43.101  10.077  1.00 63.06 ? 441  ARG A C     1 
ATOM   1863 O  O     . ARG D 4 201 ? 2.470   44.221  9.726   1.00 63.20 ? 441  ARG A O     1 
ATOM   1864 C  CB    . ARG D 4 201 ? 0.610   43.091  11.998  1.00 63.41 ? 441  ARG A CB    1 
ATOM   1865 N  N     . GLY D 4 202 ? 1.984   42.078  9.203   1.00 61.89 ? 442  GLY A N     1 
ATOM   1866 C  CA    . GLY D 4 202 ? 2.103   42.280  7.771   1.00 60.55 ? 442  GLY A CA    1 
ATOM   1867 C  C     . GLY D 4 202 ? 3.490   42.662  7.293   1.00 59.68 ? 442  GLY A C     1 
ATOM   1868 O  O     . GLY D 4 202 ? 3.626   43.397  6.317   1.00 61.45 ? 442  GLY A O     1 
ATOM   1869 N  N     . ILE D 4 203 ? 4.525   42.166  7.963   1.00 57.01 ? 443  ILE A N     1 
ATOM   1870 C  CA    . ILE D 4 203 ? 5.888   42.490  7.564   1.00 54.68 ? 443  ILE A CA    1 
ATOM   1871 C  C     . ILE D 4 203 ? 6.506   41.437  6.644   1.00 53.58 ? 443  ILE A C     1 
ATOM   1872 O  O     . ILE D 4 203 ? 7.350   41.765  5.810   1.00 54.51 ? 443  ILE A O     1 
ATOM   1873 C  CB    . ILE D 4 203 ? 6.806   42.664  8.787   1.00 54.91 ? 443  ILE A CB    1 
ATOM   1874 C  CG1   . ILE D 4 203 ? 6.915   41.340  9.547   1.00 53.91 ? 443  ILE A CG1   1 
ATOM   1875 C  CG2   . ILE D 4 203 ? 6.261   43.763  9.691   1.00 54.44 ? 443  ILE A CG2   1 
ATOM   1876 C  CD1   . ILE D 4 203 ? 7.872   41.386  10.713  1.00 53.26 ? 443  ILE A CD1   1 
ATOM   1877 N  N     . PHE D 4 204 ? 6.095   40.178  6.793   1.00 50.94 ? 444  PHE A N     1 
ATOM   1878 C  CA    . PHE D 4 204 ? 6.637   39.111  5.952   1.00 48.49 ? 444  PHE A CA    1 
ATOM   1879 C  C     . PHE D 4 204 ? 6.644   39.538  4.495   1.00 47.66 ? 444  PHE A C     1 
ATOM   1880 O  O     . PHE D 4 204 ? 7.591   39.264  3.757   1.00 47.14 ? 444  PHE A O     1 
ATOM   1881 C  CB    . PHE D 4 204 ? 5.822   37.821  6.092   1.00 46.40 ? 444  PHE A CB    1 
ATOM   1882 C  CG    . PHE D 4 204 ? 6.354   36.877  7.133   1.00 44.19 ? 444  PHE A CG    1 
ATOM   1883 C  CD1   . PHE D 4 204 ? 5.653   36.654  8.315   1.00 43.49 ? 444  PHE A CD1   1 
ATOM   1884 C  CD2   . PHE D 4 204 ? 7.550   36.198  6.926   1.00 42.51 ? 444  PHE A CD2   1 
ATOM   1885 C  CE1   . PHE D 4 204 ? 6.137   35.762  9.276   1.00 43.62 ? 444  PHE A CE1   1 
ATOM   1886 C  CE2   . PHE D 4 204 ? 8.041   35.306  7.881   1.00 42.08 ? 444  PHE A CE2   1 
ATOM   1887 C  CZ    . PHE D 4 204 ? 7.334   35.087  9.056   1.00 40.60 ? 444  PHE A CZ    1 
ATOM   1888 N  N     . SER D 4 205 ? 5.578   40.211  4.087   1.00 47.54 ? 445  SER A N     1 
ATOM   1889 C  CA    . SER D 4 205 ? 5.461   40.683  2.718   1.00 47.37 ? 445  SER A CA    1 
ATOM   1890 C  C     . SER D 4 205 ? 6.637   41.595  2.376   1.00 46.45 ? 445  SER A C     1 
ATOM   1891 O  O     . SER D 4 205 ? 7.303   41.412  1.355   1.00 46.93 ? 445  SER A O     1 
ATOM   1892 C  CB    . SER D 4 205 ? 4.147   41.445  2.544   1.00 47.48 ? 445  SER A CB    1 
ATOM   1893 O  OG    . SER D 4 205 ? 4.060   42.513  3.470   1.00 50.68 ? 445  SER A OG    1 
ATOM   1894 N  N     . ARG D 4 206 ? 6.895   42.566  3.247   1.00 44.95 ? 446  ARG A N     1 
ATOM   1895 C  CA    . ARG D 4 206 ? 7.973   43.525  3.034   1.00 44.53 ? 446  ARG A CA    1 
ATOM   1896 C  C     . ARG D 4 206 ? 9.368   42.914  3.160   1.00 42.98 ? 446  ARG A C     1 
ATOM   1897 O  O     . ARG D 4 206 ? 10.225  43.136  2.306   1.00 42.23 ? 446  ARG A O     1 
ATOM   1898 C  CB    . ARG D 4 206 ? 7.822   44.696  4.004   1.00 43.95 ? 446  ARG A CB    1 
ATOM   1899 N  N     . LEU D 4 207 ? 9.589   42.142  4.220   1.00 42.37 ? 447  LEU A N     1 
ATOM   1900 C  CA    . LEU D 4 207 ? 10.884  41.507  4.460   1.00 40.30 ? 447  LEU A CA    1 
ATOM   1901 C  C     . LEU D 4 207 ? 11.312  40.531  3.363   1.00 39.07 ? 447  LEU A C     1 
ATOM   1902 O  O     . LEU D 4 207 ? 12.400  40.662  2.797   1.00 39.26 ? 447  LEU A O     1 
ATOM   1903 C  CB    . LEU D 4 207 ? 10.862  40.768  5.797   1.00 40.69 ? 447  LEU A CB    1 
ATOM   1904 C  CG    . LEU D 4 207 ? 12.166  40.061  6.169   1.00 39.78 ? 447  LEU A CG    1 
ATOM   1905 C  CD1   . LEU D 4 207 ? 13.240  41.097  6.475   1.00 40.00 ? 447  LEU A CD1   1 
ATOM   1906 C  CD2   . LEU D 4 207 ? 11.937  39.158  7.364   1.00 38.97 ? 447  LEU A CD2   1 
ATOM   1907 N  N     . LEU D 4 208 ? 10.462  39.550  3.072   1.00 37.29 ? 448  LEU A N     1 
ATOM   1908 C  CA    . LEU D 4 208 ? 10.772  38.552  2.051   1.00 38.41 ? 448  LEU A CA    1 
ATOM   1909 C  C     . LEU D 4 208 ? 10.989  39.213  0.704   1.00 39.83 ? 448  LEU A C     1 
ATOM   1910 O  O     . LEU D 4 208 ? 11.847  38.797  -0.073  1.00 39.57 ? 448  LEU A O     1 
ATOM   1911 C  CB    . LEU D 4 208 ? 9.644   37.530  1.946   1.00 34.90 ? 448  LEU A CB    1 
ATOM   1912 C  CG    . LEU D 4 208 ? 9.356   36.797  3.258   1.00 33.48 ? 448  LEU A CG    1 
ATOM   1913 C  CD1   . LEU D 4 208 ? 8.160   35.873  3.070   1.00 31.78 ? 448  LEU A CD1   1 
ATOM   1914 C  CD2   . LEU D 4 208 ? 10.593  36.017  3.692   1.00 30.37 ? 448  LEU A CD2   1 
ATOM   1915 N  N     . ASP D 4 209 ? 10.197  40.241  0.429   1.00 42.07 ? 449  ASP A N     1 
ATOM   1916 C  CA    . ASP D 4 209 ? 10.315  40.980  -0.817  1.00 43.24 ? 449  ASP A CA    1 
ATOM   1917 C  C     . ASP D 4 209 ? 11.702  41.610  -0.879  1.00 41.74 ? 449  ASP A C     1 
ATOM   1918 O  O     . ASP D 4 209 ? 12.395  41.530  -1.892  1.00 43.02 ? 449  ASP A O     1 
ATOM   1919 C  CB    . ASP D 4 209 ? 9.253   42.076  -0.876  1.00 47.42 ? 449  ASP A CB    1 
ATOM   1920 C  CG    . ASP D 4 209 ? 9.490   43.050  -2.009  1.00 51.67 ? 449  ASP A CG    1 
ATOM   1921 O  OD1   . ASP D 4 209 ? 9.399   42.622  -3.179  1.00 53.18 ? 449  ASP A OD1   1 
ATOM   1922 O  OD2   . ASP D 4 209 ? 9.776   44.240  -1.727  1.00 54.94 ? 449  ASP A OD2   1 
ATOM   1923 N  N     . SER D 4 210 ? 12.103  42.231  0.223   1.00 40.27 ? 450  SER A N     1 
ATOM   1924 C  CA    . SER D 4 210 ? 13.403  42.873  0.298   1.00 39.53 ? 450  SER A CA    1 
ATOM   1925 C  C     . SER D 4 210 ? 14.540  41.866  0.163   1.00 39.99 ? 450  SER A C     1 
ATOM   1926 O  O     . SER D 4 210 ? 15.523  42.116  -0.537  1.00 40.60 ? 450  SER A O     1 
ATOM   1927 C  CB    . SER D 4 210 ? 13.542  43.620  1.622   1.00 39.63 ? 450  SER A CB    1 
ATOM   1928 O  OG    . SER D 4 210 ? 14.809  44.248  1.702   1.00 41.43 ? 450  SER A OG    1 
ATOM   1929 N  N     . LEU D 4 211 ? 14.409  40.724  0.833   1.00 38.83 ? 451  LEU A N     1 
ATOM   1930 C  CA    . LEU D 4 211 ? 15.454  39.708  0.774   1.00 36.64 ? 451  LEU A CA    1 
ATOM   1931 C  C     . LEU D 4 211 ? 15.554  39.067  -0.610  1.00 36.76 ? 451  LEU A C     1 
ATOM   1932 O  O     . LEU D 4 211 ? 16.596  38.531  -0.981  1.00 36.66 ? 451  LEU A O     1 
ATOM   1933 C  CB    . LEU D 4 211 ? 15.222  38.646  1.854   1.00 33.86 ? 451  LEU A CB    1 
ATOM   1934 C  CG    . LEU D 4 211 ? 15.391  39.160  3.288   1.00 32.02 ? 451  LEU A CG    1 
ATOM   1935 C  CD1   . LEU D 4 211 ? 15.081  38.052  4.272   1.00 32.53 ? 451  LEU A CD1   1 
ATOM   1936 C  CD2   . LEU D 4 211 ? 16.811  39.670  3.495   1.00 32.10 ? 451  LEU A CD2   1 
ATOM   1937 N  N     . ARG D 4 212 ? 14.474  39.132  -1.378  1.00 37.55 ? 452  ARG A N     1 
ATOM   1938 C  CA    . ARG D 4 212 ? 14.482  38.570  -2.720  1.00 38.48 ? 452  ARG A CA    1 
ATOM   1939 C  C     . ARG D 4 212 ? 15.087  39.582  -3.684  1.00 40.07 ? 452  ARG A C     1 
ATOM   1940 O  O     . ARG D 4 212 ? 15.783  39.213  -4.631  1.00 39.95 ? 452  ARG A O     1 
ATOM   1941 C  CB    . ARG D 4 212 ? 13.064  38.225  -3.160  1.00 38.46 ? 452  ARG A CB    1 
ATOM   1942 C  CG    . ARG D 4 212 ? 12.482  37.034  -2.439  1.00 38.57 ? 452  ARG A CG    1 
ATOM   1943 C  CD    . ARG D 4 212 ? 11.018  36.874  -2.752  1.00 38.92 ? 452  ARG A CD    1 
ATOM   1944 N  NE    . ARG D 4 212 ? 10.470  35.678  -2.127  1.00 38.93 ? 452  ARG A NE    1 
ATOM   1945 C  CZ    . ARG D 4 212 ? 9.269   35.618  -1.567  1.00 37.84 ? 452  ARG A CZ    1 
ATOM   1946 N  NH1   . ARG D 4 212 ? 8.489   36.691  -1.551  1.00 36.86 ? 452  ARG A NH1   1 
ATOM   1947 N  NH2   . ARG D 4 212 ? 8.847   34.484  -1.029  1.00 37.54 ? 452  ARG A NH2   1 
ATOM   1948 N  N     . GLN D 4 213 ? 14.816  40.859  -3.436  1.00 41.90 ? 453  GLN A N     1 
ATOM   1949 C  CA    . GLN D 4 213 ? 15.339  41.926  -4.279  1.00 43.04 ? 453  GLN A CA    1 
ATOM   1950 C  C     . GLN D 4 213 ? 16.859  41.833  -4.312  1.00 43.37 ? 453  GLN A C     1 
ATOM   1951 O  O     . GLN D 4 213 ? 17.465  41.936  -5.378  1.00 44.33 ? 453  GLN A O     1 
ATOM   1952 C  CB    . GLN D 4 213 ? 14.899  43.293  -3.747  1.00 44.43 ? 453  GLN A CB    1 
ATOM   1953 N  N     . GLU D 4 214 ? 17.479  41.631  -3.151  1.00 43.20 ? 454  GLU A N     1 
ATOM   1954 C  CA    . GLU D 4 214 ? 18.931  41.515  -3.112  1.00 43.76 ? 454  GLU A CA    1 
ATOM   1955 C  C     . GLU D 4 214 ? 19.418  40.112  -3.484  1.00 42.65 ? 454  GLU A C     1 
ATOM   1956 O  O     . GLU D 4 214 ? 20.608  39.821  -3.398  1.00 43.08 ? 454  GLU A O     1 
ATOM   1957 C  CB    . GLU D 4 214 ? 19.485  41.931  -1.738  1.00 45.25 ? 454  GLU A CB    1 
ATOM   1958 C  CG    . GLU D 4 214 ? 19.020  41.121  -0.538  1.00 48.89 ? 454  GLU A CG    1 
ATOM   1959 C  CD    . GLU D 4 214 ? 19.729  41.542  0.748   1.00 50.97 ? 454  GLU A CD    1 
ATOM   1960 O  OE1   . GLU D 4 214 ? 20.963  41.359  0.834   1.00 52.89 ? 454  GLU A OE1   1 
ATOM   1961 O  OE2   . GLU D 4 214 ? 19.061  42.063  1.671   1.00 51.97 ? 454  GLU A OE2   1 
ATOM   1962 N  N     . GLY D 4 215 ? 18.495  39.254  -3.912  1.00 41.57 ? 455  GLY A N     1 
ATOM   1963 C  CA    . GLY D 4 215 ? 18.850  37.900  -4.307  1.00 39.90 ? 455  GLY A CA    1 
ATOM   1964 C  C     . GLY D 4 215 ? 19.365  36.999  -3.194  1.00 38.47 ? 455  GLY A C     1 
ATOM   1965 O  O     . GLY D 4 215 ? 20.015  35.990  -3.456  1.00 39.32 ? 455  GLY A O     1 
ATOM   1966 N  N     . PHE D 4 216 ? 19.072  37.352  -1.951  1.00 35.41 ? 456  PHE A N     1 
ATOM   1967 C  CA    . PHE D 4 216 ? 19.523  36.559  -0.816  1.00 33.72 ? 456  PHE A CA    1 
ATOM   1968 C  C     . PHE D 4 216 ? 18.756  35.238  -0.677  1.00 33.41 ? 456  PHE A C     1 
ATOM   1969 O  O     . PHE D 4 216 ? 19.352  34.204  -0.373  1.00 30.97 ? 456  PHE A O     1 
ATOM   1970 C  CB    . PHE D 4 216 ? 19.391  37.377  0.467   1.00 29.93 ? 456  PHE A CB    1 
ATOM   1971 C  CG    . PHE D 4 216 ? 19.842  36.652  1.693   1.00 29.02 ? 456  PHE A CG    1 
ATOM   1972 C  CD1   . PHE D 4 216 ? 21.136  36.153  1.785   1.00 28.03 ? 456  PHE A CD1   1 
ATOM   1973 C  CD2   . PHE D 4 216 ? 18.972  36.468  2.763   1.00 28.00 ? 456  PHE A CD2   1 
ATOM   1974 C  CE1   . PHE D 4 216 ? 21.555  35.482  2.931   1.00 29.53 ? 456  PHE A CE1   1 
ATOM   1975 C  CE2   . PHE D 4 216 ? 19.381  35.800  3.910   1.00 27.36 ? 456  PHE A CE2   1 
ATOM   1976 C  CZ    . PHE D 4 216 ? 20.672  35.306  3.998   1.00 28.49 ? 456  PHE A CZ    1 
ATOM   1977 N  N     . LEU D 4 217 ? 17.440  35.278  -0.887  1.00 31.60 ? 457  LEU A N     1 
ATOM   1978 C  CA    . LEU D 4 217 ? 16.615  34.072  -0.792  1.00 32.12 ? 457  LEU A CA    1 
ATOM   1979 C  C     . LEU D 4 217 ? 16.655  33.377  -2.139  1.00 32.17 ? 457  LEU A C     1 
ATOM   1980 O  O     . LEU D 4 217 ? 16.511  34.026  -3.174  1.00 32.21 ? 457  LEU A O     1 
ATOM   1981 C  CB    . LEU D 4 217 ? 15.165  34.416  -0.444  1.00 31.06 ? 457  LEU A CB    1 
ATOM   1982 C  CG    . LEU D 4 217 ? 14.913  35.104  0.900   1.00 32.85 ? 457  LEU A CG    1 
ATOM   1983 C  CD1   . LEU D 4 217 ? 13.415  35.269  1.123   1.00 32.66 ? 457  LEU A CD1   1 
ATOM   1984 C  CD2   . LEU D 4 217 ? 15.524  34.283  2.015   1.00 29.83 ? 457  LEU A CD2   1 
ATOM   1985 N  N     . THR D 4 218 ? 16.842  32.059  -2.130  1.00 30.30 ? 458  THR A N     1 
ATOM   1986 C  CA    . THR D 4 218 ? 16.918  31.316  -3.383  1.00 28.06 ? 458  THR A CA    1 
ATOM   1987 C  C     . THR D 4 218 ? 15.749  30.359  -3.601  1.00 28.97 ? 458  THR A C     1 
ATOM   1988 O  O     . THR D 4 218 ? 15.394  30.054  -4.741  1.00 29.18 ? 458  THR A O     1 
ATOM   1989 C  CB    . THR D 4 218 ? 18.248  30.530  -3.464  1.00 28.76 ? 458  THR A CB    1 
ATOM   1990 O  OG1   . THR D 4 218 ? 18.285  29.534  -2.434  1.00 29.65 ? 458  THR A OG1   1 
ATOM   1991 C  CG2   . THR D 4 218 ? 19.436  31.475  -3.268  1.00 27.18 ? 458  THR A CG2   1 
ATOM   1992 N  N     . ASP D 4 219 ? 15.150  29.882  -2.513  1.00 28.75 ? 459  ASP A N     1 
ATOM   1993 C  CA    . ASP D 4 219 ? 14.022  28.954  -2.613  1.00 28.58 ? 459  ASP A CA    1 
ATOM   1994 C  C     . ASP D 4 219 ? 13.100  29.078  -1.407  1.00 28.22 ? 459  ASP A C     1 
ATOM   1995 O  O     . ASP D 4 219 ? 13.552  29.365  -0.301  1.00 27.10 ? 459  ASP A O     1 
ATOM   1996 C  CB    . ASP D 4 219 ? 14.510  27.499  -2.676  1.00 30.41 ? 459  ASP A CB    1 
ATOM   1997 C  CG    . ASP D 4 219 ? 15.577  27.274  -3.726  1.00 32.09 ? 459  ASP A CG    1 
ATOM   1998 O  OD1   . ASP D 4 219 ? 16.758  27.602  -3.463  1.00 31.13 ? 459  ASP A OD1   1 
ATOM   1999 O  OD2   . ASP D 4 219 ? 15.229  26.769  -4.816  1.00 30.49 ? 459  ASP A OD2   1 
ATOM   2000 N  N     . ASP D 4 220 ? 11.810  28.839  -1.619  1.00 28.33 ? 460  ASP A N     1 
ATOM   2001 C  CA    . ASP D 4 220 ? 10.842  28.893  -0.528  1.00 28.16 ? 460  ASP A CA    1 
ATOM   2002 C  C     . ASP D 4 220 ? 10.275  27.497  -0.304  1.00 28.33 ? 460  ASP A C     1 
ATOM   2003 O  O     . ASP D 4 220 ? 9.836   26.835  -1.247  1.00 27.21 ? 460  ASP A O     1 
ATOM   2004 C  CB    . ASP D 4 220 ? 9.695   29.854  -0.855  1.00 28.38 ? 460  ASP A CB    1 
ATOM   2005 C  CG    . ASP D 4 220 ? 10.188  31.235  -1.253  1.00 30.26 ? 460  ASP A CG    1 
ATOM   2006 O  OD1   . ASP D 4 220 ? 11.197  31.693  -0.679  1.00 28.91 ? 460  ASP A OD1   1 
ATOM   2007 O  OD2   . ASP D 4 220 ? 9.557   31.863  -2.129  1.00 30.54 ? 460  ASP A OD2   1 
ATOM   2008 N  N     . LEU D 4 221 ? 10.293  27.050  0.947   1.00 28.14 ? 461  LEU A N     1 
ATOM   2009 C  CA    . LEU D 4 221 ? 9.774   25.732  1.288   1.00 26.42 ? 461  LEU A CA    1 
ATOM   2010 C  C     . LEU D 4 221 ? 8.382   25.861  1.896   1.00 25.88 ? 461  LEU A C     1 
ATOM   2011 O  O     . LEU D 4 221 ? 7.455   25.126  1.539   1.00 23.65 ? 461  LEU A O     1 
ATOM   2012 C  CB    . LEU D 4 221 ? 10.717  25.044  2.275   1.00 22.85 ? 461  LEU A CB    1 
ATOM   2013 C  CG    . LEU D 4 221 ? 12.115  24.730  1.744   1.00 24.24 ? 461  LEU A CG    1 
ATOM   2014 C  CD1   . LEU D 4 221 ? 13.026  24.362  2.907   1.00 25.12 ? 461  LEU A CD1   1 
ATOM   2015 C  CD2   . LEU D 4 221 ? 12.043  23.598  0.729   1.00 22.30 ? 461  LEU A CD2   1 
ATOM   2016 N  N     . VAL D 4 222 ? 8.252   26.802  2.823   1.00 24.91 ? 462  VAL A N     1 
ATOM   2017 C  CA    . VAL D 4 222 ? 6.988   27.052  3.502   1.00 27.44 ? 462  VAL A CA    1 
ATOM   2018 C  C     . VAL D 4 222 ? 6.819   28.549  3.668   1.00 28.96 ? 462  VAL A C     1 
ATOM   2019 O  O     . VAL D 4 222 ? 7.561   29.187  4.412   1.00 31.36 ? 462  VAL A O     1 
ATOM   2020 C  CB    . VAL D 4 222 ? 6.956   26.386  4.892   1.00 25.66 ? 462  VAL A CB    1 
ATOM   2021 C  CG1   . VAL D 4 222 ? 5.686   26.787  5.633   1.00 23.93 ? 462  VAL A CG1   1 
ATOM   2022 C  CG2   . VAL D 4 222 ? 7.036   24.877  4.740   1.00 22.00 ? 462  VAL A CG2   1 
ATOM   2023 N  N     . SER D 4 223 ? 5.881   29.156  2.933   1.00 32.16 ? 463  SER A N     1 
ATOM   2024 C  CA    . SER D 4 223 ? 5.652   30.622  2.986   1.00 34.35 ? 463  SER A CA    1 
ATOM   2025 C  C     . SER D 4 223 ? 4.216   30.881  2.469   1.00 35.46 ? 463  SER A C     1 
ATOM   2026 O  O     . SER D 4 223 ? 3.987   30.971  1.266   1.00 34.13 ? 463  SER A O     1 
ATOM   2027 C  CB    . SER D 4 223 ? 6.682   31.330  2.115   1.00 34.31 ? 463  SER A CB    1 
ATOM   2028 O  OG    . SER D 4 223 ? 6.789   32.689  2.486   1.00 33.69 ? 463  SER A OG    1 
ATOM   2029 N  N     . GLN D 4 224 ? 3.307   31.121  3.405   1.00 36.93 ? 464  GLN A N     1 
ATOM   2030 C  CA    . GLN D 4 224 ? 1.872   31.147  3.167   1.00 37.06 ? 464  GLN A CA    1 
ATOM   2031 C  C     . GLN D 4 224 ? 1.715   32.671  3.118   1.00 37.63 ? 464  GLN A C     1 
ATOM   2032 O  O     . GLN D 4 224 ? 1.245   33.288  4.073   1.00 36.71 ? 464  GLN A O     1 
ATOM   2033 C  CB    . GLN D 4 224 ? 1.009   30.539  4.269   1.00 38.92 ? 464  GLN A CB    1 
ATOM   2034 C  CG    . GLN D 4 224 ? -0.487  30.688  4.112   1.00 42.71 ? 464  GLN A CG    1 
ATOM   2035 C  CD    . GLN D 4 224 ? -1.233  29.926  5.198   1.00 47.09 ? 464  GLN A CD    1 
ATOM   2036 O  OE1   . GLN D 4 224 ? -1.556  30.478  6.257   1.00 47.98 ? 464  GLN A OE1   1 
ATOM   2037 N  NE2   . GLN D 4 224 ? -1.537  28.657  4.928   1.00 45.42 ? 464  GLN A NE2   1 
ATOM   2038 N  N     . GLU D 4 225 ? 2.115   33.267  1.995   1.00 38.38 ? 465  GLU A N     1 
ATOM   2039 C  CA    . GLU D 4 225 ? 2.059   34.715  1.819   1.00 41.38 ? 465  GLU A CA    1 
ATOM   2040 C  C     . GLU D 4 225 ? 0.715   35.294  1.369   1.00 44.33 ? 465  GLU A C     1 
ATOM   2041 O  O     . GLU D 4 225 ? 0.562   36.512  1.294   1.00 42.94 ? 465  GLU A O     1 
ATOM   2042 C  CB    . GLU D 4 225 ? 3.165   35.153  0.853   1.00 40.09 ? 465  GLU A CB    1 
ATOM   2043 C  CG    . GLU D 4 225 ? 4.563   34.995  1.438   1.00 42.39 ? 465  GLU A CG    1 
ATOM   2044 C  CD    . GLU D 4 225 ? 5.665   35.068  0.396   1.00 44.16 ? 465  GLU A CD    1 
ATOM   2045 O  OE1   . GLU D 4 225 ? 5.820   36.137  -0.240  1.00 42.68 ? 465  GLU A OE1   1 
ATOM   2046 O  OE2   . GLU D 4 225 ? 6.375   34.048  0.217   1.00 42.00 ? 465  GLU A OE2   1 
ATOM   2047 N  N     . GLU D 4 226 ? -0.255  34.437  1.061   1.00 47.58 ? 466  GLU A N     1 
ATOM   2048 C  CA    . GLU D 4 226 ? -1.570  34.928  0.657   1.00 52.27 ? 466  GLU A CA    1 
ATOM   2049 C  C     . GLU D 4 226 ? -2.360  35.245  1.925   1.00 53.86 ? 466  GLU A C     1 
ATOM   2050 O  O     . GLU D 4 226 ? -3.382  35.934  1.892   1.00 55.16 ? 466  GLU A O     1 
ATOM   2051 C  CB    . GLU D 4 226 ? -2.317  33.883  -0.180  1.00 54.19 ? 466  GLU A CB    1 
ATOM   2052 C  CG    . GLU D 4 226 ? -2.389  32.507  0.448   1.00 57.72 ? 466  GLU A CG    1 
ATOM   2053 C  CD    . GLU D 4 226 ? -1.122  31.706  0.231   1.00 60.09 ? 466  GLU A CD    1 
ATOM   2054 O  OE1   . GLU D 4 226 ? -0.976  30.650  0.879   1.00 63.04 ? 466  GLU A OE1   1 
ATOM   2055 O  OE2   . GLU D 4 226 ? -0.277  32.124  -0.593  1.00 61.82 ? 466  GLU A OE2   1 
ATOM   2056 N  N     . ASN D 4 227 ? -1.862  34.734  3.045   1.00 55.17 ? 467  ASN A N     1 
ATOM   2057 C  CA    . ASN D 4 227 ? -2.476  34.949  4.347   1.00 55.32 ? 467  ASN A CA    1 
ATOM   2058 C  C     . ASN D 4 227 ? -1.691  36.031  5.088   1.00 54.90 ? 467  ASN A C     1 
ATOM   2059 O  O     . ASN D 4 227 ? -0.463  35.951  5.209   1.00 53.46 ? 467  ASN A O     1 
ATOM   2060 C  CB    . ASN D 4 227 ? -2.449  33.654  5.161   1.00 57.26 ? 467  ASN A CB    1 
ATOM   2061 C  CG    . ASN D 4 227 ? -3.047  33.821  6.540   1.00 58.39 ? 467  ASN A CG    1 
ATOM   2062 O  OD1   . ASN D 4 227 ? -3.728  34.808  6.819   1.00 61.15 ? 467  ASN A OD1   1 
ATOM   2063 N  ND2   . ASN D 4 227 ? -2.788  32.860  7.417   1.00 59.70 ? 467  ASN A ND2   1 
ATOM   2064 N  N     . GLY D 4 228 ? -2.400  37.041  5.580   1.00 53.15 ? 468  GLY A N     1 
ATOM   2065 C  CA    . GLY D 4 228 ? -1.740  38.110  6.300   1.00 51.95 ? 468  GLY A CA    1 
ATOM   2066 C  C     . GLY D 4 228 ? -1.348  37.676  7.698   1.00 51.33 ? 468  GLY A C     1 
ATOM   2067 O  O     . GLY D 4 228 ? -0.657  38.407  8.404   1.00 51.50 ? 468  GLY A O     1 
ATOM   2068 N  N     . GLN D 4 229 ? -1.791  36.485  8.100   1.00 50.05 ? 469  GLN A N     1 
ATOM   2069 C  CA    . GLN D 4 229 ? -1.479  35.961  9.425   1.00 48.44 ? 469  GLN A CA    1 
ATOM   2070 C  C     . GLN D 4 229 ? -0.379  34.904  9.401   1.00 44.19 ? 469  GLN A C     1 
ATOM   2071 O  O     . GLN D 4 229 ? -0.323  34.038  10.274  1.00 43.77 ? 469  GLN A O     1 
ATOM   2072 C  CB    . GLN D 4 229 ? -2.737  35.380  10.085  1.00 52.32 ? 469  GLN A CB    1 
ATOM   2073 C  CG    . GLN D 4 229 ? -3.728  36.429  10.590  1.00 57.61 ? 469  GLN A CG    1 
ATOM   2074 C  CD    . GLN D 4 229 ? -4.304  37.285  9.474   1.00 60.68 ? 469  GLN A CD    1 
ATOM   2075 O  OE1   . GLN D 4 229 ? -5.033  36.793  8.610   1.00 63.17 ? 469  GLN A OE1   1 
ATOM   2076 N  NE2   . GLN D 4 229 ? -3.976  38.574  9.486   1.00 61.23 ? 469  GLN A NE2   1 
ATOM   2077 N  N     . GLN D 4 230 ? 0.484   34.974  8.392   1.00 40.51 ? 470  GLN A N     1 
ATOM   2078 C  CA    . GLN D 4 230 ? 1.600   34.043  8.262   1.00 37.56 ? 470  GLN A CA    1 
ATOM   2079 C  C     . GLN D 4 230 ? 2.482   34.202  9.491   1.00 36.36 ? 470  GLN A C     1 
ATOM   2080 O  O     . GLN D 4 230 ? 2.829   35.319  9.875   1.00 36.38 ? 470  GLN A O     1 
ATOM   2081 C  CB    . GLN D 4 230 ? 2.406   34.359  6.995   1.00 38.55 ? 470  GLN A CB    1 
ATOM   2082 C  CG    . GLN D 4 230 ? 3.789   33.710  6.926   1.00 38.94 ? 470  GLN A CG    1 
ATOM   2083 C  CD    . GLN D 4 230 ? 4.510   34.017  5.622   1.00 41.19 ? 470  GLN A CD    1 
ATOM   2084 O  OE1   . GLN D 4 230 ? 4.175   34.978  4.932   1.00 41.14 ? 470  GLN A OE1   1 
ATOM   2085 N  NE2   . GLN D 4 230 ? 5.510   33.207  5.284   1.00 39.18 ? 470  GLN A NE2   1 
ATOM   2086 N  N     . GLN D 4 231 ? 2.838   33.087  10.111  1.00 34.21 ? 471  GLN A N     1 
ATOM   2087 C  CA    . GLN D 4 231 ? 3.669   33.120  11.308  1.00 33.73 ? 471  GLN A CA    1 
ATOM   2088 C  C     . GLN D 4 231 ? 5.124   32.750  11.036  1.00 31.76 ? 471  GLN A C     1 
ATOM   2089 O  O     . GLN D 4 231 ? 6.028   33.196  11.740  1.00 31.88 ? 471  GLN A O     1 
ATOM   2090 C  CB    . GLN D 4 231 ? 3.105   32.166  12.369  1.00 34.05 ? 471  GLN A CB    1 
ATOM   2091 C  CG    . GLN D 4 231 ? 1.781   32.597  12.989  1.00 34.42 ? 471  GLN A CG    1 
ATOM   2092 C  CD    . GLN D 4 231 ? 1.309   31.619  14.049  1.00 35.52 ? 471  GLN A CD    1 
ATOM   2093 O  OE1   . GLN D 4 231 ? 2.049   31.298  14.981  1.00 35.15 ? 471  GLN A OE1   1 
ATOM   2094 N  NE2   . GLN D 4 231 ? 0.077   31.132  13.909  1.00 32.80 ? 471  GLN A NE2   1 
ATOM   2095 N  N     . LYS D 4 232 ? 5.354   31.949  10.006  1.00 30.02 ? 472  LYS A N     1 
ATOM   2096 C  CA    . LYS D 4 232 ? 6.708   31.512  9.713   1.00 29.31 ? 472  LYS A CA    1 
ATOM   2097 C  C     . LYS D 4 232 ? 7.076   31.460  8.241   1.00 27.69 ? 472  LYS A C     1 
ATOM   2098 O  O     . LYS D 4 232 ? 6.218   31.354  7.358   1.00 27.51 ? 472  LYS A O     1 
ATOM   2099 C  CB    . LYS D 4 232 ? 6.931   30.113  10.297  1.00 28.18 ? 472  LYS A CB    1 
ATOM   2100 C  CG    . LYS D 4 232 ? 6.245   29.017  9.479   1.00 29.97 ? 472  LYS A CG    1 
ATOM   2101 C  CD    . LYS D 4 232 ? 6.650   27.611  9.926   1.00 30.54 ? 472  LYS A CD    1 
ATOM   2102 C  CE    . LYS D 4 232 ? 5.991   27.224  11.247  1.00 32.07 ? 472  LYS A CE    1 
ATOM   2103 N  NZ    . LYS D 4 232 ? 6.495   25.914  11.733  1.00 30.39 ? 472  LYS A NZ    1 
ATOM   2104 N  N     . TYR D 4 233 ? 8.379   31.531  7.997   1.00 27.06 ? 473  TYR A N     1 
ATOM   2105 C  CA    . TYR D 4 233 ? 8.932   31.417  6.659   1.00 25.72 ? 473  TYR A CA    1 
ATOM   2106 C  C     . TYR D 4 233 ? 10.078  30.413  6.765   1.00 26.16 ? 473  TYR A C     1 
ATOM   2107 O  O     . TYR D 4 233 ? 10.980  30.586  7.583   1.00 26.47 ? 473  TYR A O     1 
ATOM   2108 C  CB    . TYR D 4 233 ? 9.507   32.741  6.153   1.00 25.30 ? 473  TYR A CB    1 
ATOM   2109 C  CG    . TYR D 4 233 ? 10.355  32.551  4.917   1.00 26.16 ? 473  TYR A CG    1 
ATOM   2110 C  CD1   . TYR D 4 233 ? 9.781   32.511  3.647   1.00 26.64 ? 473  TYR A CD1   1 
ATOM   2111 C  CD2   . TYR D 4 233 ? 11.728  32.332  5.023   1.00 27.11 ? 473  TYR A CD2   1 
ATOM   2112 C  CE1   . TYR D 4 233 ? 10.550  32.253  2.516   1.00 27.00 ? 473  TYR A CE1   1 
ATOM   2113 C  CE2   . TYR D 4 233 ? 12.507  32.071  3.900   1.00 26.82 ? 473  TYR A CE2   1 
ATOM   2114 C  CZ    . TYR D 4 233 ? 11.914  32.030  2.649   1.00 27.25 ? 473  TYR A CZ    1 
ATOM   2115 O  OH    . TYR D 4 233 ? 12.681  31.741  1.538   1.00 27.39 ? 473  TYR A OH    1 
ATOM   2116 N  N     . LEU D 4 234 ? 10.032  29.360  5.959   1.00 24.82 ? 474  LEU A N     1 
ATOM   2117 C  CA    . LEU D 4 234 ? 11.106  28.375  5.957   1.00 24.81 ? 474  LEU A CA    1 
ATOM   2118 C  C     . LEU D 4 234 ? 11.616  28.408  4.535   1.00 23.96 ? 474  LEU A C     1 
ATOM   2119 O  O     . LEU D 4 234 ? 10.863  28.127  3.603   1.00 23.80 ? 474  LEU A O     1 
ATOM   2120 C  CB    . LEU D 4 234 ? 10.584  26.975  6.283   1.00 24.89 ? 474  LEU A CB    1 
ATOM   2121 C  CG    . LEU D 4 234 ? 9.697   26.798  7.514   1.00 26.43 ? 474  LEU A CG    1 
ATOM   2122 C  CD1   . LEU D 4 234 ? 9.430   25.302  7.716   1.00 24.18 ? 474  LEU A CD1   1 
ATOM   2123 C  CD2   . LEU D 4 234 ? 10.380  27.384  8.746   1.00 24.39 ? 474  LEU A CD2   1 
ATOM   2124 N  N     . GLY D 4 235 ? 12.883  28.773  4.363   1.00 24.63 ? 475  GLY A N     1 
ATOM   2125 C  CA    . GLY D 4 235 ? 13.431  28.846  3.026   1.00 22.56 ? 475  GLY A CA    1 
ATOM   2126 C  C     . GLY D 4 235 ? 14.903  28.522  2.914   1.00 24.80 ? 475  GLY A C     1 
ATOM   2127 O  O     . GLY D 4 235 ? 15.518  27.919  3.806   1.00 23.55 ? 475  GLY A O     1 
ATOM   2128 N  N     . VAL D 4 236 ? 15.466  28.949  1.793   1.00 23.92 ? 476  VAL A N     1 
ATOM   2129 C  CA    . VAL D 4 236 ? 16.857  28.714  1.475   1.00 24.58 ? 476  VAL A CA    1 
ATOM   2130 C  C     . VAL D 4 236 ? 17.477  30.040  1.063   1.00 26.57 ? 476  VAL A C     1 
ATOM   2131 O  O     . VAL D 4 236 ? 16.875  30.804  0.307   1.00 28.32 ? 476  VAL A O     1 
ATOM   2132 C  CB    . VAL D 4 236 ? 16.971  27.731  0.294   1.00 24.82 ? 476  VAL A CB    1 
ATOM   2133 C  CG1   . VAL D 4 236 ? 18.423  27.322  0.082   1.00 23.60 ? 476  VAL A CG1   1 
ATOM   2134 C  CG2   . VAL D 4 236 ? 16.076  26.517  0.543   1.00 22.55 ? 476  VAL A CG2   1 
ATOM   2135 N  N     . CYS D 4 237 ? 18.674  30.315  1.566   1.00 25.42 ? 477  CYS A N     1 
ATOM   2136 C  CA    . CYS D 4 237 ? 19.371  31.547  1.225   1.00 26.54 ? 477  CYS A CA    1 
ATOM   2137 C  C     . CYS D 4 237 ? 20.824  31.233  0.918   1.00 27.32 ? 477  CYS A C     1 
ATOM   2138 O  O     . CYS D 4 237 ? 21.290  30.105  1.133   1.00 28.90 ? 477  CYS A O     1 
ATOM   2139 C  CB    . CYS D 4 237 ? 19.316  32.539  2.393   1.00 26.24 ? 477  CYS A CB    1 
ATOM   2140 S  SG    . CYS D 4 237 ? 20.252  32.018  3.866   1.00 28.96 ? 477  CYS A SG    1 
ATOM   2141 N  N     . ARG D 4 238 ? 21.532  32.227  0.393   1.00 26.69 ? 478  ARG A N     1 
ATOM   2142 C  CA    . ARG D 4 238 ? 22.951  32.079  0.108   1.00 28.11 ? 478  ARG A CA    1 
ATOM   2143 C  C     . ARG D 4 238 ? 23.617  33.451  0.080   1.00 29.00 ? 478  ARG A C     1 
ATOM   2144 O  O     . ARG D 4 238 ? 23.203  34.342  -0.658  1.00 28.28 ? 478  ARG A O     1 
ATOM   2145 C  CB    . ARG D 4 238 ? 23.201  31.359  -1.225  1.00 26.03 ? 478  ARG A CB    1 
ATOM   2146 C  CG    . ARG D 4 238 ? 24.685  31.046  -1.447  1.00 26.88 ? 478  ARG A CG    1 
ATOM   2147 C  CD    . ARG D 4 238 ? 24.930  30.211  -2.704  1.00 29.37 ? 478  ARG A CD    1 
ATOM   2148 N  NE    . ARG D 4 238 ? 24.606  30.951  -3.918  1.00 34.01 ? 478  ARG A NE    1 
ATOM   2149 C  CZ    . ARG D 4 238 ? 24.851  30.521  -5.152  1.00 35.43 ? 478  ARG A CZ    1 
ATOM   2150 N  NH1   . ARG D 4 238 ? 25.429  29.341  -5.351  1.00 34.84 ? 478  ARG A NH1   1 
ATOM   2151 N  NH2   . ARG D 4 238 ? 24.526  31.279  -6.192  1.00 37.15 ? 478  ARG A NH2   1 
ATOM   2152 N  N     . LEU D 4 239 ? 24.647  33.605  0.900   1.00 30.28 ? 479  LEU A N     1 
ATOM   2153 C  CA    . LEU D 4 239 ? 25.386  34.848  0.976   1.00 32.90 ? 479  LEU A CA    1 
ATOM   2154 C  C     . LEU D 4 239 ? 26.111  35.049  -0.341  1.00 35.83 ? 479  LEU A C     1 
ATOM   2155 O  O     . LEU D 4 239 ? 26.368  34.088  -1.070  1.00 37.74 ? 479  LEU A O     1 
ATOM   2156 C  CB    . LEU D 4 239 ? 26.376  34.781  2.136   1.00 30.27 ? 479  LEU A CB    1 
ATOM   2157 C  CG    . LEU D 4 239 ? 25.644  34.660  3.475   1.00 31.14 ? 479  LEU A CG    1 
ATOM   2158 C  CD1   . LEU D 4 239 ? 26.572  34.137  4.555   1.00 26.44 ? 479  LEU A CD1   1 
ATOM   2159 C  CD2   . LEU D 4 239 ? 25.049  36.026  3.837   1.00 29.26 ? 479  LEU A CD2   1 
ATOM   2160 N  N     . PRO D 4 240 ? 26.437  36.305  -0.675  1.00 37.73 ? 480  PRO A N     1 
ATOM   2161 C  CA    . PRO D 4 240 ? 27.137  36.616  -1.924  1.00 37.50 ? 480  PRO A CA    1 
ATOM   2162 C  C     . PRO D 4 240 ? 28.623  36.248  -1.884  1.00 37.64 ? 480  PRO A C     1 
ATOM   2163 O  O     . PRO D 4 240 ? 29.179  35.970  -0.818  1.00 38.86 ? 480  PRO A O     1 
ATOM   2164 C  CB    . PRO D 4 240 ? 26.908  38.118  -2.070  1.00 38.66 ? 480  PRO A CB    1 
ATOM   2165 C  CG    . PRO D 4 240 ? 26.940  38.582  -0.642  1.00 38.79 ? 480  PRO A CG    1 
ATOM   2166 C  CD    . PRO D 4 240 ? 26.097  37.536  0.063   1.00 38.23 ? 480  PRO A CD    1 
ATOM   2167 N  N     . GLY D 4 241 ? 29.261  36.238  -3.049  1.00 37.32 ? 481  GLY A N     1 
ATOM   2168 C  CA    . GLY D 4 241 ? 30.675  35.920  -3.104  1.00 37.14 ? 481  GLY A CA    1 
ATOM   2169 C  C     . GLY D 4 241 ? 30.969  34.461  -3.392  1.00 37.11 ? 481  GLY A C     1 
ATOM   2170 O  O     . GLY D 4 241 ? 30.061  33.637  -3.420  1.00 36.76 ? 481  GLY A O     1 
ATOM   2171 N  N     . PRO D 4 242 ? 32.247  34.112  -3.606  1.00 37.17 ? 482  PRO A N     1 
ATOM   2172 C  CA    . PRO D 4 242 ? 32.671  32.741  -3.897  1.00 36.31 ? 482  PRO A CA    1 
ATOM   2173 C  C     . PRO D 4 242 ? 32.690  31.838  -2.665  1.00 33.37 ? 482  PRO A C     1 
ATOM   2174 O  O     . PRO D 4 242 ? 32.687  32.311  -1.533  1.00 33.84 ? 482  PRO A O     1 
ATOM   2175 C  CB    . PRO D 4 242 ? 34.060  32.942  -4.486  1.00 37.00 ? 482  PRO A CB    1 
ATOM   2176 C  CG    . PRO D 4 242 ? 34.580  34.075  -3.661  1.00 37.88 ? 482  PRO A CG    1 
ATOM   2177 C  CD    . PRO D 4 242 ? 33.400  35.031  -3.643  1.00 38.35 ? 482  PRO A CD    1 
ATOM   2178 N  N     . GLY D 4 243 ? 32.694  30.532  -2.903  1.00 33.07 ? 483  GLY A N     1 
ATOM   2179 C  CA    . GLY D 4 243 ? 32.731  29.573  -1.813  1.00 32.56 ? 483  GLY A CA    1 
ATOM   2180 C  C     . GLY D 4 243 ? 31.526  29.539  -0.894  1.00 31.58 ? 483  GLY A C     1 
ATOM   2181 O  O     . GLY D 4 243 ? 31.611  29.024  0.220   1.00 31.74 ? 483  GLY A O     1 
ATOM   2182 N  N     . ARG D 4 244 ? 30.399  30.074  -1.351  1.00 30.67 ? 484  ARG A N     1 
ATOM   2183 C  CA    . ARG D 4 244 ? 29.196  30.079  -0.533  1.00 29.21 ? 484  ARG A CA    1 
ATOM   2184 C  C     . ARG D 4 244 ? 28.267  28.916  -0.860  1.00 27.57 ? 484  ARG A C     1 
ATOM   2185 O  O     . ARG D 4 244 ? 28.081  28.562  -2.016  1.00 25.21 ? 484  ARG A O     1 
ATOM   2186 C  CB    . ARG D 4 244 ? 28.433  31.394  -0.712  1.00 30.54 ? 484  ARG A CB    1 
ATOM   2187 C  CG    . ARG D 4 244 ? 29.175  32.622  -0.211  1.00 30.92 ? 484  ARG A CG    1 
ATOM   2188 C  CD    . ARG D 4 244 ? 29.482  32.520  1.269   1.00 30.59 ? 484  ARG A CD    1 
ATOM   2189 N  NE    . ARG D 4 244 ? 29.798  33.832  1.820   1.00 30.70 ? 484  ARG A NE    1 
ATOM   2190 C  CZ    . ARG D 4 244 ? 30.023  34.075  3.105   1.00 32.97 ? 484  ARG A CZ    1 
ATOM   2191 N  NH1   . ARG D 4 244 ? 29.974  33.088  3.992   1.00 33.31 ? 484  ARG A NH1   1 
ATOM   2192 N  NH2   . ARG D 4 244 ? 30.280  35.316  3.506   1.00 32.38 ? 484  ARG A NH2   1 
ATOM   2193 N  N     . ARG D 4 245 ? 27.677  28.335  0.176   1.00 27.35 ? 485  ARG A N     1 
ATOM   2194 C  CA    . ARG D 4 245 ? 26.748  27.230  0.010   1.00 26.04 ? 485  ARG A CA    1 
ATOM   2195 C  C     . ARG D 4 245 ? 25.336  27.713  0.327   1.00 26.42 ? 485  ARG A C     1 
ATOM   2196 O  O     . ARG D 4 245 ? 25.162  28.711  1.027   1.00 26.63 ? 485  ARG A O     1 
ATOM   2197 C  CB    . ARG D 4 245 ? 27.125  26.095  0.963   1.00 23.67 ? 485  ARG A CB    1 
ATOM   2198 C  CG    . ARG D 4 245 ? 28.600  25.679  0.885   1.00 23.88 ? 485  ARG A CG    1 
ATOM   2199 C  CD    . ARG D 4 245 ? 29.012  25.393  -0.548  1.00 24.19 ? 485  ARG A CD    1 
ATOM   2200 N  NE    . ARG D 4 245 ? 28.130  24.407  -1.164  1.00 26.50 ? 485  ARG A NE    1 
ATOM   2201 C  CZ    . ARG D 4 245 ? 28.219  23.996  -2.426  1.00 27.99 ? 485  ARG A CZ    1 
ATOM   2202 N  NH1   . ARG D 4 245 ? 29.161  24.486  -3.227  1.00 27.25 ? 485  ARG A NH1   1 
ATOM   2203 N  NH2   . ARG D 4 245 ? 27.354  23.103  -2.891  1.00 23.62 ? 485  ARG A NH2   1 
ATOM   2204 N  N     . HIS D 4 246 ? 24.328  27.021  -0.195  1.00 26.07 ? 486  HIS A N     1 
ATOM   2205 C  CA    . HIS D 4 246 ? 22.954  27.392  0.113   1.00 26.16 ? 486  HIS A CA    1 
ATOM   2206 C  C     . HIS D 4 246 ? 22.719  26.928  1.548   1.00 26.27 ? 486  HIS A C     1 
ATOM   2207 O  O     . HIS D 4 246 ? 23.176  25.851  1.936   1.00 27.16 ? 486  HIS A O     1 
ATOM   2208 C  CB    . HIS D 4 246 ? 21.959  26.694  -0.817  1.00 23.21 ? 486  HIS A CB    1 
ATOM   2209 C  CG    . HIS D 4 246 ? 21.958  27.226  -2.214  1.00 23.36 ? 486  HIS A CG    1 
ATOM   2210 N  ND1   . HIS D 4 246 ? 22.928  26.898  -3.136  1.00 25.44 ? 486  HIS A ND1   1 
ATOM   2211 C  CD2   . HIS D 4 246 ? 21.102  28.065  -2.847  1.00 21.31 ? 486  HIS A CD2   1 
ATOM   2212 C  CE1   . HIS D 4 246 ? 22.669  27.510  -4.280  1.00 24.65 ? 486  HIS A CE1   1 
ATOM   2213 N  NE2   . HIS D 4 246 ? 21.566  28.224  -4.130  1.00 24.43 ? 486  HIS A NE2   1 
ATOM   2214 N  N     . ARG D 4 247 ? 22.018  27.745  2.330   1.00 26.29 ? 487  ARG A N     1 
ATOM   2215 C  CA    . ARG D 4 247 ? 21.737  27.425  3.727   1.00 24.94 ? 487  ARG A CA    1 
ATOM   2216 C  C     . ARG D 4 247 ? 20.253  27.523  4.019   1.00 25.76 ? 487  ARG A C     1 
ATOM   2217 O  O     . ARG D 4 247 ? 19.537  28.319  3.398   1.00 26.64 ? 487  ARG A O     1 
ATOM   2218 C  CB    . ARG D 4 247 ? 22.472  28.390  4.662   1.00 25.83 ? 487  ARG A CB    1 
ATOM   2219 C  CG    . ARG D 4 247 ? 23.978  28.487  4.454   1.00 26.33 ? 487  ARG A CG    1 
ATOM   2220 C  CD    . ARG D 4 247 ? 24.681  27.163  4.736   1.00 25.25 ? 487  ARG A CD    1 
ATOM   2221 N  NE    . ARG D 4 247 ? 26.134  27.309  4.694   1.00 26.54 ? 487  ARG A NE    1 
ATOM   2222 C  CZ    . ARG D 4 247 ? 26.988  26.296  4.802   1.00 27.25 ? 487  ARG A CZ    1 
ATOM   2223 N  NH1   . ARG D 4 247 ? 26.536  25.056  4.950   1.00 19.37 ? 487  ARG A NH1   1 
ATOM   2224 N  NH2   . ARG D 4 247 ? 28.290  26.527  4.789   1.00 23.89 ? 487  ARG A NH2   1 
ATOM   2225 N  N     . ARG D 4 248 ? 19.796  26.721  4.975   1.00 23.39 ? 488  ARG A N     1 
ATOM   2226 C  CA    . ARG D 4 248 ? 18.399  26.732  5.373   1.00 25.17 ? 488  ARG A CA    1 
ATOM   2227 C  C     . ARG D 4 248 ? 18.144  27.912  6.305   1.00 25.67 ? 488  ARG A C     1 
ATOM   2228 O  O     . ARG D 4 248 ? 18.907  28.154  7.240   1.00 27.50 ? 488  ARG A O     1 
ATOM   2229 C  CB    . ARG D 4 248 ? 18.034  25.420  6.072   1.00 26.77 ? 488  ARG A CB    1 
ATOM   2230 C  CG    . ARG D 4 248 ? 17.728  24.268  5.106   1.00 29.22 ? 488  ARG A CG    1 
ATOM   2231 C  CD    . ARG D 4 248 ? 16.237  24.241  4.721   1.00 28.18 ? 488  ARG A CD    1 
ATOM   2232 N  NE    . ARG D 4 248 ? 15.410  23.948  5.895   1.00 28.57 ? 488  ARG A NE    1 
ATOM   2233 C  CZ    . ARG D 4 248 ? 14.729  24.856  6.592   1.00 29.97 ? 488  ARG A CZ    1 
ATOM   2234 N  NH1   . ARG D 4 248 ? 14.749  26.138  6.238   1.00 27.04 ? 488  ARG A NH1   1 
ATOM   2235 N  NH2   . ARG D 4 248 ? 14.053  24.484  7.670   1.00 24.35 ? 488  ARG A NH2   1 
ATOM   2236 N  N     . LEU D 4 249 ? 17.060  28.636  6.047   1.00 23.87 ? 489  LEU A N     1 
ATOM   2237 C  CA    . LEU D 4 249 ? 16.704  29.798  6.848   1.00 23.93 ? 489  LEU A CA    1 
ATOM   2238 C  C     . LEU D 4 249 ? 15.257  29.725  7.308   1.00 23.87 ? 489  LEU A C     1 
ATOM   2239 O  O     . LEU D 4 249 ? 14.345  29.571  6.485   1.00 24.39 ? 489  LEU A O     1 
ATOM   2240 C  CB    . LEU D 4 249 ? 16.920  31.083  6.021   1.00 24.43 ? 489  LEU A CB    1 
ATOM   2241 C  CG    . LEU D 4 249 ? 16.432  32.418  6.615   1.00 25.76 ? 489  LEU A CG    1 
ATOM   2242 C  CD1   . LEU D 4 249 ? 17.131  32.673  7.941   1.00 22.80 ? 489  LEU A CD1   1 
ATOM   2243 C  CD2   . LEU D 4 249 ? 16.696  33.567  5.628   1.00 23.53 ? 489  LEU A CD2   1 
ATOM   2244 N  N     . ASP D 4 250 ? 15.056  29.839  8.620   1.00 22.80 ? 490  ASP A N     1 
ATOM   2245 C  CA    . ASP D 4 250 ? 13.727  29.826  9.221   1.00 25.37 ? 490  ASP A CA    1 
ATOM   2246 C  C     . ASP D 4 250 ? 13.497  31.163  9.917   1.00 25.49 ? 490  ASP A C     1 
ATOM   2247 O  O     . ASP D 4 250 ? 14.330  31.618  10.703  1.00 24.94 ? 490  ASP A O     1 
ATOM   2248 C  CB    . ASP D 4 250 ? 13.588  28.714  10.267  1.00 26.32 ? 490  ASP A CB    1 
ATOM   2249 C  CG    . ASP D 4 250 ? 13.622  27.324  9.659   1.00 31.91 ? 490  ASP A CG    1 
ATOM   2250 O  OD1   . ASP D 4 250 ? 13.438  26.356  10.426  1.00 30.35 ? 490  ASP A OD1   1 
ATOM   2251 O  OD2   . ASP D 4 250 ? 13.835  27.199  8.427   1.00 31.37 ? 490  ASP A OD2   1 
ATOM   2252 N  N     . ILE D 4 251 ? 12.357  31.775  9.638   1.00 25.99 ? 491  ILE A N     1 
ATOM   2253 C  CA    . ILE D 4 251 ? 12.021  33.055  10.240  1.00 26.32 ? 491  ILE A CA    1 
ATOM   2254 C  C     . ILE D 4 251 ? 10.615  33.035  10.817  1.00 26.42 ? 491  ILE A C     1 
ATOM   2255 O  O     . ILE D 4 251 ? 9.671   32.577  10.160  1.00 25.57 ? 491  ILE A O     1 
ATOM   2256 C  CB    . ILE D 4 251 ? 12.066  34.197  9.195   1.00 26.18 ? 491  ILE A CB    1 
ATOM   2257 C  CG1   . ILE D 4 251 ? 13.459  34.297  8.580   1.00 24.42 ? 491  ILE A CG1   1 
ATOM   2258 C  CG2   . ILE D 4 251 ? 11.677  35.521  9.852   1.00 28.15 ? 491  ILE A CG2   1 
ATOM   2259 C  CD1   . ILE D 4 251 ? 13.548  35.311  7.442   1.00 22.67 ? 491  ILE A CD1   1 
ATOM   2260 N  N     . ILE D 4 252 ? 10.477  33.512  12.049  1.00 25.93 ? 492  ILE A N     1 
ATOM   2261 C  CA    . ILE D 4 252 ? 9.160   33.613  12.661  1.00 26.80 ? 492  ILE A CA    1 
ATOM   2262 C  C     . ILE D 4 252 ? 8.948   35.037  13.176  1.00 28.46 ? 492  ILE A C     1 
ATOM   2263 O  O     . ILE D 4 252 ? 9.857   35.666  13.729  1.00 25.58 ? 492  ILE A O     1 
ATOM   2264 C  CB    . ILE D 4 252 ? 8.948   32.613  13.844  1.00 28.19 ? 492  ILE A CB    1 
ATOM   2265 C  CG1   . ILE D 4 252 ? 9.855   32.969  15.019  1.00 28.68 ? 492  ILE A CG1   1 
ATOM   2266 C  CG2   . ILE D 4 252 ? 9.201   31.182  13.376  1.00 24.89 ? 492  ILE A CG2   1 
ATOM   2267 C  CD1   . ILE D 4 252 ? 9.649   32.074  16.236  1.00 30.74 ? 492  ILE A CD1   1 
ATOM   2268 N  N     . VAL D 4 253 ? 7.744   35.545  12.958  1.00 30.64 ? 493  VAL A N     1 
ATOM   2269 C  CA    . VAL D 4 253 ? 7.368   36.875  13.411  1.00 31.62 ? 493  VAL A CA    1 
ATOM   2270 C  C     . VAL D 4 253 ? 6.302   36.645  14.478  1.00 32.41 ? 493  VAL A C     1 
ATOM   2271 O  O     . VAL D 4 253 ? 5.289   35.989  14.217  1.00 31.94 ? 493  VAL A O     1 
ATOM   2272 C  CB    . VAL D 4 253 ? 6.785   37.703  12.251  1.00 31.98 ? 493  VAL A CB    1 
ATOM   2273 C  CG1   . VAL D 4 253 ? 6.244   39.038  12.772  1.00 31.57 ? 493  VAL A CG1   1 
ATOM   2274 C  CG2   . VAL D 4 253 ? 7.863   37.929  11.193  1.00 29.45 ? 493  VAL A CG2   1 
ATOM   2275 N  N     . VAL D 4 254 ? 6.533   37.165  15.679  1.00 32.22 ? 494  VAL A N     1 
ATOM   2276 C  CA    . VAL D 4 254 ? 5.581   36.972  16.761  1.00 34.37 ? 494  VAL A CA    1 
ATOM   2277 C  C     . VAL D 4 254 ? 5.158   38.263  17.449  1.00 37.66 ? 494  VAL A C     1 
ATOM   2278 O  O     . VAL D 4 254 ? 5.851   39.284  17.365  1.00 36.69 ? 494  VAL A O     1 
ATOM   2279 C  CB    . VAL D 4 254 ? 6.158   36.041  17.851  1.00 34.45 ? 494  VAL A CB    1 
ATOM   2280 C  CG1   . VAL D 4 254 ? 6.680   34.751  17.220  1.00 32.90 ? 494  VAL A CG1   1 
ATOM   2281 C  CG2   . VAL D 4 254 ? 7.267   36.759  18.617  1.00 33.88 ? 494  VAL A CG2   1 
ATOM   2282 N  N     . PRO D 4 255 ? 3.997   38.232  18.132  1.00 38.14 ? 495  PRO A N     1 
ATOM   2283 C  CA    . PRO D 4 255 ? 3.472   39.397  18.855  1.00 38.01 ? 495  PRO A CA    1 
ATOM   2284 C  C     . PRO D 4 255 ? 4.395   39.609  20.049  1.00 37.96 ? 495  PRO A C     1 
ATOM   2285 O  O     . PRO D 4 255 ? 4.852   38.639  20.653  1.00 37.67 ? 495  PRO A O     1 
ATOM   2286 C  CB    . PRO D 4 255 ? 2.080   38.938  19.293  1.00 36.29 ? 495  PRO A CB    1 
ATOM   2287 C  CG    . PRO D 4 255 ? 1.708   37.913  18.273  1.00 37.59 ? 495  PRO A CG    1 
ATOM   2288 C  CD    . PRO D 4 255 ? 2.995   37.154  18.090  1.00 37.59 ? 495  PRO A CD    1 
ATOM   2289 N  N     . TYR D 4 256 ? 4.673   40.858  20.401  1.00 38.36 ? 496  TYR A N     1 
ATOM   2290 C  CA    . TYR D 4 256 ? 5.566   41.103  21.524  1.00 37.17 ? 496  TYR A CA    1 
ATOM   2291 C  C     . TYR D 4 256 ? 5.098   40.401  22.792  1.00 36.12 ? 496  TYR A C     1 
ATOM   2292 O  O     . TYR D 4 256 ? 5.914   39.943  23.588  1.00 34.29 ? 496  TYR A O     1 
ATOM   2293 C  CB    . TYR D 4 256 ? 5.706   42.595  21.792  1.00 40.26 ? 496  TYR A CB    1 
ATOM   2294 C  CG    . TYR D 4 256 ? 6.880   42.910  22.683  1.00 42.57 ? 496  TYR A CG    1 
ATOM   2295 C  CD1   . TYR D 4 256 ? 8.177   42.584  22.291  1.00 43.41 ? 496  TYR A CD1   1 
ATOM   2296 C  CD2   . TYR D 4 256 ? 6.700   43.533  23.916  1.00 44.61 ? 496  TYR A CD2   1 
ATOM   2297 C  CE1   . TYR D 4 256 ? 9.267   42.870  23.102  1.00 45.22 ? 496  TYR A CE1   1 
ATOM   2298 C  CE2   . TYR D 4 256 ? 7.786   43.826  24.738  1.00 45.03 ? 496  TYR A CE2   1 
ATOM   2299 C  CZ    . TYR D 4 256 ? 9.066   43.493  24.324  1.00 46.11 ? 496  TYR A CZ    1 
ATOM   2300 O  OH    . TYR D 4 256 ? 10.146  43.790  25.125  1.00 47.36 ? 496  TYR A OH    1 
ATOM   2301 N  N     . SER D 4 257 ? 3.784   40.305  22.968  1.00 36.68 ? 497  SER A N     1 
ATOM   2302 C  CA    . SER D 4 257 ? 3.219   39.659  24.148  1.00 37.51 ? 497  SER A CA    1 
ATOM   2303 C  C     . SER D 4 257 ? 3.584   38.180  24.250  1.00 36.45 ? 497  SER A C     1 
ATOM   2304 O  O     . SER D 4 257 ? 3.530   37.596  25.334  1.00 35.72 ? 497  SER A O     1 
ATOM   2305 C  CB    . SER D 4 257 ? 1.694   39.806  24.153  1.00 38.51 ? 497  SER A CB    1 
ATOM   2306 O  OG    . SER D 4 257 ? 1.117   39.239  22.988  1.00 41.44 ? 497  SER A OG    1 
ATOM   2307 N  N     . GLU D 4 258 ? 3.957   37.576  23.126  1.00 35.15 ? 498  GLU A N     1 
ATOM   2308 C  CA    . GLU D 4 258 ? 4.318   36.159  23.113  1.00 35.97 ? 498  GLU A CA    1 
ATOM   2309 C  C     . GLU D 4 258 ? 5.824   35.954  23.003  1.00 34.97 ? 498  GLU A C     1 
ATOM   2310 O  O     . GLU D 4 258 ? 6.295   34.825  22.880  1.00 35.06 ? 498  GLU A O     1 
ATOM   2311 C  CB    . GLU D 4 258 ? 3.633   35.458  21.940  1.00 33.33 ? 498  GLU A CB    1 
ATOM   2312 C  CG    . GLU D 4 258 ? 2.122   35.475  22.009  1.00 33.00 ? 498  GLU A CG    1 
ATOM   2313 C  CD    . GLU D 4 258 ? 1.479   34.858  20.782  1.00 33.48 ? 498  GLU A CD    1 
ATOM   2314 O  OE1   . GLU D 4 258 ? 2.196   34.217  19.980  1.00 33.96 ? 498  GLU A OE1   1 
ATOM   2315 O  OE2   . GLU D 4 258 ? 0.252   35.010  20.620  1.00 34.25 ? 498  GLU A OE2   1 
ATOM   2316 N  N     . PHE D 4 259 ? 6.571   37.050  23.066  1.00 35.53 ? 499  PHE A N     1 
ATOM   2317 C  CA    . PHE D 4 259 ? 8.024   37.018  22.928  1.00 35.61 ? 499  PHE A CA    1 
ATOM   2318 C  C     . PHE D 4 259 ? 8.789   35.965  23.727  1.00 34.84 ? 499  PHE A C     1 
ATOM   2319 O  O     . PHE D 4 259 ? 9.534   35.169  23.151  1.00 35.00 ? 499  PHE A O     1 
ATOM   2320 C  CB    . PHE D 4 259 ? 8.593   38.408  23.223  1.00 38.89 ? 499  PHE A CB    1 
ATOM   2321 C  CG    . PHE D 4 259 ? 10.064  38.533  22.952  1.00 39.94 ? 499  PHE A CG    1 
ATOM   2322 C  CD1   . PHE D 4 259 ? 10.629  37.962  21.814  1.00 41.53 ? 499  PHE A CD1   1 
ATOM   2323 C  CD2   . PHE D 4 259 ? 10.888  39.236  23.827  1.00 42.51 ? 499  PHE A CD2   1 
ATOM   2324 C  CE1   . PHE D 4 259 ? 11.996  38.087  21.551  1.00 41.39 ? 499  PHE A CE1   1 
ATOM   2325 C  CE2   . PHE D 4 259 ? 12.256  39.368  23.576  1.00 42.57 ? 499  PHE A CE2   1 
ATOM   2326 C  CZ    . PHE D 4 259 ? 12.811  38.791  22.433  1.00 42.51 ? 499  PHE A CZ    1 
ATOM   2327 N  N     . ALA D 4 260 ? 8.620   35.949  25.042  1.00 33.53 ? 500  ALA A N     1 
ATOM   2328 C  CA    . ALA D 4 260 ? 9.342   34.980  25.867  1.00 33.88 ? 500  ALA A CA    1 
ATOM   2329 C  C     . ALA D 4 260 ? 9.068   33.524  25.481  1.00 33.10 ? 500  ALA A C     1 
ATOM   2330 O  O     . ALA D 4 260 ? 9.992   32.717  25.380  1.00 33.66 ? 500  ALA A O     1 
ATOM   2331 C  CB    . ALA D 4 260 ? 9.017   35.197  27.349  1.00 33.42 ? 500  ALA A CB    1 
ATOM   2332 N  N     . CYS D 4 261 ? 7.804   33.182  25.272  1.00 31.14 ? 501  CYS A N     1 
ATOM   2333 C  CA    . CYS D 4 261 ? 7.466   31.815  24.911  1.00 30.43 ? 501  CYS A CA    1 
ATOM   2334 C  C     . CYS D 4 261 ? 7.999   31.466  23.529  1.00 29.78 ? 501  CYS A C     1 
ATOM   2335 O  O     . CYS D 4 261 ? 8.425   30.338  23.288  1.00 28.18 ? 501  CYS A O     1 
ATOM   2336 C  CB    . CYS D 4 261 ? 5.956   31.616  24.966  1.00 29.84 ? 501  CYS A CB    1 
ATOM   2337 S  SG    . CYS D 4 261 ? 5.328   31.621  26.647  1.00 32.20 ? 501  CYS A SG    1 
ATOM   2338 N  N     . ALA D 4 262 ? 7.976   32.448  22.634  1.00 28.15 ? 502  ALA A N     1 
ATOM   2339 C  CA    . ALA D 4 262 ? 8.464   32.273  21.275  1.00 29.37 ? 502  ALA A CA    1 
ATOM   2340 C  C     . ALA D 4 262 ? 9.979   32.066  21.300  1.00 30.67 ? 502  ALA A C     1 
ATOM   2341 O  O     . ALA D 4 262 ? 10.516  31.203  20.591  1.00 31.42 ? 502  ALA A O     1 
ATOM   2342 C  CB    . ALA D 4 262 ? 8.109   33.502  20.433  1.00 27.49 ? 502  ALA A CB    1 
ATOM   2343 N  N     . LEU D 4 263 ? 10.656  32.856  22.134  1.00 30.75 ? 503  LEU A N     1 
ATOM   2344 C  CA    . LEU D 4 263 ? 12.107  32.792  22.285  1.00 29.93 ? 503  LEU A CA    1 
ATOM   2345 C  C     . LEU D 4 263 ? 12.537  31.462  22.888  1.00 29.35 ? 503  LEU A C     1 
ATOM   2346 O  O     . LEU D 4 263 ? 13.478  30.817  22.421  1.00 27.88 ? 503  LEU A O     1 
ATOM   2347 C  CB    . LEU D 4 263 ? 12.589  33.933  23.190  1.00 32.21 ? 503  LEU A CB    1 
ATOM   2348 C  CG    . LEU D 4 263 ? 14.100  34.072  23.377  1.00 32.94 ? 503  LEU A CG    1 
ATOM   2349 C  CD1   . LEU D 4 263 ? 14.743  34.451  22.042  1.00 31.60 ? 503  LEU A CD1   1 
ATOM   2350 C  CD2   . LEU D 4 263 ? 14.393  35.138  24.433  1.00 34.89 ? 503  LEU A CD2   1 
ATOM   2351 N  N     . LEU D 4 264 ? 11.850  31.069  23.951  1.00 28.54 ? 504  LEU A N     1 
ATOM   2352 C  CA    . LEU D 4 264 ? 12.137  29.815  24.624  1.00 29.83 ? 504  LEU A CA    1 
ATOM   2353 C  C     . LEU D 4 264 ? 11.975  28.678  23.615  1.00 28.81 ? 504  LEU A C     1 
ATOM   2354 O  O     . LEU D 4 264 ? 12.864  27.849  23.453  1.00 30.65 ? 504  LEU A O     1 
ATOM   2355 C  CB    . LEU D 4 264 ? 11.170  29.622  25.789  1.00 30.99 ? 504  LEU A CB    1 
ATOM   2356 C  CG    . LEU D 4 264 ? 11.346  28.367  26.642  1.00 31.88 ? 504  LEU A CG    1 
ATOM   2357 C  CD1   . LEU D 4 264 ? 12.651  28.444  27.405  1.00 33.04 ? 504  LEU A CD1   1 
ATOM   2358 C  CD2   . LEU D 4 264 ? 10.175  28.246  27.604  1.00 32.45 ? 504  LEU A CD2   1 
ATOM   2359 N  N     . TYR D 4 265 ? 10.832  28.651  22.939  1.00 28.54 ? 505  TYR A N     1 
ATOM   2360 C  CA    . TYR D 4 265 ? 10.552  27.632  21.929  1.00 27.11 ? 505  TYR A CA    1 
ATOM   2361 C  C     . TYR D 4 265 ? 11.617  27.575  20.830  1.00 27.16 ? 505  TYR A C     1 
ATOM   2362 O  O     . TYR D 4 265 ? 12.209  26.520  20.572  1.00 25.83 ? 505  TYR A O     1 
ATOM   2363 C  CB    . TYR D 4 265 ? 9.195   27.898  21.264  1.00 25.71 ? 505  TYR A CB    1 
ATOM   2364 C  CG    . TYR D 4 265 ? 9.087   27.338  19.850  1.00 23.26 ? 505  TYR A CG    1 
ATOM   2365 C  CD1   . TYR D 4 265 ? 9.004   25.962  19.625  1.00 23.53 ? 505  TYR A CD1   1 
ATOM   2366 C  CD2   . TYR D 4 265 ? 9.104   28.186  18.743  1.00 23.35 ? 505  TYR A CD2   1 
ATOM   2367 C  CE1   . TYR D 4 265 ? 8.942   25.440  18.330  1.00 25.29 ? 505  TYR A CE1   1 
ATOM   2368 C  CE2   . TYR D 4 265 ? 9.045   27.681  17.437  1.00 23.30 ? 505  TYR A CE2   1 
ATOM   2369 C  CZ    . TYR D 4 265 ? 8.964   26.305  17.237  1.00 25.56 ? 505  TYR A CZ    1 
ATOM   2370 O  OH    . TYR D 4 265 ? 8.913   25.793  15.958  1.00 21.12 ? 505  TYR A OH    1 
ATOM   2371 N  N     . PHE D 4 266 ? 11.851  28.718  20.193  1.00 25.11 ? 506  PHE A N     1 
ATOM   2372 C  CA    . PHE D 4 266 ? 12.786  28.798  19.090  1.00 24.80 ? 506  PHE A CA    1 
ATOM   2373 C  C     . PHE D 4 266 ? 14.237  28.524  19.464  1.00 25.69 ? 506  PHE A C     1 
ATOM   2374 O  O     . PHE D 4 266 ? 15.038  28.151  18.600  1.00 25.55 ? 506  PHE A O     1 
ATOM   2375 C  CB    . PHE D 4 266 ? 12.639  30.153  18.385  1.00 23.33 ? 506  PHE A CB    1 
ATOM   2376 C  CG    . PHE D 4 266 ? 12.701  30.066  16.875  1.00 24.34 ? 506  PHE A CG    1 
ATOM   2377 C  CD1   . PHE D 4 266 ? 12.282  28.913  16.209  1.00 24.63 ? 506  PHE A CD1   1 
ATOM   2378 C  CD2   . PHE D 4 266 ? 13.137  31.150  16.118  1.00 22.82 ? 506  PHE A CD2   1 
ATOM   2379 C  CE1   . PHE D 4 266 ? 12.293  28.842  14.809  1.00 25.48 ? 506  PHE A CE1   1 
ATOM   2380 C  CE2   . PHE D 4 266 ? 13.152  31.094  14.718  1.00 25.10 ? 506  PHE A CE2   1 
ATOM   2381 C  CZ    . PHE D 4 266 ? 12.729  29.938  14.065  1.00 24.94 ? 506  PHE A CZ    1 
ATOM   2382 N  N     . THR D 4 267 ? 14.570  28.689  20.743  1.00 23.80 ? 507  THR A N     1 
ATOM   2383 C  CA    . THR D 4 267 ? 15.927  28.435  21.218  1.00 24.18 ? 507  THR A CA    1 
ATOM   2384 C  C     . THR D 4 267 ? 16.146  26.940  21.469  1.00 24.65 ? 507  THR A C     1 
ATOM   2385 O  O     . THR D 4 267 ? 17.258  26.442  21.337  1.00 24.37 ? 507  THR A O     1 
ATOM   2386 C  CB    . THR D 4 267 ? 16.221  29.220  22.525  1.00 25.74 ? 507  THR A CB    1 
ATOM   2387 O  OG1   . THR D 4 267 ? 16.149  30.624  22.261  1.00 27.73 ? 507  THR A OG1   1 
ATOM   2388 C  CG2   . THR D 4 267 ? 17.608  28.903  23.042  1.00 25.51 ? 507  THR A CG2   1 
ATOM   2389 N  N     . GLY D 4 268 ? 15.079  26.233  21.835  1.00 25.13 ? 508  GLY A N     1 
ATOM   2390 C  CA    . GLY D 4 268 ? 15.179  24.804  22.075  1.00 24.85 ? 508  GLY A CA    1 
ATOM   2391 C  C     . GLY D 4 268 ? 16.077  24.419  23.232  1.00 27.53 ? 508  GLY A C     1 
ATOM   2392 O  O     . GLY D 4 268 ? 16.206  25.178  24.194  1.00 27.55 ? 508  GLY A O     1 
ATOM   2393 N  N     . SER D 4 269 ? 16.699  23.242  23.156  1.00 28.22 ? 509  SER A N     1 
ATOM   2394 C  CA    . SER D 4 269 ? 16.558  22.324  22.024  1.00 29.82 ? 509  SER A CA    1 
ATOM   2395 C  C     . SER D 4 269 ? 15.161  21.691  21.935  1.00 31.10 ? 509  SER A C     1 
ATOM   2396 O  O     . SER D 4 269 ? 14.300  21.926  22.784  1.00 30.71 ? 509  SER A O     1 
ATOM   2397 C  CB    . SER D 4 269 ? 17.589  21.203  22.142  1.00 30.62 ? 509  SER A CB    1 
ATOM   2398 O  OG    . SER D 4 269 ? 17.212  20.318  23.181  1.00 31.24 ? 509  SER A OG    1 
ATOM   2399 N  N     . ALA D 4 270 ? 14.951  20.883  20.899  1.00 30.41 ? 510  ALA A N     1 
ATOM   2400 C  CA    . ALA D 4 270 ? 13.678  20.198  20.696  1.00 30.65 ? 510  ALA A CA    1 
ATOM   2401 C  C     . ALA D 4 270 ? 13.345  19.321  21.900  1.00 30.55 ? 510  ALA A C     1 
ATOM   2402 O  O     . ALA D 4 270 ? 12.256  19.426  22.476  1.00 31.09 ? 510  ALA A O     1 
ATOM   2403 C  CB    . ALA D 4 270 ? 13.738  19.341  19.427  1.00 29.77 ? 510  ALA A CB    1 
ATOM   2404 N  N     . HIS D 4 271 ? 14.279  18.446  22.269  1.00 29.26 ? 511  HIS A N     1 
ATOM   2405 C  CA    A HIS D 4 271 ? 14.081  17.563  23.415  0.50 29.61 ? 511  HIS A CA    1 
ATOM   2406 C  CA    B HIS D 4 271 ? 14.163  17.521  23.419  0.50 41.81 ? 511  HIS A CA    1 
ATOM   2407 C  C     . HIS D 4 271 ? 13.827  18.386  24.675  1.00 28.70 ? 511  HIS A C     1 
ATOM   2408 O  O     . HIS D 4 271 ? 13.028  17.998  25.521  1.00 25.87 ? 511  HIS A O     1 
ATOM   2409 C  CB    A HIS D 4 271 ? 15.298  16.653  23.617  0.50 31.50 ? 511  HIS A CB    1 
ATOM   2410 C  CB    B HIS D 4 271 ? 15.308  16.530  23.658  0.50 43.10 ? 511  HIS A CB    1 
ATOM   2411 C  CG    A HIS D 4 271 ? 15.397  15.549  22.608  0.50 33.90 ? 511  HIS A CG    1 
ATOM   2412 C  CG    B HIS D 4 271 ? 15.100  15.638  24.844  0.50 44.73 ? 511  HIS A CG    1 
ATOM   2413 N  ND1   A HIS D 4 271 ? 16.276  15.589  21.545  0.50 35.24 ? 511  HIS A ND1   1 
ATOM   2414 N  ND1   B HIS D 4 271 ? 15.051  16.114  26.136  0.50 45.31 ? 511  HIS A ND1   1 
ATOM   2415 C  CD2   A HIS D 4 271 ? 14.736  14.370  22.505  0.50 35.05 ? 511  HIS A CD2   1 
ATOM   2416 C  CD2   B HIS D 4 271 ? 14.919  14.298  24.930  0.50 45.60 ? 511  HIS A CD2   1 
ATOM   2417 C  CE1   A HIS D 4 271 ? 16.152  14.483  20.831  0.50 35.79 ? 511  HIS A CE1   1 
ATOM   2418 C  CE1   B HIS D 4 271 ? 14.848  15.106  26.967  0.50 45.06 ? 511  HIS A CE1   1 
ATOM   2419 N  NE2   A HIS D 4 271 ? 15.225  13.727  21.393  0.50 37.10 ? 511  HIS A NE2   1 
ATOM   2420 N  NE2   B HIS D 4 271 ? 14.765  13.995  26.261  0.50 45.47 ? 511  HIS A NE2   1 
ATOM   2421 N  N     . PHE D 4 272 ? 14.511  19.517  24.799  1.00 29.55 ? 512  PHE A N     1 
ATOM   2422 C  CA    . PHE D 4 272 ? 14.315  20.387  25.953  1.00 30.37 ? 512  PHE A CA    1 
ATOM   2423 C  C     . PHE D 4 272 ? 12.878  20.903  25.956  1.00 29.95 ? 512  PHE A C     1 
ATOM   2424 O  O     . PHE D 4 272 ? 12.210  20.881  26.989  1.00 30.28 ? 512  PHE A O     1 
ATOM   2425 C  CB    . PHE D 4 272 ? 15.300  21.559  25.919  1.00 31.53 ? 512  PHE A CB    1 
ATOM   2426 C  CG    . PHE D 4 272 ? 15.076  22.566  27.006  1.00 32.95 ? 512  PHE A CG    1 
ATOM   2427 C  CD1   . PHE D 4 272 ? 14.321  23.707  26.767  1.00 34.63 ? 512  PHE A CD1   1 
ATOM   2428 C  CD2   . PHE D 4 272 ? 15.608  22.367  28.278  1.00 35.20 ? 512  PHE A CD2   1 
ATOM   2429 C  CE1   . PHE D 4 272 ? 14.099  24.636  27.778  1.00 37.04 ? 512  PHE A CE1   1 
ATOM   2430 C  CE2   . PHE D 4 272 ? 15.388  23.293  29.296  1.00 34.12 ? 512  PHE A CE2   1 
ATOM   2431 C  CZ    . PHE D 4 272 ? 14.634  24.427  29.046  1.00 34.55 ? 512  PHE A CZ    1 
ATOM   2432 N  N     . ASN D 4 273 ? 12.398  21.361  24.802  1.00 27.82 ? 513  ASN A N     1 
ATOM   2433 C  CA    . ASN D 4 273 ? 11.019  21.851  24.706  1.00 26.80 ? 513  ASN A CA    1 
ATOM   2434 C  C     . ASN D 4 273 ? 10.009  20.769  25.099  1.00 26.60 ? 513  ASN A C     1 
ATOM   2435 O  O     . ASN D 4 273 ? 9.038   21.041  25.808  1.00 25.08 ? 513  ASN A O     1 
ATOM   2436 C  CB    . ASN D 4 273 ? 10.692  22.319  23.284  1.00 25.52 ? 513  ASN A CB    1 
ATOM   2437 C  CG    . ASN D 4 273 ? 11.322  23.649  22.944  1.00 27.78 ? 513  ASN A CG    1 
ATOM   2438 O  OD1   . ASN D 4 273 ? 11.563  24.478  23.824  1.00 29.23 ? 513  ASN A OD1   1 
ATOM   2439 N  ND2   . ASN D 4 273 ? 11.572  23.875  21.655  1.00 25.37 ? 513  ASN A ND2   1 
ATOM   2440 N  N     . ARG D 4 274 ? 10.237  19.545  24.630  1.00 23.58 ? 514  ARG A N     1 
ATOM   2441 C  CA    . ARG D 4 274 ? 9.330   18.450  24.933  1.00 27.13 ? 514  ARG A CA    1 
ATOM   2442 C  C     . ARG D 4 274 ? 9.259   18.150  26.431  1.00 27.17 ? 514  ARG A C     1 
ATOM   2443 O  O     . ARG D 4 274 ? 8.170   18.041  26.991  1.00 27.96 ? 514  ARG A O     1 
ATOM   2444 C  CB    . ARG D 4 274 ? 9.729   17.193  24.141  1.00 25.85 ? 514  ARG A CB    1 
ATOM   2445 C  CG    . ARG D 4 274 ? 9.591   17.377  22.629  1.00 30.28 ? 514  ARG A CG    1 
ATOM   2446 C  CD    . ARG D 4 274 ? 10.169  16.213  21.813  1.00 31.99 ? 514  ARG A CD    1 
ATOM   2447 N  NE    . ARG D 4 274 ? 9.260   15.076  21.747  1.00 36.02 ? 514  ARG A NE    1 
ATOM   2448 C  CZ    . ARG D 4 274 ? 9.385   14.069  20.884  1.00 42.12 ? 514  ARG A CZ    1 
ATOM   2449 N  NH1   . ARG D 4 274 ? 10.388  14.061  20.011  1.00 42.78 ? 514  ARG A NH1   1 
ATOM   2450 N  NH2   . ARG D 4 274 ? 8.501   13.076  20.879  1.00 42.64 ? 514  ARG A NH2   1 
ATOM   2451 N  N     . SER D 4 275 ? 10.406  18.023  27.088  1.00 30.09 ? 515  SER A N     1 
ATOM   2452 C  CA    . SER D 4 275 ? 10.395  17.745  28.519  1.00 32.55 ? 515  SER A CA    1 
ATOM   2453 C  C     . SER D 4 275 ? 9.764   18.921  29.266  1.00 33.11 ? 515  SER A C     1 
ATOM   2454 O  O     . SER D 4 275 ? 9.029   18.732  30.236  1.00 33.64 ? 515  SER A O     1 
ATOM   2455 C  CB    . SER D 4 275 ? 11.816  17.459  29.022  1.00 35.04 ? 515  SER A CB    1 
ATOM   2456 O  OG    . SER D 4 275 ? 12.758  18.343  28.446  1.00 40.32 ? 515  SER A OG    1 
ATOM   2457 N  N     . MET D 4 276 ? 10.019  20.139  28.796  1.00 32.37 ? 516  MET A N     1 
ATOM   2458 C  CA    . MET D 4 276 ? 9.437   21.312  29.436  1.00 33.26 ? 516  MET A CA    1 
ATOM   2459 C  C     . MET D 4 276 ? 7.911   21.247  29.317  1.00 33.09 ? 516  MET A C     1 
ATOM   2460 O  O     . MET D 4 276 ? 7.193   21.458  30.293  1.00 32.37 ? 516  MET A O     1 
ATOM   2461 C  CB    . MET D 4 276 ? 9.911   22.599  28.768  1.00 35.92 ? 516  MET A CB    1 
ATOM   2462 C  CG    . MET D 4 276 ? 11.291  23.084  29.173  1.00 41.23 ? 516  MET A CG    1 
ATOM   2463 S  SD    . MET D 4 276 ? 11.231  23.777  30.838  1.00 47.23 ? 516  MET A SD    1 
ATOM   2464 C  CE    . MET D 4 276 ? 10.661  25.426  30.485  1.00 43.23 ? 516  MET A CE    1 
ATOM   2465 N  N     . ARG D 4 277 ? 7.419   20.949  28.123  1.00 30.24 ? 517  ARG A N     1 
ATOM   2466 C  CA    . ARG D 4 277 ? 5.980   20.878  27.912  1.00 29.77 ? 517  ARG A CA    1 
ATOM   2467 C  C     . ARG D 4 277 ? 5.371   19.654  28.600  1.00 30.25 ? 517  ARG A C     1 
ATOM   2468 O  O     . ARG D 4 277 ? 4.224   19.690  29.037  1.00 29.54 ? 517  ARG A O     1 
ATOM   2469 C  CB    . ARG D 4 277 ? 5.670   20.880  26.406  1.00 28.22 ? 517  ARG A CB    1 
ATOM   2470 C  CG    . ARG D 4 277 ? 6.133   22.164  25.718  1.00 25.37 ? 517  ARG A CG    1 
ATOM   2471 C  CD    . ARG D 4 277 ? 5.919   22.172  24.203  1.00 25.46 ? 517  ARG A CD    1 
ATOM   2472 N  NE    . ARG D 4 277 ? 6.528   23.363  23.610  1.00 23.64 ? 517  ARG A NE    1 
ATOM   2473 C  CZ    . ARG D 4 277 ? 6.161   23.921  22.458  1.00 26.43 ? 517  ARG A CZ    1 
ATOM   2474 N  NH1   . ARG D 4 277 ? 5.170   23.405  21.740  1.00 23.83 ? 517  ARG A NH1   1 
ATOM   2475 N  NH2   . ARG D 4 277 ? 6.791   25.006  22.023  1.00 26.57 ? 517  ARG A NH2   1 
ATOM   2476 N  N     . ALA D 4 278 ? 6.141   18.574  28.701  1.00 30.13 ? 518  ALA A N     1 
ATOM   2477 C  CA    . ALA D 4 278 ? 5.655   17.365  29.358  1.00 32.38 ? 518  ALA A CA    1 
ATOM   2478 C  C     . ALA D 4 278 ? 5.436   17.691  30.832  1.00 33.89 ? 518  ALA A C     1 
ATOM   2479 O  O     . ALA D 4 278 ? 4.468   17.232  31.443  1.00 30.89 ? 518  ALA A O     1 
ATOM   2480 C  CB    . ALA D 4 278 ? 6.680   16.232  29.222  1.00 31.12 ? 518  ALA A CB    1 
ATOM   2481 N  N     . LEU D 4 279 ? 6.350   18.490  31.386  1.00 35.35 ? 519  LEU A N     1 
ATOM   2482 C  CA    . LEU D 4 279 ? 6.283   18.896  32.784  1.00 37.37 ? 519  LEU A CA    1 
ATOM   2483 C  C     . LEU D 4 279 ? 5.077   19.788  33.026  1.00 38.32 ? 519  LEU A C     1 
ATOM   2484 O  O     . LEU D 4 279 ? 4.303   19.557  33.955  1.00 39.76 ? 519  LEU A O     1 
ATOM   2485 C  CB    . LEU D 4 279 ? 7.551   19.652  33.187  1.00 39.86 ? 519  LEU A CB    1 
ATOM   2486 C  CG    . LEU D 4 279 ? 7.522   20.264  34.596  1.00 41.95 ? 519  LEU A CG    1 
ATOM   2487 C  CD1   . LEU D 4 279 ? 7.564   19.159  35.651  1.00 41.53 ? 519  LEU A CD1   1 
ATOM   2488 C  CD2   . LEU D 4 279 ? 8.702   21.196  34.768  1.00 42.42 ? 519  LEU A CD2   1 
ATOM   2489 N  N     . ALA D 4 280 ? 4.920   20.813  32.195  1.00 36.82 ? 520  ALA A N     1 
ATOM   2490 C  CA    . ALA D 4 280 ? 3.793   21.720  32.347  1.00 36.52 ? 520  ALA A CA    1 
ATOM   2491 C  C     . ALA D 4 280 ? 2.494   20.923  32.398  1.00 36.88 ? 520  ALA A C     1 
ATOM   2492 O  O     . ALA D 4 280 ? 1.607   21.219  33.198  1.00 38.06 ? 520  ALA A O     1 
ATOM   2493 C  CB    . ALA D 4 280 ? 3.755   22.713  31.193  1.00 34.19 ? 520  ALA A CB    1 
ATOM   2494 N  N     . LYS D 4 281 ? 2.387   19.909  31.545  1.00 37.03 ? 521  LYS A N     1 
ATOM   2495 C  CA    . LYS D 4 281 ? 1.189   19.081  31.495  1.00 38.98 ? 521  LYS A CA    1 
ATOM   2496 C  C     . LYS D 4 281 ? 0.910   18.376  32.824  1.00 40.39 ? 521  LYS A C     1 
ATOM   2497 O  O     . LYS D 4 281 ? -0.249  18.232  33.219  1.00 40.90 ? 521  LYS A O     1 
ATOM   2498 C  CB    . LYS D 4 281 ? 1.296   18.047  30.370  1.00 39.68 ? 521  LYS A CB    1 
ATOM   2499 C  CG    . LYS D 4 281 ? 0.094   17.112  30.285  1.00 41.58 ? 521  LYS A CG    1 
ATOM   2500 C  CD    . LYS D 4 281 ? 0.139   16.206  29.059  1.00 42.34 ? 521  LYS A CD    1 
ATOM   2501 C  CE    . LYS D 4 281 ? -0.110  16.983  27.772  1.00 43.42 ? 521  LYS A CE    1 
ATOM   2502 N  NZ    . LYS D 4 281 ? -0.256  16.069  26.590  1.00 44.38 ? 521  LYS A NZ    1 
ATOM   2503 N  N     . THR D 4 282 ? 1.961   17.934  33.512  1.00 40.94 ? 522  THR A N     1 
ATOM   2504 C  CA    . THR D 4 282 ? 1.783   17.266  34.800  1.00 42.14 ? 522  THR A CA    1 
ATOM   2505 C  C     . THR D 4 282 ? 1.193   18.246  35.821  1.00 43.17 ? 522  THR A C     1 
ATOM   2506 O  O     . THR D 4 282 ? 0.429   17.849  36.706  1.00 43.83 ? 522  THR A O     1 
ATOM   2507 C  CB    . THR D 4 282 ? 3.121   16.717  35.368  1.00 41.81 ? 522  THR A CB    1 
ATOM   2508 O  OG1   . THR D 4 282 ? 3.987   17.807  35.707  1.00 40.42 ? 522  THR A OG1   1 
ATOM   2509 C  CG2   . THR D 4 282 ? 3.815   15.824  34.346  1.00 40.92 ? 522  THR A CG2   1 
ATOM   2510 N  N     . LYS D 4 283 ? 1.543   19.524  35.690  1.00 42.65 ? 523  LYS A N     1 
ATOM   2511 C  CA    . LYS D 4 283 ? 1.052   20.558  36.603  1.00 42.56 ? 523  LYS A CA    1 
ATOM   2512 C  C     . LYS D 4 283 ? -0.257  21.187  36.136  1.00 42.99 ? 523  LYS A C     1 
ATOM   2513 O  O     . LYS D 4 283 ? -0.602  22.291  36.561  1.00 43.41 ? 523  LYS A O     1 
ATOM   2514 C  CB    . LYS D 4 283 ? 2.088   21.664  36.761  1.00 42.39 ? 523  LYS A CB    1 
ATOM   2515 C  CG    . LYS D 4 283 ? 3.436   21.194  37.258  1.00 44.52 ? 523  LYS A CG    1 
ATOM   2516 C  CD    . LYS D 4 283 ? 4.427   22.343  37.234  1.00 46.84 ? 523  LYS A CD    1 
ATOM   2517 C  CE    . LYS D 4 283 ? 5.744   21.948  37.871  1.00 48.84 ? 523  LYS A CE    1 
ATOM   2518 N  NZ    . LYS D 4 283 ? 5.558   21.601  39.305  1.00 51.37 ? 523  LYS A NZ    1 
ATOM   2519 N  N     . GLY D 4 284 ? -0.979  20.493  35.260  1.00 42.03 ? 524  GLY A N     1 
ATOM   2520 C  CA    . GLY D 4 284 ? -2.238  21.023  34.767  1.00 39.95 ? 524  GLY A CA    1 
ATOM   2521 C  C     . GLY D 4 284 ? -2.071  22.328  34.012  1.00 39.69 ? 524  GLY A C     1 
ATOM   2522 O  O     . GLY D 4 284 ? -2.990  23.143  33.950  1.00 39.93 ? 524  GLY A O     1 
ATOM   2523 N  N     . MET D 4 285 ? -0.890  22.526  33.439  1.00 38.99 ? 525  MET A N     1 
ATOM   2524 C  CA    . MET D 4 285 ? -0.588  23.729  32.670  1.00 37.17 ? 525  MET A CA    1 
ATOM   2525 C  C     . MET D 4 285 ? -0.302  23.334  31.226  1.00 35.90 ? 525  MET A C     1 
ATOM   2526 O  O     . MET D 4 285 ? -0.341  22.157  30.878  1.00 35.24 ? 525  MET A O     1 
ATOM   2527 C  CB    . MET D 4 285 ? 0.635   24.428  33.261  1.00 37.82 ? 525  MET A CB    1 
ATOM   2528 C  CG    . MET D 4 285 ? 0.470   24.825  34.723  1.00 40.03 ? 525  MET A CG    1 
ATOM   2529 S  SD    . MET D 4 285 ? 2.014   25.330  35.515  1.00 41.31 ? 525  MET A SD    1 
ATOM   2530 C  CE    . MET D 4 285 ? 2.125   27.017  34.982  1.00 33.13 ? 525  MET A CE    1 
ATOM   2531 N  N     . SER D 4 286 ? -0.008  24.316  30.384  1.00 34.48 ? 526  SER A N     1 
ATOM   2532 C  CA    . SER D 4 286 ? 0.300   24.026  28.994  1.00 34.06 ? 526  SER A CA    1 
ATOM   2533 C  C     . SER D 4 286 ? 1.211   25.101  28.423  1.00 32.90 ? 526  SER A C     1 
ATOM   2534 O  O     . SER D 4 286 ? 0.934   26.293  28.550  1.00 32.30 ? 526  SER A O     1 
ATOM   2535 C  CB    . SER D 4 286 ? -0.984  23.936  28.172  1.00 36.43 ? 526  SER A CB    1 
ATOM   2536 O  OG    . SER D 4 286 ? -0.705  23.486  26.861  1.00 37.84 ? 526  SER A OG    1 
ATOM   2537 N  N     . LEU D 4 287 ? 2.303   24.670  27.799  1.00 31.08 ? 527  LEU A N     1 
ATOM   2538 C  CA    . LEU D 4 287 ? 3.261   25.597  27.211  1.00 30.87 ? 527  LEU A CA    1 
ATOM   2539 C  C     . LEU D 4 287 ? 3.395   25.393  25.703  1.00 30.49 ? 527  LEU A C     1 
ATOM   2540 O  O     . LEU D 4 287 ? 3.530   24.267  25.218  1.00 29.41 ? 527  LEU A O     1 
ATOM   2541 C  CB    . LEU D 4 287 ? 4.640   25.429  27.871  1.00 29.45 ? 527  LEU A CB    1 
ATOM   2542 C  CG    . LEU D 4 287 ? 5.777   26.256  27.250  1.00 30.64 ? 527  LEU A CG    1 
ATOM   2543 C  CD1   . LEU D 4 287 ? 5.539   27.742  27.512  1.00 31.57 ? 527  LEU A CD1   1 
ATOM   2544 C  CD2   . LEU D 4 287 ? 7.113   25.824  27.829  1.00 29.05 ? 527  LEU A CD2   1 
ATOM   2545 N  N     . SER D 4 288 ? 3.356   26.500  24.972  1.00 29.62 ? 528  SER A N     1 
ATOM   2546 C  CA    . SER D 4 288 ? 3.491   26.477  23.529  1.00 29.98 ? 528  SER A CA    1 
ATOM   2547 C  C     . SER D 4 288 ? 4.339   27.679  23.150  1.00 29.94 ? 528  SER A C     1 
ATOM   2548 O  O     . SER D 4 288 ? 4.720   28.477  24.008  1.00 30.22 ? 528  SER A O     1 
ATOM   2549 C  CB    . SER D 4 288 ? 2.121   26.591  22.856  1.00 30.12 ? 528  SER A CB    1 
ATOM   2550 O  OG    . SER D 4 288 ? 1.622   27.915  22.956  1.00 31.18 ? 528  SER A OG    1 
ATOM   2551 N  N     . GLU D 4 289 ? 4.635   27.799  21.863  1.00 29.08 ? 529  GLU A N     1 
ATOM   2552 C  CA    . GLU D 4 289 ? 5.418   28.912  21.361  1.00 28.03 ? 529  GLU A CA    1 
ATOM   2553 C  C     . GLU D 4 289 ? 4.605   30.196  21.485  1.00 28.01 ? 529  GLU A C     1 
ATOM   2554 O  O     . GLU D 4 289 ? 5.130   31.295  21.308  1.00 26.97 ? 529  GLU A O     1 
ATOM   2555 C  CB    . GLU D 4 289 ? 5.785   28.670  19.899  1.00 27.18 ? 529  GLU A CB    1 
ATOM   2556 C  CG    . GLU D 4 289 ? 4.684   27.977  19.095  1.00 29.91 ? 529  GLU A CG    1 
ATOM   2557 C  CD    . GLU D 4 289 ? 4.847   26.459  19.050  1.00 29.50 ? 529  GLU A CD    1 
ATOM   2558 O  OE1   . GLU D 4 289 ? 4.830   25.812  20.119  1.00 31.22 ? 529  GLU A OE1   1 
ATOM   2559 O  OE2   . GLU D 4 289 ? 4.997   25.915  17.938  1.00 28.90 ? 529  GLU A OE2   1 
ATOM   2560 N  N     . HIS D 4 290 ? 3.317   30.051  21.781  1.00 27.81 ? 530  HIS A N     1 
ATOM   2561 C  CA    . HIS D 4 290 ? 2.443   31.210  21.927  1.00 30.46 ? 530  HIS A CA    1 
ATOM   2562 C  C     . HIS D 4 290 ? 2.365   31.681  23.378  1.00 30.73 ? 530  HIS A C     1 
ATOM   2563 O  O     . HIS D 4 290 ? 2.372   32.880  23.642  1.00 30.47 ? 530  HIS A O     1 
ATOM   2564 C  CB    . HIS D 4 290 ? 1.029   30.896  21.409  1.00 27.52 ? 530  HIS A CB    1 
ATOM   2565 C  CG    . HIS D 4 290 ? 0.935   30.810  19.915  1.00 30.39 ? 530  HIS A CG    1 
ATOM   2566 N  ND1   . HIS D 4 290 ? 1.300   31.849  19.086  1.00 28.59 ? 530  HIS A ND1   1 
ATOM   2567 C  CD2   . HIS D 4 290 ? 0.518   29.809  19.100  1.00 28.51 ? 530  HIS A CD2   1 
ATOM   2568 C  CE1   . HIS D 4 290 ? 1.112   31.493  17.827  1.00 30.79 ? 530  HIS A CE1   1 
ATOM   2569 N  NE2   . HIS D 4 290 ? 0.639   30.260  17.808  1.00 30.61 ? 530  HIS A NE2   1 
ATOM   2570 N  N     . ALA D 4 291 ? 2.266   30.747  24.320  1.00 31.45 ? 531  ALA A N     1 
ATOM   2571 C  CA    . ALA D 4 291 ? 2.152   31.143  25.726  1.00 32.89 ? 531  ALA A CA    1 
ATOM   2572 C  C     . ALA D 4 291 ? 2.115   29.989  26.709  1.00 33.16 ? 531  ALA A C     1 
ATOM   2573 O  O     . ALA D 4 291 ? 1.990   28.818  26.325  1.00 33.37 ? 531  ALA A O     1 
ATOM   2574 C  CB    . ALA D 4 291 ? 0.900   31.993  25.915  1.00 34.80 ? 531  ALA A CB    1 
ATOM   2575 N  N     . LEU D 4 292 ? 2.204   30.338  27.993  1.00 31.27 ? 532  LEU A N     1 
ATOM   2576 C  CA    . LEU D 4 292 ? 2.158   29.357  29.072  1.00 31.78 ? 532  LEU A CA    1 
ATOM   2577 C  C     . LEU D 4 292 ? 0.765   29.530  29.675  1.00 32.67 ? 532  LEU A C     1 
ATOM   2578 O  O     . LEU D 4 292 ? 0.382   30.641  30.059  1.00 31.90 ? 532  LEU A O     1 
ATOM   2579 C  CB    . LEU D 4 292 ? 3.219   29.615  30.148  1.00 31.39 ? 532  LEU A CB    1 
ATOM   2580 C  CG    . LEU D 4 292 ? 3.104   28.725  31.390  1.00 33.70 ? 532  LEU A CG    1 
ATOM   2581 C  CD1   . LEU D 4 292 ? 3.278   27.256  30.996  1.00 34.09 ? 532  LEU A CD1   1 
ATOM   2582 C  CD2   . LEU D 4 292 ? 4.151   29.137  32.417  1.00 32.85 ? 532  LEU A CD2   1 
ATOM   2583 N  N     . SER D 4 293 ? 0.009   28.439  29.746  1.00 33.00 ? 533  SER A N     1 
ATOM   2584 C  CA    . SER D 4 293 ? -1.340  28.481  30.293  1.00 35.31 ? 533  SER A CA    1 
ATOM   2585 C  C     . SER D 4 293 ? -1.479  27.638  31.557  1.00 37.07 ? 533  SER A C     1 
ATOM   2586 O  O     . SER D 4 293 ? -0.800  26.624  31.727  1.00 35.79 ? 533  SER A O     1 
ATOM   2587 C  CB    . SER D 4 293 ? -2.351  27.996  29.249  1.00 35.22 ? 533  SER A CB    1 
ATOM   2588 O  OG    . SER D 4 293 ? -2.371  28.855  28.122  1.00 37.20 ? 533  SER A OG    1 
ATOM   2589 N  N     . THR D 4 294 ? -2.375  28.070  32.437  1.00 39.60 ? 534  THR A N     1 
ATOM   2590 C  CA    . THR D 4 294 ? -2.632  27.380  33.693  1.00 42.31 ? 534  THR A CA    1 
ATOM   2591 C  C     . THR D 4 294 ? -4.096  26.956  33.688  1.00 44.25 ? 534  THR A C     1 
ATOM   2592 O  O     . THR D 4 294 ? -4.879  27.428  32.865  1.00 45.87 ? 534  THR A O     1 
ATOM   2593 C  CB    . THR D 4 294 ? -2.355  28.321  34.903  1.00 42.94 ? 534  THR A CB    1 
ATOM   2594 O  OG1   . THR D 4 294 ? -2.482  27.594  36.132  1.00 42.67 ? 534  THR A OG1   1 
ATOM   2595 C  CG2   . THR D 4 294 ? -3.333  29.486  34.904  1.00 43.11 ? 534  THR A CG2   1 
ATOM   2596 N  N     . ALA D 4 295 ? -4.463  26.057  34.593  1.00 47.16 ? 535  ALA A N     1 
ATOM   2597 C  CA    . ALA D 4 295 ? -5.841  25.588  34.680  1.00 48.91 ? 535  ALA A CA    1 
ATOM   2598 C  C     . ALA D 4 295 ? -6.347  25.026  33.347  1.00 50.35 ? 535  ALA A C     1 
ATOM   2599 O  O     . ALA D 4 295 ? -7.490  25.273  32.950  1.00 50.07 ? 535  ALA A O     1 
ATOM   2600 C  CB    . ALA D 4 295 ? -6.751  26.729  35.147  1.00 48.83 ? 535  ALA A CB    1 
ATOM   2601 N  N     . VAL D 4 296 ? -5.492  24.279  32.655  1.00 51.57 ? 536  VAL A N     1 
ATOM   2602 C  CA    . VAL D 4 296 ? -5.878  23.679  31.381  1.00 51.41 ? 536  VAL A CA    1 
ATOM   2603 C  C     . VAL D 4 296 ? -6.637  22.392  31.673  1.00 52.19 ? 536  VAL A C     1 
ATOM   2604 O  O     . VAL D 4 296 ? -6.237  21.614  32.539  1.00 52.56 ? 536  VAL A O     1 
ATOM   2605 C  CB    . VAL D 4 296 ? -4.645  23.345  30.521  1.00 50.31 ? 536  VAL A CB    1 
ATOM   2606 C  CG1   . VAL D 4 296 ? -5.085  22.704  29.215  1.00 49.84 ? 536  VAL A CG1   1 
ATOM   2607 C  CG2   . VAL D 4 296 ? -3.842  24.606  30.256  1.00 49.38 ? 536  VAL A CG2   1 
ATOM   2608 N  N     . VAL D 4 297 ? -7.734  22.174  30.957  1.00 53.31 ? 537  VAL A N     1 
ATOM   2609 C  CA    . VAL D 4 297 ? -8.543  20.976  31.153  1.00 54.26 ? 537  VAL A CA    1 
ATOM   2610 C  C     . VAL D 4 297 ? -8.255  19.921  30.087  1.00 55.16 ? 537  VAL A C     1 
ATOM   2611 O  O     . VAL D 4 297 ? -8.414  20.175  28.893  1.00 54.91 ? 537  VAL A O     1 
ATOM   2612 C  CB    . VAL D 4 297 ? -10.050 21.311  31.120  1.00 54.98 ? 537  VAL A CB    1 
ATOM   2613 C  CG1   . VAL D 4 297 ? -10.872 20.045  31.352  1.00 55.25 ? 537  VAL A CG1   1 
ATOM   2614 C  CG2   . VAL D 4 297 ? -10.370 22.365  32.171  1.00 53.55 ? 537  VAL A CG2   1 
ATOM   2615 N  N     . ARG D 4 298 ? -7.830  18.741  30.529  1.00 55.09 ? 538  ARG A N     1 
ATOM   2616 C  CA    . ARG D 4 298 ? -7.521  17.638  29.624  1.00 56.78 ? 538  ARG A CA    1 
ATOM   2617 C  C     . ARG D 4 298 ? -8.338  16.407  30.003  1.00 57.83 ? 538  ARG A C     1 
ATOM   2618 O  O     . ARG D 4 298 ? -8.723  16.244  31.161  1.00 58.11 ? 538  ARG A O     1 
ATOM   2619 C  CB    . ARG D 4 298 ? -6.031  17.281  29.692  1.00 56.00 ? 538  ARG A CB    1 
ATOM   2620 C  CG    . ARG D 4 298 ? -5.080  18.370  29.228  1.00 54.88 ? 538  ARG A CG    1 
ATOM   2621 C  CD    . ARG D 4 298 ? -3.650  17.848  29.211  1.00 53.85 ? 538  ARG A CD    1 
ATOM   2622 N  NE    . ARG D 4 298 ? -2.690  18.826  28.704  1.00 53.65 ? 538  ARG A NE    1 
ATOM   2623 C  CZ    . ARG D 4 298 ? -2.244  19.874  29.390  1.00 53.31 ? 538  ARG A CZ    1 
ATOM   2624 N  NH1   . ARG D 4 298 ? -2.670  20.094  30.628  1.00 53.33 ? 538  ARG A NH1   1 
ATOM   2625 N  NH2   . ARG D 4 298 ? -1.363  20.700  28.839  1.00 51.51 ? 538  ARG A NH2   1 
ATOM   2626 N  N     . ASN D 4 299 ? -8.603  15.551  29.014  1.00 58.21 ? 539  ASN A N     1 
ATOM   2627 C  CA    . ASN D 4 299 ? -9.359  14.323  29.250  1.00 59.77 ? 539  ASN A CA    1 
ATOM   2628 C  C     . ASN D 4 299 ? -8.446  13.195  29.741  1.00 60.75 ? 539  ASN A C     1 
ATOM   2629 O  O     . ASN D 4 299 ? -7.281  13.432  30.083  1.00 60.33 ? 539  ASN A O     1 
ATOM   2630 C  CB    . ASN D 4 299 ? -10.093 13.873  27.975  1.00 59.54 ? 539  ASN A CB    1 
ATOM   2631 C  CG    . ASN D 4 299 ? -9.180  13.742  26.774  1.00 59.96 ? 539  ASN A CG    1 
ATOM   2632 O  OD1   . ASN D 4 299 ? -8.081  13.196  26.869  1.00 60.33 ? 539  ASN A OD1   1 
ATOM   2633 N  ND2   . ASN D 4 299 ? -9.638  14.229  25.632  1.00 60.97 ? 539  ASN A ND2   1 
ATOM   2634 N  N     . THR D 4 300 ? -8.982  11.977  29.765  1.00 61.86 ? 540  THR A N     1 
ATOM   2635 C  CA    . THR D 4 300 ? -8.252  10.793  30.219  1.00 62.75 ? 540  THR A CA    1 
ATOM   2636 C  C     . THR D 4 300 ? -7.092  10.444  29.289  1.00 62.71 ? 540  THR A C     1 
ATOM   2637 O  O     . THR D 4 300 ? -6.184  9.697   29.664  1.00 62.54 ? 540  THR A O     1 
ATOM   2638 C  CB    . THR D 4 300 ? -9.189  9.563   30.299  1.00 63.09 ? 540  THR A CB    1 
ATOM   2639 O  OG1   . THR D 4 300 ? -10.331 9.877   31.104  1.00 64.72 ? 540  THR A OG1   1 
ATOM   2640 C  CG2   . THR D 4 300 ? -8.463  8.376   30.916  1.00 64.48 ? 540  THR A CG2   1 
ATOM   2641 N  N     . HIS D 4 301 ? -7.126  10.991  28.079  1.00 61.93 ? 541  HIS A N     1 
ATOM   2642 C  CA    . HIS D 4 301 ? -6.094  10.723  27.087  1.00 61.96 ? 541  HIS A CA    1 
ATOM   2643 C  C     . HIS D 4 301 ? -5.125  11.893  26.940  1.00 61.27 ? 541  HIS A C     1 
ATOM   2644 O  O     . HIS D 4 301 ? -4.384  11.981  25.958  1.00 60.80 ? 541  HIS A O     1 
ATOM   2645 C  CB    . HIS D 4 301 ? -6.761  10.416  25.749  1.00 63.55 ? 541  HIS A CB    1 
ATOM   2646 C  CG    . HIS D 4 301 ? -7.916  9.470   25.863  1.00 65.56 ? 541  HIS A CG    1 
ATOM   2647 N  ND1   . HIS D 4 301 ? -7.758  8.133   26.161  1.00 66.80 ? 541  HIS A ND1   1 
ATOM   2648 C  CD2   . HIS D 4 301 ? -9.251  9.677   25.763  1.00 65.82 ? 541  HIS A CD2   1 
ATOM   2649 C  CE1   . HIS D 4 301 ? -8.945  7.558   26.239  1.00 67.00 ? 541  HIS A CE1   1 
ATOM   2650 N  NE2   . HIS D 4 301 ? -9.868  8.473   26.002  1.00 66.05 ? 541  HIS A NE2   1 
ATOM   2651 N  N     . GLY D 4 302 ? -5.134  12.785  27.926  1.00 60.28 ? 542  GLY A N     1 
ATOM   2652 C  CA    . GLY D 4 302 ? -4.253  13.940  27.898  1.00 59.56 ? 542  GLY A CA    1 
ATOM   2653 C  C     . GLY D 4 302 ? -4.583  14.936  26.802  1.00 58.40 ? 542  GLY A C     1 
ATOM   2654 O  O     . GLY D 4 302 ? -3.739  15.741  26.410  1.00 57.69 ? 542  GLY A O     1 
ATOM   2655 N  N     . ALA D 4 303 ? -5.813  14.885  26.303  1.00 58.41 ? 543  ALA A N     1 
ATOM   2656 C  CA    . ALA D 4 303 ? -6.238  15.792  25.243  1.00 58.95 ? 543  ALA A CA    1 
ATOM   2657 C  C     . ALA D 4 303 ? -6.872  17.047  25.833  1.00 59.10 ? 543  ALA A C     1 
ATOM   2658 O  O     . ALA D 4 303 ? -7.769  16.966  26.674  1.00 58.97 ? 543  ALA A O     1 
ATOM   2659 C  CB    . ALA D 4 303 ? -7.221  15.090  24.317  1.00 58.55 ? 543  ALA A CB    1 
ATOM   2660 N  N     . LYS D 4 304 ? -6.405  18.199  25.368  1.00 58.86 ? 544  LYS A N     1 
ATOM   2661 C  CA    . LYS D 4 304 ? -6.910  19.474  25.846  1.00 59.71 ? 544  LYS A CA    1 
ATOM   2662 C  C     . LYS D 4 304 ? -8.396  19.657  25.534  1.00 59.62 ? 544  LYS A C     1 
ATOM   2663 O  O     . LYS D 4 304 ? -8.788  19.813  24.376  1.00 60.25 ? 544  LYS A O     1 
ATOM   2664 C  CB    . LYS D 4 304 ? -6.090  20.621  25.243  1.00 59.29 ? 544  LYS A CB    1 
ATOM   2665 C  CG    . LYS D 4 304 ? -6.413  21.998  25.817  1.00 59.73 ? 544  LYS A CG    1 
ATOM   2666 C  CD    . LYS D 4 304 ? -5.218  22.968  25.761  1.00 60.24 ? 544  LYS A CD    1 
ATOM   2667 C  CE    . LYS D 4 304 ? -4.786  23.344  24.342  1.00 61.18 ? 544  LYS A CE    1 
ATOM   2668 N  NZ    . LYS D 4 304 ? -4.005  22.270  23.649  1.00 62.28 ? 544  LYS A NZ    1 
ATOM   2669 N  N     . VAL D 4 305 ? -9.215  19.604  26.575  1.00 58.94 ? 545  VAL A N     1 
ATOM   2670 C  CA    . VAL D 4 305 ? -10.654 19.794  26.430  1.00 58.78 ? 545  VAL A CA    1 
ATOM   2671 C  C     . VAL D 4 305 ? -11.011 21.209  26.893  1.00 58.91 ? 545  VAL A C     1 
ATOM   2672 O  O     . VAL D 4 305 ? -11.996 21.796  26.441  1.00 59.16 ? 545  VAL A O     1 
ATOM   2673 C  CB    . VAL D 4 305 ? -11.405 18.761  27.261  1.00 58.42 ? 545  VAL A CB    1 
ATOM   2674 N  N     . GLY D 4 306 ? -10.196 21.742  27.800  1.00 58.27 ? 546  GLY A N     1 
ATOM   2675 C  CA    . GLY D 4 306 ? -10.405 23.082  28.318  1.00 57.42 ? 546  GLY A CA    1 
ATOM   2676 C  C     . GLY D 4 306 ? -9.170  23.914  28.031  1.00 56.82 ? 546  GLY A C     1 
ATOM   2677 O  O     . GLY D 4 306 ? -8.054  23.422  28.190  1.00 57.75 ? 546  GLY A O     1 
ATOM   2678 N  N     . PRO D 4 307 ? -9.331  25.180  27.614  1.00 55.83 ? 547  PRO A N     1 
ATOM   2679 C  CA    . PRO D 4 307 ? -8.201  26.061  27.303  1.00 54.27 ? 547  PRO A CA    1 
ATOM   2680 C  C     . PRO D 4 307 ? -7.493  26.676  28.509  1.00 52.85 ? 547  PRO A C     1 
ATOM   2681 O  O     . PRO D 4 307 ? -6.308  27.010  28.439  1.00 52.84 ? 547  PRO A O     1 
ATOM   2682 C  CB    . PRO D 4 307 ? -8.844  27.124  26.426  1.00 54.87 ? 547  PRO A CB    1 
ATOM   2683 C  CG    . PRO D 4 307 ? -10.181 27.295  27.090  1.00 55.01 ? 547  PRO A CG    1 
ATOM   2684 C  CD    . PRO D 4 307 ? -10.612 25.859  27.344  1.00 55.59 ? 547  PRO A CD    1 
ATOM   2685 N  N     . GLY D 4 308 ? -8.214  26.832  29.612  1.00 50.94 ? 548  GLY A N     1 
ATOM   2686 C  CA    . GLY D 4 308 ? -7.610  27.439  30.784  1.00 48.92 ? 548  GLY A CA    1 
ATOM   2687 C  C     . GLY D 4 308 ? -7.313  28.896  30.480  1.00 46.28 ? 548  GLY A C     1 
ATOM   2688 O  O     . GLY D 4 308 ? -7.945  29.487  29.608  1.00 47.87 ? 548  GLY A O     1 
ATOM   2689 N  N     . ARG D 4 309 ? -6.345  29.478  31.176  1.00 44.21 ? 549  ARG A N     1 
ATOM   2690 C  CA    . ARG D 4 309 ? -6.002  30.875  30.949  1.00 41.63 ? 549  ARG A CA    1 
ATOM   2691 C  C     . ARG D 4 309 ? -4.506  31.113  30.795  1.00 39.38 ? 549  ARG A C     1 
ATOM   2692 O  O     . ARG D 4 309 ? -3.681  30.384  31.355  1.00 37.33 ? 549  ARG A O     1 
ATOM   2693 C  CB    . ARG D 4 309 ? -6.550  31.737  32.094  1.00 43.89 ? 549  ARG A CB    1 
ATOM   2694 C  CG    . ARG D 4 309 ? -6.571  31.039  33.440  1.00 44.87 ? 549  ARG A CG    1 
ATOM   2695 C  CD    . ARG D 4 309 ? -6.960  32.000  34.564  1.00 47.45 ? 549  ARG A CD    1 
ATOM   2696 N  NE    . ARG D 4 309 ? -6.068  31.852  35.712  1.00 47.42 ? 549  ARG A NE    1 
ATOM   2697 C  CZ    . ARG D 4 309 ? -6.313  31.053  36.742  1.00 47.21 ? 549  ARG A CZ    1 
ATOM   2698 N  NH1   . ARG D 4 309 ? -7.413  30.324  36.759  1.00 49.60 ? 549  ARG A NH1   1 
ATOM   2699 N  NH2   . ARG D 4 309 ? -5.474  31.002  37.765  1.00 48.77 ? 549  ARG A NH2   1 
ATOM   2700 N  N     . VAL D 4 310 ? -4.175  32.148  30.032  1.00 35.40 ? 550  VAL A N     1 
ATOM   2701 C  CA    . VAL D 4 310 ? -2.794  32.523  29.776  1.00 34.99 ? 550  VAL A CA    1 
ATOM   2702 C  C     . VAL D 4 310 ? -2.175  33.237  30.974  1.00 34.38 ? 550  VAL A C     1 
ATOM   2703 O  O     . VAL D 4 310 ? -2.809  34.089  31.596  1.00 33.81 ? 550  VAL A O     1 
ATOM   2704 C  CB    . VAL D 4 310 ? -2.696  33.460  28.548  1.00 34.65 ? 550  VAL A CB    1 
ATOM   2705 C  CG1   . VAL D 4 310 ? -1.270  33.990  28.406  1.00 33.43 ? 550  VAL A CG1   1 
ATOM   2706 C  CG2   . VAL D 4 310 ? -3.118  32.709  27.282  1.00 34.71 ? 550  VAL A CG2   1 
ATOM   2707 N  N     . LEU D 4 311 ? -0.936  32.877  31.289  1.00 34.79 ? 551  LEU A N     1 
ATOM   2708 C  CA    . LEU D 4 311 ? -0.203  33.484  32.393  1.00 36.60 ? 551  LEU A CA    1 
ATOM   2709 C  C     . LEU D 4 311 ? 0.746   34.532  31.829  1.00 38.82 ? 551  LEU A C     1 
ATOM   2710 O  O     . LEU D 4 311 ? 1.318   34.344  30.754  1.00 39.17 ? 551  LEU A O     1 
ATOM   2711 C  CB    . LEU D 4 311 ? 0.616   32.429  33.135  1.00 36.43 ? 551  LEU A CB    1 
ATOM   2712 C  CG    . LEU D 4 311 ? -0.133  31.297  33.835  1.00 37.18 ? 551  LEU A CG    1 
ATOM   2713 C  CD1   . LEU D 4 311 ? 0.857   30.221  34.269  1.00 38.41 ? 551  LEU A CD1   1 
ATOM   2714 C  CD2   . LEU D 4 311 ? -0.885  31.850  35.033  1.00 38.71 ? 551  LEU A CD2   1 
ATOM   2715 N  N     . PRO D 4 312 ? 0.920   35.659  32.538  1.00 39.66 ? 552  PRO A N     1 
ATOM   2716 C  CA    . PRO D 4 312 ? 1.828   36.699  32.046  1.00 39.37 ? 552  PRO A CA    1 
ATOM   2717 C  C     . PRO D 4 312 ? 3.275   36.220  32.115  1.00 38.99 ? 552  PRO A C     1 
ATOM   2718 O  O     . PRO D 4 312 ? 3.768   35.853  33.183  1.00 38.56 ? 552  PRO A O     1 
ATOM   2719 C  CB    . PRO D 4 312 ? 1.556   37.873  32.988  1.00 39.75 ? 552  PRO A CB    1 
ATOM   2720 C  CG    . PRO D 4 312 ? 1.167   37.190  34.267  1.00 40.74 ? 552  PRO A CG    1 
ATOM   2721 C  CD    . PRO D 4 312 ? 0.253   36.086  33.781  1.00 39.92 ? 552  PRO A CD    1 
ATOM   2722 N  N     . THR D 4 313 ? 3.947   36.208  30.970  1.00 37.80 ? 553  THR A N     1 
ATOM   2723 C  CA    . THR D 4 313 ? 5.334   35.771  30.928  1.00 36.96 ? 553  THR A CA    1 
ATOM   2724 C  C     . THR D 4 313 ? 6.190   36.718  30.100  1.00 37.83 ? 553  THR A C     1 
ATOM   2725 O  O     . THR D 4 313 ? 6.522   36.430  28.950  1.00 36.91 ? 553  THR A O     1 
ATOM   2726 C  CB    . THR D 4 313 ? 5.455   34.341  30.361  1.00 37.04 ? 553  THR A CB    1 
ATOM   2727 O  OG1   . THR D 4 313 ? 4.881   34.289  29.046  1.00 35.84 ? 553  THR A OG1   1 
ATOM   2728 C  CG2   . THR D 4 313 ? 4.742   33.351  31.271  1.00 34.64 ? 553  THR A CG2   1 
ATOM   2729 N  N     . PRO D 4 314 ? 6.553   37.875  30.681  1.00 38.41 ? 554  PRO A N     1 
ATOM   2730 C  CA    . PRO D 4 314 ? 7.378   38.874  29.998  1.00 37.27 ? 554  PRO A CA    1 
ATOM   2731 C  C     . PRO D 4 314 ? 8.796   38.404  29.692  1.00 35.57 ? 554  PRO A C     1 
ATOM   2732 O  O     . PRO D 4 314 ? 9.430   38.910  28.768  1.00 35.73 ? 554  PRO A O     1 
ATOM   2733 C  CB    . PRO D 4 314 ? 7.348   40.067  30.963  1.00 38.34 ? 554  PRO A CB    1 
ATOM   2734 C  CG    . PRO D 4 314 ? 7.157   39.426  32.296  1.00 37.67 ? 554  PRO A CG    1 
ATOM   2735 C  CD    . PRO D 4 314 ? 6.106   38.381  31.992  1.00 38.10 ? 554  PRO A CD    1 
ATOM   2736 N  N     . THR D 4 315 ? 9.293   37.439  30.461  1.00 35.41 ? 555  THR A N     1 
ATOM   2737 C  CA    . THR D 4 315 ? 10.646  36.924  30.247  1.00 34.57 ? 555  THR A CA    1 
ATOM   2738 C  C     . THR D 4 315 ? 10.700  35.411  30.389  1.00 34.03 ? 555  THR A C     1 
ATOM   2739 O  O     . THR D 4 315 ? 9.814   34.805  30.991  1.00 32.89 ? 555  THR A O     1 
ATOM   2740 C  CB    . THR D 4 315 ? 11.661  37.513  31.259  1.00 35.64 ? 555  THR A CB    1 
ATOM   2741 O  OG1   . THR D 4 315 ? 11.520  36.848  32.524  1.00 34.67 ? 555  THR A OG1   1 
ATOM   2742 C  CG2   . THR D 4 315 ? 11.434  39.006  31.433  1.00 33.06 ? 555  THR A CG2   1 
ATOM   2743 N  N     . GLU D 4 316 ? 11.753  34.812  29.838  1.00 34.16 ? 556  GLU A N     1 
ATOM   2744 C  CA    . GLU D 4 316 ? 11.934  33.368  29.902  1.00 36.45 ? 556  GLU A CA    1 
ATOM   2745 C  C     . GLU D 4 316 ? 11.997  32.929  31.357  1.00 37.55 ? 556  GLU A C     1 
ATOM   2746 O  O     . GLU D 4 316 ? 11.516  31.854  31.713  1.00 37.60 ? 556  GLU A O     1 
ATOM   2747 C  CB    . GLU D 4 316 ? 13.228  32.945  29.198  1.00 37.59 ? 556  GLU A CB    1 
ATOM   2748 C  CG    . GLU D 4 316 ? 13.319  33.284  27.717  1.00 38.47 ? 556  GLU A CG    1 
ATOM   2749 C  CD    . GLU D 4 316 ? 14.554  32.662  27.071  1.00 42.00 ? 556  GLU A CD    1 
ATOM   2750 O  OE1   . GLU D 4 316 ? 14.411  31.700  26.282  1.00 39.24 ? 556  GLU A OE1   1 
ATOM   2751 O  OE2   . GLU D 4 316 ? 15.676  33.127  27.372  1.00 43.27 ? 556  GLU A OE2   1 
ATOM   2752 N  N     . LYS D 4 317 ? 12.610  33.759  32.195  1.00 38.19 ? 557  LYS A N     1 
ATOM   2753 C  CA    . LYS D 4 317 ? 12.713  33.453  33.614  1.00 38.97 ? 557  LYS A CA    1 
ATOM   2754 C  C     . LYS D 4 317 ? 11.324  33.197  34.196  1.00 37.20 ? 557  LYS A C     1 
ATOM   2755 O  O     . LYS D 4 317 ? 11.138  32.298  35.013  1.00 37.13 ? 557  LYS A O     1 
ATOM   2756 C  CB    . LYS D 4 317 ? 13.394  34.609  34.356  1.00 41.43 ? 557  LYS A CB    1 
ATOM   2757 C  CG    . LYS D 4 317 ? 14.908  34.646  34.190  1.00 44.53 ? 557  LYS A CG    1 
ATOM   2758 C  CD    . LYS D 4 317 ? 15.497  35.922  34.772  1.00 47.68 ? 557  LYS A CD    1 
ATOM   2759 C  CE    . LYS D 4 317 ? 17.013  35.855  34.831  1.00 49.88 ? 557  LYS A CE    1 
ATOM   2760 N  NZ    . LYS D 4 317 ? 17.613  35.547  33.506  1.00 52.97 ? 557  LYS A NZ    1 
ATOM   2761 N  N     . ASP D 4 318 ? 10.346  33.983  33.764  1.00 35.95 ? 558  ASP A N     1 
ATOM   2762 C  CA    . ASP D 4 318 ? 8.983   33.807  34.251  1.00 36.08 ? 558  ASP A CA    1 
ATOM   2763 C  C     . ASP D 4 318 ? 8.436   32.417  33.929  1.00 36.28 ? 558  ASP A C     1 
ATOM   2764 O  O     . ASP D 4 318 ? 7.759   31.802  34.758  1.00 35.67 ? 558  ASP A O     1 
ATOM   2765 C  CB    . ASP D 4 318 ? 8.067   34.876  33.655  1.00 37.92 ? 558  ASP A CB    1 
ATOM   2766 C  CG    . ASP D 4 318 ? 8.371   36.264  34.192  1.00 40.45 ? 558  ASP A CG    1 
ATOM   2767 O  OD1   . ASP D 4 318 ? 8.189   36.485  35.409  1.00 40.86 ? 558  ASP A OD1   1 
ATOM   2768 O  OD2   . ASP D 4 318 ? 8.796   37.127  33.399  1.00 41.70 ? 558  ASP A OD2   1 
ATOM   2769 N  N     . VAL D 4 319 ? 8.734   31.919  32.731  1.00 34.41 ? 559  VAL A N     1 
ATOM   2770 C  CA    . VAL D 4 319 ? 8.256   30.600  32.334  1.00 32.81 ? 559  VAL A CA    1 
ATOM   2771 C  C     . VAL D 4 319 ? 8.784   29.551  33.303  1.00 33.33 ? 559  VAL A C     1 
ATOM   2772 O  O     . VAL D 4 319 ? 8.019   28.733  33.826  1.00 31.10 ? 559  VAL A O     1 
ATOM   2773 C  CB    . VAL D 4 319 ? 8.711   30.232  30.901  1.00 32.35 ? 559  VAL A CB    1 
ATOM   2774 C  CG1   . VAL D 4 319 ? 8.105   28.898  30.494  1.00 30.90 ? 559  VAL A CG1   1 
ATOM   2775 C  CG2   . VAL D 4 319 ? 8.299   31.330  29.921  1.00 27.20 ? 559  VAL A CG2   1 
ATOM   2776 N  N     . PHE D 4 320 ? 10.093  29.580  33.542  1.00 35.01 ? 560  PHE A N     1 
ATOM   2777 C  CA    . PHE D 4 320 ? 10.712  28.631  34.458  1.00 36.90 ? 560  PHE A CA    1 
ATOM   2778 C  C     . PHE D 4 320 ? 10.108  28.801  35.846  1.00 38.03 ? 560  PHE A C     1 
ATOM   2779 O  O     . PHE D 4 320 ? 9.682   27.831  36.476  1.00 38.61 ? 560  PHE A O     1 
ATOM   2780 C  CB    . PHE D 4 320 ? 12.225  28.854  34.547  1.00 38.04 ? 560  PHE A CB    1 
ATOM   2781 C  CG    . PHE D 4 320 ? 12.984  28.448  33.311  1.00 36.94 ? 560  PHE A CG    1 
ATOM   2782 C  CD1   . PHE D 4 320 ? 13.022  29.274  32.194  1.00 38.76 ? 560  PHE A CD1   1 
ATOM   2783 C  CD2   . PHE D 4 320 ? 13.677  27.246  33.276  1.00 36.96 ? 560  PHE A CD2   1 
ATOM   2784 C  CE1   . PHE D 4 320 ? 13.749  28.908  31.055  1.00 37.16 ? 560  PHE A CE1   1 
ATOM   2785 C  CE2   . PHE D 4 320 ? 14.404  26.868  32.145  1.00 37.60 ? 560  PHE A CE2   1 
ATOM   2786 C  CZ    . PHE D 4 320 ? 14.440  27.703  31.034  1.00 37.92 ? 560  PHE A CZ    1 
ATOM   2787 N  N     . ARG D 4 321 ? 10.078  30.045  36.315  1.00 38.64 ? 561  ARG A N     1 
ATOM   2788 C  CA    . ARG D 4 321 ? 9.534   30.350  37.632  1.00 38.57 ? 561  ARG A CA    1 
ATOM   2789 C  C     . ARG D 4 321 ? 8.134   29.759  37.793  1.00 38.23 ? 561  ARG A C     1 
ATOM   2790 O  O     . ARG D 4 321 ? 7.884   28.952  38.692  1.00 35.35 ? 561  ARG A O     1 
ATOM   2791 C  CB    . ARG D 4 321 ? 9.490   31.868  37.838  1.00 39.09 ? 561  ARG A CB    1 
ATOM   2792 C  CG    . ARG D 4 321 ? 9.015   32.291  39.223  1.00 42.41 ? 561  ARG A CG    1 
ATOM   2793 C  CD    . ARG D 4 321 ? 9.112   33.798  39.399  1.00 41.48 ? 561  ARG A CD    1 
ATOM   2794 N  NE    . ARG D 4 321 ? 8.334   34.516  38.396  1.00 42.44 ? 561  ARG A NE    1 
ATOM   2795 C  CZ    . ARG D 4 321 ? 7.008   34.479  38.311  1.00 43.20 ? 561  ARG A CZ    1 
ATOM   2796 N  NH1   . ARG D 4 321 ? 6.303   33.755  39.177  1.00 44.03 ? 561  ARG A NH1   1 
ATOM   2797 N  NH2   . ARG D 4 321 ? 6.387   35.166  37.359  1.00 41.14 ? 561  ARG A NH2   1 
ATOM   2798 N  N     . LEU D 4 322 ? 7.230   30.152  36.902  1.00 37.68 ? 562  LEU A N     1 
ATOM   2799 C  CA    . LEU D 4 322 ? 5.856   29.676  36.953  1.00 37.38 ? 562  LEU A CA    1 
ATOM   2800 C  C     . LEU D 4 322 ? 5.755   28.159  36.963  1.00 38.51 ? 562  LEU A C     1 
ATOM   2801 O  O     . LEU D 4 322 ? 4.798   27.602  37.502  1.00 38.23 ? 562  LEU A O     1 
ATOM   2802 C  CB    . LEU D 4 322 ? 5.069   30.256  35.782  1.00 37.34 ? 562  LEU A CB    1 
ATOM   2803 C  CG    . LEU D 4 322 ? 4.861   31.767  35.906  1.00 38.35 ? 562  LEU A CG    1 
ATOM   2804 C  CD1   . LEU D 4 322 ? 4.384   32.351  34.595  1.00 34.75 ? 562  LEU A CD1   1 
ATOM   2805 C  CD2   . LEU D 4 322 ? 3.858   32.038  37.031  1.00 38.23 ? 562  LEU A CD2   1 
ATOM   2806 N  N     . LEU D 4 323 ? 6.746   27.491  36.378  1.00 39.24 ? 563  LEU A N     1 
ATOM   2807 C  CA    . LEU D 4 323 ? 6.757   26.035  36.334  1.00 40.30 ? 563  LEU A CA    1 
ATOM   2808 C  C     . LEU D 4 323 ? 7.473   25.452  37.547  1.00 40.85 ? 563  LEU A C     1 
ATOM   2809 O  O     . LEU D 4 323 ? 7.633   24.236  37.662  1.00 40.26 ? 563  LEU A O     1 
ATOM   2810 C  CB    . LEU D 4 323 ? 7.438   25.544  35.051  1.00 39.60 ? 563  LEU A CB    1 
ATOM   2811 C  CG    . LEU D 4 323 ? 6.641   25.680  33.748  1.00 40.30 ? 563  LEU A CG    1 
ATOM   2812 C  CD1   . LEU D 4 323 ? 7.511   25.278  32.567  1.00 37.38 ? 563  LEU A CD1   1 
ATOM   2813 C  CD2   . LEU D 4 323 ? 5.393   24.804  33.819  1.00 40.37 ? 563  LEU A CD2   1 
ATOM   2814 N  N     . GLY D 4 324 ? 7.895   26.324  38.455  1.00 42.36 ? 564  GLY A N     1 
ATOM   2815 C  CA    . GLY D 4 324 ? 8.596   25.869  39.640  1.00 43.47 ? 564  GLY A CA    1 
ATOM   2816 C  C     . GLY D 4 324 ? 9.945   25.286  39.267  1.00 44.95 ? 564  GLY A C     1 
ATOM   2817 O  O     . GLY D 4 324 ? 10.374  24.277  39.830  1.00 45.11 ? 564  GLY A O     1 
ATOM   2818 N  N     . LEU D 4 325 ? 10.618  25.928  38.316  1.00 45.68 ? 565  LEU A N     1 
ATOM   2819 C  CA    . LEU D 4 325 ? 11.919  25.463  37.850  1.00 47.41 ? 565  LEU A CA    1 
ATOM   2820 C  C     . LEU D 4 325 ? 13.006  26.525  37.920  1.00 47.81 ? 565  LEU A C     1 
ATOM   2821 O  O     . LEU D 4 325 ? 12.749  27.717  37.730  1.00 48.13 ? 565  LEU A O     1 
ATOM   2822 C  CB    . LEU D 4 325 ? 11.817  24.979  36.401  1.00 47.83 ? 565  LEU A CB    1 
ATOM   2823 C  CG    . LEU D 4 325 ? 10.908  23.788  36.096  1.00 47.93 ? 565  LEU A CG    1 
ATOM   2824 C  CD1   . LEU D 4 325 ? 10.719  23.685  34.600  1.00 47.34 ? 565  LEU A CD1   1 
ATOM   2825 C  CD2   . LEU D 4 325 ? 11.512  22.511  36.649  1.00 47.01 ? 565  LEU A CD2   1 
ATOM   2826 N  N     . PRO D 4 326 ? 14.245  26.100  38.202  1.00 48.35 ? 566  PRO A N     1 
ATOM   2827 C  CA    . PRO D 4 326 ? 15.341  27.064  38.272  1.00 48.59 ? 566  PRO A CA    1 
ATOM   2828 C  C     . PRO D 4 326 ? 15.687  27.414  36.831  1.00 48.90 ? 566  PRO A C     1 
ATOM   2829 O  O     . PRO D 4 326 ? 15.683  26.543  35.958  1.00 49.14 ? 566  PRO A O     1 
ATOM   2830 C  CB    . PRO D 4 326 ? 16.445  26.277  38.972  1.00 48.12 ? 566  PRO A CB    1 
ATOM   2831 C  CG    . PRO D 4 326 ? 16.212  24.877  38.479  1.00 47.68 ? 566  PRO A CG    1 
ATOM   2832 C  CD    . PRO D 4 326 ? 14.705  24.741  38.548  1.00 47.94 ? 566  PRO A CD    1 
ATOM   2833 N  N     . TYR D 4 327 ? 15.965  28.686  36.577  1.00 48.17 ? 567  TYR A N     1 
ATOM   2834 C  CA    . TYR D 4 327 ? 16.291  29.128  35.232  1.00 48.46 ? 567  TYR A CA    1 
ATOM   2835 C  C     . TYR D 4 327 ? 17.467  28.358  34.627  1.00 49.23 ? 567  TYR A C     1 
ATOM   2836 O  O     . TYR D 4 327 ? 18.295  27.787  35.343  1.00 49.51 ? 567  TYR A O     1 
ATOM   2837 C  CB    . TYR D 4 327 ? 16.596  30.627  35.244  1.00 47.80 ? 567  TYR A CB    1 
ATOM   2838 C  CG    . TYR D 4 327 ? 16.928  31.194  33.885  1.00 48.70 ? 567  TYR A CG    1 
ATOM   2839 C  CD1   . TYR D 4 327 ? 18.231  31.579  33.569  1.00 48.07 ? 567  TYR A CD1   1 
ATOM   2840 C  CD2   . TYR D 4 327 ? 15.941  31.340  32.908  1.00 47.72 ? 567  TYR A CD2   1 
ATOM   2841 C  CE1   . TYR D 4 327 ? 18.545  32.097  32.314  1.00 47.91 ? 567  TYR A CE1   1 
ATOM   2842 C  CE2   . TYR D 4 327 ? 16.244  31.858  31.649  1.00 47.38 ? 567  TYR A CE2   1 
ATOM   2843 C  CZ    . TYR D 4 327 ? 17.547  32.234  31.358  1.00 46.92 ? 567  TYR A CZ    1 
ATOM   2844 O  OH    . TYR D 4 327 ? 17.854  32.751  30.119  1.00 44.87 ? 567  TYR A OH    1 
ATOM   2845 N  N     . ARG D 4 328 ? 17.519  28.333  33.299  1.00 47.82 ? 568  ARG A N     1 
ATOM   2846 C  CA    . ARG D 4 328 ? 18.590  27.657  32.574  1.00 46.64 ? 568  ARG A CA    1 
ATOM   2847 C  C     . ARG D 4 328 ? 19.072  28.542  31.441  1.00 45.33 ? 568  ARG A C     1 
ATOM   2848 O  O     . ARG D 4 328 ? 18.271  29.061  30.666  1.00 44.93 ? 568  ARG A O     1 
ATOM   2849 C  CB    . ARG D 4 328 ? 18.105  26.332  31.989  1.00 46.58 ? 568  ARG A CB    1 
ATOM   2850 C  CG    . ARG D 4 328 ? 18.135  25.170  32.947  1.00 47.97 ? 568  ARG A CG    1 
ATOM   2851 C  CD    . ARG D 4 328 ? 17.558  23.934  32.289  1.00 49.67 ? 568  ARG A CD    1 
ATOM   2852 N  NE    . ARG D 4 328 ? 17.593  22.774  33.174  1.00 53.03 ? 568  ARG A NE    1 
ATOM   2853 C  CZ    . ARG D 4 328 ? 18.648  21.981  33.339  1.00 54.88 ? 568  ARG A CZ    1 
ATOM   2854 N  NH1   . ARG D 4 328 ? 19.775  22.213  32.674  1.00 55.12 ? 568  ARG A NH1   1 
ATOM   2855 N  NH2   . ARG D 4 328 ? 18.575  20.951  34.174  1.00 55.57 ? 568  ARG A NH2   1 
ATOM   2856 N  N     . GLU D 4 329 ? 20.382  28.728  31.357  1.00 44.39 ? 569  GLU A N     1 
ATOM   2857 C  CA    . GLU D 4 329 ? 20.950  29.536  30.290  1.00 44.54 ? 569  GLU A CA    1 
ATOM   2858 C  C     . GLU D 4 329 ? 20.738  28.724  29.018  1.00 40.97 ? 569  GLU A C     1 
ATOM   2859 O  O     . GLU D 4 329 ? 20.663  27.496  29.075  1.00 40.26 ? 569  GLU A O     1 
ATOM   2860 C  CB    . GLU D 4 329 ? 22.450  29.748  30.517  1.00 47.49 ? 569  GLU A CB    1 
ATOM   2861 C  CG    . GLU D 4 329 ? 22.813  30.396  31.849  1.00 52.70 ? 569  GLU A CG    1 
ATOM   2862 C  CD    . GLU D 4 329 ? 22.270  31.805  31.978  1.00 56.23 ? 569  GLU A CD    1 
ATOM   2863 O  OE1   . GLU D 4 329 ? 22.483  32.611  31.045  1.00 57.51 ? 569  GLU A OE1   1 
ATOM   2864 O  OE2   . GLU D 4 329 ? 21.638  32.111  33.013  1.00 58.83 ? 569  GLU A OE2   1 
ATOM   2865 N  N     . PRO D 4 330 ? 20.625  29.395  27.860  1.00 38.89 ? 570  PRO A N     1 
ATOM   2866 C  CA    . PRO D 4 330 ? 20.422  28.684  26.594  1.00 37.20 ? 570  PRO A CA    1 
ATOM   2867 C  C     . PRO D 4 330 ? 21.399  27.517  26.446  1.00 37.20 ? 570  PRO A C     1 
ATOM   2868 O  O     . PRO D 4 330 ? 20.999  26.400  26.126  1.00 33.91 ? 570  PRO A O     1 
ATOM   2869 C  CB    . PRO D 4 330 ? 20.653  29.773  25.557  1.00 37.18 ? 570  PRO A CB    1 
ATOM   2870 C  CG    . PRO D 4 330 ? 20.094  30.985  26.244  1.00 38.15 ? 570  PRO A CG    1 
ATOM   2871 C  CD    . PRO D 4 330 ? 20.652  30.853  27.646  1.00 37.37 ? 570  PRO A CD    1 
ATOM   2872 N  N     . ALA D 4 331 ? 22.677  27.781  26.716  1.00 37.26 ? 571  ALA A N     1 
ATOM   2873 C  CA    . ALA D 4 331 ? 23.718  26.760  26.613  1.00 37.63 ? 571  ALA A CA    1 
ATOM   2874 C  C     . ALA D 4 331 ? 23.411  25.530  27.464  1.00 39.00 ? 571  ALA A C     1 
ATOM   2875 O  O     . ALA D 4 331 ? 23.905  24.433  27.191  1.00 39.58 ? 571  ALA A O     1 
ATOM   2876 C  CB    . ALA D 4 331 ? 25.064  27.349  27.017  1.00 37.10 ? 571  ALA A CB    1 
ATOM   2877 N  N     . GLU D 4 332 ? 22.593  25.709  28.494  1.00 38.88 ? 572  GLU A N     1 
ATOM   2878 C  CA    . GLU D 4 332 ? 22.244  24.600  29.366  1.00 40.56 ? 572  GLU A CA    1 
ATOM   2879 C  C     . GLU D 4 332 ? 20.923  23.953  28.954  1.00 41.20 ? 572  GLU A C     1 
ATOM   2880 O  O     . GLU D 4 332 ? 20.339  23.186  29.721  1.00 39.14 ? 572  GLU A O     1 
ATOM   2881 C  CB    . GLU D 4 332 ? 22.168  25.083  30.817  1.00 41.65 ? 572  GLU A CB    1 
ATOM   2882 N  N     . ARG D 4 333 ? 20.467  24.258  27.739  1.00 42.27 ? 573  ARG A N     1 
ATOM   2883 C  CA    . ARG D 4 333 ? 19.215  23.695  27.231  1.00 44.67 ? 573  ARG A CA    1 
ATOM   2884 C  C     . ARG D 4 333 ? 19.432  22.727  26.069  1.00 46.76 ? 573  ARG A C     1 
ATOM   2885 O  O     . ARG D 4 333 ? 18.509  22.460  25.300  1.00 46.66 ? 573  ARG A O     1 
ATOM   2886 C  CB    . ARG D 4 333 ? 18.267  24.804  26.770  1.00 42.85 ? 573  ARG A CB    1 
ATOM   2887 C  CG    . ARG D 4 333 ? 17.893  25.825  27.839  1.00 41.85 ? 573  ARG A CG    1 
ATOM   2888 C  CD    . ARG D 4 333 ? 17.099  26.958  27.212  1.00 40.41 ? 573  ARG A CD    1 
ATOM   2889 N  NE    . ARG D 4 333 ? 17.126  28.180  28.009  1.00 40.70 ? 573  ARG A NE    1 
ATOM   2890 C  CZ    . ARG D 4 333 ? 16.598  29.336  27.617  1.00 39.62 ? 573  ARG A CZ    1 
ATOM   2891 N  NH1   . ARG D 4 333 ? 15.998  29.423  26.437  1.00 37.19 ? 573  ARG A NH1   1 
ATOM   2892 N  NH2   . ARG D 4 333 ? 16.684  30.406  28.398  1.00 39.32 ? 573  ARG A NH2   1 
ATOM   2893 N  N     . ASP D 4 334 ? 20.650  22.211  25.930  1.00 50.27 ? 574  ASP A N     1 
ATOM   2894 C  CA    . ASP D 4 334 ? 20.949  21.263  24.858  1.00 53.12 ? 574  ASP A CA    1 
ATOM   2895 C  C     . ASP D 4 334 ? 20.326  19.920  25.172  1.00 53.71 ? 574  ASP A C     1 
ATOM   2896 O  O     . ASP D 4 334 ? 20.741  18.896  24.638  1.00 55.12 ? 574  ASP A O     1 
ATOM   2897 C  CB    . ASP D 4 334 ? 22.458  21.085  24.688  1.00 56.50 ? 574  ASP A CB    1 
ATOM   2898 C  CG    . ASP D 4 334 ? 23.065  22.121  23.768  1.00 58.94 ? 574  ASP A CG    1 
ATOM   2899 O  OD1   . ASP D 4 334 ? 22.667  22.164  22.586  1.00 60.54 ? 574  ASP A OD1   1 
ATOM   2900 O  OD2   . ASP D 4 334 ? 23.937  22.890  24.223  1.00 62.73 ? 574  ASP A OD2   1 
ATOM   2901 N  N     . TRP D 4 335 ? 19.337  19.949  26.059  1.00 54.83 ? 575  TRP A N     1 
ATOM   2902 C  CA    . TRP D 4 335 ? 18.596  18.773  26.511  1.00 54.71 ? 575  TRP A CA    1 
ATOM   2903 C  C     . TRP D 4 335 ? 17.946  19.117  27.845  1.00 56.15 ? 575  TRP A C     1 
ATOM   2904 O  O     . TRP D 4 335 ? 18.544  19.873  28.641  1.00 57.26 ? 575  TRP A O     1 
ATOM   2905 C  CB    . TRP D 4 335 ? 19.528  17.583  26.689  1.00 54.16 ? 575  TRP A CB    1 
ATOM   2906 O  OXT   . TRP D 4 335 ? 16.830  18.611  28.092  1.00 55.48 ? 575  TRP A OXT   1 
HETATM 2907 NA NA    . NA  E 5 .   ? 11.411  -6.181  19.533  1.00 70.15 ? 503  NA  D NA    1 
HETATM 2908 MG MG    . MG  F 6 .   ? 18.490  25.613  13.820  1.00 32.05 ? 750  MG  A MG    1 
HETATM 2909 NA NA    . NA  G 5 .   ? 15.360  25.502  11.933  1.00 58.96 ? 751  NA  A NA    1 
HETATM 2910 NA NA    . NA  H 5 .   ? 13.115  14.552  5.142   1.00 19.78 ? 752  NA  A NA    1 
HETATM 2911 NA NA    . NA  I 5 .   ? 3.448   30.214  -0.555  1.00 34.56 ? 753  NA  A NA    1 
HETATM 2912 NA NA    . NA  J 5 .   ? 16.015  3.638   35.508  0.50 41.43 ? 754  NA  A NA    1 
HETATM 2913 N  N1    . DCP K 7 .   ? 11.885  22.704  17.659  1.00 25.82 ? 755  DCP A N1    1 
HETATM 2914 C  C2    . DCP K 7 .   ? 10.935  22.017  18.429  1.00 25.02 ? 755  DCP A C2    1 
HETATM 2915 N  N3    . DCP K 7 .   ? 10.573  20.765  18.066  1.00 24.19 ? 755  DCP A N3    1 
HETATM 2916 C  C4    . DCP K 7 .   ? 11.130  20.189  16.997  1.00 25.42 ? 755  DCP A C4    1 
HETATM 2917 C  C5    . DCP K 7 .   ? 12.087  20.871  16.183  1.00 24.57 ? 755  DCP A C5    1 
HETATM 2918 C  C6    . DCP K 7 .   ? 12.428  22.117  16.546  1.00 25.87 ? 755  DCP A C6    1 
HETATM 2919 O  O2    . DCP K 7 .   ? 10.451  22.571  19.432  1.00 25.52 ? 755  DCP A O2    1 
HETATM 2920 N  N4    . DCP K 7 .   ? 10.770  18.935  16.710  1.00 22.38 ? 755  DCP A N4    1 
HETATM 2921 C  "C1'" . DCP K 7 .   ? 12.300  24.053  18.083  1.00 24.35 ? 755  DCP A "C1'" 1 
HETATM 2922 C  "C2'" . DCP K 7 .   ? 13.498  24.010  19.038  1.00 23.42 ? 755  DCP A "C2'" 1 
HETATM 2923 C  "C3'" . DCP K 7 .   ? 14.661  24.226  18.076  1.00 25.89 ? 755  DCP A "C3'" 1 
HETATM 2924 C  "C4'" . DCP K 7 .   ? 14.075  25.241  17.105  1.00 24.72 ? 755  DCP A "C4'" 1 
HETATM 2925 O  "O4'" . DCP K 7 .   ? 12.702  24.793  16.936  1.00 25.14 ? 755  DCP A "O4'" 1 
HETATM 2926 O  "O3'" . DCP K 7 .   ? 15.812  24.730  18.752  1.00 26.94 ? 755  DCP A "O3'" 1 
HETATM 2927 C  "C5'" . DCP K 7 .   ? 14.742  25.338  15.751  1.00 27.91 ? 755  DCP A "C5'" 1 
HETATM 2928 O  "O5'" . DCP K 7 .   ? 14.800  24.055  15.134  1.00 26.82 ? 755  DCP A "O5'" 1 
HETATM 2929 P  PA    . DCP K 7 .   ? 16.158  23.515  14.492  1.00 28.73 ? 755  DCP A PA    1 
HETATM 2930 O  O1A   . DCP K 7 .   ? 15.773  22.273  13.785  1.00 27.79 ? 755  DCP A O1A   1 
HETATM 2931 O  O2A   . DCP K 7 .   ? 16.786  24.625  13.728  1.00 27.17 ? 755  DCP A O2A   1 
HETATM 2932 O  O3A   . DCP K 7 .   ? 17.023  23.113  15.666  1.00 30.10 ? 755  DCP A O3A   1 
HETATM 2933 P  PB    . DCP K 7 .   ? 18.349  23.664  16.145  1.00 29.87 ? 755  DCP A PB    1 
HETATM 2934 O  O1B   . DCP K 7 .   ? 18.339  23.460  17.612  1.00 29.48 ? 755  DCP A O1B   1 
HETATM 2935 O  O2B   . DCP K 7 .   ? 18.577  25.026  15.607  1.00 23.64 ? 755  DCP A O2B   1 
HETATM 2936 O  O3B   . DCP K 7 .   ? 19.403  22.724  15.623  1.00 34.62 ? 755  DCP A O3B   1 
HETATM 2937 P  PG    . DCP K 7 .   ? 20.226  22.858  14.367  1.00 42.17 ? 755  DCP A PG    1 
HETATM 2938 O  O1G   . DCP K 7 .   ? 20.359  21.470  13.836  1.00 41.90 ? 755  DCP A O1G   1 
HETATM 2939 O  O2G   . DCP K 7 .   ? 19.691  23.927  13.482  1.00 37.22 ? 755  DCP A O2G   1 
HETATM 2940 O  O3G   . DCP K 7 .   ? 21.593  23.279  14.777  1.00 37.70 ? 755  DCP A O3G   1 
HETATM 2941 O  O     . HOH L 8 .   ? -5.860  23.513  4.332   1.00 25.69 ? 12   HOH T O     1 
HETATM 2942 O  O     . HOH L 8 .   ? -3.629  3.364   30.836  1.00 37.60 ? 13   HOH T O     1 
HETATM 2943 O  O     . HOH L 8 .   ? 5.495   24.716  14.043  1.00 24.69 ? 14   HOH T O     1 
HETATM 2944 O  O     . HOH L 8 .   ? 5.186   16.118  16.707  1.00 29.57 ? 15   HOH T O     1 
HETATM 2945 O  O     . HOH L 8 .   ? 2.440   21.501  27.763  1.00 24.23 ? 16   HOH T O     1 
HETATM 2946 O  O     . HOH L 8 .   ? -0.983  31.575  10.754  1.00 29.19 ? 17   HOH T O     1 
HETATM 2947 O  O     . HOH L 8 .   ? 5.449   20.933  -1.506  1.00 30.01 ? 18   HOH T O     1 
HETATM 2948 O  O     . HOH L 8 .   ? 3.680   20.124  -4.830  1.00 32.35 ? 19   HOH T O     1 
HETATM 2949 O  O     . HOH L 8 .   ? 1.007   16.377  15.713  1.00 40.32 ? 20   HOH T O     1 
HETATM 2950 O  O     . HOH L 8 .   ? -0.885  27.646  22.267  1.00 33.26 ? 21   HOH T O     1 
HETATM 2951 O  O     . HOH L 8 .   ? 3.181   15.135  27.802  1.00 39.17 ? 22   HOH T O     1 
HETATM 2952 O  O     . HOH L 8 .   ? -1.110  21.436  14.431  1.00 38.14 ? 23   HOH T O     1 
HETATM 2953 O  O     . HOH L 8 .   ? 3.836   30.215  6.543   1.00 28.41 ? 24   HOH T O     1 
HETATM 2954 O  O     . HOH L 8 .   ? 1.348   4.777   21.331  1.00 43.51 ? 25   HOH T O     1 
HETATM 2955 O  O     . HOH L 8 .   ? 4.511   24.929  8.798   1.00 28.71 ? 26   HOH T O     1 
HETATM 2956 O  O     . HOH L 8 .   ? 3.434   9.075   29.007  1.00 39.32 ? 27   HOH T O     1 
HETATM 2957 O  O     . HOH L 8 .   ? 4.356   21.810  4.337   1.00 25.41 ? 28   HOH T O     1 
HETATM 2958 O  O     . HOH L 8 .   ? -0.729  5.948   29.113  1.00 42.18 ? 29   HOH T O     1 
HETATM 2959 O  O     . HOH L 8 .   ? 7.482   15.375  17.236  1.00 57.24 ? 30   HOH T O     1 
HETATM 2960 O  O     . HOH L 8 .   ? 8.043   8.451   26.882  1.00 50.29 ? 31   HOH T O     1 
HETATM 2961 O  O     . HOH L 8 .   ? -2.076  21.410  19.113  1.00 31.71 ? 32   HOH T O     1 
HETATM 2962 O  O     . HOH L 8 .   ? -3.564  23.045  8.612   1.00 38.59 ? 33   HOH T O     1 
HETATM 2963 O  O     . HOH L 8 .   ? 2.803   16.141  18.534  1.00 37.84 ? 34   HOH T O     1 
HETATM 2964 O  O     . HOH L 8 .   ? -3.507  24.729  1.903   1.00 33.48 ? 35   HOH T O     1 
HETATM 2965 O  O     . HOH L 8 .   ? -3.533  25.404  16.505  1.00 44.31 ? 36   HOH T O     1 
HETATM 2966 O  O     . HOH L 8 .   ? 3.318   13.736  21.568  1.00 44.92 ? 37   HOH T O     1 
HETATM 2967 O  O     . HOH L 8 .   ? -0.861  25.523  25.041  1.00 41.66 ? 38   HOH T O     1 
HETATM 2968 O  O     . HOH L 8 .   ? 0.724   3.037   23.242  1.00 46.76 ? 39   HOH T O     1 
HETATM 2969 O  O     . HOH L 8 .   ? -5.143  25.806  3.699   1.00 26.12 ? 40   HOH T O     1 
HETATM 2970 O  O     . HOH L 8 .   ? 6.451   23.200  7.890   1.00 27.25 ? 41   HOH T O     1 
HETATM 2971 O  O     . HOH L 8 .   ? 4.677   27.834  -0.633  1.00 44.12 ? 42   HOH T O     1 
HETATM 2972 O  O     . HOH L 8 .   ? -0.924  18.945  13.831  1.00 31.40 ? 43   HOH T O     1 
HETATM 2973 O  O     . HOH L 8 .   ? -2.117  22.593  16.782  1.00 38.39 ? 44   HOH T O     1 
HETATM 2974 O  O     . HOH L 8 .   ? -1.073  26.132  2.083   1.00 45.15 ? 45   HOH T O     1 
HETATM 2975 O  O     . HOH L 8 .   ? 3.122   0.903   23.697  1.00 50.96 ? 46   HOH T O     1 
HETATM 2976 O  O     . HOH L 8 .   ? 0.183   18.004  21.547  1.00 35.25 ? 47   HOH T O     1 
HETATM 2977 O  O     . HOH L 8 .   ? -3.879  19.752  -5.549  1.00 40.04 ? 48   HOH T O     1 
HETATM 2978 O  O     . HOH L 8 .   ? -3.003  6.216   30.664  1.00 44.42 ? 49   HOH T O     1 
HETATM 2979 O  O     . HOH L 8 .   ? -9.680  0.367   27.289  1.00 51.87 ? 50   HOH T O     1 
HETATM 2980 O  O     . HOH L 8 .   ? -2.360  19.087  20.398  1.00 55.16 ? 51   HOH T O     1 
HETATM 2981 O  O     . HOH L 8 .   ? 0.366   -1.672  24.943  1.00 52.47 ? 52   HOH T O     1 
HETATM 2982 O  O     . HOH L 8 .   ? 5.334   25.255  -1.325  1.00 54.39 ? 53   HOH T O     1 
HETATM 2983 O  O     . HOH L 8 .   ? -3.037  21.798  11.419  1.00 41.07 ? 54   HOH T O     1 
HETATM 2984 O  O     . HOH L 8 .   ? -3.627  27.040  19.276  1.00 53.99 ? 55   HOH T O     1 
HETATM 2985 O  O     . HOH L 8 .   ? 3.887   -1.847  26.701  1.00 64.72 ? 56   HOH T O     1 
HETATM 2986 O  O     . HOH M 8 .   ? 13.641  20.424  13.145  1.00 24.55 ? 7    HOH P O     1 
HETATM 2987 O  O     . HOH M 8 .   ? 7.262   23.397  10.732  1.00 27.71 ? 8    HOH P O     1 
HETATM 2988 O  O     . HOH M 8 .   ? -4.706  13.660  3.828   1.00 19.77 ? 9    HOH P O     1 
HETATM 2989 O  O     . HOH M 8 .   ? 14.882  15.991  6.015   1.00 26.30 ? 10   HOH P O     1 
HETATM 2990 O  O     . HOH M 8 .   ? -3.959  18.615  10.567  1.00 32.68 ? 11   HOH P O     1 
HETATM 2991 O  O     . HOH M 8 .   ? 10.405  16.079  10.484  1.00 30.24 ? 12   HOH P O     1 
HETATM 2992 O  O     . HOH M 8 .   ? 6.737   15.133  12.584  1.00 32.60 ? 13   HOH P O     1 
HETATM 2993 O  O     . HOH M 8 .   ? 9.127   16.216  14.495  1.00 31.14 ? 14   HOH P O     1 
HETATM 2994 O  O     . HOH M 8 .   ? 5.872   20.939  6.360   1.00 25.79 ? 15   HOH P O     1 
HETATM 2995 O  O     . HOH M 8 .   ? -0.903  14.963  11.238  1.00 22.08 ? 16   HOH P O     1 
HETATM 2996 O  O     . HOH M 8 .   ? 1.483   11.056  9.334   1.00 36.44 ? 17   HOH P O     1 
HETATM 2997 O  O     . HOH M 8 .   ? 5.027   10.848  9.081   1.00 32.53 ? 18   HOH P O     1 
HETATM 2998 O  O     . HOH M 8 .   ? -1.601  17.626  11.505  1.00 25.50 ? 19   HOH P O     1 
HETATM 2999 O  O     . HOH M 8 .   ? -4.776  16.087  10.960  1.00 49.09 ? 20   HOH P O     1 
HETATM 3000 O  O     . HOH M 8 .   ? 9.598   26.900  12.718  1.00 48.94 ? 21   HOH P O     1 
HETATM 3001 O  O     . HOH M 8 .   ? 4.965   14.822  14.446  1.00 41.24 ? 22   HOH P O     1 
HETATM 3002 O  O     . HOH M 8 .   ? 1.552   15.399  13.266  1.00 36.13 ? 23   HOH P O     1 
HETATM 3003 O  O     . HOH M 8 .   ? -6.796  14.101  11.788  1.00 34.54 ? 24   HOH P O     1 
HETATM 3004 O  O     . HOH M 8 .   ? 4.306   15.268  1.643   1.00 46.80 ? 25   HOH P O     1 
HETATM 3005 O  O     . HOH M 8 .   ? 13.900  17.182  7.738   1.00 34.21 ? 26   HOH P O     1 
HETATM 3006 O  O     . HOH M 8 .   ? 6.589   12.858  9.570   1.00 38.99 ? 27   HOH P O     1 
HETATM 3007 O  O     . HOH M 8 .   ? 2.150   16.177  3.288   1.00 47.04 ? 28   HOH P O     1 
HETATM 3008 O  O     . HOH M 8 .   ? 15.649  17.372  12.480  1.00 58.54 ? 29   HOH P O     1 
HETATM 3009 O  O     . HOH M 8 .   ? 12.682  13.596  7.492   1.00 25.06 ? 30   HOH P O     1 
HETATM 3010 O  O     . HOH M 8 .   ? 11.461  18.238  11.563  1.00 49.26 ? 31   HOH P O     1 
HETATM 3011 O  O     . HOH M 8 .   ? 9.253   13.266  9.265   1.00 42.30 ? 32   HOH P O     1 
HETATM 3012 O  O     . HOH M 8 .   ? 16.369  21.820  7.771   1.00 39.70 ? 33   HOH P O     1 
HETATM 3013 O  O     . HOH M 8 .   ? 4.513   17.974  3.973   1.00 51.98 ? 34   HOH P O     1 
HETATM 3014 O  O     . HOH M 8 .   ? 15.473  16.608  9.412   1.00 58.61 ? 35   HOH P O     1 
HETATM 3015 O  O     . HOH M 8 .   ? 15.924  19.414  10.392  1.00 52.02 ? 36   HOH P O     1 
HETATM 3016 O  O     . HOH M 8 .   ? -2.183  12.793  11.059  1.00 51.19 ? 37   HOH P O     1 
HETATM 3017 O  O     . HOH N 8 .   ? 9.129   -2.282  26.928  1.00 56.69 ? 110  HOH D O     1 
HETATM 3018 O  O     . HOH N 8 .   ? 7.500   3.422   37.194  1.00 53.32 ? 186  HOH D O     1 
HETATM 3019 O  O     . HOH N 8 .   ? 10.493  1.379   33.057  1.00 59.99 ? 269  HOH D O     1 
HETATM 3020 O  O     . HOH N 8 .   ? 1.296   6.196   40.049  1.00 50.81 ? 324  HOH D O     1 
HETATM 3021 O  O     . HOH N 8 .   ? 7.367   -2.125  29.110  1.00 66.00 ? 331  HOH D O     1 
HETATM 3022 O  O     . HOH O 8 .   ? 19.401  16.834  2.633   1.00 18.61 ? 756  HOH A O     1 
HETATM 3023 O  O     . HOH O 8 .   ? 23.438  20.421  -2.493  1.00 21.14 ? 757  HOH A O     1 
HETATM 3024 O  O     . HOH O 8 .   ? 12.175  33.664  -2.346  1.00 27.54 ? 758  HOH A O     1 
HETATM 3025 O  O     . HOH O 8 .   ? 17.000  20.942  18.590  1.00 26.54 ? 759  HOH A O     1 
HETATM 3026 O  O     . HOH O 8 .   ? 14.871  27.254  25.087  1.00 22.82 ? 760  HOH A O     1 
HETATM 3027 O  O     . HOH O 8 .   ? 17.404  17.823  4.943   1.00 32.21 ? 761  HOH A O     1 
HETATM 3028 O  O     . HOH O 8 .   ? 7.594   28.242  24.736  1.00 26.07 ? 762  HOH A O     1 
HETATM 3029 O  O     . HOH O 8 .   ? -0.525  27.956  26.256  1.00 35.04 ? 763  HOH A O     1 
HETATM 3030 O  O     . HOH O 8 .   ? 25.701  31.323  2.217   1.00 26.50 ? 764  HOH A O     1 
HETATM 3031 O  O     . HOH O 8 .   ? 28.544  28.974  2.847   1.00 29.89 ? 765  HOH A O     1 
HETATM 3032 O  O     . HOH O 8 .   ? 1.248   29.422  0.278   1.00 35.67 ? 766  HOH A O     1 
HETATM 3033 O  O     . HOH O 8 .   ? 27.109  17.458  -3.353  1.00 22.64 ? 767  HOH A O     1 
HETATM 3034 O  O     . HOH O 8 .   ? 26.754  27.507  -3.761  1.00 35.53 ? 768  HOH A O     1 
HETATM 3035 O  O     . HOH O 8 .   ? 11.022  9.237   14.683  1.00 32.46 ? 769  HOH A O     1 
HETATM 3036 O  O     . HOH O 8 .   ? 19.868  29.539  14.557  1.00 27.44 ? 770  HOH A O     1 
HETATM 3037 O  O     . HOH O 8 .   ? 21.727  10.785  3.570   1.00 32.54 ? 771  HOH A O     1 
HETATM 3038 O  O     . HOH O 8 .   ? 18.481  16.829  6.757   1.00 47.22 ? 772  HOH A O     1 
HETATM 3039 O  O     . HOH O 8 .   ? 5.588   35.029  26.327  1.00 27.58 ? 773  HOH A O     1 
HETATM 3040 O  O     . HOH O 8 .   ? 8.543   0.089   1.815   1.00 25.09 ? 774  HOH A O     1 
HETATM 3041 O  O     . HOH O 8 .   ? 6.890   17.792  0.789   1.00 27.32 ? 775  HOH A O     1 
HETATM 3042 O  O     . HOH O 8 .   ? 20.255  26.656  14.480  1.00 38.98 ? 776  HOH A O     1 
HETATM 3043 O  O     . HOH O 8 .   ? 17.056  17.974  20.827  1.00 32.70 ? 777  HOH A O     1 
HETATM 3044 O  O     . HOH O 8 .   ? 14.348  35.816  31.093  1.00 38.94 ? 778  HOH A O     1 
HETATM 3045 O  O     . HOH O 8 .   ? 9.140   10.763  9.079   1.00 32.14 ? 779  HOH A O     1 
HETATM 3046 O  O     . HOH O 8 .   ? 5.078   27.275  15.493  1.00 32.01 ? 780  HOH A O     1 
HETATM 3047 O  O     . HOH O 8 .   ? 5.382   31.829  -1.309  1.00 40.64 ? 781  HOH A O     1 
HETATM 3048 O  O     . HOH O 8 .   ? 2.664   34.526  25.881  1.00 38.69 ? 782  HOH A O     1 
HETATM 3049 O  O     . HOH O 8 .   ? 26.750  14.698  0.079   1.00 37.30 ? 783  HOH A O     1 
HETATM 3050 O  O     . HOH O 8 .   ? -4.663  28.019  38.366  1.00 50.30 ? 784  HOH A O     1 
HETATM 3051 O  O     . HOH O 8 .   ? 3.488   14.939  30.975  1.00 30.61 ? 785  HOH A O     1 
HETATM 3052 O  O     . HOH O 8 .   ? 3.279   34.098  15.640  1.00 39.74 ? 786  HOH A O     1 
HETATM 3053 O  O     . HOH O 8 .   ? 21.728  7.778   -7.059  1.00 41.72 ? 787  HOH A O     1 
HETATM 3054 O  O     . HOH O 8 .   ? 14.071  1.645   35.358  1.00 52.67 ? 788  HOH A O     1 
HETATM 3055 O  O     . HOH O 8 .   ? 3.760   19.781  2.352   1.00 33.36 ? 789  HOH A O     1 
HETATM 3056 O  O     . HOH O 8 .   ? -5.948  33.584  28.872  1.00 49.97 ? 790  HOH A O     1 
HETATM 3057 O  O     . HOH O 8 .   ? 27.287  20.696  -0.354  1.00 33.95 ? 791  HOH A O     1 
HETATM 3058 O  O     . HOH O 8 .   ? 30.030  35.080  15.106  1.00 37.04 ? 792  HOH A O     1 
HETATM 3059 O  O     . HOH O 8 .   ? 5.174   12.999  -0.360  1.00 31.40 ? 793  HOH A O     1 
HETATM 3060 O  O     . HOH O 8 .   ? 6.856   37.768  26.389  1.00 37.46 ? 794  HOH A O     1 
HETATM 3061 O  O     . HOH O 8 .   ? 10.565  22.896  -6.612  1.00 41.84 ? 795  HOH A O     1 
HETATM 3062 O  O     . HOH O 8 .   ? -4.211  26.938  6.011   1.00 37.76 ? 796  HOH A O     1 
HETATM 3063 O  O     . HOH O 8 .   ? 5.963   3.747   17.463  1.00 35.62 ? 797  HOH A O     1 
HETATM 3064 O  O     . HOH O 8 .   ? 16.312  34.904  29.839  1.00 48.80 ? 798  HOH A O     1 
HETATM 3065 O  O     . HOH O 8 .   ? 2.513   33.169  28.301  1.00 37.57 ? 799  HOH A O     1 
HETATM 3066 O  O     . HOH O 8 .   ? 32.257  28.722  -4.837  1.00 51.27 ? 800  HOH A O     1 
HETATM 3067 O  O     . HOH O 8 .   ? 9.688   7.501   13.073  1.00 33.22 ? 801  HOH A O     1 
HETATM 3068 O  O     . HOH O 8 .   ? 6.633   12.697  -3.456  1.00 36.43 ? 802  HOH A O     1 
HETATM 3069 O  O     . HOH O 8 .   ? 15.499  18.563  -7.730  1.00 36.07 ? 803  HOH A O     1 
HETATM 3070 O  O     . HOH O 8 .   ? 2.245   37.159  4.697   1.00 40.84 ? 804  HOH A O     1 
HETATM 3071 O  O     . HOH O 8 .   ? -5.257  35.367  30.953  1.00 35.65 ? 805  HOH A O     1 
HETATM 3072 O  O     . HOH O 8 .   ? 22.738  22.951  -3.468  1.00 31.68 ? 806  HOH A O     1 
HETATM 3073 O  O     . HOH O 8 .   ? 6.895   1.783   -9.482  1.00 42.74 ? 807  HOH A O     1 
HETATM 3074 O  O     . HOH O 8 .   ? 22.763  21.827  28.105  1.00 48.61 ? 808  HOH A O     1 
HETATM 3075 O  O     . HOH O 8 .   ? 17.715  -2.042  -0.198  1.00 59.78 ? 809  HOH A O     1 
HETATM 3076 O  O     . HOH O 8 .   ? 21.208  35.382  19.475  1.00 43.47 ? 810  HOH A O     1 
HETATM 3077 O  O     . HOH O 8 .   ? 29.687  23.657  19.841  1.00 38.80 ? 811  HOH A O     1 
HETATM 3078 O  O     . HOH O 8 .   ? 10.674  -2.816  -3.773  1.00 44.17 ? 812  HOH A O     1 
HETATM 3079 O  O     . HOH O 8 .   ? 3.685   5.226   2.679   1.00 35.48 ? 813  HOH A O     1 
HETATM 3080 O  O     . HOH O 8 .   ? 23.583  23.723  5.147   1.00 41.53 ? 814  HOH A O     1 
HETATM 3081 O  O     . HOH O 8 .   ? 21.567  25.078  6.053   1.00 33.44 ? 815  HOH A O     1 
HETATM 3082 O  O     . HOH O 8 .   ? 14.259  -5.031  0.591   1.00 44.71 ? 816  HOH A O     1 
HETATM 3083 O  O     . HOH O 8 .   ? -2.239  18.131  25.893  1.00 54.90 ? 817  HOH A O     1 
HETATM 3084 O  O     . HOH O 8 .   ? 6.957   19.217  4.794   1.00 30.22 ? 818  HOH A O     1 
HETATM 3085 O  O     . HOH O 8 .   ? -1.881  21.391  25.637  1.00 39.21 ? 819  HOH A O     1 
HETATM 3086 O  O     . HOH O 8 .   ? 17.194  14.759  7.342   1.00 37.86 ? 820  HOH A O     1 
HETATM 3087 O  O     . HOH O 8 .   ? 25.256  25.414  -2.840  1.00 44.17 ? 821  HOH A O     1 
HETATM 3088 O  O     . HOH O 8 .   ? 8.297   25.690  24.327  1.00 37.96 ? 822  HOH A O     1 
HETATM 3089 O  O     . HOH O 8 .   ? 31.135  23.709  9.297   1.00 43.58 ? 823  HOH A O     1 
HETATM 3090 O  O     . HOH O 8 .   ? -4.723  19.454  32.505  1.00 47.50 ? 824  HOH A O     1 
HETATM 3091 O  O     . HOH O 8 .   ? 9.508   16.863  31.854  1.00 46.02 ? 825  HOH A O     1 
HETATM 3092 O  O     . HOH O 8 .   ? 29.789  24.269  4.992   1.00 43.82 ? 826  HOH A O     1 
HETATM 3093 O  O     . HOH O 8 .   ? 10.952  9.213   17.561  1.00 36.09 ? 827  HOH A O     1 
HETATM 3094 O  O     . HOH O 8 .   ? 4.148   36.256  35.772  1.00 37.15 ? 828  HOH A O     1 
HETATM 3095 O  O     . HOH O 8 .   ? 18.342  22.864  10.978  1.00 44.69 ? 829  HOH A O     1 
HETATM 3096 O  O     . HOH O 8 .   ? 21.175  3.584   -2.701  1.00 37.88 ? 830  HOH A O     1 
HETATM 3097 O  O     . HOH O 8 .   ? 21.145  37.193  17.368  1.00 39.93 ? 831  HOH A O     1 
HETATM 3098 O  O     . HOH O 8 .   ? 11.303  12.943  -11.041 1.00 34.14 ? 832  HOH A O     1 
HETATM 3099 O  O     . HOH O 8 .   ? 22.055  5.847   4.002   1.00 39.49 ? 833  HOH A O     1 
HETATM 3100 O  O     . HOH O 8 .   ? 12.114  17.572  14.462  1.00 27.99 ? 834  HOH A O     1 
HETATM 3101 O  O     . HOH O 8 .   ? 28.531  13.785  -1.543  1.00 36.33 ? 835  HOH A O     1 
HETATM 3102 O  O     . HOH O 8 .   ? 2.218   37.446  37.096  1.00 37.96 ? 836  HOH A O     1 
HETATM 3103 O  O     . HOH O 8 .   ? 8.969   21.353  -8.552  1.00 46.11 ? 837  HOH A O     1 
HETATM 3104 O  O     . HOH O 8 .   ? 13.224  36.367  28.292  1.00 43.44 ? 838  HOH A O     1 
HETATM 3105 O  O     . HOH O 8 .   ? 19.221  48.472  8.317   1.00 47.65 ? 839  HOH A O     1 
HETATM 3106 O  O     . HOH O 8 .   ? 23.957  23.913  -5.745  1.00 43.36 ? 840  HOH A O     1 
HETATM 3107 O  O     . HOH O 8 .   ? 8.905   -2.540  0.408   1.00 32.27 ? 841  HOH A O     1 
HETATM 3108 O  O     . HOH O 8 .   ? 5.560   38.678  35.803  1.00 44.39 ? 842  HOH A O     1 
HETATM 3109 O  O     . HOH O 8 .   ? 30.097  21.830  0.731   1.00 50.08 ? 843  HOH A O     1 
HETATM 3110 O  O     . HOH O 8 .   ? 4.722   33.260  19.090  1.00 34.64 ? 844  HOH A O     1 
HETATM 3111 O  O     . HOH O 8 .   ? 32.549  28.383  14.337  1.00 50.06 ? 845  HOH A O     1 
HETATM 3112 O  O     . HOH O 8 .   ? 20.638  29.746  -6.340  1.00 39.87 ? 846  HOH A O     1 
HETATM 3113 O  O     . HOH O 8 .   ? -3.959  25.676  8.303   1.00 44.39 ? 847  HOH A O     1 
HETATM 3114 O  O     . HOH O 8 .   ? 13.041  27.337  -5.670  1.00 42.49 ? 848  HOH A O     1 
HETATM 3115 O  O     . HOH O 8 .   ? 28.541  22.319  17.072  1.00 42.36 ? 849  HOH A O     1 
HETATM 3116 O  O     . HOH O 8 .   ? 31.308  29.561  3.086   1.00 37.88 ? 850  HOH A O     1 
HETATM 3117 O  O     . HOH O 8 .   ? 22.681  8.251   3.242   1.00 42.06 ? 851  HOH A O     1 
HETATM 3118 O  O     . HOH O 8 .   ? 15.870  20.011  16.113  1.00 45.22 ? 852  HOH A O     1 
HETATM 3119 O  O     . HOH O 8 .   ? -1.913  29.115  8.443   1.00 41.94 ? 853  HOH A O     1 
HETATM 3120 O  O     . HOH O 8 .   ? 28.786  27.632  24.345  1.00 55.32 ? 854  HOH A O     1 
HETATM 3121 O  O     . HOH O 8 .   ? 19.839  42.873  4.069   1.00 42.54 ? 855  HOH A O     1 
HETATM 3122 O  O     . HOH O 8 .   ? 15.477  18.454  30.084  1.00 49.21 ? 856  HOH A O     1 
HETATM 3123 O  O     . HOH O 8 .   ? -5.091  29.403  27.728  1.00 44.06 ? 857  HOH A O     1 
HETATM 3124 O  O     . HOH O 8 .   ? 0.849   34.811  16.188  1.00 47.68 ? 858  HOH A O     1 
HETATM 3125 O  O     . HOH O 8 .   ? 10.877  28.640  -4.318  1.00 35.87 ? 859  HOH A O     1 
HETATM 3126 O  O     . HOH O 8 .   ? 7.070   4.311   -10.417 1.00 40.13 ? 860  HOH A O     1 
HETATM 3127 O  O     . HOH O 8 .   ? 6.905   15.734  33.016  1.00 50.04 ? 861  HOH A O     1 
HETATM 3128 O  O     . HOH O 8 .   ? 23.140  37.136  15.424  1.00 51.05 ? 862  HOH A O     1 
HETATM 3129 O  O     . HOH O 8 .   ? 8.174   9.451   11.660  1.00 44.98 ? 863  HOH A O     1 
HETATM 3130 O  O     . HOH O 8 .   ? 27.374  33.652  -3.936  1.00 47.85 ? 864  HOH A O     1 
HETATM 3131 O  O     . HOH O 8 .   ? 8.752   27.052  -3.904  1.00 41.92 ? 865  HOH A O     1 
HETATM 3132 O  O     . HOH O 8 .   ? 20.959  21.217  16.741  1.00 43.68 ? 866  HOH A O     1 
HETATM 3133 O  O     . HOH O 8 .   ? 29.576  37.167  1.783   1.00 38.03 ? 867  HOH A O     1 
HETATM 3134 O  O     . HOH O 8 .   ? 21.280  34.655  33.851  1.00 50.97 ? 868  HOH A O     1 
HETATM 3135 O  O     . HOH O 8 .   ? 14.797  -2.369  13.104  1.00 42.60 ? 869  HOH A O     1 
HETATM 3136 O  O     . HOH O 8 .   ? 15.145  2.245   -12.482 1.00 54.60 ? 870  HOH A O     1 
HETATM 3137 O  O     . HOH O 8 .   ? 14.531  -3.400  10.752  1.00 43.55 ? 871  HOH A O     1 
HETATM 3138 O  O     . HOH O 8 .   ? 0.836   36.310  25.352  1.00 47.97 ? 872  HOH A O     1 
HETATM 3139 O  O     . HOH O 8 .   ? 26.327  20.076  -3.088  1.00 40.93 ? 873  HOH A O     1 
HETATM 3140 O  O     . HOH O 8 .   ? 7.932   18.927  -8.416  1.00 41.26 ? 874  HOH A O     1 
HETATM 3141 O  O     . HOH O 8 .   ? 3.736   2.275   19.357  1.00 49.89 ? 875  HOH A O     1 
HETATM 3142 O  O     . HOH O 8 .   ? 23.831  30.246  27.201  1.00 48.21 ? 876  HOH A O     1 
HETATM 3143 O  O     . HOH O 8 .   ? -3.853  18.578  23.759  1.00 47.78 ? 877  HOH A O     1 
HETATM 3144 O  O     . HOH O 8 .   ? 3.286   37.316  28.163  1.00 43.67 ? 878  HOH A O     1 
HETATM 3145 O  O     . HOH O 8 .   ? 24.957  7.247   2.330   1.00 44.99 ? 879  HOH A O     1 
HETATM 3146 O  O     . HOH O 8 .   ? 19.965  35.703  26.264  1.00 50.79 ? 880  HOH A O     1 
HETATM 3147 O  O     . HOH O 8 .   ? 17.293  18.080  1.463   1.00 22.10 ? 881  HOH A O     1 
HETATM 3148 O  O     . HOH O 8 .   ? 17.048  -3.901  -3.773  1.00 49.33 ? 882  HOH A O     1 
HETATM 3149 O  O     . HOH O 8 .   ? 21.180  7.787   17.101  1.00 56.69 ? 883  HOH A O     1 
HETATM 3150 O  O     . HOH O 8 .   ? 4.742   43.023  18.856  1.00 59.34 ? 884  HOH A O     1 
HETATM 3151 O  O     . HOH O 8 .   ? 12.937  32.915  -4.469  1.00 39.44 ? 885  HOH A O     1 
HETATM 3152 O  O     . HOH O 8 .   ? 12.808  38.431  27.167  1.00 55.94 ? 886  HOH A O     1 
HETATM 3153 O  O     . HOH O 8 .   ? 15.139  13.267  8.308   1.00 50.62 ? 887  HOH A O     1 
HETATM 3154 O  O     . HOH O 8 .   ? 20.206  33.676  30.183  1.00 52.58 ? 888  HOH A O     1 
HETATM 3155 O  O     . HOH O 8 .   ? -3.484  27.749  40.627  1.00 54.90 ? 889  HOH A O     1 
HETATM 3156 O  O     . HOH O 8 .   ? 2.301   38.032  8.668   1.00 57.16 ? 890  HOH A O     1 
HETATM 3157 O  O     . HOH O 8 .   ? 28.534  7.932   29.570  1.00 48.64 ? 891  HOH A O     1 
HETATM 3158 O  O     . HOH O 8 .   ? 16.355  30.548  38.872  1.00 53.30 ? 892  HOH A O     1 
HETATM 3159 O  O     . HOH O 8 .   ? 7.973   15.274  -9.642  1.00 54.23 ? 893  HOH A O     1 
HETATM 3160 O  O     . HOH O 8 .   ? 14.361  -2.063  -7.710  1.00 48.34 ? 894  HOH A O     1 
HETATM 3161 O  O     . HOH O 8 .   ? 2.632   29.938  -3.312  1.00 51.60 ? 895  HOH A O     1 
HETATM 3162 O  O     . HOH O 8 .   ? 16.350  29.500  41.467  1.00 64.79 ? 896  HOH A O     1 
HETATM 3163 O  O     . HOH O 8 .   ? 29.017  20.499  7.961   1.00 47.81 ? 897  HOH A O     1 
HETATM 3164 O  O     . HOH O 8 .   ? 31.760  -4.142  23.170  1.00 54.72 ? 898  HOH A O     1 
HETATM 3165 O  O     . HOH O 8 .   ? 18.077  6.279   -13.787 1.00 54.95 ? 899  HOH A O     1 
HETATM 3166 O  O     . HOH O 8 .   ? 29.436  31.107  -4.449  1.00 52.66 ? 900  HOH A O     1 
HETATM 3167 O  O     . HOH O 8 .   ? 0.448   28.539  -2.310  1.00 54.53 ? 901  HOH A O     1 
HETATM 3168 O  O     . HOH O 8 .   ? 18.161  27.662  -6.463  1.00 51.09 ? 902  HOH A O     1 
HETATM 3169 O  O     . HOH O 8 .   ? 17.678  43.480  16.867  1.00 50.67 ? 903  HOH A O     1 
HETATM 3170 O  O     . HOH O 8 .   ? -4.774  37.075  5.084   1.00 55.38 ? 904  HOH A O     1 
HETATM 3171 O  O     . HOH O 8 .   ? 9.174   40.686  27.181  1.00 47.40 ? 905  HOH A O     1 
HETATM 3172 O  O     . HOH O 8 .   ? 8.197   39.276  -2.572  1.00 54.32 ? 906  HOH A O     1 
HETATM 3173 O  O     . HOH O 8 .   ? 20.843  -2.299  7.087   1.00 51.68 ? 907  HOH A O     1 
HETATM 3174 O  O     . HOH O 8 .   ? -0.700  34.570  18.185  1.00 48.76 ? 908  HOH A O     1 
HETATM 3175 O  O     . HOH O 8 .   ? 5.116   3.754   8.592   1.00 47.33 ? 909  HOH A O     1 
HETATM 3176 O  O     . HOH O 8 .   ? 20.074  -8.806  19.906  1.00 46.37 ? 910  HOH A O     1 
HETATM 3177 O  O     . HOH O 8 .   ? 5.855   0.978   19.202  1.00 49.50 ? 911  HOH A O     1 
HETATM 3178 O  O     . HOH O 8 .   ? 5.140   41.948  27.395  1.00 49.26 ? 912  HOH A O     1 
HETATM 3179 O  O     . HOH O 8 .   ? -0.146  27.008  37.491  1.00 51.88 ? 913  HOH A O     1 
HETATM 3180 O  O     . HOH O 8 .   ? 28.179  38.387  3.813   1.00 50.98 ? 914  HOH A O     1 
HETATM 3181 O  O     . HOH O 8 .   ? 4.382   39.871  28.964  1.00 46.23 ? 915  HOH A O     1 
HETATM 3182 O  O     . HOH O 8 .   ? 20.498  40.056  17.212  1.00 61.94 ? 916  HOH A O     1 
HETATM 3183 O  O     . HOH O 8 .   ? 1.966   41.975  22.105  1.00 58.92 ? 917  HOH A O     1 
HETATM 3184 O  O     . HOH O 8 .   ? 12.542  16.058  19.083  1.00 55.61 ? 918  HOH A O     1 
HETATM 3185 O  O     . HOH O 8 .   ? 14.967  -5.107  -3.119  1.00 51.46 ? 919  HOH A O     1 
HETATM 3186 O  O     . HOH O 8 .   ? 17.201  10.111  28.888  1.00 49.82 ? 920  HOH A O     1 
HETATM 3187 O  O     . HOH O 8 .   ? 6.948   40.629  25.938  1.00 49.86 ? 921  HOH A O     1 
HETATM 3188 O  O     . HOH O 8 .   ? 2.756   39.566  5.952   1.00 59.40 ? 922  HOH A O     1 
HETATM 3189 O  O     . HOH O 8 .   ? 4.869   31.505  16.887  1.00 37.52 ? 923  HOH A O     1 
HETATM 3190 O  O     . HOH O 8 .   ? 5.032   30.026  14.800  1.00 51.18 ? 924  HOH A O     1 
HETATM 3191 O  O     . HOH O 8 .   ? 22.429  27.200  33.339  1.00 46.49 ? 925  HOH A O     1 
HETATM 3192 O  O     . HOH O 8 .   ? 22.946  24.945  34.296  1.00 84.35 ? 926  HOH A O     1 
HETATM 3193 O  O     . HOH O 8 .   ? 14.450  15.879  -11.405 1.00 50.55 ? 927  HOH A O     1 
HETATM 3194 O  O     . HOH O 8 .   ? 13.749  16.960  -9.400  1.00 50.19 ? 928  HOH A O     1 
HETATM 3195 O  O     . HOH O 8 .   ? 18.880  17.963  23.386  1.00 43.61 ? 929  HOH A O     1 
HETATM 3196 O  O     . HOH O 8 .   ? 30.786  21.184  -1.436  1.00 40.11 ? 930  HOH A O     1 
HETATM 3197 O  O     . HOH O 8 .   ? 19.352  19.665  18.571  1.00 46.52 ? 931  HOH A O     1 
HETATM 3198 O  O     . HOH O 8 .   ? -1.387  34.715  23.997  1.00 52.45 ? 932  HOH A O     1 
HETATM 3199 O  O     . HOH O 8 .   ? 2.148   28.296  38.364  1.00 52.01 ? 933  HOH A O     1 
HETATM 3200 O  O     . HOH O 8 .   ? -10.587 25.920  30.576  1.00 53.70 ? 934  HOH A O     1 
HETATM 3201 O  O     . HOH O 8 .   ? 2.917   42.802  26.140  1.00 50.11 ? 935  HOH A O     1 
HETATM 3202 O  O     . HOH O 8 .   ? 31.906  33.293  6.711   1.00 50.90 ? 936  HOH A O     1 
HETATM 3203 O  O     . HOH O 8 .   ? 21.702  19.892  20.976  1.00 49.38 ? 937  HOH A O     1 
HETATM 3204 O  O     . HOH O 8 .   ? 15.824  36.070  27.890  1.00 48.50 ? 938  HOH A O     1 
HETATM 3205 O  O     . HOH O 8 .   ? 9.204   -1.685  14.360  1.00 52.25 ? 939  HOH A O     1 
HETATM 3206 O  O     . HOH O 8 .   ? 30.485  14.097  0.124   1.00 49.85 ? 940  HOH A O     1 
HETATM 3207 O  O     . HOH O 8 .   ? 2.669   38.311  11.189  1.00 53.22 ? 941  HOH A O     1 
HETATM 3208 O  O     . HOH O 8 .   ? -6.299  21.494  35.552  1.00 54.69 ? 942  HOH A O     1 
HETATM 3209 O  O     . HOH O 8 .   ? 24.653  41.999  6.415   1.00 58.14 ? 943  HOH A O     1 
HETATM 3210 O  O     . HOH O 8 .   ? 26.808  40.613  7.687   1.00 48.99 ? 944  HOH A O     1 
HETATM 3211 O  O     . HOH O 8 .   ? 23.757  34.037  -4.387  1.00 53.54 ? 945  HOH A O     1 
HETATM 3212 O  O     . HOH O 8 .   ? 23.615  5.377   0.816   1.00 48.12 ? 946  HOH A O     1 
HETATM 3213 O  O     . HOH O 8 .   ? 13.224  14.105  -14.296 1.00 53.33 ? 947  HOH A O     1 
HETATM 3214 O  O     . HOH O 8 .   ? 10.710  15.901  -13.221 1.00 77.81 ? 948  HOH A O     1 
HETATM 3215 O  O     . HOH O 8 .   ? 21.598  3.764   0.466   1.00 45.61 ? 949  HOH A O     1 
HETATM 3216 O  O     . HOH O 8 .   ? 32.496  31.371  8.258   1.00 51.23 ? 950  HOH A O     1 
HETATM 3217 O  O     . HOH O 8 .   ? 29.680  20.451  13.230  1.00 51.07 ? 951  HOH A O     1 
HETATM 3218 O  O     . HOH O 8 .   ? 17.135  20.025  12.747  1.00 53.81 ? 952  HOH A O     1 
HETATM 3219 O  O     . HOH O 8 .   ? 14.951  22.659  -9.600  1.00 58.55 ? 953  HOH A O     1 
HETATM 3220 O  O     . HOH O 8 .   ? 13.750  22.869  -7.339  1.00 57.31 ? 954  HOH A O     1 
HETATM 3221 O  O     . HOH O 8 .   ? 15.239  38.533  31.975  1.00 48.49 ? 955  HOH A O     1 
HETATM 3222 O  O     . HOH O 8 .   ? 12.778  52.585  10.289  1.00 68.28 ? 956  HOH A O     1 
HETATM 3223 O  O     . HOH O 8 .   ? 11.391  52.908  13.890  1.00 59.00 ? 957  HOH A O     1 
HETATM 3224 O  O     . HOH O 8 .   ? 24.609  44.542  8.535   1.00 53.54 ? 958  HOH A O     1 
HETATM 3225 O  O     . HOH O 8 .   ? 27.848  39.612  9.827   1.00 57.36 ? 959  HOH A O     1 
HETATM 3226 O  O     . HOH O 8 .   ? 27.866  35.118  18.479  1.00 59.14 ? 960  HOH A O     1 
HETATM 3227 O  O     . HOH O 8 .   ? 31.127  26.218  21.362  1.00 68.77 ? 961  HOH A O     1 
HETATM 3228 O  O     . HOH O 8 .   ? -6.793  30.915  26.327  1.00 60.11 ? 962  HOH A O     1 
HETATM 3229 O  O     . HOH O 8 .   ? 11.361  1.154   -10.240 1.00 46.28 ? 963  HOH A O     1 
HETATM 3230 O  O     . HOH O 8 .   ? 2.489   44.079  23.802  1.00 47.94 ? 964  HOH A O     1 
HETATM 3231 O  O     . HOH O 8 .   ? 16.875  10.568  7.724   1.00 47.60 ? 965  HOH A O     1 
HETATM 3232 O  O     . HOH O 8 .   ? 21.079  4.481   -9.412  1.00 47.66 ? 966  HOH A O     1 
HETATM 3233 O  O     . HOH O 8 .   ? 24.539  4.081   3.915   1.00 52.96 ? 967  HOH A O     1 
HETATM 3234 O  O     . HOH O 8 .   ? 27.035  16.918  2.804   1.00 42.40 ? 968  HOH A O     1 
HETATM 3235 O  O     . HOH O 8 .   ? 26.629  25.345  23.984  1.00 47.48 ? 969  HOH A O     1 
HETATM 3236 O  O     . HOH O 8 .   ? 8.460   21.589  39.173  1.00 55.21 ? 970  HOH A O     1 
HETATM 3237 O  O     . HOH O 8 .   ? 30.486  20.813  10.064  1.00 56.24 ? 971  HOH A O     1 
HETATM 3238 O  O     . HOH O 8 .   ? 16.491  12.066  -17.076 1.00 57.55 ? 972  HOH A O     1 
HETATM 3239 O  O     . HOH O 8 .   ? 6.773   6.884   -9.554  1.00 57.91 ? 973  HOH A O     1 
HETATM 3240 O  O     . HOH O 8 .   ? 12.932  48.763  19.688  1.00 51.40 ? 974  HOH A O     1 
HETATM 3241 O  O     . HOH O 8 .   ? 9.273   -2.010  11.486  1.00 71.32 ? 975  HOH A O     1 
HETATM 3242 O  O     . HOH O 8 .   ? 23.939  -13.476 30.155  1.00 57.66 ? 976  HOH A O     1 
HETATM 3243 O  O     . HOH O 8 .   ? 12.971  9.995   -16.852 1.00 51.03 ? 977  HOH A O     1 
HETATM 3244 O  O     . HOH O 8 .   ? 23.661  21.430  18.824  1.00 64.39 ? 978  HOH A O     1 
HETATM 3245 O  O     . HOH O 8 .   ? 25.270  18.862  15.520  1.00 68.54 ? 979  HOH A O     1 
HETATM 3246 O  O     . HOH O 8 .   ? 22.167  18.174  16.102  1.00 55.87 ? 980  HOH A O     1 
HETATM 3247 O  O     . HOH O 8 .   ? 4.279   46.322  24.429  1.00 66.50 ? 981  HOH A O     1 
HETATM 3248 O  O     . HOH O 8 .   ? 1.876   51.630  17.131  1.00 51.19 ? 982  HOH A O     1 
HETATM 3249 O  O     . HOH O 8 .   ? 3.518   52.900  16.224  1.00 58.30 ? 983  HOH A O     1 
HETATM 3250 O  O     . HOH O 8 .   ? -1.462  25.132  38.264  1.00 53.45 ? 984  HOH A O     1 
HETATM 3251 O  O     . HOH O 8 .   ? 29.134  10.169  22.146  1.00 45.78 ? 985  HOH A O     1 
HETATM 3252 O  O     . HOH O 8 .   ? -9.524  29.093  34.067  1.00 48.30 ? 986  HOH A O     1 
HETATM 3253 O  O     . HOH O 8 .   ? 2.119   32.240  -1.003  1.00 49.79 ? 987  HOH A O     1 
HETATM 3254 O  O     . HOH O 8 .   ? 24.480  39.644  15.907  1.00 60.02 ? 988  HOH A O     1 
HETATM 3255 O  O     . HOH O 8 .   ? 12.736  3.746   36.941  1.00 55.70 ? 989  HOH A O     1 
HETATM 3256 O  O     . HOH O 8 .   ? 21.757  -0.226  9.110   1.00 53.12 ? 990  HOH A O     1 
HETATM 3257 O  O     . HOH O 8 .   ? 24.397  25.291  -7.627  1.00 65.12 ? 991  HOH A O     1 
HETATM 3258 O  O     . HOH O 8 .   ? 15.395  5.391   37.386  1.00 57.28 ? 992  HOH A O     1 
HETATM 3259 O  O     . HOH O 8 .   ? 21.326  -1.303  1.251   1.00 61.41 ? 993  HOH A O     1 
HETATM 3260 O  O     . HOH O 8 .   ? -1.890  26.541  9.431   1.00 54.16 ? 994  HOH A O     1 
HETATM 3261 O  O     . HOH O 8 .   ? -2.705  27.920  11.823  1.00 60.06 ? 995  HOH A O     1 
HETATM 3262 O  O     . HOH O 8 .   ? -0.742  40.336  20.983  1.00 58.92 ? 996  HOH A O     1 
HETATM 3263 O  O     . HOH O 8 .   ? -1.277  37.616  20.875  1.00 57.96 ? 997  HOH A O     1 
HETATM 3264 O  O     . HOH O 8 .   ? 22.713  18.813  11.127  1.00 51.25 ? 998  HOH A O     1 
HETATM 3265 O  O     . HOH O 8 .   ? 16.410  30.979  -7.031  1.00 58.19 ? 999  HOH A O     1 
HETATM 3266 O  O     . HOH O 8 .   ? 30.820  28.287  19.801  1.00 60.50 ? 1000 HOH A O     1 
HETATM 3267 O  O     . HOH O 8 .   ? 10.872  17.172  -10.097 1.00 61.07 ? 1001 HOH A O     1 
HETATM 3268 O  O     . HOH O 8 .   ? 27.352  17.522  8.638   1.00 60.20 ? 1002 HOH A O     1 
HETATM 3269 O  O     . HOH O 8 .   ? 12.831  16.134  -15.828 1.00 74.05 ? 1003 HOH A O     1 
HETATM 3270 O  O     . HOH O 8 .   ? 18.042  39.099  32.615  1.00 65.34 ? 1004 HOH A O     1 
HETATM 3271 O  O     . HOH O 8 .   ? 9.774   51.746  15.716  1.00 72.10 ? 1005 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   1   1   DC  C   T . n 
A 1 2   DG  2   2   2   DG  G   T . n 
A 1 3   DG  3   3   3   DG  G   T . n 
A 1 4   DC  4   4   4   DC  C   T . n 
A 1 5   DG  5   5   5   DG  G   T . n 
A 1 6   DG  6   6   6   DG  G   T . n 
A 1 7   DT  7   7   7   DT  T   T . n 
A 1 8   DA  8   8   8   DA  A   T . n 
A 1 9   DC  9   9   9   DC  C   T . n 
A 1 10  DT  10  10  10  DT  T   T . n 
A 1 11  DG  11  11  11  DG  G   T . n 
B 2 1   DC  1   1   1   DC  C   P . n 
B 2 2   DA  2   2   2   DA  A   P . n 
B 2 3   DG  3   3   3   DG  G   P . n 
B 2 4   DT  4   4   4   DT  T   P . n 
B 2 5   DA  5   5   5   DA  A   P . n 
B 2 6   DC  6   6   6   DC  C   P . n 
C 3 1   DG  1   1   1   DG  G   D . n 
C 3 2   DC  2   2   2   DC  C   D . n 
C 3 3   DC  3   3   3   DC  C   D . n 
C 3 4   DG  4   4   4   DG  G   D . n 
D 4 1   MET 1   241 ?   ?   ?   A . n 
D 4 2   ALA 2   242 ?   ?   ?   A . n 
D 4 3   GLN 3   243 ?   ?   ?   A . n 
D 4 4   PRO 4   244 ?   ?   ?   A . n 
D 4 5   SER 5   245 ?   ?   ?   A . n 
D 4 6   SER 6   246 ?   ?   ?   A . n 
D 4 7   GLN 7   247 ?   ?   ?   A . n 
D 4 8   LYS 8   248 ?   ?   ?   A . n 
D 4 9   ALA 9   249 ?   ?   ?   A . n 
D 4 10  THR 10  250 250 THR THR A . n 
D 4 11  ASN 11  251 251 ASN ASN A . n 
D 4 12  HIS 12  252 252 HIS HIS A . n 
D 4 13  ASN 13  253 253 ASN ASN A . n 
D 4 14  LEU 14  254 254 LEU LEU A . n 
D 4 15  HIS 15  255 255 HIS HIS A . n 
D 4 16  ILE 16  256 256 ILE ILE A . n 
D 4 17  THR 17  257 257 THR THR A . n 
D 4 18  GLU 18  258 258 GLU GLU A . n 
D 4 19  LYS 19  259 259 LYS LYS A . n 
D 4 20  LEU 20  260 260 LEU LEU A . n 
D 4 21  GLU 21  261 261 GLU GLU A . n 
D 4 22  VAL 22  262 262 VAL VAL A . n 
D 4 23  LEU 23  263 263 LEU LEU A . n 
D 4 24  ALA 24  264 264 ALA ALA A . n 
D 4 25  LYS 25  265 265 LYS LYS A . n 
D 4 26  ALA 26  266 266 ALA ALA A . n 
D 4 27  TYR 27  267 267 TYR TYR A . n 
D 4 28  SER 28  268 268 SER SER A . n 
D 4 29  VAL 29  269 269 VAL VAL A . n 
D 4 30  GLN 30  270 270 GLN GLN A . n 
D 4 31  GLY 31  271 271 GLY GLY A . n 
D 4 32  ASP 32  272 272 ASP ASP A . n 
D 4 33  LYS 33  273 273 LYS LYS A . n 
D 4 34  TRP 34  274 274 TRP TRP A . n 
D 4 35  ARG 35  275 275 ARG ARG A . n 
D 4 36  ALA 36  276 276 ALA ALA A . n 
D 4 37  LEU 37  277 277 LEU LEU A . n 
D 4 38  GLY 38  278 278 GLY GLY A . n 
D 4 39  TYR 39  279 279 TYR TYR A . n 
D 4 40  ALA 40  280 280 ALA ALA A . n 
D 4 41  LYS 41  281 281 LYS LYS A . n 
D 4 42  ALA 42  282 282 ALA ALA A . n 
D 4 43  ILE 43  283 283 ILE ILE A . n 
D 4 44  ASN 44  284 284 ASN ASN A . n 
D 4 45  ALA 45  285 285 ALA ALA A . n 
D 4 46  LEU 46  286 286 LEU LEU A . n 
D 4 47  LYS 47  287 287 LYS LYS A . n 
D 4 48  SER 48  288 288 SER SER A . n 
D 4 49  PHE 49  289 289 PHE PHE A . n 
D 4 50  HIS 50  290 290 HIS HIS A . n 
D 4 51  LYS 51  291 291 LYS LYS A . n 
D 4 52  PRO 52  292 292 PRO PRO A . n 
D 4 53  VAL 53  293 293 VAL VAL A . n 
D 4 54  THR 54  294 294 THR THR A . n 
D 4 55  SER 55  295 295 SER SER A . n 
D 4 56  TYR 56  296 296 TYR TYR A . n 
D 4 57  GLN 57  297 297 GLN GLN A . n 
D 4 58  GLU 58  298 298 GLU GLU A . n 
D 4 59  ALA 59  299 299 ALA ALA A . n 
D 4 60  CYS 60  300 300 CYS CYS A . n 
D 4 61  SER 61  301 301 SER SER A . n 
D 4 62  ILE 62  302 302 ILE ILE A . n 
D 4 63  PRO 63  303 303 PRO PRO A . n 
D 4 64  GLY 64  304 304 GLY GLY A . n 
D 4 65  ILE 65  305 305 ILE ILE A . n 
D 4 66  GLY 66  306 306 GLY GLY A . n 
D 4 67  LYS 67  307 307 LYS LYS A . n 
D 4 68  ARG 68  308 308 ARG ARG A . n 
D 4 69  MET 69  309 309 MET MET A . n 
D 4 70  ALA 70  310 310 ALA ALA A . n 
D 4 71  GLU 71  311 311 GLU GLU A . n 
D 4 72  LYS 72  312 312 LYS LYS A . n 
D 4 73  ILE 73  313 313 ILE ILE A . n 
D 4 74  ILE 74  314 314 ILE ILE A . n 
D 4 75  GLU 75  315 315 GLU GLU A . n 
D 4 76  ILE 76  316 316 ILE ILE A . n 
D 4 77  LEU 77  317 317 LEU LEU A . n 
D 4 78  GLU 78  318 318 GLU GLU A . n 
D 4 79  SER 79  319 319 SER SER A . n 
D 4 80  GLY 80  320 320 GLY GLY A . n 
D 4 81  HIS 81  321 321 HIS HIS A . n 
D 4 82  LEU 82  322 322 LEU LEU A . n 
D 4 83  ARG 83  323 323 ARG ARG A . n 
D 4 84  LYS 84  324 324 LYS LYS A . n 
D 4 85  LEU 85  325 325 LEU LEU A . n 
D 4 86  ASP 86  326 326 ASP ASP A . n 
D 4 87  HIS 87  327 327 HIS HIS A . n 
D 4 88  ILE 88  328 328 ILE ILE A . n 
D 4 89  SER 89  329 329 SER SER A . n 
D 4 90  GLU 90  330 330 GLU GLU A . n 
D 4 91  SER 91  331 331 SER SER A . n 
D 4 92  VAL 92  332 332 VAL VAL A . n 
D 4 93  PRO 93  333 333 PRO PRO A . n 
D 4 94  VAL 94  334 334 VAL VAL A . n 
D 4 95  LEU 95  335 335 LEU LEU A . n 
D 4 96  GLU 96  336 336 GLU GLU A . n 
D 4 97  LEU 97  337 337 LEU LEU A . n 
D 4 98  PHE 98  338 338 PHE PHE A . n 
D 4 99  SER 99  339 339 SER SER A . n 
D 4 100 ASN 100 340 340 ASN ASN A . n 
D 4 101 ILE 101 341 341 ILE ILE A . n 
D 4 102 TRP 102 342 342 TRP TRP A . n 
D 4 103 GLY 103 343 343 GLY GLY A . n 
D 4 104 ALA 104 344 344 ALA ALA A . n 
D 4 105 GLY 105 345 345 GLY GLY A . n 
D 4 106 THR 106 346 346 THR THR A . n 
D 4 107 LYS 107 347 347 LYS LYS A . n 
D 4 108 THR 108 348 348 THR THR A . n 
D 4 109 ALA 109 349 349 ALA ALA A . n 
D 4 110 GLN 110 350 350 GLN GLN A . n 
D 4 111 MET 111 351 351 MET MET A . n 
D 4 112 TRP 112 352 352 TRP TRP A . n 
D 4 113 TYR 113 353 353 TYR TYR A . n 
D 4 114 GLN 114 354 354 GLN GLN A . n 
D 4 115 GLN 115 355 355 GLN GLN A . n 
D 4 116 GLY 116 356 356 GLY GLY A . n 
D 4 117 PHE 117 357 357 PHE PHE A . n 
D 4 118 ARG 118 358 358 ARG ARG A . n 
D 4 119 SER 119 359 359 SER SER A . n 
D 4 120 LEU 120 360 360 LEU LEU A . n 
D 4 121 GLU 121 361 361 GLU GLU A . n 
D 4 122 ASP 122 362 362 ASP ASP A . n 
D 4 123 ILE 123 363 363 ILE ILE A . n 
D 4 124 ARG 124 364 364 ARG ARG A . n 
D 4 125 SER 125 365 365 SER SER A . n 
D 4 126 GLN 126 366 366 GLN GLN A . n 
D 4 127 ALA 127 367 367 ALA ALA A . n 
D 4 128 SER 128 368 368 SER SER A . n 
D 4 129 LEU 129 369 369 LEU LEU A . n 
D 4 130 THR 130 370 370 THR THR A . n 
D 4 131 THR 131 371 371 THR THR A . n 
D 4 132 GLN 132 372 372 GLN GLN A . n 
D 4 133 GLN 133 373 373 GLN GLN A . n 
D 4 134 ALA 134 374 374 ALA ALA A . n 
D 4 135 ILE 135 375 375 ILE ILE A . n 
D 4 136 GLY 136 376 376 GLY GLY A . n 
D 4 137 LEU 137 377 377 LEU LEU A . n 
D 4 138 LYS 138 378 378 LYS LYS A . n 
D 4 139 HIS 139 379 379 HIS HIS A . n 
D 4 140 TYR 140 380 380 TYR TYR A . n 
D 4 141 SER 141 381 381 SER SER A . n 
D 4 142 ASP 142 382 382 ASP ASP A . n 
D 4 143 PHE 143 383 383 PHE PHE A . n 
D 4 144 LEU 144 384 384 LEU LEU A . n 
D 4 145 GLU 145 385 385 GLU GLU A . n 
D 4 146 ARG 146 386 386 ARG ARG A . n 
D 4 147 MET 147 387 387 MET MET A . n 
D 4 148 PRO 148 388 388 PRO PRO A . n 
D 4 149 ARG 149 389 389 ARG ARG A . n 
D 4 150 GLU 150 390 390 GLU GLU A . n 
D 4 151 GLU 151 391 391 GLU GLU A . n 
D 4 152 ALA 152 392 392 ALA ALA A . n 
D 4 153 THR 153 393 393 THR THR A . n 
D 4 154 GLU 154 394 394 GLU GLU A . n 
D 4 155 ILE 155 395 395 ILE ILE A . n 
D 4 156 GLU 156 396 396 GLU GLU A . n 
D 4 157 GLN 157 397 397 GLN GLN A . n 
D 4 158 THR 158 398 398 THR THR A . n 
D 4 159 VAL 159 399 399 VAL VAL A . n 
D 4 160 GLN 160 400 400 GLN GLN A . n 
D 4 161 LYS 161 401 401 LYS LYS A . n 
D 4 162 ALA 162 402 402 ALA ALA A . n 
D 4 163 ALA 163 403 403 ALA ALA A . n 
D 4 164 GLN 164 404 404 GLN GLN A . n 
D 4 165 ALA 165 405 405 ALA ALA A . n 
D 4 166 PHE 166 406 406 PHE PHE A . n 
D 4 167 ASN 167 407 407 ASN ASN A . n 
D 4 168 SER 168 408 408 SER SER A . n 
D 4 169 GLY 169 409 409 GLY GLY A . n 
D 4 170 LEU 170 410 410 LEU LEU A . n 
D 4 171 LEU 171 411 411 LEU LEU A . n 
D 4 172 CYS 172 412 412 CYS CYS A . n 
D 4 173 VAL 173 413 413 VAL VAL A . n 
D 4 174 ALA 174 414 414 ALA ALA A . n 
D 4 175 CYS 175 415 415 CYS CYS A . n 
D 4 176 GLY 176 416 416 GLY GLY A . n 
D 4 177 SER 177 417 417 SER SER A . n 
D 4 178 TYR 178 418 418 TYR TYR A . n 
D 4 179 ARG 179 419 419 ARG ARG A . n 
D 4 180 ARG 180 420 420 ARG ARG A . n 
D 4 181 GLY 181 421 421 GLY GLY A . n 
D 4 182 LYS 182 422 422 LYS LYS A . n 
D 4 183 ALA 183 423 423 ALA ALA A . n 
D 4 184 THR 184 424 424 THR THR A . n 
D 4 185 CYS 185 425 425 CYS CYS A . n 
D 4 186 GLY 186 426 426 GLY GLY A . n 
D 4 187 ASP 187 427 427 ASP ASP A . n 
D 4 188 VAL 188 428 428 VAL VAL A . n 
D 4 189 ASP 189 429 429 ASP ASP A . n 
D 4 190 VAL 190 430 430 VAL VAL A . n 
D 4 191 LEU 191 431 431 LEU LEU A . n 
D 4 192 ILE 192 432 432 ILE ILE A . n 
D 4 193 THR 193 433 433 THR THR A . n 
D 4 194 HIS 194 434 434 HIS HIS A . n 
D 4 195 PRO 195 435 435 PRO PRO A . n 
D 4 196 ASP 196 436 436 ASP ASP A . n 
D 4 197 GLY 197 437 437 GLY GLY A . n 
D 4 198 ARG 198 438 438 ARG ARG A . n 
D 4 199 SER 199 439 439 SER SER A . n 
D 4 200 HIS 200 440 440 HIS HIS A . n 
D 4 201 ARG 201 441 441 ARG ARG A . n 
D 4 202 GLY 202 442 442 GLY GLY A . n 
D 4 203 ILE 203 443 443 ILE ILE A . n 
D 4 204 PHE 204 444 444 PHE PHE A . n 
D 4 205 SER 205 445 445 SER SER A . n 
D 4 206 ARG 206 446 446 ARG ARG A . n 
D 4 207 LEU 207 447 447 LEU LEU A . n 
D 4 208 LEU 208 448 448 LEU LEU A . n 
D 4 209 ASP 209 449 449 ASP ASP A . n 
D 4 210 SER 210 450 450 SER SER A . n 
D 4 211 LEU 211 451 451 LEU LEU A . n 
D 4 212 ARG 212 452 452 ARG ARG A . n 
D 4 213 GLN 213 453 453 GLN GLN A . n 
D 4 214 GLU 214 454 454 GLU GLU A . n 
D 4 215 GLY 215 455 455 GLY GLY A . n 
D 4 216 PHE 216 456 456 PHE PHE A . n 
D 4 217 LEU 217 457 457 LEU LEU A . n 
D 4 218 THR 218 458 458 THR THR A . n 
D 4 219 ASP 219 459 459 ASP ASP A . n 
D 4 220 ASP 220 460 460 ASP ASP A . n 
D 4 221 LEU 221 461 461 LEU LEU A . n 
D 4 222 VAL 222 462 462 VAL VAL A . n 
D 4 223 SER 223 463 463 SER SER A . n 
D 4 224 GLN 224 464 464 GLN GLN A . n 
D 4 225 GLU 225 465 465 GLU GLU A . n 
D 4 226 GLU 226 466 466 GLU GLU A . n 
D 4 227 ASN 227 467 467 ASN ASN A . n 
D 4 228 GLY 228 468 468 GLY GLY A . n 
D 4 229 GLN 229 469 469 GLN GLN A . n 
D 4 230 GLN 230 470 470 GLN GLN A . n 
D 4 231 GLN 231 471 471 GLN GLN A . n 
D 4 232 LYS 232 472 472 LYS LYS A . n 
D 4 233 TYR 233 473 473 TYR TYR A . n 
D 4 234 LEU 234 474 474 LEU LEU A . n 
D 4 235 GLY 235 475 475 GLY GLY A . n 
D 4 236 VAL 236 476 476 VAL VAL A . n 
D 4 237 CYS 237 477 477 CYS CYS A . n 
D 4 238 ARG 238 478 478 ARG ARG A . n 
D 4 239 LEU 239 479 479 LEU LEU A . n 
D 4 240 PRO 240 480 480 PRO PRO A . n 
D 4 241 GLY 241 481 481 GLY GLY A . n 
D 4 242 PRO 242 482 482 PRO PRO A . n 
D 4 243 GLY 243 483 483 GLY GLY A . n 
D 4 244 ARG 244 484 484 ARG ARG A . n 
D 4 245 ARG 245 485 485 ARG ARG A . n 
D 4 246 HIS 246 486 486 HIS HIS A . n 
D 4 247 ARG 247 487 487 ARG ARG A . n 
D 4 248 ARG 248 488 488 ARG ARG A . n 
D 4 249 LEU 249 489 489 LEU LEU A . n 
D 4 250 ASP 250 490 490 ASP ASP A . n 
D 4 251 ILE 251 491 491 ILE ILE A . n 
D 4 252 ILE 252 492 492 ILE ILE A . n 
D 4 253 VAL 253 493 493 VAL VAL A . n 
D 4 254 VAL 254 494 494 VAL VAL A . n 
D 4 255 PRO 255 495 495 PRO PRO A . n 
D 4 256 TYR 256 496 496 TYR TYR A . n 
D 4 257 SER 257 497 497 SER SER A . n 
D 4 258 GLU 258 498 498 GLU GLU A . n 
D 4 259 PHE 259 499 499 PHE PHE A . n 
D 4 260 ALA 260 500 500 ALA ALA A . n 
D 4 261 CYS 261 501 501 CYS CYS A . n 
D 4 262 ALA 262 502 502 ALA ALA A . n 
D 4 263 LEU 263 503 503 LEU LEU A . n 
D 4 264 LEU 264 504 504 LEU LEU A . n 
D 4 265 TYR 265 505 505 TYR TYR A . n 
D 4 266 PHE 266 506 506 PHE PHE A . n 
D 4 267 THR 267 507 507 THR THR A . n 
D 4 268 GLY 268 508 508 GLY GLY A . n 
D 4 269 SER 269 509 509 SER SER A . n 
D 4 270 ALA 270 510 510 ALA ALA A . n 
D 4 271 HIS 271 511 511 HIS HIS A . n 
D 4 272 PHE 272 512 512 PHE PHE A . n 
D 4 273 ASN 273 513 513 ASN ASN A . n 
D 4 274 ARG 274 514 514 ARG ARG A . n 
D 4 275 SER 275 515 515 SER SER A . n 
D 4 276 MET 276 516 516 MET MET A . n 
D 4 277 ARG 277 517 517 ARG ARG A . n 
D 4 278 ALA 278 518 518 ALA ALA A . n 
D 4 279 LEU 279 519 519 LEU LEU A . n 
D 4 280 ALA 280 520 520 ALA ALA A . n 
D 4 281 LYS 281 521 521 LYS LYS A . n 
D 4 282 THR 282 522 522 THR THR A . n 
D 4 283 LYS 283 523 523 LYS LYS A . n 
D 4 284 GLY 284 524 524 GLY GLY A . n 
D 4 285 MET 285 525 525 MET MET A . n 
D 4 286 SER 286 526 526 SER SER A . n 
D 4 287 LEU 287 527 527 LEU LEU A . n 
D 4 288 SER 288 528 528 SER SER A . n 
D 4 289 GLU 289 529 529 GLU GLU A . n 
D 4 290 HIS 290 530 530 HIS HIS A . n 
D 4 291 ALA 291 531 531 ALA ALA A . n 
D 4 292 LEU 292 532 532 LEU LEU A . n 
D 4 293 SER 293 533 533 SER SER A . n 
D 4 294 THR 294 534 534 THR THR A . n 
D 4 295 ALA 295 535 535 ALA ALA A . n 
D 4 296 VAL 296 536 536 VAL VAL A . n 
D 4 297 VAL 297 537 537 VAL VAL A . n 
D 4 298 ARG 298 538 538 ARG ARG A . n 
D 4 299 ASN 299 539 539 ASN ASN A . n 
D 4 300 THR 300 540 540 THR THR A . n 
D 4 301 HIS 301 541 541 HIS HIS A . n 
D 4 302 GLY 302 542 542 GLY GLY A . n 
D 4 303 ALA 303 543 543 ALA ALA A . n 
D 4 304 LYS 304 544 544 LYS LYS A . n 
D 4 305 VAL 305 545 545 VAL VAL A . n 
D 4 306 GLY 306 546 546 GLY GLY A . n 
D 4 307 PRO 307 547 547 PRO PRO A . n 
D 4 308 GLY 308 548 548 GLY GLY A . n 
D 4 309 ARG 309 549 549 ARG ARG A . n 
D 4 310 VAL 310 550 550 VAL VAL A . n 
D 4 311 LEU 311 551 551 LEU LEU A . n 
D 4 312 PRO 312 552 552 PRO PRO A . n 
D 4 313 THR 313 553 553 THR THR A . n 
D 4 314 PRO 314 554 554 PRO PRO A . n 
D 4 315 THR 315 555 555 THR THR A . n 
D 4 316 GLU 316 556 556 GLU GLU A . n 
D 4 317 LYS 317 557 557 LYS LYS A . n 
D 4 318 ASP 318 558 558 ASP ASP A . n 
D 4 319 VAL 319 559 559 VAL VAL A . n 
D 4 320 PHE 320 560 560 PHE PHE A . n 
D 4 321 ARG 321 561 561 ARG ARG A . n 
D 4 322 LEU 322 562 562 LEU LEU A . n 
D 4 323 LEU 323 563 563 LEU LEU A . n 
D 4 324 GLY 324 564 564 GLY GLY A . n 
D 4 325 LEU 325 565 565 LEU LEU A . n 
D 4 326 PRO 326 566 566 PRO PRO A . n 
D 4 327 TYR 327 567 567 TYR TYR A . n 
D 4 328 ARG 328 568 568 ARG ARG A . n 
D 4 329 GLU 329 569 569 GLU GLU A . n 
D 4 330 PRO 330 570 570 PRO PRO A . n 
D 4 331 ALA 331 571 571 ALA ALA A . n 
D 4 332 GLU 332 572 572 GLU GLU A . n 
D 4 333 ARG 333 573 573 ARG ARG A . n 
D 4 334 ASP 334 574 574 ASP ASP A . n 
D 4 335 TRP 335 575 575 TRP TRP A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 NA  1   503  503 NA  NA  D . 
F 6 MG  1   750  750 MG  MG  A . 
G 5 NA  1   751  500 NA  NA  A . 
H 5 NA  1   752  501 NA  NA  A . 
I 5 NA  1   753  502 NA  NA  A . 
J 5 NA  1   754  504 NA  NA  A . 
K 7 DCP 1   755  338 DCP DCP A . 
L 8 HOH 1   12   10  HOH HOH T . 
L 8 HOH 2   13   14  HOH HOH T . 
L 8 HOH 3   14   19  HOH HOH T . 
L 8 HOH 4   15   20  HOH HOH T . 
L 8 HOH 5   16   22  HOH HOH T . 
L 8 HOH 6   17   24  HOH HOH T . 
L 8 HOH 7   18   31  HOH HOH T . 
L 8 HOH 8   19   32  HOH HOH T . 
L 8 HOH 9   20   33  HOH HOH T . 
L 8 HOH 10  21   46  HOH HOH T . 
L 8 HOH 11  22   56  HOH HOH T . 
L 8 HOH 12  23   57  HOH HOH T . 
L 8 HOH 13  24   61  HOH HOH T . 
L 8 HOH 14  25   67  HOH HOH T . 
L 8 HOH 15  26   68  HOH HOH T . 
L 8 HOH 16  27   72  HOH HOH T . 
L 8 HOH 17  28   78  HOH HOH T . 
L 8 HOH 18  29   79  HOH HOH T . 
L 8 HOH 19  30   80  HOH HOH T . 
L 8 HOH 20  31   85  HOH HOH T . 
L 8 HOH 21  32   87  HOH HOH T . 
L 8 HOH 22  33   89  HOH HOH T . 
L 8 HOH 23  34   90  HOH HOH T . 
L 8 HOH 24  35   93  HOH HOH T . 
L 8 HOH 25  36   99  HOH HOH T . 
L 8 HOH 26  37   103 HOH HOH T . 
L 8 HOH 27  38   113 HOH HOH T . 
L 8 HOH 28  39   121 HOH HOH T . 
L 8 HOH 29  40   132 HOH HOH T . 
L 8 HOH 30  41   134 HOH HOH T . 
L 8 HOH 31  42   137 HOH HOH T . 
L 8 HOH 32  43   145 HOH HOH T . 
L 8 HOH 33  44   162 HOH HOH T . 
L 8 HOH 34  45   164 HOH HOH T . 
L 8 HOH 35  46   182 HOH HOH T . 
L 8 HOH 36  47   184 HOH HOH T . 
L 8 HOH 37  48   196 HOH HOH T . 
L 8 HOH 38  49   198 HOH HOH T . 
L 8 HOH 39  50   212 HOH HOH T . 
L 8 HOH 40  51   214 HOH HOH T . 
L 8 HOH 41  52   223 HOH HOH T . 
L 8 HOH 42  53   245 HOH HOH T . 
L 8 HOH 43  54   246 HOH HOH T . 
L 8 HOH 44  55   293 HOH HOH T . 
L 8 HOH 45  56   303 HOH HOH T . 
M 8 HOH 1   7    3   HOH HOH P . 
M 8 HOH 2   8    9   HOH HOH P . 
M 8 HOH 3   9    17  HOH HOH P . 
M 8 HOH 4   10   28  HOH HOH P . 
M 8 HOH 5   11   35  HOH HOH P . 
M 8 HOH 6   12   37  HOH HOH P . 
M 8 HOH 7   13   39  HOH HOH P . 
M 8 HOH 8   14   40  HOH HOH P . 
M 8 HOH 9   15   47  HOH HOH P . 
M 8 HOH 10  16   48  HOH HOH P . 
M 8 HOH 11  17   51  HOH HOH P . 
M 8 HOH 12  18   70  HOH HOH P . 
M 8 HOH 13  19   75  HOH HOH P . 
M 8 HOH 14  20   83  HOH HOH P . 
M 8 HOH 15  21   94  HOH HOH P . 
M 8 HOH 16  22   111 HOH HOH P . 
M 8 HOH 17  23   116 HOH HOH P . 
M 8 HOH 18  24   117 HOH HOH P . 
M 8 HOH 19  25   130 HOH HOH P . 
M 8 HOH 20  26   136 HOH HOH P . 
M 8 HOH 21  27   138 HOH HOH P . 
M 8 HOH 22  28   142 HOH HOH P . 
M 8 HOH 23  29   152 HOH HOH P . 
M 8 HOH 24  30   179 HOH HOH P . 
M 8 HOH 25  31   185 HOH HOH P . 
M 8 HOH 26  32   192 HOH HOH P . 
M 8 HOH 27  33   200 HOH HOH P . 
M 8 HOH 28  34   208 HOH HOH P . 
M 8 HOH 29  35   256 HOH HOH P . 
M 8 HOH 30  36   273 HOH HOH P . 
M 8 HOH 31  37   315 HOH HOH P . 
N 8 HOH 1   110  110 HOH HOH D . 
N 8 HOH 2   186  186 HOH HOH D . 
N 8 HOH 3   269  269 HOH HOH D . 
N 8 HOH 4   324  324 HOH HOH D . 
N 8 HOH 5   331  331 HOH HOH D . 
O 8 HOH 1   756  5   HOH HOH A . 
O 8 HOH 2   757  6   HOH HOH A . 
O 8 HOH 3   758  7   HOH HOH A . 
O 8 HOH 4   759  8   HOH HOH A . 
O 8 HOH 5   760  12  HOH HOH A . 
O 8 HOH 6   761  13  HOH HOH A . 
O 8 HOH 7   762  15  HOH HOH A . 
O 8 HOH 8   763  16  HOH HOH A . 
O 8 HOH 9   764  18  HOH HOH A . 
O 8 HOH 10  765  21  HOH HOH A . 
O 8 HOH 11  766  23  HOH HOH A . 
O 8 HOH 12  767  25  HOH HOH A . 
O 8 HOH 13  768  26  HOH HOH A . 
O 8 HOH 14  769  27  HOH HOH A . 
O 8 HOH 15  770  29  HOH HOH A . 
O 8 HOH 16  771  30  HOH HOH A . 
O 8 HOH 17  772  34  HOH HOH A . 
O 8 HOH 18  773  36  HOH HOH A . 
O 8 HOH 19  774  38  HOH HOH A . 
O 8 HOH 20  775  41  HOH HOH A . 
O 8 HOH 21  776  42  HOH HOH A . 
O 8 HOH 22  777  43  HOH HOH A . 
O 8 HOH 23  778  44  HOH HOH A . 
O 8 HOH 24  779  45  HOH HOH A . 
O 8 HOH 25  780  49  HOH HOH A . 
O 8 HOH 26  781  50  HOH HOH A . 
O 8 HOH 27  782  52  HOH HOH A . 
O 8 HOH 28  783  53  HOH HOH A . 
O 8 HOH 29  784  54  HOH HOH A . 
O 8 HOH 30  785  55  HOH HOH A . 
O 8 HOH 31  786  58  HOH HOH A . 
O 8 HOH 32  787  59  HOH HOH A . 
O 8 HOH 33  788  60  HOH HOH A . 
O 8 HOH 34  789  62  HOH HOH A . 
O 8 HOH 35  790  63  HOH HOH A . 
O 8 HOH 36  791  64  HOH HOH A . 
O 8 HOH 37  792  65  HOH HOH A . 
O 8 HOH 38  793  66  HOH HOH A . 
O 8 HOH 39  794  69  HOH HOH A . 
O 8 HOH 40  795  71  HOH HOH A . 
O 8 HOH 41  796  73  HOH HOH A . 
O 8 HOH 42  797  74  HOH HOH A . 
O 8 HOH 43  798  76  HOH HOH A . 
O 8 HOH 44  799  77  HOH HOH A . 
O 8 HOH 45  800  81  HOH HOH A . 
O 8 HOH 46  801  82  HOH HOH A . 
O 8 HOH 47  802  84  HOH HOH A . 
O 8 HOH 48  803  86  HOH HOH A . 
O 8 HOH 49  804  88  HOH HOH A . 
O 8 HOH 50  805  91  HOH HOH A . 
O 8 HOH 51  806  92  HOH HOH A . 
O 8 HOH 52  807  95  HOH HOH A . 
O 8 HOH 53  808  96  HOH HOH A . 
O 8 HOH 54  809  97  HOH HOH A . 
O 8 HOH 55  810  98  HOH HOH A . 
O 8 HOH 56  811  100 HOH HOH A . 
O 8 HOH 57  812  101 HOH HOH A . 
O 8 HOH 58  813  102 HOH HOH A . 
O 8 HOH 59  814  104 HOH HOH A . 
O 8 HOH 60  815  105 HOH HOH A . 
O 8 HOH 61  816  106 HOH HOH A . 
O 8 HOH 62  817  107 HOH HOH A . 
O 8 HOH 63  818  108 HOH HOH A . 
O 8 HOH 64  819  109 HOH HOH A . 
O 8 HOH 65  820  112 HOH HOH A . 
O 8 HOH 66  821  114 HOH HOH A . 
O 8 HOH 67  822  115 HOH HOH A . 
O 8 HOH 68  823  118 HOH HOH A . 
O 8 HOH 69  824  119 HOH HOH A . 
O 8 HOH 70  825  122 HOH HOH A . 
O 8 HOH 71  826  123 HOH HOH A . 
O 8 HOH 72  827  124 HOH HOH A . 
O 8 HOH 73  828  125 HOH HOH A . 
O 8 HOH 74  829  126 HOH HOH A . 
O 8 HOH 75  830  127 HOH HOH A . 
O 8 HOH 76  831  128 HOH HOH A . 
O 8 HOH 77  832  129 HOH HOH A . 
O 8 HOH 78  833  131 HOH HOH A . 
O 8 HOH 79  834  133 HOH HOH A . 
O 8 HOH 80  835  135 HOH HOH A . 
O 8 HOH 81  836  139 HOH HOH A . 
O 8 HOH 82  837  140 HOH HOH A . 
O 8 HOH 83  838  141 HOH HOH A . 
O 8 HOH 84  839  143 HOH HOH A . 
O 8 HOH 85  840  146 HOH HOH A . 
O 8 HOH 86  841  147 HOH HOH A . 
O 8 HOH 87  842  148 HOH HOH A . 
O 8 HOH 88  843  149 HOH HOH A . 
O 8 HOH 89  844  150 HOH HOH A . 
O 8 HOH 90  845  151 HOH HOH A . 
O 8 HOH 91  846  153 HOH HOH A . 
O 8 HOH 92  847  154 HOH HOH A . 
O 8 HOH 93  848  155 HOH HOH A . 
O 8 HOH 94  849  156 HOH HOH A . 
O 8 HOH 95  850  157 HOH HOH A . 
O 8 HOH 96  851  158 HOH HOH A . 
O 8 HOH 97  852  159 HOH HOH A . 
O 8 HOH 98  853  160 HOH HOH A . 
O 8 HOH 99  854  161 HOH HOH A . 
O 8 HOH 100 855  163 HOH HOH A . 
O 8 HOH 101 856  165 HOH HOH A . 
O 8 HOH 102 857  166 HOH HOH A . 
O 8 HOH 103 858  167 HOH HOH A . 
O 8 HOH 104 859  168 HOH HOH A . 
O 8 HOH 105 860  169 HOH HOH A . 
O 8 HOH 106 861  170 HOH HOH A . 
O 8 HOH 107 862  171 HOH HOH A . 
O 8 HOH 108 863  172 HOH HOH A . 
O 8 HOH 109 864  173 HOH HOH A . 
O 8 HOH 110 865  174 HOH HOH A . 
O 8 HOH 111 866  175 HOH HOH A . 
O 8 HOH 112 867  176 HOH HOH A . 
O 8 HOH 113 868  177 HOH HOH A . 
O 8 HOH 114 869  180 HOH HOH A . 
O 8 HOH 115 870  181 HOH HOH A . 
O 8 HOH 116 871  183 HOH HOH A . 
O 8 HOH 117 872  187 HOH HOH A . 
O 8 HOH 118 873  188 HOH HOH A . 
O 8 HOH 119 874  189 HOH HOH A . 
O 8 HOH 120 875  190 HOH HOH A . 
O 8 HOH 121 876  191 HOH HOH A . 
O 8 HOH 122 877  193 HOH HOH A . 
O 8 HOH 123 878  194 HOH HOH A . 
O 8 HOH 124 879  195 HOH HOH A . 
O 8 HOH 125 880  197 HOH HOH A . 
O 8 HOH 126 881  199 HOH HOH A . 
O 8 HOH 127 882  201 HOH HOH A . 
O 8 HOH 128 883  202 HOH HOH A . 
O 8 HOH 129 884  203 HOH HOH A . 
O 8 HOH 130 885  204 HOH HOH A . 
O 8 HOH 131 886  205 HOH HOH A . 
O 8 HOH 132 887  206 HOH HOH A . 
O 8 HOH 133 888  207 HOH HOH A . 
O 8 HOH 134 889  209 HOH HOH A . 
O 8 HOH 135 890  210 HOH HOH A . 
O 8 HOH 136 891  211 HOH HOH A . 
O 8 HOH 137 892  213 HOH HOH A . 
O 8 HOH 138 893  215 HOH HOH A . 
O 8 HOH 139 894  216 HOH HOH A . 
O 8 HOH 140 895  217 HOH HOH A . 
O 8 HOH 141 896  218 HOH HOH A . 
O 8 HOH 142 897  219 HOH HOH A . 
O 8 HOH 143 898  220 HOH HOH A . 
O 8 HOH 144 899  221 HOH HOH A . 
O 8 HOH 145 900  222 HOH HOH A . 
O 8 HOH 146 901  224 HOH HOH A . 
O 8 HOH 147 902  225 HOH HOH A . 
O 8 HOH 148 903  226 HOH HOH A . 
O 8 HOH 149 904  227 HOH HOH A . 
O 8 HOH 150 905  228 HOH HOH A . 
O 8 HOH 151 906  229 HOH HOH A . 
O 8 HOH 152 907  230 HOH HOH A . 
O 8 HOH 153 908  231 HOH HOH A . 
O 8 HOH 154 909  232 HOH HOH A . 
O 8 HOH 155 910  233 HOH HOH A . 
O 8 HOH 156 911  234 HOH HOH A . 
O 8 HOH 157 912  235 HOH HOH A . 
O 8 HOH 158 913  236 HOH HOH A . 
O 8 HOH 159 914  237 HOH HOH A . 
O 8 HOH 160 915  238 HOH HOH A . 
O 8 HOH 161 916  239 HOH HOH A . 
O 8 HOH 162 917  240 HOH HOH A . 
O 8 HOH 163 918  241 HOH HOH A . 
O 8 HOH 164 919  242 HOH HOH A . 
O 8 HOH 165 920  243 HOH HOH A . 
O 8 HOH 166 921  244 HOH HOH A . 
O 8 HOH 167 922  247 HOH HOH A . 
O 8 HOH 168 923  248 HOH HOH A . 
O 8 HOH 169 924  249 HOH HOH A . 
O 8 HOH 170 925  250 HOH HOH A . 
O 8 HOH 171 926  251 HOH HOH A . 
O 8 HOH 172 927  252 HOH HOH A . 
O 8 HOH 173 928  253 HOH HOH A . 
O 8 HOH 174 929  254 HOH HOH A . 
O 8 HOH 175 930  255 HOH HOH A . 
O 8 HOH 176 931  257 HOH HOH A . 
O 8 HOH 177 932  258 HOH HOH A . 
O 8 HOH 178 933  259 HOH HOH A . 
O 8 HOH 179 934  260 HOH HOH A . 
O 8 HOH 180 935  261 HOH HOH A . 
O 8 HOH 181 936  262 HOH HOH A . 
O 8 HOH 182 937  263 HOH HOH A . 
O 8 HOH 183 938  264 HOH HOH A . 
O 8 HOH 184 939  265 HOH HOH A . 
O 8 HOH 185 940  266 HOH HOH A . 
O 8 HOH 186 941  267 HOH HOH A . 
O 8 HOH 187 942  268 HOH HOH A . 
O 8 HOH 188 943  270 HOH HOH A . 
O 8 HOH 189 944  271 HOH HOH A . 
O 8 HOH 190 945  272 HOH HOH A . 
O 8 HOH 191 946  274 HOH HOH A . 
O 8 HOH 192 947  275 HOH HOH A . 
O 8 HOH 193 948  276 HOH HOH A . 
O 8 HOH 194 949  277 HOH HOH A . 
O 8 HOH 195 950  278 HOH HOH A . 
O 8 HOH 196 951  279 HOH HOH A . 
O 8 HOH 197 952  280 HOH HOH A . 
O 8 HOH 198 953  281 HOH HOH A . 
O 8 HOH 199 954  282 HOH HOH A . 
O 8 HOH 200 955  283 HOH HOH A . 
O 8 HOH 201 956  284 HOH HOH A . 
O 8 HOH 202 957  285 HOH HOH A . 
O 8 HOH 203 958  286 HOH HOH A . 
O 8 HOH 204 959  287 HOH HOH A . 
O 8 HOH 205 960  289 HOH HOH A . 
O 8 HOH 206 961  290 HOH HOH A . 
O 8 HOH 207 962  294 HOH HOH A . 
O 8 HOH 208 963  295 HOH HOH A . 
O 8 HOH 209 964  296 HOH HOH A . 
O 8 HOH 210 965  297 HOH HOH A . 
O 8 HOH 211 966  298 HOH HOH A . 
O 8 HOH 212 967  299 HOH HOH A . 
O 8 HOH 213 968  300 HOH HOH A . 
O 8 HOH 214 969  301 HOH HOH A . 
O 8 HOH 215 970  302 HOH HOH A . 
O 8 HOH 216 971  304 HOH HOH A . 
O 8 HOH 217 972  305 HOH HOH A . 
O 8 HOH 218 973  306 HOH HOH A . 
O 8 HOH 219 974  307 HOH HOH A . 
O 8 HOH 220 975  308 HOH HOH A . 
O 8 HOH 221 976  309 HOH HOH A . 
O 8 HOH 222 977  310 HOH HOH A . 
O 8 HOH 223 978  311 HOH HOH A . 
O 8 HOH 224 979  312 HOH HOH A . 
O 8 HOH 225 980  313 HOH HOH A . 
O 8 HOH 226 981  314 HOH HOH A . 
O 8 HOH 227 982  317 HOH HOH A . 
O 8 HOH 228 983  318 HOH HOH A . 
O 8 HOH 229 984  319 HOH HOH A . 
O 8 HOH 230 985  320 HOH HOH A . 
O 8 HOH 231 986  322 HOH HOH A . 
O 8 HOH 232 987  323 HOH HOH A . 
O 8 HOH 233 988  325 HOH HOH A . 
O 8 HOH 234 989  326 HOH HOH A . 
O 8 HOH 235 990  327 HOH HOH A . 
O 8 HOH 236 991  328 HOH HOH A . 
O 8 HOH 237 992  329 HOH HOH A . 
O 8 HOH 238 993  330 HOH HOH A . 
O 8 HOH 239 994  332 HOH HOH A . 
O 8 HOH 240 995  333 HOH HOH A . 
O 8 HOH 241 996  335 HOH HOH A . 
O 8 HOH 242 997  336 HOH HOH A . 
O 8 HOH 243 998  339 HOH HOH A . 
O 8 HOH 244 999  340 HOH HOH A . 
O 8 HOH 245 1000 341 HOH HOH A . 
O 8 HOH 246 1001 343 HOH HOH A . 
O 8 HOH 247 1002 344 HOH HOH A . 
O 8 HOH 248 1003 346 HOH HOH A . 
O 8 HOH 249 1004 348 HOH HOH A . 
O 8 HOH 250 1005 349 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? L HOH .   ? T HOH 42  ? 1_555 NA ? I NA . ? A NA 753 ? 1_555 O   ? D SER 223 ? A SER 463 ? 1_555 103.5 ? 
2  O   ? L HOH .   ? T HOH 42  ? 1_555 NA ? I NA . ? A NA 753 ? 1_555 O   ? O HOH .   ? A HOH 766 ? 1_555 97.6  ? 
3  O   ? D SER 223 ? A SER 463 ? 1_555 NA ? I NA . ? A NA 753 ? 1_555 O   ? O HOH .   ? A HOH 766 ? 1_555 93.0  ? 
4  O   ? L HOH .   ? T HOH 42  ? 1_555 NA ? I NA . ? A NA 753 ? 1_555 O   ? O HOH .   ? A HOH 781 ? 1_555 101.5 ? 
5  O   ? D SER 223 ? A SER 463 ? 1_555 NA ? I NA . ? A NA 753 ? 1_555 O   ? O HOH .   ? A HOH 781 ? 1_555 80.5  ? 
6  O   ? O HOH .   ? A HOH 766 ? 1_555 NA ? I NA . ? A NA 753 ? 1_555 O   ? O HOH .   ? A HOH 781 ? 1_555 160.7 ? 
7  O   ? L HOH .   ? T HOH 42  ? 1_555 NA ? I NA . ? A NA 753 ? 1_555 O   ? O HOH .   ? A HOH 895 ? 1_555 91.0  ? 
8  O   ? D SER 223 ? A SER 463 ? 1_555 NA ? I NA . ? A NA 753 ? 1_555 O   ? O HOH .   ? A HOH 895 ? 1_555 163.8 ? 
9  O   ? O HOH .   ? A HOH 766 ? 1_555 NA ? I NA . ? A NA 753 ? 1_555 O   ? O HOH .   ? A HOH 895 ? 1_555 92.3  ? 
10 O   ? O HOH .   ? A HOH 781 ? 1_555 NA ? I NA . ? A NA 753 ? 1_555 O   ? O HOH .   ? A HOH 895 ? 1_555 89.6  ? 
11 O   ? L HOH .   ? T HOH 42  ? 1_555 NA ? I NA . ? A NA 753 ? 1_555 O   ? O HOH .   ? A HOH 987 ? 1_555 166.5 ? 
12 O   ? D SER 223 ? A SER 463 ? 1_555 NA ? I NA . ? A NA 753 ? 1_555 O   ? O HOH .   ? A HOH 987 ? 1_555 90.0  ? 
13 O   ? O HOH .   ? A HOH 766 ? 1_555 NA ? I NA . ? A NA 753 ? 1_555 O   ? O HOH .   ? A HOH 987 ? 1_555 81.1  ? 
14 O   ? O HOH .   ? A HOH 781 ? 1_555 NA ? I NA . ? A NA 753 ? 1_555 O   ? O HOH .   ? A HOH 987 ? 1_555 80.8  ? 
15 O   ? O HOH .   ? A HOH 895 ? 1_555 NA ? I NA . ? A NA 753 ? 1_555 O   ? O HOH .   ? A HOH 987 ? 1_555 75.7  ? 
16 OP1 ? B DA  5   ? P DA  5   ? 1_555 NA ? H NA . ? A NA 752 ? 1_555 O   ? M HOH .   ? P HOH 10  ? 1_555 88.1  ? 
17 OP1 ? B DA  5   ? P DA  5   ? 1_555 NA ? H NA . ? A NA 752 ? 1_555 O   ? M HOH .   ? P HOH 30  ? 1_555 87.5  ? 
18 O   ? M HOH .   ? P HOH 10  ? 1_555 NA ? H NA . ? A NA 752 ? 1_555 O   ? M HOH .   ? P HOH 30  ? 1_555 90.8  ? 
19 OP1 ? B DA  5   ? P DA  5   ? 1_555 NA ? H NA . ? A NA 752 ? 1_555 O   ? D SER 99  ? A SER 339 ? 1_555 163.2 ? 
20 O   ? M HOH .   ? P HOH 10  ? 1_555 NA ? H NA . ? A NA 752 ? 1_555 O   ? D SER 99  ? A SER 339 ? 1_555 88.9  ? 
21 O   ? M HOH .   ? P HOH 30  ? 1_555 NA ? H NA . ? A NA 752 ? 1_555 O   ? D SER 99  ? A SER 339 ? 1_555 76.0  ? 
22 OP1 ? B DA  5   ? P DA  5   ? 1_555 NA ? H NA . ? A NA 752 ? 1_555 O   ? D ILE 101 ? A ILE 341 ? 1_555 97.7  ? 
23 O   ? M HOH .   ? P HOH 10  ? 1_555 NA ? H NA . ? A NA 752 ? 1_555 O   ? D ILE 101 ? A ILE 341 ? 1_555 95.2  ? 
24 O   ? M HOH .   ? P HOH 30  ? 1_555 NA ? H NA . ? A NA 752 ? 1_555 O   ? D ILE 101 ? A ILE 341 ? 1_555 172.1 ? 
25 O   ? D SER 99  ? A SER 339 ? 1_555 NA ? H NA . ? A NA 752 ? 1_555 O   ? D ILE 101 ? A ILE 341 ? 1_555 99.1  ? 
26 OP1 ? B DA  5   ? P DA  5   ? 1_555 NA ? H NA . ? A NA 752 ? 1_555 O   ? D ALA 104 ? A ALA 344 ? 1_555 89.0  ? 
27 O   ? M HOH .   ? P HOH 10  ? 1_555 NA ? H NA . ? A NA 752 ? 1_555 O   ? D ALA 104 ? A ALA 344 ? 1_555 175.3 ? 
28 O   ? M HOH .   ? P HOH 30  ? 1_555 NA ? H NA . ? A NA 752 ? 1_555 O   ? D ALA 104 ? A ALA 344 ? 1_555 85.4  ? 
29 O   ? D SER 99  ? A SER 339 ? 1_555 NA ? H NA . ? A NA 752 ? 1_555 O   ? D ALA 104 ? A ALA 344 ? 1_555 92.8  ? 
30 O   ? D ILE 101 ? A ILE 341 ? 1_555 NA ? H NA . ? A NA 752 ? 1_555 O   ? D ALA 104 ? A ALA 344 ? 1_555 88.8  ? 
31 O   ? D CYS 60  ? A CYS 300 ? 1_555 NA ? J NA . ? A NA 754 ? 1_555 O   ? D ILE 62  ? A ILE 302 ? 1_555 101.1 ? 
32 O   ? D CYS 60  ? A CYS 300 ? 1_555 NA ? J NA . ? A NA 754 ? 1_555 O   ? O HOH .   ? A HOH 788 ? 1_555 66.4  ? 
33 O   ? D ILE 62  ? A ILE 302 ? 1_555 NA ? J NA . ? A NA 754 ? 1_555 O   ? O HOH .   ? A HOH 788 ? 1_555 125.5 ? 
34 O   ? D CYS 60  ? A CYS 300 ? 1_555 NA ? J NA . ? A NA 754 ? 1_555 O   ? O HOH .   ? A HOH 992 ? 1_555 120.9 ? 
35 O   ? D ILE 62  ? A ILE 302 ? 1_555 NA ? J NA . ? A NA 754 ? 1_555 O   ? O HOH .   ? A HOH 992 ? 1_555 120.0 ? 
36 O   ? O HOH .   ? A HOH 788 ? 1_555 NA ? J NA . ? A NA 754 ? 1_555 O   ? O HOH .   ? A HOH 992 ? 1_555 110.4 ? 
37 OD1 ? D ASP 187 ? A ASP 427 ? 1_555 MG ? F MG . ? A MG 750 ? 1_555 OD2 ? D ASP 189 ? A ASP 429 ? 1_555 93.2  ? 
38 OD1 ? D ASP 187 ? A ASP 427 ? 1_555 MG ? F MG . ? A MG 750 ? 1_555 O2A ? K DCP .   ? A DCP 755 ? 1_555 92.5  ? 
39 OD2 ? D ASP 189 ? A ASP 429 ? 1_555 MG ? F MG . ? A MG 750 ? 1_555 O2A ? K DCP .   ? A DCP 755 ? 1_555 91.1  ? 
40 OD1 ? D ASP 187 ? A ASP 427 ? 1_555 MG ? F MG . ? A MG 750 ? 1_555 O2B ? K DCP .   ? A DCP 755 ? 1_555 175.2 ? 
41 OD2 ? D ASP 189 ? A ASP 429 ? 1_555 MG ? F MG . ? A MG 750 ? 1_555 O2B ? K DCP .   ? A DCP 755 ? 1_555 91.4  ? 
42 O2A ? K DCP .   ? A DCP 755 ? 1_555 MG ? F MG . ? A MG 750 ? 1_555 O2B ? K DCP .   ? A DCP 755 ? 1_555 85.9  ? 
43 OD1 ? D ASP 187 ? A ASP 427 ? 1_555 MG ? F MG . ? A MG 750 ? 1_555 O2G ? K DCP .   ? A DCP 755 ? 1_555 92.8  ? 
44 OD2 ? D ASP 189 ? A ASP 429 ? 1_555 MG ? F MG . ? A MG 750 ? 1_555 O2G ? K DCP .   ? A DCP 755 ? 1_555 171.4 ? 
45 O2A ? K DCP .   ? A DCP 755 ? 1_555 MG ? F MG . ? A MG 750 ? 1_555 O2G ? K DCP .   ? A DCP 755 ? 1_555 94.8  ? 
46 O2B ? K DCP .   ? A DCP 755 ? 1_555 MG ? F MG . ? A MG 750 ? 1_555 O2G ? K DCP .   ? A DCP 755 ? 1_555 82.9  ? 
47 OD1 ? D ASP 187 ? A ASP 427 ? 1_555 MG ? F MG . ? A MG 750 ? 1_555 O   ? O HOH .   ? A HOH 776 ? 1_555 102.2 ? 
48 OD2 ? D ASP 189 ? A ASP 429 ? 1_555 MG ? F MG . ? A MG 750 ? 1_555 O   ? O HOH .   ? A HOH 776 ? 1_555 84.4  ? 
49 O2A ? K DCP .   ? A DCP 755 ? 1_555 MG ? F MG . ? A MG 750 ? 1_555 O   ? O HOH .   ? A HOH 776 ? 1_555 164.8 ? 
50 O2B ? K DCP .   ? A DCP 755 ? 1_555 MG ? F MG . ? A MG 750 ? 1_555 O   ? O HOH .   ? A HOH 776 ? 1_555 79.8  ? 
51 O2G ? K DCP .   ? A DCP 755 ? 1_555 MG ? F MG . ? A MG 750 ? 1_555 O   ? O HOH .   ? A HOH 776 ? 1_555 88.2  ? 
52 OD2 ? D ASP 187 ? A ASP 427 ? 1_555 NA ? G NA . ? A NA 751 ? 1_555 OD1 ? D ASP 189 ? A ASP 429 ? 1_555 103.5 ? 
53 OD2 ? D ASP 187 ? A ASP 427 ? 1_555 NA ? G NA . ? A NA 751 ? 1_555 OD1 ? D ASP 250 ? A ASP 490 ? 1_555 94.2  ? 
54 OD1 ? D ASP 189 ? A ASP 429 ? 1_555 NA ? G NA . ? A NA 751 ? 1_555 OD1 ? D ASP 250 ? A ASP 490 ? 1_555 95.6  ? 
55 OD2 ? D ASP 187 ? A ASP 427 ? 1_555 NA ? G NA . ? A NA 751 ? 1_555 O2A ? K DCP .   ? A DCP 755 ? 1_555 98.3  ? 
56 OD1 ? D ASP 189 ? A ASP 429 ? 1_555 NA ? G NA . ? A NA 751 ? 1_555 O2A ? K DCP .   ? A DCP 755 ? 1_555 83.6  ? 
57 OD1 ? D ASP 250 ? A ASP 490 ? 1_555 NA ? G NA . ? A NA 751 ? 1_555 O2A ? K DCP .   ? A DCP 755 ? 1_555 167.3 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-05-15 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
5 'Structure model' 1 4 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
4 5 'Structure model' 'Database references'       
5 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software               
2 5 'Structure model' database_2             
3 5 'Structure model' pdbx_struct_conn_angle 
4 5 'Structure model' struct_conn            
5 5 'Structure model' struct_ref_seq_dif     
6 5 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_database_2.pdbx_DOI'                        
2  5 'Structure model' '_database_2.pdbx_database_accession'         
3  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
4  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
5  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
6  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
7  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
8  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
9  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id'  
11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 
14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 
15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
18 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
19 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
20 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
21 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
22 5 'Structure model' '_pdbx_struct_conn_angle.value'               
23 5 'Structure model' '_struct_conn.pdbx_dist_value'                
24 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
25 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
26 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
27 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
28 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
29 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
30 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
31 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
32 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
33 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
34 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
35 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
36 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
37 5 'Structure model' '_struct_ref_seq_dif.details'                 
38 5 'Structure model' '_struct_site.pdbx_auth_asym_id'              
39 5 'Structure model' '_struct_site.pdbx_auth_comp_id'              
40 5 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO           .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK       .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
CNS             .     ?                package 'Axel T. Brunger'    axel.brunger@yale.edu    refinement        
http://cns.csb.yale.edu/v1.1/                    Fortran_77 ? 3 
PDB_EXTRACT     2.000 'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 4 
StructureStudio .     ?                ?       ?                    ?                        'data collection' ? ?          ? 5 
HKL-2000        .     ?                ?       ?                    ?                        'data reduction'  ? ?          ? 6 
HKL-2000        .     ?                ?       ?                    ?                        'data scaling'    ? ?          ? 7 
MOLREP          .     ?                ?       ?                    ?                        phasing           ? ?          ? 8 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            P 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OP3 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.522 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.085 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 253 ? ? -152.68 36.46   
2 1 HIS A 290 ? ? -34.00  -38.53  
3 1 ASN A 407 ? ? -177.60 92.83   
4 1 CYS A 415 ? ? -118.36 -134.04 
5 1 ARG A 438 ? ? -148.61 -25.99  
6 1 GLN A 464 ? ? -101.08 76.70   
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DT 
_pdbx_validate_planes.auth_asym_id    T 
_pdbx_validate_planes.auth_seq_id     10 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.072 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A THR 250 ? OG1 ? D THR 10  OG1 
2   1 Y 1 A THR 250 ? CG2 ? D THR 10  CG2 
3   1 Y 1 A HIS 252 ? CG  ? D HIS 12  CG  
4   1 Y 1 A HIS 252 ? ND1 ? D HIS 12  ND1 
5   1 Y 1 A HIS 252 ? CD2 ? D HIS 12  CD2 
6   1 Y 1 A HIS 252 ? CE1 ? D HIS 12  CE1 
7   1 Y 1 A HIS 252 ? NE2 ? D HIS 12  NE2 
8   1 Y 1 A LEU 254 ? CG  ? D LEU 14  CG  
9   1 Y 1 A LEU 254 ? CD1 ? D LEU 14  CD1 
10  1 Y 1 A LEU 254 ? CD2 ? D LEU 14  CD2 
11  1 Y 1 A GLU 258 ? CG  ? D GLU 18  CG  
12  1 Y 1 A GLU 258 ? CD  ? D GLU 18  CD  
13  1 Y 1 A GLU 258 ? OE1 ? D GLU 18  OE1 
14  1 Y 1 A GLU 258 ? OE2 ? D GLU 18  OE2 
15  1 Y 1 A LYS 259 ? CG  ? D LYS 19  CG  
16  1 Y 1 A LYS 259 ? CD  ? D LYS 19  CD  
17  1 Y 1 A LYS 259 ? CE  ? D LYS 19  CE  
18  1 Y 1 A LYS 259 ? NZ  ? D LYS 19  NZ  
19  1 Y 1 A LYS 265 ? CG  ? D LYS 25  CG  
20  1 Y 1 A LYS 265 ? CD  ? D LYS 25  CD  
21  1 Y 1 A LYS 265 ? CE  ? D LYS 25  CE  
22  1 Y 1 A LYS 265 ? NZ  ? D LYS 25  NZ  
23  1 Y 1 A SER 288 ? OG  ? D SER 48  OG  
24  1 Y 1 A PHE 289 ? CG  ? D PHE 49  CG  
25  1 Y 1 A PHE 289 ? CD1 ? D PHE 49  CD1 
26  1 Y 1 A PHE 289 ? CD2 ? D PHE 49  CD2 
27  1 Y 1 A PHE 289 ? CE1 ? D PHE 49  CE1 
28  1 Y 1 A PHE 289 ? CE2 ? D PHE 49  CE2 
29  1 Y 1 A PHE 289 ? CZ  ? D PHE 49  CZ  
30  1 Y 1 A HIS 290 ? CG  ? D HIS 50  CG  
31  1 Y 1 A HIS 290 ? ND1 ? D HIS 50  ND1 
32  1 Y 1 A HIS 290 ? CD2 ? D HIS 50  CD2 
33  1 Y 1 A HIS 290 ? CE1 ? D HIS 50  CE1 
34  1 Y 1 A HIS 290 ? NE2 ? D HIS 50  NE2 
35  1 Y 1 A VAL 293 ? CG1 ? D VAL 53  CG1 
36  1 Y 1 A VAL 293 ? CG2 ? D VAL 53  CG2 
37  1 Y 1 A THR 294 ? OG1 ? D THR 54  OG1 
38  1 Y 1 A THR 294 ? CG2 ? D THR 54  CG2 
39  1 Y 1 A GLN 297 ? CG  ? D GLN 57  CG  
40  1 Y 1 A GLN 297 ? CD  ? D GLN 57  CD  
41  1 Y 1 A GLN 297 ? OE1 ? D GLN 57  OE1 
42  1 Y 1 A GLN 297 ? NE2 ? D GLN 57  NE2 
43  1 Y 1 A GLU 298 ? CG  ? D GLU 58  CG  
44  1 Y 1 A GLU 298 ? CD  ? D GLU 58  CD  
45  1 Y 1 A GLU 298 ? OE1 ? D GLU 58  OE1 
46  1 Y 1 A GLU 298 ? OE2 ? D GLU 58  OE2 
47  1 Y 1 A LYS 307 ? CG  ? D LYS 67  CG  
48  1 Y 1 A LYS 307 ? CD  ? D LYS 67  CD  
49  1 Y 1 A LYS 307 ? CE  ? D LYS 67  CE  
50  1 Y 1 A LYS 307 ? NZ  ? D LYS 67  NZ  
51  1 Y 1 A LYS 312 ? CG  ? D LYS 72  CG  
52  1 Y 1 A LYS 312 ? CD  ? D LYS 72  CD  
53  1 Y 1 A LYS 312 ? CE  ? D LYS 72  CE  
54  1 Y 1 A LYS 312 ? NZ  ? D LYS 72  NZ  
55  1 Y 1 A LEU 317 ? CG  ? D LEU 77  CG  
56  1 Y 1 A LEU 317 ? CD1 ? D LEU 77  CD1 
57  1 Y 1 A LEU 317 ? CD2 ? D LEU 77  CD2 
58  1 Y 1 A SER 319 ? OG  ? D SER 79  OG  
59  1 Y 1 A ARG 323 ? CG  ? D ARG 83  CG  
60  1 Y 1 A ARG 323 ? CD  ? D ARG 83  CD  
61  1 Y 1 A ARG 323 ? NE  ? D ARG 83  NE  
62  1 Y 1 A ARG 323 ? CZ  ? D ARG 83  CZ  
63  1 Y 1 A ARG 323 ? NH1 ? D ARG 83  NH1 
64  1 Y 1 A ARG 323 ? NH2 ? D ARG 83  NH2 
65  1 Y 1 A LYS 401 ? CG  ? D LYS 161 CG  
66  1 Y 1 A LYS 401 ? CD  ? D LYS 161 CD  
67  1 Y 1 A LYS 401 ? CE  ? D LYS 161 CE  
68  1 Y 1 A LYS 401 ? NZ  ? D LYS 161 NZ  
69  1 Y 1 A ARG 438 ? CG  ? D ARG 198 CG  
70  1 Y 1 A ARG 438 ? CD  ? D ARG 198 CD  
71  1 Y 1 A ARG 438 ? NE  ? D ARG 198 NE  
72  1 Y 1 A ARG 438 ? CZ  ? D ARG 198 CZ  
73  1 Y 1 A ARG 438 ? NH1 ? D ARG 198 NH1 
74  1 Y 1 A ARG 438 ? NH2 ? D ARG 198 NH2 
75  1 Y 1 A ARG 441 ? CG  ? D ARG 201 CG  
76  1 Y 1 A ARG 441 ? CD  ? D ARG 201 CD  
77  1 Y 1 A ARG 441 ? NE  ? D ARG 201 NE  
78  1 Y 1 A ARG 441 ? CZ  ? D ARG 201 CZ  
79  1 Y 1 A ARG 441 ? NH1 ? D ARG 201 NH1 
80  1 Y 1 A ARG 441 ? NH2 ? D ARG 201 NH2 
81  1 Y 1 A ARG 446 ? CG  ? D ARG 206 CG  
82  1 Y 1 A ARG 446 ? CD  ? D ARG 206 CD  
83  1 Y 1 A ARG 446 ? NE  ? D ARG 206 NE  
84  1 Y 1 A ARG 446 ? CZ  ? D ARG 206 CZ  
85  1 Y 1 A ARG 446 ? NH1 ? D ARG 206 NH1 
86  1 Y 1 A ARG 446 ? NH2 ? D ARG 206 NH2 
87  1 Y 1 A GLN 453 ? CG  ? D GLN 213 CG  
88  1 Y 1 A GLN 453 ? CD  ? D GLN 213 CD  
89  1 Y 1 A GLN 453 ? OE1 ? D GLN 213 OE1 
90  1 Y 1 A GLN 453 ? NE2 ? D GLN 213 NE2 
91  1 Y 1 A VAL 545 ? CG1 ? D VAL 305 CG1 
92  1 Y 1 A VAL 545 ? CG2 ? D VAL 305 CG2 
93  1 Y 1 A GLU 572 ? CG  ? D GLU 332 CG  
94  1 Y 1 A GLU 572 ? CD  ? D GLU 332 CD  
95  1 Y 1 A GLU 572 ? OE1 ? D GLU 332 OE1 
96  1 Y 1 A GLU 572 ? OE2 ? D GLU 332 OE2 
97  1 Y 1 A TRP 575 ? CG  ? D TRP 335 CG  
98  1 Y 1 A TRP 575 ? CD1 ? D TRP 335 CD1 
99  1 Y 1 A TRP 575 ? CD2 ? D TRP 335 CD2 
100 1 Y 1 A TRP 575 ? NE1 ? D TRP 335 NE1 
101 1 Y 1 A TRP 575 ? CE2 ? D TRP 335 CE2 
102 1 Y 1 A TRP 575 ? CE3 ? D TRP 335 CE3 
103 1 Y 1 A TRP 575 ? CZ2 ? D TRP 335 CZ2 
104 1 Y 1 A TRP 575 ? CZ3 ? D TRP 335 CZ3 
105 1 Y 1 A TRP 575 ? CH2 ? D TRP 335 CH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 241 ? D MET 1 
2 1 Y 1 A ALA 242 ? D ALA 2 
3 1 Y 1 A GLN 243 ? D GLN 3 
4 1 Y 1 A PRO 244 ? D PRO 4 
5 1 Y 1 A SER 245 ? D SER 5 
6 1 Y 1 A SER 246 ? D SER 6 
7 1 Y 1 A GLN 247 ? D GLN 7 
8 1 Y 1 A LYS 248 ? D LYS 8 
9 1 Y 1 A ALA 249 ? D ALA 9 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2PFP 'double helix'        
2PFP 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 1  1_555 C DG 4 1_555 0.221  -0.281 0.470  -13.618 -6.754  -4.393 1  T_DC1:DG4_D  T 1  ? D 4 ? 19 1 
1 A DG 2  1_555 C DC 3 1_555 -0.304 -0.210 -0.189 -2.760  0.670   -0.267 2  T_DG2:DC3_D  T 2  ? D 3 ? 19 1 
1 A DG 3  1_555 C DC 2 1_555 -0.066 -0.137 0.020  6.633   -0.984  -4.849 3  T_DG3:DC2_D  T 3  ? D 2 ? 19 1 
1 A DC 4  1_555 C DG 1 1_555 0.663  -0.240 0.192  13.810  -11.782 -0.567 4  T_DC4:DG1_D  T 4  ? D 1 ? 19 1 
1 A DG 6  1_555 B DC 6 1_555 -0.126 -0.156 0.057  2.468   -5.203  -4.221 5  T_DG6:DC6_P  T 6  ? P 6 ? 19 1 
1 A DT 7  1_555 B DA 5 1_555 0.073  -0.192 0.284  -3.449  -19.594 3.570  6  T_DT7:DA5_P  T 7  ? P 5 ? 20 1 
1 A DA 8  1_555 B DT 4 1_555 0.063  -0.086 -0.140 -5.374  -5.092  1.156  7  T_DA8:DT4_P  T 8  ? P 4 ? 20 1 
1 A DC 9  1_555 B DG 3 1_555 0.044  -0.082 0.044  2.106   -6.950  -2.972 8  T_DC9:DG3_P  T 9  ? P 3 ? 19 1 
1 A DT 10 1_555 B DA 2 1_555 -0.070 -0.134 -0.050 7.453   -6.313  1.328  9  T_DT10:DA2_P T 10 ? P 2 ? 20 1 
1 A DG 11 1_555 B DC 1 1_555 -0.243 -0.138 0.408  21.029  -16.415 2.897  10 T_DG11:DC1_P T 11 ? P 1 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 1  1_555 C DG 4 1_555 A DG 2  1_555 C DC 3 1_555 1.286  0.287  3.065 6.457  3.623  29.092 -0.181 -1.175 3.279 7.070  
-12.598 29.999 1 TT_DC1DG2:DC3DG4_DD   T 1  ? D 4 ? T 2  ? D 3 ? 
1 A DG 2  1_555 C DC 3 1_555 A DG 3  1_555 C DC 2 1_555 -1.011 0.167  3.124 -4.148 3.388  35.342 -0.205 1.063  3.220 5.541  6.784 
35.733 2 TT_DG2DG3:DC2DC3_DD   T 2  ? D 3 ? T 3  ? D 2 ? 
1 A DG 3  1_555 C DC 2 1_555 A DC 4  1_555 C DG 1 1_555 0.658  -0.875 3.235 -3.884 6.411  35.579 -2.259 -1.574 2.953 10.350 6.270 
36.335 3 TT_DG3DC4:DG1DC2_DD   T 3  ? D 2 ? T 4  ? D 1 ? 
1 A DG 6  1_555 B DC 6 1_555 A DT 7  1_555 B DA 5 1_555 0.981  -0.709 3.502 -2.205 -0.615 33.444 -1.122 -2.085 3.445 -1.066 3.825 
33.520 4 TT_DG6DT7:DA5DC6_PP   T 6  ? P 6 ? T 7  ? P 5 ? 
1 A DT 7  1_555 B DA 5 1_555 A DA 8  1_555 B DT 4 1_555 -0.698 -0.707 3.293 3.740  7.568  35.006 -2.196 1.648  2.992 12.361 -6.108 
35.978 5 TT_DT7DA8:DT4DA5_PP   T 7  ? P 5 ? T 8  ? P 4 ? 
1 A DA 8  1_555 B DT 4 1_555 A DC 9  1_555 B DG 3 1_555 -0.822 -0.634 3.144 -1.303 4.287  30.209 -2.015 1.314  3.059 8.170  2.484 
30.532 6 TT_DA8DC9:DG3DT4_PP   T 8  ? P 4 ? T 9  ? P 3 ? 
1 A DC 9  1_555 B DG 3 1_555 A DT 10 1_555 B DA 2 1_555 -0.112 -0.547 3.216 2.101  2.477  31.370 -1.456 0.588  3.150 4.565  -3.873 
31.534 7 TT_DC9DT10:DA2DG3_PP  T 9  ? P 3 ? T 10 ? P 2 ? 
1 A DT 10 1_555 B DA 2 1_555 A DG 11 1_555 B DC 1 1_555 0.463  0.808  3.060 -2.424 13.233 31.552 -0.676 -1.162 3.099 23.069 4.225 
34.233 8 TT_DT10DG11:DC1DA2_PP T 10 ? P 2 ? T 11 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'SODIUM ION'                       NA  
6 'MAGNESIUM ION'                    MG  
7 "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE" DCP 
8 water                              HOH 
#