data_2PHA
# 
_entry.id   2PHA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2PHA         
RCSB  RCSB042376   
WWPDB D_1000042376 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2AEB 'The same human arginase I enzyme complexed with ABH' unspecified 
PDB 1WVA 'The same human arginase I enzyme complexed with BEC' unspecified 
PDB 2PHO 
;Crystal structure of human arginase I complexed with thiosemicarbazide reveals an unusual thiocarbonyl-sulfide ligand in the binuclear manganese cluster
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2PHA 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Di Costanzo, L.'    1 
'Pique, M.E.'        2 
'Christianson, D.W.' 3 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of human arginase I complexed with thiosemicarbazide reveals an unusual thiocarbonyl mu-sulfide ligand in the binuclear manganese cluster.
;
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            129 
_citation.page_first                6388 
_citation.page_last                 6389 
_citation.year                      2007 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17469833 
_citation.pdbx_database_id_DOI      10.1021/ja071567j 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Di Costanzo, L.'    1 
primary 'Pique, M.E.'        2 
primary 'Christianson, D.W.' 3 
# 
_cell.entry_id           2PHA 
_cell.length_a           90.77 
_cell.length_b           90.77 
_cell.length_c           69.74 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        120 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2PHA 
_symmetry.space_group_name_H-M             'P 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                143 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Arginase-1           34779.879 2   3.5.3.1 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION' 54.938    4   ?       ? ? ? 
3 water       nat water                18.015    254 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Type I arginase, Liver-type arginase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQL
AGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVP
GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNP
PK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQL
AGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVP
GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNP
PK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ALA n 
1 4   LYS n 
1 5   SER n 
1 6   ARG n 
1 7   THR n 
1 8   ILE n 
1 9   GLY n 
1 10  ILE n 
1 11  ILE n 
1 12  GLY n 
1 13  ALA n 
1 14  PRO n 
1 15  PHE n 
1 16  SER n 
1 17  LYS n 
1 18  GLY n 
1 19  GLN n 
1 20  PRO n 
1 21  ARG n 
1 22  GLY n 
1 23  GLY n 
1 24  VAL n 
1 25  GLU n 
1 26  GLU n 
1 27  GLY n 
1 28  PRO n 
1 29  THR n 
1 30  VAL n 
1 31  LEU n 
1 32  ARG n 
1 33  LYS n 
1 34  ALA n 
1 35  GLY n 
1 36  LEU n 
1 37  LEU n 
1 38  GLU n 
1 39  LYS n 
1 40  LEU n 
1 41  LYS n 
1 42  GLU n 
1 43  GLN n 
1 44  GLU n 
1 45  CYS n 
1 46  ASP n 
1 47  VAL n 
1 48  LYS n 
1 49  ASP n 
1 50  TYR n 
1 51  GLY n 
1 52  ASP n 
1 53  LEU n 
1 54  PRO n 
1 55  PHE n 
1 56  ALA n 
1 57  ASP n 
1 58  ILE n 
1 59  PRO n 
1 60  ASN n 
1 61  ASP n 
1 62  SER n 
1 63  PRO n 
1 64  PHE n 
1 65  GLN n 
1 66  ILE n 
1 67  VAL n 
1 68  LYS n 
1 69  ASN n 
1 70  PRO n 
1 71  ARG n 
1 72  SER n 
1 73  VAL n 
1 74  GLY n 
1 75  LYS n 
1 76  ALA n 
1 77  SER n 
1 78  GLU n 
1 79  GLN n 
1 80  LEU n 
1 81  ALA n 
1 82  GLY n 
1 83  LYS n 
1 84  VAL n 
1 85  ALA n 
1 86  GLU n 
1 87  VAL n 
1 88  LYS n 
1 89  LYS n 
1 90  ASN n 
1 91  GLY n 
1 92  ARG n 
1 93  ILE n 
1 94  SER n 
1 95  LEU n 
1 96  VAL n 
1 97  LEU n 
1 98  GLY n 
1 99  GLY n 
1 100 ASP n 
1 101 HIS n 
1 102 SER n 
1 103 LEU n 
1 104 ALA n 
1 105 ILE n 
1 106 GLY n 
1 107 SER n 
1 108 ILE n 
1 109 SER n 
1 110 GLY n 
1 111 HIS n 
1 112 ALA n 
1 113 ARG n 
1 114 VAL n 
1 115 HIS n 
1 116 PRO n 
1 117 ASP n 
1 118 LEU n 
1 119 GLY n 
1 120 VAL n 
1 121 ILE n 
1 122 TRP n 
1 123 VAL n 
1 124 ASP n 
1 125 ALA n 
1 126 HIS n 
1 127 THR n 
1 128 ASP n 
1 129 ILE n 
1 130 ASN n 
1 131 THR n 
1 132 PRO n 
1 133 LEU n 
1 134 THR n 
1 135 THR n 
1 136 THR n 
1 137 SER n 
1 138 GLY n 
1 139 ASN n 
1 140 LEU n 
1 141 HIS n 
1 142 GLY n 
1 143 GLN n 
1 144 PRO n 
1 145 VAL n 
1 146 SER n 
1 147 PHE n 
1 148 LEU n 
1 149 LEU n 
1 150 LYS n 
1 151 GLU n 
1 152 LEU n 
1 153 LYS n 
1 154 GLY n 
1 155 LYS n 
1 156 ILE n 
1 157 PRO n 
1 158 ASP n 
1 159 VAL n 
1 160 PRO n 
1 161 GLY n 
1 162 PHE n 
1 163 SER n 
1 164 TRP n 
1 165 VAL n 
1 166 THR n 
1 167 PRO n 
1 168 CYS n 
1 169 ILE n 
1 170 SER n 
1 171 ALA n 
1 172 LYS n 
1 173 ASP n 
1 174 ILE n 
1 175 VAL n 
1 176 TYR n 
1 177 ILE n 
1 178 GLY n 
1 179 LEU n 
1 180 ARG n 
1 181 ASP n 
1 182 VAL n 
1 183 ASP n 
1 184 PRO n 
1 185 GLY n 
1 186 GLU n 
1 187 HIS n 
1 188 TYR n 
1 189 ILE n 
1 190 LEU n 
1 191 LYS n 
1 192 THR n 
1 193 LEU n 
1 194 GLY n 
1 195 ILE n 
1 196 LYS n 
1 197 TYR n 
1 198 PHE n 
1 199 SER n 
1 200 MET n 
1 201 THR n 
1 202 GLU n 
1 203 VAL n 
1 204 ASP n 
1 205 ARG n 
1 206 LEU n 
1 207 GLY n 
1 208 ILE n 
1 209 GLY n 
1 210 LYS n 
1 211 VAL n 
1 212 MET n 
1 213 GLU n 
1 214 GLU n 
1 215 THR n 
1 216 LEU n 
1 217 SER n 
1 218 TYR n 
1 219 LEU n 
1 220 LEU n 
1 221 GLY n 
1 222 ARG n 
1 223 LYS n 
1 224 LYS n 
1 225 ARG n 
1 226 PRO n 
1 227 ILE n 
1 228 HIS n 
1 229 LEU n 
1 230 SER n 
1 231 PHE n 
1 232 ASP n 
1 233 VAL n 
1 234 ASP n 
1 235 GLY n 
1 236 LEU n 
1 237 ASP n 
1 238 PRO n 
1 239 SER n 
1 240 PHE n 
1 241 THR n 
1 242 PRO n 
1 243 ALA n 
1 244 THR n 
1 245 GLY n 
1 246 THR n 
1 247 PRO n 
1 248 VAL n 
1 249 VAL n 
1 250 GLY n 
1 251 GLY n 
1 252 LEU n 
1 253 THR n 
1 254 TYR n 
1 255 ARG n 
1 256 GLU n 
1 257 GLY n 
1 258 LEU n 
1 259 TYR n 
1 260 ILE n 
1 261 THR n 
1 262 GLU n 
1 263 GLU n 
1 264 ILE n 
1 265 TYR n 
1 266 LYS n 
1 267 THR n 
1 268 GLY n 
1 269 LEU n 
1 270 LEU n 
1 271 SER n 
1 272 GLY n 
1 273 LEU n 
1 274 ASP n 
1 275 ILE n 
1 276 MET n 
1 277 GLU n 
1 278 VAL n 
1 279 ASN n 
1 280 PRO n 
1 281 SER n 
1 282 LEU n 
1 283 GLY n 
1 284 LYS n 
1 285 THR n 
1 286 PRO n 
1 287 GLU n 
1 288 GLU n 
1 289 VAL n 
1 290 THR n 
1 291 ARG n 
1 292 THR n 
1 293 VAL n 
1 294 ASN n 
1 295 THR n 
1 296 ALA n 
1 297 VAL n 
1 298 ALA n 
1 299 ILE n 
1 300 THR n 
1 301 LEU n 
1 302 ALA n 
1 303 CYS n 
1 304 PHE n 
1 305 GLY n 
1 306 LEU n 
1 307 ALA n 
1 308 ARG n 
1 309 GLU n 
1 310 GLY n 
1 311 ASN n 
1 312 HIS n 
1 313 LYS n 
1 314 PRO n 
1 315 ILE n 
1 316 ASP n 
1 317 TYR n 
1 318 LEU n 
1 319 ASN n 
1 320 PRO n 
1 321 PRO n 
1 322 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ARG1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pBS(KS)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ARGI1_HUMAN 
_struct_ref.pdbx_db_accession          P05089 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQL
AGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVP
GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNP
PK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2PHA A 1 ? 322 ? P05089 1 ? 322 ? 1 322 
2 1 2PHA B 1 ? 322 ? P05089 1 ? 322 ? 1 322 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2PHA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.38 
_exptl_crystal.density_percent_sol   48.38 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'18-22% Jeffamine ED-2001, 0.1M Hepes (pH 7.0), VAPOR DIFFUSION, HANGING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     2PHA 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.d_resolution_high            1.90 
_reflns.d_resolution_low             39.3 
_reflns.number_all                   49544 
_reflns.number_obs                   49544 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.3 
_reflns.B_iso_Wilson_estimate        18.9 
_reflns.pdbx_redundancy              1.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              2.00 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           0.237 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        1.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      7103 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2PHA 
_refine.ls_d_res_high                            1.90 
_refine.ls_d_res_low                             18.03 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_ls_sigma_I                          1.0 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     42856 
_refine.ls_number_reflns_R_free                  2173 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.198 
_refine.ls_R_factor_R_free                       0.244 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2AEB 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  
;From 39.3 and 18.03 A there are only very few reflections and the 
scaling process doesn't record those in the output file of 
structure factors because those have a poor profile. 
The data is perfect hemihedral twinning with twinning operator: 
-h,-k,l and twinned fraction:0.5
;
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4774 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             254 
_refine_hist.number_atoms_total               5032 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        18.03 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_d          1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_deg         0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.0   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        2.00 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.305 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.314 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2PHA 
_struct.title                     'Crystal structure of native, unliganded human arginase at 1.90 resolution' 
_struct.pdbx_descriptor           'Arginase-1 (E.C.3.5.3.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2PHA 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'PROTON WIRE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
1 ? 
2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 26  ? LYS A 33  ? GLU A 26  LYS A 33  1 ? 8  
HELX_P HELX_P2  2  GLY A 35  ? GLU A 42  ? GLY A 35  GLU A 42  1 ? 8  
HELX_P HELX_P3  3  ASN A 69  ? ASN A 90  ? ASN A 69  ASN A 90  1 ? 22 
HELX_P HELX_P4  4  ASP A 100 ? SER A 102 ? ASP A 100 SER A 102 5 ? 3  
HELX_P HELX_P5  5  LEU A 103 ? HIS A 115 ? LEU A 103 HIS A 115 1 ? 13 
HELX_P HELX_P6  6  ASN A 139 ? GLY A 142 ? ASN A 139 GLY A 142 5 ? 4  
HELX_P HELX_P7  7  GLN A 143 ? LEU A 149 ? GLN A 143 LEU A 149 1 ? 7  
HELX_P HELX_P8  8  SER A 170 ? LYS A 172 ? SER A 170 LYS A 172 5 ? 3  
HELX_P HELX_P9  9  ASP A 183 ? LEU A 193 ? ASP A 183 LEU A 193 1 ? 11 
HELX_P HELX_P10 10 SER A 199 ? GLY A 221 ? SER A 199 GLY A 221 1 ? 23 
HELX_P HELX_P11 11 ASP A 234 ? LEU A 236 ? ASP A 234 LEU A 236 5 ? 3  
HELX_P HELX_P12 12 THR A 253 ? GLY A 268 ? THR A 253 GLY A 268 1 ? 16 
HELX_P HELX_P13 13 ASN A 279 ? GLY A 283 ? ASN A 279 GLY A 283 5 ? 5  
HELX_P HELX_P14 14 THR A 285 ? PHE A 304 ? THR A 285 PHE A 304 1 ? 20 
HELX_P HELX_P15 15 ARG B 21  ? GLU B 25  ? ARG B 21  GLU B 25  5 ? 5  
HELX_P HELX_P16 16 GLU B 26  ? LYS B 33  ? GLU B 26  LYS B 33  1 ? 8  
HELX_P HELX_P17 17 GLY B 35  ? GLU B 42  ? GLY B 35  GLU B 42  1 ? 8  
HELX_P HELX_P18 18 ASN B 69  ? ASN B 90  ? ASN B 69  ASN B 90  1 ? 22 
HELX_P HELX_P19 19 ASP B 100 ? SER B 102 ? ASP B 100 SER B 102 5 ? 3  
HELX_P HELX_P20 20 LEU B 103 ? HIS B 115 ? LEU B 103 HIS B 115 1 ? 13 
HELX_P HELX_P21 21 ASN B 139 ? GLY B 142 ? ASN B 139 GLY B 142 5 ? 4  
HELX_P HELX_P22 22 GLN B 143 ? LEU B 149 ? GLN B 143 LEU B 149 1 ? 7  
HELX_P HELX_P23 23 SER B 170 ? LYS B 172 ? SER B 170 LYS B 172 5 ? 3  
HELX_P HELX_P24 24 ASP B 183 ? GLY B 194 ? ASP B 183 GLY B 194 1 ? 12 
HELX_P HELX_P25 25 MET B 200 ? GLY B 207 ? MET B 200 GLY B 207 1 ? 8  
HELX_P HELX_P26 26 GLY B 207 ? GLY B 221 ? GLY B 207 GLY B 221 1 ? 15 
HELX_P HELX_P27 27 ASP B 234 ? LEU B 236 ? ASP B 234 LEU B 236 5 ? 3  
HELX_P HELX_P28 28 THR B 253 ? LYS B 266 ? THR B 253 LYS B 266 1 ? 14 
HELX_P HELX_P29 29 ASN B 279 ? GLY B 283 ? ASN B 279 GLY B 283 5 ? 5  
HELX_P HELX_P30 30 THR B 285 ? CYS B 303 ? THR B 285 CYS B 303 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 124 OD1 ? ? ? 1_555 C MN  .   MN  ? ? A ASP 124 A MN  323 1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc2  metalc ? ? A ASP 124 OD2 ? ? ? 1_555 D MN  .   MN  ? ? A ASP 124 A MN  324 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc3  metalc ? ? A ASP 128 OD1 ? ? ? 1_555 D MN  .   MN  ? ? A ASP 128 A MN  324 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc4  metalc ? ? A ASP 234 OD1 ? ? ? 1_555 C MN  .   MN  ? ? A ASP 234 A MN  323 1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc5  metalc ? ? A ASP 234 OD2 ? ? ? 1_555 C MN  .   MN  ? ? A ASP 234 A MN  323 1_555 ? ? ? ? ? ? ? 2.485 ? 
metalc6  metalc ? ? B ASP 124 OD1 ? ? ? 1_555 E MN  .   MN  ? ? B ASP 124 B MN  323 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc7  metalc ? ? B ASP 124 OD2 ? ? ? 1_555 F MN  .   MN  ? ? B ASP 124 B MN  324 1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc8  metalc ? ? B ASP 128 OD1 ? ? ? 1_555 F MN  .   MN  ? ? B ASP 128 B MN  324 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc9  metalc ? ? B ASP 232 OD2 ? ? ? 1_555 E MN  .   MN  ? ? B ASP 232 B MN  323 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc10 metalc ? ? B ASP 234 OD2 ? ? ? 1_555 E MN  .   MN  ? ? B ASP 234 B MN  323 1_555 ? ? ? ? ? ? ? 2.235 ? 
metalc11 metalc ? ? E MN  .   MN  ? ? ? 1_555 H HOH .   O   ? ? B MN  323 B HOH 436 1_555 ? ? ? ? ? ? ? 2.408 ? 
metalc12 metalc ? ? F MN  .   MN  ? ? ? 1_555 H HOH .   O   ? ? B MN  324 B HOH 436 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc13 metalc ? ? C MN  .   MN  ? ? ? 1_555 G HOH .   O   ? ? A MN  323 A HOH 388 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc14 metalc ? ? D MN  .   MN  ? ? ? 1_555 G HOH .   O   ? ? A MN  324 A HOH 388 1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc15 metalc ? ? C MN  .   MN  ? ? ? 1_555 A HIS 126 ND1 ? ? A MN  323 A HIS 126 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc16 metalc ? ? C MN  .   MN  ? ? ? 1_555 A ASP 232 OD2 ? ? A MN  323 A ASP 232 1_555 ? ? ? ? ? ? ? 2.608 ? 
metalc17 metalc ? ? D MN  .   MN  ? ? ? 1_555 A HIS 101 ND1 ? ? A MN  324 A HIS 101 1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc18 metalc ? ? D MN  .   MN  ? ? ? 1_555 A ASP 232 OD2 ? ? A MN  324 A ASP 232 1_555 ? ? ? ? ? ? ? 2.581 ? 
metalc19 metalc ? ? E MN  .   MN  ? ? ? 1_555 B ASP 234 OD1 ? ? B MN  323 B ASP 234 1_555 ? ? ? ? ? ? ? 2.561 ? 
metalc20 metalc ? ? E MN  .   MN  ? ? ? 1_555 B HIS 126 ND1 ? ? B MN  323 B HIS 126 1_555 ? ? ? ? ? ? ? 2.130 ? 
metalc21 metalc ? ? F MN  .   MN  ? ? ? 1_555 B HIS 101 ND1 ? ? B MN  324 B HIS 101 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc22 metalc ? ? F MN  .   MN  ? ? ? 1_555 B ASP 232 OD2 ? ? B MN  324 B ASP 232 1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc23 metalc ? ? F MN  .   MN  ? ? ? 1_555 H HOH .   O   ? ? B MN  324 B HOH 430 1_555 ? ? ? ? ? ? ? 2.680 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
A 5 6 ? parallel 
A 6 7 ? parallel 
A 7 8 ? parallel 
B 1 2 ? parallel 
B 2 3 ? parallel 
B 3 4 ? parallel 
B 4 5 ? parallel 
B 5 6 ? parallel 
B 6 7 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASP A 46  ? ASP A 52  ? ASP A 46  ASP A 52  
A 2 THR A 7   ? GLY A 12  ? THR A 7   GLY A 12  
A 3 ILE A 93  ? LEU A 97  ? ILE A 93  LEU A 97  
A 4 LEU A 270 ? MET A 276 ? LEU A 270 MET A 276 
A 5 ILE A 227 ? ASP A 232 ? ILE A 227 ASP A 232 
A 6 GLY A 119 ? VAL A 123 ? GLY A 119 VAL A 123 
A 7 ILE A 174 ? ILE A 177 ? ILE A 174 ILE A 177 
A 8 LYS A 196 ? PHE A 198 ? LYS A 196 PHE A 198 
B 1 ILE B 8   ? ALA B 13  ? ILE B 8   ALA B 13  
B 2 ILE B 93  ? GLY B 98  ? ILE B 93  GLY B 98  
B 3 LEU B 270 ? MET B 276 ? LEU B 270 MET B 276 
B 4 ILE B 227 ? ASP B 232 ? ILE B 227 ASP B 232 
B 5 GLY B 119 ? VAL B 123 ? GLY B 119 VAL B 123 
B 6 ILE B 174 ? LEU B 179 ? ILE B 174 LEU B 179 
B 7 LYS B 196 ? SER B 199 ? LYS B 196 SER B 199 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 51  ? O GLY A 51  N GLY A 12  ? N GLY A 12  
A 2 3 N THR A 7   ? N THR A 7   O ILE A 93  ? O ILE A 93  
A 3 4 N VAL A 96  ? N VAL A 96  O LEU A 273 ? O LEU A 273 
A 4 5 O GLY A 272 ? O GLY A 272 N LEU A 229 ? N LEU A 229 
A 5 6 O HIS A 228 ? O HIS A 228 N GLY A 119 ? N GLY A 119 
A 6 7 N TRP A 122 ? N TRP A 122 O VAL A 175 ? O VAL A 175 
A 7 8 N TYR A 176 ? N TYR A 176 O PHE A 198 ? O PHE A 198 
B 1 2 N ILE B 11  ? N ILE B 11  O LEU B 97  ? O LEU B 97  
B 2 3 N SER B 94  ? N SER B 94  O LEU B 273 ? O LEU B 273 
B 3 4 O SER B 271 ? O SER B 271 N ILE B 227 ? N ILE B 227 
B 4 5 O HIS B 228 ? O HIS B 228 N GLY B 119 ? N GLY B 119 
B 5 6 N TRP B 122 ? N TRP B 122 O VAL B 175 ? O VAL B 175 
B 6 7 N TYR B 176 ? N TYR B 176 O PHE B 198 ? O PHE B 198 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN B 323' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MN B 324' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN A 323' 
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MN A 324' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP B 124 ? ASP B 124 . ? 1_555 ? 
2  AC1 6 HIS B 126 ? HIS B 126 . ? 1_555 ? 
3  AC1 6 ASP B 232 ? ASP B 232 . ? 1_555 ? 
4  AC1 6 ASP B 234 ? ASP B 234 . ? 1_555 ? 
5  AC1 6 MN  F .   ? MN  B 324 . ? 1_555 ? 
6  AC1 6 HOH H .   ? HOH B 436 . ? 1_555 ? 
7  AC2 7 HIS B 101 ? HIS B 101 . ? 1_555 ? 
8  AC2 7 ASP B 124 ? ASP B 124 . ? 1_555 ? 
9  AC2 7 ASP B 128 ? ASP B 128 . ? 1_555 ? 
10 AC2 7 ASP B 232 ? ASP B 232 . ? 1_555 ? 
11 AC2 7 MN  E .   ? MN  B 323 . ? 1_555 ? 
12 AC2 7 HOH H .   ? HOH B 430 . ? 1_555 ? 
13 AC2 7 HOH H .   ? HOH B 436 . ? 1_555 ? 
14 AC3 6 ASP A 124 ? ASP A 124 . ? 1_555 ? 
15 AC3 6 HIS A 126 ? HIS A 126 . ? 1_555 ? 
16 AC3 6 ASP A 232 ? ASP A 232 . ? 1_555 ? 
17 AC3 6 ASP A 234 ? ASP A 234 . ? 1_555 ? 
18 AC3 6 MN  D .   ? MN  A 324 . ? 1_555 ? 
19 AC3 6 HOH G .   ? HOH A 388 . ? 1_555 ? 
20 AC4 7 HIS A 101 ? HIS A 101 . ? 1_555 ? 
21 AC4 7 ASP A 124 ? ASP A 124 . ? 1_555 ? 
22 AC4 7 ASP A 128 ? ASP A 128 . ? 1_555 ? 
23 AC4 7 ASP A 232 ? ASP A 232 . ? 1_555 ? 
24 AC4 7 MN  C .   ? MN  A 323 . ? 1_555 ? 
25 AC4 7 HOH G .   ? HOH A 388 . ? 1_555 ? 
26 AC4 7 HOH G .   ? HOH A 442 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2PHA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2PHA 
_atom_sites.fract_transf_matrix[1][1]   0.011017 
_atom_sites.fract_transf_matrix[1][2]   0.006361 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012721 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014339 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 5   ? 26.553 18.885  9.719   1.00 42.48 ? 5   SER A N   1 
ATOM   2    C  CA  . SER A 1 5   ? 26.362 18.479  8.300   1.00 42.49 ? 5   SER A CA  1 
ATOM   3    C  C   . SER A 1 5   ? 27.078 17.167  8.035   1.00 43.19 ? 5   SER A C   1 
ATOM   4    O  O   . SER A 1 5   ? 28.059 16.840  8.705   1.00 42.94 ? 5   SER A O   1 
ATOM   5    C  CB  . SER A 1 5   ? 26.904 19.556  7.356   1.00 41.68 ? 5   SER A CB  1 
ATOM   6    O  OG  . SER A 1 5   ? 28.279 19.794  7.586   1.00 40.21 ? 5   SER A OG  1 
ATOM   7    N  N   . ARG A 1 6   ? 26.578 16.415  7.059   1.00 43.95 ? 6   ARG A N   1 
ATOM   8    C  CA  . ARG A 1 6   ? 27.172 15.131  6.704   1.00 43.79 ? 6   ARG A CA  1 
ATOM   9    C  C   . ARG A 1 6   ? 27.816 15.142  5.321   1.00 42.69 ? 6   ARG A C   1 
ATOM   10   O  O   . ARG A 1 6   ? 27.146 15.371  4.307   1.00 41.98 ? 6   ARG A O   1 
ATOM   11   C  CB  . ARG A 1 6   ? 26.123 14.015  6.797   1.00 44.47 ? 6   ARG A CB  1 
ATOM   12   C  CG  . ARG A 1 6   ? 25.777 13.640  8.226   1.00 45.26 ? 6   ARG A CG  1 
ATOM   13   C  CD  . ARG A 1 6   ? 27.044 13.474  9.049   1.00 47.78 ? 6   ARG A CD  1 
ATOM   14   N  NE  . ARG A 1 6   ? 26.796 12.817  10.326  1.00 50.36 ? 6   ARG A NE  1 
ATOM   15   C  CZ  . ARG A 1 6   ? 27.747 12.509  11.207  1.00 51.48 ? 6   ARG A CZ  1 
ATOM   16   N  NH1 . ARG A 1 6   ? 29.015 12.806  10.951  1.00 51.76 ? 6   ARG A NH1 1 
ATOM   17   N  NH2 . ARG A 1 6   ? 27.435 11.881  12.334  1.00 51.85 ? 6   ARG A NH2 1 
ATOM   18   N  N   . THR A 1 7   ? 29.126 14.900  5.298   1.00 41.11 ? 7   THR A N   1 
ATOM   19   C  CA  . THR A 1 7   ? 29.899 14.882  4.061   1.00 38.38 ? 7   THR A CA  1 
ATOM   20   C  C   . THR A 1 7   ? 29.827 13.524  3.380   1.00 35.78 ? 7   THR A C   1 
ATOM   21   O  O   . THR A 1 7   ? 29.840 12.481  4.039   1.00 35.51 ? 7   THR A O   1 
ATOM   22   C  CB  . THR A 1 7   ? 31.379 15.231  4.316   1.00 38.68 ? 7   THR A CB  1 
ATOM   23   O  OG1 . THR A 1 7   ? 31.461 16.455  5.056   1.00 39.26 ? 7   THR A OG1 1 
ATOM   24   C  CG2 . THR A 1 7   ? 32.113 15.403  2.993   1.00 38.92 ? 7   THR A CG2 1 
ATOM   25   N  N   . ILE A 1 8   ? 29.770 13.552  2.052   1.00 33.19 ? 8   ILE A N   1 
ATOM   26   C  CA  . ILE A 1 8   ? 29.665 12.342  1.250   1.00 29.33 ? 8   ILE A CA  1 
ATOM   27   C  C   . ILE A 1 8   ? 30.918 12.099  0.403   1.00 27.98 ? 8   ILE A C   1 
ATOM   28   O  O   . ILE A 1 8   ? 31.633 13.038  0.024   1.00 25.80 ? 8   ILE A O   1 
ATOM   29   C  CB  . ILE A 1 8   ? 28.420 12.419  0.313   1.00 27.56 ? 8   ILE A CB  1 
ATOM   30   C  CG1 . ILE A 1 8   ? 27.243 13.047  1.067   1.00 26.74 ? 8   ILE A CG1 1 
ATOM   31   C  CG2 . ILE A 1 8   ? 28.025 11.020  -0.163  1.00 25.71 ? 8   ILE A CG2 1 
ATOM   32   C  CD1 . ILE A 1 8   ? 26.073 13.427  0.188   1.00 24.02 ? 8   ILE A CD1 1 
ATOM   33   N  N   . GLY A 1 9   ? 31.166 10.825  0.118   1.00 26.07 ? 9   GLY A N   1 
ATOM   34   C  CA  . GLY A 1 9   ? 32.305 10.427  -0.683  1.00 23.91 ? 9   GLY A CA  1 
ATOM   35   C  C   . GLY A 1 9   ? 31.797 9.408   -1.676  1.00 23.29 ? 9   GLY A C   1 
ATOM   36   O  O   . GLY A 1 9   ? 31.728 8.217   -1.372  1.00 23.31 ? 9   GLY A O   1 
ATOM   37   N  N   . ILE A 1 10  ? 31.422 9.886   -2.860  1.00 23.36 ? 10  ILE A N   1 
ATOM   38   C  CA  . ILE A 1 10  ? 30.894 9.031   -3.918  1.00 21.99 ? 10  ILE A CA  1 
ATOM   39   C  C   . ILE A 1 10  ? 31.964 8.104   -4.465  1.00 21.84 ? 10  ILE A C   1 
ATOM   40   O  O   . ILE A 1 10  ? 33.028 8.546   -4.889  1.00 21.62 ? 10  ILE A O   1 
ATOM   41   C  CB  . ILE A 1 10  ? 30.342 9.861   -5.102  1.00 21.81 ? 10  ILE A CB  1 
ATOM   42   C  CG1 . ILE A 1 10  ? 29.374 10.934  -4.597  1.00 22.82 ? 10  ILE A CG1 1 
ATOM   43   C  CG2 . ILE A 1 10  ? 29.630 8.946   -6.091  1.00 21.87 ? 10  ILE A CG2 1 
ATOM   44   C  CD1 . ILE A 1 10  ? 28.111 10.403  -3.998  1.00 23.11 ? 10  ILE A CD1 1 
ATOM   45   N  N   . ILE A 1 11  ? 31.672 6.811   -4.439  1.00 22.80 ? 11  ILE A N   1 
ATOM   46   C  CA  . ILE A 1 11  ? 32.580 5.793   -4.951  1.00 22.62 ? 11  ILE A CA  1 
ATOM   47   C  C   . ILE A 1 11  ? 31.790 5.101   -6.043  1.00 22.64 ? 11  ILE A C   1 
ATOM   48   O  O   . ILE A 1 11  ? 30.905 4.300   -5.751  1.00 23.32 ? 11  ILE A O   1 
ATOM   49   C  CB  . ILE A 1 11  ? 32.952 4.720   -3.871  1.00 23.91 ? 11  ILE A CB  1 
ATOM   50   C  CG1 . ILE A 1 11  ? 33.846 5.326   -2.780  1.00 23.57 ? 11  ILE A CG1 1 
ATOM   51   C  CG2 . ILE A 1 11  ? 33.648 3.526   -4.534  1.00 21.97 ? 11  ILE A CG2 1 
ATOM   52   C  CD1 . ILE A 1 11  ? 35.207 5.784   -3.271  1.00 25.93 ? 11  ILE A CD1 1 
ATOM   53   N  N   . GLY A 1 12  ? 32.082 5.433   -7.296  1.00 22.73 ? 12  GLY A N   1 
ATOM   54   C  CA  . GLY A 1 12  ? 31.389 4.792   -8.400  1.00 21.23 ? 12  GLY A CA  1 
ATOM   55   C  C   . GLY A 1 12  ? 31.970 3.403   -8.607  1.00 20.47 ? 12  GLY A C   1 
ATOM   56   O  O   . GLY A 1 12  ? 33.156 3.271   -8.900  1.00 20.01 ? 12  GLY A O   1 
ATOM   57   N  N   . ALA A 1 13  ? 31.144 2.371   -8.443  1.00 18.98 ? 13  ALA A N   1 
ATOM   58   C  CA  . ALA A 1 13  ? 31.584 0.985   -8.600  1.00 18.30 ? 13  ALA A CA  1 
ATOM   59   C  C   . ALA A 1 13  ? 30.846 0.290   -9.743  1.00 17.93 ? 13  ALA A C   1 
ATOM   60   O  O   . ALA A 1 13  ? 29.822 -0.357  -9.534  1.00 18.56 ? 13  ALA A O   1 
ATOM   61   C  CB  . ALA A 1 13  ? 31.369 0.223   -7.296  1.00 18.71 ? 13  ALA A CB  1 
ATOM   62   N  N   . PRO A 1 14  ? 31.357 0.428   -10.976 1.00 18.74 ? 14  PRO A N   1 
ATOM   63   C  CA  . PRO A 1 14  ? 30.736 -0.193  -12.151 1.00 18.51 ? 14  PRO A CA  1 
ATOM   64   C  C   . PRO A 1 14  ? 31.098 -1.665  -12.323 1.00 18.42 ? 14  PRO A C   1 
ATOM   65   O  O   . PRO A 1 14  ? 31.937 -2.010  -13.151 1.00 21.11 ? 14  PRO A O   1 
ATOM   66   C  CB  . PRO A 1 14  ? 31.249 0.677   -13.299 1.00 19.82 ? 14  PRO A CB  1 
ATOM   67   C  CG  . PRO A 1 14  ? 32.599 1.085   -12.838 1.00 16.67 ? 14  PRO A CG  1 
ATOM   68   C  CD  . PRO A 1 14  ? 32.380 1.413   -11.383 1.00 19.62 ? 14  PRO A CD  1 
ATOM   69   N  N   . PHE A 1 15  ? 30.444 -2.537  -11.562 1.00 17.57 ? 15  PHE A N   1 
ATOM   70   C  CA  . PHE A 1 15  ? 30.741 -3.958  -11.632 1.00 16.33 ? 15  PHE A CA  1 
ATOM   71   C  C   . PHE A 1 15  ? 29.481 -4.810  -11.793 1.00 16.75 ? 15  PHE A C   1 
ATOM   72   O  O   . PHE A 1 15  ? 28.455 -4.523  -11.187 1.00 16.28 ? 15  PHE A O   1 
ATOM   73   C  CB  . PHE A 1 15  ? 31.491 -4.368  -10.368 1.00 14.42 ? 15  PHE A CB  1 
ATOM   74   C  CG  . PHE A 1 15  ? 32.096 -5.728  -10.442 1.00 13.71 ? 15  PHE A CG  1 
ATOM   75   C  CD1 . PHE A 1 15  ? 33.166 -5.979  -11.297 1.00 14.15 ? 15  PHE A CD1 1 
ATOM   76   C  CD2 . PHE A 1 15  ? 31.614 -6.760  -9.652  1.00 14.13 ? 15  PHE A CD2 1 
ATOM   77   C  CE1 . PHE A 1 15  ? 33.747 -7.240  -11.359 1.00 12.23 ? 15  PHE A CE1 1 
ATOM   78   C  CE2 . PHE A 1 15  ? 32.191 -8.024  -9.710  1.00 13.02 ? 15  PHE A CE2 1 
ATOM   79   C  CZ  . PHE A 1 15  ? 33.262 -8.258  -10.567 1.00 11.51 ? 15  PHE A CZ  1 
ATOM   80   N  N   . SER A 1 16  ? 29.582 -5.876  -12.590 1.00 17.48 ? 16  SER A N   1 
ATOM   81   C  CA  . SER A 1 16  ? 28.449 -6.770  -12.851 1.00 16.94 ? 16  SER A CA  1 
ATOM   82   C  C   . SER A 1 16  ? 28.706 -8.278  -12.680 1.00 16.65 ? 16  SER A C   1 
ATOM   83   O  O   . SER A 1 16  ? 27.758 -9.058  -12.566 1.00 14.50 ? 16  SER A O   1 
ATOM   84   C  CB  . SER A 1 16  ? 27.930 -6.533  -14.276 1.00 17.46 ? 16  SER A CB  1 
ATOM   85   O  OG  . SER A 1 16  ? 28.916 -6.849  -15.250 1.00 17.26 ? 16  SER A OG  1 
ATOM   86   N  N   . LYS A 1 17  ? 29.974 -8.683  -12.672 1.00 17.70 ? 17  LYS A N   1 
ATOM   87   C  CA  . LYS A 1 17  ? 30.343 -10.098 -12.574 1.00 17.14 ? 17  LYS A CA  1 
ATOM   88   C  C   . LYS A 1 17  ? 29.907 -10.856 -11.320 1.00 16.78 ? 17  LYS A C   1 
ATOM   89   O  O   . LYS A 1 17  ? 30.395 -11.957 -11.058 1.00 17.00 ? 17  LYS A O   1 
ATOM   90   C  CB  . LYS A 1 17  ? 31.859 -10.268 -12.758 1.00 19.27 ? 17  LYS A CB  1 
ATOM   91   C  CG  . LYS A 1 17  ? 32.393 -10.049 -14.191 1.00 19.34 ? 17  LYS A CG  1 
ATOM   92   C  CD  . LYS A 1 17  ? 33.891 -10.413 -14.248 1.00 22.26 ? 17  LYS A CD  1 
ATOM   93   C  CE  . LYS A 1 17  ? 34.610 -9.906  -15.513 1.00 23.48 ? 17  LYS A CE  1 
ATOM   94   N  NZ  . LYS A 1 17  ? 36.124 -9.911  -15.385 1.00 23.07 ? 17  LYS A NZ  1 
ATOM   95   N  N   . GLY A 1 18  ? 28.994 -10.270 -10.554 1.00 17.52 ? 18  GLY A N   1 
ATOM   96   C  CA  . GLY A 1 18  ? 28.479 -10.919 -9.361  1.00 15.53 ? 18  GLY A CA  1 
ATOM   97   C  C   . GLY A 1 18  ? 27.210 -11.676 -9.724  1.00 15.44 ? 18  GLY A C   1 
ATOM   98   O  O   . GLY A 1 18  ? 26.632 -12.385 -8.911  1.00 13.48 ? 18  GLY A O   1 
ATOM   99   N  N   . GLN A 1 19  ? 26.785 -11.507 -10.972 1.00 16.76 ? 19  GLN A N   1 
ATOM   100  C  CA  . GLN A 1 19  ? 25.603 -12.162 -11.517 1.00 17.37 ? 19  GLN A CA  1 
ATOM   101  C  C   . GLN A 1 19  ? 25.685 -12.181 -13.055 1.00 17.82 ? 19  GLN A C   1 
ATOM   102  O  O   . GLN A 1 19  ? 26.619 -11.637 -13.642 1.00 16.05 ? 19  GLN A O   1 
ATOM   103  C  CB  . GLN A 1 19  ? 24.337 -11.452 -11.016 1.00 18.03 ? 19  GLN A CB  1 
ATOM   104  C  CG  . GLN A 1 19  ? 24.416 -9.934  -10.982 1.00 17.63 ? 19  GLN A CG  1 
ATOM   105  C  CD  . GLN A 1 19  ? 24.030 -9.297  -12.293 1.00 17.73 ? 19  GLN A CD  1 
ATOM   106  O  OE1 . GLN A 1 19  ? 22.931 -9.508  -12.790 1.00 18.12 ? 19  GLN A OE1 1 
ATOM   107  N  NE2 . GLN A 1 19  ? 24.932 -8.504  -12.858 1.00 16.84 ? 19  GLN A NE2 1 
ATOM   108  N  N   . PRO A 1 20  ? 24.714 -12.816 -13.724 1.00 19.04 ? 20  PRO A N   1 
ATOM   109  C  CA  . PRO A 1 20  ? 24.694 -12.905 -15.192 1.00 20.49 ? 20  PRO A CA  1 
ATOM   110  C  C   . PRO A 1 20  ? 24.548 -11.618 -16.017 1.00 21.45 ? 20  PRO A C   1 
ATOM   111  O  O   . PRO A 1 20  ? 25.372 -11.346 -16.900 1.00 22.81 ? 20  PRO A O   1 
ATOM   112  C  CB  . PRO A 1 20  ? 23.555 -13.890 -15.453 1.00 19.49 ? 20  PRO A CB  1 
ATOM   113  C  CG  . PRO A 1 20  ? 22.633 -13.647 -14.296 1.00 20.54 ? 20  PRO A CG  1 
ATOM   114  C  CD  . PRO A 1 20  ? 23.599 -13.582 -13.140 1.00 19.86 ? 20  PRO A CD  1 
ATOM   115  N  N   . ARG A 1 21  ? 23.503 -10.844 -15.729 1.00 21.52 ? 21  ARG A N   1 
ATOM   116  C  CA  . ARG A 1 21  ? 23.179 -9.587  -16.423 1.00 21.62 ? 21  ARG A CA  1 
ATOM   117  C  C   . ARG A 1 21  ? 24.256 -8.482  -16.334 1.00 21.17 ? 21  ARG A C   1 
ATOM   118  O  O   . ARG A 1 21  ? 24.695 -8.108  -15.248 1.00 22.01 ? 21  ARG A O   1 
ATOM   119  C  CB  . ARG A 1 21  ? 21.840 -9.091  -15.879 1.00 22.95 ? 21  ARG A CB  1 
ATOM   120  C  CG  . ARG A 1 21  ? 20.775 -10.200 -15.860 1.00 26.23 ? 21  ARG A CG  1 
ATOM   121  C  CD  . ARG A 1 21  ? 19.695 -9.949  -14.820 1.00 29.81 ? 21  ARG A CD  1 
ATOM   122  N  NE  . ARG A 1 21  ? 20.232 -9.897  -13.457 1.00 32.33 ? 21  ARG A NE  1 
ATOM   123  C  CZ  . ARG A 1 21  ? 20.138 -10.878 -12.562 1.00 32.70 ? 21  ARG A CZ  1 
ATOM   124  N  NH1 . ARG A 1 21  ? 19.520 -12.018 -12.869 1.00 33.37 ? 21  ARG A NH1 1 
ATOM   125  N  NH2 . ARG A 1 21  ? 20.665 -10.715 -11.353 1.00 31.30 ? 21  ARG A NH2 1 
ATOM   126  N  N   . GLY A 1 22  ? 24.655 -7.939  -17.483 1.00 20.58 ? 22  GLY A N   1 
ATOM   127  C  CA  . GLY A 1 22  ? 25.707 -6.929  -17.498 1.00 20.48 ? 22  GLY A CA  1 
ATOM   128  C  C   . GLY A 1 22  ? 25.369 -5.449  -17.401 1.00 19.38 ? 22  GLY A C   1 
ATOM   129  O  O   . GLY A 1 22  ? 26.221 -4.637  -17.014 1.00 18.11 ? 22  GLY A O   1 
ATOM   130  N  N   . GLY A 1 23  ? 24.139 -5.088  -17.744 1.00 18.27 ? 23  GLY A N   1 
ATOM   131  C  CA  . GLY A 1 23  ? 23.748 -3.689  -17.686 1.00 19.57 ? 23  GLY A CA  1 
ATOM   132  C  C   . GLY A 1 23  ? 23.813 -3.021  -16.319 1.00 18.84 ? 23  GLY A C   1 
ATOM   133  O  O   . GLY A 1 23  ? 23.540 -1.817  -16.191 1.00 16.35 ? 23  GLY A O   1 
ATOM   134  N  N   . VAL A 1 24  ? 24.162 -3.790  -15.292 1.00 19.27 ? 24  VAL A N   1 
ATOM   135  C  CA  . VAL A 1 24  ? 24.249 -3.243  -13.940 1.00 19.74 ? 24  VAL A CA  1 
ATOM   136  C  C   . VAL A 1 24  ? 25.501 -2.385  -13.795 1.00 21.18 ? 24  VAL A C   1 
ATOM   137  O  O   . VAL A 1 24  ? 25.595 -1.554  -12.881 1.00 20.50 ? 24  VAL A O   1 
ATOM   138  C  CB  . VAL A 1 24  ? 24.279 -4.361  -12.863 1.00 19.18 ? 24  VAL A CB  1 
ATOM   139  C  CG1 . VAL A 1 24  ? 23.048 -5.219  -12.965 1.00 21.33 ? 24  VAL A CG1 1 
ATOM   140  C  CG2 . VAL A 1 24  ? 25.509 -5.209  -13.022 1.00 17.74 ? 24  VAL A CG2 1 
ATOM   141  N  N   . GLU A 1 25  ? 26.458 -2.596  -14.701 1.00 21.92 ? 25  GLU A N   1 
ATOM   142  C  CA  . GLU A 1 25  ? 27.721 -1.858  -14.710 1.00 23.62 ? 25  GLU A CA  1 
ATOM   143  C  C   . GLU A 1 25  ? 27.477 -0.361  -14.968 1.00 23.16 ? 25  GLU A C   1 
ATOM   144  O  O   . GLU A 1 25  ? 28.152 0.500   -14.399 1.00 24.89 ? 25  GLU A O   1 
ATOM   145  C  CB  . GLU A 1 25  ? 28.652 -2.391  -15.810 1.00 25.34 ? 25  GLU A CB  1 
ATOM   146  C  CG  . GLU A 1 25  ? 28.661 -3.897  -15.996 1.00 27.42 ? 25  GLU A CG  1 
ATOM   147  C  CD  . GLU A 1 25  ? 29.760 -4.361  -16.950 1.00 28.53 ? 25  GLU A CD  1 
ATOM   148  O  OE1 . GLU A 1 25  ? 29.765 -3.937  -18.127 1.00 28.94 ? 25  GLU A OE1 1 
ATOM   149  O  OE2 . GLU A 1 25  ? 30.621 -5.151  -16.514 1.00 28.64 ? 25  GLU A OE2 1 
ATOM   150  N  N   . GLU A 1 26  ? 26.508 -0.065  -15.829 1.00 22.92 ? 26  GLU A N   1 
ATOM   151  C  CA  . GLU A 1 26  ? 26.186 1.310   -16.180 1.00 23.12 ? 26  GLU A CA  1 
ATOM   152  C  C   . GLU A 1 26  ? 25.258 1.955   -15.159 1.00 22.00 ? 26  GLU A C   1 
ATOM   153  O  O   . GLU A 1 26  ? 24.498 2.861   -15.490 1.00 24.29 ? 26  GLU A O   1 
ATOM   154  C  CB  . GLU A 1 26  ? 25.541 1.362   -17.569 1.00 25.83 ? 26  GLU A CB  1 
ATOM   155  C  CG  . GLU A 1 26  ? 26.358 0.718   -18.678 1.00 26.46 ? 26  GLU A CG  1 
ATOM   156  C  CD  . GLU A 1 26  ? 26.234 -0.798  -18.706 1.00 28.52 ? 26  GLU A CD  1 
ATOM   157  O  OE1 . GLU A 1 26  ? 25.111 -1.303  -18.926 1.00 29.76 ? 26  GLU A OE1 1 
ATOM   158  O  OE2 . GLU A 1 26  ? 27.262 -1.486  -18.516 1.00 28.44 ? 26  GLU A OE2 1 
ATOM   159  N  N   . GLY A 1 27  ? 25.321 1.479   -13.920 1.00 21.29 ? 27  GLY A N   1 
ATOM   160  C  CA  . GLY A 1 27  ? 24.493 2.027   -12.861 1.00 20.04 ? 27  GLY A CA  1 
ATOM   161  C  C   . GLY A 1 27  ? 25.022 3.365   -12.362 1.00 20.09 ? 27  GLY A C   1 
ATOM   162  O  O   . GLY A 1 27  ? 24.272 4.348   -12.325 1.00 20.20 ? 27  GLY A O   1 
ATOM   163  N  N   . PRO A 1 28  ? 26.310 3.445   -11.978 1.00 19.23 ? 28  PRO A N   1 
ATOM   164  C  CA  . PRO A 1 28  ? 26.887 4.701   -11.487 1.00 20.22 ? 28  PRO A CA  1 
ATOM   165  C  C   . PRO A 1 28  ? 26.672 5.822   -12.501 1.00 20.90 ? 28  PRO A C   1 
ATOM   166  O  O   . PRO A 1 28  ? 26.539 6.992   -12.141 1.00 20.50 ? 28  PRO A O   1 
ATOM   167  C  CB  . PRO A 1 28  ? 28.371 4.362   -11.326 1.00 19.69 ? 28  PRO A CB  1 
ATOM   168  C  CG  . PRO A 1 28  ? 28.365 2.898   -11.040 1.00 19.97 ? 28  PRO A CG  1 
ATOM   169  C  CD  . PRO A 1 28  ? 27.325 2.374   -11.994 1.00 18.61 ? 28  PRO A CD  1 
ATOM   170  N  N   . THR A 1 29  ? 26.653 5.440   -13.774 1.00 20.53 ? 29  THR A N   1 
ATOM   171  C  CA  . THR A 1 29  ? 26.470 6.366   -14.878 1.00 19.15 ? 29  THR A CA  1 
ATOM   172  C  C   . THR A 1 29  ? 25.056 6.934   -14.962 1.00 19.87 ? 29  THR A C   1 
ATOM   173  O  O   . THR A 1 29  ? 24.869 8.142   -15.110 1.00 18.28 ? 29  THR A O   1 
ATOM   174  C  CB  . THR A 1 29  ? 26.812 5.672   -16.211 1.00 18.59 ? 29  THR A CB  1 
ATOM   175  O  OG1 . THR A 1 29  ? 28.223 5.444   -16.271 1.00 18.02 ? 29  THR A OG1 1 
ATOM   176  C  CG2 . THR A 1 29  ? 26.388 6.525   -17.397 1.00 19.64 ? 29  THR A CG2 1 
ATOM   177  N  N   . VAL A 1 30  ? 24.063 6.056   -14.880 1.00 20.85 ? 30  VAL A N   1 
ATOM   178  C  CA  . VAL A 1 30  ? 22.675 6.475   -14.964 1.00 19.82 ? 30  VAL A CA  1 
ATOM   179  C  C   . VAL A 1 30  ? 22.268 7.262   -13.727 1.00 19.43 ? 30  VAL A C   1 
ATOM   180  O  O   . VAL A 1 30  ? 21.440 8.170   -13.820 1.00 21.04 ? 30  VAL A O   1 
ATOM   181  C  CB  . VAL A 1 30  ? 21.738 5.254   -15.157 1.00 19.98 ? 30  VAL A CB  1 
ATOM   182  C  CG1 . VAL A 1 30  ? 20.294 5.694   -15.135 1.00 22.09 ? 30  VAL A CG1 1 
ATOM   183  C  CG2 . VAL A 1 30  ? 22.029 4.586   -16.490 1.00 20.94 ? 30  VAL A CG2 1 
ATOM   184  N  N   . LEU A 1 31  ? 22.853 6.924   -12.576 1.00 18.10 ? 31  LEU A N   1 
ATOM   185  C  CA  . LEU A 1 31  ? 22.542 7.618   -11.325 1.00 18.22 ? 31  LEU A CA  1 
ATOM   186  C  C   . LEU A 1 31  ? 23.146 9.019   -11.293 1.00 18.89 ? 31  LEU A C   1 
ATOM   187  O  O   . LEU A 1 31  ? 22.582 9.936   -10.687 1.00 19.67 ? 31  LEU A O   1 
ATOM   188  C  CB  . LEU A 1 31  ? 23.036 6.808   -10.126 1.00 17.72 ? 31  LEU A CB  1 
ATOM   189  C  CG  . LEU A 1 31  ? 22.166 5.606   -9.742  1.00 16.46 ? 31  LEU A CG  1 
ATOM   190  C  CD1 . LEU A 1 31  ? 22.916 4.723   -8.768  1.00 16.88 ? 31  LEU A CD1 1 
ATOM   191  C  CD2 . LEU A 1 31  ? 20.847 6.092   -9.142  1.00 17.84 ? 31  LEU A CD2 1 
ATOM   192  N  N   . ARG A 1 32  ? 24.300 9.170   -11.938 1.00 19.72 ? 32  ARG A N   1 
ATOM   193  C  CA  . ARG A 1 32  ? 24.988 10.454  -12.020 1.00 20.45 ? 32  ARG A CA  1 
ATOM   194  C  C   . ARG A 1 32  ? 24.300 11.324  -13.067 1.00 20.73 ? 32  ARG A C   1 
ATOM   195  O  O   . ARG A 1 32  ? 24.201 12.537  -12.891 1.00 20.89 ? 32  ARG A O   1 
ATOM   196  C  CB  . ARG A 1 32  ? 26.449 10.267  -12.425 1.00 20.02 ? 32  ARG A CB  1 
ATOM   197  C  CG  . ARG A 1 32  ? 27.422 10.035  -11.294 1.00 23.62 ? 32  ARG A CG  1 
ATOM   198  C  CD  . ARG A 1 32  ? 28.804 10.532  -11.725 1.00 26.37 ? 32  ARG A CD  1 
ATOM   199  N  NE  . ARG A 1 32  ? 29.847 10.326  -10.721 1.00 26.10 ? 32  ARG A NE  1 
ATOM   200  C  CZ  . ARG A 1 32  ? 30.322 9.134   -10.379 1.00 27.42 ? 32  ARG A CZ  1 
ATOM   201  N  NH1 . ARG A 1 32  ? 29.838 8.042   -10.958 1.00 27.06 ? 32  ARG A NH1 1 
ATOM   202  N  NH2 . ARG A 1 32  ? 31.297 9.036   -9.481  1.00 27.40 ? 32  ARG A NH2 1 
ATOM   203  N  N   . LYS A 1 33  ? 23.841 10.699  -14.155 1.00 21.29 ? 33  LYS A N   1 
ATOM   204  C  CA  . LYS A 1 33  ? 23.154 11.408  -15.237 1.00 23.39 ? 33  LYS A CA  1 
ATOM   205  C  C   . LYS A 1 33  ? 21.762 11.824  -14.758 1.00 22.66 ? 33  LYS A C   1 
ATOM   206  O  O   . LYS A 1 33  ? 21.069 12.612  -15.411 1.00 21.87 ? 33  LYS A O   1 
ATOM   207  C  CB  . LYS A 1 33  ? 23.054 10.533  -16.511 1.00 24.52 ? 33  LYS A CB  1 
ATOM   208  C  CG  . LYS A 1 33  ? 21.909 9.509   -16.537 1.00 27.33 ? 33  LYS A CG  1 
ATOM   209  C  CD  . LYS A 1 33  ? 21.880 8.673   -17.831 1.00 27.61 ? 33  LYS A CD  1 
ATOM   210  C  CE  . LYS A 1 33  ? 20.690 7.704   -17.850 1.00 27.92 ? 33  LYS A CE  1 
ATOM   211  N  NZ  . LYS A 1 33  ? 20.754 6.659   -18.928 1.00 26.22 ? 33  LYS A NZ  1 
ATOM   212  N  N   . ALA A 1 34  ? 21.367 11.292  -13.604 1.00 23.07 ? 34  ALA A N   1 
ATOM   213  C  CA  . ALA A 1 34  ? 20.078 11.620  -13.013 1.00 23.64 ? 34  ALA A CA  1 
ATOM   214  C  C   . ALA A 1 34  ? 20.247 12.923  -12.225 1.00 23.68 ? 34  ALA A C   1 
ATOM   215  O  O   . ALA A 1 34  ? 19.309 13.711  -12.087 1.00 24.27 ? 34  ALA A O   1 
ATOM   216  C  CB  . ALA A 1 34  ? 19.620 10.488  -12.095 1.00 25.00 ? 34  ALA A CB  1 
ATOM   217  N  N   . GLY A 1 35  ? 21.461 13.139  -11.723 1.00 23.69 ? 35  GLY A N   1 
ATOM   218  C  CA  . GLY A 1 35  ? 21.769 14.346  -10.983 1.00 23.54 ? 35  GLY A CA  1 
ATOM   219  C  C   . GLY A 1 35  ? 22.113 14.162  -9.517  1.00 23.37 ? 35  GLY A C   1 
ATOM   220  O  O   . GLY A 1 35  ? 22.155 15.152  -8.782  1.00 23.85 ? 35  GLY A O   1 
ATOM   221  N  N   . LEU A 1 36  ? 22.380 12.930  -9.085  1.00 21.60 ? 36  LEU A N   1 
ATOM   222  C  CA  . LEU A 1 36  ? 22.691 12.683  -7.676  1.00 21.89 ? 36  LEU A CA  1 
ATOM   223  C  C   . LEU A 1 36  ? 23.637 13.692  -7.020  1.00 21.99 ? 36  LEU A C   1 
ATOM   224  O  O   . LEU A 1 36  ? 23.352 14.188  -5.936  1.00 21.05 ? 36  LEU A O   1 
ATOM   225  C  CB  . LEU A 1 36  ? 23.249 11.269  -7.469  1.00 21.04 ? 36  LEU A CB  1 
ATOM   226  C  CG  . LEU A 1 36  ? 23.554 10.980  -5.990  1.00 19.61 ? 36  LEU A CG  1 
ATOM   227  C  CD1 . LEU A 1 36  ? 22.282 11.167  -5.176  1.00 20.29 ? 36  LEU A CD1 1 
ATOM   228  C  CD2 . LEU A 1 36  ? 24.092 9.584   -5.823  1.00 20.16 ? 36  LEU A CD2 1 
ATOM   229  N  N   . LEU A 1 37  ? 24.759 13.996  -7.663  1.00 23.43 ? 37  LEU A N   1 
ATOM   230  C  CA  . LEU A 1 37  ? 25.707 14.951  -7.086  1.00 25.66 ? 37  LEU A CA  1 
ATOM   231  C  C   . LEU A 1 37  ? 25.070 16.320  -6.905  1.00 24.87 ? 37  LEU A C   1 
ATOM   232  O  O   . LEU A 1 37  ? 25.060 16.878  -5.813  1.00 24.78 ? 37  LEU A O   1 
ATOM   233  C  CB  . LEU A 1 37  ? 26.961 15.088  -7.968  1.00 28.54 ? 37  LEU A CB  1 
ATOM   234  C  CG  . LEU A 1 37  ? 27.984 13.943  -7.993  1.00 30.23 ? 37  LEU A CG  1 
ATOM   235  C  CD1 . LEU A 1 37  ? 29.083 14.262  -9.001  1.00 29.92 ? 37  LEU A CD1 1 
ATOM   236  C  CD2 . LEU A 1 37  ? 28.581 13.742  -6.611  1.00 30.34 ? 37  LEU A CD2 1 
ATOM   237  N  N   . GLU A 1 38  ? 24.536 16.860  -7.988  1.00 25.64 ? 38  GLU A N   1 
ATOM   238  C  CA  . GLU A 1 38  ? 23.902 18.167  -7.946  1.00 27.25 ? 38  GLU A CA  1 
ATOM   239  C  C   . GLU A 1 38  ? 22.785 18.244  -6.898  1.00 26.45 ? 38  GLU A C   1 
ATOM   240  O  O   . GLU A 1 38  ? 22.706 19.218  -6.141  1.00 26.05 ? 38  GLU A O   1 
ATOM   241  C  CB  . GLU A 1 38  ? 23.349 18.513  -9.332  1.00 29.91 ? 38  GLU A CB  1 
ATOM   242  C  CG  . GLU A 1 38  ? 24.408 18.590  -10.442 1.00 32.81 ? 38  GLU A CG  1 
ATOM   243  C  CD  . GLU A 1 38  ? 25.129 17.266  -10.674 1.00 34.31 ? 38  GLU A CD  1 
ATOM   244  O  OE1 . GLU A 1 38  ? 24.450 16.218  -10.678 1.00 34.69 ? 38  GLU A OE1 1 
ATOM   245  O  OE2 . GLU A 1 38  ? 26.370 17.273  -10.864 1.00 37.24 ? 38  GLU A OE2 1 
ATOM   246  N  N   . LYS A 1 39  ? 21.934 17.217  -6.852  1.00 25.23 ? 39  LYS A N   1 
ATOM   247  C  CA  . LYS A 1 39  ? 20.823 17.180  -5.901  1.00 23.86 ? 39  LYS A CA  1 
ATOM   248  C  C   . LYS A 1 39  ? 21.298 17.168  -4.456  1.00 23.72 ? 39  LYS A C   1 
ATOM   249  O  O   . LYS A 1 39  ? 20.683 17.787  -3.590  1.00 23.23 ? 39  LYS A O   1 
ATOM   250  C  CB  . LYS A 1 39  ? 19.931 15.970  -6.181  1.00 23.43 ? 39  LYS A CB  1 
ATOM   251  C  CG  . LYS A 1 39  ? 19.188 16.089  -7.504  1.00 24.10 ? 39  LYS A CG  1 
ATOM   252  C  CD  . LYS A 1 39  ? 18.062 15.076  -7.645  1.00 24.71 ? 39  LYS A CD  1 
ATOM   253  C  CE  . LYS A 1 39  ? 17.396 15.218  -9.003  1.00 25.71 ? 39  LYS A CE  1 
ATOM   254  N  NZ  . LYS A 1 39  ? 16.301 14.231  -9.198  1.00 27.99 ? 39  LYS A NZ  1 
ATOM   255  N  N   . LEU A 1 40  ? 22.396 16.462  -4.200  1.00 23.83 ? 40  LEU A N   1 
ATOM   256  C  CA  . LEU A 1 40  ? 22.966 16.400  -2.865  1.00 23.10 ? 40  LEU A CA  1 
ATOM   257  C  C   . LEU A 1 40  ? 23.526 17.773  -2.491  1.00 24.41 ? 40  LEU A C   1 
ATOM   258  O  O   . LEU A 1 40  ? 23.517 18.152  -1.322  1.00 24.48 ? 40  LEU A O   1 
ATOM   259  C  CB  . LEU A 1 40  ? 24.084 15.348  -2.801  1.00 21.69 ? 40  LEU A CB  1 
ATOM   260  C  CG  . LEU A 1 40  ? 23.699 13.866  -2.753  1.00 20.02 ? 40  LEU A CG  1 
ATOM   261  C  CD1 . LEU A 1 40  ? 24.953 13.022  -2.919  1.00 19.07 ? 40  LEU A CD1 1 
ATOM   262  C  CD2 . LEU A 1 40  ? 23.001 13.547  -1.434  1.00 16.90 ? 40  LEU A CD2 1 
ATOM   263  N  N   . LYS A 1 41  ? 23.998 18.524  -3.481  1.00 25.91 ? 41  LYS A N   1 
ATOM   264  C  CA  . LYS A 1 41  ? 24.562 19.845  -3.217  1.00 27.85 ? 41  LYS A CA  1 
ATOM   265  C  C   . LYS A 1 41  ? 23.522 20.905  -2.865  1.00 28.56 ? 41  LYS A C   1 
ATOM   266  O  O   . LYS A 1 41  ? 23.842 21.908  -2.226  1.00 27.76 ? 41  LYS A O   1 
ATOM   267  C  CB  . LYS A 1 41  ? 25.411 20.318  -4.405  1.00 27.90 ? 41  LYS A CB  1 
ATOM   268  C  CG  . LYS A 1 41  ? 26.736 19.557  -4.580  1.00 28.75 ? 41  LYS A CG  1 
ATOM   269  C  CD  . LYS A 1 41  ? 27.718 20.338  -5.456  1.00 30.20 ? 41  LYS A CD  1 
ATOM   270  C  CE  . LYS A 1 41  ? 29.037 19.599  -5.643  1.00 30.77 ? 41  LYS A CE  1 
ATOM   271  N  NZ  . LYS A 1 41  ? 30.077 20.448  -6.299  1.00 29.94 ? 41  LYS A NZ  1 
ATOM   272  N  N   . GLU A 1 42  ? 22.280 20.681  -3.279  1.00 31.14 ? 42  GLU A N   1 
ATOM   273  C  CA  . GLU A 1 42  ? 21.189 21.613  -2.991  1.00 32.87 ? 42  GLU A CA  1 
ATOM   274  C  C   . GLU A 1 42  ? 20.821 21.549  -1.504  1.00 33.04 ? 42  GLU A C   1 
ATOM   275  O  O   . GLU A 1 42  ? 20.138 22.435  -0.979  1.00 32.24 ? 42  GLU A O   1 
ATOM   276  C  CB  . GLU A 1 42  ? 19.965 21.258  -3.833  1.00 34.29 ? 42  GLU A CB  1 
ATOM   277  C  CG  . GLU A 1 42  ? 20.184 21.340  -5.329  1.00 36.94 ? 42  GLU A CG  1 
ATOM   278  C  CD  . GLU A 1 42  ? 19.059 20.680  -6.110  1.00 38.71 ? 42  GLU A CD  1 
ATOM   279  O  OE1 . GLU A 1 42  ? 17.880 20.889  -5.749  1.00 40.95 ? 42  GLU A OE1 1 
ATOM   280  O  OE2 . GLU A 1 42  ? 19.353 19.959  -7.088  1.00 38.95 ? 42  GLU A OE2 1 
ATOM   281  N  N   . GLN A 1 43  ? 21.281 20.485  -0.845  1.00 33.73 ? 43  GLN A N   1 
ATOM   282  C  CA  . GLN A 1 43  ? 21.040 20.261  0.579   1.00 33.26 ? 43  GLN A CA  1 
ATOM   283  C  C   . GLN A 1 43  ? 22.291 20.759  1.320   1.00 34.32 ? 43  GLN A C   1 
ATOM   284  O  O   . GLN A 1 43  ? 23.151 21.402  0.716   1.00 35.12 ? 43  GLN A O   1 
ATOM   285  C  CB  . GLN A 1 43  ? 20.795 18.754  0.845   1.00 32.24 ? 43  GLN A CB  1 
ATOM   286  C  CG  . GLN A 1 43  ? 20.402 17.927  -0.416  1.00 27.70 ? 43  GLN A CG  1 
ATOM   287  C  CD  . GLN A 1 43  ? 19.819 16.530  -0.123  1.00 25.12 ? 43  GLN A CD  1 
ATOM   288  O  OE1 . GLN A 1 43  ? 18.792 16.156  -0.873  1.00 20.86 ? 43  GLN A OE1 1 
ATOM   289  N  NE2 . GLN A 1 43  ? 20.299 15.801  0.740   1.00 26.74 ? 43  GLN A NE2 1 
ATOM   290  N  N   . GLU A 1 44  ? 22.393 20.491  2.618   1.00 35.31 ? 44  GLU A N   1 
ATOM   291  C  CA  . GLU A 1 44  ? 23.571 20.926  3.378   1.00 35.96 ? 44  GLU A CA  1 
ATOM   292  C  C   . GLU A 1 44  ? 24.673 19.885  3.219   1.00 35.15 ? 44  GLU A C   1 
ATOM   293  O  O   . GLU A 1 44  ? 25.411 19.593  4.165   1.00 35.41 ? 44  GLU A O   1 
ATOM   294  C  CB  . GLU A 1 44  ? 23.230 21.107  4.874   1.00 38.26 ? 44  GLU A CB  1 
ATOM   295  C  CG  . GLU A 1 44  ? 22.283 20.045  5.476   1.00 39.20 ? 44  GLU A CG  1 
ATOM   296  C  CD  . GLU A 1 44  ? 22.905 19.221  6.603   1.00 39.30 ? 44  GLU A CD  1 
ATOM   297  O  OE1 . GLU A 1 44  ? 23.744 18.333  6.317   1.00 37.57 ? 44  GLU A OE1 1 
ATOM   298  O  OE2 . GLU A 1 44  ? 22.549 19.462  7.778   1.00 39.46 ? 44  GLU A OE2 1 
ATOM   299  N  N   . CYS A 1 45  ? 24.779 19.335  2.010   1.00 34.06 ? 45  CYS A N   1 
ATOM   300  C  CA  . CYS A 1 45  ? 25.755 18.291  1.721   1.00 31.98 ? 45  CYS A CA  1 
ATOM   301  C  C   . CYS A 1 45  ? 27.040 18.738  1.043   1.00 32.03 ? 45  CYS A C   1 
ATOM   302  O  O   . CYS A 1 45  ? 27.024 19.491  0.070   1.00 32.34 ? 45  CYS A O   1 
ATOM   303  C  CB  . CYS A 1 45  ? 25.109 17.183  0.870   1.00 31.00 ? 45  CYS A CB  1 
ATOM   304  S  SG  . CYS A 1 45  ? 23.728 16.286  1.643   1.00 24.57 ? 45  CYS A SG  1 
ATOM   305  N  N   . ASP A 1 46  ? 28.149 18.244  1.587   1.00 31.88 ? 46  ASP A N   1 
ATOM   306  C  CA  . ASP A 1 46  ? 29.504 18.497  1.096   1.00 30.94 ? 46  ASP A CA  1 
ATOM   307  C  C   . ASP A 1 46  ? 29.853 17.221  0.321   1.00 30.50 ? 46  ASP A C   1 
ATOM   308  O  O   . ASP A 1 46  ? 30.057 16.163  0.917   1.00 29.51 ? 46  ASP A O   1 
ATOM   309  C  CB  . ASP A 1 46  ? 30.456 18.669  2.288   1.00 31.03 ? 46  ASP A CB  1 
ATOM   310  C  CG  . ASP A 1 46  ? 31.894 18.935  1.869   1.00 30.33 ? 46  ASP A CG  1 
ATOM   311  O  OD1 . ASP A 1 46  ? 32.382 18.285  0.920   1.00 29.43 ? 46  ASP A OD1 1 
ATOM   312  O  OD2 . ASP A 1 46  ? 32.545 19.788  2.510   1.00 33.31 ? 46  ASP A OD2 1 
ATOM   313  N  N   . VAL A 1 47  ? 29.919 17.316  -1.003  1.00 31.03 ? 47  VAL A N   1 
ATOM   314  C  CA  . VAL A 1 47  ? 30.198 16.141  -1.822  1.00 31.03 ? 47  VAL A CA  1 
ATOM   315  C  C   . VAL A 1 47  ? 31.543 16.145  -2.537  1.00 30.77 ? 47  VAL A C   1 
ATOM   316  O  O   . VAL A 1 47  ? 31.905 17.116  -3.203  1.00 29.84 ? 47  VAL A O   1 
ATOM   317  C  CB  . VAL A 1 47  ? 29.087 15.940  -2.885  1.00 30.51 ? 47  VAL A CB  1 
ATOM   318  C  CG1 . VAL A 1 47  ? 29.283 14.613  -3.598  1.00 31.24 ? 47  VAL A CG1 1 
ATOM   319  C  CG2 . VAL A 1 47  ? 27.723 16.002  -2.226  1.00 29.58 ? 47  VAL A CG2 1 
ATOM   320  N  N   . LYS A 1 48  ? 32.275 15.042  -2.380  1.00 31.61 ? 48  LYS A N   1 
ATOM   321  C  CA  . LYS A 1 48  ? 33.579 14.850  -3.022  1.00 31.83 ? 48  LYS A CA  1 
ATOM   322  C  C   . LYS A 1 48  ? 33.514 13.530  -3.781  1.00 30.74 ? 48  LYS A C   1 
ATOM   323  O  O   . LYS A 1 48  ? 33.361 12.458  -3.188  1.00 29.65 ? 48  LYS A O   1 
ATOM   324  C  CB  . LYS A 1 48  ? 34.703 14.813  -1.985  1.00 33.61 ? 48  LYS A CB  1 
ATOM   325  C  CG  . LYS A 1 48  ? 34.759 16.061  -1.125  1.00 36.11 ? 48  LYS A CG  1 
ATOM   326  C  CD  . LYS A 1 48  ? 34.782 17.322  -1.980  1.00 37.45 ? 48  LYS A CD  1 
ATOM   327  C  CE  . LYS A 1 48  ? 34.507 18.556  -1.132  1.00 38.45 ? 48  LYS A CE  1 
ATOM   328  N  NZ  . LYS A 1 48  ? 34.246 19.768  -1.959  1.00 38.86 ? 48  LYS A NZ  1 
ATOM   329  N  N   . ASP A 1 49  ? 33.624 13.619  -5.100  1.00 30.66 ? 49  ASP A N   1 
ATOM   330  C  CA  . ASP A 1 49  ? 33.529 12.446  -5.955  1.00 30.16 ? 49  ASP A CA  1 
ATOM   331  C  C   . ASP A 1 49  ? 34.857 11.761  -6.239  1.00 29.11 ? 49  ASP A C   1 
ATOM   332  O  O   . ASP A 1 49  ? 35.738 12.326  -6.886  1.00 29.57 ? 49  ASP A O   1 
ATOM   333  C  CB  . ASP A 1 49  ? 32.848 12.839  -7.263  1.00 32.75 ? 49  ASP A CB  1 
ATOM   334  C  CG  . ASP A 1 49  ? 32.543 11.653  -8.133  1.00 34.61 ? 49  ASP A CG  1 
ATOM   335  O  OD1 . ASP A 1 49  ? 32.095 10.616  -7.591  1.00 36.55 ? 49  ASP A OD1 1 
ATOM   336  O  OD2 . ASP A 1 49  ? 32.740 11.760  -9.361  1.00 38.23 ? 49  ASP A OD2 1 
ATOM   337  N  N   . TYR A 1 50  ? 34.996 10.539  -5.744  1.00 28.58 ? 50  TYR A N   1 
ATOM   338  C  CA  . TYR A 1 50  ? 36.211 9.773   -5.949  1.00 28.65 ? 50  TYR A CA  1 
ATOM   339  C  C   . TYR A 1 50  ? 36.163 9.012   -7.269  1.00 27.95 ? 50  TYR A C   1 
ATOM   340  O  O   . TYR A 1 50  ? 36.863 8.018   -7.443  1.00 28.89 ? 50  TYR A O   1 
ATOM   341  C  CB  . TYR A 1 50  ? 36.426 8.808   -4.782  1.00 28.93 ? 50  TYR A CB  1 
ATOM   342  C  CG  . TYR A 1 50  ? 36.724 9.517   -3.482  1.00 28.85 ? 50  TYR A CG  1 
ATOM   343  C  CD1 . TYR A 1 50  ? 35.769 10.342  -2.878  1.00 28.12 ? 50  TYR A CD1 1 
ATOM   344  C  CD2 . TYR A 1 50  ? 37.972 9.393   -2.867  1.00 27.78 ? 50  TYR A CD2 1 
ATOM   345  C  CE1 . TYR A 1 50  ? 36.054 11.029  -1.690  1.00 27.31 ? 50  TYR A CE1 1 
ATOM   346  C  CE2 . TYR A 1 50  ? 38.266 10.073  -1.683  1.00 26.39 ? 50  TYR A CE2 1 
ATOM   347  C  CZ  . TYR A 1 50  ? 37.304 10.888  -1.102  1.00 27.05 ? 50  TYR A CZ  1 
ATOM   348  O  OH  . TYR A 1 50  ? 37.593 11.565  0.056   1.00 27.60 ? 50  TYR A OH  1 
ATOM   349  N  N   . GLY A 1 51  ? 35.336 9.498   -8.194  1.00 26.81 ? 51  GLY A N   1 
ATOM   350  C  CA  . GLY A 1 51  ? 35.194 8.883   -9.503  1.00 26.06 ? 51  GLY A CA  1 
ATOM   351  C  C   . GLY A 1 51  ? 34.634 7.471   -9.516  1.00 26.29 ? 51  GLY A C   1 
ATOM   352  O  O   . GLY A 1 51  ? 34.113 6.983   -8.515  1.00 26.27 ? 51  GLY A O   1 
ATOM   353  N  N   . ASP A 1 52  ? 34.730 6.821   -10.671 1.00 26.53 ? 52  ASP A N   1 
ATOM   354  C  CA  . ASP A 1 52  ? 34.267 5.443   -10.839 1.00 25.77 ? 52  ASP A CA  1 
ATOM   355  C  C   . ASP A 1 52  ? 35.490 4.548   -10.740 1.00 26.41 ? 52  ASP A C   1 
ATOM   356  O  O   . ASP A 1 52  ? 36.518 4.837   -11.354 1.00 26.21 ? 52  ASP A O   1 
ATOM   357  C  CB  . ASP A 1 52  ? 33.635 5.236   -12.222 1.00 23.88 ? 52  ASP A CB  1 
ATOM   358  C  CG  . ASP A 1 52  ? 32.264 5.856   -12.341 1.00 21.03 ? 52  ASP A CG  1 
ATOM   359  O  OD1 . ASP A 1 52  ? 31.636 5.717   -13.408 1.00 22.78 ? 52  ASP A OD1 1 
ATOM   360  O  OD2 . ASP A 1 52  ? 31.813 6.479   -11.370 1.00 20.39 ? 52  ASP A OD2 1 
ATOM   361  N  N   . LEU A 1 53  ? 35.386 3.468   -9.974  1.00 27.46 ? 53  LEU A N   1 
ATOM   362  C  CA  . LEU A 1 53  ? 36.499 2.540   -9.836  1.00 27.98 ? 53  LEU A CA  1 
ATOM   363  C  C   . LEU A 1 53  ? 36.661 1.727   -11.126 1.00 28.87 ? 53  LEU A C   1 
ATOM   364  O  O   . LEU A 1 53  ? 35.788 0.943   -11.495 1.00 27.61 ? 53  LEU A O   1 
ATOM   365  C  CB  . LEU A 1 53  ? 36.272 1.616   -8.634  1.00 27.55 ? 53  LEU A CB  1 
ATOM   366  C  CG  . LEU A 1 53  ? 36.253 2.359   -7.291  1.00 28.17 ? 53  LEU A CG  1 
ATOM   367  C  CD1 . LEU A 1 53  ? 36.015 1.398   -6.151  1.00 26.32 ? 53  LEU A CD1 1 
ATOM   368  C  CD2 . LEU A 1 53  ? 37.579 3.088   -7.110  1.00 28.48 ? 53  LEU A CD2 1 
ATOM   369  N  N   . PRO A 1 54  ? 37.784 1.925   -11.839 1.00 30.91 ? 54  PRO A N   1 
ATOM   370  C  CA  . PRO A 1 54  ? 38.059 1.211   -13.090 1.00 31.48 ? 54  PRO A CA  1 
ATOM   371  C  C   . PRO A 1 54  ? 38.466 -0.232  -12.804 1.00 32.19 ? 54  PRO A C   1 
ATOM   372  O  O   . PRO A 1 54  ? 39.650 -0.547  -12.697 1.00 32.49 ? 54  PRO A O   1 
ATOM   373  C  CB  . PRO A 1 54  ? 39.185 2.034   -13.704 1.00 31.19 ? 54  PRO A CB  1 
ATOM   374  C  CG  . PRO A 1 54  ? 39.966 2.441   -12.509 1.00 31.76 ? 54  PRO A CG  1 
ATOM   375  C  CD  . PRO A 1 54  ? 38.894 2.840   -11.507 1.00 30.93 ? 54  PRO A CD  1 
ATOM   376  N  N   . PHE A 1 55  ? 37.471 -1.102  -12.668 1.00 32.98 ? 55  PHE A N   1 
ATOM   377  C  CA  . PHE A 1 55  ? 37.714 -2.509  -12.374 1.00 32.50 ? 55  PHE A CA  1 
ATOM   378  C  C   . PHE A 1 55  ? 38.336 -3.232  -13.558 1.00 33.41 ? 55  PHE A C   1 
ATOM   379  O  O   . PHE A 1 55  ? 37.780 -3.246  -14.653 1.00 33.07 ? 55  PHE A O   1 
ATOM   380  C  CB  . PHE A 1 55  ? 36.407 -3.188  -11.956 1.00 30.89 ? 55  PHE A CB  1 
ATOM   381  C  CG  . PHE A 1 55  ? 35.804 -2.610  -10.711 1.00 29.57 ? 55  PHE A CG  1 
ATOM   382  C  CD1 . PHE A 1 55  ? 36.555 -2.518  -9.542  1.00 28.92 ? 55  PHE A CD1 1 
ATOM   383  C  CD2 . PHE A 1 55  ? 34.487 -2.155  -10.704 1.00 29.30 ? 55  PHE A CD2 1 
ATOM   384  C  CE1 . PHE A 1 55  ? 36.009 -1.982  -8.383  1.00 28.20 ? 55  PHE A CE1 1 
ATOM   385  C  CE2 . PHE A 1 55  ? 33.925 -1.616  -9.545  1.00 27.76 ? 55  PHE A CE2 1 
ATOM   386  C  CZ  . PHE A 1 55  ? 34.686 -1.528  -8.383  1.00 28.39 ? 55  PHE A CZ  1 
ATOM   387  N  N   . ALA A 1 56  ? 39.498 -3.830  -13.316 1.00 34.75 ? 56  ALA A N   1 
ATOM   388  C  CA  . ALA A 1 56  ? 40.245 -4.548  -14.342 1.00 35.60 ? 56  ALA A CA  1 
ATOM   389  C  C   . ALA A 1 56  ? 39.491 -5.698  -15.004 1.00 35.59 ? 56  ALA A C   1 
ATOM   390  O  O   . ALA A 1 56  ? 38.372 -6.056  -14.629 1.00 34.82 ? 56  ALA A O   1 
ATOM   391  C  CB  . ALA A 1 56  ? 41.560 -5.066  -13.758 1.00 36.43 ? 56  ALA A CB  1 
ATOM   392  N  N   . ASP A 1 57  ? 40.139 -6.271  -16.006 1.00 36.21 ? 57  ASP A N   1 
ATOM   393  C  CA  . ASP A 1 57  ? 39.584 -7.375  -16.754 1.00 35.22 ? 57  ASP A CA  1 
ATOM   394  C  C   . ASP A 1 57  ? 40.407 -8.616  -16.448 1.00 33.99 ? 57  ASP A C   1 
ATOM   395  O  O   . ASP A 1 57  ? 41.629 -8.612  -16.600 1.00 33.43 ? 57  ASP A O   1 
ATOM   396  C  CB  . ASP A 1 57  ? 39.649 -7.055  -18.249 1.00 36.04 ? 57  ASP A CB  1 
ATOM   397  C  CG  . ASP A 1 57  ? 39.043 -8.143  -19.113 1.00 37.38 ? 57  ASP A CG  1 
ATOM   398  O  OD1 . ASP A 1 57  ? 39.192 -8.049  -20.345 1.00 37.37 ? 57  ASP A OD1 1 
ATOM   399  O  OD2 . ASP A 1 57  ? 38.417 -9.082  -18.571 1.00 39.37 ? 57  ASP A OD2 1 
ATOM   400  N  N   . ILE A 1 58  ? 39.738 -9.664  -15.982 1.00 32.65 ? 58  ILE A N   1 
ATOM   401  C  CA  . ILE A 1 58  ? 40.409 -10.922 -15.696 1.00 31.20 ? 58  ILE A CA  1 
ATOM   402  C  C   . ILE A 1 58  ? 39.758 -11.953 -16.609 1.00 30.25 ? 58  ILE A C   1 
ATOM   403  O  O   . ILE A 1 58  ? 38.702 -12.505 -16.284 1.00 30.44 ? 58  ILE A O   1 
ATOM   404  C  CB  . ILE A 1 58  ? 40.250 -11.360 -14.211 1.00 30.90 ? 58  ILE A CB  1 
ATOM   405  C  CG1 . ILE A 1 58  ? 40.957 -10.370 -13.282 1.00 30.88 ? 58  ILE A CG1 1 
ATOM   406  C  CG2 . ILE A 1 58  ? 40.857 -12.737 -14.005 1.00 29.14 ? 58  ILE A CG2 1 
ATOM   407  C  CD1 . ILE A 1 58  ? 40.266 -9.029  -13.147 1.00 30.14 ? 58  ILE A CD1 1 
ATOM   408  N  N   . PRO A 1 59  ? 40.371 -12.207 -17.783 1.00 28.47 ? 59  PRO A N   1 
ATOM   409  C  CA  . PRO A 1 59  ? 39.866 -13.172 -18.770 1.00 27.07 ? 59  PRO A CA  1 
ATOM   410  C  C   . PRO A 1 59  ? 39.953 -14.629 -18.314 1.00 23.93 ? 59  PRO A C   1 
ATOM   411  O  O   . PRO A 1 59  ? 39.081 -15.436 -18.626 1.00 23.99 ? 59  PRO A O   1 
ATOM   412  C  CB  . PRO A 1 59  ? 40.726 -12.882 -19.998 1.00 28.71 ? 59  PRO A CB  1 
ATOM   413  C  CG  . PRO A 1 59  ? 42.034 -12.478 -19.389 1.00 28.86 ? 59  PRO A CG  1 
ATOM   414  C  CD  . PRO A 1 59  ? 41.602 -11.556 -18.269 1.00 28.81 ? 59  PRO A CD  1 
ATOM   415  N  N   . ASN A 1 60  ? 41.011 -14.955 -17.578 1.00 23.22 ? 60  ASN A N   1 
ATOM   416  C  CA  . ASN A 1 60  ? 41.216 -16.309 -17.057 1.00 22.13 ? 60  ASN A CA  1 
ATOM   417  C  C   . ASN A 1 60  ? 40.604 -16.442 -15.675 1.00 22.27 ? 60  ASN A C   1 
ATOM   418  O  O   . ASN A 1 60  ? 41.302 -16.531 -14.662 1.00 21.65 ? 60  ASN A O   1 
ATOM   419  C  CB  . ASN A 1 60  ? 42.700 -16.624 -16.986 1.00 20.84 ? 60  ASN A CB  1 
ATOM   420  C  CG  . ASN A 1 60  ? 43.295 -16.837 -18.342 1.00 19.49 ? 60  ASN A CG  1 
ATOM   421  O  OD1 . ASN A 1 60  ? 43.111 -17.895 -18.946 1.00 18.00 ? 60  ASN A OD1 1 
ATOM   422  N  ND2 . ASN A 1 60  ? 43.994 -15.825 -18.849 1.00 18.76 ? 60  ASN A ND2 1 
ATOM   423  N  N   . ASP A 1 61  ? 39.280 -16.469 -15.654 1.00 22.36 ? 61  ASP A N   1 
ATOM   424  C  CA  . ASP A 1 61  ? 38.546 -16.556 -14.413 1.00 21.30 ? 61  ASP A CA  1 
ATOM   425  C  C   . ASP A 1 61  ? 37.454 -17.630 -14.488 1.00 22.32 ? 61  ASP A C   1 
ATOM   426  O  O   . ASP A 1 61  ? 36.260 -17.336 -14.383 1.00 21.08 ? 61  ASP A O   1 
ATOM   427  C  CB  . ASP A 1 61  ? 37.957 -15.171 -14.115 1.00 20.35 ? 61  ASP A CB  1 
ATOM   428  C  CG  . ASP A 1 61  ? 37.464 -15.040 -12.703 1.00 18.01 ? 61  ASP A CG  1 
ATOM   429  O  OD1 . ASP A 1 61  ? 37.853 -15.877 -11.863 1.00 16.39 ? 61  ASP A OD1 1 
ATOM   430  O  OD2 . ASP A 1 61  ? 36.700 -14.093 -12.437 1.00 18.16 ? 61  ASP A OD2 1 
ATOM   431  N  N   . SER A 1 62  ? 37.884 -18.876 -14.686 1.00 22.28 ? 62  SER A N   1 
ATOM   432  C  CA  . SER A 1 62  ? 36.978 -20.021 -14.759 1.00 21.23 ? 62  SER A CA  1 
ATOM   433  C  C   . SER A 1 62  ? 36.364 -20.248 -13.371 1.00 21.96 ? 62  SER A C   1 
ATOM   434  O  O   . SER A 1 62  ? 36.903 -19.796 -12.357 1.00 20.24 ? 62  SER A O   1 
ATOM   435  C  CB  . SER A 1 62  ? 37.746 -21.277 -15.200 1.00 17.72 ? 62  SER A CB  1 
ATOM   436  O  OG  . SER A 1 62  ? 38.435 -21.062 -16.424 1.00 16.02 ? 62  SER A OG  1 
ATOM   437  N  N   . PRO A 1 63  ? 35.228 -20.955 -13.308 1.00 23.69 ? 63  PRO A N   1 
ATOM   438  C  CA  . PRO A 1 63  ? 34.544 -21.234 -12.035 1.00 25.37 ? 63  PRO A CA  1 
ATOM   439  C  C   . PRO A 1 63  ? 35.355 -21.995 -10.971 1.00 25.33 ? 63  PRO A C   1 
ATOM   440  O  O   . PRO A 1 63  ? 36.276 -22.749 -11.292 1.00 25.30 ? 63  PRO A O   1 
ATOM   441  C  CB  . PRO A 1 63  ? 33.308 -22.034 -12.472 1.00 24.41 ? 63  PRO A CB  1 
ATOM   442  C  CG  . PRO A 1 63  ? 33.040 -21.518 -13.868 1.00 25.72 ? 63  PRO A CG  1 
ATOM   443  C  CD  . PRO A 1 63  ? 34.433 -21.442 -14.453 1.00 25.01 ? 63  PRO A CD  1 
ATOM   444  N  N   . PHE A 1 64  ? 34.999 -21.770 -9.704  1.00 24.19 ? 64  PHE A N   1 
ATOM   445  C  CA  . PHE A 1 64  ? 35.605 -22.458 -8.566  1.00 23.00 ? 64  PHE A CA  1 
ATOM   446  C  C   . PHE A 1 64  ? 34.444 -23.333 -8.113  1.00 23.31 ? 64  PHE A C   1 
ATOM   447  O  O   . PHE A 1 64  ? 33.475 -22.837 -7.529  1.00 23.62 ? 64  PHE A O   1 
ATOM   448  C  CB  . PHE A 1 64  ? 35.981 -21.476 -7.453  1.00 23.54 ? 64  PHE A CB  1 
ATOM   449  C  CG  . PHE A 1 64  ? 36.403 -22.150 -6.176  1.00 23.49 ? 64  PHE A CG  1 
ATOM   450  C  CD1 . PHE A 1 64  ? 37.673 -22.713 -6.054  1.00 23.10 ? 64  PHE A CD1 1 
ATOM   451  C  CD2 . PHE A 1 64  ? 35.511 -22.272 -5.114  1.00 22.97 ? 64  PHE A CD2 1 
ATOM   452  C  CE1 . PHE A 1 64  ? 38.046 -23.390 -4.897  1.00 21.98 ? 64  PHE A CE1 1 
ATOM   453  C  CE2 . PHE A 1 64  ? 35.873 -22.948 -3.958  1.00 23.79 ? 64  PHE A CE2 1 
ATOM   454  C  CZ  . PHE A 1 64  ? 37.145 -23.508 -3.847  1.00 24.00 ? 64  PHE A CZ  1 
ATOM   455  N  N   . GLN A 1 65  ? 34.539 -24.632 -8.372  1.00 22.82 ? 65  GLN A N   1 
ATOM   456  C  CA  . GLN A 1 65  ? 33.446 -25.537 -8.058  1.00 23.55 ? 65  GLN A CA  1 
ATOM   457  C  C   . GLN A 1 65  ? 32.298 -24.970 -8.887  1.00 23.70 ? 65  GLN A C   1 
ATOM   458  O  O   . GLN A 1 65  ? 32.327 -25.052 -10.115 1.00 26.07 ? 65  GLN A O   1 
ATOM   459  C  CB  . GLN A 1 65  ? 33.109 -25.516 -6.568  1.00 23.90 ? 65  GLN A CB  1 
ATOM   460  C  CG  . GLN A 1 65  ? 34.236 -26.021 -5.693  1.00 25.56 ? 65  GLN A CG  1 
ATOM   461  C  CD  . GLN A 1 65  ? 33.876 -26.038 -4.223  1.00 26.63 ? 65  GLN A CD  1 
ATOM   462  O  OE1 . GLN A 1 65  ? 34.744 -25.886 -3.360  1.00 26.19 ? 65  GLN A OE1 1 
ATOM   463  N  NE2 . GLN A 1 65  ? 32.593 -26.235 -3.927  1.00 26.33 ? 65  GLN A NE2 1 
ATOM   464  N  N   . ILE A 1 66  ? 31.306 -24.374 -8.238  1.00 22.82 ? 66  ILE A N   1 
ATOM   465  C  CA  . ILE A 1 66  ? 30.189 -23.784 -8.964  1.00 22.34 ? 66  ILE A CA  1 
ATOM   466  C  C   . ILE A 1 66  ? 30.198 -22.254 -8.859  1.00 20.71 ? 66  ILE A C   1 
ATOM   467  O  O   . ILE A 1 66  ? 29.381 -21.583 -9.484  1.00 19.19 ? 66  ILE A O   1 
ATOM   468  C  CB  . ILE A 1 66  ? 28.826 -24.316 -8.446  1.00 23.13 ? 66  ILE A CB  1 
ATOM   469  C  CG1 . ILE A 1 66  ? 28.659 -23.998 -6.953  1.00 21.63 ? 66  ILE A CG1 1 
ATOM   470  C  CG2 . ILE A 1 66  ? 28.718 -25.815 -8.731  1.00 22.52 ? 66  ILE A CG2 1 
ATOM   471  C  CD1 . ILE A 1 66  ? 29.647 -24.706 -6.031  1.00 22.56 ? 66  ILE A CD1 1 
ATOM   472  N  N   . VAL A 1 67  ? 31.132 -21.721 -8.068  1.00 20.31 ? 67  VAL A N   1 
ATOM   473  C  CA  . VAL A 1 67  ? 31.265 -20.277 -7.854  1.00 18.63 ? 67  VAL A CA  1 
ATOM   474  C  C   . VAL A 1 67  ? 31.798 -19.605 -9.113  1.00 18.53 ? 67  VAL A C   1 
ATOM   475  O  O   . VAL A 1 67  ? 32.884 -19.937 -9.572  1.00 19.32 ? 67  VAL A O   1 
ATOM   476  C  CB  . VAL A 1 67  ? 32.230 -19.971 -6.682  1.00 17.11 ? 67  VAL A CB  1 
ATOM   477  C  CG1 . VAL A 1 67  ? 32.290 -18.475 -6.431  1.00 17.99 ? 67  VAL A CG1 1 
ATOM   478  C  CG2 . VAL A 1 67  ? 31.776 -20.704 -5.422  1.00 17.78 ? 67  VAL A CG2 1 
ATOM   479  N  N   . LYS A 1 68  ? 31.032 -18.653 -9.648  1.00 17.43 ? 68  LYS A N   1 
ATOM   480  C  CA  . LYS A 1 68  ? 31.384 -17.930 -10.872 1.00 16.45 ? 68  LYS A CA  1 
ATOM   481  C  C   . LYS A 1 68  ? 32.163 -16.619 -10.726 1.00 15.80 ? 68  LYS A C   1 
ATOM   482  O  O   . LYS A 1 68  ? 31.929 -15.850 -9.802  1.00 15.58 ? 68  LYS A O   1 
ATOM   483  C  CB  . LYS A 1 68  ? 30.114 -17.658 -11.692 1.00 15.21 ? 68  LYS A CB  1 
ATOM   484  C  CG  . LYS A 1 68  ? 29.849 -18.697 -12.751 1.00 14.31 ? 68  LYS A CG  1 
ATOM   485  C  CD  . LYS A 1 68  ? 28.829 -19.710 -12.327 1.00 14.81 ? 68  LYS A CD  1 
ATOM   486  C  CE  . LYS A 1 68  ? 27.434 -19.085 -12.255 1.00 18.23 ? 68  LYS A CE  1 
ATOM   487  N  NZ  . LYS A 1 68  ? 26.329 -20.103 -12.219 1.00 18.07 ? 68  LYS A NZ  1 
ATOM   488  N  N   . ASN A 1 69  ? 33.075 -16.378 -11.672 1.00 16.17 ? 69  ASN A N   1 
ATOM   489  C  CA  . ASN A 1 69  ? 33.924 -15.173 -11.730 1.00 16.55 ? 69  ASN A CA  1 
ATOM   490  C  C   . ASN A 1 69  ? 34.448 -14.684 -10.373 1.00 15.50 ? 69  ASN A C   1 
ATOM   491  O  O   . ASN A 1 69  ? 34.350 -13.491 -10.063 1.00 14.30 ? 69  ASN A O   1 
ATOM   492  C  CB  . ASN A 1 69  ? 33.159 -14.020 -12.394 1.00 18.85 ? 69  ASN A CB  1 
ATOM   493  C  CG  . ASN A 1 69  ? 32.467 -14.433 -13.683 1.00 19.15 ? 69  ASN A CG  1 
ATOM   494  O  OD1 . ASN A 1 69  ? 33.102 -14.904 -14.620 1.00 19.35 ? 69  ASN A OD1 1 
ATOM   495  N  ND2 . ASN A 1 69  ? 31.155 -14.249 -13.731 1.00 20.83 ? 69  ASN A ND2 1 
ATOM   496  N  N   . PRO A 1 70  ? 35.022 -15.593 -9.559  1.00 15.37 ? 70  PRO A N   1 
ATOM   497  C  CA  . PRO A 1 70  ? 35.557 -15.257 -8.231  1.00 14.52 ? 70  PRO A CA  1 
ATOM   498  C  C   . PRO A 1 70  ? 36.696 -14.230 -8.163  1.00 14.00 ? 70  PRO A C   1 
ATOM   499  O  O   . PRO A 1 70  ? 36.682 -13.331 -7.319  1.00 13.85 ? 70  PRO A O   1 
ATOM   500  C  CB  . PRO A 1 70  ? 35.962 -16.620 -7.667  1.00 14.47 ? 70  PRO A CB  1 
ATOM   501  C  CG  . PRO A 1 70  ? 36.336 -17.413 -8.904  1.00 14.25 ? 70  PRO A CG  1 
ATOM   502  C  CD  . PRO A 1 70  ? 35.236 -17.023 -9.865  1.00 15.97 ? 70  PRO A CD  1 
ATOM   503  N  N   . ARG A 1 71  ? 37.675 -14.362 -9.048  1.00 14.14 ? 71  ARG A N   1 
ATOM   504  C  CA  . ARG A 1 71  ? 38.815 -13.449 -9.066  1.00 14.26 ? 71  ARG A CA  1 
ATOM   505  C  C   . ARG A 1 71  ? 38.424 -12.016 -9.443  1.00 14.18 ? 71  ARG A C   1 
ATOM   506  O  O   . ARG A 1 71  ? 38.949 -11.059 -8.887  1.00 12.81 ? 71  ARG A O   1 
ATOM   507  C  CB  . ARG A 1 71  ? 39.874 -13.991 -10.026 1.00 13.14 ? 71  ARG A CB  1 
ATOM   508  C  CG  . ARG A 1 71  ? 40.210 -15.438 -9.747  1.00 11.19 ? 71  ARG A CG  1 
ATOM   509  C  CD  . ARG A 1 71  ? 41.187 -16.017 -10.755 1.00 14.34 ? 71  ARG A CD  1 
ATOM   510  N  NE  . ARG A 1 71  ? 41.405 -17.436 -10.492 1.00 15.97 ? 71  ARG A NE  1 
ATOM   511  C  CZ  . ARG A 1 71  ? 40.530 -18.401 -10.765 1.00 15.69 ? 71  ARG A CZ  1 
ATOM   512  N  NH1 . ARG A 1 71  ? 39.360 -18.114 -11.334 1.00 16.19 ? 71  ARG A NH1 1 
ATOM   513  N  NH2 . ARG A 1 71  ? 40.813 -19.657 -10.432 1.00 15.24 ? 71  ARG A NH2 1 
ATOM   514  N  N   . SER A 1 72  ? 37.492 -11.880 -10.386 1.00 15.84 ? 72  SER A N   1 
ATOM   515  C  CA  . SER A 1 72  ? 37.027 -10.567 -10.824 1.00 16.45 ? 72  SER A CA  1 
ATOM   516  C  C   . SER A 1 72  ? 36.234 -9.929  -9.690  1.00 15.98 ? 72  SER A C   1 
ATOM   517  O  O   . SER A 1 72  ? 36.459 -8.771  -9.330  1.00 13.69 ? 72  SER A O   1 
ATOM   518  C  CB  . SER A 1 72  ? 36.135 -10.711 -12.052 1.00 16.91 ? 72  SER A CB  1 
ATOM   519  O  OG  . SER A 1 72  ? 36.808 -11.391 -13.094 1.00 19.75 ? 72  SER A OG  1 
ATOM   520  N  N   . VAL A 1 73  ? 35.306 -10.707 -9.135  1.00 16.01 ? 73  VAL A N   1 
ATOM   521  C  CA  . VAL A 1 73  ? 34.469 -10.251 -8.026  1.00 14.61 ? 73  VAL A CA  1 
ATOM   522  C  C   . VAL A 1 73  ? 35.319 -9.977  -6.785  1.00 14.17 ? 73  VAL A C   1 
ATOM   523  O  O   . VAL A 1 73  ? 35.151 -8.947  -6.132  1.00 12.76 ? 73  VAL A O   1 
ATOM   524  C  CB  . VAL A 1 73  ? 33.367 -11.290 -7.689  1.00 13.03 ? 73  VAL A CB  1 
ATOM   525  C  CG1 . VAL A 1 73  ? 32.603 -10.873 -6.435  1.00 9.75  ? 73  VAL A CG1 1 
ATOM   526  C  CG2 . VAL A 1 73  ? 32.411 -11.408 -8.861  1.00 12.71 ? 73  VAL A CG2 1 
ATOM   527  N  N   . GLY A 1 74  ? 36.237 -10.891 -6.478  1.00 13.86 ? 74  GLY A N   1 
ATOM   528  C  CA  . GLY A 1 74  ? 37.100 -10.710 -5.327  1.00 15.23 ? 74  GLY A CA  1 
ATOM   529  C  C   . GLY A 1 74  ? 38.053 -9.537  -5.496  1.00 15.53 ? 74  GLY A C   1 
ATOM   530  O  O   . GLY A 1 74  ? 38.412 -8.863  -4.528  1.00 16.49 ? 74  GLY A O   1 
ATOM   531  N  N   . LYS A 1 75  ? 38.458 -9.287  -6.735  1.00 16.76 ? 75  LYS A N   1 
ATOM   532  C  CA  . LYS A 1 75  ? 39.379 -8.200  -7.034  1.00 17.52 ? 75  LYS A CA  1 
ATOM   533  C  C   . LYS A 1 75  ? 38.664 -6.846  -7.045  1.00 16.55 ? 75  LYS A C   1 
ATOM   534  O  O   . LYS A 1 75  ? 39.236 -5.840  -6.635  1.00 16.26 ? 75  LYS A O   1 
ATOM   535  C  CB  . LYS A 1 75  ? 40.066 -8.461  -8.382  1.00 17.86 ? 75  LYS A CB  1 
ATOM   536  C  CG  . LYS A 1 75  ? 41.302 -7.616  -8.642  1.00 20.84 ? 75  LYS A CG  1 
ATOM   537  C  CD  . LYS A 1 75  ? 42.401 -7.860  -7.599  1.00 20.83 ? 75  LYS A CD  1 
ATOM   538  C  CE  . LYS A 1 75  ? 43.650 -7.043  -7.909  1.00 21.37 ? 75  LYS A CE  1 
ATOM   539  N  NZ  . LYS A 1 75  ? 43.353 -5.576  -7.986  1.00 19.97 ? 75  LYS A NZ  1 
ATOM   540  N  N   . ALA A 1 76  ? 37.413 -6.822  -7.504  1.00 16.97 ? 76  ALA A N   1 
ATOM   541  C  CA  . ALA A 1 76  ? 36.639 -5.580  -7.546  1.00 15.87 ? 76  ALA A CA  1 
ATOM   542  C  C   . ALA A 1 76  ? 36.301 -5.142  -6.121  1.00 14.84 ? 76  ALA A C   1 
ATOM   543  O  O   . ALA A 1 76  ? 36.262 -3.946  -5.807  1.00 13.85 ? 76  ALA A O   1 
ATOM   544  C  CB  . ALA A 1 76  ? 35.357 -5.781  -8.363  1.00 16.05 ? 76  ALA A CB  1 
ATOM   545  N  N   . SER A 1 77  ? 36.057 -6.129  -5.267  1.00 14.47 ? 77  SER A N   1 
ATOM   546  C  CA  . SER A 1 77  ? 35.739 -5.883  -3.871  1.00 14.79 ? 77  SER A CA  1 
ATOM   547  C  C   . SER A 1 77  ? 36.977 -5.448  -3.086  1.00 15.64 ? 77  SER A C   1 
ATOM   548  O  O   . SER A 1 77  ? 36.873 -4.640  -2.168  1.00 16.15 ? 77  SER A O   1 
ATOM   549  C  CB  . SER A 1 77  ? 35.137 -7.137  -3.233  1.00 13.58 ? 77  SER A CB  1 
ATOM   550  O  OG  . SER A 1 77  ? 33.723 -7.071  -3.217  1.00 13.27 ? 77  SER A OG  1 
ATOM   551  N  N   . GLU A 1 78  ? 38.139 -5.997  -3.436  1.00 17.32 ? 78  GLU A N   1 
ATOM   552  C  CA  . GLU A 1 78  ? 39.393 -5.638  -2.774  1.00 17.64 ? 78  GLU A CA  1 
ATOM   553  C  C   . GLU A 1 78  ? 39.739 -4.213  -3.169  1.00 19.16 ? 78  GLU A C   1 
ATOM   554  O  O   . GLU A 1 78  ? 40.309 -3.466  -2.377  1.00 20.14 ? 78  GLU A O   1 
ATOM   555  C  CB  . GLU A 1 78  ? 40.524 -6.578  -3.201  1.00 18.66 ? 78  GLU A CB  1 
ATOM   556  C  CG  . GLU A 1 78  ? 41.902 -6.209  -2.644  1.00 19.91 ? 78  GLU A CG  1 
ATOM   557  C  CD  . GLU A 1 78  ? 42.994 -7.193  -3.053  1.00 21.64 ? 78  GLU A CD  1 
ATOM   558  O  OE1 . GLU A 1 78  ? 43.185 -7.418  -4.266  1.00 22.51 ? 78  GLU A OE1 1 
ATOM   559  O  OE2 . GLU A 1 78  ? 43.668 -7.741  -2.158  1.00 22.63 ? 78  GLU A OE2 1 
ATOM   560  N  N   . GLN A 1 79  ? 39.389 -3.851  -4.401  1.00 19.69 ? 79  GLN A N   1 
ATOM   561  C  CA  . GLN A 1 79  ? 39.635 -2.512  -4.933  1.00 20.22 ? 79  GLN A CA  1 
ATOM   562  C  C   . GLN A 1 79  ? 38.676 -1.522  -4.280  1.00 20.90 ? 79  GLN A C   1 
ATOM   563  O  O   . GLN A 1 79  ? 39.090 -0.461  -3.825  1.00 22.75 ? 79  GLN A O   1 
ATOM   564  C  CB  . GLN A 1 79  ? 39.428 -2.487  -6.456  1.00 21.17 ? 79  GLN A CB  1 
ATOM   565  C  CG  . GLN A 1 79  ? 40.442 -3.308  -7.258  1.00 22.13 ? 79  GLN A CG  1 
ATOM   566  C  CD  . GLN A 1 79  ? 40.142 -3.342  -8.751  1.00 21.17 ? 79  GLN A CD  1 
ATOM   567  O  OE1 . GLN A 1 79  ? 40.097 -4.540  -9.314  1.00 22.82 ? 79  GLN A OE1 1 
ATOM   568  N  NE2 . GLN A 1 79  ? 39.955 -2.305  -9.388  1.00 22.98 ? 79  GLN A NE2 1 
ATOM   569  N  N   . LEU A 1 80  ? 37.392 -1.873  -4.239  1.00 21.49 ? 80  LEU A N   1 
ATOM   570  C  CA  . LEU A 1 80  ? 36.383 -1.009  -3.631  1.00 20.55 ? 80  LEU A CA  1 
ATOM   571  C  C   . LEU A 1 80  ? 36.671 -0.730  -2.153  1.00 20.02 ? 80  LEU A C   1 
ATOM   572  O  O   . LEU A 1 80  ? 36.566 0.406   -1.698  1.00 19.34 ? 80  LEU A O   1 
ATOM   573  C  CB  . LEU A 1 80  ? 34.990 -1.636  -3.765  1.00 19.19 ? 80  LEU A CB  1 
ATOM   574  C  CG  . LEU A 1 80  ? 33.926 -1.052  -2.825  1.00 18.27 ? 80  LEU A CG  1 
ATOM   575  C  CD1 . LEU A 1 80  ? 33.785 0.448   -3.057  1.00 15.89 ? 80  LEU A CD1 1 
ATOM   576  C  CD2 . LEU A 1 80  ? 32.615 -1.762  -3.040  1.00 17.37 ? 80  LEU A CD2 1 
ATOM   577  N  N   . ALA A 1 81  ? 37.039 -1.774  -1.418  1.00 19.99 ? 81  ALA A N   1 
ATOM   578  C  CA  . ALA A 1 81  ? 37.334 -1.680  0.011   1.00 20.52 ? 81  ALA A CA  1 
ATOM   579  C  C   . ALA A 1 81  ? 38.370 -0.624  0.414   1.00 21.73 ? 81  ALA A C   1 
ATOM   580  O  O   . ALA A 1 81  ? 38.223 0.023   1.456   1.00 20.72 ? 81  ALA A O   1 
ATOM   581  C  CB  . ALA A 1 81  ? 37.770 -3.041  0.523   1.00 21.66 ? 81  ALA A CB  1 
ATOM   582  N  N   . GLY A 1 82  ? 39.421 -0.468  -0.394  1.00 22.26 ? 82  GLY A N   1 
ATOM   583  C  CA  . GLY A 1 82  ? 40.455 0.509   -0.093  1.00 22.05 ? 82  GLY A CA  1 
ATOM   584  C  C   . GLY A 1 82  ? 39.981 1.944   -0.271  1.00 22.83 ? 82  GLY A C   1 
ATOM   585  O  O   . GLY A 1 82  ? 40.384 2.841   0.476   1.00 21.29 ? 82  GLY A O   1 
ATOM   586  N  N   . LYS A 1 83  ? 39.127 2.154   -1.274  1.00 23.60 ? 83  LYS A N   1 
ATOM   587  C  CA  . LYS A 1 83  ? 38.571 3.468   -1.572  1.00 23.86 ? 83  LYS A CA  1 
ATOM   588  C  C   . LYS A 1 83  ? 37.617 3.896   -0.466  1.00 22.28 ? 83  LYS A C   1 
ATOM   589  O  O   . LYS A 1 83  ? 37.644 5.048   -0.022  1.00 22.19 ? 83  LYS A O   1 
ATOM   590  C  CB  . LYS A 1 83  ? 37.839 3.436   -2.915  1.00 25.75 ? 83  LYS A CB  1 
ATOM   591  C  CG  . LYS A 1 83  ? 38.776 3.417   -4.113  1.00 30.60 ? 83  LYS A CG  1 
ATOM   592  C  CD  . LYS A 1 83  ? 39.765 2.262   -4.035  1.00 33.25 ? 83  LYS A CD  1 
ATOM   593  C  CE  . LYS A 1 83  ? 40.853 2.367   -5.090  1.00 35.26 ? 83  LYS A CE  1 
ATOM   594  N  NZ  . LYS A 1 83  ? 41.859 1.280   -4.915  1.00 36.85 ? 83  LYS A NZ  1 
ATOM   595  N  N   . VAL A 1 84  ? 36.777 2.955   -0.045  1.00 20.16 ? 84  VAL A N   1 
ATOM   596  C  CA  . VAL A 1 84  ? 35.807 3.160   1.028   1.00 18.43 ? 84  VAL A CA  1 
ATOM   597  C  C   . VAL A 1 84  ? 36.565 3.527   2.299   1.00 17.37 ? 84  VAL A C   1 
ATOM   598  O  O   . VAL A 1 84  ? 36.174 4.440   3.027   1.00 15.66 ? 84  VAL A O   1 
ATOM   599  C  CB  . VAL A 1 84  ? 34.972 1.870   1.273   1.00 16.71 ? 84  VAL A CB  1 
ATOM   600  C  CG1 . VAL A 1 84  ? 34.276 1.930   2.620   1.00 12.86 ? 84  VAL A CG1 1 
ATOM   601  C  CG2 . VAL A 1 84  ? 33.956 1.701   0.159   1.00 14.41 ? 84  VAL A CG2 1 
ATOM   602  N  N   . ALA A 1 85  ? 37.649 2.799   2.551   1.00 18.51 ? 85  ALA A N   1 
ATOM   603  C  CA  . ALA A 1 85  ? 38.501 3.037   3.709   1.00 17.52 ? 85  ALA A CA  1 
ATOM   604  C  C   . ALA A 1 85  ? 39.132 4.422   3.557   1.00 18.18 ? 85  ALA A C   1 
ATOM   605  O  O   . ALA A 1 85  ? 39.264 5.168   4.527   1.00 17.77 ? 85  ALA A O   1 
ATOM   606  C  CB  . ALA A 1 85  ? 39.579 1.965   3.788   1.00 16.64 ? 85  ALA A CB  1 
ATOM   607  N  N   . GLU A 1 86  ? 39.502 4.759   2.325   1.00 20.65 ? 86  GLU A N   1 
ATOM   608  C  CA  . GLU A 1 86  ? 40.101 6.055   2.011   1.00 21.63 ? 86  GLU A CA  1 
ATOM   609  C  C   . GLU A 1 86  ? 39.151 7.208   2.340   1.00 21.55 ? 86  GLU A C   1 
ATOM   610  O  O   . GLU A 1 86  ? 39.519 8.126   3.068   1.00 21.31 ? 86  GLU A O   1 
ATOM   611  C  CB  . GLU A 1 86  ? 40.481 6.111   0.527   1.00 24.03 ? 86  GLU A CB  1 
ATOM   612  C  CG  . GLU A 1 86  ? 41.192 7.382   0.084   1.00 26.05 ? 86  GLU A CG  1 
ATOM   613  C  CD  . GLU A 1 86  ? 41.526 7.372   -1.401  1.00 28.80 ? 86  GLU A CD  1 
ATOM   614  O  OE1 . GLU A 1 86  ? 42.051 6.344   -1.890  1.00 30.59 ? 86  GLU A OE1 1 
ATOM   615  O  OE2 . GLU A 1 86  ? 41.271 8.392   -2.082  1.00 32.86 ? 86  GLU A OE2 1 
ATOM   616  N  N   . VAL A 1 87  ? 37.931 7.158   1.804   1.00 22.98 ? 87  VAL A N   1 
ATOM   617  C  CA  . VAL A 1 87  ? 36.940 8.208   2.045   1.00 23.46 ? 87  VAL A CA  1 
ATOM   618  C  C   . VAL A 1 87  ? 36.584 8.314   3.535   1.00 23.25 ? 87  VAL A C   1 
ATOM   619  O  O   . VAL A 1 87  ? 36.386 9.420   4.053   1.00 22.98 ? 87  VAL A O   1 
ATOM   620  C  CB  . VAL A 1 87  ? 35.630 7.967   1.240   1.00 24.17 ? 87  VAL A CB  1 
ATOM   621  C  CG1 . VAL A 1 87  ? 35.958 7.521   -0.179  1.00 23.79 ? 87  VAL A CG1 1 
ATOM   622  C  CG2 . VAL A 1 87  ? 34.757 6.941   1.950   1.00 26.23 ? 87  VAL A CG2 1 
ATOM   623  N  N   . LYS A 1 88  ? 36.495 7.169   4.212   1.00 22.67 ? 88  LYS A N   1 
ATOM   624  C  CA  . LYS A 1 88  ? 36.177 7.156   5.635   1.00 21.53 ? 88  LYS A CA  1 
ATOM   625  C  C   . LYS A 1 88  ? 37.308 7.823   6.411   1.00 23.53 ? 88  LYS A C   1 
ATOM   626  O  O   . LYS A 1 88  ? 37.055 8.542   7.378   1.00 22.73 ? 88  LYS A O   1 
ATOM   627  C  CB  . LYS A 1 88  ? 35.967 5.724   6.157   1.00 20.51 ? 88  LYS A CB  1 
ATOM   628  C  CG  . LYS A 1 88  ? 34.687 5.022   5.688   1.00 16.45 ? 88  LYS A CG  1 
ATOM   629  C  CD  . LYS A 1 88  ? 33.445 5.890   5.841   1.00 14.16 ? 88  LYS A CD  1 
ATOM   630  C  CE  . LYS A 1 88  ? 33.230 6.353   7.273   1.00 13.50 ? 88  LYS A CE  1 
ATOM   631  N  NZ  . LYS A 1 88  ? 32.156 7.360   7.378   1.00 10.62 ? 88  LYS A NZ  1 
ATOM   632  N  N   . LYS A 1 89  ? 38.554 7.582   5.997   1.00 24.39 ? 89  LYS A N   1 
ATOM   633  C  CA  . LYS A 1 89  ? 39.692 8.216   6.673   1.00 23.65 ? 89  LYS A CA  1 
ATOM   634  C  C   . LYS A 1 89  ? 39.653 9.703   6.337   1.00 24.05 ? 89  LYS A C   1 
ATOM   635  O  O   . LYS A 1 89  ? 40.288 10.515  7.006   1.00 23.25 ? 89  LYS A O   1 
ATOM   636  C  CB  . LYS A 1 89  ? 41.029 7.627   6.210   1.00 23.43 ? 89  LYS A CB  1 
ATOM   637  C  CG  . LYS A 1 89  ? 41.236 6.152   6.503   1.00 23.57 ? 89  LYS A CG  1 
ATOM   638  C  CD  . LYS A 1 89  ? 42.719 5.821   6.504   1.00 24.61 ? 89  LYS A CD  1 
ATOM   639  C  CE  . LYS A 1 89  ? 42.987 4.333   6.300   1.00 24.57 ? 89  LYS A CE  1 
ATOM   640  N  NZ  . LYS A 1 89  ? 42.889 3.949   4.858   1.00 25.49 ? 89  LYS A NZ  1 
ATOM   641  N  N   . ASN A 1 90  ? 38.895 10.039  5.291   1.00 24.85 ? 90  ASN A N   1 
ATOM   642  C  CA  . ASN A 1 90  ? 38.717 11.422  4.838   1.00 25.28 ? 90  ASN A CA  1 
ATOM   643  C  C   . ASN A 1 90  ? 37.558 12.050  5.613   1.00 25.32 ? 90  ASN A C   1 
ATOM   644  O  O   . ASN A 1 90  ? 37.156 13.184  5.341   1.00 26.02 ? 90  ASN A O   1 
ATOM   645  C  CB  . ASN A 1 90  ? 38.390 11.465  3.337   1.00 26.11 ? 90  ASN A CB  1 
ATOM   646  C  CG  . ASN A 1 90  ? 39.626 11.620  2.452   1.00 27.42 ? 90  ASN A CG  1 
ATOM   647  O  OD1 . ASN A 1 90  ? 39.573 12.585  1.539   1.00 29.05 ? 90  ASN A OD1 1 
ATOM   648  N  ND2 . ASN A 1 90  ? 40.602 10.877  2.572   1.00 29.23 ? 90  ASN A ND2 1 
ATOM   649  N  N   . GLY A 1 91  ? 37.019 11.297  6.570   1.00 25.03 ? 91  GLY A N   1 
ATOM   650  C  CA  . GLY A 1 91  ? 35.912 11.788  7.379   1.00 24.58 ? 91  GLY A CA  1 
ATOM   651  C  C   . GLY A 1 91  ? 34.660 12.046  6.562   1.00 24.11 ? 91  GLY A C   1 
ATOM   652  O  O   . GLY A 1 91  ? 33.915 12.987  6.824   1.00 24.69 ? 91  GLY A O   1 
ATOM   653  N  N   . ARG A 1 92  ? 34.430 11.199  5.568   1.00 23.89 ? 92  ARG A N   1 
ATOM   654  C  CA  . ARG A 1 92  ? 33.279 11.342  4.696   1.00 23.72 ? 92  ARG A CA  1 
ATOM   655  C  C   . ARG A 1 92  ? 32.465 10.055  4.599   1.00 23.60 ? 92  ARG A C   1 
ATOM   656  O  O   . ARG A 1 92  ? 33.021 8.953   4.620   1.00 23.02 ? 92  ARG A O   1 
ATOM   657  C  CB  . ARG A 1 92  ? 33.735 11.759  3.294   1.00 25.52 ? 92  ARG A CB  1 
ATOM   658  C  CG  . ARG A 1 92  ? 34.376 13.139  3.216   1.00 28.77 ? 92  ARG A CG  1 
ATOM   659  C  CD  . ARG A 1 92  ? 34.534 13.584  1.770   1.00 30.96 ? 92  ARG A CD  1 
ATOM   660  N  NE  . ARG A 1 92  ? 34.759 15.023  1.638   1.00 35.40 ? 92  ARG A NE  1 
ATOM   661  C  CZ  . ARG A 1 92  ? 35.905 15.648  1.909   1.00 37.87 ? 92  ARG A CZ  1 
ATOM   662  N  NH1 . ARG A 1 92  ? 36.965 14.969  2.333   1.00 38.96 ? 92  ARG A NH1 1 
ATOM   663  N  NH2 . ARG A 1 92  ? 35.995 16.964  1.747   1.00 39.91 ? 92  ARG A NH2 1 
ATOM   664  N  N   . ILE A 1 93  ? 31.144 10.214  4.492   1.00 21.51 ? 93  ILE A N   1 
ATOM   665  C  CA  . ILE A 1 93  ? 30.218 9.094   4.353   1.00 19.52 ? 93  ILE A CA  1 
ATOM   666  C  C   . ILE A 1 93  ? 30.374 8.521   2.947   1.00 18.37 ? 93  ILE A C   1 
ATOM   667  O  O   . ILE A 1 93  ? 30.058 9.189   1.955   1.00 19.66 ? 93  ILE A O   1 
ATOM   668  C  CB  . ILE A 1 93  ? 28.746 9.550   4.545   1.00 18.71 ? 93  ILE A CB  1 
ATOM   669  C  CG1 . ILE A 1 93  ? 28.523 10.007  5.988   1.00 18.62 ? 93  ILE A CG1 1 
ATOM   670  C  CG2 . ILE A 1 93  ? 27.785 8.416   4.197   1.00 19.06 ? 93  ILE A CG2 1 
ATOM   671  C  CD1 . ILE A 1 93  ? 27.125 10.556  6.248   1.00 16.76 ? 93  ILE A CD1 1 
ATOM   672  N  N   . SER A 1 94  ? 30.868 7.292   2.861   1.00 17.84 ? 94  SER A N   1 
ATOM   673  C  CA  . SER A 1 94  ? 31.070 6.634   1.574   1.00 17.95 ? 94  SER A CA  1 
ATOM   674  C  C   . SER A 1 94  ? 29.749 6.253   0.912   1.00 18.51 ? 94  SER A C   1 
ATOM   675  O  O   . SER A 1 94  ? 28.911 5.580   1.516   1.00 19.78 ? 94  SER A O   1 
ATOM   676  C  CB  . SER A 1 94  ? 31.945 5.390   1.755   1.00 16.48 ? 94  SER A CB  1 
ATOM   677  O  OG  . SER A 1 94  ? 31.503 4.620   2.863   1.00 12.94 ? 94  SER A OG  1 
ATOM   678  N  N   . LEU A 1 95  ? 29.566 6.702   -0.326  1.00 19.04 ? 95  LEU A N   1 
ATOM   679  C  CA  . LEU A 1 95  ? 28.359 6.411   -1.089  1.00 18.48 ? 95  LEU A CA  1 
ATOM   680  C  C   . LEU A 1 95  ? 28.764 5.528   -2.264  1.00 19.06 ? 95  LEU A C   1 
ATOM   681  O  O   . LEU A 1 95  ? 29.252 6.023   -3.278  1.00 18.97 ? 95  LEU A O   1 
ATOM   682  C  CB  . LEU A 1 95  ? 27.728 7.708   -1.606  1.00 17.69 ? 95  LEU A CB  1 
ATOM   683  C  CG  . LEU A 1 95  ? 26.263 7.631   -2.054  1.00 19.67 ? 95  LEU A CG  1 
ATOM   684  C  CD1 . LEU A 1 95  ? 25.766 9.003   -2.510  1.00 20.02 ? 95  LEU A CD1 1 
ATOM   685  C  CD2 . LEU A 1 95  ? 26.122 6.628   -3.163  1.00 18.77 ? 95  LEU A CD2 1 
ATOM   686  N  N   . VAL A 1 96  ? 28.576 4.219   -2.132  1.00 18.20 ? 96  VAL A N   1 
ATOM   687  C  CA  . VAL A 1 96  ? 28.944 3.325   -3.223  1.00 17.97 ? 96  VAL A CA  1 
ATOM   688  C  C   . VAL A 1 96  ? 27.803 3.082   -4.216  1.00 16.81 ? 96  VAL A C   1 
ATOM   689  O  O   . VAL A 1 96  ? 26.867 2.317   -3.962  1.00 14.28 ? 96  VAL A O   1 
ATOM   690  C  CB  . VAL A 1 96  ? 29.480 1.968   -2.700  1.00 17.90 ? 96  VAL A CB  1 
ATOM   691  C  CG1 . VAL A 1 96  ? 29.764 1.029   -3.879  1.00 18.66 ? 96  VAL A CG1 1 
ATOM   692  C  CG2 . VAL A 1 96  ? 30.770 2.195   -1.886  1.00 18.71 ? 96  VAL A CG2 1 
ATOM   693  N  N   . LEU A 1 97  ? 27.898 3.769   -5.347  1.00 16.20 ? 97  LEU A N   1 
ATOM   694  C  CA  . LEU A 1 97  ? 26.924 3.654   -6.416  1.00 16.78 ? 97  LEU A CA  1 
ATOM   695  C  C   . LEU A 1 97  ? 27.417 2.442   -7.175  1.00 18.49 ? 97  LEU A C   1 
ATOM   696  O  O   . LEU A 1 97  ? 28.340 2.525   -7.989  1.00 20.17 ? 97  LEU A O   1 
ATOM   697  C  CB  . LEU A 1 97  ? 26.970 4.895   -7.305  1.00 16.18 ? 97  LEU A CB  1 
ATOM   698  C  CG  . LEU A 1 97  ? 26.578 6.257   -6.716  1.00 14.55 ? 97  LEU A CG  1 
ATOM   699  C  CD1 . LEU A 1 97  ? 26.683 7.328   -7.807  1.00 11.79 ? 97  LEU A CD1 1 
ATOM   700  C  CD2 . LEU A 1 97  ? 25.151 6.194   -6.177  1.00 15.09 ? 97  LEU A CD2 1 
ATOM   701  N  N   . GLY A 1 98  ? 26.809 1.301   -6.920  1.00 18.15 ? 98  GLY A N   1 
ATOM   702  C  CA  . GLY A 1 98  ? 27.319 0.123   -7.575  1.00 19.26 ? 98  GLY A CA  1 
ATOM   703  C  C   . GLY A 1 98  ? 26.553 -0.494  -8.710  1.00 19.98 ? 98  GLY A C   1 
ATOM   704  O  O   . GLY A 1 98  ? 25.686 0.113   -9.351  1.00 19.02 ? 98  GLY A O   1 
ATOM   705  N  N   . GLY A 1 99  ? 26.955 -1.730  -8.964  1.00 18.90 ? 99  GLY A N   1 
ATOM   706  C  CA  . GLY A 1 99  ? 26.346 -2.547  -9.970  1.00 17.34 ? 99  GLY A CA  1 
ATOM   707  C  C   . GLY A 1 99  ? 25.737 -3.605  -9.094  1.00 15.88 ? 99  GLY A C   1 
ATOM   708  O  O   . GLY A 1 99  ? 24.834 -3.305  -8.326  1.00 15.72 ? 99  GLY A O   1 
ATOM   709  N  N   . ASP A 1 100 ? 26.254 -4.826  -9.159  1.00 15.56 ? 100 ASP A N   1 
ATOM   710  C  CA  . ASP A 1 100 ? 25.694 -5.899  -8.343  1.00 15.11 ? 100 ASP A CA  1 
ATOM   711  C  C   . ASP A 1 100 ? 26.141 -5.818  -6.873  1.00 14.34 ? 100 ASP A C   1 
ATOM   712  O  O   . ASP A 1 100 ? 27.110 -5.130  -6.526  1.00 14.44 ? 100 ASP A O   1 
ATOM   713  C  CB  . ASP A 1 100 ? 26.044 -7.264  -8.948  1.00 12.98 ? 100 ASP A CB  1 
ATOM   714  C  CG  . ASP A 1 100 ? 27.446 -7.693  -8.625  1.00 12.57 ? 100 ASP A CG  1 
ATOM   715  O  OD1 . ASP A 1 100 ? 27.624 -8.324  -7.569  1.00 9.94  ? 100 ASP A OD1 1 
ATOM   716  O  OD2 . ASP A 1 100 ? 28.369 -7.380  -9.410  1.00 11.81 ? 100 ASP A OD2 1 
ATOM   717  N  N   . HIS A 1 101 ? 25.422 -6.553  -6.029  1.00 14.16 ? 101 HIS A N   1 
ATOM   718  C  CA  . HIS A 1 101 ? 25.638 -6.580  -4.589  1.00 14.66 ? 101 HIS A CA  1 
ATOM   719  C  C   . HIS A 1 101 ? 26.855 -7.339  -4.035  1.00 14.40 ? 101 HIS A C   1 
ATOM   720  O  O   . HIS A 1 101 ? 27.046 -7.383  -2.818  1.00 15.29 ? 101 HIS A O   1 
ATOM   721  C  CB  . HIS A 1 101 ? 24.375 -7.110  -3.927  1.00 13.22 ? 101 HIS A CB  1 
ATOM   722  C  CG  . HIS A 1 101 ? 24.001 -6.386  -2.675  1.00 12.91 ? 101 HIS A CG  1 
ATOM   723  N  ND1 . HIS A 1 101 ? 22.805 -6.600  -2.026  1.00 12.21 ? 101 HIS A ND1 1 
ATOM   724  C  CD2 . HIS A 1 101 ? 24.660 -5.452  -1.952  1.00 14.94 ? 101 HIS A CD2 1 
ATOM   725  C  CE1 . HIS A 1 101 ? 22.744 -5.830  -0.957  1.00 12.34 ? 101 HIS A CE1 1 
ATOM   726  N  NE2 . HIS A 1 101 ? 23.857 -5.125  -0.888  1.00 12.74 ? 101 HIS A NE2 1 
ATOM   727  N  N   . SER A 1 102 ? 27.668 -7.941  -4.897  1.00 13.90 ? 102 SER A N   1 
ATOM   728  C  CA  . SER A 1 102 ? 28.857 -8.655  -4.416  1.00 15.28 ? 102 SER A CA  1 
ATOM   729  C  C   . SER A 1 102 ? 29.846 -7.628  -3.870  1.00 15.46 ? 102 SER A C   1 
ATOM   730  O  O   . SER A 1 102 ? 30.681 -7.942  -3.023  1.00 14.67 ? 102 SER A O   1 
ATOM   731  C  CB  . SER A 1 102 ? 29.537 -9.440  -5.545  1.00 12.88 ? 102 SER A CB  1 
ATOM   732  O  OG  . SER A 1 102 ? 30.200 -8.575  -6.462  1.00 16.00 ? 102 SER A OG  1 
ATOM   733  N  N   . LEU A 1 103 ? 29.729 -6.402  -4.375  1.00 16.15 ? 103 LEU A N   1 
ATOM   734  C  CA  . LEU A 1 103 ? 30.584 -5.278  -3.998  1.00 17.03 ? 103 LEU A CA  1 
ATOM   735  C  C   . LEU A 1 103 ? 30.433 -4.910  -2.524  1.00 16.65 ? 103 LEU A C   1 
ATOM   736  O  O   . LEU A 1 103 ? 31.227 -4.126  -1.977  1.00 16.81 ? 103 LEU A O   1 
ATOM   737  C  CB  . LEU A 1 103 ? 30.251 -4.071  -4.882  1.00 15.44 ? 103 LEU A CB  1 
ATOM   738  C  CG  . LEU A 1 103 ? 30.615 -4.231  -6.360  1.00 17.37 ? 103 LEU A CG  1 
ATOM   739  C  CD1 . LEU A 1 103 ? 29.885 -3.186  -7.196  1.00 16.61 ? 103 LEU A CD1 1 
ATOM   740  C  CD2 . LEU A 1 103 ? 32.135 -4.119  -6.524  1.00 16.06 ? 103 LEU A CD2 1 
ATOM   741  N  N   . ALA A 1 104 ? 29.410 -5.474  -1.886  1.00 16.30 ? 104 ALA A N   1 
ATOM   742  C  CA  . ALA A 1 104 ? 29.161 -5.209  -0.477  1.00 16.34 ? 104 ALA A CA  1 
ATOM   743  C  C   . ALA A 1 104 ? 30.311 -5.774  0.350   1.00 15.62 ? 104 ALA A C   1 
ATOM   744  O  O   . ALA A 1 104 ? 30.715 -5.166  1.339   1.00 15.50 ? 104 ALA A O   1 
ATOM   745  C  CB  . ALA A 1 104 ? 27.825 -5.838  -0.041  1.00 17.08 ? 104 ALA A CB  1 
ATOM   746  N  N   . ILE A 1 105 ? 30.833 -6.933  -0.066  1.00 13.88 ? 105 ILE A N   1 
ATOM   747  C  CA  . ILE A 1 105 ? 31.949 -7.576  0.631   1.00 14.66 ? 105 ILE A CA  1 
ATOM   748  C  C   . ILE A 1 105 ? 33.103 -6.600  0.847   1.00 14.69 ? 105 ILE A C   1 
ATOM   749  O  O   . ILE A 1 105 ? 33.699 -6.552  1.928   1.00 15.48 ? 105 ILE A O   1 
ATOM   750  C  CB  . ILE A 1 105 ? 32.516 -8.795  -0.154  1.00 14.16 ? 105 ILE A CB  1 
ATOM   751  C  CG1 . ILE A 1 105 ? 31.407 -9.800  -0.469  1.00 13.39 ? 105 ILE A CG1 1 
ATOM   752  C  CG2 . ILE A 1 105 ? 33.601 -9.489  0.683   1.00 14.71 ? 105 ILE A CG2 1 
ATOM   753  C  CD1 . ILE A 1 105 ? 31.916 -11.063 -1.193  1.00 13.56 ? 105 ILE A CD1 1 
ATOM   754  N  N   . GLY A 1 106 ? 33.410 -5.832  -0.191  1.00 14.65 ? 106 GLY A N   1 
ATOM   755  C  CA  . GLY A 1 106 ? 34.486 -4.866  -0.114  1.00 16.18 ? 106 GLY A CA  1 
ATOM   756  C  C   . GLY A 1 106 ? 34.069 -3.581  0.573   1.00 16.65 ? 106 GLY A C   1 
ATOM   757  O  O   . GLY A 1 106 ? 34.886 -2.919  1.210   1.00 17.30 ? 106 GLY A O   1 
ATOM   758  N  N   . SER A 1 107 ? 32.792 -3.229  0.447   1.00 17.22 ? 107 SER A N   1 
ATOM   759  C  CA  . SER A 1 107 ? 32.260 -2.023  1.066   1.00 17.98 ? 107 SER A CA  1 
ATOM   760  C  C   . SER A 1 107 ? 32.218 -2.120  2.586   1.00 18.53 ? 107 SER A C   1 
ATOM   761  O  O   . SER A 1 107 ? 32.707 -1.232  3.272   1.00 20.53 ? 107 SER A O   1 
ATOM   762  C  CB  . SER A 1 107 ? 30.856 -1.732  0.543   1.00 18.35 ? 107 SER A CB  1 
ATOM   763  O  OG  . SER A 1 107 ? 30.460 -0.426  0.920   1.00 19.64 ? 107 SER A OG  1 
ATOM   764  N  N   . ILE A 1 108 ? 31.628 -3.186  3.120   1.00 19.03 ? 108 ILE A N   1 
ATOM   765  C  CA  . ILE A 1 108 ? 31.561 -3.336  4.570   1.00 18.32 ? 108 ILE A CA  1 
ATOM   766  C  C   . ILE A 1 108 ? 32.968 -3.556  5.138   1.00 18.71 ? 108 ILE A C   1 
ATOM   767  O  O   . ILE A 1 108 ? 33.308 -3.025  6.192   1.00 18.94 ? 108 ILE A O   1 
ATOM   768  C  CB  . ILE A 1 108 ? 30.638 -4.514  4.987   1.00 17.20 ? 108 ILE A CB  1 
ATOM   769  C  CG1 . ILE A 1 108 ? 29.187 -4.221  4.576   1.00 16.46 ? 108 ILE A CG1 1 
ATOM   770  C  CG2 . ILE A 1 108 ? 30.723 -4.729  6.483   1.00 15.15 ? 108 ILE A CG2 1 
ATOM   771  C  CD1 . ILE A 1 108 ? 28.154 -5.181  5.158   1.00 16.25 ? 108 ILE A CD1 1 
ATOM   772  N  N   . SER A 1 109 ? 33.780 -4.338  4.433   1.00 18.99 ? 109 SER A N   1 
ATOM   773  C  CA  . SER A 1 109 ? 35.153 -4.607  4.855   1.00 19.00 ? 109 SER A CA  1 
ATOM   774  C  C   . SER A 1 109 ? 35.964 -3.312  4.921   1.00 18.14 ? 109 SER A C   1 
ATOM   775  O  O   . SER A 1 109 ? 36.599 -3.016  5.940   1.00 19.09 ? 109 SER A O   1 
ATOM   776  C  CB  . SER A 1 109 ? 35.843 -5.569  3.878   1.00 18.19 ? 109 SER A CB  1 
ATOM   777  O  OG  . SER A 1 109 ? 35.220 -6.834  3.869   1.00 19.10 ? 109 SER A OG  1 
ATOM   778  N  N   . GLY A 1 110 ? 35.954 -2.560  3.824   1.00 16.96 ? 110 GLY A N   1 
ATOM   779  C  CA  . GLY A 1 110 ? 36.681 -1.304  3.773   1.00 18.00 ? 110 GLY A CA  1 
ATOM   780  C  C   . GLY A 1 110 ? 36.234 -0.366  4.878   1.00 17.98 ? 110 GLY A C   1 
ATOM   781  O  O   . GLY A 1 110 ? 37.041 0.299   5.510   1.00 17.62 ? 110 GLY A O   1 
ATOM   782  N  N   . HIS A 1 111 ? 34.931 -0.325  5.108   1.00 19.66 ? 111 HIS A N   1 
ATOM   783  C  CA  . HIS A 1 111 ? 34.340 0.519   6.136   1.00 19.10 ? 111 HIS A CA  1 
ATOM   784  C  C   . HIS A 1 111 ? 34.755 0.046   7.534   1.00 19.27 ? 111 HIS A C   1 
ATOM   785  O  O   . HIS A 1 111 ? 35.128 0.856   8.386   1.00 20.34 ? 111 HIS A O   1 
ATOM   786  C  CB  . HIS A 1 111 ? 32.809 0.484   5.991   1.00 19.08 ? 111 HIS A CB  1 
ATOM   787  C  CG  . HIS A 1 111 ? 32.087 1.488   6.838   1.00 19.15 ? 111 HIS A CG  1 
ATOM   788  N  ND1 . HIS A 1 111 ? 30.726 1.697   6.742   1.00 19.00 ? 111 HIS A ND1 1 
ATOM   789  C  CD2 . HIS A 1 111 ? 32.532 2.343   7.790   1.00 18.53 ? 111 HIS A CD2 1 
ATOM   790  C  CE1 . HIS A 1 111 ? 30.366 2.639   7.596   1.00 17.81 ? 111 HIS A CE1 1 
ATOM   791  N  NE2 . HIS A 1 111 ? 31.443 3.047   8.244   1.00 18.19 ? 111 HIS A NE2 1 
ATOM   792  N  N   . ALA A 1 112 ? 34.703 -1.265  7.761   1.00 17.79 ? 112 ALA A N   1 
ATOM   793  C  CA  . ALA A 1 112 ? 35.049 -1.828  9.061   1.00 17.86 ? 112 ALA A CA  1 
ATOM   794  C  C   . ALA A 1 112 ? 36.520 -1.641  9.448   1.00 19.13 ? 112 ALA A C   1 
ATOM   795  O  O   . ALA A 1 112 ? 36.842 -1.557  10.633  1.00 20.03 ? 112 ALA A O   1 
ATOM   796  C  CB  . ALA A 1 112 ? 34.677 -3.302  9.105   1.00 18.01 ? 112 ALA A CB  1 
ATOM   797  N  N   . ARG A 1 113 ? 37.406 -1.573  8.458   1.00 19.73 ? 113 ARG A N   1 
ATOM   798  C  CA  . ARG A 1 113 ? 38.834 -1.374  8.721   1.00 20.86 ? 113 ARG A CA  1 
ATOM   799  C  C   . ARG A 1 113 ? 39.054 -0.063  9.480   1.00 20.10 ? 113 ARG A C   1 
ATOM   800  O  O   . ARG A 1 113 ? 39.949 0.041   10.314  1.00 19.74 ? 113 ARG A O   1 
ATOM   801  C  CB  . ARG A 1 113 ? 39.634 -1.313  7.411   1.00 19.33 ? 113 ARG A CB  1 
ATOM   802  C  CG  . ARG A 1 113 ? 39.569 -2.550  6.525   1.00 19.88 ? 113 ARG A CG  1 
ATOM   803  C  CD  . ARG A 1 113 ? 40.358 -2.302  5.233   1.00 21.20 ? 113 ARG A CD  1 
ATOM   804  N  NE  . ARG A 1 113 ? 40.355 -3.450  4.327   1.00 21.38 ? 113 ARG A NE  1 
ATOM   805  C  CZ  . ARG A 1 113 ? 40.851 -3.433  3.092   1.00 21.24 ? 113 ARG A CZ  1 
ATOM   806  N  NH1 . ARG A 1 113 ? 41.395 -2.329  2.605   1.00 23.08 ? 113 ARG A NH1 1 
ATOM   807  N  NH2 . ARG A 1 113 ? 40.795 -4.521  2.339   1.00 21.66 ? 113 ARG A NH2 1 
ATOM   808  N  N   . VAL A 1 114 ? 38.225 0.932   9.184   1.00 20.38 ? 114 VAL A N   1 
ATOM   809  C  CA  . VAL A 1 114 ? 38.334 2.236   9.823   1.00 21.11 ? 114 VAL A CA  1 
ATOM   810  C  C   . VAL A 1 114 ? 37.327 2.350   10.979  1.00 22.33 ? 114 VAL A C   1 
ATOM   811  O  O   . VAL A 1 114 ? 37.533 3.111   11.928  1.00 21.18 ? 114 VAL A O   1 
ATOM   812  C  CB  . VAL A 1 114 ? 38.092 3.373   8.778   1.00 20.77 ? 114 VAL A CB  1 
ATOM   813  C  CG1 . VAL A 1 114 ? 38.526 4.731   9.351   1.00 20.19 ? 114 VAL A CG1 1 
ATOM   814  C  CG2 . VAL A 1 114 ? 38.863 3.069   7.480   1.00 21.03 ? 114 VAL A CG2 1 
ATOM   815  N  N   . HIS A 1 115 ? 36.243 1.583   10.901  1.00 22.40 ? 115 HIS A N   1 
ATOM   816  C  CA  . HIS A 1 115 ? 35.229 1.602   11.948  1.00 22.14 ? 115 HIS A CA  1 
ATOM   817  C  C   . HIS A 1 115 ? 34.749 0.187   12.275  1.00 22.68 ? 115 HIS A C   1 
ATOM   818  O  O   . HIS A 1 115 ? 33.623 -0.192  11.953  1.00 24.39 ? 115 HIS A O   1 
ATOM   819  C  CB  . HIS A 1 115 ? 34.047 2.482   11.528  1.00 22.18 ? 115 HIS A CB  1 
ATOM   820  C  CG  . HIS A 1 115 ? 34.439 3.883   11.173  1.00 22.36 ? 115 HIS A CG  1 
ATOM   821  N  ND1 . HIS A 1 115 ? 34.962 4.222   9.944   1.00 23.22 ? 115 HIS A ND1 1 
ATOM   822  C  CD2 . HIS A 1 115 ? 34.420 5.025   11.900  1.00 21.38 ? 115 HIS A CD2 1 
ATOM   823  C  CE1 . HIS A 1 115 ? 35.248 5.511   9.929   1.00 22.11 ? 115 HIS A CE1 1 
ATOM   824  N  NE2 . HIS A 1 115 ? 34.929 6.022   11.104  1.00 21.59 ? 115 HIS A NE2 1 
ATOM   825  N  N   . PRO A 1 116 ? 35.604 -0.607  12.940  1.00 22.46 ? 116 PRO A N   1 
ATOM   826  C  CA  . PRO A 1 116 ? 35.301 -1.988  13.322  1.00 21.52 ? 116 PRO A CA  1 
ATOM   827  C  C   . PRO A 1 116 ? 34.031 -2.199  14.141  1.00 22.32 ? 116 PRO A C   1 
ATOM   828  O  O   . PRO A 1 116 ? 33.528 -3.318  14.219  1.00 21.98 ? 116 PRO A O   1 
ATOM   829  C  CB  . PRO A 1 116 ? 36.560 -2.416  14.076  1.00 21.47 ? 116 PRO A CB  1 
ATOM   830  C  CG  . PRO A 1 116 ? 37.063 -1.137  14.647  1.00 19.77 ? 116 PRO A CG  1 
ATOM   831  C  CD  . PRO A 1 116 ? 36.896 -0.184  13.509  1.00 20.84 ? 116 PRO A CD  1 
ATOM   832  N  N   . ASP A 1 117 ? 33.513 -1.133  14.747  1.00 22.51 ? 117 ASP A N   1 
ATOM   833  C  CA  . ASP A 1 117 ? 32.304 -1.223  15.569  1.00 22.09 ? 117 ASP A CA  1 
ATOM   834  C  C   . ASP A 1 117 ? 31.018 -0.884  14.804  1.00 22.31 ? 117 ASP A C   1 
ATOM   835  O  O   . ASP A 1 117 ? 29.991 -0.563  15.415  1.00 21.84 ? 117 ASP A O   1 
ATOM   836  C  CB  . ASP A 1 117 ? 32.439 -0.301  16.793  1.00 22.93 ? 117 ASP A CB  1 
ATOM   837  C  CG  . ASP A 1 117 ? 32.582 1.187   16.421  1.00 24.15 ? 117 ASP A CG  1 
ATOM   838  O  OD1 . ASP A 1 117 ? 33.194 1.520   15.379  1.00 22.48 ? 117 ASP A OD1 1 
ATOM   839  O  OD2 . ASP A 1 117 ? 32.094 2.034   17.200  1.00 25.52 ? 117 ASP A OD2 1 
ATOM   840  N  N   . LEU A 1 118 ? 31.068 -0.982  13.475  1.00 20.93 ? 118 LEU A N   1 
ATOM   841  C  CA  . LEU A 1 118 ? 29.919 -0.654  12.626  1.00 20.40 ? 118 LEU A CA  1 
ATOM   842  C  C   . LEU A 1 118 ? 28.705 -1.608  12.697  1.00 18.95 ? 118 LEU A C   1 
ATOM   843  O  O   . LEU A 1 118 ? 28.828 -2.790  13.028  1.00 17.82 ? 118 LEU A O   1 
ATOM   844  C  CB  . LEU A 1 118 ? 30.392 -0.495  11.166  1.00 20.51 ? 118 LEU A CB  1 
ATOM   845  C  CG  . LEU A 1 118 ? 30.480 -1.670  10.186  1.00 19.14 ? 118 LEU A CG  1 
ATOM   846  C  CD1 . LEU A 1 118 ? 29.109 -1.908  9.556   1.00 20.68 ? 118 LEU A CD1 1 
ATOM   847  C  CD2 . LEU A 1 118 ? 31.469 -1.342  9.089   1.00 19.77 ? 118 LEU A CD2 1 
ATOM   848  N  N   . GLY A 1 119 ? 27.531 -1.062  12.397  1.00 17.72 ? 119 GLY A N   1 
ATOM   849  C  CA  . GLY A 1 119 ? 26.305 -1.846  12.405  1.00 16.06 ? 119 GLY A CA  1 
ATOM   850  C  C   . GLY A 1 119 ? 25.750 -1.834  10.997  1.00 15.09 ? 119 GLY A C   1 
ATOM   851  O  O   . GLY A 1 119 ? 25.840 -0.819  10.304  1.00 14.91 ? 119 GLY A O   1 
ATOM   852  N  N   . VAL A 1 120 ? 25.178 -2.948  10.563  1.00 13.67 ? 120 VAL A N   1 
ATOM   853  C  CA  . VAL A 1 120 ? 24.651 -3.024  9.210   1.00 13.41 ? 120 VAL A CA  1 
ATOM   854  C  C   . VAL A 1 120 ? 23.144 -3.251  9.082   1.00 11.08 ? 120 VAL A C   1 
ATOM   855  O  O   . VAL A 1 120 ? 22.589 -4.177  9.676   1.00 9.97  ? 120 VAL A O   1 
ATOM   856  C  CB  . VAL A 1 120 ? 25.357 -4.155  8.410   1.00 14.20 ? 120 VAL A CB  1 
ATOM   857  C  CG1 . VAL A 1 120 ? 24.932 -4.105  6.944   1.00 11.92 ? 120 VAL A CG1 1 
ATOM   858  C  CG2 . VAL A 1 120 ? 26.873 -4.040  8.558   1.00 14.17 ? 120 VAL A CG2 1 
ATOM   859  N  N   . ILE A 1 121 ? 22.488 -2.398  8.297   1.00 11.94 ? 121 ILE A N   1 
ATOM   860  C  CA  . ILE A 1 121 ? 21.060 -2.545  8.006   1.00 11.28 ? 121 ILE A CA  1 
ATOM   861  C  C   . ILE A 1 121 ? 21.077 -2.972  6.543   1.00 11.39 ? 121 ILE A C   1 
ATOM   862  O  O   . ILE A 1 121 ? 21.503 -2.207  5.683   1.00 11.84 ? 121 ILE A O   1 
ATOM   863  C  CB  . ILE A 1 121 ? 20.277 -1.216  8.128   1.00 10.67 ? 121 ILE A CB  1 
ATOM   864  C  CG1 . ILE A 1 121 ? 20.214 -0.759  9.588   1.00 12.81 ? 121 ILE A CG1 1 
ATOM   865  C  CG2 . ILE A 1 121 ? 18.842 -1.409  7.635   1.00 10.59 ? 121 ILE A CG2 1 
ATOM   866  C  CD1 . ILE A 1 121 ? 21.518 -0.370  10.168  1.00 16.02 ? 121 ILE A CD1 1 
ATOM   867  N  N   . TRP A 1 122 ? 20.629 -4.195  6.271   1.00 10.08 ? 122 TRP A N   1 
ATOM   868  C  CA  . TRP A 1 122 ? 20.615 -4.762  4.917   1.00 10.13 ? 122 TRP A CA  1 
ATOM   869  C  C   . TRP A 1 122 ? 19.190 -4.803  4.327   1.00 10.33 ? 122 TRP A C   1 
ATOM   870  O  O   . TRP A 1 122 ? 18.414 -5.698  4.646   1.00 10.93 ? 122 TRP A O   1 
ATOM   871  C  CB  . TRP A 1 122 ? 21.232 -6.176  4.995   1.00 9.49  ? 122 TRP A CB  1 
ATOM   872  C  CG  . TRP A 1 122 ? 21.625 -6.826  3.691   1.00 9.87  ? 122 TRP A CG  1 
ATOM   873  C  CD1 . TRP A 1 122 ? 20.792 -7.392  2.775   1.00 9.60  ? 122 TRP A CD1 1 
ATOM   874  C  CD2 . TRP A 1 122 ? 22.956 -6.989  3.176   1.00 9.39  ? 122 TRP A CD2 1 
ATOM   875  N  NE1 . TRP A 1 122 ? 21.518 -7.900  1.720   1.00 12.64 ? 122 TRP A NE1 1 
ATOM   876  C  CE2 . TRP A 1 122 ? 22.847 -7.665  1.940   1.00 8.79  ? 122 TRP A CE2 1 
ATOM   877  C  CE3 . TRP A 1 122 ? 24.226 -6.627  3.638   1.00 8.27  ? 122 TRP A CE3 1 
ATOM   878  C  CZ2 . TRP A 1 122 ? 23.961 -7.987  1.158   1.00 7.08  ? 122 TRP A CZ2 1 
ATOM   879  C  CZ3 . TRP A 1 122 ? 25.334 -6.944  2.863   1.00 9.64  ? 122 TRP A CZ3 1 
ATOM   880  C  CH2 . TRP A 1 122 ? 25.192 -7.620  1.632   1.00 9.70  ? 122 TRP A CH2 1 
ATOM   881  N  N   . VAL A 1 123 ? 18.848 -3.824  3.481   1.00 10.97 ? 123 VAL A N   1 
ATOM   882  C  CA  . VAL A 1 123 ? 17.525 -3.764  2.854   1.00 11.49 ? 123 VAL A CA  1 
ATOM   883  C  C   . VAL A 1 123 ? 17.549 -4.588  1.573   1.00 12.32 ? 123 VAL A C   1 
ATOM   884  O  O   . VAL A 1 123 ? 18.311 -4.271  0.649   1.00 10.89 ? 123 VAL A O   1 
ATOM   885  C  CB  . VAL A 1 123 ? 17.122 -2.321  2.514   1.00 11.44 ? 123 VAL A CB  1 
ATOM   886  C  CG1 . VAL A 1 123 ? 15.746 -2.314  1.838   1.00 11.40 ? 123 VAL A CG1 1 
ATOM   887  C  CG2 . VAL A 1 123 ? 17.092 -1.480  3.780   1.00 10.22 ? 123 VAL A CG2 1 
ATOM   888  N  N   . ASP A 1 124 ? 16.699 -5.621  1.505   1.00 13.46 ? 124 ASP A N   1 
ATOM   889  C  CA  . ASP A 1 124 ? 16.698 -6.532  0.350   1.00 12.32 ? 124 ASP A CA  1 
ATOM   890  C  C   . ASP A 1 124 ? 15.544 -7.545  0.370   1.00 11.18 ? 124 ASP A C   1 
ATOM   891  O  O   . ASP A 1 124 ? 14.952 -7.790  1.406   1.00 11.35 ? 124 ASP A O   1 
ATOM   892  C  CB  . ASP A 1 124 ? 18.012 -7.325  0.376   1.00 12.35 ? 124 ASP A CB  1 
ATOM   893  C  CG  . ASP A 1 124 ? 18.441 -7.819  -0.989  1.00 13.15 ? 124 ASP A CG  1 
ATOM   894  O  OD1 . ASP A 1 124 ? 17.594 -8.321  -1.764  1.00 12.27 ? 124 ASP A OD1 1 
ATOM   895  O  OD2 . ASP A 1 124 ? 19.655 -7.717  -1.274  1.00 15.35 ? 124 ASP A OD2 1 
ATOM   896  N  N   . ALA A 1 125 ? 15.278 -8.170  -0.776  1.00 11.74 ? 125 ALA A N   1 
ATOM   897  C  CA  . ALA A 1 125 ? 14.235 -9.191  -0.889  1.00 10.50 ? 125 ALA A CA  1 
ATOM   898  C  C   . ALA A 1 125 ? 14.862 -10.537 -0.542  1.00 11.12 ? 125 ALA A C   1 
ATOM   899  O  O   . ALA A 1 125 ? 14.164 -11.489 -0.190  1.00 11.29 ? 125 ALA A O   1 
ATOM   900  C  CB  . ALA A 1 125 ? 13.669 -9.233  -2.325  1.00 9.62  ? 125 ALA A CB  1 
ATOM   901  N  N   . HIS A 1 126 ? 16.188 -10.585 -0.650  1.00 11.80 ? 126 HIS A N   1 
ATOM   902  C  CA  . HIS A 1 126 ? 16.996 -11.775 -0.382  1.00 11.46 ? 126 HIS A CA  1 
ATOM   903  C  C   . HIS A 1 126 ? 18.005 -11.517 0.758   1.00 11.97 ? 126 HIS A C   1 
ATOM   904  O  O   . HIS A 1 126 ? 18.361 -10.366 1.025   1.00 12.69 ? 126 HIS A O   1 
ATOM   905  C  CB  . HIS A 1 126 ? 17.762 -12.173 -1.656  1.00 13.25 ? 126 HIS A CB  1 
ATOM   906  C  CG  . HIS A 1 126 ? 16.985 -11.980 -2.927  1.00 12.01 ? 126 HIS A CG  1 
ATOM   907  N  ND1 . HIS A 1 126 ? 16.831 -10.746 -3.528  1.00 10.76 ? 126 HIS A ND1 1 
ATOM   908  C  CD2 . HIS A 1 126 ? 16.291 -12.858 -3.690  1.00 10.72 ? 126 HIS A CD2 1 
ATOM   909  C  CE1 . HIS A 1 126 ? 16.076 -10.873 -4.603  1.00 10.88 ? 126 HIS A CE1 1 
ATOM   910  N  NE2 . HIS A 1 126 ? 15.734 -12.144 -4.724  1.00 11.53 ? 126 HIS A NE2 1 
ATOM   911  N  N   . THR A 1 127 ? 18.468 -12.579 1.427   1.00 11.89 ? 127 THR A N   1 
ATOM   912  C  CA  . THR A 1 127 ? 19.445 -12.416 2.514   1.00 11.62 ? 127 THR A CA  1 
ATOM   913  C  C   . THR A 1 127 ? 20.906 -12.426 2.033   1.00 11.30 ? 127 THR A C   1 
ATOM   914  O  O   . THR A 1 127 ? 21.808 -11.998 2.765   1.00 10.55 ? 127 THR A O   1 
ATOM   915  C  CB  . THR A 1 127 ? 19.287 -13.482 3.622   1.00 8.90  ? 127 THR A CB  1 
ATOM   916  O  OG1 . THR A 1 127 ? 19.045 -14.761 3.040   1.00 10.28 ? 127 THR A OG1 1 
ATOM   917  C  CG2 . THR A 1 127 ? 18.165 -13.108 4.551   1.00 8.04  ? 127 THR A CG2 1 
ATOM   918  N  N   . ASP A 1 128 ? 21.133 -12.905 0.807   1.00 11.45 ? 128 ASP A N   1 
ATOM   919  C  CA  . ASP A 1 128 ? 22.480 -12.934 0.229   1.00 10.63 ? 128 ASP A CA  1 
ATOM   920  C  C   . ASP A 1 128 ? 23.508 -13.516 1.194   1.00 12.41 ? 128 ASP A C   1 
ATOM   921  O  O   . ASP A 1 128 ? 24.646 -13.030 1.290   1.00 12.18 ? 128 ASP A O   1 
ATOM   922  C  CB  . ASP A 1 128 ? 22.918 -11.518 -0.141  1.00 10.49 ? 128 ASP A CB  1 
ATOM   923  C  CG  . ASP A 1 128 ? 22.089 -10.914 -1.256  1.00 11.43 ? 128 ASP A CG  1 
ATOM   924  O  OD1 . ASP A 1 128 ? 22.285 -9.714  -1.523  1.00 13.33 ? 128 ASP A OD1 1 
ATOM   925  O  OD2 . ASP A 1 128 ? 21.261 -11.628 -1.869  1.00 9.81  ? 128 ASP A OD2 1 
ATOM   926  N  N   . ILE A 1 129 ? 23.112 -14.569 1.891   1.00 11.63 ? 129 ILE A N   1 
ATOM   927  C  CA  . ILE A 1 129 ? 23.983 -15.183 2.871   1.00 11.08 ? 129 ILE A CA  1 
ATOM   928  C  C   . ILE A 1 129 ? 24.352 -16.620 2.499   1.00 11.43 ? 129 ILE A C   1 
ATOM   929  O  O   . ILE A 1 129 ? 24.711 -17.420 3.362   1.00 11.69 ? 129 ILE A O   1 
ATOM   930  C  CB  . ILE A 1 129 ? 23.321 -15.104 4.285   1.00 10.22 ? 129 ILE A CB  1 
ATOM   931  C  CG1 . ILE A 1 129 ? 24.338 -15.472 5.364   1.00 12.19 ? 129 ILE A CG1 1 
ATOM   932  C  CG2 . ILE A 1 129 ? 22.058 -15.967 4.332   1.00 6.48  ? 129 ILE A CG2 1 
ATOM   933  C  CD1 . ILE A 1 129 ? 23.919 -15.049 6.773   1.00 17.30 ? 129 ILE A CD1 1 
ATOM   934  N  N   . ASN A 1 130 ? 24.264 -16.946 1.207   1.00 12.02 ? 130 ASN A N   1 
ATOM   935  C  CA  . ASN A 1 130 ? 24.642 -18.284 0.720   1.00 12.58 ? 130 ASN A CA  1 
ATOM   936  C  C   . ASN A 1 130 ? 26.176 -18.411 0.754   1.00 12.01 ? 130 ASN A C   1 
ATOM   937  O  O   . ASN A 1 130 ? 26.892 -17.418 0.601   1.00 9.74  ? 130 ASN A O   1 
ATOM   938  C  CB  . ASN A 1 130 ? 24.142 -18.506 -0.720  1.00 13.25 ? 130 ASN A CB  1 
ATOM   939  C  CG  . ASN A 1 130 ? 22.757 -19.144 -0.778  1.00 11.20 ? 130 ASN A CG  1 
ATOM   940  O  OD1 . ASN A 1 130 ? 22.537 -20.230 -0.247  1.00 13.05 ? 130 ASN A OD1 1 
ATOM   941  N  ND2 . ASN A 1 130 ? 21.821 -18.468 -1.432  1.00 10.87 ? 130 ASN A ND2 1 
ATOM   942  N  N   . THR A 1 131 ? 26.691 -19.616 0.982   1.00 13.15 ? 131 THR A N   1 
ATOM   943  C  CA  . THR A 1 131 ? 28.145 -19.796 1.006   1.00 14.51 ? 131 THR A CA  1 
ATOM   944  C  C   . THR A 1 131 ? 28.530 -20.435 -0.326  1.00 15.09 ? 131 THR A C   1 
ATOM   945  O  O   . THR A 1 131 ? 27.650 -20.783 -1.122  1.00 15.46 ? 131 THR A O   1 
ATOM   946  C  CB  . THR A 1 131 ? 28.618 -20.745 2.163   1.00 15.07 ? 131 THR A CB  1 
ATOM   947  O  OG1 . THR A 1 131 ? 28.448 -22.113 1.770   1.00 14.25 ? 131 THR A OG1 1 
ATOM   948  C  CG2 . THR A 1 131 ? 27.817 -20.489 3.448   1.00 12.98 ? 131 THR A CG2 1 
ATOM   949  N  N   . PRO A 1 132 ? 29.843 -20.557 -0.612  1.00 14.54 ? 132 PRO A N   1 
ATOM   950  C  CA  . PRO A 1 132 ? 30.179 -21.188 -1.887  1.00 14.14 ? 132 PRO A CA  1 
ATOM   951  C  C   . PRO A 1 132 ? 29.681 -22.633 -1.921  1.00 14.83 ? 132 PRO A C   1 
ATOM   952  O  O   . PRO A 1 132 ? 29.593 -23.233 -2.983  1.00 15.75 ? 132 PRO A O   1 
ATOM   953  C  CB  . PRO A 1 132 ? 31.695 -21.080 -1.921  1.00 14.39 ? 132 PRO A CB  1 
ATOM   954  C  CG  . PRO A 1 132 ? 31.902 -19.739 -1.356  1.00 11.91 ? 132 PRO A CG  1 
ATOM   955  C  CD  . PRO A 1 132 ? 30.984 -19.754 -0.134  1.00 15.05 ? 132 PRO A CD  1 
ATOM   956  N  N   . LEU A 1 133 ? 29.334 -23.173 -0.754  1.00 15.88 ? 133 LEU A N   1 
ATOM   957  C  CA  . LEU A 1 133 ? 28.847 -24.546 -0.660  1.00 18.47 ? 133 LEU A CA  1 
ATOM   958  C  C   . LEU A 1 133 ? 27.328 -24.692 -0.585  1.00 18.05 ? 133 LEU A C   1 
ATOM   959  O  O   . LEU A 1 133 ? 26.796 -25.780 -0.812  1.00 18.88 ? 133 LEU A O   1 
ATOM   960  C  CB  . LEU A 1 133 ? 29.489 -25.260 0.539   1.00 19.54 ? 133 LEU A CB  1 
ATOM   961  C  CG  . LEU A 1 133 ? 31.010 -25.416 0.495   1.00 21.61 ? 133 LEU A CG  1 
ATOM   962  C  CD1 . LEU A 1 133 ? 31.462 -26.164 1.731   1.00 22.97 ? 133 LEU A CD1 1 
ATOM   963  C  CD2 . LEU A 1 133 ? 31.429 -26.165 -0.759  1.00 22.99 ? 133 LEU A CD2 1 
ATOM   964  N  N   . THR A 1 134 ? 26.622 -23.613 -0.272  1.00 17.26 ? 134 THR A N   1 
ATOM   965  C  CA  . THR A 1 134 ? 25.169 -23.696 -0.198  1.00 16.72 ? 134 THR A CA  1 
ATOM   966  C  C   . THR A 1 134 ? 24.470 -23.050 -1.411  1.00 17.16 ? 134 THR A C   1 
ATOM   967  O  O   . THR A 1 134 ? 23.295 -23.313 -1.677  1.00 16.61 ? 134 THR A O   1 
ATOM   968  C  CB  . THR A 1 134 ? 24.642 -23.056 1.115   1.00 16.93 ? 134 THR A CB  1 
ATOM   969  O  OG1 . THR A 1 134 ? 24.966 -21.665 1.141   1.00 16.23 ? 134 THR A OG1 1 
ATOM   970  C  CG2 . THR A 1 134 ? 25.264 -23.727 2.327   1.00 15.50 ? 134 THR A CG2 1 
ATOM   971  N  N   . THR A 1 135 ? 25.198 -22.217 -2.149  1.00 17.13 ? 135 THR A N   1 
ATOM   972  C  CA  . THR A 1 135 ? 24.659 -21.534 -3.326  1.00 17.67 ? 135 THR A CA  1 
ATOM   973  C  C   . THR A 1 135 ? 24.282 -22.533 -4.425  1.00 19.38 ? 135 THR A C   1 
ATOM   974  O  O   . THR A 1 135 ? 24.955 -23.547 -4.594  1.00 19.71 ? 135 THR A O   1 
ATOM   975  C  CB  . THR A 1 135 ? 25.712 -20.510 -3.890  1.00 16.86 ? 135 THR A CB  1 
ATOM   976  O  OG1 . THR A 1 135 ? 25.162 -19.794 -4.999  1.00 12.28 ? 135 THR A OG1 1 
ATOM   977  C  CG2 . THR A 1 135 ? 26.990 -21.228 -4.344  1.00 16.67 ? 135 THR A CG2 1 
ATOM   978  N  N   . THR A 1 136 ? 23.201 -22.271 -5.157  1.00 19.61 ? 136 THR A N   1 
ATOM   979  C  CA  . THR A 1 136 ? 22.828 -23.173 -6.251  1.00 20.74 ? 136 THR A CA  1 
ATOM   980  C  C   . THR A 1 136 ? 23.193 -22.527 -7.590  1.00 19.67 ? 136 THR A C   1 
ATOM   981  O  O   . THR A 1 136 ? 23.541 -23.221 -8.547  1.00 19.29 ? 136 THR A O   1 
ATOM   982  C  CB  . THR A 1 136 ? 21.303 -23.540 -6.259  1.00 22.06 ? 136 THR A CB  1 
ATOM   983  O  OG1 . THR A 1 136 ? 20.514 -22.365 -6.482  1.00 27.71 ? 136 THR A OG1 1 
ATOM   984  C  CG2 . THR A 1 136 ? 20.897 -24.198 -4.946  1.00 22.12 ? 136 THR A CG2 1 
ATOM   985  N  N   . SER A 1 137 ? 23.129 -21.196 -7.643  1.00 19.97 ? 137 SER A N   1 
ATOM   986  C  CA  . SER A 1 137 ? 23.451 -20.450 -8.857  1.00 18.95 ? 137 SER A CA  1 
ATOM   987  C  C   . SER A 1 137 ? 24.955 -20.257 -9.063  1.00 19.22 ? 137 SER A C   1 
ATOM   988  O  O   . SER A 1 137 ? 25.490 -20.565 -10.119 1.00 18.64 ? 137 SER A O   1 
ATOM   989  C  CB  . SER A 1 137 ? 22.771 -19.070 -8.836  1.00 19.97 ? 137 SER A CB  1 
ATOM   990  O  OG  . SER A 1 137 ? 23.313 -18.218 -7.835  1.00 15.47 ? 137 SER A OG  1 
ATOM   991  N  N   . GLY A 1 138 ? 25.638 -19.740 -8.049  1.00 20.33 ? 138 GLY A N   1 
ATOM   992  C  CA  . GLY A 1 138 ? 27.065 -19.499 -8.183  1.00 18.77 ? 138 GLY A CA  1 
ATOM   993  C  C   . GLY A 1 138 ? 27.320 -18.008 -8.275  1.00 17.75 ? 138 GLY A C   1 
ATOM   994  O  O   . GLY A 1 138 ? 28.442 -17.555 -8.088  1.00 17.58 ? 138 GLY A O   1 
ATOM   995  N  N   . ASN A 1 139 ? 26.269 -17.240 -8.557  1.00 16.81 ? 139 ASN A N   1 
ATOM   996  C  CA  . ASN A 1 139 ? 26.403 -15.792 -8.661  1.00 14.90 ? 139 ASN A CA  1 
ATOM   997  C  C   . ASN A 1 139 ? 26.766 -15.272 -7.273  1.00 14.38 ? 139 ASN A C   1 
ATOM   998  O  O   . ASN A 1 139 ? 26.011 -15.448 -6.317  1.00 13.71 ? 139 ASN A O   1 
ATOM   999  C  CB  . ASN A 1 139 ? 25.093 -15.139 -9.117  1.00 16.14 ? 139 ASN A CB  1 
ATOM   1000 C  CG  . ASN A 1 139 ? 24.421 -15.878 -10.263 1.00 16.33 ? 139 ASN A CG  1 
ATOM   1001 O  OD1 . ASN A 1 139 ? 25.051 -16.643 -10.993 1.00 15.82 ? 139 ASN A OD1 1 
ATOM   1002 N  ND2 . ASN A 1 139 ? 23.127 -15.632 -10.433 1.00 15.07 ? 139 ASN A ND2 1 
ATOM   1003 N  N   . LEU A 1 140 ? 27.921 -14.631 -7.164  1.00 11.46 ? 140 LEU A N   1 
ATOM   1004 C  CA  . LEU A 1 140 ? 28.381 -14.107 -5.880  1.00 13.86 ? 140 LEU A CA  1 
ATOM   1005 C  C   . LEU A 1 140 ? 27.644 -12.867 -5.329  1.00 14.13 ? 140 LEU A C   1 
ATOM   1006 O  O   . LEU A 1 140 ? 28.015 -12.356 -4.278  1.00 13.89 ? 140 LEU A O   1 
ATOM   1007 C  CB  . LEU A 1 140 ? 29.890 -13.823 -5.943  1.00 11.69 ? 140 LEU A CB  1 
ATOM   1008 C  CG  . LEU A 1 140 ? 30.860 -15.009 -5.791  1.00 13.52 ? 140 LEU A CG  1 
ATOM   1009 C  CD1 . LEU A 1 140 ? 32.120 -14.746 -6.594  1.00 10.51 ? 140 LEU A CD1 1 
ATOM   1010 C  CD2 . LEU A 1 140 ? 31.185 -15.250 -4.310  1.00 11.97 ? 140 LEU A CD2 1 
ATOM   1011 N  N   . HIS A 1 141 ? 26.620 -12.373 -6.023  1.00 15.29 ? 141 HIS A N   1 
ATOM   1012 C  CA  . HIS A 1 141 ? 25.891 -11.223 -5.506  1.00 14.81 ? 141 HIS A CA  1 
ATOM   1013 C  C   . HIS A 1 141 ? 24.849 -11.748 -4.533  1.00 13.99 ? 141 HIS A C   1 
ATOM   1014 O  O   . HIS A 1 141 ? 24.160 -10.983 -3.877  1.00 14.87 ? 141 HIS A O   1 
ATOM   1015 C  CB  . HIS A 1 141 ? 25.213 -10.421 -6.622  1.00 16.40 ? 141 HIS A CB  1 
ATOM   1016 C  CG  . HIS A 1 141 ? 24.006 -11.080 -7.214  1.00 16.43 ? 141 HIS A CG  1 
ATOM   1017 N  ND1 . HIS A 1 141 ? 22.986 -10.362 -7.804  1.00 16.93 ? 141 HIS A ND1 1 
ATOM   1018 C  CD2 . HIS A 1 141 ? 23.681 -12.386 -7.364  1.00 16.08 ? 141 HIS A CD2 1 
ATOM   1019 C  CE1 . HIS A 1 141 ? 22.086 -11.196 -8.291  1.00 17.76 ? 141 HIS A CE1 1 
ATOM   1020 N  NE2 . HIS A 1 141 ? 22.485 -12.430 -8.037  1.00 17.86 ? 141 HIS A NE2 1 
ATOM   1021 N  N   . GLY A 1 142 ? 24.744 -13.071 -4.457  1.00 15.10 ? 142 GLY A N   1 
ATOM   1022 C  CA  . GLY A 1 142 ? 23.815 -13.704 -3.543  1.00 12.40 ? 142 GLY A CA  1 
ATOM   1023 C  C   . GLY A 1 142 ? 24.588 -14.389 -2.424  1.00 12.69 ? 142 GLY A C   1 
ATOM   1024 O  O   . GLY A 1 142 ? 24.030 -15.191 -1.677  1.00 12.72 ? 142 GLY A O   1 
ATOM   1025 N  N   . GLN A 1 143 ? 25.872 -14.050 -2.302  1.00 12.27 ? 143 GLN A N   1 
ATOM   1026 C  CA  . GLN A 1 143 ? 26.764 -14.625 -1.291  1.00 12.19 ? 143 GLN A CA  1 
ATOM   1027 C  C   . GLN A 1 143 ? 27.548 -13.680 -0.362  1.00 12.27 ? 143 GLN A C   1 
ATOM   1028 O  O   . GLN A 1 143 ? 28.133 -14.151 0.611   1.00 13.63 ? 143 GLN A O   1 
ATOM   1029 C  CB  . GLN A 1 143 ? 27.801 -15.516 -1.970  1.00 12.68 ? 143 GLN A CB  1 
ATOM   1030 C  CG  . GLN A 1 143 ? 27.246 -16.639 -2.777  1.00 13.84 ? 143 GLN A CG  1 
ATOM   1031 C  CD  . GLN A 1 143 ? 28.335 -17.373 -3.489  1.00 13.79 ? 143 GLN A CD  1 
ATOM   1032 O  OE1 . GLN A 1 143 ? 29.351 -17.724 -2.891  1.00 15.52 ? 143 GLN A OE1 1 
ATOM   1033 N  NE2 . GLN A 1 143 ? 28.141 -17.612 -4.781  1.00 16.05 ? 143 GLN A NE2 1 
ATOM   1034 N  N   . PRO A 1 144 ? 27.573 -12.355 -0.636  1.00 12.20 ? 144 PRO A N   1 
ATOM   1035 C  CA  . PRO A 1 144 ? 28.315 -11.394 0.197   1.00 12.82 ? 144 PRO A CA  1 
ATOM   1036 C  C   . PRO A 1 144 ? 28.302 -11.504 1.733   1.00 11.09 ? 144 PRO A C   1 
ATOM   1037 O  O   . PRO A 1 144 ? 29.363 -11.538 2.352   1.00 11.21 ? 144 PRO A O   1 
ATOM   1038 C  CB  . PRO A 1 144 ? 27.791 -10.037 -0.290  1.00 12.79 ? 144 PRO A CB  1 
ATOM   1039 C  CG  . PRO A 1 144 ? 26.420 -10.362 -0.796  1.00 13.09 ? 144 PRO A CG  1 
ATOM   1040 C  CD  . PRO A 1 144 ? 26.678 -11.630 -1.554  1.00 11.51 ? 144 PRO A CD  1 
ATOM   1041 N  N   . VAL A 1 145 ? 27.123 -11.565 2.345   1.00 12.24 ? 145 VAL A N   1 
ATOM   1042 C  CA  . VAL A 1 145 ? 27.026 -11.636 3.807   1.00 12.57 ? 145 VAL A CA  1 
ATOM   1043 C  C   . VAL A 1 145 ? 27.760 -12.816 4.440   1.00 11.94 ? 145 VAL A C   1 
ATOM   1044 O  O   . VAL A 1 145 ? 28.237 -12.710 5.572   1.00 13.00 ? 145 VAL A O   1 
ATOM   1045 C  CB  . VAL A 1 145 ? 25.555 -11.655 4.274   1.00 11.82 ? 145 VAL A CB  1 
ATOM   1046 C  CG1 . VAL A 1 145 ? 25.495 -11.545 5.801   1.00 10.90 ? 145 VAL A CG1 1 
ATOM   1047 C  CG2 . VAL A 1 145 ? 24.798 -10.496 3.636   1.00 9.07  ? 145 VAL A CG2 1 
ATOM   1048 N  N   . SER A 1 146 ? 27.855 -13.930 3.717   1.00 12.13 ? 146 SER A N   1 
ATOM   1049 C  CA  . SER A 1 146 ? 28.551 -15.103 4.235   1.00 12.77 ? 146 SER A CA  1 
ATOM   1050 C  C   . SER A 1 146 ? 30.074 -14.891 4.272   1.00 14.14 ? 146 SER A C   1 
ATOM   1051 O  O   . SER A 1 146 ? 30.767 -15.507 5.085   1.00 14.27 ? 146 SER A O   1 
ATOM   1052 C  CB  . SER A 1 146 ? 28.219 -16.358 3.407   1.00 10.88 ? 146 SER A CB  1 
ATOM   1053 O  OG  . SER A 1 146 ? 28.934 -16.400 2.189   1.00 14.63 ? 146 SER A OG  1 
ATOM   1054 N  N   . PHE A 1 147 ? 30.599 -14.033 3.399   1.00 14.86 ? 147 PHE A N   1 
ATOM   1055 C  CA  . PHE A 1 147 ? 32.039 -13.772 3.394   1.00 17.31 ? 147 PHE A CA  1 
ATOM   1056 C  C   . PHE A 1 147 ? 32.399 -12.794 4.518   1.00 17.85 ? 147 PHE A C   1 
ATOM   1057 O  O   . PHE A 1 147 ? 33.527 -12.791 5.014   1.00 16.89 ? 147 PHE A O   1 
ATOM   1058 C  CB  . PHE A 1 147 ? 32.497 -13.176 2.047   1.00 17.76 ? 147 PHE A CB  1 
ATOM   1059 C  CG  . PHE A 1 147 ? 32.669 -14.192 0.939   1.00 20.05 ? 147 PHE A CG  1 
ATOM   1060 C  CD1 . PHE A 1 147 ? 31.576 -14.620 0.182   1.00 18.97 ? 147 PHE A CD1 1 
ATOM   1061 C  CD2 . PHE A 1 147 ? 33.931 -14.713 0.645   1.00 21.06 ? 147 PHE A CD2 1 
ATOM   1062 C  CE1 . PHE A 1 147 ? 31.738 -15.546 -0.848  1.00 20.35 ? 147 PHE A CE1 1 
ATOM   1063 C  CE2 . PHE A 1 147 ? 34.100 -15.641 -0.386  1.00 21.34 ? 147 PHE A CE2 1 
ATOM   1064 C  CZ  . PHE A 1 147 ? 33.004 -16.057 -1.131  1.00 21.75 ? 147 PHE A CZ  1 
ATOM   1065 N  N   . LEU A 1 148 ? 31.418 -11.985 4.917   1.00 17.89 ? 148 LEU A N   1 
ATOM   1066 C  CA  . LEU A 1 148 ? 31.591 -10.959 5.941   1.00 18.34 ? 148 LEU A CA  1 
ATOM   1067 C  C   . LEU A 1 148 ? 31.391 -11.373 7.394   1.00 19.03 ? 148 LEU A C   1 
ATOM   1068 O  O   . LEU A 1 148 ? 32.025 -10.802 8.278   1.00 18.72 ? 148 LEU A O   1 
ATOM   1069 C  CB  . LEU A 1 148 ? 30.662 -9.787  5.635   1.00 17.57 ? 148 LEU A CB  1 
ATOM   1070 C  CG  . LEU A 1 148 ? 30.884 -9.078  4.300   1.00 16.45 ? 148 LEU A CG  1 
ATOM   1071 C  CD1 . LEU A 1 148 ? 29.748 -8.101  4.028   1.00 14.41 ? 148 LEU A CD1 1 
ATOM   1072 C  CD2 . LEU A 1 148 ? 32.222 -8.355  4.338   1.00 15.97 ? 148 LEU A CD2 1 
ATOM   1073 N  N   . LEU A 1 149 ? 30.515 -12.348 7.650   1.00 19.66 ? 149 LEU A N   1 
ATOM   1074 C  CA  . LEU A 1 149 ? 30.239 -12.798 9.022   1.00 20.08 ? 149 LEU A CA  1 
ATOM   1075 C  C   . LEU A 1 149 ? 31.307 -13.700 9.648   1.00 18.78 ? 149 LEU A C   1 
ATOM   1076 O  O   . LEU A 1 149 ? 31.705 -14.702 9.066   1.00 18.65 ? 149 LEU A O   1 
ATOM   1077 C  CB  . LEU A 1 149 ? 28.876 -13.513 9.100   1.00 19.38 ? 149 LEU A CB  1 
ATOM   1078 C  CG  . LEU A 1 149 ? 27.610 -12.670 8.916   1.00 20.80 ? 149 LEU A CG  1 
ATOM   1079 C  CD1 . LEU A 1 149 ? 26.379 -13.562 9.027   1.00 21.36 ? 149 LEU A CD1 1 
ATOM   1080 C  CD2 . LEU A 1 149 ? 27.568 -11.566 9.953   1.00 20.88 ? 149 LEU A CD2 1 
ATOM   1081 N  N   . LYS A 1 150 ? 31.740 -13.333 10.854  1.00 19.72 ? 150 LYS A N   1 
ATOM   1082 C  CA  . LYS A 1 150 ? 32.753 -14.072 11.615  1.00 19.89 ? 150 LYS A CA  1 
ATOM   1083 C  C   . LYS A 1 150 ? 32.354 -15.511 12.006  1.00 20.02 ? 150 LYS A C   1 
ATOM   1084 O  O   . LYS A 1 150 ? 33.196 -16.408 12.013  1.00 18.90 ? 150 LYS A O   1 
ATOM   1085 C  CB  . LYS A 1 150 ? 33.093 -13.307 12.900  1.00 21.05 ? 150 LYS A CB  1 
ATOM   1086 C  CG  . LYS A 1 150 ? 33.713 -11.917 12.732  1.00 18.63 ? 150 LYS A CG  1 
ATOM   1087 C  CD  . LYS A 1 150 ? 33.862 -11.262 14.111  1.00 20.12 ? 150 LYS A CD  1 
ATOM   1088 C  CE  . LYS A 1 150 ? 34.401 -9.840  14.040  1.00 21.17 ? 150 LYS A CE  1 
ATOM   1089 N  NZ  . LYS A 1 150 ? 34.322 -9.139  15.363  1.00 23.29 ? 150 LYS A NZ  1 
ATOM   1090 N  N   . GLU A 1 151 ? 31.082 -15.710 12.357  1.00 19.33 ? 151 GLU A N   1 
ATOM   1091 C  CA  . GLU A 1 151 ? 30.572 -17.022 12.766  1.00 21.12 ? 151 GLU A CA  1 
ATOM   1092 C  C   . GLU A 1 151 ? 30.520 -18.014 11.620  1.00 21.11 ? 151 GLU A C   1 
ATOM   1093 O  O   . GLU A 1 151 ? 30.593 -19.223 11.834  1.00 21.54 ? 151 GLU A O   1 
ATOM   1094 C  CB  . GLU A 1 151 ? 29.166 -16.907 13.381  1.00 20.34 ? 151 GLU A CB  1 
ATOM   1095 C  CG  . GLU A 1 151 ? 29.119 -16.134 14.676  1.00 19.89 ? 151 GLU A CG  1 
ATOM   1096 C  CD  . GLU A 1 151 ? 29.039 -14.628 14.455  1.00 19.86 ? 151 GLU A CD  1 
ATOM   1097 O  OE1 . GLU A 1 151 ? 29.230 -14.182 13.299  1.00 16.60 ? 151 GLU A OE1 1 
ATOM   1098 O  OE2 . GLU A 1 151 ? 28.788 -13.895 15.441  1.00 20.83 ? 151 GLU A OE2 1 
ATOM   1099 N  N   . LEU A 1 152 ? 30.381 -17.499 10.406  1.00 22.64 ? 152 LEU A N   1 
ATOM   1100 C  CA  . LEU A 1 152 ? 30.331 -18.349 9.228   1.00 24.24 ? 152 LEU A CA  1 
ATOM   1101 C  C   . LEU A 1 152 ? 31.755 -18.613 8.737   1.00 25.87 ? 152 LEU A C   1 
ATOM   1102 O  O   . LEU A 1 152 ? 31.977 -18.968 7.583   1.00 26.82 ? 152 LEU A O   1 
ATOM   1103 C  CB  . LEU A 1 152 ? 29.471 -17.683 8.145   1.00 23.81 ? 152 LEU A CB  1 
ATOM   1104 C  CG  . LEU A 1 152 ? 28.184 -18.406 7.692   1.00 24.41 ? 152 LEU A CG  1 
ATOM   1105 C  CD1 . LEU A 1 152 ? 27.620 -19.303 8.800   1.00 22.59 ? 152 LEU A CD1 1 
ATOM   1106 C  CD2 . LEU A 1 152 ? 27.155 -17.358 7.242   1.00 22.06 ? 152 LEU A CD2 1 
ATOM   1107 N  N   . LYS A 1 153 ? 32.722 -18.437 9.633   1.00 27.41 ? 153 LYS A N   1 
ATOM   1108 C  CA  . LYS A 1 153 ? 34.118 -18.688 9.306   1.00 29.83 ? 153 LYS A CA  1 
ATOM   1109 C  C   . LYS A 1 153 ? 34.299 -20.196 9.469   1.00 30.67 ? 153 LYS A C   1 
ATOM   1110 O  O   . LYS A 1 153 ? 33.817 -20.786 10.444  1.00 31.26 ? 153 LYS A O   1 
ATOM   1111 C  CB  . LYS A 1 153 ? 35.049 -17.919 10.258  1.00 30.56 ? 153 LYS A CB  1 
ATOM   1112 C  CG  . LYS A 1 153 ? 36.459 -17.688 9.701   1.00 30.71 ? 153 LYS A CG  1 
ATOM   1113 C  CD  . LYS A 1 153 ? 37.177 -16.570 10.446  1.00 31.33 ? 153 LYS A CD  1 
ATOM   1114 C  CE  . LYS A 1 153 ? 38.493 -16.202 9.779   1.00 32.64 ? 153 LYS A CE  1 
ATOM   1115 N  NZ  . LYS A 1 153 ? 39.065 -14.940 10.338  1.00 32.69 ? 153 LYS A NZ  1 
ATOM   1116 N  N   . GLY A 1 154 ? 34.969 -20.818 8.503   1.00 31.33 ? 154 GLY A N   1 
ATOM   1117 C  CA  . GLY A 1 154 ? 35.157 -22.255 8.554   1.00 30.55 ? 154 GLY A CA  1 
ATOM   1118 C  C   . GLY A 1 154 ? 34.113 -22.963 7.709   1.00 30.35 ? 154 GLY A C   1 
ATOM   1119 O  O   . GLY A 1 154 ? 34.153 -24.181 7.552   1.00 30.17 ? 154 GLY A O   1 
ATOM   1120 N  N   . LYS A 1 155 ? 33.172 -22.201 7.160   1.00 30.55 ? 155 LYS A N   1 
ATOM   1121 C  CA  . LYS A 1 155 ? 32.124 -22.776 6.330   1.00 30.57 ? 155 LYS A CA  1 
ATOM   1122 C  C   . LYS A 1 155 ? 32.144 -22.257 4.898   1.00 30.35 ? 155 LYS A C   1 
ATOM   1123 O  O   . LYS A 1 155 ? 31.341 -22.668 4.067   1.00 29.55 ? 155 LYS A O   1 
ATOM   1124 C  CB  . LYS A 1 155 ? 30.753 -22.545 6.972   1.00 31.41 ? 155 LYS A CB  1 
ATOM   1125 C  CG  . LYS A 1 155 ? 30.263 -23.757 7.740   1.00 31.15 ? 155 LYS A CG  1 
ATOM   1126 C  CD  . LYS A 1 155 ? 29.960 -24.893 6.773   1.00 32.45 ? 155 LYS A CD  1 
ATOM   1127 C  CE  . LYS A 1 155 ? 30.270 -26.247 7.369   1.00 33.30 ? 155 LYS A CE  1 
ATOM   1128 N  NZ  . LYS A 1 155 ? 31.723 -26.492 7.506   1.00 36.10 ? 155 LYS A NZ  1 
ATOM   1129 N  N   . ILE A 1 156 ? 33.066 -21.347 4.618   1.00 30.77 ? 156 ILE A N   1 
ATOM   1130 C  CA  . ILE A 1 156 ? 33.234 -20.793 3.278   1.00 31.12 ? 156 ILE A CA  1 
ATOM   1131 C  C   . ILE A 1 156 ? 34.601 -21.259 2.769   1.00 31.52 ? 156 ILE A C   1 
ATOM   1132 O  O   . ILE A 1 156 ? 35.628 -21.014 3.418   1.00 31.56 ? 156 ILE A O   1 
ATOM   1133 C  CB  . ILE A 1 156 ? 33.210 -19.234 3.283   1.00 30.77 ? 156 ILE A CB  1 
ATOM   1134 C  CG1 . ILE A 1 156 ? 31.768 -18.726 3.380   1.00 29.76 ? 156 ILE A CG1 1 
ATOM   1135 C  CG2 . ILE A 1 156 ? 33.867 -18.683 2.008   1.00 30.44 ? 156 ILE A CG2 1 
ATOM   1136 C  CD1 . ILE A 1 156 ? 31.074 -19.055 4.681   1.00 27.77 ? 156 ILE A CD1 1 
ATOM   1137 N  N   . PRO A 1 157 ? 34.634 -21.948 1.612   1.00 30.22 ? 157 PRO A N   1 
ATOM   1138 C  CA  . PRO A 1 157 ? 35.921 -22.419 1.076   1.00 29.92 ? 157 PRO A CA  1 
ATOM   1139 C  C   . PRO A 1 157 ? 36.832 -21.302 0.534   1.00 29.70 ? 157 PRO A C   1 
ATOM   1140 O  O   . PRO A 1 157 ? 36.375 -20.175 0.319   1.00 31.13 ? 157 PRO A O   1 
ATOM   1141 C  CB  . PRO A 1 157 ? 35.500 -23.438 0.010   1.00 28.62 ? 157 PRO A CB  1 
ATOM   1142 C  CG  . PRO A 1 157 ? 34.142 -22.975 -0.407  1.00 29.31 ? 157 PRO A CG  1 
ATOM   1143 C  CD  . PRO A 1 157 ? 33.501 -22.545 0.881   1.00 29.34 ? 157 PRO A CD  1 
ATOM   1144 N  N   . ASP A 1 158 ? 38.115 -21.606 0.327   1.00 28.74 ? 158 ASP A N   1 
ATOM   1145 C  CA  . ASP A 1 158 ? 39.060 -20.609 -0.183  1.00 28.37 ? 158 ASP A CA  1 
ATOM   1146 C  C   . ASP A 1 158 ? 38.773 -20.223 -1.638  1.00 27.53 ? 158 ASP A C   1 
ATOM   1147 O  O   . ASP A 1 158 ? 39.309 -20.837 -2.561  1.00 27.44 ? 158 ASP A O   1 
ATOM   1148 C  CB  . ASP A 1 158 ? 40.511 -21.113 -0.073  1.00 28.80 ? 158 ASP A CB  1 
ATOM   1149 C  CG  . ASP A 1 158 ? 41.041 -21.107 1.362   1.00 31.03 ? 158 ASP A CG  1 
ATOM   1150 O  OD1 . ASP A 1 158 ? 40.605 -20.246 2.160   1.00 31.83 ? 158 ASP A OD1 1 
ATOM   1151 O  OD2 . ASP A 1 158 ? 41.909 -21.951 1.691   1.00 29.80 ? 158 ASP A OD2 1 
ATOM   1152 N  N   . VAL A 1 159 ? 37.943 -19.197 -1.839  1.00 26.76 ? 159 VAL A N   1 
ATOM   1153 C  CA  . VAL A 1 159 ? 37.595 -18.748 -3.190  1.00 24.13 ? 159 VAL A CA  1 
ATOM   1154 C  C   . VAL A 1 159 ? 38.700 -17.876 -3.768  1.00 22.60 ? 159 VAL A C   1 
ATOM   1155 O  O   . VAL A 1 159 ? 39.001 -16.806 -3.236  1.00 23.69 ? 159 VAL A O   1 
ATOM   1156 C  CB  . VAL A 1 159 ? 36.302 -17.900 -3.220  1.00 24.37 ? 159 VAL A CB  1 
ATOM   1157 C  CG1 . VAL A 1 159 ? 35.752 -17.856 -4.631  1.00 22.83 ? 159 VAL A CG1 1 
ATOM   1158 C  CG2 . VAL A 1 159 ? 35.274 -18.449 -2.259  1.00 24.49 ? 159 VAL A CG2 1 
ATOM   1159 N  N   . PRO A 1 160 ? 39.324 -18.323 -4.864  1.00 20.76 ? 160 PRO A N   1 
ATOM   1160 C  CA  . PRO A 1 160 ? 40.392 -17.538 -5.479  1.00 20.11 ? 160 PRO A CA  1 
ATOM   1161 C  C   . PRO A 1 160 ? 39.929 -16.095 -5.661  1.00 20.38 ? 160 PRO A C   1 
ATOM   1162 O  O   . PRO A 1 160 ? 38.872 -15.838 -6.246  1.00 18.97 ? 160 PRO A O   1 
ATOM   1163 C  CB  . PRO A 1 160 ? 40.616 -18.249 -6.806  1.00 21.73 ? 160 PRO A CB  1 
ATOM   1164 C  CG  . PRO A 1 160 ? 40.346 -19.684 -6.449  1.00 22.02 ? 160 PRO A CG  1 
ATOM   1165 C  CD  . PRO A 1 160 ? 39.108 -19.588 -5.587  1.00 21.65 ? 160 PRO A CD  1 
ATOM   1166 N  N   . GLY A 1 161 ? 40.719 -15.160 -5.140  1.00 18.85 ? 161 GLY A N   1 
ATOM   1167 C  CA  . GLY A 1 161 ? 40.365 -13.762 -5.243  1.00 18.75 ? 161 GLY A CA  1 
ATOM   1168 C  C   . GLY A 1 161 ? 39.769 -13.200 -3.968  1.00 18.22 ? 161 GLY A C   1 
ATOM   1169 O  O   . GLY A 1 161 ? 39.509 -12.011 -3.894  1.00 18.17 ? 161 GLY A O   1 
ATOM   1170 N  N   . PHE A 1 162 ? 39.547 -14.037 -2.960  1.00 18.67 ? 162 PHE A N   1 
ATOM   1171 C  CA  . PHE A 1 162 ? 38.977 -13.541 -1.713  1.00 19.13 ? 162 PHE A CA  1 
ATOM   1172 C  C   . PHE A 1 162 ? 39.875 -13.790 -0.503  1.00 21.01 ? 162 PHE A C   1 
ATOM   1173 O  O   . PHE A 1 162 ? 39.490 -13.510 0.635   1.00 21.44 ? 162 PHE A O   1 
ATOM   1174 C  CB  . PHE A 1 162 ? 37.604 -14.168 -1.458  1.00 19.04 ? 162 PHE A CB  1 
ATOM   1175 C  CG  . PHE A 1 162 ? 36.606 -13.935 -2.561  1.00 19.42 ? 162 PHE A CG  1 
ATOM   1176 C  CD1 . PHE A 1 162 ? 36.626 -14.716 -3.714  1.00 19.34 ? 162 PHE A CD1 1 
ATOM   1177 C  CD2 . PHE A 1 162 ? 35.627 -12.958 -2.433  1.00 20.11 ? 162 PHE A CD2 1 
ATOM   1178 C  CE1 . PHE A 1 162 ? 35.679 -14.533 -4.725  1.00 19.62 ? 162 PHE A CE1 1 
ATOM   1179 C  CE2 . PHE A 1 162 ? 34.672 -12.764 -3.442  1.00 19.40 ? 162 PHE A CE2 1 
ATOM   1180 C  CZ  . PHE A 1 162 ? 34.701 -13.557 -4.588  1.00 18.80 ? 162 PHE A CZ  1 
ATOM   1181 N  N   . SER A 1 163 ? 41.074 -14.308 -0.743  1.00 22.21 ? 163 SER A N   1 
ATOM   1182 C  CA  . SER A 1 163 ? 42.001 -14.582 0.348   1.00 23.48 ? 163 SER A CA  1 
ATOM   1183 C  C   . SER A 1 163 ? 42.192 -13.353 1.234   1.00 23.89 ? 163 SER A C   1 
ATOM   1184 O  O   . SER A 1 163 ? 42.332 -13.474 2.456   1.00 25.86 ? 163 SER A O   1 
ATOM   1185 C  CB  . SER A 1 163 ? 43.355 -15.043 -0.205  1.00 22.96 ? 163 SER A CB  1 
ATOM   1186 O  OG  . SER A 1 163 ? 43.938 -14.060 -1.044  1.00 24.77 ? 163 SER A OG  1 
ATOM   1187 N  N   . TRP A 1 164 ? 42.179 -12.176 0.614   1.00 22.23 ? 164 TRP A N   1 
ATOM   1188 C  CA  . TRP A 1 164 ? 42.356 -10.905 1.313   1.00 20.22 ? 164 TRP A CA  1 
ATOM   1189 C  C   . TRP A 1 164 ? 41.289 -10.622 2.370   1.00 21.21 ? 164 TRP A C   1 
ATOM   1190 O  O   . TRP A 1 164 ? 41.518 -9.834  3.292   1.00 20.49 ? 164 TRP A O   1 
ATOM   1191 C  CB  . TRP A 1 164 ? 42.349 -9.748  0.308   1.00 19.40 ? 164 TRP A CB  1 
ATOM   1192 C  CG  . TRP A 1 164 ? 41.030 -9.582  -0.414  1.00 18.35 ? 164 TRP A CG  1 
ATOM   1193 C  CD1 . TRP A 1 164 ? 40.634 -10.214 -1.558  1.00 17.35 ? 164 TRP A CD1 1 
ATOM   1194 C  CD2 . TRP A 1 164 ? 39.921 -8.774  0.001   1.00 17.11 ? 164 TRP A CD2 1 
ATOM   1195 N  NE1 . TRP A 1 164 ? 39.348 -9.851  -1.881  1.00 17.09 ? 164 TRP A NE1 1 
ATOM   1196 C  CE2 . TRP A 1 164 ? 38.887 -8.970  -0.940  1.00 18.33 ? 164 TRP A CE2 1 
ATOM   1197 C  CE3 . TRP A 1 164 ? 39.701 -7.905  1.079   1.00 16.54 ? 164 TRP A CE3 1 
ATOM   1198 C  CZ2 . TRP A 1 164 ? 37.646 -8.327  -0.834  1.00 17.66 ? 164 TRP A CZ2 1 
ATOM   1199 C  CZ3 . TRP A 1 164 ? 38.470 -7.265  1.183   1.00 17.50 ? 164 TRP A CZ3 1 
ATOM   1200 C  CH2 . TRP A 1 164 ? 37.460 -7.480  0.231   1.00 16.73 ? 164 TRP A CH2 1 
ATOM   1201 N  N   . VAL A 1 165 ? 40.129 -11.260 2.219   1.00 20.63 ? 165 VAL A N   1 
ATOM   1202 C  CA  . VAL A 1 165 ? 38.999 -11.075 3.120   1.00 20.50 ? 165 VAL A CA  1 
ATOM   1203 C  C   . VAL A 1 165 ? 39.201 -11.626 4.505   1.00 20.69 ? 165 VAL A C   1 
ATOM   1204 O  O   . VAL A 1 165 ? 39.821 -12.662 4.703   1.00 21.82 ? 165 VAL A O   1 
ATOM   1205 C  CB  . VAL A 1 165 ? 37.704 -11.734 2.563   1.00 19.86 ? 165 VAL A CB  1 
ATOM   1206 C  CG1 . VAL A 1 165 ? 36.523 -11.412 3.474   1.00 19.41 ? 165 VAL A CG1 1 
ATOM   1207 C  CG2 . VAL A 1 165 ? 37.442 -11.262 1.155   1.00 17.89 ? 165 VAL A CG2 1 
ATOM   1208 N  N   . THR A 1 166 ? 38.640 -10.912 5.467   1.00 22.15 ? 166 THR A N   1 
ATOM   1209 C  CA  . THR A 1 166 ? 38.693 -11.298 6.862   1.00 21.61 ? 166 THR A CA  1 
ATOM   1210 C  C   . THR A 1 166 ? 37.316 -10.937 7.375   1.00 20.73 ? 166 THR A C   1 
ATOM   1211 O  O   . THR A 1 166 ? 36.940 -9.767  7.369   1.00 19.94 ? 166 THR A O   1 
ATOM   1212 C  CB  . THR A 1 166 ? 39.753 -10.480 7.640   1.00 23.55 ? 166 THR A CB  1 
ATOM   1213 O  OG1 . THR A 1 166 ? 41.036 -10.647 7.022   1.00 26.00 ? 166 THR A OG1 1 
ATOM   1214 C  CG2 . THR A 1 166 ? 39.832 -10.941 9.087   1.00 22.00 ? 166 THR A CG2 1 
ATOM   1215 N  N   . PRO A 1 167 ? 36.529 -11.937 7.793   1.00 20.92 ? 167 PRO A N   1 
ATOM   1216 C  CA  . PRO A 1 167 ? 35.180 -11.675 8.310   1.00 22.22 ? 167 PRO A CA  1 
ATOM   1217 C  C   . PRO A 1 167 ? 35.229 -10.518 9.315   1.00 22.17 ? 167 PRO A C   1 
ATOM   1218 O  O   . PRO A 1 167 ? 35.952 -10.592 10.302  1.00 22.02 ? 167 PRO A O   1 
ATOM   1219 C  CB  . PRO A 1 167 ? 34.811 -13.002 8.960   1.00 23.16 ? 167 PRO A CB  1 
ATOM   1220 C  CG  . PRO A 1 167 ? 35.482 -13.995 8.063   1.00 23.44 ? 167 PRO A CG  1 
ATOM   1221 C  CD  . PRO A 1 167 ? 36.844 -13.373 7.845   1.00 22.10 ? 167 PRO A CD  1 
ATOM   1222 N  N   . CYS A 1 168 ? 34.463 -9.457  9.070   1.00 23.01 ? 168 CYS A N   1 
ATOM   1223 C  CA  . CYS A 1 168 ? 34.500 -8.292  9.955   1.00 23.69 ? 168 CYS A CA  1 
ATOM   1224 C  C   . CYS A 1 168 ? 33.291 -8.049  10.847  1.00 23.32 ? 168 CYS A C   1 
ATOM   1225 O  O   . CYS A 1 168 ? 33.435 -7.521  11.946  1.00 24.75 ? 168 CYS A O   1 
ATOM   1226 C  CB  . CYS A 1 168 ? 34.805 -7.020  9.144   1.00 24.46 ? 168 CYS A CB  1 
ATOM   1227 S  SG  . CYS A 1 168 ? 33.652 -6.633  7.796   1.00 27.67 ? 168 CYS A SG  1 
ATOM   1228 N  N   . ILE A 1 169 ? 32.098 -8.409  10.398  1.00 22.65 ? 169 ILE A N   1 
ATOM   1229 C  CA  . ILE A 1 169 ? 30.943 -8.196  11.254  1.00 22.29 ? 169 ILE A CA  1 
ATOM   1230 C  C   . ILE A 1 169 ? 30.403 -9.538  11.730  1.00 22.03 ? 169 ILE A C   1 
ATOM   1231 O  O   . ILE A 1 169 ? 30.458 -10.538 11.010  1.00 19.89 ? 169 ILE A O   1 
ATOM   1232 C  CB  . ILE A 1 169 ? 29.815 -7.360  10.546  1.00 22.16 ? 169 ILE A CB  1 
ATOM   1233 C  CG1 . ILE A 1 169 ? 28.906 -8.248  9.693   1.00 23.33 ? 169 ILE A CG1 1 
ATOM   1234 C  CG2 . ILE A 1 169 ? 30.437 -6.278  9.674   1.00 20.71 ? 169 ILE A CG2 1 
ATOM   1235 C  CD1 . ILE A 1 169 ? 29.576 -8.858  8.503   1.00 22.45 ? 169 ILE A CD1 1 
ATOM   1236 N  N   . SER A 1 170 ? 29.924 -9.565  12.970  1.00 21.96 ? 170 SER A N   1 
ATOM   1237 C  CA  . SER A 1 170 ? 29.357 -10.780 13.538  1.00 22.44 ? 170 SER A CA  1 
ATOM   1238 C  C   . SER A 1 170 ? 27.836 -10.783 13.323  1.00 21.84 ? 170 SER A C   1 
ATOM   1239 O  O   . SER A 1 170 ? 27.217 -9.725  13.205  1.00 19.20 ? 170 SER A O   1 
ATOM   1240 C  CB  . SER A 1 170 ? 29.697 -10.872 15.028  1.00 23.05 ? 170 SER A CB  1 
ATOM   1241 O  OG  . SER A 1 170 ? 29.664 -9.595  15.639  1.00 26.63 ? 170 SER A OG  1 
ATOM   1242 N  N   . ALA A 1 171 ? 27.252 -11.977 13.268  1.00 20.57 ? 171 ALA A N   1 
ATOM   1243 C  CA  . ALA A 1 171 ? 25.819 -12.155 13.054  1.00 21.16 ? 171 ALA A CA  1 
ATOM   1244 C  C   . ALA A 1 171 ? 24.944 -11.258 13.927  1.00 21.65 ? 171 ALA A C   1 
ATOM   1245 O  O   . ALA A 1 171 ? 23.797 -10.979 13.574  1.00 20.72 ? 171 ALA A O   1 
ATOM   1246 C  CB  . ALA A 1 171 ? 25.438 -13.629 13.274  1.00 20.23 ? 171 ALA A CB  1 
ATOM   1247 N  N   . LYS A 1 172 ? 25.487 -10.803 15.057  1.00 22.45 ? 172 LYS A N   1 
ATOM   1248 C  CA  . LYS A 1 172 ? 24.740 -9.942  15.980  1.00 22.02 ? 172 LYS A CA  1 
ATOM   1249 C  C   . LYS A 1 172 ? 24.644 -8.470  15.543  1.00 22.13 ? 172 LYS A C   1 
ATOM   1250 O  O   . LYS A 1 172 ? 23.776 -7.739  16.026  1.00 23.64 ? 172 LYS A O   1 
ATOM   1251 C  CB  . LYS A 1 172 ? 25.377 -9.982  17.375  1.00 21.62 ? 172 LYS A CB  1 
ATOM   1252 C  CG  . LYS A 1 172 ? 26.609 -9.070  17.521  1.00 23.86 ? 172 LYS A CG  1 
ATOM   1253 C  CD  . LYS A 1 172 ? 27.027 -8.904  18.974  1.00 25.58 ? 172 LYS A CD  1 
ATOM   1254 C  CE  . LYS A 1 172 ? 28.030 -7.759  19.174  1.00 27.96 ? 172 LYS A CE  1 
ATOM   1255 N  NZ  . LYS A 1 172 ? 29.386 -8.014  18.603  1.00 28.30 ? 172 LYS A NZ  1 
ATOM   1256 N  N   . ASP A 1 173 ? 25.524 -8.047  14.632  1.00 21.22 ? 173 ASP A N   1 
ATOM   1257 C  CA  . ASP A 1 173 ? 25.589 -6.653  14.182  1.00 19.66 ? 173 ASP A CA  1 
ATOM   1258 C  C   . ASP A 1 173 ? 24.895 -6.319  12.871  1.00 17.98 ? 173 ASP A C   1 
ATOM   1259 O  O   . ASP A 1 173 ? 25.200 -5.299  12.264  1.00 17.96 ? 173 ASP A O   1 
ATOM   1260 C  CB  . ASP A 1 173 ? 27.049 -6.214  14.044  1.00 20.32 ? 173 ASP A CB  1 
ATOM   1261 C  CG  . ASP A 1 173 ? 27.904 -6.655  15.203  1.00 22.62 ? 173 ASP A CG  1 
ATOM   1262 O  OD1 . ASP A 1 173 ? 27.471 -6.478  16.363  1.00 20.65 ? 173 ASP A OD1 1 
ATOM   1263 O  OD2 . ASP A 1 173 ? 29.019 -7.165  14.939  1.00 24.67 ? 173 ASP A OD2 1 
ATOM   1264 N  N   . ILE A 1 174 ? 23.973 -7.161  12.432  1.00 17.53 ? 174 ILE A N   1 
ATOM   1265 C  CA  . ILE A 1 174 ? 23.286 -6.910  11.181  1.00 14.63 ? 174 ILE A CA  1 
ATOM   1266 C  C   . ILE A 1 174 ? 21.774 -7.187  11.275  1.00 14.10 ? 174 ILE A C   1 
ATOM   1267 O  O   . ILE A 1 174 ? 21.325 -8.085  11.990  1.00 13.42 ? 174 ILE A O   1 
ATOM   1268 C  CB  . ILE A 1 174 ? 23.941 -7.750  10.042  1.00 14.39 ? 174 ILE A CB  1 
ATOM   1269 C  CG1 . ILE A 1 174 ? 23.300 -7.413  8.687   1.00 15.26 ? 174 ILE A CG1 1 
ATOM   1270 C  CG2 . ILE A 1 174 ? 23.837 -9.232  10.363  1.00 15.04 ? 174 ILE A CG2 1 
ATOM   1271 C  CD1 . ILE A 1 174 ? 23.994 -8.063  7.493   1.00 16.89 ? 174 ILE A CD1 1 
ATOM   1272 N  N   . VAL A 1 175 ? 20.995 -6.383  10.563  1.00 13.70 ? 175 VAL A N   1 
ATOM   1273 C  CA  . VAL A 1 175 ? 19.545 -6.524  10.532  1.00 12.39 ? 175 VAL A CA  1 
ATOM   1274 C  C   . VAL A 1 175 ? 19.090 -6.511  9.074   1.00 11.95 ? 175 VAL A C   1 
ATOM   1275 O  O   . VAL A 1 175 ? 19.528 -5.676  8.302   1.00 11.65 ? 175 VAL A O   1 
ATOM   1276 C  CB  . VAL A 1 175 ? 18.829 -5.348  11.244  1.00 9.32  ? 175 VAL A CB  1 
ATOM   1277 C  CG1 . VAL A 1 175 ? 17.314 -5.570  11.210  1.00 9.38  ? 175 VAL A CG1 1 
ATOM   1278 C  CG2 . VAL A 1 175 ? 19.326 -5.205  12.682  1.00 9.53  ? 175 VAL A CG2 1 
ATOM   1279 N  N   . TYR A 1 176 ? 18.225 -7.445  8.705   1.00 12.25 ? 176 TYR A N   1 
ATOM   1280 C  CA  . TYR A 1 176 ? 17.700 -7.496  7.347   1.00 12.28 ? 176 TYR A CA  1 
ATOM   1281 C  C   . TYR A 1 176 ? 16.302 -6.882  7.384   1.00 10.73 ? 176 TYR A C   1 
ATOM   1282 O  O   . TYR A 1 176 ? 15.596 -7.022  8.378   1.00 12.11 ? 176 TYR A O   1 
ATOM   1283 C  CB  . TYR A 1 176 ? 17.564 -8.941  6.855   1.00 12.29 ? 176 TYR A CB  1 
ATOM   1284 C  CG  . TYR A 1 176 ? 18.848 -9.670  6.520   1.00 12.34 ? 176 TYR A CG  1 
ATOM   1285 C  CD1 . TYR A 1 176 ? 19.602 -9.331  5.390   1.00 12.58 ? 176 TYR A CD1 1 
ATOM   1286 C  CD2 . TYR A 1 176 ? 19.262 -10.759 7.290   1.00 12.94 ? 176 TYR A CD2 1 
ATOM   1287 C  CE1 . TYR A 1 176 ? 20.742 -10.074 5.029   1.00 14.15 ? 176 TYR A CE1 1 
ATOM   1288 C  CE2 . TYR A 1 176 ? 20.387 -11.507 6.946   1.00 14.98 ? 176 TYR A CE2 1 
ATOM   1289 C  CZ  . TYR A 1 176 ? 21.123 -11.168 5.817   1.00 15.98 ? 176 TYR A CZ  1 
ATOM   1290 O  OH  . TYR A 1 176 ? 22.214 -11.940 5.478   1.00 14.39 ? 176 TYR A OH  1 
ATOM   1291 N  N   . ILE A 1 177 ? 15.919 -6.181  6.321   1.00 10.82 ? 177 ILE A N   1 
ATOM   1292 C  CA  . ILE A 1 177 ? 14.575 -5.605  6.221   1.00 10.31 ? 177 ILE A CA  1 
ATOM   1293 C  C   . ILE A 1 177 ? 14.052 -5.845  4.801   1.00 9.55  ? 177 ILE A C   1 
ATOM   1294 O  O   . ILE A 1 177 ? 14.726 -5.501  3.828   1.00 12.27 ? 177 ILE A O   1 
ATOM   1295 C  CB  . ILE A 1 177 ? 14.540 -4.064  6.486   1.00 12.77 ? 177 ILE A CB  1 
ATOM   1296 C  CG1 . ILE A 1 177 ? 15.009 -3.744  7.909   1.00 13.52 ? 177 ILE A CG1 1 
ATOM   1297 C  CG2 . ILE A 1 177 ? 13.109 -3.529  6.285   1.00 11.54 ? 177 ILE A CG2 1 
ATOM   1298 C  CD1 . ILE A 1 177 ? 16.506 -3.840  8.106   1.00 14.70 ? 177 ILE A CD1 1 
ATOM   1299 N  N   . GLY A 1 178 ? 12.874 -6.454  4.681   1.00 9.83  ? 178 GLY A N   1 
ATOM   1300 C  CA  . GLY A 1 178 ? 12.291 -6.675  3.364   1.00 8.91  ? 178 GLY A CA  1 
ATOM   1301 C  C   . GLY A 1 178 ? 12.296 -8.066  2.756   1.00 10.36 ? 178 GLY A C   1 
ATOM   1302 O  O   . GLY A 1 178 ? 11.799 -8.246  1.646   1.00 10.98 ? 178 GLY A O   1 
ATOM   1303 N  N   . LEU A 1 179 ? 12.824 -9.052  3.471   1.00 10.01 ? 179 LEU A N   1 
ATOM   1304 C  CA  . LEU A 1 179 ? 12.910 -10.428 2.965   1.00 10.20 ? 179 LEU A CA  1 
ATOM   1305 C  C   . LEU A 1 179 ? 11.605 -11.084 2.494   1.00 11.34 ? 179 LEU A C   1 
ATOM   1306 O  O   . LEU A 1 179 ? 10.539 -10.868 3.071   1.00 11.75 ? 179 LEU A O   1 
ATOM   1307 C  CB  . LEU A 1 179 ? 13.554 -11.321 4.031   1.00 9.01  ? 179 LEU A CB  1 
ATOM   1308 C  CG  . LEU A 1 179 ? 14.820 -10.785 4.700   1.00 9.88  ? 179 LEU A CG  1 
ATOM   1309 C  CD1 . LEU A 1 179 ? 15.262 -11.792 5.763   1.00 12.60 ? 179 LEU A CD1 1 
ATOM   1310 C  CD2 . LEU A 1 179 ? 15.917 -10.532 3.676   1.00 7.99  ? 179 LEU A CD2 1 
ATOM   1311 N  N   . ARG A 1 180 ? 11.704 -11.905 1.449   1.00 12.35 ? 180 ARG A N   1 
ATOM   1312 C  CA  . ARG A 1 180 ? 10.538 -12.618 0.918   1.00 14.48 ? 180 ARG A CA  1 
ATOM   1313 C  C   . ARG A 1 180 ? 10.909 -13.725 -0.087  1.00 14.74 ? 180 ARG A C   1 
ATOM   1314 O  O   . ARG A 1 180 ? 10.041 -14.409 -0.627  1.00 12.31 ? 180 ARG A O   1 
ATOM   1315 C  CB  . ARG A 1 180 ? 9.570  -11.625 0.269   1.00 12.85 ? 180 ARG A CB  1 
ATOM   1316 C  CG  . ARG A 1 180 ? 9.788  -11.422 -1.194  1.00 14.68 ? 180 ARG A CG  1 
ATOM   1317 C  CD  . ARG A 1 180 ? 9.367  -10.047 -1.627  1.00 13.95 ? 180 ARG A CD  1 
ATOM   1318 N  NE  . ARG A 1 180 ? 10.253 -9.052  -1.056  1.00 15.95 ? 180 ARG A NE  1 
ATOM   1319 C  CZ  . ARG A 1 180 ? 10.592 -7.921  -1.663  1.00 11.98 ? 180 ARG A CZ  1 
ATOM   1320 N  NH1 . ARG A 1 180 ? 10.114 -7.644  -2.865  1.00 9.60  ? 180 ARG A NH1 1 
ATOM   1321 N  NH2 . ARG A 1 180 ? 11.426 -7.078  -1.068  1.00 14.26 ? 180 ARG A NH2 1 
ATOM   1322 N  N   . ASP A 1 181 ? 12.209 -13.889 -0.323  1.00 16.98 ? 181 ASP A N   1 
ATOM   1323 C  CA  . ASP A 1 181 ? 12.727 -14.904 -1.242  1.00 16.05 ? 181 ASP A CA  1 
ATOM   1324 C  C   . ASP A 1 181 ? 14.087 -15.368 -0.714  1.00 16.15 ? 181 ASP A C   1 
ATOM   1325 O  O   . ASP A 1 181 ? 15.136 -15.009 -1.257  1.00 14.87 ? 181 ASP A O   1 
ATOM   1326 C  CB  . ASP A 1 181 ? 12.881 -14.318 -2.651  1.00 17.00 ? 181 ASP A CB  1 
ATOM   1327 C  CG  . ASP A 1 181 ? 13.272 -15.358 -3.679  1.00 18.55 ? 181 ASP A CG  1 
ATOM   1328 O  OD1 . ASP A 1 181 ? 13.303 -16.563 -3.343  1.00 19.12 ? 181 ASP A OD1 1 
ATOM   1329 O  OD2 . ASP A 1 181 ? 13.543 -14.967 -4.834  1.00 21.40 ? 181 ASP A OD2 1 
ATOM   1330 N  N   . VAL A 1 182 ? 14.040 -16.176 0.346   1.00 16.15 ? 182 VAL A N   1 
ATOM   1331 C  CA  . VAL A 1 182 ? 15.223 -16.711 1.020   1.00 16.36 ? 182 VAL A CA  1 
ATOM   1332 C  C   . VAL A 1 182 ? 15.334 -18.237 0.839   1.00 16.28 ? 182 VAL A C   1 
ATOM   1333 O  O   . VAL A 1 182 ? 14.381 -18.958 1.112   1.00 17.32 ? 182 VAL A O   1 
ATOM   1334 C  CB  . VAL A 1 182 ? 15.150 -16.355 2.536   1.00 16.81 ? 182 VAL A CB  1 
ATOM   1335 C  CG1 . VAL A 1 182 ? 16.358 -16.933 3.287   1.00 14.32 ? 182 VAL A CG1 1 
ATOM   1336 C  CG2 . VAL A 1 182 ? 15.059 -14.819 2.702   1.00 13.12 ? 182 VAL A CG2 1 
ATOM   1337 N  N   . ASP A 1 183 ? 16.495 -18.716 0.382   1.00 15.83 ? 183 ASP A N   1 
ATOM   1338 C  CA  . ASP A 1 183 ? 16.724 -20.154 0.148   1.00 15.98 ? 183 ASP A CA  1 
ATOM   1339 C  C   . ASP A 1 183 ? 16.699 -20.973 1.444   1.00 16.69 ? 183 ASP A C   1 
ATOM   1340 O  O   . ASP A 1 183 ? 16.844 -20.416 2.543   1.00 16.11 ? 183 ASP A O   1 
ATOM   1341 C  CB  . ASP A 1 183 ? 18.082 -20.388 -0.553  1.00 17.36 ? 183 ASP A CB  1 
ATOM   1342 C  CG  . ASP A 1 183 ? 18.106 -19.908 -2.008  1.00 15.99 ? 183 ASP A CG  1 
ATOM   1343 O  OD1 . ASP A 1 183 ? 17.114 -20.109 -2.742  1.00 16.16 ? 183 ASP A OD1 1 
ATOM   1344 O  OD2 . ASP A 1 183 ? 19.140 -19.347 -2.425  1.00 19.47 ? 183 ASP A OD2 1 
ATOM   1345 N  N   . PRO A 1 184 ? 16.514 -22.306 1.335   1.00 15.15 ? 184 PRO A N   1 
ATOM   1346 C  CA  . PRO A 1 184 ? 16.478 -23.200 2.507   1.00 14.93 ? 184 PRO A CA  1 
ATOM   1347 C  C   . PRO A 1 184 ? 17.749 -23.111 3.384   1.00 13.72 ? 184 PRO A C   1 
ATOM   1348 O  O   . PRO A 1 184 ? 17.675 -23.016 4.619   1.00 14.21 ? 184 PRO A O   1 
ATOM   1349 C  CB  . PRO A 1 184 ? 16.321 -24.589 1.883   1.00 14.86 ? 184 PRO A CB  1 
ATOM   1350 C  CG  . PRO A 1 184 ? 15.590 -24.317 0.613   1.00 14.45 ? 184 PRO A CG  1 
ATOM   1351 C  CD  . PRO A 1 184 ? 16.259 -23.059 0.094   1.00 13.77 ? 184 PRO A CD  1 
ATOM   1352 N  N   . GLY A 1 185 ? 18.915 -23.146 2.748   1.00 13.16 ? 185 GLY A N   1 
ATOM   1353 C  CA  . GLY A 1 185 ? 20.153 -23.068 3.504   1.00 11.40 ? 185 GLY A CA  1 
ATOM   1354 C  C   . GLY A 1 185 ? 20.341 -21.720 4.175   1.00 10.89 ? 185 GLY A C   1 
ATOM   1355 O  O   . GLY A 1 185 ? 20.796 -21.632 5.312   1.00 8.50  ? 185 GLY A O   1 
ATOM   1356 N  N   . GLU A 1 186 ? 20.006 -20.655 3.460   1.00 13.09 ? 186 GLU A N   1 
ATOM   1357 C  CA  . GLU A 1 186 ? 20.126 -19.312 4.021   1.00 14.98 ? 186 GLU A CA  1 
ATOM   1358 C  C   . GLU A 1 186 ? 19.255 -19.190 5.268   1.00 13.31 ? 186 GLU A C   1 
ATOM   1359 O  O   . GLU A 1 186 ? 19.684 -18.619 6.271   1.00 15.49 ? 186 GLU A O   1 
ATOM   1360 C  CB  . GLU A 1 186 ? 19.699 -18.262 2.998   1.00 15.30 ? 186 GLU A CB  1 
ATOM   1361 C  CG  . GLU A 1 186 ? 20.627 -18.122 1.815   1.00 16.24 ? 186 GLU A CG  1 
ATOM   1362 C  CD  . GLU A 1 186 ? 20.130 -17.097 0.820   1.00 16.91 ? 186 GLU A CD  1 
ATOM   1363 O  OE1 . GLU A 1 186 ? 19.062 -17.324 0.214   1.00 17.29 ? 186 GLU A OE1 1 
ATOM   1364 O  OE2 . GLU A 1 186 ? 20.798 -16.064 0.644   1.00 17.81 ? 186 GLU A OE2 1 
ATOM   1365 N  N   . HIS A 1 187 ? 18.036 -19.726 5.199   1.00 13.26 ? 187 HIS A N   1 
ATOM   1366 C  CA  . HIS A 1 187 ? 17.104 -19.673 6.330   1.00 13.20 ? 187 HIS A CA  1 
ATOM   1367 C  C   . HIS A 1 187 ? 17.663 -20.420 7.529   1.00 12.31 ? 187 HIS A C   1 
ATOM   1368 O  O   . HIS A 1 187 ? 17.505 -19.974 8.661   1.00 13.45 ? 187 HIS A O   1 
ATOM   1369 C  CB  . HIS A 1 187 ? 15.737 -20.270 5.965   1.00 12.23 ? 187 HIS A CB  1 
ATOM   1370 C  CG  . HIS A 1 187 ? 14.657 -19.959 6.963   1.00 12.15 ? 187 HIS A CG  1 
ATOM   1371 N  ND1 . HIS A 1 187 ? 13.797 -20.914 7.456   1.00 12.93 ? 187 HIS A ND1 1 
ATOM   1372 C  CD2 . HIS A 1 187 ? 14.288 -18.791 7.540   1.00 12.20 ? 187 HIS A CD2 1 
ATOM   1373 C  CE1 . HIS A 1 187 ? 12.943 -20.351 8.291   1.00 12.56 ? 187 HIS A CE1 1 
ATOM   1374 N  NE2 . HIS A 1 187 ? 13.219 -19.062 8.360   1.00 10.20 ? 187 HIS A NE2 1 
ATOM   1375 N  N   . TYR A 1 188 ? 18.291 -21.566 7.270   1.00 13.74 ? 188 TYR A N   1 
ATOM   1376 C  CA  . TYR A 1 188 ? 18.916 -22.393 8.307   1.00 13.40 ? 188 TYR A CA  1 
ATOM   1377 C  C   . TYR A 1 188 ? 19.978 -21.553 9.027   1.00 13.50 ? 188 TYR A C   1 
ATOM   1378 O  O   . TYR A 1 188 ? 20.069 -21.566 10.257  1.00 12.52 ? 188 TYR A O   1 
ATOM   1379 C  CB  . TYR A 1 188 ? 19.584 -23.620 7.663   1.00 16.82 ? 188 TYR A CB  1 
ATOM   1380 C  CG  . TYR A 1 188 ? 20.442 -24.424 8.612   1.00 17.52 ? 188 TYR A CG  1 
ATOM   1381 C  CD1 . TYR A 1 188 ? 19.864 -25.289 9.538   1.00 18.93 ? 188 TYR A CD1 1 
ATOM   1382 C  CD2 . TYR A 1 188 ? 21.827 -24.265 8.633   1.00 18.51 ? 188 TYR A CD2 1 
ATOM   1383 C  CE1 . TYR A 1 188 ? 20.642 -25.968 10.472  1.00 19.74 ? 188 TYR A CE1 1 
ATOM   1384 C  CE2 . TYR A 1 188 ? 22.616 -24.941 9.564   1.00 20.18 ? 188 TYR A CE2 1 
ATOM   1385 C  CZ  . TYR A 1 188 ? 22.010 -25.783 10.482  1.00 19.59 ? 188 TYR A CZ  1 
ATOM   1386 O  OH  . TYR A 1 188 ? 22.762 -26.392 11.450  1.00 20.03 ? 188 TYR A OH  1 
ATOM   1387 N  N   . ILE A 1 189 ? 20.775 -20.838 8.234   1.00 13.07 ? 189 ILE A N   1 
ATOM   1388 C  CA  . ILE A 1 189 ? 21.836 -19.959 8.726   1.00 14.23 ? 189 ILE A CA  1 
ATOM   1389 C  C   . ILE A 1 189 ? 21.252 -18.843 9.590   1.00 14.47 ? 189 ILE A C   1 
ATOM   1390 O  O   . ILE A 1 189 ? 21.779 -18.544 10.664  1.00 13.57 ? 189 ILE A O   1 
ATOM   1391 C  CB  . ILE A 1 189 ? 22.615 -19.333 7.547   1.00 13.75 ? 189 ILE A CB  1 
ATOM   1392 C  CG1 . ILE A 1 189 ? 23.371 -20.437 6.805   1.00 13.70 ? 189 ILE A CG1 1 
ATOM   1393 C  CG2 . ILE A 1 189 ? 23.555 -18.242 8.052   1.00 14.98 ? 189 ILE A CG2 1 
ATOM   1394 C  CD1 . ILE A 1 189 ? 23.999 -19.993 5.522   1.00 14.50 ? 189 ILE A CD1 1 
ATOM   1395 N  N   . LEU A 1 190 ? 20.163 -18.231 9.123   1.00 14.05 ? 190 LEU A N   1 
ATOM   1396 C  CA  . LEU A 1 190 ? 19.517 -17.164 9.884   1.00 14.84 ? 190 LEU A CA  1 
ATOM   1397 C  C   . LEU A 1 190 ? 19.090 -17.623 11.271  1.00 14.17 ? 190 LEU A C   1 
ATOM   1398 O  O   . LEU A 1 190 ? 19.411 -16.981 12.261  1.00 15.20 ? 190 LEU A O   1 
ATOM   1399 C  CB  . LEU A 1 190 ? 18.272 -16.627 9.163   1.00 14.45 ? 190 LEU A CB  1 
ATOM   1400 C  CG  . LEU A 1 190 ? 18.385 -15.635 8.003   1.00 14.99 ? 190 LEU A CG  1 
ATOM   1401 C  CD1 . LEU A 1 190 ? 16.967 -15.329 7.521   1.00 15.16 ? 190 LEU A CD1 1 
ATOM   1402 C  CD2 . LEU A 1 190 ? 19.109 -14.363 8.420   1.00 13.22 ? 190 LEU A CD2 1 
ATOM   1403 N  N   . LYS A 1 191 ? 18.344 -18.723 11.336  1.00 14.76 ? 191 LYS A N   1 
ATOM   1404 C  CA  . LYS A 1 191 ? 17.850 -19.258 12.605  1.00 14.77 ? 191 LYS A CA  1 
ATOM   1405 C  C   . LYS A 1 191 ? 18.964 -19.812 13.494  1.00 15.93 ? 191 LYS A C   1 
ATOM   1406 O  O   . LYS A 1 191 ? 18.858 -19.781 14.717  1.00 15.53 ? 191 LYS A O   1 
ATOM   1407 C  CB  . LYS A 1 191 ? 16.824 -20.374 12.350  1.00 13.98 ? 191 LYS A CB  1 
ATOM   1408 C  CG  . LYS A 1 191 ? 15.545 -19.955 11.631  1.00 14.07 ? 191 LYS A CG  1 
ATOM   1409 C  CD  . LYS A 1 191 ? 14.647 -19.110 12.524  1.00 17.71 ? 191 LYS A CD  1 
ATOM   1410 C  CE  . LYS A 1 191 ? 13.257 -18.918 11.924  1.00 17.85 ? 191 LYS A CE  1 
ATOM   1411 N  NZ  . LYS A 1 191 ? 12.358 -18.129 12.824  1.00 21.73 ? 191 LYS A NZ  1 
ATOM   1412 N  N   . THR A 1 192 ? 20.020 -20.326 12.868  1.00 17.28 ? 192 THR A N   1 
ATOM   1413 C  CA  . THR A 1 192 ? 21.167 -20.907 13.574  1.00 18.05 ? 192 THR A CA  1 
ATOM   1414 C  C   . THR A 1 192 ? 22.158 -19.859 14.106  1.00 17.66 ? 192 THR A C   1 
ATOM   1415 O  O   . THR A 1 192 ? 22.721 -20.020 15.193  1.00 17.85 ? 192 THR A O   1 
ATOM   1416 C  CB  . THR A 1 192 ? 21.922 -21.910 12.649  1.00 18.10 ? 192 THR A CB  1 
ATOM   1417 O  OG1 . THR A 1 192 ? 21.086 -23.043 12.382  1.00 18.34 ? 192 THR A OG1 1 
ATOM   1418 C  CG2 . THR A 1 192 ? 23.212 -22.389 13.299  1.00 19.66 ? 192 THR A CG2 1 
ATOM   1419 N  N   . LEU A 1 193 ? 22.369 -18.791 13.342  1.00 17.61 ? 193 LEU A N   1 
ATOM   1420 C  CA  . LEU A 1 193 ? 23.272 -17.720 13.746  1.00 17.95 ? 193 LEU A CA  1 
ATOM   1421 C  C   . LEU A 1 193 ? 22.494 -16.643 14.501  1.00 17.92 ? 193 LEU A C   1 
ATOM   1422 O  O   . LEU A 1 193 ? 23.044 -15.607 14.880  1.00 18.29 ? 193 LEU A O   1 
ATOM   1423 C  CB  . LEU A 1 193 ? 23.955 -17.096 12.517  1.00 18.92 ? 193 LEU A CB  1 
ATOM   1424 C  CG  . LEU A 1 193 ? 25.232 -17.688 11.901  1.00 18.45 ? 193 LEU A CG  1 
ATOM   1425 C  CD1 . LEU A 1 193 ? 24.995 -19.086 11.364  1.00 19.56 ? 193 LEU A CD1 1 
ATOM   1426 C  CD2 . LEU A 1 193 ? 25.688 -16.775 10.777  1.00 16.54 ? 193 LEU A CD2 1 
ATOM   1427 N  N   . GLY A 1 194 ? 21.203 -16.893 14.700  1.00 18.78 ? 194 GLY A N   1 
ATOM   1428 C  CA  . GLY A 1 194 ? 20.343 -15.958 15.412  1.00 17.51 ? 194 GLY A CA  1 
ATOM   1429 C  C   . GLY A 1 194 ? 20.291 -14.547 14.847  1.00 17.41 ? 194 GLY A C   1 
ATOM   1430 O  O   . GLY A 1 194 ? 20.222 -13.574 15.603  1.00 16.12 ? 194 GLY A O   1 
ATOM   1431 N  N   . ILE A 1 195 ? 20.309 -14.435 13.521  1.00 14.67 ? 195 ILE A N   1 
ATOM   1432 C  CA  . ILE A 1 195 ? 20.274 -13.137 12.862  1.00 13.76 ? 195 ILE A CA  1 
ATOM   1433 C  C   . ILE A 1 195 ? 18.895 -12.471 12.962  1.00 12.31 ? 195 ILE A C   1 
ATOM   1434 O  O   . ILE A 1 195 ? 17.874 -13.080 12.636  1.00 12.77 ? 195 ILE A O   1 
ATOM   1435 C  CB  . ILE A 1 195 ? 20.680 -13.264 11.357  1.00 11.95 ? 195 ILE A CB  1 
ATOM   1436 C  CG1 . ILE A 1 195 ? 22.097 -13.851 11.248  1.00 12.32 ? 195 ILE A CG1 1 
ATOM   1437 C  CG2 . ILE A 1 195 ? 20.629 -11.883 10.679  1.00 10.53 ? 195 ILE A CG2 1 
ATOM   1438 C  CD1 . ILE A 1 195 ? 22.547 -14.141 9.839   1.00 12.54 ? 195 ILE A CD1 1 
ATOM   1439 N  N   . LYS A 1 196 ? 18.863 -11.224 13.424  1.00 11.22 ? 196 LYS A N   1 
ATOM   1440 C  CA  . LYS A 1 196 ? 17.593 -10.505 13.523  1.00 12.33 ? 196 LYS A CA  1 
ATOM   1441 C  C   . LYS A 1 196 ? 17.213 -10.091 12.107  1.00 13.14 ? 196 LYS A C   1 
ATOM   1442 O  O   . LYS A 1 196 ? 18.060 -9.613  11.330  1.00 11.82 ? 196 LYS A O   1 
ATOM   1443 C  CB  . LYS A 1 196 ? 17.716 -9.254  14.412  1.00 11.66 ? 196 LYS A CB  1 
ATOM   1444 C  CG  . LYS A 1 196 ? 16.404 -8.447  14.628  1.00 11.84 ? 196 LYS A CG  1 
ATOM   1445 C  CD  . LYS A 1 196 ? 15.272 -9.299  15.219  1.00 15.12 ? 196 LYS A CD  1 
ATOM   1446 C  CE  . LYS A 1 196 ? 14.608 -8.666  16.449  1.00 15.60 ? 196 LYS A CE  1 
ATOM   1447 N  NZ  . LYS A 1 196 ? 13.986 -7.327  16.233  1.00 17.28 ? 196 LYS A NZ  1 
ATOM   1448 N  N   . TYR A 1 197 ? 15.943 -10.286 11.770  1.00 13.31 ? 197 TYR A N   1 
ATOM   1449 C  CA  . TYR A 1 197 ? 15.454 -9.928  10.450  1.00 12.97 ? 197 TYR A CA  1 
ATOM   1450 C  C   . TYR A 1 197 ? 14.008 -9.464  10.498  1.00 12.74 ? 197 TYR A C   1 
ATOM   1451 O  O   . TYR A 1 197 ? 13.266 -9.747  11.441  1.00 10.82 ? 197 TYR A O   1 
ATOM   1452 C  CB  . TYR A 1 197 ? 15.605 -11.118 9.481   1.00 14.50 ? 197 TYR A CB  1 
ATOM   1453 C  CG  . TYR A 1 197 ? 14.863 -12.381 9.878   1.00 14.77 ? 197 TYR A CG  1 
ATOM   1454 C  CD1 . TYR A 1 197 ? 13.532 -12.577 9.511   1.00 14.56 ? 197 TYR A CD1 1 
ATOM   1455 C  CD2 . TYR A 1 197 ? 15.488 -13.370 10.636  1.00 15.42 ? 197 TYR A CD2 1 
ATOM   1456 C  CE1 . TYR A 1 197 ? 12.837 -13.725 9.892   1.00 16.18 ? 197 TYR A CE1 1 
ATOM   1457 C  CE2 . TYR A 1 197 ? 14.805 -14.522 11.022  1.00 16.16 ? 197 TYR A CE2 1 
ATOM   1458 C  CZ  . TYR A 1 197 ? 13.475 -14.694 10.647  1.00 17.91 ? 197 TYR A CZ  1 
ATOM   1459 O  OH  . TYR A 1 197 ? 12.788 -15.831 11.026  1.00 16.00 ? 197 TYR A OH  1 
ATOM   1460 N  N   . PHE A 1 198 ? 13.636 -8.713  9.476   1.00 13.46 ? 198 PHE A N   1 
ATOM   1461 C  CA  . PHE A 1 198 ? 12.285 -8.209  9.339   1.00 13.45 ? 198 PHE A CA  1 
ATOM   1462 C  C   . PHE A 1 198 ? 11.898 -8.441  7.895   1.00 11.32 ? 198 PHE A C   1 
ATOM   1463 O  O   . PHE A 1 198 ? 12.099 -7.577  7.043   1.00 12.17 ? 198 PHE A O   1 
ATOM   1464 C  CB  . PHE A 1 198 ? 12.194 -6.709  9.665   1.00 12.01 ? 198 PHE A CB  1 
ATOM   1465 C  CG  . PHE A 1 198 ? 12.320 -6.390  11.135  1.00 13.05 ? 198 PHE A CG  1 
ATOM   1466 C  CD1 . PHE A 1 198 ? 13.537 -5.972  11.673  1.00 11.92 ? 198 PHE A CD1 1 
ATOM   1467 C  CD2 . PHE A 1 198 ? 11.225 -6.512  11.983  1.00 12.87 ? 198 PHE A CD2 1 
ATOM   1468 C  CE1 . PHE A 1 198 ? 13.660 -5.680  13.030  1.00 10.44 ? 198 PHE A CE1 1 
ATOM   1469 C  CE2 . PHE A 1 198 ? 11.342 -6.221  13.345  1.00 14.49 ? 198 PHE A CE2 1 
ATOM   1470 C  CZ  . PHE A 1 198 ? 12.560 -5.805  13.865  1.00 12.35 ? 198 PHE A CZ  1 
ATOM   1471 N  N   . SER A 1 199 ? 11.377 -9.632  7.635   1.00 11.55 ? 199 SER A N   1 
ATOM   1472 C  CA  . SER A 1 199 ? 10.931 -10.006 6.311   1.00 10.14 ? 199 SER A CA  1 
ATOM   1473 C  C   . SER A 1 199 ? 9.641  -9.231  6.095   1.00 10.04 ? 199 SER A C   1 
ATOM   1474 O  O   . SER A 1 199 ? 9.171  -8.538  7.009   1.00 7.98  ? 199 SER A O   1 
ATOM   1475 C  CB  . SER A 1 199 ? 10.650 -11.509 6.249   1.00 11.31 ? 199 SER A CB  1 
ATOM   1476 O  OG  . SER A 1 199 ? 9.480  -11.845 6.973   1.00 10.31 ? 199 SER A OG  1 
ATOM   1477 N  N   . MET A 1 200 ? 9.072  -9.343  4.900   1.00 8.65  ? 200 MET A N   1 
ATOM   1478 C  CA  . MET A 1 200 ? 7.829  -8.644  4.602   1.00 9.90  ? 200 MET A CA  1 
ATOM   1479 C  C   . MET A 1 200 ? 6.694  -9.048  5.563   1.00 9.86  ? 200 MET A C   1 
ATOM   1480 O  O   . MET A 1 200 ? 5.779  -8.263  5.811   1.00 9.56  ? 200 MET A O   1 
ATOM   1481 C  CB  . MET A 1 200 ? 7.412  -8.882  3.139   1.00 9.95  ? 200 MET A CB  1 
ATOM   1482 C  CG  . MET A 1 200 ? 8.315  -8.197  2.085   1.00 9.46  ? 200 MET A CG  1 
ATOM   1483 S  SD  . MET A 1 200 ? 8.772  -6.445  2.444   1.00 10.96 ? 200 MET A SD  1 
ATOM   1484 C  CE  . MET A 1 200 ? 7.287  -5.589  2.049   1.00 5.16  ? 200 MET A CE  1 
ATOM   1485 N  N   . THR A 1 201 ? 6.757  -10.263 6.109   1.00 9.80  ? 201 THR A N   1 
ATOM   1486 C  CA  . THR A 1 201 ? 5.732  -10.735 7.044   1.00 10.14 ? 201 THR A CA  1 
ATOM   1487 C  C   . THR A 1 201 ? 5.715  -9.904  8.333   1.00 9.75  ? 201 THR A C   1 
ATOM   1488 O  O   . THR A 1 201 ? 4.652  -9.618  8.880   1.00 7.27  ? 201 THR A O   1 
ATOM   1489 C  CB  . THR A 1 201 ? 5.948  -12.218 7.411   1.00 9.69  ? 201 THR A CB  1 
ATOM   1490 O  OG1 . THR A 1 201 ? 5.948  -13.005 6.218   1.00 7.82  ? 201 THR A OG1 1 
ATOM   1491 C  CG2 . THR A 1 201 ? 4.852  -12.716 8.351   1.00 10.90 ? 201 THR A CG2 1 
ATOM   1492 N  N   . GLU A 1 202 ? 6.894  -9.518  8.807   1.00 8.90  ? 202 GLU A N   1 
ATOM   1493 C  CA  . GLU A 1 202 ? 7.010  -8.724  10.022  1.00 9.24  ? 202 GLU A CA  1 
ATOM   1494 C  C   . GLU A 1 202 ? 6.680  -7.247  9.755   1.00 9.02  ? 202 GLU A C   1 
ATOM   1495 O  O   . GLU A 1 202 ? 6.237  -6.532  10.656  1.00 9.99  ? 202 GLU A O   1 
ATOM   1496 C  CB  . GLU A 1 202 ? 8.420  -8.869  10.620  1.00 8.90  ? 202 GLU A CB  1 
ATOM   1497 C  CG  . GLU A 1 202 ? 8.681  -10.220 11.312  1.00 11.85 ? 202 GLU A CG  1 
ATOM   1498 C  CD  . GLU A 1 202 ? 8.774  -11.383 10.347  1.00 11.20 ? 202 GLU A CD  1 
ATOM   1499 O  OE1 . GLU A 1 202 ? 9.737  -11.421 9.552   1.00 12.19 ? 202 GLU A OE1 1 
ATOM   1500 O  OE2 . GLU A 1 202 ? 7.886  -12.261 10.381  1.00 11.29 ? 202 GLU A OE2 1 
ATOM   1501 N  N   . VAL A 1 203 ? 6.906  -6.797  8.522   1.00 9.29  ? 203 VAL A N   1 
ATOM   1502 C  CA  . VAL A 1 203 ? 6.586  -5.426  8.132   1.00 8.60  ? 203 VAL A CA  1 
ATOM   1503 C  C   . VAL A 1 203 ? 5.064  -5.337  8.094   1.00 7.58  ? 203 VAL A C   1 
ATOM   1504 O  O   . VAL A 1 203 ? 4.474  -4.382  8.585   1.00 8.82  ? 203 VAL A O   1 
ATOM   1505 C  CB  . VAL A 1 203 ? 7.160  -5.057  6.720   1.00 9.02  ? 203 VAL A CB  1 
ATOM   1506 C  CG1 . VAL A 1 203 ? 6.684  -3.650  6.316   1.00 10.06 ? 203 VAL A CG1 1 
ATOM   1507 C  CG2 . VAL A 1 203 ? 8.701  -5.094  6.733   1.00 7.95  ? 203 VAL A CG2 1 
ATOM   1508 N  N   . ASP A 1 204 ? 4.427  -6.347  7.512   1.00 10.43 ? 204 ASP A N   1 
ATOM   1509 C  CA  . ASP A 1 204 ? 2.965  -6.384  7.445   1.00 10.50 ? 204 ASP A CA  1 
ATOM   1510 C  C   . ASP A 1 204 ? 2.386  -6.375  8.855   1.00 10.39 ? 204 ASP A C   1 
ATOM   1511 O  O   . ASP A 1 204 ? 1.488  -5.592  9.167   1.00 9.60  ? 204 ASP A O   1 
ATOM   1512 C  CB  . ASP A 1 204 ? 2.468  -7.646  6.744   1.00 10.75 ? 204 ASP A CB  1 
ATOM   1513 C  CG  . ASP A 1 204 ? 2.848  -7.700  5.287   1.00 9.80  ? 204 ASP A CG  1 
ATOM   1514 O  OD1 . ASP A 1 204 ? 2.828  -6.658  4.613   1.00 11.32 ? 204 ASP A OD1 1 
ATOM   1515 O  OD2 . ASP A 1 204 ? 3.144  -8.804  4.809   1.00 16.11 ? 204 ASP A OD2 1 
ATOM   1516 N  N   . ARG A 1 205 ? 2.907  -7.267  9.693   1.00 10.93 ? 205 ARG A N   1 
ATOM   1517 C  CA  . ARG A 1 205 ? 2.466  -7.397  11.078  1.00 11.89 ? 205 ARG A CA  1 
ATOM   1518 C  C   . ARG A 1 205 ? 2.648  -6.166  11.958  1.00 12.27 ? 205 ARG A C   1 
ATOM   1519 O  O   . ARG A 1 205 ? 1.678  -5.666  12.550  1.00 11.27 ? 205 ARG A O   1 
ATOM   1520 C  CB  . ARG A 1 205 ? 3.191  -8.555  11.755  1.00 13.49 ? 205 ARG A CB  1 
ATOM   1521 C  CG  . ARG A 1 205 ? 3.002  -8.580  13.270  1.00 14.31 ? 205 ARG A CG  1 
ATOM   1522 C  CD  . ARG A 1 205 ? 3.802  -9.689  13.905  1.00 17.63 ? 205 ARG A CD  1 
ATOM   1523 N  NE  . ARG A 1 205 ? 3.505  -10.978 13.289  1.00 20.43 ? 205 ARG A NE  1 
ATOM   1524 C  CZ  . ARG A 1 205 ? 4.389  -11.695 12.603  1.00 20.48 ? 205 ARG A CZ  1 
ATOM   1525 N  NH1 . ARG A 1 205 ? 5.626  -11.245 12.444  1.00 20.50 ? 205 ARG A NH1 1 
ATOM   1526 N  NH2 . ARG A 1 205 ? 4.042  -12.866 12.086  1.00 21.04 ? 205 ARG A NH2 1 
ATOM   1527 N  N   . LEU A 1 206 ? 3.888  -5.693  12.054  1.00 10.99 ? 206 LEU A N   1 
ATOM   1528 C  CA  . LEU A 1 206 ? 4.209  -4.560  12.921  1.00 11.05 ? 206 LEU A CA  1 
ATOM   1529 C  C   . LEU A 1 206 ? 4.147  -3.154  12.307  1.00 10.67 ? 206 LEU A C   1 
ATOM   1530 O  O   . LEU A 1 206 ? 3.958  -2.169  13.022  1.00 7.89  ? 206 LEU A O   1 
ATOM   1531 C  CB  . LEU A 1 206 ? 5.589  -4.803  13.565  1.00 12.39 ? 206 LEU A CB  1 
ATOM   1532 C  CG  . LEU A 1 206 ? 5.679  -6.065  14.448  1.00 11.75 ? 206 LEU A CG  1 
ATOM   1533 C  CD1 . LEU A 1 206 ? 7.120  -6.530  14.572  1.00 13.95 ? 206 LEU A CD1 1 
ATOM   1534 C  CD2 . LEU A 1 206 ? 5.104  -5.782  15.824  1.00 11.61 ? 206 LEU A CD2 1 
ATOM   1535 N  N   . GLY A 1 207 ? 4.277  -3.058  10.991  1.00 10.68 ? 207 GLY A N   1 
ATOM   1536 C  CA  . GLY A 1 207 ? 4.245  -1.760  10.348  1.00 12.42 ? 207 GLY A CA  1 
ATOM   1537 C  C   . GLY A 1 207 ? 5.680  -1.318  10.123  1.00 13.47 ? 207 GLY A C   1 
ATOM   1538 O  O   . GLY A 1 207 ? 6.584  -1.808  10.790  1.00 12.71 ? 207 GLY A O   1 
ATOM   1539 N  N   . ILE A 1 208 ? 5.898  -0.406  9.181   1.00 15.54 ? 208 ILE A N   1 
ATOM   1540 C  CA  . ILE A 1 208 ? 7.249  0.065   8.886   1.00 15.33 ? 208 ILE A CA  1 
ATOM   1541 C  C   . ILE A 1 208 ? 7.812  0.900   10.050  1.00 15.22 ? 208 ILE A C   1 
ATOM   1542 O  O   . ILE A 1 208 ? 9.024  0.901   10.301  1.00 13.48 ? 208 ILE A O   1 
ATOM   1543 C  CB  . ILE A 1 208 ? 7.263  0.878   7.560   1.00 17.31 ? 208 ILE A CB  1 
ATOM   1544 C  CG1 . ILE A 1 208 ? 8.615  0.707   6.852   1.00 17.41 ? 208 ILE A CG1 1 
ATOM   1545 C  CG2 . ILE A 1 208 ? 6.962  2.345   7.831   1.00 17.35 ? 208 ILE A CG2 1 
ATOM   1546 C  CD1 . ILE A 1 208 ? 9.791  1.213   7.623   1.00 21.76 ? 208 ILE A CD1 1 
ATOM   1547 N  N   . GLY A 1 209 ? 6.926  1.591   10.768  1.00 13.68 ? 209 GLY A N   1 
ATOM   1548 C  CA  . GLY A 1 209 ? 7.354  2.404   11.893  1.00 14.42 ? 209 GLY A CA  1 
ATOM   1549 C  C   . GLY A 1 209 ? 7.988  1.588   13.004  1.00 14.04 ? 209 GLY A C   1 
ATOM   1550 O  O   . GLY A 1 209 ? 9.116  1.867   13.424  1.00 13.19 ? 209 GLY A O   1 
ATOM   1551 N  N   . LYS A 1 210 ? 7.253  0.583   13.484  1.00 13.99 ? 210 LYS A N   1 
ATOM   1552 C  CA  . LYS A 1 210 ? 7.719  -0.304  14.549  1.00 13.62 ? 210 LYS A CA  1 
ATOM   1553 C  C   . LYS A 1 210 ? 9.012  -1.024  14.147  1.00 12.05 ? 210 LYS A C   1 
ATOM   1554 O  O   . LYS A 1 210 ? 9.948  -1.138  14.942  1.00 12.77 ? 210 LYS A O   1 
ATOM   1555 C  CB  . LYS A 1 210 ? 6.626  -1.331  14.881  1.00 16.42 ? 210 LYS A CB  1 
ATOM   1556 C  CG  . LYS A 1 210 ? 6.978  -2.283  16.008  1.00 19.98 ? 210 LYS A CG  1 
ATOM   1557 C  CD  . LYS A 1 210 ? 7.314  -1.506  17.268  1.00 22.74 ? 210 LYS A CD  1 
ATOM   1558 C  CE  . LYS A 1 210 ? 7.935  -2.386  18.336  1.00 22.59 ? 210 LYS A CE  1 
ATOM   1559 N  NZ  . LYS A 1 210 ? 8.492  -1.535  19.417  1.00 26.68 ? 210 LYS A NZ  1 
ATOM   1560 N  N   . VAL A 1 211 ? 9.062  -1.494  12.906  1.00 10.52 ? 211 VAL A N   1 
ATOM   1561 C  CA  . VAL A 1 211 ? 10.236 -2.197  12.402  1.00 11.02 ? 211 VAL A CA  1 
ATOM   1562 C  C   . VAL A 1 211 ? 11.506 -1.365  12.566  1.00 12.12 ? 211 VAL A C   1 
ATOM   1563 O  O   . VAL A 1 211 ? 12.524 -1.884  13.023  1.00 11.40 ? 211 VAL A O   1 
ATOM   1564 C  CB  . VAL A 1 211 ? 10.070 -2.577  10.902  1.00 8.03  ? 211 VAL A CB  1 
ATOM   1565 C  CG1 . VAL A 1 211 ? 11.423 -2.945  10.293  1.00 9.46  ? 211 VAL A CG1 1 
ATOM   1566 C  CG2 . VAL A 1 211 ? 9.100  -3.738  10.771  1.00 5.19  ? 211 VAL A CG2 1 
ATOM   1567 N  N   . MET A 1 212 ? 11.443 -0.081  12.205  1.00 12.35 ? 212 MET A N   1 
ATOM   1568 C  CA  . MET A 1 212 ? 12.608 0.792   12.310  1.00 13.49 ? 212 MET A CA  1 
ATOM   1569 C  C   . MET A 1 212 ? 12.969 1.061   13.756  1.00 13.15 ? 212 MET A C   1 
ATOM   1570 O  O   . MET A 1 212 ? 14.144 1.114   14.108  1.00 12.55 ? 212 MET A O   1 
ATOM   1571 C  CB  . MET A 1 212 ? 12.375 2.119   11.566  1.00 13.69 ? 212 MET A CB  1 
ATOM   1572 C  CG  . MET A 1 212 ? 12.547 2.030   10.039  1.00 13.12 ? 212 MET A CG  1 
ATOM   1573 S  SD  . MET A 1 212 ? 14.082 1.201   9.503   1.00 15.03 ? 212 MET A SD  1 
ATOM   1574 C  CE  . MET A 1 212 ? 15.311 2.402   10.050  1.00 12.18 ? 212 MET A CE  1 
ATOM   1575 N  N   . GLU A 1 213 ? 11.949 1.226   14.591  1.00 14.19 ? 213 GLU A N   1 
ATOM   1576 C  CA  . GLU A 1 213 ? 12.148 1.469   16.015  1.00 14.93 ? 213 GLU A CA  1 
ATOM   1577 C  C   . GLU A 1 213 ? 12.999 0.337   16.562  1.00 13.76 ? 213 GLU A C   1 
ATOM   1578 O  O   . GLU A 1 213 ? 14.039 0.571   17.173  1.00 11.18 ? 213 GLU A O   1 
ATOM   1579 C  CB  . GLU A 1 213 ? 10.801 1.488   16.719  1.00 16.65 ? 213 GLU A CB  1 
ATOM   1580 C  CG  . GLU A 1 213 ? 10.790 2.149   18.076  1.00 21.16 ? 213 GLU A CG  1 
ATOM   1581 C  CD  . GLU A 1 213 ? 9.373  2.348   18.576  1.00 23.91 ? 213 GLU A CD  1 
ATOM   1582 O  OE1 . GLU A 1 213 ? 8.678  1.338   18.818  1.00 24.75 ? 213 GLU A OE1 1 
ATOM   1583 O  OE2 . GLU A 1 213 ? 8.947  3.516   18.711  1.00 25.89 ? 213 GLU A OE2 1 
ATOM   1584 N  N   . GLU A 1 214 ? 12.547 -0.890  16.316  1.00 14.29 ? 214 GLU A N   1 
ATOM   1585 C  CA  . GLU A 1 214 ? 13.246 -2.096  16.752  1.00 14.90 ? 214 GLU A CA  1 
ATOM   1586 C  C   . GLU A 1 214 ? 14.617 -2.293  16.104  1.00 15.03 ? 214 GLU A C   1 
ATOM   1587 O  O   . GLU A 1 214 ? 15.541 -2.767  16.764  1.00 16.18 ? 214 GLU A O   1 
ATOM   1588 C  CB  . GLU A 1 214 ? 12.398 -3.342  16.489  1.00 15.89 ? 214 GLU A CB  1 
ATOM   1589 C  CG  . GLU A 1 214 ? 11.278 -3.601  17.482  1.00 17.66 ? 214 GLU A CG  1 
ATOM   1590 C  CD  . GLU A 1 214 ? 10.576 -4.922  17.203  1.00 21.56 ? 214 GLU A CD  1 
ATOM   1591 O  OE1 . GLU A 1 214 ? 11.269 -5.963  17.165  1.00 20.98 ? 214 GLU A OE1 1 
ATOM   1592 O  OE2 . GLU A 1 214 ? 9.339  -4.920  17.015  1.00 24.03 ? 214 GLU A OE2 1 
ATOM   1593 N  N   . THR A 1 215 ? 14.770 -1.957  14.824  1.00 16.35 ? 215 THR A N   1 
ATOM   1594 C  CA  . THR A 1 215 ? 16.086 -2.133  14.195  1.00 16.82 ? 215 THR A CA  1 
ATOM   1595 C  C   . THR A 1 215 ? 17.134 -1.149  14.729  1.00 15.88 ? 215 THR A C   1 
ATOM   1596 O  O   . THR A 1 215 ? 18.304 -1.498  14.866  1.00 15.80 ? 215 THR A O   1 
ATOM   1597 C  CB  . THR A 1 215 ? 16.051 -1.986  12.635  1.00 17.84 ? 215 THR A CB  1 
ATOM   1598 O  OG1 . THR A 1 215 ? 15.760 -0.627  12.269  1.00 20.18 ? 215 THR A OG1 1 
ATOM   1599 C  CG2 . THR A 1 215 ? 15.018 -2.917  12.035  1.00 13.10 ? 215 THR A CG2 1 
ATOM   1600 N  N   . LEU A 1 216 ? 16.713 0.077   15.032  1.00 16.31 ? 216 LEU A N   1 
ATOM   1601 C  CA  . LEU A 1 216 ? 17.635 1.101   15.528  1.00 16.01 ? 216 LEU A CA  1 
ATOM   1602 C  C   . LEU A 1 216 ? 18.039 0.880   16.990  1.00 17.92 ? 216 LEU A C   1 
ATOM   1603 O  O   . LEU A 1 216 ? 19.179 1.166   17.378  1.00 15.59 ? 216 LEU A O   1 
ATOM   1604 C  CB  . LEU A 1 216 ? 17.014 2.498   15.335  1.00 15.21 ? 216 LEU A CB  1 
ATOM   1605 C  CG  . LEU A 1 216 ? 16.803 2.882   13.861  1.00 12.68 ? 216 LEU A CG  1 
ATOM   1606 C  CD1 . LEU A 1 216 ? 16.184 4.261   13.750  1.00 7.92  ? 216 LEU A CD1 1 
ATOM   1607 C  CD2 . LEU A 1 216 ? 18.145 2.838   13.137  1.00 11.44 ? 216 LEU A CD2 1 
ATOM   1608 N  N   . SER A 1 217 ? 17.109 0.361   17.792  1.00 18.94 ? 217 SER A N   1 
ATOM   1609 C  CA  . SER A 1 217 ? 17.402 0.090   19.194  1.00 19.95 ? 217 SER A CA  1 
ATOM   1610 C  C   . SER A 1 217 ? 18.208 -1.201  19.248  1.00 19.25 ? 217 SER A C   1 
ATOM   1611 O  O   . SER A 1 217 ? 19.062 -1.372  20.113  1.00 19.39 ? 217 SER A O   1 
ATOM   1612 C  CB  . SER A 1 217 ? 16.115 -0.069  20.016  1.00 19.68 ? 217 SER A CB  1 
ATOM   1613 O  OG  . SER A 1 217 ? 15.592 -1.379  19.913  1.00 23.14 ? 217 SER A OG  1 
ATOM   1614 N  N   . TYR A 1 218 ? 17.932 -2.107  18.316  1.00 19.09 ? 218 TYR A N   1 
ATOM   1615 C  CA  . TYR A 1 218 ? 18.643 -3.379  18.254  1.00 19.21 ? 218 TYR A CA  1 
ATOM   1616 C  C   . TYR A 1 218 ? 20.140 -3.148  18.002  1.00 19.42 ? 218 TYR A C   1 
ATOM   1617 O  O   . TYR A 1 218 ? 20.996 -3.846  18.548  1.00 18.71 ? 218 TYR A O   1 
ATOM   1618 C  CB  . TYR A 1 218 ? 18.061 -4.254  17.133  1.00 18.32 ? 218 TYR A CB  1 
ATOM   1619 C  CG  . TYR A 1 218 ? 18.716 -5.616  17.022  1.00 18.12 ? 218 TYR A CG  1 
ATOM   1620 C  CD1 . TYR A 1 218 ? 18.201 -6.718  17.700  1.00 16.43 ? 218 TYR A CD1 1 
ATOM   1621 C  CD2 . TYR A 1 218 ? 19.895 -5.788  16.284  1.00 16.69 ? 218 TYR A CD2 1 
ATOM   1622 C  CE1 . TYR A 1 218 ? 18.848 -7.962  17.648  1.00 16.21 ? 218 TYR A CE1 1 
ATOM   1623 C  CE2 . TYR A 1 218 ? 20.546 -7.025  16.231  1.00 14.86 ? 218 TYR A CE2 1 
ATOM   1624 C  CZ  . TYR A 1 218 ? 20.021 -8.104  16.913  1.00 13.18 ? 218 TYR A CZ  1 
ATOM   1625 O  OH  . TYR A 1 218 ? 20.665 -9.325  16.863  1.00 10.67 ? 218 TYR A OH  1 
ATOM   1626 N  N   . LEU A 1 219 ? 20.445 -2.153  17.178  1.00 21.53 ? 219 LEU A N   1 
ATOM   1627 C  CA  . LEU A 1 219 ? 21.821 -1.832  16.819  1.00 23.04 ? 219 LEU A CA  1 
ATOM   1628 C  C   . LEU A 1 219 ? 22.471 -0.717  17.622  1.00 23.44 ? 219 LEU A C   1 
ATOM   1629 O  O   . LEU A 1 219 ? 23.695 -0.680  17.743  1.00 24.60 ? 219 LEU A O   1 
ATOM   1630 C  CB  . LEU A 1 219 ? 21.888 -1.456  15.341  1.00 24.85 ? 219 LEU A CB  1 
ATOM   1631 C  CG  . LEU A 1 219 ? 21.548 -2.530  14.309  1.00 26.66 ? 219 LEU A CG  1 
ATOM   1632 C  CD1 . LEU A 1 219 ? 21.337 -1.861  12.967  1.00 27.71 ? 219 LEU A CD1 1 
ATOM   1633 C  CD2 . LEU A 1 219 ? 22.666 -3.572  14.233  1.00 26.17 ? 219 LEU A CD2 1 
ATOM   1634 N  N   . LEU A 1 220 ? 21.667 0.194   18.160  1.00 22.13 ? 220 LEU A N   1 
ATOM   1635 C  CA  . LEU A 1 220 ? 22.213 1.318   18.910  1.00 23.11 ? 220 LEU A CA  1 
ATOM   1636 C  C   . LEU A 1 220 ? 21.832 1.308   20.392  1.00 24.65 ? 220 LEU A C   1 
ATOM   1637 O  O   . LEU A 1 220 ? 22.101 2.262   21.121  1.00 24.87 ? 220 LEU A O   1 
ATOM   1638 C  CB  . LEU A 1 220 ? 21.755 2.623   18.252  1.00 22.57 ? 220 LEU A CB  1 
ATOM   1639 C  CG  . LEU A 1 220 ? 21.911 2.659   16.724  1.00 21.64 ? 220 LEU A CG  1 
ATOM   1640 C  CD1 . LEU A 1 220 ? 21.196 3.873   16.156  1.00 20.34 ? 220 LEU A CD1 1 
ATOM   1641 C  CD2 . LEU A 1 220 ? 23.389 2.659   16.354  1.00 21.17 ? 220 LEU A CD2 1 
ATOM   1642 N  N   . GLY A 1 221 ? 21.218 0.221   20.836  1.00 25.14 ? 221 GLY A N   1 
ATOM   1643 C  CA  . GLY A 1 221 ? 20.808 0.113   22.223  1.00 28.12 ? 221 GLY A CA  1 
ATOM   1644 C  C   . GLY A 1 221 ? 21.941 0.243   23.228  1.00 29.75 ? 221 GLY A C   1 
ATOM   1645 O  O   . GLY A 1 221 ? 21.828 1.013   24.183  1.00 28.69 ? 221 GLY A O   1 
ATOM   1646 N  N   . ARG A 1 222 ? 23.020 -0.513  23.021  1.00 31.51 ? 222 ARG A N   1 
ATOM   1647 C  CA  . ARG A 1 222 ? 24.182 -0.480  23.913  1.00 33.16 ? 222 ARG A CA  1 
ATOM   1648 C  C   . ARG A 1 222 ? 25.021 0.792   23.780  1.00 33.10 ? 222 ARG A C   1 
ATOM   1649 O  O   . ARG A 1 222 ? 25.406 1.399   24.788  1.00 34.20 ? 222 ARG A O   1 
ATOM   1650 C  CB  . ARG A 1 222 ? 25.092 -1.692  23.670  1.00 33.67 ? 222 ARG A CB  1 
ATOM   1651 C  CG  . ARG A 1 222 ? 24.669 -2.963  24.376  1.00 35.20 ? 222 ARG A CG  1 
ATOM   1652 C  CD  . ARG A 1 222 ? 25.894 -3.818  24.715  1.00 38.79 ? 222 ARG A CD  1 
ATOM   1653 N  NE  . ARG A 1 222 ? 25.541 -5.060  25.398  1.00 40.24 ? 222 ARG A NE  1 
ATOM   1654 C  CZ  . ARG A 1 222 ? 26.425 -5.894  25.937  1.00 40.73 ? 222 ARG A CZ  1 
ATOM   1655 N  NH1 . ARG A 1 222 ? 27.723 -5.623  25.880  1.00 40.64 ? 222 ARG A NH1 1 
ATOM   1656 N  NH2 . ARG A 1 222 ? 26.010 -7.005  26.528  1.00 42.19 ? 222 ARG A NH2 1 
ATOM   1657 N  N   . LYS A 1 223 ? 25.316 1.178   22.540  1.00 32.66 ? 223 LYS A N   1 
ATOM   1658 C  CA  . LYS A 1 223 ? 26.110 2.371   22.262  1.00 32.01 ? 223 LYS A CA  1 
ATOM   1659 C  C   . LYS A 1 223 ? 25.643 2.990   20.945  1.00 30.72 ? 223 LYS A C   1 
ATOM   1660 O  O   . LYS A 1 223 ? 24.756 2.464   20.280  1.00 31.45 ? 223 LYS A O   1 
ATOM   1661 C  CB  . LYS A 1 223 ? 27.595 2.011   22.143  1.00 32.78 ? 223 LYS A CB  1 
ATOM   1662 C  CG  . LYS A 1 223 ? 28.116 1.024   23.179  1.00 34.50 ? 223 LYS A CG  1 
ATOM   1663 C  CD  . LYS A 1 223 ? 29.616 0.764   22.995  1.00 34.40 ? 223 LYS A CD  1 
ATOM   1664 C  CE  . LYS A 1 223 ? 30.060 -0.552  23.645  1.00 36.88 ? 223 LYS A CE  1 
ATOM   1665 N  NZ  . LYS A 1 223 ? 29.632 -0.718  25.071  1.00 37.31 ? 223 LYS A NZ  1 
ATOM   1666 N  N   . LYS A 1 224 ? 26.247 4.107   20.568  1.00 30.94 ? 224 LYS A N   1 
ATOM   1667 C  CA  . LYS A 1 224 ? 25.885 4.771   19.323  1.00 31.19 ? 224 LYS A CA  1 
ATOM   1668 C  C   . LYS A 1 224 ? 26.995 4.566   18.302  1.00 30.68 ? 224 LYS A C   1 
ATOM   1669 O  O   . LYS A 1 224 ? 27.879 5.415   18.163  1.00 32.32 ? 224 LYS A O   1 
ATOM   1670 C  CB  . LYS A 1 224 ? 25.656 6.269   19.555  1.00 31.98 ? 224 LYS A CB  1 
ATOM   1671 C  CG  . LYS A 1 224 ? 24.480 6.590   20.469  1.00 35.12 ? 224 LYS A CG  1 
ATOM   1672 C  CD  . LYS A 1 224 ? 24.745 6.120   21.896  1.00 36.27 ? 224 LYS A CD  1 
ATOM   1673 C  CE  . LYS A 1 224 ? 23.518 6.261   22.787  1.00 36.43 ? 224 LYS A CE  1 
ATOM   1674 N  NZ  . LYS A 1 224 ? 23.772 5.676   24.136  1.00 36.61 ? 224 LYS A NZ  1 
ATOM   1675 N  N   . ARG A 1 225 ? 26.940 3.442   17.587  1.00 28.34 ? 225 ARG A N   1 
ATOM   1676 C  CA  . ARG A 1 225 ? 27.947 3.106   16.585  1.00 25.77 ? 225 ARG A CA  1 
ATOM   1677 C  C   . ARG A 1 225 ? 27.578 3.469   15.152  1.00 26.00 ? 225 ARG A C   1 
ATOM   1678 O  O   . ARG A 1 225 ? 26.400 3.637   14.816  1.00 25.99 ? 225 ARG A O   1 
ATOM   1679 C  CB  . ARG A 1 225 ? 28.300 1.614   16.669  1.00 24.95 ? 225 ARG A CB  1 
ATOM   1680 C  CG  . ARG A 1 225 ? 27.145 0.663   16.976  1.00 24.28 ? 225 ARG A CG  1 
ATOM   1681 C  CD  . ARG A 1 225 ? 26.474 0.080   15.738  1.00 23.32 ? 225 ARG A CD  1 
ATOM   1682 N  NE  . ARG A 1 225 ? 25.701 -1.121  16.072  1.00 21.71 ? 225 ARG A NE  1 
ATOM   1683 C  CZ  . ARG A 1 225 ? 26.234 -2.320  16.306  1.00 20.08 ? 225 ARG A CZ  1 
ATOM   1684 N  NH1 . ARG A 1 225 ? 27.548 -2.492  16.236  1.00 20.51 ? 225 ARG A NH1 1 
ATOM   1685 N  NH2 . ARG A 1 225 ? 25.458 -3.346  16.623  1.00 17.45 ? 225 ARG A NH2 1 
ATOM   1686 N  N   . PRO A 1 226 ? 28.594 3.608   14.286  1.00 25.07 ? 226 PRO A N   1 
ATOM   1687 C  CA  . PRO A 1 226 ? 28.368 3.954   12.879  1.00 23.50 ? 226 PRO A CA  1 
ATOM   1688 C  C   . PRO A 1 226 ? 27.410 2.968   12.218  1.00 22.32 ? 226 PRO A C   1 
ATOM   1689 O  O   . PRO A 1 226 ? 27.393 1.786   12.565  1.00 21.59 ? 226 PRO A O   1 
ATOM   1690 C  CB  . PRO A 1 226 ? 29.770 3.883   12.284  1.00 25.18 ? 226 PRO A CB  1 
ATOM   1691 C  CG  . PRO A 1 226 ? 30.652 4.281   13.452  1.00 25.14 ? 226 PRO A CG  1 
ATOM   1692 C  CD  . PRO A 1 226 ? 30.037 3.506   14.580  1.00 25.29 ? 226 PRO A CD  1 
ATOM   1693 N  N   . ILE A 1 227 ? 26.607 3.451   11.273  1.00 21.57 ? 227 ILE A N   1 
ATOM   1694 C  CA  . ILE A 1 227 ? 25.666 2.582   10.571  1.00 19.09 ? 227 ILE A CA  1 
ATOM   1695 C  C   . ILE A 1 227 ? 25.964 2.461   9.083   1.00 17.02 ? 227 ILE A C   1 
ATOM   1696 O  O   . ILE A 1 227 ? 26.134 3.465   8.394   1.00 15.45 ? 227 ILE A O   1 
ATOM   1697 C  CB  . ILE A 1 227 ? 24.205 3.065   10.724  1.00 19.53 ? 227 ILE A CB  1 
ATOM   1698 C  CG1 . ILE A 1 227 ? 23.731 2.874   12.166  1.00 19.77 ? 227 ILE A CG1 1 
ATOM   1699 C  CG2 . ILE A 1 227 ? 23.304 2.299   9.767   1.00 19.55 ? 227 ILE A CG2 1 
ATOM   1700 C  CD1 . ILE A 1 227 ? 22.348 3.409   12.427  1.00 23.27 ? 227 ILE A CD1 1 
ATOM   1701 N  N   . HIS A 1 228 ? 26.031 1.216   8.614   1.00 15.76 ? 228 HIS A N   1 
ATOM   1702 C  CA  . HIS A 1 228 ? 26.263 0.895   7.205   1.00 13.97 ? 228 HIS A CA  1 
ATOM   1703 C  C   . HIS A 1 228 ? 24.948 0.360   6.649   1.00 12.23 ? 228 HIS A C   1 
ATOM   1704 O  O   . HIS A 1 228 ? 24.460 -0.683  7.074   1.00 11.21 ? 228 HIS A O   1 
ATOM   1705 C  CB  . HIS A 1 228 ? 27.352 -0.182  7.049   1.00 13.44 ? 228 HIS A CB  1 
ATOM   1706 C  CG  . HIS A 1 228 ? 27.654 -0.541  5.621   1.00 14.84 ? 228 HIS A CG  1 
ATOM   1707 N  ND1 . HIS A 1 228 ? 28.776 -0.092  4.958   1.00 14.90 ? 228 HIS A ND1 1 
ATOM   1708 C  CD2 . HIS A 1 228 ? 26.971 -1.297  4.726   1.00 16.79 ? 228 HIS A CD2 1 
ATOM   1709 C  CE1 . HIS A 1 228 ? 28.772 -0.551  3.719   1.00 16.84 ? 228 HIS A CE1 1 
ATOM   1710 N  NE2 . HIS A 1 228 ? 27.687 -1.286  3.552   1.00 17.31 ? 228 HIS A NE2 1 
ATOM   1711 N  N   . LEU A 1 229 ? 24.367 1.095   5.714   1.00 13.42 ? 229 LEU A N   1 
ATOM   1712 C  CA  . LEU A 1 229 ? 23.115 0.693   5.090   1.00 13.51 ? 229 LEU A CA  1 
ATOM   1713 C  C   . LEU A 1 229 ? 23.442 0.189   3.695   1.00 12.88 ? 229 LEU A C   1 
ATOM   1714 O  O   . LEU A 1 229 ? 23.897 0.960   2.856   1.00 14.78 ? 229 LEU A O   1 
ATOM   1715 C  CB  . LEU A 1 229 ? 22.127 1.881   4.996   1.00 13.24 ? 229 LEU A CB  1 
ATOM   1716 C  CG  . LEU A 1 229 ? 20.867 1.698   4.114   1.00 11.94 ? 229 LEU A CG  1 
ATOM   1717 C  CD1 . LEU A 1 229 ? 20.070 0.496   4.585   1.00 10.22 ? 229 LEU A CD1 1 
ATOM   1718 C  CD2 . LEU A 1 229 ? 19.988 2.951   4.149   1.00 12.27 ? 229 LEU A CD2 1 
ATOM   1719 N  N   . SER A 1 230 ? 23.250 -1.109  3.467   1.00 11.11 ? 230 SER A N   1 
ATOM   1720 C  CA  . SER A 1 230 ? 23.486 -1.702  2.154   1.00 11.37 ? 230 SER A CA  1 
ATOM   1721 C  C   . SER A 1 230 ? 22.086 -1.830  1.547   1.00 12.45 ? 230 SER A C   1 
ATOM   1722 O  O   . SER A 1 230 ? 21.332 -2.722  1.917   1.00 13.87 ? 230 SER A O   1 
ATOM   1723 C  CB  . SER A 1 230 ? 24.150 -3.085  2.291   1.00 13.07 ? 230 SER A CB  1 
ATOM   1724 O  OG  . SER A 1 230 ? 24.515 -3.624  1.022   1.00 7.29  ? 230 SER A OG  1 
ATOM   1725 N  N   . PHE A 1 231 ? 21.747 -0.931  0.623   1.00 12.31 ? 231 PHE A N   1 
ATOM   1726 C  CA  . PHE A 1 231 ? 20.422 -0.914  0.009   1.00 12.21 ? 231 PHE A CA  1 
ATOM   1727 C  C   . PHE A 1 231 ? 20.350 -1.527  -1.399  1.00 12.88 ? 231 PHE A C   1 
ATOM   1728 O  O   . PHE A 1 231 ? 20.954 -1.034  -2.361  1.00 13.42 ? 231 PHE A O   1 
ATOM   1729 C  CB  . PHE A 1 231 ? 19.899 0.538   -0.003  1.00 11.33 ? 231 PHE A CB  1 
ATOM   1730 C  CG  . PHE A 1 231 ? 18.392 0.660   -0.058  1.00 12.38 ? 231 PHE A CG  1 
ATOM   1731 C  CD1 . PHE A 1 231 ? 17.679 0.278   -1.191  1.00 12.34 ? 231 PHE A CD1 1 
ATOM   1732 C  CD2 . PHE A 1 231 ? 17.689 1.196   1.019   1.00 13.31 ? 231 PHE A CD2 1 
ATOM   1733 C  CE1 . PHE A 1 231 ? 16.290 0.433   -1.248  1.00 12.78 ? 231 PHE A CE1 1 
ATOM   1734 C  CE2 . PHE A 1 231 ? 16.299 1.355   0.970   1.00 12.06 ? 231 PHE A CE2 1 
ATOM   1735 C  CZ  . PHE A 1 231 ? 15.602 0.974   -0.164  1.00 11.44 ? 231 PHE A CZ  1 
ATOM   1736 N  N   . ASP A 1 232 ? 19.617 -2.625  -1.512  1.00 12.08 ? 232 ASP A N   1 
ATOM   1737 C  CA  . ASP A 1 232 ? 19.445 -3.264  -2.806  1.00 14.18 ? 232 ASP A CA  1 
ATOM   1738 C  C   . ASP A 1 232 ? 18.084 -2.834  -3.305  1.00 14.25 ? 232 ASP A C   1 
ATOM   1739 O  O   . ASP A 1 232 ? 17.062 -3.103  -2.678  1.00 14.64 ? 232 ASP A O   1 
ATOM   1740 C  CB  . ASP A 1 232 ? 19.499 -4.783  -2.698  1.00 13.76 ? 232 ASP A CB  1 
ATOM   1741 C  CG  . ASP A 1 232 ? 19.228 -5.472  -4.025  1.00 14.29 ? 232 ASP A CG  1 
ATOM   1742 O  OD1 . ASP A 1 232 ? 18.895 -4.787  -5.016  1.00 12.73 ? 232 ASP A OD1 1 
ATOM   1743 O  OD2 . ASP A 1 232 ? 19.353 -6.714  -4.073  1.00 16.98 ? 232 ASP A OD2 1 
ATOM   1744 N  N   . VAL A 1 233 ? 18.106 -2.156  -4.444  1.00 13.77 ? 233 VAL A N   1 
ATOM   1745 C  CA  . VAL A 1 233 ? 16.926 -1.630  -5.092  1.00 13.15 ? 233 VAL A CA  1 
ATOM   1746 C  C   . VAL A 1 233 ? 15.798 -2.656  -5.205  1.00 9.69  ? 233 VAL A C   1 
ATOM   1747 O  O   . VAL A 1 233 ? 14.637 -2.276  -5.271  1.00 8.90  ? 233 VAL A O   1 
ATOM   1748 C  CB  . VAL A 1 233 ? 17.324 -1.083  -6.477  1.00 13.28 ? 233 VAL A CB  1 
ATOM   1749 C  CG1 . VAL A 1 233 ? 16.253 -0.189  -7.033  1.00 17.76 ? 233 VAL A CG1 1 
ATOM   1750 C  CG2 . VAL A 1 233 ? 18.600 -0.301  -6.346  1.00 15.16 ? 233 VAL A CG2 1 
ATOM   1751 N  N   . ASP A 1 234 ? 16.112 -3.951  -5.208  1.00 9.70  ? 234 ASP A N   1 
ATOM   1752 C  CA  . ASP A 1 234 ? 15.033 -4.933  -5.304  1.00 9.76  ? 234 ASP A CA  1 
ATOM   1753 C  C   . ASP A 1 234 ? 14.371 -5.263  -3.973  1.00 9.71  ? 234 ASP A C   1 
ATOM   1754 O  O   . ASP A 1 234 ? 13.559 -6.177  -3.887  1.00 10.45 ? 234 ASP A O   1 
ATOM   1755 C  CB  . ASP A 1 234 ? 15.464 -6.223  -6.029  1.00 10.13 ? 234 ASP A CB  1 
ATOM   1756 C  CG  . ASP A 1 234 ? 16.337 -7.141  -5.188  1.00 10.59 ? 234 ASP A CG  1 
ATOM   1757 O  OD1 . ASP A 1 234 ? 16.264 -7.142  -3.937  1.00 10.18 ? 234 ASP A OD1 1 
ATOM   1758 O  OD2 . ASP A 1 234 ? 17.088 -7.908  -5.809  1.00 10.72 ? 234 ASP A OD2 1 
ATOM   1759 N  N   . GLY A 1 235 ? 14.727 -4.514  -2.934  1.00 11.75 ? 235 GLY A N   1 
ATOM   1760 C  CA  . GLY A 1 235 ? 14.101 -4.699  -1.635  1.00 10.83 ? 235 GLY A CA  1 
ATOM   1761 C  C   . GLY A 1 235 ? 12.750 -4.012  -1.784  1.00 10.88 ? 235 GLY A C   1 
ATOM   1762 O  O   . GLY A 1 235 ? 11.765 -4.383  -1.152  1.00 9.61  ? 235 GLY A O   1 
ATOM   1763 N  N   . LEU A 1 236 ? 12.724 -3.007  -2.657  1.00 10.72 ? 236 LEU A N   1 
ATOM   1764 C  CA  . LEU A 1 236 ? 11.513 -2.248  -2.970  1.00 11.88 ? 236 LEU A CA  1 
ATOM   1765 C  C   . LEU A 1 236 ? 10.671 -3.066  -3.950  1.00 10.08 ? 236 LEU A C   1 
ATOM   1766 O  O   . LEU A 1 236 ? 11.199 -3.944  -4.612  1.00 8.85  ? 236 LEU A O   1 
ATOM   1767 C  CB  . LEU A 1 236 ? 11.895 -0.910  -3.596  1.00 11.19 ? 236 LEU A CB  1 
ATOM   1768 C  CG  . LEU A 1 236 ? 12.786 -0.073  -2.676  1.00 12.42 ? 236 LEU A CG  1 
ATOM   1769 C  CD1 . LEU A 1 236 ? 13.069 1.267   -3.334  1.00 11.25 ? 236 LEU A CD1 1 
ATOM   1770 C  CD2 . LEU A 1 236 ? 12.097 0.117   -1.330  1.00 8.66  ? 236 LEU A CD2 1 
ATOM   1771 N  N   . ASP A 1 237 ? 9.371  -2.792  -4.037  1.00 11.71 ? 237 ASP A N   1 
ATOM   1772 C  CA  . ASP A 1 237 ? 8.508  -3.550  -4.954  1.00 11.89 ? 237 ASP A CA  1 
ATOM   1773 C  C   . ASP A 1 237 ? 8.889  -3.274  -6.417  1.00 11.34 ? 237 ASP A C   1 
ATOM   1774 O  O   . ASP A 1 237 ? 9.365  -2.184  -6.740  1.00 9.90  ? 237 ASP A O   1 
ATOM   1775 C  CB  . ASP A 1 237 ? 7.027  -3.202  -4.713  1.00 11.66 ? 237 ASP A CB  1 
ATOM   1776 C  CG  . ASP A 1 237 ? 6.078  -4.086  -5.509  1.00 11.64 ? 237 ASP A CG  1 
ATOM   1777 O  OD1 . ASP A 1 237 ? 5.414  -3.569  -6.424  1.00 11.66 ? 237 ASP A OD1 1 
ATOM   1778 O  OD2 . ASP A 1 237 ? 6.000  -5.298  -5.222  1.00 10.30 ? 237 ASP A OD2 1 
ATOM   1779 N  N   . PRO A 1 238 ? 8.708  -4.275  -7.308  1.00 10.76 ? 238 PRO A N   1 
ATOM   1780 C  CA  . PRO A 1 238 ? 9.017  -4.179  -8.742  1.00 10.97 ? 238 PRO A CA  1 
ATOM   1781 C  C   . PRO A 1 238 ? 8.123  -3.187  -9.494  1.00 12.21 ? 238 PRO A C   1 
ATOM   1782 O  O   . PRO A 1 238 ? 8.171  -3.097  -10.719 1.00 12.69 ? 238 PRO A O   1 
ATOM   1783 C  CB  . PRO A 1 238 ? 8.826  -5.615  -9.234  1.00 10.72 ? 238 PRO A CB  1 
ATOM   1784 C  CG  . PRO A 1 238 ? 9.112  -6.432  -8.032  1.00 9.63  ? 238 PRO A CG  1 
ATOM   1785 C  CD  . PRO A 1 238 ? 8.400  -5.671  -6.950  1.00 9.08  ? 238 PRO A CD  1 
ATOM   1786 N  N   . SER A 1 239 ? 7.287  -2.467  -8.753  1.00 12.48 ? 239 SER A N   1 
ATOM   1787 C  CA  . SER A 1 239 ? 6.406  -1.466  -9.340  1.00 13.03 ? 239 SER A CA  1 
ATOM   1788 C  C   . SER A 1 239 ? 7.082  -0.114  -9.160  1.00 13.42 ? 239 SER A C   1 
ATOM   1789 O  O   . SER A 1 239 ? 6.673  0.883   -9.750  1.00 12.36 ? 239 SER A O   1 
ATOM   1790 C  CB  . SER A 1 239 ? 5.035  -1.473  -8.655  1.00 13.06 ? 239 SER A CB  1 
ATOM   1791 O  OG  . SER A 1 239 ? 5.154  -1.377  -7.250  1.00 16.08 ? 239 SER A OG  1 
ATOM   1792 N  N   . PHE A 1 240 ? 8.139  -0.103  -8.351  1.00 13.17 ? 240 PHE A N   1 
ATOM   1793 C  CA  . PHE A 1 240 ? 8.892  1.112   -8.087  1.00 12.17 ? 240 PHE A CA  1 
ATOM   1794 C  C   . PHE A 1 240 ? 10.304 1.002   -8.641  1.00 12.23 ? 240 PHE A C   1 
ATOM   1795 O  O   . PHE A 1 240 ? 10.890 1.986   -9.110  1.00 13.20 ? 240 PHE A O   1 
ATOM   1796 C  CB  . PHE A 1 240 ? 8.919  1.383   -6.583  1.00 12.06 ? 240 PHE A CB  1 
ATOM   1797 C  CG  . PHE A 1 240 ? 7.561  1.631   -6.004  1.00 12.20 ? 240 PHE A CG  1 
ATOM   1798 C  CD1 . PHE A 1 240 ? 6.805  2.713   -6.429  1.00 12.63 ? 240 PHE A CD1 1 
ATOM   1799 C  CD2 . PHE A 1 240 ? 7.018  0.758   -5.067  1.00 14.00 ? 240 PHE A CD2 1 
ATOM   1800 C  CE1 . PHE A 1 240 ? 5.517  2.929   -5.933  1.00 13.98 ? 240 PHE A CE1 1 
ATOM   1801 C  CE2 . PHE A 1 240 ? 5.735  0.958   -4.561  1.00 12.75 ? 240 PHE A CE2 1 
ATOM   1802 C  CZ  . PHE A 1 240 ? 4.981  2.044   -4.993  1.00 12.13 ? 240 PHE A CZ  1 
ATOM   1803 N  N   . THR A 1 241 ? 10.851 -0.202  -8.603  1.00 11.77 ? 241 THR A N   1 
ATOM   1804 C  CA  . THR A 1 241 ? 12.190 -0.402  -9.121  1.00 13.34 ? 241 THR A CA  1 
ATOM   1805 C  C   . THR A 1 241 ? 12.240 -1.660  -9.995  1.00 12.91 ? 241 THR A C   1 
ATOM   1806 O  O   . THR A 1 241 ? 12.863 -2.669  -9.657  1.00 11.54 ? 241 THR A O   1 
ATOM   1807 C  CB  . THR A 1 241 ? 13.210 -0.435  -7.953  1.00 12.81 ? 241 THR A CB  1 
ATOM   1808 O  OG1 . THR A 1 241 ? 12.773 -1.357  -6.943  1.00 14.89 ? 241 THR A OG1 1 
ATOM   1809 C  CG2 . THR A 1 241 ? 13.316 0.965   -7.322  1.00 11.81 ? 241 THR A CG2 1 
ATOM   1810 N  N   . PRO A 1 242 ? 11.552 -1.603  -11.144 1.00 13.66 ? 242 PRO A N   1 
ATOM   1811 C  CA  . PRO A 1 242 ? 11.464 -2.690  -12.125 1.00 13.26 ? 242 PRO A CA  1 
ATOM   1812 C  C   . PRO A 1 242 ? 12.773 -3.088  -12.819 1.00 13.44 ? 242 PRO A C   1 
ATOM   1813 O  O   . PRO A 1 242 ? 12.988 -4.269  -13.128 1.00 12.61 ? 242 PRO A O   1 
ATOM   1814 C  CB  . PRO A 1 242 ? 10.417 -2.171  -13.114 1.00 13.38 ? 242 PRO A CB  1 
ATOM   1815 C  CG  . PRO A 1 242 ? 10.545 -0.684  -13.015 1.00 12.32 ? 242 PRO A CG  1 
ATOM   1816 C  CD  . PRO A 1 242 ? 10.699 -0.467  -11.540 1.00 11.79 ? 242 PRO A CD  1 
ATOM   1817 N  N   . ALA A 1 243 ? 13.644 -2.109  -13.051 1.00 13.57 ? 243 ALA A N   1 
ATOM   1818 C  CA  . ALA A 1 243 ? 14.916 -2.349  -13.736 1.00 13.62 ? 243 ALA A CA  1 
ATOM   1819 C  C   . ALA A 1 243 ? 15.983 -2.931  -12.812 1.00 11.73 ? 243 ALA A C   1 
ATOM   1820 O  O   . ALA A 1 243 ? 16.971 -2.276  -12.480 1.00 12.34 ? 243 ALA A O   1 
ATOM   1821 C  CB  . ALA A 1 243 ? 15.417 -1.038  -14.392 1.00 12.61 ? 243 ALA A CB  1 
ATOM   1822 N  N   . THR A 1 244 ? 15.774 -4.182  -12.421 1.00 12.84 ? 244 THR A N   1 
ATOM   1823 C  CA  . THR A 1 244 ? 16.684 -4.887  -11.536 1.00 13.47 ? 244 THR A CA  1 
ATOM   1824 C  C   . THR A 1 244 ? 16.693 -6.377  -11.906 1.00 12.52 ? 244 THR A C   1 
ATOM   1825 O  O   . THR A 1 244 ? 15.684 -6.928  -12.354 1.00 14.02 ? 244 THR A O   1 
ATOM   1826 C  CB  . THR A 1 244 ? 16.255 -4.683  -10.053 1.00 12.88 ? 244 THR A CB  1 
ATOM   1827 O  OG1 . THR A 1 244 ? 17.373 -4.916  -9.180  1.00 15.06 ? 244 THR A OG1 1 
ATOM   1828 C  CG2 . THR A 1 244 ? 15.116 -5.625  -9.694  1.00 11.60 ? 244 THR A CG2 1 
ATOM   1829 N  N   . GLY A 1 245 ? 17.841 -7.020  -11.723 1.00 13.00 ? 245 GLY A N   1 
ATOM   1830 C  CA  . GLY A 1 245 ? 17.988 -8.426  -12.064 1.00 9.98  ? 245 GLY A CA  1 
ATOM   1831 C  C   . GLY A 1 245 ? 17.086 -9.462  -11.413 1.00 11.31 ? 245 GLY A C   1 
ATOM   1832 O  O   . GLY A 1 245 ? 16.527 -10.323 -12.098 1.00 10.98 ? 245 GLY A O   1 
ATOM   1833 N  N   . THR A 1 246 ? 16.941 -9.400  -10.094 1.00 10.37 ? 246 THR A N   1 
ATOM   1834 C  CA  . THR A 1 246 ? 16.126 -10.377 -9.388  1.00 11.53 ? 246 THR A CA  1 
ATOM   1835 C  C   . THR A 1 246 ? 14.927 -9.777  -8.627  1.00 12.41 ? 246 THR A C   1 
ATOM   1836 O  O   . THR A 1 246 ? 14.905 -9.763  -7.397  1.00 13.52 ? 246 THR A O   1 
ATOM   1837 C  CB  . THR A 1 246 ? 17.004 -11.170 -8.406  1.00 11.35 ? 246 THR A CB  1 
ATOM   1838 O  OG1 . THR A 1 246 ? 17.720 -10.252 -7.568  1.00 14.25 ? 246 THR A OG1 1 
ATOM   1839 C  CG2 . THR A 1 246 ? 18.011 -12.049 -9.162  1.00 11.23 ? 246 THR A CG2 1 
ATOM   1840 N  N   . PRO A 1 247 ? 13.905 -9.295  -9.357  1.00 12.35 ? 247 PRO A N   1 
ATOM   1841 C  CA  . PRO A 1 247 ? 12.708 -8.701  -8.755  1.00 13.34 ? 247 PRO A CA  1 
ATOM   1842 C  C   . PRO A 1 247 ? 11.752 -9.754  -8.177  1.00 13.27 ? 247 PRO A C   1 
ATOM   1843 O  O   . PRO A 1 247 ? 11.541 -10.803 -8.793  1.00 13.97 ? 247 PRO A O   1 
ATOM   1844 C  CB  . PRO A 1 247 ? 12.075 -7.967  -9.935  1.00 13.31 ? 247 PRO A CB  1 
ATOM   1845 C  CG  . PRO A 1 247 ? 12.333 -8.941  -11.059 1.00 13.07 ? 247 PRO A CG  1 
ATOM   1846 C  CD  . PRO A 1 247 ? 13.795 -9.286  -10.830 1.00 13.17 ? 247 PRO A CD  1 
ATOM   1847 N  N   . VAL A 1 248 ? 11.184 -9.472  -7.000  1.00 12.96 ? 248 VAL A N   1 
ATOM   1848 C  CA  . VAL A 1 248 ? 10.230 -10.370 -6.347  1.00 10.25 ? 248 VAL A CA  1 
ATOM   1849 C  C   . VAL A 1 248 ? 9.009  -9.550  -5.934  1.00 11.01 ? 248 VAL A C   1 
ATOM   1850 O  O   . VAL A 1 248 ? 9.145  -8.505  -5.289  1.00 11.38 ? 248 VAL A O   1 
ATOM   1851 C  CB  . VAL A 1 248 ? 10.846 -11.049 -5.099  1.00 7.89  ? 248 VAL A CB  1 
ATOM   1852 C  CG1 . VAL A 1 248 ? 9.858  -12.036 -4.483  1.00 6.49  ? 248 VAL A CG1 1 
ATOM   1853 C  CG2 . VAL A 1 248 ? 12.125 -11.756 -5.484  1.00 10.57 ? 248 VAL A CG2 1 
ATOM   1854 N  N   . VAL A 1 249 ? 7.820  -10.030 -6.301  1.00 11.97 ? 249 VAL A N   1 
ATOM   1855 C  CA  . VAL A 1 249 ? 6.575  -9.322  -6.004  1.00 11.86 ? 249 VAL A CA  1 
ATOM   1856 C  C   . VAL A 1 249 ? 6.294  -9.174  -4.519  1.00 10.95 ? 249 VAL A C   1 
ATOM   1857 O  O   . VAL A 1 249 ? 6.760  -9.974  -3.709  1.00 10.98 ? 249 VAL A O   1 
ATOM   1858 C  CB  . VAL A 1 249 ? 5.359  -10.006 -6.681  1.00 12.66 ? 249 VAL A CB  1 
ATOM   1859 C  CG1 . VAL A 1 249 ? 5.529  -9.951  -8.193  1.00 11.40 ? 249 VAL A CG1 1 
ATOM   1860 C  CG2 . VAL A 1 249 ? 5.223  -11.456 -6.211  1.00 12.04 ? 249 VAL A CG2 1 
ATOM   1861 N  N   . GLY A 1 250 ? 5.528  -8.141  -4.175  1.00 9.60  ? 250 GLY A N   1 
ATOM   1862 C  CA  . GLY A 1 250 ? 5.176  -7.886  -2.785  1.00 9.19  ? 250 GLY A CA  1 
ATOM   1863 C  C   . GLY A 1 250 ? 6.293  -7.255  -1.983  1.00 7.47  ? 250 GLY A C   1 
ATOM   1864 O  O   . GLY A 1 250 ? 6.576  -7.672  -0.853  1.00 8.19  ? 250 GLY A O   1 
ATOM   1865 N  N   . GLY A 1 251 ? 6.923  -6.238  -2.561  1.00 8.87  ? 251 GLY A N   1 
ATOM   1866 C  CA  . GLY A 1 251 ? 8.025  -5.582  -1.892  1.00 9.79  ? 251 GLY A CA  1 
ATOM   1867 C  C   . GLY A 1 251 ? 7.689  -4.391  -1.016  1.00 11.21 ? 251 GLY A C   1 
ATOM   1868 O  O   . GLY A 1 251 ? 6.519  -4.103  -0.737  1.00 11.73 ? 251 GLY A O   1 
ATOM   1869 N  N   . LEU A 1 252 ? 8.744  -3.719  -0.556  1.00 12.01 ? 252 LEU A N   1 
ATOM   1870 C  CA  . LEU A 1 252 ? 8.617  -2.525  0.278   1.00 14.04 ? 252 LEU A CA  1 
ATOM   1871 C  C   . LEU A 1 252 ? 8.034  -1.417  -0.576  1.00 14.89 ? 252 LEU A C   1 
ATOM   1872 O  O   . LEU A 1 252 ? 8.290  -1.340  -1.779  1.00 15.79 ? 252 LEU A O   1 
ATOM   1873 C  CB  . LEU A 1 252 ? 9.985  -2.089  0.810   1.00 12.40 ? 252 LEU A CB  1 
ATOM   1874 C  CG  . LEU A 1 252 ? 10.562 -2.971  1.922   1.00 11.79 ? 252 LEU A CG  1 
ATOM   1875 C  CD1 . LEU A 1 252 ? 12.072 -2.735  2.062   1.00 7.54  ? 252 LEU A CD1 1 
ATOM   1876 C  CD2 . LEU A 1 252 ? 9.803  -2.667  3.227   1.00 7.82  ? 252 LEU A CD2 1 
ATOM   1877 N  N   . THR A 1 253 ? 7.245  -0.557  0.045   1.00 14.45 ? 253 THR A N   1 
ATOM   1878 C  CA  . THR A 1 253 ? 6.630  0.537   -0.684  1.00 15.54 ? 253 THR A CA  1 
ATOM   1879 C  C   . THR A 1 253 ? 7.627  1.672   -0.964  1.00 14.14 ? 253 THR A C   1 
ATOM   1880 O  O   . THR A 1 253 ? 8.719  1.704   -0.400  1.00 10.94 ? 253 THR A O   1 
ATOM   1881 C  CB  . THR A 1 253 ? 5.422  1.076   0.107   1.00 15.90 ? 253 THR A CB  1 
ATOM   1882 O  OG1 . THR A 1 253 ? 4.485  0.009   0.322   1.00 18.77 ? 253 THR A OG1 1 
ATOM   1883 C  CG2 . THR A 1 253 ? 4.731  2.176   -0.660  1.00 19.63 ? 253 THR A CG2 1 
ATOM   1884 N  N   . TYR A 1 254 ? 7.249  2.572   -1.871  1.00 14.79 ? 254 TYR A N   1 
ATOM   1885 C  CA  . TYR A 1 254 ? 8.062  3.742   -2.195  1.00 14.39 ? 254 TYR A CA  1 
ATOM   1886 C  C   . TYR A 1 254 ? 8.156  4.464   -0.848  1.00 14.20 ? 254 TYR A C   1 
ATOM   1887 O  O   . TYR A 1 254 ? 9.232  4.864   -0.402  1.00 13.30 ? 254 TYR A O   1 
ATOM   1888 C  CB  . TYR A 1 254 ? 7.326  4.649   -3.191  1.00 14.06 ? 254 TYR A CB  1 
ATOM   1889 C  CG  . TYR A 1 254 ? 8.161  5.798   -3.690  1.00 12.89 ? 254 TYR A CG  1 
ATOM   1890 C  CD1 . TYR A 1 254 ? 9.071  5.614   -4.728  1.00 13.53 ? 254 TYR A CD1 1 
ATOM   1891 C  CD2 . TYR A 1 254 ? 8.082  7.057   -3.095  1.00 13.27 ? 254 TYR A CD2 1 
ATOM   1892 C  CE1 . TYR A 1 254 ? 9.885  6.655   -5.163  1.00 16.01 ? 254 TYR A CE1 1 
ATOM   1893 C  CE2 . TYR A 1 254 ? 8.891  8.110   -3.520  1.00 15.20 ? 254 TYR A CE2 1 
ATOM   1894 C  CZ  . TYR A 1 254 ? 9.791  7.903   -4.555  1.00 16.11 ? 254 TYR A CZ  1 
ATOM   1895 O  OH  . TYR A 1 254 ? 10.597 8.930   -5.000  1.00 15.32 ? 254 TYR A OH  1 
ATOM   1896 N  N   . ARG A 1 255 ? 6.993  4.604   -0.213  1.00 12.93 ? 255 ARG A N   1 
ATOM   1897 C  CA  . ARG A 1 255 ? 6.860  5.246   1.085   1.00 13.50 ? 255 ARG A CA  1 
ATOM   1898 C  C   . ARG A 1 255 ? 7.706  4.564   2.156   1.00 13.93 ? 255 ARG A C   1 
ATOM   1899 O  O   . ARG A 1 255 ? 8.418  5.235   2.908   1.00 14.20 ? 255 ARG A O   1 
ATOM   1900 C  CB  . ARG A 1 255 ? 5.384  5.268   1.492   1.00 11.94 ? 255 ARG A CB  1 
ATOM   1901 C  CG  . ARG A 1 255 ? 4.570  6.326   0.716   1.00 14.54 ? 255 ARG A CG  1 
ATOM   1902 C  CD  . ARG A 1 255 ? 3.066  6.110   0.788   1.00 13.01 ? 255 ARG A CD  1 
ATOM   1903 N  NE  . ARG A 1 255 ? 2.599  5.964   2.164   1.00 14.42 ? 255 ARG A NE  1 
ATOM   1904 C  CZ  . ARG A 1 255 ? 1.326  5.812   2.506   1.00 12.44 ? 255 ARG A CZ  1 
ATOM   1905 N  NH1 . ARG A 1 255 ? 0.389  5.785   1.567   1.00 10.36 ? 255 ARG A NH1 1 
ATOM   1906 N  NH2 . ARG A 1 255 ? 0.999  5.687   3.786   1.00 10.18 ? 255 ARG A NH2 1 
ATOM   1907 N  N   . GLU A 1 256 ? 7.647  3.235   2.218   1.00 11.47 ? 256 GLU A N   1 
ATOM   1908 C  CA  . GLU A 1 256 ? 8.426  2.494   3.202   1.00 11.69 ? 256 GLU A CA  1 
ATOM   1909 C  C   . GLU A 1 256 ? 9.930  2.660   2.959   1.00 11.07 ? 256 GLU A C   1 
ATOM   1910 O  O   . GLU A 1 256 ? 10.704 2.797   3.907   1.00 11.80 ? 256 GLU A O   1 
ATOM   1911 C  CB  . GLU A 1 256 ? 8.025  1.015   3.187   1.00 9.77  ? 256 GLU A CB  1 
ATOM   1912 C  CG  . GLU A 1 256 ? 6.580  0.807   3.591   1.00 8.25  ? 256 GLU A CG  1 
ATOM   1913 C  CD  . GLU A 1 256 ? 6.167  -0.640  3.556   1.00 9.91  ? 256 GLU A CD  1 
ATOM   1914 O  OE1 . GLU A 1 256 ? 6.486  -1.317  2.565   1.00 12.27 ? 256 GLU A OE1 1 
ATOM   1915 O  OE2 . GLU A 1 256 ? 5.510  -1.104  4.510   1.00 14.25 ? 256 GLU A OE2 1 
ATOM   1916 N  N   . GLY A 1 257 ? 10.337 2.665   1.692   1.00 11.63 ? 257 GLY A N   1 
ATOM   1917 C  CA  . GLY A 1 257 ? 11.741 2.852   1.374   1.00 10.01 ? 257 GLY A CA  1 
ATOM   1918 C  C   . GLY A 1 257 ? 12.235 4.214   1.849   1.00 10.58 ? 257 GLY A C   1 
ATOM   1919 O  O   . GLY A 1 257 ? 13.360 4.343   2.335   1.00 8.97  ? 257 GLY A O   1 
ATOM   1920 N  N   . LEU A 1 258 ? 11.394 5.235   1.693   1.00 10.05 ? 258 LEU A N   1 
ATOM   1921 C  CA  . LEU A 1 258 ? 11.733 6.583   2.131   1.00 11.06 ? 258 LEU A CA  1 
ATOM   1922 C  C   . LEU A 1 258 ? 11.688 6.660   3.658   1.00 11.48 ? 258 LEU A C   1 
ATOM   1923 O  O   . LEU A 1 258 ? 12.500 7.352   4.274   1.00 11.90 ? 258 LEU A O   1 
ATOM   1924 C  CB  . LEU A 1 258 ? 10.767 7.617   1.539   1.00 10.02 ? 258 LEU A CB  1 
ATOM   1925 C  CG  . LEU A 1 258 ? 10.789 7.909   0.028   1.00 9.93  ? 258 LEU A CG  1 
ATOM   1926 C  CD1 . LEU A 1 258 ? 9.828  9.061   -0.300  1.00 10.69 ? 258 LEU A CD1 1 
ATOM   1927 C  CD2 . LEU A 1 258 ? 12.206 8.271   -0.400  1.00 9.63  ? 258 LEU A CD2 1 
ATOM   1928 N  N   . TYR A 1 259 ? 10.744 5.949   4.270   1.00 13.16 ? 259 TYR A N   1 
ATOM   1929 C  CA  . TYR A 1 259 ? 10.641 5.965   5.728   1.00 12.79 ? 259 TYR A CA  1 
ATOM   1930 C  C   . TYR A 1 259 ? 11.874 5.312   6.343   1.00 13.26 ? 259 TYR A C   1 
ATOM   1931 O  O   . TYR A 1 259 ? 12.423 5.820   7.327   1.00 13.80 ? 259 TYR A O   1 
ATOM   1932 C  CB  . TYR A 1 259 ? 9.395  5.217   6.223   1.00 13.26 ? 259 TYR A CB  1 
ATOM   1933 C  CG  . TYR A 1 259 ? 9.225  5.385   7.718   1.00 13.43 ? 259 TYR A CG  1 
ATOM   1934 C  CD1 . TYR A 1 259 ? 8.749  6.590   8.248   1.00 11.45 ? 259 TYR A CD1 1 
ATOM   1935 C  CD2 . TYR A 1 259 ? 9.634  4.388   8.610   1.00 11.22 ? 259 TYR A CD2 1 
ATOM   1936 C  CE1 . TYR A 1 259 ? 8.687  6.798   9.616   1.00 11.42 ? 259 TYR A CE1 1 
ATOM   1937 C  CE2 . TYR A 1 259 ? 9.582  4.595   9.992   1.00 11.06 ? 259 TYR A CE2 1 
ATOM   1938 C  CZ  . TYR A 1 259 ? 9.103  5.804   10.488  1.00 9.87  ? 259 TYR A CZ  1 
ATOM   1939 O  OH  . TYR A 1 259 ? 9.018  6.024   11.850  1.00 11.11 ? 259 TYR A OH  1 
ATOM   1940 N  N   . ILE A 1 260 ? 12.274 4.170   5.772   1.00 11.58 ? 260 ILE A N   1 
ATOM   1941 C  CA  . ILE A 1 260 ? 13.444 3.419   6.222   1.00 11.19 ? 260 ILE A CA  1 
ATOM   1942 C  C   . ILE A 1 260 ? 14.621 4.364   6.390   1.00 11.40 ? 260 ILE A C   1 
ATOM   1943 O  O   . ILE A 1 260 ? 15.162 4.526   7.479   1.00 12.80 ? 260 ILE A O   1 
ATOM   1944 C  CB  . ILE A 1 260 ? 13.874 2.319   5.179   1.00 10.85 ? 260 ILE A CB  1 
ATOM   1945 C  CG1 . ILE A 1 260 ? 12.810 1.234   5.073   1.00 8.07  ? 260 ILE A CG1 1 
ATOM   1946 C  CG2 . ILE A 1 260 ? 15.215 1.688   5.570   1.00 10.38 ? 260 ILE A CG2 1 
ATOM   1947 C  CD1 . ILE A 1 260 ? 12.558 0.540   6.343   1.00 13.76 ? 260 ILE A CD1 1 
ATOM   1948 N  N   . THR A 1 261 ? 14.976 5.004   5.286   1.00 11.88 ? 261 THR A N   1 
ATOM   1949 C  CA  . THR A 1 261 ? 16.117 5.904   5.205   1.00 10.94 ? 261 THR A CA  1 
ATOM   1950 C  C   . THR A 1 261 ? 16.029 7.275   5.864   1.00 11.41 ? 261 THR A C   1 
ATOM   1951 O  O   . THR A 1 261 ? 17.058 7.840   6.224   1.00 10.77 ? 261 THR A O   1 
ATOM   1952 C  CB  . THR A 1 261 ? 16.522 6.050   3.740   1.00 11.82 ? 261 THR A CB  1 
ATOM   1953 O  OG1 . THR A 1 261 ? 15.388 6.475   2.969   1.00 12.12 ? 261 THR A OG1 1 
ATOM   1954 C  CG2 . THR A 1 261 ? 17.008 4.702   3.208   1.00 7.93  ? 261 THR A CG2 1 
ATOM   1955 N  N   . GLU A 1 262 ? 14.823 7.824   6.003   1.00 10.15 ? 262 GLU A N   1 
ATOM   1956 C  CA  . GLU A 1 262 ? 14.673 9.113   6.670   1.00 10.27 ? 262 GLU A CA  1 
ATOM   1957 C  C   . GLU A 1 262 ? 15.008 8.848   8.125   1.00 10.45 ? 262 GLU A C   1 
ATOM   1958 O  O   . GLU A 1 262 ? 15.636 9.660   8.788   1.00 12.00 ? 262 GLU A O   1 
ATOM   1959 C  CB  . GLU A 1 262 ? 13.232 9.640   6.575   1.00 11.07 ? 262 GLU A CB  1 
ATOM   1960 C  CG  . GLU A 1 262 ? 12.785 10.057  5.174   1.00 12.19 ? 262 GLU A CG  1 
ATOM   1961 C  CD  . GLU A 1 262 ? 11.320 10.487  5.120   1.00 13.63 ? 262 GLU A CD  1 
ATOM   1962 O  OE1 . GLU A 1 262 ? 10.494 9.879   5.832   1.00 9.75  ? 262 GLU A OE1 1 
ATOM   1963 O  OE2 . GLU A 1 262 ? 10.995 11.423  4.352   1.00 10.47 ? 262 GLU A OE2 1 
ATOM   1964 N  N   . GLU A 1 263 ? 14.590 7.693   8.620   1.00 9.21  ? 263 GLU A N   1 
ATOM   1965 C  CA  . GLU A 1 263 ? 14.864 7.336   10.002  1.00 9.49  ? 263 GLU A CA  1 
ATOM   1966 C  C   . GLU A 1 263 ? 16.350 7.088   10.200  1.00 10.49 ? 263 GLU A C   1 
ATOM   1967 O  O   . GLU A 1 263 ? 16.912 7.473   11.221  1.00 9.20  ? 263 GLU A O   1 
ATOM   1968 C  CB  . GLU A 1 263 ? 14.063 6.097   10.403  1.00 9.75  ? 263 GLU A CB  1 
ATOM   1969 C  CG  . GLU A 1 263 ? 12.597 6.380   10.625  1.00 9.82  ? 263 GLU A CG  1 
ATOM   1970 C  CD  . GLU A 1 263 ? 12.373 7.496   11.629  1.00 8.20  ? 263 GLU A CD  1 
ATOM   1971 O  OE1 . GLU A 1 263 ? 12.924 7.404   12.750  1.00 7.56  ? 263 GLU A OE1 1 
ATOM   1972 O  OE2 . GLU A 1 263 ? 11.653 8.463   11.295  1.00 9.17  ? 263 GLU A OE2 1 
ATOM   1973 N  N   . ILE A 1 264 ? 16.976 6.434   9.224   1.00 12.72 ? 264 ILE A N   1 
ATOM   1974 C  CA  . ILE A 1 264 ? 18.402 6.154   9.298   1.00 14.02 ? 264 ILE A CA  1 
ATOM   1975 C  C   . ILE A 1 264 ? 19.118 7.501   9.355   1.00 15.30 ? 264 ILE A C   1 
ATOM   1976 O  O   . ILE A 1 264 ? 20.007 7.710   10.185  1.00 16.11 ? 264 ILE A O   1 
ATOM   1977 C  CB  . ILE A 1 264 ? 18.914 5.378   8.059   1.00 13.71 ? 264 ILE A CB  1 
ATOM   1978 C  CG1 . ILE A 1 264 ? 18.268 3.994   7.985   1.00 13.54 ? 264 ILE A CG1 1 
ATOM   1979 C  CG2 . ILE A 1 264 ? 20.432 5.271   8.111   1.00 13.20 ? 264 ILE A CG2 1 
ATOM   1980 C  CD1 . ILE A 1 264 ? 18.545 3.128   9.168   1.00 17.88 ? 264 ILE A CD1 1 
ATOM   1981 N  N   . TYR A 1 265 ? 18.728 8.409   8.464   1.00 16.39 ? 265 TYR A N   1 
ATOM   1982 C  CA  . TYR A 1 265 ? 19.325 9.737   8.432   1.00 16.75 ? 265 TYR A CA  1 
ATOM   1983 C  C   . TYR A 1 265 ? 19.251 10.355  9.816   1.00 17.28 ? 265 TYR A C   1 
ATOM   1984 O  O   . TYR A 1 265 ? 20.265 10.759  10.393  1.00 19.50 ? 265 TYR A O   1 
ATOM   1985 C  CB  . TYR A 1 265 ? 18.583 10.665  7.468   1.00 16.34 ? 265 TYR A CB  1 
ATOM   1986 C  CG  . TYR A 1 265 ? 19.035 12.109  7.598   1.00 18.13 ? 265 TYR A CG  1 
ATOM   1987 C  CD1 . TYR A 1 265 ? 20.288 12.519  7.129   1.00 19.31 ? 265 TYR A CD1 1 
ATOM   1988 C  CD2 . TYR A 1 265 ? 18.241 13.053  8.252   1.00 18.69 ? 265 TYR A CD2 1 
ATOM   1989 C  CE1 . TYR A 1 265 ? 20.737 13.842  7.314   1.00 21.81 ? 265 TYR A CE1 1 
ATOM   1990 C  CE2 . TYR A 1 265 ? 18.677 14.369  8.442   1.00 19.61 ? 265 TYR A CE2 1 
ATOM   1991 C  CZ  . TYR A 1 265 ? 19.922 14.758  7.973   1.00 22.00 ? 265 TYR A CZ  1 
ATOM   1992 O  OH  . TYR A 1 265 ? 20.345 16.058  8.161   1.00 22.20 ? 265 TYR A OH  1 
ATOM   1993 N  N   . LYS A 1 266 ? 18.031 10.416  10.334  1.00 15.71 ? 266 LYS A N   1 
ATOM   1994 C  CA  . LYS A 1 266 ? 17.754 11.001  11.637  1.00 16.71 ? 266 LYS A CA  1 
ATOM   1995 C  C   . LYS A 1 266 ? 18.579 10.493  12.830  1.00 16.66 ? 266 LYS A C   1 
ATOM   1996 O  O   . LYS A 1 266 ? 18.632 11.166  13.856  1.00 16.68 ? 266 LYS A O   1 
ATOM   1997 C  CB  . LYS A 1 266 ? 16.252 10.891  11.910  1.00 16.38 ? 266 LYS A CB  1 
ATOM   1998 C  CG  . LYS A 1 266 ? 15.446 11.629  10.852  1.00 16.78 ? 266 LYS A CG  1 
ATOM   1999 C  CD  . LYS A 1 266 ? 13.960 11.311  10.886  1.00 20.10 ? 266 LYS A CD  1 
ATOM   2000 C  CE  . LYS A 1 266 ? 13.258 12.059  11.985  1.00 21.43 ? 266 LYS A CE  1 
ATOM   2001 N  NZ  . LYS A 1 266 ? 11.831 11.678  12.044  1.00 24.93 ? 266 LYS A NZ  1 
ATOM   2002 N  N   . THR A 1 267 ? 19.221 9.331   12.708  1.00 16.47 ? 267 THR A N   1 
ATOM   2003 C  CA  . THR A 1 267 ? 20.060 8.821   13.795  1.00 16.26 ? 267 THR A CA  1 
ATOM   2004 C  C   . THR A 1 267 ? 21.358 9.621   13.759  1.00 16.99 ? 267 THR A C   1 
ATOM   2005 O  O   . THR A 1 267 ? 22.064 9.728   14.750  1.00 16.31 ? 267 THR A O   1 
ATOM   2006 C  CB  . THR A 1 267 ? 20.440 7.318   13.630  1.00 17.16 ? 267 THR A CB  1 
ATOM   2007 O  OG1 . THR A 1 267 ? 21.231 7.143   12.449  1.00 17.59 ? 267 THR A OG1 1 
ATOM   2008 C  CG2 . THR A 1 267 ? 19.196 6.440   13.552  1.00 18.80 ? 267 THR A CG2 1 
ATOM   2009 N  N   . GLY A 1 268 ? 21.657 10.187  12.593  1.00 17.61 ? 268 GLY A N   1 
ATOM   2010 C  CA  . GLY A 1 268 ? 22.867 10.961  12.431  1.00 16.69 ? 268 GLY A CA  1 
ATOM   2011 C  C   . GLY A 1 268 ? 24.064 10.047  12.509  1.00 16.19 ? 268 GLY A C   1 
ATOM   2012 O  O   . GLY A 1 268 ? 25.200 10.513  12.609  1.00 15.60 ? 268 GLY A O   1 
ATOM   2013 N  N   . LEU A 1 269 ? 23.812 8.742   12.456  1.00 16.27 ? 269 LEU A N   1 
ATOM   2014 C  CA  . LEU A 1 269 ? 24.890 7.764   12.538  1.00 15.99 ? 269 LEU A CA  1 
ATOM   2015 C  C   . LEU A 1 269 ? 25.224 7.042   11.238  1.00 14.99 ? 269 LEU A C   1 
ATOM   2016 O  O   . LEU A 1 269 ? 25.955 6.058   11.256  1.00 14.11 ? 269 LEU A O   1 
ATOM   2017 C  CB  . LEU A 1 269 ? 24.593 6.734   13.644  1.00 16.93 ? 269 LEU A CB  1 
ATOM   2018 C  CG  . LEU A 1 269 ? 24.833 7.192   15.089  1.00 13.01 ? 269 LEU A CG  1 
ATOM   2019 C  CD1 . LEU A 1 269 ? 24.479 6.081   16.038  1.00 15.53 ? 269 LEU A CD1 1 
ATOM   2020 C  CD2 . LEU A 1 269 ? 26.284 7.589   15.269  1.00 13.33 ? 269 LEU A CD2 1 
ATOM   2021 N  N   . LEU A 1 270 ? 24.706 7.516   10.109  1.00 15.25 ? 270 LEU A N   1 
ATOM   2022 C  CA  . LEU A 1 270 ? 25.038 6.863   8.849   1.00 15.41 ? 270 LEU A CA  1 
ATOM   2023 C  C   . LEU A 1 270 ? 26.495 7.151   8.499   1.00 17.60 ? 270 LEU A C   1 
ATOM   2024 O  O   . LEU A 1 270 ? 26.951 8.293   8.585   1.00 18.04 ? 270 LEU A O   1 
ATOM   2025 C  CB  . LEU A 1 270 ? 24.151 7.347   7.699   1.00 14.70 ? 270 LEU A CB  1 
ATOM   2026 C  CG  . LEU A 1 270 ? 24.461 6.653   6.359   1.00 13.25 ? 270 LEU A CG  1 
ATOM   2027 C  CD1 . LEU A 1 270 ? 24.076 5.188   6.464   1.00 11.18 ? 270 LEU A CD1 1 
ATOM   2028 C  CD2 . LEU A 1 270 ? 23.701 7.302   5.217   1.00 11.02 ? 270 LEU A CD2 1 
ATOM   2029 N  N   . SER A 1 271 ? 27.228 6.109   8.117   1.00 17.46 ? 271 SER A N   1 
ATOM   2030 C  CA  . SER A 1 271 ? 28.625 6.267   7.733   1.00 17.61 ? 271 SER A CA  1 
ATOM   2031 C  C   . SER A 1 271 ? 28.905 5.548   6.419   1.00 17.99 ? 271 SER A C   1 
ATOM   2032 O  O   . SER A 1 271 ? 29.771 5.968   5.639   1.00 18.27 ? 271 SER A O   1 
ATOM   2033 C  CB  . SER A 1 271 ? 29.555 5.739   8.836   1.00 16.43 ? 271 SER A CB  1 
ATOM   2034 O  OG  . SER A 1 271 ? 28.899 4.783   9.644   1.00 18.29 ? 271 SER A OG  1 
ATOM   2035 N  N   . GLY A 1 272 ? 28.165 4.469   6.179   1.00 16.99 ? 272 GLY A N   1 
ATOM   2036 C  CA  . GLY A 1 272 ? 28.343 3.693   4.964   1.00 18.09 ? 272 GLY A CA  1 
ATOM   2037 C  C   . GLY A 1 272 ? 27.017 3.444   4.277   1.00 18.22 ? 272 GLY A C   1 
ATOM   2038 O  O   . GLY A 1 272 ? 26.024 3.138   4.936   1.00 17.79 ? 272 GLY A O   1 
ATOM   2039 N  N   . LEU A 1 273 ? 27.005 3.566   2.953   1.00 17.94 ? 273 LEU A N   1 
ATOM   2040 C  CA  . LEU A 1 273 ? 25.785 3.383   2.180   1.00 18.58 ? 273 LEU A CA  1 
ATOM   2041 C  C   . LEU A 1 273 ? 26.034 2.814   0.765   1.00 18.05 ? 273 LEU A C   1 
ATOM   2042 O  O   . LEU A 1 273 ? 26.924 3.264   0.025   1.00 16.97 ? 273 LEU A O   1 
ATOM   2043 C  CB  . LEU A 1 273 ? 25.037 4.732   2.109   1.00 18.15 ? 273 LEU A CB  1 
ATOM   2044 C  CG  . LEU A 1 273 ? 23.615 4.869   1.544   1.00 19.61 ? 273 LEU A CG  1 
ATOM   2045 C  CD1 . LEU A 1 273 ? 23.638 4.668   0.045   1.00 19.04 ? 273 LEU A CD1 1 
ATOM   2046 C  CD2 . LEU A 1 273 ? 22.683 3.875   2.202   1.00 17.94 ? 273 LEU A CD2 1 
ATOM   2047 N  N   . ASP A 1 274 ? 25.241 1.810   0.407   1.00 16.59 ? 274 ASP A N   1 
ATOM   2048 C  CA  . ASP A 1 274 ? 25.344 1.181   -0.904  1.00 15.98 ? 274 ASP A CA  1 
ATOM   2049 C  C   . ASP A 1 274 ? 23.973 1.235   -1.574  1.00 15.30 ? 274 ASP A C   1 
ATOM   2050 O  O   . ASP A 1 274 ? 22.963 0.969   -0.934  1.00 14.41 ? 274 ASP A O   1 
ATOM   2051 C  CB  . ASP A 1 274 ? 25.784 -0.282  -0.771  1.00 16.35 ? 274 ASP A CB  1 
ATOM   2052 C  CG  . ASP A 1 274 ? 27.044 -0.445  0.061   1.00 17.01 ? 274 ASP A CG  1 
ATOM   2053 O  OD1 . ASP A 1 274 ? 28.088 0.135   -0.303  1.00 16.78 ? 274 ASP A OD1 1 
ATOM   2054 O  OD2 . ASP A 1 274 ? 26.991 -1.163  1.079   1.00 20.09 ? 274 ASP A OD2 1 
ATOM   2055 N  N   . ILE A 1 275 ? 23.948 1.602   -2.855  1.00 16.80 ? 275 ILE A N   1 
ATOM   2056 C  CA  . ILE A 1 275 ? 22.710 1.672   -3.638  1.00 16.03 ? 275 ILE A CA  1 
ATOM   2057 C  C   . ILE A 1 275 ? 23.021 0.802   -4.845  1.00 16.93 ? 275 ILE A C   1 
ATOM   2058 O  O   . ILE A 1 275 ? 23.625 1.261   -5.817  1.00 16.92 ? 275 ILE A O   1 
ATOM   2059 C  CB  . ILE A 1 275 ? 22.399 3.124   -4.045  1.00 16.64 ? 275 ILE A CB  1 
ATOM   2060 C  CG1 . ILE A 1 275 ? 22.059 3.918   -2.783  1.00 15.89 ? 275 ILE A CG1 1 
ATOM   2061 C  CG2 . ILE A 1 275 ? 21.225 3.171   -5.030  1.00 16.12 ? 275 ILE A CG2 1 
ATOM   2062 C  CD1 . ILE A 1 275 ? 22.251 5.391   -2.903  1.00 18.00 ? 275 ILE A CD1 1 
ATOM   2063 N  N   . MET A 1 276 ? 22.598 -0.462  -4.761  1.00 17.09 ? 276 MET A N   1 
ATOM   2064 C  CA  . MET A 1 276 ? 22.916 -1.459  -5.772  1.00 16.21 ? 276 MET A CA  1 
ATOM   2065 C  C   . MET A 1 276 ? 21.795 -2.132  -6.522  1.00 15.50 ? 276 MET A C   1 
ATOM   2066 O  O   . MET A 1 276 ? 20.632 -2.054  -6.151  1.00 15.99 ? 276 MET A O   1 
ATOM   2067 C  CB  . MET A 1 276 ? 23.746 -2.573  -5.127  1.00 18.34 ? 276 MET A CB  1 
ATOM   2068 C  CG  . MET A 1 276 ? 24.654 -2.119  -3.986  1.00 19.03 ? 276 MET A CG  1 
ATOM   2069 S  SD  . MET A 1 276 ? 26.011 -1.041  -4.491  1.00 19.22 ? 276 MET A SD  1 
ATOM   2070 C  CE  . MET A 1 276 ? 27.315 -2.277  -4.621  1.00 20.73 ? 276 MET A CE  1 
ATOM   2071 N  N   . GLU A 1 277 ? 22.202 -2.829  -7.579  1.00 16.40 ? 277 GLU A N   1 
ATOM   2072 C  CA  . GLU A 1 277 ? 21.333 -3.621  -8.452  1.00 15.54 ? 277 GLU A CA  1 
ATOM   2073 C  C   . GLU A 1 277 ? 20.400 -2.880  -9.403  1.00 14.85 ? 277 GLU A C   1 
ATOM   2074 O  O   . GLU A 1 277 ? 19.410 -3.447  -9.863  1.00 14.05 ? 277 GLU A O   1 
ATOM   2075 C  CB  . GLU A 1 277 ? 20.529 -4.628  -7.624  1.00 17.15 ? 277 GLU A CB  1 
ATOM   2076 C  CG  . GLU A 1 277 ? 21.383 -5.571  -6.773  1.00 16.51 ? 277 GLU A CG  1 
ATOM   2077 C  CD  . GLU A 1 277 ? 22.231 -6.536  -7.580  1.00 18.11 ? 277 GLU A CD  1 
ATOM   2078 O  OE1 . GLU A 1 277 ? 22.071 -6.604  -8.811  1.00 17.29 ? 277 GLU A OE1 1 
ATOM   2079 O  OE2 . GLU A 1 277 ? 23.059 -7.242  -6.974  1.00 18.30 ? 277 GLU A OE2 1 
ATOM   2080 N  N   . VAL A 1 278 ? 20.708 -1.620  -9.685  1.00 14.14 ? 278 VAL A N   1 
ATOM   2081 C  CA  . VAL A 1 278 ? 19.925 -0.852  -10.646 1.00 16.47 ? 278 VAL A CA  1 
ATOM   2082 C  C   . VAL A 1 278 ? 20.549 -1.199  -12.013 1.00 15.94 ? 278 VAL A C   1 
ATOM   2083 O  O   . VAL A 1 278 ? 21.709 -0.881  -12.272 1.00 16.72 ? 278 VAL A O   1 
ATOM   2084 C  CB  . VAL A 1 278 ? 20.042 0.693   -10.425 1.00 15.63 ? 278 VAL A CB  1 
ATOM   2085 C  CG1 . VAL A 1 278 ? 19.392 1.431   -11.588 1.00 15.05 ? 278 VAL A CG1 1 
ATOM   2086 C  CG2 . VAL A 1 278 ? 19.366 1.098   -9.127  1.00 17.42 ? 278 VAL A CG2 1 
ATOM   2087 N  N   . ASN A 1 279 ? 19.784 -1.866  -12.869 1.00 15.62 ? 279 ASN A N   1 
ATOM   2088 C  CA  . ASN A 1 279 ? 20.261 -2.260  -14.191 1.00 15.64 ? 279 ASN A CA  1 
ATOM   2089 C  C   . ASN A 1 279 ? 19.342 -1.615  -15.242 1.00 17.76 ? 279 ASN A C   1 
ATOM   2090 O  O   . ASN A 1 279 ? 18.312 -2.188  -15.609 1.00 17.93 ? 279 ASN A O   1 
ATOM   2091 C  CB  . ASN A 1 279 ? 20.232 -3.797  -14.293 1.00 15.59 ? 279 ASN A CB  1 
ATOM   2092 C  CG  . ASN A 1 279 ? 20.852 -4.324  -15.584 1.00 14.07 ? 279 ASN A CG  1 
ATOM   2093 O  OD1 . ASN A 1 279 ? 20.957 -3.459  -16.574 1.00 13.35 ? 279 ASN A OD1 1 
ATOM   2094 N  ND2 . ASN A 1 279 ? 21.227 -5.506  -15.684 1.00 14.84 ? 279 ASN A ND2 1 
ATOM   2095 N  N   . PRO A 1 280 ? 19.705 -0.414  -15.748 1.00 18.58 ? 280 PRO A N   1 
ATOM   2096 C  CA  . PRO A 1 280 ? 18.840 0.231   -16.744 1.00 20.25 ? 280 PRO A CA  1 
ATOM   2097 C  C   . PRO A 1 280 ? 18.566 -0.612  -17.999 1.00 22.04 ? 280 PRO A C   1 
ATOM   2098 O  O   . PRO A 1 280 ? 17.590 -0.369  -18.711 1.00 22.41 ? 280 PRO A O   1 
ATOM   2099 C  CB  . PRO A 1 280 ? 19.576 1.539   -17.047 1.00 18.81 ? 280 PRO A CB  1 
ATOM   2100 C  CG  . PRO A 1 280 ? 21.003 1.174   -16.835 1.00 17.98 ? 280 PRO A CG  1 
ATOM   2101 C  CD  . PRO A 1 280 ? 20.956 0.348   -15.573 1.00 17.21 ? 280 PRO A CD  1 
ATOM   2102 N  N   . SER A 1 281 ? 19.416 -1.608  -18.260 1.00 22.31 ? 281 SER A N   1 
ATOM   2103 C  CA  . SER A 1 281 ? 19.236 -2.463  -19.432 1.00 21.64 ? 281 SER A CA  1 
ATOM   2104 C  C   . SER A 1 281 ? 18.115 -3.492  -19.239 1.00 22.44 ? 281 SER A C   1 
ATOM   2105 O  O   . SER A 1 281 ? 17.733 -4.176  -20.189 1.00 21.52 ? 281 SER A O   1 
ATOM   2106 C  CB  . SER A 1 281 ? 20.540 -3.188  -19.773 1.00 21.33 ? 281 SER A CB  1 
ATOM   2107 O  OG  . SER A 1 281 ? 20.690 -4.359  -18.982 1.00 22.76 ? 281 SER A OG  1 
ATOM   2108 N  N   . LEU A 1 282 ? 17.583 -3.603  -18.019 1.00 23.43 ? 282 LEU A N   1 
ATOM   2109 C  CA  . LEU A 1 282 ? 16.505 -4.561  -17.752 1.00 23.92 ? 282 LEU A CA  1 
ATOM   2110 C  C   . LEU A 1 282 ? 15.119 -3.918  -17.763 1.00 24.87 ? 282 LEU A C   1 
ATOM   2111 O  O   . LEU A 1 282 ? 14.117 -4.552  -17.405 1.00 25.65 ? 282 LEU A O   1 
ATOM   2112 C  CB  . LEU A 1 282 ? 16.730 -5.277  -16.418 1.00 23.22 ? 282 LEU A CB  1 
ATOM   2113 C  CG  . LEU A 1 282 ? 17.906 -6.252  -16.387 1.00 25.32 ? 282 LEU A CG  1 
ATOM   2114 C  CD1 . LEU A 1 282 ? 17.951 -6.957  -15.033 1.00 23.61 ? 282 LEU A CD1 1 
ATOM   2115 C  CD2 . LEU A 1 282 ? 17.766 -7.266  -17.522 1.00 25.17 ? 282 LEU A CD2 1 
ATOM   2116 N  N   . GLY A 1 283 ? 15.067 -2.657  -18.178 1.00 25.29 ? 283 GLY A N   1 
ATOM   2117 C  CA  . GLY A 1 283 ? 13.798 -1.964  -18.247 1.00 26.03 ? 283 GLY A CA  1 
ATOM   2118 C  C   . GLY A 1 283 ? 12.998 -2.479  -19.427 1.00 26.59 ? 283 GLY A C   1 
ATOM   2119 O  O   . GLY A 1 283 ? 13.535 -2.663  -20.521 1.00 27.57 ? 283 GLY A O   1 
ATOM   2120 N  N   . LYS A 1 284 ? 11.713 -2.718  -19.193 1.00 26.55 ? 284 LYS A N   1 
ATOM   2121 C  CA  . LYS A 1 284 ? 10.796 -3.211  -20.210 1.00 27.13 ? 284 LYS A CA  1 
ATOM   2122 C  C   . LYS A 1 284 ? 10.563 -2.063  -21.173 1.00 26.88 ? 284 LYS A C   1 
ATOM   2123 O  O   . LYS A 1 284 ? 10.408 -2.264  -22.375 1.00 26.39 ? 284 LYS A O   1 
ATOM   2124 C  CB  . LYS A 1 284 ? 9.470  -3.596  -19.546 1.00 29.95 ? 284 LYS A CB  1 
ATOM   2125 C  CG  . LYS A 1 284 ? 8.701  -4.739  -20.193 1.00 32.32 ? 284 LYS A CG  1 
ATOM   2126 C  CD  . LYS A 1 284 ? 7.577  -5.213  -19.264 1.00 33.91 ? 284 LYS A CD  1 
ATOM   2127 C  CE  . LYS A 1 284 ? 8.119  -5.658  -17.903 1.00 33.69 ? 284 LYS A CE  1 
ATOM   2128 N  NZ  . LYS A 1 284 ? 7.052  -6.130  -16.976 1.00 35.52 ? 284 LYS A NZ  1 
ATOM   2129 N  N   . THR A 1 285 ? 10.545 -0.856  -20.611 1.00 26.08 ? 285 THR A N   1 
ATOM   2130 C  CA  . THR A 1 285 ? 10.318 0.379   -21.352 1.00 24.71 ? 285 THR A CA  1 
ATOM   2131 C  C   . THR A 1 285 ? 11.280 1.471   -20.869 1.00 24.50 ? 285 THR A C   1 
ATOM   2132 O  O   . THR A 1 285 ? 11.995 1.289   -19.885 1.00 24.66 ? 285 THR A O   1 
ATOM   2133 C  CB  . THR A 1 285 ? 8.856  0.862   -21.168 1.00 24.26 ? 285 THR A CB  1 
ATOM   2134 O  OG1 . THR A 1 285 ? 8.498  0.815   -19.777 1.00 24.67 ? 285 THR A OG1 1 
ATOM   2135 C  CG2 . THR A 1 285 ? 7.901  -0.017  -21.953 1.00 22.12 ? 285 THR A CG2 1 
ATOM   2136 N  N   . PRO A 1 286 ? 11.320 2.620   -21.563 1.00 24.25 ? 286 PRO A N   1 
ATOM   2137 C  CA  . PRO A 1 286 ? 12.224 3.691   -21.134 1.00 23.31 ? 286 PRO A CA  1 
ATOM   2138 C  C   . PRO A 1 286 ? 11.811 4.333   -19.810 1.00 23.45 ? 286 PRO A C   1 
ATOM   2139 O  O   . PRO A 1 286 ? 12.661 4.848   -19.074 1.00 23.64 ? 286 PRO A O   1 
ATOM   2140 C  CB  . PRO A 1 286 ? 12.157 4.683   -22.290 1.00 22.53 ? 286 PRO A CB  1 
ATOM   2141 C  CG  . PRO A 1 286 ? 11.851 3.820   -23.458 1.00 22.18 ? 286 PRO A CG  1 
ATOM   2142 C  CD  . PRO A 1 286 ? 10.800 2.900   -22.912 1.00 23.65 ? 286 PRO A CD  1 
ATOM   2143 N  N   . GLU A 1 287 ? 10.511 4.306   -19.511 1.00 21.32 ? 287 GLU A N   1 
ATOM   2144 C  CA  . GLU A 1 287 ? 10.024 4.907   -18.278 1.00 22.29 ? 287 GLU A CA  1 
ATOM   2145 C  C   . GLU A 1 287 ? 10.268 3.990   -17.086 1.00 20.60 ? 287 GLU A C   1 
ATOM   2146 O  O   . GLU A 1 287 ? 10.319 4.451   -15.950 1.00 18.87 ? 287 GLU A O   1 
ATOM   2147 C  CB  . GLU A 1 287 ? 8.533  5.274   -18.401 1.00 23.61 ? 287 GLU A CB  1 
ATOM   2148 C  CG  . GLU A 1 287 ? 7.536  4.249   -17.871 1.00 29.39 ? 287 GLU A CG  1 
ATOM   2149 C  CD  . GLU A 1 287 ? 7.506  4.175   -16.349 1.00 29.62 ? 287 GLU A CD  1 
ATOM   2150 O  OE1 . GLU A 1 287 ? 7.182  5.191   -15.696 1.00 31.12 ? 287 GLU A OE1 1 
ATOM   2151 O  OE2 . GLU A 1 287 ? 7.810  3.095   -15.809 1.00 32.61 ? 287 GLU A OE2 1 
ATOM   2152 N  N   . GLU A 1 288 ? 10.412 2.690   -17.340 1.00 21.43 ? 288 GLU A N   1 
ATOM   2153 C  CA  . GLU A 1 288 ? 10.692 1.754   -16.256 1.00 20.41 ? 288 GLU A CA  1 
ATOM   2154 C  C   . GLU A 1 288 ? 12.106 2.033   -15.767 1.00 17.89 ? 288 GLU A C   1 
ATOM   2155 O  O   . GLU A 1 288 ? 12.391 1.923   -14.587 1.00 15.77 ? 288 GLU A O   1 
ATOM   2156 C  CB  . GLU A 1 288 ? 10.567 0.301   -16.721 1.00 20.09 ? 288 GLU A CB  1 
ATOM   2157 C  CG  . GLU A 1 288 ? 9.146  -0.237  -16.644 1.00 21.80 ? 288 GLU A CG  1 
ATOM   2158 C  CD  . GLU A 1 288 ? 9.080  -1.742  -16.811 1.00 24.05 ? 288 GLU A CD  1 
ATOM   2159 O  OE1 . GLU A 1 288 ? 10.143 -2.392  -16.730 1.00 25.11 ? 288 GLU A OE1 1 
ATOM   2160 O  OE2 . GLU A 1 288 ? 7.970  -2.282  -17.010 1.00 25.15 ? 288 GLU A OE2 1 
ATOM   2161 N  N   . VAL A 1 289 ? 12.984 2.407   -16.689 1.00 18.10 ? 289 VAL A N   1 
ATOM   2162 C  CA  . VAL A 1 289 ? 14.360 2.732   -16.335 1.00 19.02 ? 289 VAL A CA  1 
ATOM   2163 C  C   . VAL A 1 289 ? 14.316 4.001   -15.500 1.00 18.11 ? 289 VAL A C   1 
ATOM   2164 O  O   . VAL A 1 289 ? 15.019 4.131   -14.500 1.00 17.91 ? 289 VAL A O   1 
ATOM   2165 C  CB  . VAL A 1 289 ? 15.235 3.012   -17.582 1.00 18.69 ? 289 VAL A CB  1 
ATOM   2166 C  CG1 . VAL A 1 289 ? 16.672 3.304   -17.150 1.00 20.15 ? 289 VAL A CG1 1 
ATOM   2167 C  CG2 . VAL A 1 289 ? 15.197 1.825   -18.537 1.00 18.00 ? 289 VAL A CG2 1 
ATOM   2168 N  N   . THR A 1 290 ? 13.483 4.938   -15.936 1.00 16.50 ? 290 THR A N   1 
ATOM   2169 C  CA  . THR A 1 290 ? 13.308 6.208   -15.254 1.00 15.85 ? 290 THR A CA  1 
ATOM   2170 C  C   . THR A 1 290 ? 12.720 6.043   -13.845 1.00 14.60 ? 290 THR A C   1 
ATOM   2171 O  O   . THR A 1 290 ? 13.180 6.677   -12.905 1.00 14.10 ? 290 THR A O   1 
ATOM   2172 C  CB  . THR A 1 290 ? 12.407 7.138   -16.114 1.00 16.29 ? 290 THR A CB  1 
ATOM   2173 O  OG1 . THR A 1 290 ? 13.209 7.739   -17.134 1.00 18.59 ? 290 THR A OG1 1 
ATOM   2174 C  CG2 . THR A 1 290 ? 11.749 8.217   -15.278 1.00 15.68 ? 290 THR A CG2 1 
ATOM   2175 N  N   . ARG A 1 291 ? 11.708 5.189   -13.710 1.00 15.24 ? 291 ARG A N   1 
ATOM   2176 C  CA  . ARG A 1 291 ? 11.051 4.939   -12.427 1.00 14.86 ? 291 ARG A CA  1 
ATOM   2177 C  C   . ARG A 1 291 ? 12.014 4.264   -11.459 1.00 14.48 ? 291 ARG A C   1 
ATOM   2178 O  O   . ARG A 1 291 ? 11.958 4.511   -10.256 1.00 14.39 ? 291 ARG A O   1 
ATOM   2179 C  CB  . ARG A 1 291 ? 9.830  4.039   -12.632 1.00 15.72 ? 291 ARG A CB  1 
ATOM   2180 C  CG  . ARG A 1 291 ? 8.954  3.839   -11.397 1.00 17.20 ? 291 ARG A CG  1 
ATOM   2181 C  CD  . ARG A 1 291 ? 8.051  2.617   -11.552 1.00 16.95 ? 291 ARG A CD  1 
ATOM   2182 N  NE  . ARG A 1 291 ? 7.527  2.478   -12.912 1.00 17.47 ? 291 ARG A NE  1 
ATOM   2183 C  CZ  . ARG A 1 291 ? 6.937  1.381   -13.379 1.00 17.29 ? 291 ARG A CZ  1 
ATOM   2184 N  NH1 . ARG A 1 291 ? 6.783  0.319   -12.594 1.00 18.48 ? 291 ARG A NH1 1 
ATOM   2185 N  NH2 . ARG A 1 291 ? 6.522  1.335   -14.639 1.00 17.10 ? 291 ARG A NH2 1 
ATOM   2186 N  N   . THR A 1 292 ? 12.874 3.392   -11.983 1.00 12.73 ? 292 THR A N   1 
ATOM   2187 C  CA  . THR A 1 292 ? 13.857 2.698   -11.156 1.00 12.74 ? 292 THR A CA  1 
ATOM   2188 C  C   . THR A 1 292 ? 14.914 3.674   -10.643 1.00 12.26 ? 292 THR A C   1 
ATOM   2189 O  O   . THR A 1 292 ? 15.094 3.821   -9.440  1.00 10.88 ? 292 THR A O   1 
ATOM   2190 C  CB  . THR A 1 292 ? 14.562 1.575   -11.936 1.00 9.82  ? 292 THR A CB  1 
ATOM   2191 O  OG1 . THR A 1 292 ? 13.616 0.547   -12.251 1.00 14.59 ? 292 THR A OG1 1 
ATOM   2192 C  CG2 . THR A 1 292 ? 15.683 0.961   -11.097 1.00 12.31 ? 292 THR A CG2 1 
ATOM   2193 N  N   . VAL A 1 293 ? 15.602 4.344   -11.571 1.00 14.50 ? 293 VAL A N   1 
ATOM   2194 C  CA  . VAL A 1 293 ? 16.644 5.308   -11.219 1.00 13.52 ? 293 VAL A CA  1 
ATOM   2195 C  C   . VAL A 1 293 ? 16.122 6.453   -10.331 1.00 14.06 ? 293 VAL A C   1 
ATOM   2196 O  O   . VAL A 1 293 ? 16.769 6.812   -9.341  1.00 13.70 ? 293 VAL A O   1 
ATOM   2197 C  CB  . VAL A 1 293 ? 17.306 5.923   -12.490 1.00 14.60 ? 293 VAL A CB  1 
ATOM   2198 C  CG1 . VAL A 1 293 ? 18.507 6.773   -12.093 1.00 14.77 ? 293 VAL A CG1 1 
ATOM   2199 C  CG2 . VAL A 1 293 ? 17.720 4.822   -13.454 1.00 12.65 ? 293 VAL A CG2 1 
ATOM   2200 N  N   . ASN A 1 294 ? 14.963 7.028   -10.664 1.00 14.19 ? 294 ASN A N   1 
ATOM   2201 C  CA  . ASN A 1 294 ? 14.438 8.130   -9.853  1.00 14.60 ? 294 ASN A CA  1 
ATOM   2202 C  C   . ASN A 1 294 ? 14.179 7.707   -8.417  1.00 13.85 ? 294 ASN A C   1 
ATOM   2203 O  O   . ASN A 1 294 ? 14.409 8.480   -7.492  1.00 13.70 ? 294 ASN A O   1 
ATOM   2204 C  CB  . ASN A 1 294 ? 13.139 8.708   -10.440 1.00 16.38 ? 294 ASN A CB  1 
ATOM   2205 C  CG  . ASN A 1 294 ? 13.374 9.537   -11.708 1.00 18.90 ? 294 ASN A CG  1 
ATOM   2206 O  OD1 . ASN A 1 294 ? 14.433 10.149  -11.893 1.00 18.13 ? 294 ASN A OD1 1 
ATOM   2207 N  ND2 . ASN A 1 294 ? 12.370 9.567   -12.577 1.00 17.14 ? 294 ASN A ND2 1 
ATOM   2208 N  N   . THR A 1 295 ? 13.684 6.483   -8.241  1.00 11.80 ? 295 THR A N   1 
ATOM   2209 C  CA  . THR A 1 295 ? 13.399 5.951   -6.914  1.00 12.47 ? 295 THR A CA  1 
ATOM   2210 C  C   . THR A 1 295 ? 14.723 5.753   -6.203  1.00 11.49 ? 295 THR A C   1 
ATOM   2211 O  O   . THR A 1 295 ? 14.843 5.999   -5.008  1.00 10.38 ? 295 THR A O   1 
ATOM   2212 C  CB  . THR A 1 295 ? 12.642 4.605   -6.999  1.00 12.15 ? 295 THR A CB  1 
ATOM   2213 O  OG1 . THR A 1 295 ? 11.326 4.837   -7.517  1.00 13.33 ? 295 THR A OG1 1 
ATOM   2214 C  CG2 . THR A 1 295 ? 12.535 3.952   -5.631  1.00 12.74 ? 295 THR A CG2 1 
ATOM   2215 N  N   . ALA A 1 296 ? 15.723 5.318   -6.957  1.00 11.17 ? 296 ALA A N   1 
ATOM   2216 C  CA  . ALA A 1 296 ? 17.058 5.117   -6.412  1.00 11.24 ? 296 ALA A CA  1 
ATOM   2217 C  C   . ALA A 1 296 ? 17.606 6.460   -5.904  1.00 11.34 ? 296 ALA A C   1 
ATOM   2218 O  O   . ALA A 1 296 ? 18.145 6.542   -4.801  1.00 9.75  ? 296 ALA A O   1 
ATOM   2219 C  CB  . ALA A 1 296 ? 17.987 4.520   -7.497  1.00 11.23 ? 296 ALA A CB  1 
ATOM   2220 N  N   . VAL A 1 297 ? 17.457 7.515   -6.701  1.00 11.41 ? 297 VAL A N   1 
ATOM   2221 C  CA  . VAL A 1 297 ? 17.938 8.843   -6.304  1.00 13.66 ? 297 VAL A CA  1 
ATOM   2222 C  C   . VAL A 1 297 ? 17.220 9.368   -5.058  1.00 13.04 ? 297 VAL A C   1 
ATOM   2223 O  O   . VAL A 1 297 ? 17.858 9.878   -4.136  1.00 12.49 ? 297 VAL A O   1 
ATOM   2224 C  CB  . VAL A 1 297 ? 17.759 9.876   -7.450  1.00 13.62 ? 297 VAL A CB  1 
ATOM   2225 C  CG1 . VAL A 1 297 ? 17.954 11.293  -6.914  1.00 14.68 ? 297 VAL A CG1 1 
ATOM   2226 C  CG2 . VAL A 1 297 ? 18.760 9.581   -8.571  1.00 12.77 ? 297 VAL A CG2 1 
ATOM   2227 N  N   . ALA A 1 298 ? 15.894 9.221   -5.046  1.00 12.68 ? 298 ALA A N   1 
ATOM   2228 C  CA  . ALA A 1 298 ? 15.052 9.671   -3.946  1.00 13.53 ? 298 ALA A CA  1 
ATOM   2229 C  C   . ALA A 1 298 ? 15.467 9.068   -2.612  1.00 14.22 ? 298 ALA A C   1 
ATOM   2230 O  O   . ALA A 1 298 ? 15.523 9.766   -1.606  1.00 13.81 ? 298 ALA A O   1 
ATOM   2231 C  CB  . ALA A 1 298 ? 13.594 9.342   -4.237  1.00 12.18 ? 298 ALA A CB  1 
ATOM   2232 N  N   . ILE A 1 299 ? 15.760 7.772   -2.604  1.00 14.97 ? 299 ILE A N   1 
ATOM   2233 C  CA  . ILE A 1 299 ? 16.177 7.106   -1.374  1.00 16.64 ? 299 ILE A CA  1 
ATOM   2234 C  C   . ILE A 1 299 ? 17.564 7.568   -0.923  1.00 15.78 ? 299 ILE A C   1 
ATOM   2235 O  O   . ILE A 1 299 ? 17.860 7.608   0.278   1.00 15.22 ? 299 ILE A O   1 
ATOM   2236 C  CB  . ILE A 1 299 ? 16.136 5.567   -1.542  1.00 16.57 ? 299 ILE A CB  1 
ATOM   2237 C  CG1 . ILE A 1 299 ? 14.674 5.108   -1.445  1.00 18.55 ? 299 ILE A CG1 1 
ATOM   2238 C  CG2 . ILE A 1 299 ? 17.034 4.879   -0.499  1.00 16.08 ? 299 ILE A CG2 1 
ATOM   2239 C  CD1 . ILE A 1 299 ? 14.475 3.620   -1.452  1.00 22.48 ? 299 ILE A CD1 1 
ATOM   2240 N  N   . THR A 1 300 ? 18.403 7.932   -1.888  1.00 16.50 ? 300 THR A N   1 
ATOM   2241 C  CA  . THR A 1 300 ? 19.754 8.410   -1.601  1.00 14.92 ? 300 THR A CA  1 
ATOM   2242 C  C   . THR A 1 300 ? 19.689 9.774   -0.913  1.00 13.90 ? 300 THR A C   1 
ATOM   2243 O  O   . THR A 1 300 ? 20.352 10.011  0.097   1.00 13.03 ? 300 THR A O   1 
ATOM   2244 C  CB  . THR A 1 300 ? 20.578 8.543   -2.902  1.00 14.48 ? 300 THR A CB  1 
ATOM   2245 O  OG1 . THR A 1 300 ? 20.605 7.276   -3.569  1.00 13.00 ? 300 THR A OG1 1 
ATOM   2246 C  CG2 . THR A 1 300 ? 22.015 8.991   -2.596  1.00 12.34 ? 300 THR A CG2 1 
ATOM   2247 N  N   . LEU A 1 301 ? 18.881 10.665  -1.480  1.00 14.38 ? 301 LEU A N   1 
ATOM   2248 C  CA  . LEU A 1 301 ? 18.705 12.004  -0.948  1.00 13.45 ? 301 LEU A CA  1 
ATOM   2249 C  C   . LEU A 1 301 ? 18.084 11.998  0.448   1.00 13.63 ? 301 LEU A C   1 
ATOM   2250 O  O   . LEU A 1 301 ? 18.308 12.916  1.233   1.00 13.78 ? 301 LEU A O   1 
ATOM   2251 C  CB  . LEU A 1 301 ? 17.852 12.833  -1.914  1.00 14.26 ? 301 LEU A CB  1 
ATOM   2252 C  CG  . LEU A 1 301 ? 18.511 13.047  -3.280  1.00 11.62 ? 301 LEU A CG  1 
ATOM   2253 C  CD1 . LEU A 1 301 ? 17.618 13.893  -4.147  1.00 13.12 ? 301 LEU A CD1 1 
ATOM   2254 C  CD2 . LEU A 1 301 ? 19.866 13.692  -3.092  1.00 9.17  ? 301 LEU A CD2 1 
ATOM   2255 N  N   . ALA A 1 302 ? 17.299 10.971  0.758   1.00 12.20 ? 302 ALA A N   1 
ATOM   2256 C  CA  . ALA A 1 302 ? 16.695 10.878  2.083   1.00 12.57 ? 302 ALA A CA  1 
ATOM   2257 C  C   . ALA A 1 302 ? 17.741 10.381  3.087   1.00 11.23 ? 302 ALA A C   1 
ATOM   2258 O  O   . ALA A 1 302 ? 17.649 10.652  4.278   1.00 12.52 ? 302 ALA A O   1 
ATOM   2259 C  CB  . ALA A 1 302 ? 15.482 9.946   2.063   1.00 11.13 ? 302 ALA A CB  1 
ATOM   2260 N  N   . CYS A 1 303 ? 18.741 9.652   2.608   1.00 13.06 ? 303 CYS A N   1 
ATOM   2261 C  CA  . CYS A 1 303 ? 19.791 9.168   3.496   1.00 14.17 ? 303 CYS A CA  1 
ATOM   2262 C  C   . CYS A 1 303 ? 20.645 10.345  3.924   1.00 13.29 ? 303 CYS A C   1 
ATOM   2263 O  O   . CYS A 1 303 ? 21.379 10.261  4.900   1.00 14.80 ? 303 CYS A O   1 
ATOM   2264 C  CB  . CYS A 1 303 ? 20.680 8.141   2.799   1.00 12.75 ? 303 CYS A CB  1 
ATOM   2265 S  SG  . CYS A 1 303 ? 19.916 6.544   2.575   1.00 16.68 ? 303 CYS A SG  1 
ATOM   2266 N  N   . PHE A 1 304 ? 20.533 11.442  3.185   1.00 14.48 ? 304 PHE A N   1 
ATOM   2267 C  CA  . PHE A 1 304 ? 21.316 12.625  3.480   1.00 14.33 ? 304 PHE A CA  1 
ATOM   2268 C  C   . PHE A 1 304 ? 20.523 13.879  3.823   1.00 14.64 ? 304 PHE A C   1 
ATOM   2269 O  O   . PHE A 1 304 ? 20.979 14.988  3.565   1.00 16.00 ? 304 PHE A O   1 
ATOM   2270 C  CB  . PHE A 1 304 ? 22.285 12.898  2.329   1.00 13.78 ? 304 PHE A CB  1 
ATOM   2271 C  CG  . PHE A 1 304 ? 23.206 11.742  2.031   1.00 13.70 ? 304 PHE A CG  1 
ATOM   2272 C  CD1 . PHE A 1 304 ? 24.096 11.276  2.999   1.00 12.68 ? 304 PHE A CD1 1 
ATOM   2273 C  CD2 . PHE A 1 304 ? 23.182 11.115  0.783   1.00 13.54 ? 304 PHE A CD2 1 
ATOM   2274 C  CE1 . PHE A 1 304 ? 24.945 10.208  2.736   1.00 10.81 ? 304 PHE A CE1 1 
ATOM   2275 C  CE2 . PHE A 1 304 ? 24.033 10.039  0.508   1.00 13.99 ? 304 PHE A CE2 1 
ATOM   2276 C  CZ  . PHE A 1 304 ? 24.918 9.586   1.491   1.00 12.55 ? 304 PHE A CZ  1 
ATOM   2277 N  N   . GLY A 1 305 ? 19.335 13.714  4.399   1.00 14.78 ? 305 GLY A N   1 
ATOM   2278 C  CA  . GLY A 1 305 ? 18.581 14.879  4.818   1.00 14.85 ? 305 GLY A CA  1 
ATOM   2279 C  C   . GLY A 1 305 ? 17.230 15.245  4.239   1.00 15.57 ? 305 GLY A C   1 
ATOM   2280 O  O   . GLY A 1 305 ? 16.408 15.822  4.954   1.00 15.16 ? 305 GLY A O   1 
ATOM   2281 N  N   . LEU A 1 306 ? 16.999 14.948  2.962   1.00 16.36 ? 306 LEU A N   1 
ATOM   2282 C  CA  . LEU A 1 306 ? 15.726 15.280  2.329   1.00 14.91 ? 306 LEU A CA  1 
ATOM   2283 C  C   . LEU A 1 306 ? 14.552 14.650  3.081   1.00 14.77 ? 306 LEU A C   1 
ATOM   2284 O  O   . LEU A 1 306 ? 14.400 13.429  3.093   1.00 15.26 ? 306 LEU A O   1 
ATOM   2285 C  CB  . LEU A 1 306 ? 15.721 14.810  0.870   1.00 15.31 ? 306 LEU A CB  1 
ATOM   2286 C  CG  . LEU A 1 306 ? 15.010 15.701  -0.164  1.00 16.16 ? 306 LEU A CG  1 
ATOM   2287 C  CD1 . LEU A 1 306 ? 14.858 14.926  -1.464  1.00 16.03 ? 306 LEU A CD1 1 
ATOM   2288 C  CD2 . LEU A 1 306 ? 13.639 16.138  0.336   1.00 16.87 ? 306 LEU A CD2 1 
ATOM   2289 N  N   . ALA A 1 307 ? 13.722 15.486  3.706   1.00 12.82 ? 307 ALA A N   1 
ATOM   2290 C  CA  . ALA A 1 307 ? 12.565 15.002  4.452   1.00 11.21 ? 307 ALA A CA  1 
ATOM   2291 C  C   . ALA A 1 307 ? 11.266 15.411  3.765   1.00 11.25 ? 307 ALA A C   1 
ATOM   2292 O  O   . ALA A 1 307 ? 11.145 16.523  3.250   1.00 12.52 ? 307 ALA A O   1 
ATOM   2293 C  CB  . ALA A 1 307 ? 12.598 15.535  5.877   1.00 9.34  ? 307 ALA A CB  1 
ATOM   2294 N  N   . ARG A 1 308 ? 10.295 14.504  3.765   1.00 11.14 ? 308 ARG A N   1 
ATOM   2295 C  CA  . ARG A 1 308 ? 9.002  14.766  3.135   1.00 11.75 ? 308 ARG A CA  1 
ATOM   2296 C  C   . ARG A 1 308 ? 8.208  15.900  3.781   1.00 11.79 ? 308 ARG A C   1 
ATOM   2297 O  O   . ARG A 1 308 ? 7.480  16.610  3.095   1.00 13.17 ? 308 ARG A O   1 
ATOM   2298 C  CB  . ARG A 1 308 ? 8.152  13.493  3.106   1.00 9.52  ? 308 ARG A CB  1 
ATOM   2299 C  CG  . ARG A 1 308 ? 8.493  12.557  1.958   1.00 10.68 ? 308 ARG A CG  1 
ATOM   2300 C  CD  . ARG A 1 308 ? 7.703  11.254  2.027   1.00 7.92  ? 308 ARG A CD  1 
ATOM   2301 N  NE  . ARG A 1 308 ? 8.263  10.315  3.010   1.00 7.14  ? 308 ARG A NE  1 
ATOM   2302 C  CZ  . ARG A 1 308 ? 7.763  9.109   3.266   1.00 5.30  ? 308 ARG A CZ  1 
ATOM   2303 N  NH1 . ARG A 1 308 ? 6.693  8.690   2.612   1.00 6.27  ? 308 ARG A NH1 1 
ATOM   2304 N  NH2 . ARG A 1 308 ? 8.324  8.322   4.176   1.00 7.59  ? 308 ARG A NH2 1 
ATOM   2305 N  N   . GLU A 1 309 ? 8.348  16.079  5.089   1.00 13.31 ? 309 GLU A N   1 
ATOM   2306 C  CA  . GLU A 1 309 ? 7.631  17.147  5.784   1.00 12.03 ? 309 GLU A CA  1 
ATOM   2307 C  C   . GLU A 1 309 ? 8.176  18.512  5.371   1.00 12.40 ? 309 GLU A C   1 
ATOM   2308 O  O   . GLU A 1 309 ? 7.497  19.530  5.487   1.00 12.42 ? 309 GLU A O   1 
ATOM   2309 C  CB  . GLU A 1 309 ? 7.777  16.998  7.299   1.00 12.76 ? 309 GLU A CB  1 
ATOM   2310 C  CG  . GLU A 1 309 ? 9.170  17.302  7.811   1.00 12.41 ? 309 GLU A CG  1 
ATOM   2311 C  CD  . GLU A 1 309 ? 9.186  17.591  9.293   1.00 14.81 ? 309 GLU A CD  1 
ATOM   2312 O  OE1 . GLU A 1 309 ? 8.665  16.763  10.070  1.00 15.09 ? 309 GLU A OE1 1 
ATOM   2313 O  OE2 . GLU A 1 309 ? 9.723  18.649  9.687   1.00 16.23 ? 309 GLU A OE2 1 
ATOM   2314 N  N   . GLY A 1 310 ? 9.415  18.528  4.900   1.00 12.50 ? 310 GLY A N   1 
ATOM   2315 C  CA  . GLY A 1 310 ? 10.020 19.778  4.492   1.00 12.63 ? 310 GLY A CA  1 
ATOM   2316 C  C   . GLY A 1 310 ? 11.406 19.955  5.078   1.00 13.40 ? 310 GLY A C   1 
ATOM   2317 O  O   . GLY A 1 310 ? 11.800 19.251  6.014   1.00 12.33 ? 310 GLY A O   1 
ATOM   2318 N  N   . ASN A 1 311 ? 12.140 20.905  4.505   1.00 14.34 ? 311 ASN A N   1 
ATOM   2319 C  CA  . ASN A 1 311 ? 13.501 21.234  4.924   1.00 15.79 ? 311 ASN A CA  1 
ATOM   2320 C  C   . ASN A 1 311 ? 13.690 22.755  4.796   1.00 17.32 ? 311 ASN A C   1 
ATOM   2321 O  O   . ASN A 1 311 ? 13.192 23.361  3.852   1.00 16.37 ? 311 ASN A O   1 
ATOM   2322 C  CB  . ASN A 1 311 ? 14.550 20.567  3.994   1.00 14.72 ? 311 ASN A CB  1 
ATOM   2323 C  CG  . ASN A 1 311 ? 14.684 19.064  4.196   1.00 12.96 ? 311 ASN A CG  1 
ATOM   2324 O  OD1 . ASN A 1 311 ? 13.880 18.280  3.710   1.00 16.01 ? 311 ASN A OD1 1 
ATOM   2325 N  ND2 . ASN A 1 311 ? 15.723 18.662  4.918   1.00 17.48 ? 311 ASN A ND2 1 
ATOM   2326 N  N   . HIS A 1 312 ? 14.389 23.376  5.741   1.00 18.72 ? 312 HIS A N   1 
ATOM   2327 C  CA  . HIS A 1 312 ? 14.691 24.803  5.626   1.00 22.52 ? 312 HIS A CA  1 
ATOM   2328 C  C   . HIS A 1 312 ? 16.016 25.081  6.321   1.00 24.47 ? 312 HIS A C   1 
ATOM   2329 O  O   . HIS A 1 312 ? 16.389 24.382  7.265   1.00 26.52 ? 312 HIS A O   1 
ATOM   2330 C  CB  . HIS A 1 312 ? 13.572 25.697  6.198   1.00 21.65 ? 312 HIS A CB  1 
ATOM   2331 C  CG  . HIS A 1 312 ? 13.527 25.762  7.692   1.00 19.67 ? 312 HIS A CG  1 
ATOM   2332 N  ND1 . HIS A 1 312 ? 12.857 24.833  8.459   1.00 19.29 ? 312 HIS A ND1 1 
ATOM   2333 C  CD2 . HIS A 1 312 ? 14.058 26.654  8.562   1.00 18.38 ? 312 HIS A CD2 1 
ATOM   2334 C  CE1 . HIS A 1 312 ? 12.977 25.150  9.736   1.00 17.78 ? 312 HIS A CE1 1 
ATOM   2335 N  NE2 . HIS A 1 312 ? 13.702 26.250  9.825   1.00 15.81 ? 312 HIS A NE2 1 
ATOM   2336 N  N   . LYS A 1 313 ? 16.739 26.083  5.841   1.00 20.00 ? 313 LYS A N   1 
ATOM   2337 C  CA  . LYS A 1 313 ? 18.028 26.421  6.433   1.00 22.65 ? 313 LYS A CA  1 
ATOM   2338 C  C   . LYS A 1 313 ? 17.820 27.216  7.721   1.00 23.73 ? 313 LYS A C   1 
ATOM   2339 O  O   . LYS A 1 313 ? 16.736 27.743  7.960   1.00 23.10 ? 313 LYS A O   1 
ATOM   2340 C  CB  . LYS A 1 313 ? 18.858 27.238  5.443   1.00 23.22 ? 313 LYS A CB  1 
ATOM   2341 C  CG  . LYS A 1 313 ? 18.882 26.654  4.031   1.00 24.60 ? 313 LYS A CG  1 
ATOM   2342 C  CD  . LYS A 1 313 ? 19.782 27.470  3.114   1.00 26.54 ? 313 LYS A CD  1 
ATOM   2343 C  CE  . LYS A 1 313 ? 19.636 27.032  1.660   1.00 27.25 ? 313 LYS A CE  1 
ATOM   2344 N  NZ  . LYS A 1 313 ? 18.277 27.347  1.116   1.00 29.53 ? 313 LYS A NZ  1 
ATOM   2345 N  N   . PRO A 1 314 ? 18.848 27.285  8.585   1.00 24.70 ? 314 PRO A N   1 
ATOM   2346 C  CA  . PRO A 1 314 ? 18.741 28.034  9.849   1.00 24.66 ? 314 PRO A CA  1 
ATOM   2347 C  C   . PRO A 1 314 ? 18.731 29.549  9.602   1.00 24.04 ? 314 PRO A C   1 
ATOM   2348 O  O   . PRO A 1 314 ? 19.738 30.223  9.822   1.00 23.92 ? 314 PRO A O   1 
ATOM   2349 C  CB  . PRO A 1 314 ? 19.987 27.594  10.622  1.00 25.06 ? 314 PRO A CB  1 
ATOM   2350 C  CG  . PRO A 1 314 ? 20.269 26.222  10.074  1.00 24.44 ? 314 PRO A CG  1 
ATOM   2351 C  CD  . PRO A 1 314 ? 20.040 26.419  8.592   1.00 24.55 ? 314 PRO A CD  1 
ATOM   2352 N  N   . ILE A 1 315 ? 17.591 30.070  9.150   1.00 23.57 ? 315 ILE A N   1 
ATOM   2353 C  CA  . ILE A 1 315 ? 17.444 31.491  8.847   1.00 21.85 ? 315 ILE A CA  1 
ATOM   2354 C  C   . ILE A 1 315 ? 15.968 31.928  8.915   1.00 18.48 ? 315 ILE A C   1 
ATOM   2355 O  O   . ILE A 1 315 ? 15.061 31.091  8.899   1.00 16.24 ? 315 ILE A O   1 
ATOM   2356 C  CB  . ILE A 1 315 ? 18.013 31.798  7.433   1.00 23.87 ? 315 ILE A CB  1 
ATOM   2357 C  CG1 . ILE A 1 315 ? 18.371 33.285  7.317   1.00 25.49 ? 315 ILE A CG1 1 
ATOM   2358 C  CG2 . ILE A 1 315 ? 17.000 31.393  6.365   1.00 24.51 ? 315 ILE A CG2 1 
ATOM   2359 C  CD1 . ILE A 1 315 ? 19.098 33.645  6.028   1.00 27.92 ? 315 ILE A CD1 1 
ATOM   2360 N  N   . ASP A 1 316 ? 15.723 33.236  8.979   1.00 16.64 ? 316 ASP A N   1 
ATOM   2361 C  CA  . ASP A 1 316 ? 14.349 33.735  9.066   1.00 16.43 ? 316 ASP A CA  1 
ATOM   2362 C  C   . ASP A 1 316 ? 13.677 34.013  7.725   1.00 15.83 ? 316 ASP A C   1 
ATOM   2363 O  O   . ASP A 1 316 ? 13.697 35.131  7.216   1.00 14.77 ? 316 ASP A O   1 
ATOM   2364 C  CB  . ASP A 1 316 ? 14.302 34.989  9.931   1.00 17.51 ? 316 ASP A CB  1 
ATOM   2365 C  CG  . ASP A 1 316 ? 12.882 35.436  10.229  1.00 17.61 ? 316 ASP A CG  1 
ATOM   2366 O  OD1 . ASP A 1 316 ? 12.743 36.404  11.008  1.00 18.04 ? 316 ASP A OD1 1 
ATOM   2367 O  OD2 . ASP A 1 316 ? 11.911 34.835  9.697   1.00 15.57 ? 316 ASP A OD2 1 
ATOM   2368 N  N   . TYR A 1 317 ? 13.053 32.974  7.188   1.00 15.07 ? 317 TYR A N   1 
ATOM   2369 C  CA  . TYR A 1 317 ? 12.349 33.021  5.924   1.00 13.43 ? 317 TYR A CA  1 
ATOM   2370 C  C   . TYR A 1 317 ? 11.280 34.102  5.771   1.00 13.16 ? 317 TYR A C   1 
ATOM   2371 O  O   . TYR A 1 317 ? 10.891 34.429  4.652   1.00 13.27 ? 317 TYR A O   1 
ATOM   2372 C  CB  . TYR A 1 317 ? 11.756 31.638  5.645   1.00 12.04 ? 317 TYR A CB  1 
ATOM   2373 C  CG  . TYR A 1 317 ? 12.787 30.656  5.149   1.00 13.71 ? 317 TYR A CG  1 
ATOM   2374 C  CD1 . TYR A 1 317 ? 13.099 30.569  3.789   1.00 11.86 ? 317 TYR A CD1 1 
ATOM   2375 C  CD2 . TYR A 1 317 ? 13.482 29.840  6.034   1.00 11.58 ? 317 TYR A CD2 1 
ATOM   2376 C  CE1 . TYR A 1 317 ? 14.084 29.686  3.325   1.00 13.05 ? 317 TYR A CE1 1 
ATOM   2377 C  CE2 . TYR A 1 317 ? 14.467 28.960  5.583   1.00 12.98 ? 317 TYR A CE2 1 
ATOM   2378 C  CZ  . TYR A 1 317 ? 14.755 28.889  4.232   1.00 13.06 ? 317 TYR A CZ  1 
ATOM   2379 O  OH  . TYR A 1 317 ? 15.689 27.996  3.789   1.00 12.88 ? 317 TYR A OH  1 
ATOM   2380 N  N   . LEU A 1 318 ? 10.802 34.663  6.876   1.00 12.47 ? 318 LEU A N   1 
ATOM   2381 C  CA  . LEU A 1 318 ? 9.792  35.710  6.787   1.00 12.58 ? 318 LEU A CA  1 
ATOM   2382 C  C   . LEU A 1 318 ? 10.412 37.104  6.858   1.00 13.07 ? 318 LEU A C   1 
ATOM   2383 O  O   . LEU A 1 318 ? 11.577 37.242  7.293   1.00 15.54 ? 318 LEU A O   1 
ATOM   2384 C  CB  . LEU A 1 318 ? 8.744  35.567  7.896   1.00 13.52 ? 318 LEU A CB  1 
ATOM   2385 C  CG  . LEU A 1 318 ? 7.671  34.480  7.771   1.00 11.62 ? 318 LEU A CG  1 
ATOM   2386 C  CD1 . LEU A 1 318 ? 6.635  34.701  8.863   1.00 12.35 ? 318 LEU A CD1 1 
ATOM   2387 C  CD2 . LEU A 1 318 ? 6.997  34.527  6.407   1.00 12.25 ? 318 LEU A CD2 1 
ATOM   2388 N  N   . SER B 1 5   ? 20.665 -48.596 -25.234 1.00 43.47 ? 5   SER B N   1 
ATOM   2389 C  CA  . SER B 1 5   ? 21.153 -47.958 -26.483 1.00 41.92 ? 5   SER B CA  1 
ATOM   2390 C  C   . SER B 1 5   ? 20.422 -46.643 -26.710 1.00 42.78 ? 5   SER B C   1 
ATOM   2391 O  O   . SER B 1 5   ? 19.644 -46.194 -25.860 1.00 42.24 ? 5   SER B O   1 
ATOM   2392 C  CB  . SER B 1 5   ? 20.933 -48.888 -27.690 1.00 41.67 ? 5   SER B CB  1 
ATOM   2393 O  OG  . SER B 1 5   ? 19.561 -49.011 -28.024 1.00 38.96 ? 5   SER B OG  1 
ATOM   2394 N  N   . ARG B 1 6   ? 20.692 -46.028 -27.857 1.00 42.95 ? 6   ARG B N   1 
ATOM   2395 C  CA  . ARG B 1 6   ? 20.071 -44.767 -28.223 1.00 43.45 ? 6   ARG B CA  1 
ATOM   2396 C  C   . ARG B 1 6   ? 19.464 -44.818 -29.615 1.00 42.75 ? 6   ARG B C   1 
ATOM   2397 O  O   . ARG B 1 6   ? 20.158 -45.042 -30.612 1.00 42.06 ? 6   ARG B O   1 
ATOM   2398 C  CB  . ARG B 1 6   ? 21.082 -43.625 -28.117 1.00 43.90 ? 6   ARG B CB  1 
ATOM   2399 C  CG  . ARG B 1 6   ? 21.265 -43.160 -26.693 1.00 45.88 ? 6   ARG B CG  1 
ATOM   2400 C  CD  . ARG B 1 6   ? 19.907 -42.840 -26.105 1.00 47.76 ? 6   ARG B CD  1 
ATOM   2401 N  NE  . ARG B 1 6   ? 19.934 -42.679 -24.656 1.00 48.96 ? 6   ARG B NE  1 
ATOM   2402 C  CZ  . ARG B 1 6   ? 18.840 -42.547 -23.912 1.00 49.61 ? 6   ARG B CZ  1 
ATOM   2403 N  NH1 . ARG B 1 6   ? 17.646 -42.558 -24.487 1.00 49.01 ? 6   ARG B NH1 1 
ATOM   2404 N  NH2 . ARG B 1 6   ? 18.934 -42.408 -22.595 1.00 49.59 ? 6   ARG B NH2 1 
ATOM   2405 N  N   . THR B 1 7   ? 18.150 -44.621 -29.661 1.00 41.69 ? 7   THR B N   1 
ATOM   2406 C  CA  . THR B 1 7   ? 17.401 -44.639 -30.907 1.00 39.87 ? 7   THR B CA  1 
ATOM   2407 C  C   . THR B 1 7   ? 17.362 -43.243 -31.519 1.00 38.62 ? 7   THR B C   1 
ATOM   2408 O  O   . THR B 1 7   ? 17.320 -42.245 -30.799 1.00 37.42 ? 7   THR B O   1 
ATOM   2409 C  CB  . THR B 1 7   ? 15.959 -45.126 -30.671 1.00 39.99 ? 7   THR B CB  1 
ATOM   2410 O  OG1 . THR B 1 7   ? 15.988 -46.412 -30.038 1.00 40.04 ? 7   THR B OG1 1 
ATOM   2411 C  CG2 . THR B 1 7   ? 15.212 -45.232 -31.993 1.00 39.75 ? 7   THR B CG2 1 
ATOM   2412 N  N   . ILE B 1 8   ? 17.377 -43.186 -32.850 1.00 37.85 ? 8   ILE B N   1 
ATOM   2413 C  CA  . ILE B 1 8   ? 17.357 -41.915 -33.572 1.00 35.07 ? 8   ILE B CA  1 
ATOM   2414 C  C   . ILE B 1 8   ? 16.035 -41.712 -34.307 1.00 33.26 ? 8   ILE B C   1 
ATOM   2415 O  O   . ILE B 1 8   ? 15.322 -42.669 -34.613 1.00 34.15 ? 8   ILE B O   1 
ATOM   2416 C  CB  . ILE B 1 8   ? 18.489 -41.831 -34.636 1.00 34.23 ? 8   ILE B CB  1 
ATOM   2417 C  CG1 . ILE B 1 8   ? 19.654 -42.752 -34.268 1.00 33.68 ? 8   ILE B CG1 1 
ATOM   2418 C  CG2 . ILE B 1 8   ? 18.965 -40.394 -34.763 1.00 34.17 ? 8   ILE B CG2 1 
ATOM   2419 C  CD1 . ILE B 1 8   ? 20.311 -42.428 -32.959 1.00 34.18 ? 8   ILE B CD1 1 
ATOM   2420 N  N   . GLY B 1 9   ? 15.724 -40.452 -34.586 1.00 31.01 ? 9   GLY B N   1 
ATOM   2421 C  CA  . GLY B 1 9   ? 14.514 -40.115 -35.306 1.00 27.12 ? 9   GLY B CA  1 
ATOM   2422 C  C   . GLY B 1 9   ? 14.895 -39.138 -36.395 1.00 25.14 ? 9   GLY B C   1 
ATOM   2423 O  O   . GLY B 1 9   ? 14.778 -37.929 -36.214 1.00 24.26 ? 9   GLY B O   1 
ATOM   2424 N  N   . ILE B 1 10  ? 15.360 -39.663 -37.526 1.00 24.22 ? 10  ILE B N   1 
ATOM   2425 C  CA  . ILE B 1 10  ? 15.785 -38.823 -38.644 1.00 23.13 ? 10  ILE B CA  1 
ATOM   2426 C  C   . ILE B 1 10  ? 14.614 -38.037 -39.250 1.00 22.71 ? 10  ILE B C   1 
ATOM   2427 O  O   . ILE B 1 10  ? 13.568 -38.599 -39.580 1.00 23.64 ? 10  ILE B O   1 
ATOM   2428 C  CB  . ILE B 1 10  ? 16.451 -39.671 -39.772 1.00 22.66 ? 10  ILE B CB  1 
ATOM   2429 C  CG1 . ILE B 1 10  ? 17.378 -40.736 -39.174 1.00 22.57 ? 10  ILE B CG1 1 
ATOM   2430 C  CG2 . ILE B 1 10  ? 17.227 -38.760 -40.713 1.00 20.08 ? 10  ILE B CG2 1 
ATOM   2431 C  CD1 . ILE B 1 10  ? 18.609 -40.198 -38.470 1.00 21.11 ? 10  ILE B CD1 1 
ATOM   2432 N  N   . ILE B 1 11  ? 14.794 -36.730 -39.386 1.00 22.65 ? 11  ILE B N   1 
ATOM   2433 C  CA  . ILE B 1 11  ? 13.772 -35.867 -39.963 1.00 21.37 ? 11  ILE B CA  1 
ATOM   2434 C  C   . ILE B 1 11  ? 14.426 -34.980 -41.018 1.00 20.99 ? 11  ILE B C   1 
ATOM   2435 O  O   . ILE B 1 11  ? 15.408 -34.288 -40.739 1.00 21.35 ? 11  ILE B O   1 
ATOM   2436 C  CB  . ILE B 1 11  ? 13.116 -34.962 -38.888 1.00 21.40 ? 11  ILE B CB  1 
ATOM   2437 C  CG1 . ILE B 1 11  ? 12.250 -35.810 -37.951 1.00 20.87 ? 11  ILE B CG1 1 
ATOM   2438 C  CG2 . ILE B 1 11  ? 12.304 -33.854 -39.563 1.00 21.18 ? 11  ILE B CG2 1 
ATOM   2439 C  CD1 . ILE B 1 11  ? 11.680 -35.044 -36.775 1.00 22.05 ? 11  ILE B CD1 1 
ATOM   2440 N  N   . GLY B 1 12  ? 13.884 -35.012 -42.230 1.00 21.18 ? 12  GLY B N   1 
ATOM   2441 C  CA  . GLY B 1 12  ? 14.423 -34.198 -43.300 1.00 20.53 ? 12  GLY B CA  1 
ATOM   2442 C  C   . GLY B 1 12  ? 13.754 -32.842 -43.339 1.00 19.63 ? 12  GLY B C   1 
ATOM   2443 O  O   . GLY B 1 12  ? 12.535 -32.744 -43.256 1.00 20.24 ? 12  GLY B O   1 
ATOM   2444 N  N   . ALA B 1 13  ? 14.556 -31.792 -43.462 1.00 20.39 ? 13  ALA B N   1 
ATOM   2445 C  CA  . ALA B 1 13  ? 14.034 -30.433 -43.506 1.00 18.68 ? 13  ALA B CA  1 
ATOM   2446 C  C   . ALA B 1 13  ? 14.698 -29.605 -44.603 1.00 19.14 ? 13  ALA B C   1 
ATOM   2447 O  O   . ALA B 1 13  ? 15.489 -28.702 -44.310 1.00 18.22 ? 13  ALA B O   1 
ATOM   2448 C  CB  . ALA B 1 13  ? 14.232 -29.755 -42.151 1.00 20.79 ? 13  ALA B CB  1 
ATOM   2449 N  N   . PRO B 1 14  ? 14.382 -29.904 -45.880 1.00 19.15 ? 14  PRO B N   1 
ATOM   2450 C  CA  . PRO B 1 14  ? 14.917 -29.217 -47.062 1.00 19.88 ? 14  PRO B CA  1 
ATOM   2451 C  C   . PRO B 1 14  ? 14.389 -27.790 -47.296 1.00 22.19 ? 14  PRO B C   1 
ATOM   2452 O  O   . PRO B 1 14  ? 14.091 -27.397 -48.426 1.00 21.85 ? 14  PRO B O   1 
ATOM   2453 C  CB  . PRO B 1 14  ? 14.557 -30.168 -48.201 1.00 18.90 ? 14  PRO B CB  1 
ATOM   2454 C  CG  . PRO B 1 14  ? 13.288 -30.798 -47.726 1.00 16.81 ? 14  PRO B CG  1 
ATOM   2455 C  CD  . PRO B 1 14  ? 13.593 -31.085 -46.282 1.00 17.78 ? 14  PRO B CD  1 
ATOM   2456 N  N   . PHE B 1 15  ? 14.288 -27.024 -46.215 1.00 23.10 ? 15  PHE B N   1 
ATOM   2457 C  CA  . PHE B 1 15  ? 13.815 -25.650 -46.269 1.00 23.00 ? 15  PHE B CA  1 
ATOM   2458 C  C   . PHE B 1 15  ? 15.014 -24.704 -46.425 1.00 24.43 ? 15  PHE B C   1 
ATOM   2459 O  O   . PHE B 1 15  ? 16.018 -24.834 -45.705 1.00 23.34 ? 15  PHE B O   1 
ATOM   2460 C  CB  . PHE B 1 15  ? 13.051 -25.327 -44.983 1.00 22.85 ? 15  PHE B CB  1 
ATOM   2461 C  CG  . PHE B 1 15  ? 12.459 -23.958 -44.961 1.00 22.21 ? 15  PHE B CG  1 
ATOM   2462 C  CD1 . PHE B 1 15  ? 11.379 -23.642 -45.774 1.00 22.27 ? 15  PHE B CD1 1 
ATOM   2463 C  CD2 . PHE B 1 15  ? 12.997 -22.970 -44.150 1.00 24.50 ? 15  PHE B CD2 1 
ATOM   2464 C  CE1 . PHE B 1 15  ? 10.845 -22.363 -45.781 1.00 20.79 ? 15  PHE B CE1 1 
ATOM   2465 C  CE2 . PHE B 1 15  ? 12.466 -21.679 -44.152 1.00 22.59 ? 15  PHE B CE2 1 
ATOM   2466 C  CZ  . PHE B 1 15  ? 11.392 -21.380 -44.969 1.00 22.87 ? 15  PHE B CZ  1 
ATOM   2467 N  N   . SER B 1 16  ? 14.900 -23.752 -47.355 1.00 23.88 ? 16  SER B N   1 
ATOM   2468 C  CA  . SER B 1 16  ? 15.974 -22.795 -47.636 1.00 23.92 ? 16  SER B CA  1 
ATOM   2469 C  C   . SER B 1 16  ? 15.542 -21.344 -47.545 1.00 24.24 ? 16  SER B C   1 
ATOM   2470 O  O   . SER B 1 16  ? 16.377 -20.443 -47.632 1.00 24.88 ? 16  SER B O   1 
ATOM   2471 C  CB  . SER B 1 16  ? 16.525 -23.008 -49.047 1.00 23.03 ? 16  SER B CB  1 
ATOM   2472 O  OG  . SER B 1 16  ? 15.603 -22.520 -50.015 1.00 23.86 ? 16  SER B OG  1 
ATOM   2473 N  N   . LYS B 1 17  ? 14.246 -21.114 -47.386 1.00 23.39 ? 17  LYS B N   1 
ATOM   2474 C  CA  . LYS B 1 17  ? 13.729 -19.755 -47.345 1.00 23.81 ? 17  LYS B CA  1 
ATOM   2475 C  C   . LYS B 1 17  ? 14.070 -18.930 -46.106 1.00 23.10 ? 17  LYS B C   1 
ATOM   2476 O  O   . LYS B 1 17  ? 13.511 -17.851 -45.906 1.00 23.18 ? 17  LYS B O   1 
ATOM   2477 C  CB  . LYS B 1 17  ? 12.213 -19.774 -47.568 1.00 24.58 ? 17  LYS B CB  1 
ATOM   2478 C  CG  . LYS B 1 17  ? 11.801 -20.384 -48.902 1.00 27.05 ? 17  LYS B CG  1 
ATOM   2479 C  CD  . LYS B 1 17  ? 10.288 -20.374 -49.073 1.00 28.64 ? 17  LYS B CD  1 
ATOM   2480 C  CE  . LYS B 1 17  ? 9.872  -20.965 -50.411 1.00 28.71 ? 17  LYS B CE  1 
ATOM   2481 N  NZ  . LYS B 1 17  ? 8.401  -20.864 -50.638 1.00 28.69 ? 17  LYS B NZ  1 
ATOM   2482 N  N   . GLY B 1 18  ? 14.984 -19.423 -45.281 1.00 21.21 ? 18  GLY B N   1 
ATOM   2483 C  CA  . GLY B 1 18  ? 15.377 -18.676 -44.100 1.00 20.37 ? 18  GLY B CA  1 
ATOM   2484 C  C   . GLY B 1 18  ? 16.552 -17.787 -44.456 1.00 20.25 ? 18  GLY B C   1 
ATOM   2485 O  O   . GLY B 1 18  ? 17.025 -16.966 -43.657 1.00 20.49 ? 18  GLY B O   1 
ATOM   2486 N  N   . GLN B 1 19  ? 17.032 -17.958 -45.682 1.00 19.50 ? 19  GLN B N   1 
ATOM   2487 C  CA  . GLN B 1 19  ? 18.163 -17.182 -46.175 1.00 19.65 ? 19  GLN B CA  1 
ATOM   2488 C  C   . GLN B 1 19  ? 18.205 -17.218 -47.707 1.00 19.51 ? 19  GLN B C   1 
ATOM   2489 O  O   . GLN B 1 19  ? 17.580 -18.076 -48.335 1.00 18.74 ? 19  GLN B O   1 
ATOM   2490 C  CB  . GLN B 1 19  ? 19.460 -17.721 -45.559 1.00 19.14 ? 19  GLN B CB  1 
ATOM   2491 C  CG  . GLN B 1 19  ? 19.592 -19.239 -45.593 1.00 17.86 ? 19  GLN B CG  1 
ATOM   2492 C  CD  . GLN B 1 19  ? 20.087 -19.743 -46.931 1.00 16.62 ? 19  GLN B CD  1 
ATOM   2493 O  OE1 . GLN B 1 19  ? 21.232 -19.501 -47.313 1.00 15.68 ? 19  GLN B OE1 1 
ATOM   2494 N  NE2 . GLN B 1 19  ? 19.226 -20.439 -47.651 1.00 16.25 ? 19  GLN B NE2 1 
ATOM   2495 N  N   . PRO B 1 20  ? 18.937 -16.280 -48.326 1.00 20.06 ? 20  PRO B N   1 
ATOM   2496 C  CA  . PRO B 1 20  ? 19.074 -16.168 -49.784 1.00 20.31 ? 20  PRO B CA  1 
ATOM   2497 C  C   . PRO B 1 20  ? 19.356 -17.413 -50.643 1.00 19.66 ? 20  PRO B C   1 
ATOM   2498 O  O   . PRO B 1 20  ? 18.561 -17.749 -51.527 1.00 21.02 ? 20  PRO B O   1 
ATOM   2499 C  CB  . PRO B 1 20  ? 20.147 -15.083 -49.947 1.00 19.32 ? 20  PRO B CB  1 
ATOM   2500 C  CG  . PRO B 1 20  ? 20.902 -15.132 -48.645 1.00 20.65 ? 20  PRO B CG  1 
ATOM   2501 C  CD  . PRO B 1 20  ? 19.805 -15.301 -47.649 1.00 20.80 ? 20  PRO B CD  1 
ATOM   2502 N  N   . ARG B 1 21  ? 20.474 -18.087 -50.398 1.00 19.02 ? 21  ARG B N   1 
ATOM   2503 C  CA  . ARG B 1 21  ? 20.865 -19.270 -51.181 1.00 19.13 ? 21  ARG B CA  1 
ATOM   2504 C  C   . ARG B 1 21  ? 19.974 -20.528 -51.066 1.00 19.87 ? 21  ARG B C   1 
ATOM   2505 O  O   . ARG B 1 21  ? 19.759 -21.068 -49.978 1.00 20.73 ? 21  ARG B O   1 
ATOM   2506 C  CB  . ARG B 1 21  ? 22.317 -19.610 -50.844 1.00 18.57 ? 21  ARG B CB  1 
ATOM   2507 C  CG  . ARG B 1 21  ? 23.276 -18.515 -51.292 1.00 18.23 ? 21  ARG B CG  1 
ATOM   2508 C  CD  . ARG B 1 21  ? 24.187 -17.998 -50.193 1.00 20.39 ? 21  ARG B CD  1 
ATOM   2509 N  NE  . ARG B 1 21  ? 23.483 -17.260 -49.146 1.00 22.44 ? 21  ARG B NE  1 
ATOM   2510 C  CZ  . ARG B 1 21  ? 24.093 -16.564 -48.191 1.00 22.17 ? 21  ARG B CZ  1 
ATOM   2511 N  NH1 . ARG B 1 21  ? 25.413 -16.515 -48.163 1.00 23.11 ? 21  ARG B NH1 1 
ATOM   2512 N  NH2 . ARG B 1 21  ? 23.392 -15.932 -47.256 1.00 20.98 ? 21  ARG B NH2 1 
ATOM   2513 N  N   . GLY B 1 22  ? 19.473 -21.002 -52.205 1.00 18.98 ? 22  GLY B N   1 
ATOM   2514 C  CA  . GLY B 1 22  ? 18.602 -22.166 -52.213 1.00 18.04 ? 22  GLY B CA  1 
ATOM   2515 C  C   . GLY B 1 22  ? 19.189 -23.570 -52.126 1.00 16.50 ? 22  GLY B C   1 
ATOM   2516 O  O   . GLY B 1 22  ? 18.490 -24.500 -51.736 1.00 16.24 ? 22  GLY B O   1 
ATOM   2517 N  N   . GLY B 1 23  ? 20.455 -23.736 -52.485 1.00 16.90 ? 23  GLY B N   1 
ATOM   2518 C  CA  . GLY B 1 23  ? 21.066 -25.053 -52.432 1.00 18.43 ? 23  GLY B CA  1 
ATOM   2519 C  C   . GLY B 1 23  ? 21.112 -25.754 -51.077 1.00 19.37 ? 23  GLY B C   1 
ATOM   2520 O  O   . GLY B 1 23  ? 21.529 -26.915 -50.988 1.00 19.09 ? 23  GLY B O   1 
ATOM   2521 N  N   . VAL B 1 24  ? 20.702 -25.071 -50.014 1.00 21.42 ? 24  VAL B N   1 
ATOM   2522 C  CA  . VAL B 1 24  ? 20.715 -25.693 -48.694 1.00 22.19 ? 24  VAL B CA  1 
ATOM   2523 C  C   . VAL B 1 24  ? 19.618 -26.760 -48.632 1.00 22.75 ? 24  VAL B C   1 
ATOM   2524 O  O   . VAL B 1 24  ? 19.641 -27.654 -47.789 1.00 22.62 ? 24  VAL B O   1 
ATOM   2525 C  CB  . VAL B 1 24  ? 20.524 -24.636 -47.557 1.00 22.95 ? 24  VAL B CB  1 
ATOM   2526 C  CG1 . VAL B 1 24  ? 21.544 -23.525 -47.717 1.00 23.25 ? 24  VAL B CG1 1 
ATOM   2527 C  CG2 . VAL B 1 24  ? 19.132 -24.064 -47.569 1.00 20.98 ? 24  VAL B CG2 1 
ATOM   2528 N  N   . GLU B 1 25  ? 18.665 -26.668 -49.549 1.00 23.40 ? 25  GLU B N   1 
ATOM   2529 C  CA  . GLU B 1 25  ? 17.581 -27.634 -49.608 1.00 23.79 ? 25  GLU B CA  1 
ATOM   2530 C  C   . GLU B 1 25  ? 18.174 -29.005 -49.956 1.00 24.46 ? 25  GLU B C   1 
ATOM   2531 O  O   . GLU B 1 25  ? 17.538 -30.038 -49.748 1.00 24.27 ? 25  GLU B O   1 
ATOM   2532 C  CB  . GLU B 1 25  ? 16.560 -27.202 -50.671 1.00 25.47 ? 25  GLU B CB  1 
ATOM   2533 C  CG  . GLU B 1 25  ? 15.956 -25.818 -50.413 1.00 27.02 ? 25  GLU B CG  1 
ATOM   2534 C  CD  . GLU B 1 25  ? 15.111 -25.289 -51.572 1.00 27.09 ? 25  GLU B CD  1 
ATOM   2535 O  OE1 . GLU B 1 25  ? 14.183 -26.004 -52.002 1.00 27.97 ? 25  GLU B OE1 1 
ATOM   2536 O  OE2 . GLU B 1 25  ? 15.367 -24.155 -52.047 1.00 25.72 ? 25  GLU B OE2 1 
ATOM   2537 N  N   . GLU B 1 26  ? 19.403 -29.000 -50.475 1.00 24.56 ? 26  GLU B N   1 
ATOM   2538 C  CA  . GLU B 1 26  ? 20.113 -30.224 -50.866 1.00 25.42 ? 26  GLU B CA  1 
ATOM   2539 C  C   . GLU B 1 26  ? 20.567 -31.030 -49.652 1.00 25.87 ? 26  GLU B C   1 
ATOM   2540 O  O   . GLU B 1 26  ? 20.625 -32.256 -49.699 1.00 27.04 ? 26  GLU B O   1 
ATOM   2541 C  CB  . GLU B 1 26  ? 21.361 -29.881 -51.677 1.00 27.10 ? 26  GLU B CB  1 
ATOM   2542 C  CG  . GLU B 1 26  ? 21.148 -29.114 -52.962 1.00 27.65 ? 26  GLU B CG  1 
ATOM   2543 C  CD  . GLU B 1 26  ? 22.456 -28.566 -53.502 1.00 29.25 ? 26  GLU B CD  1 
ATOM   2544 O  OE1 . GLU B 1 26  ? 22.885 -27.479 -53.048 1.00 26.82 ? 26  GLU B OE1 1 
ATOM   2545 O  OE2 . GLU B 1 26  ? 23.071 -29.235 -54.366 1.00 28.19 ? 26  GLU B OE2 1 
ATOM   2546 N  N   . GLY B 1 27  ? 20.912 -30.319 -48.583 1.00 25.06 ? 27  GLY B N   1 
ATOM   2547 C  CA  . GLY B 1 27  ? 21.386 -30.934 -47.351 1.00 23.64 ? 27  GLY B CA  1 
ATOM   2548 C  C   . GLY B 1 27  ? 20.932 -32.337 -46.993 1.00 22.87 ? 27  GLY B C   1 
ATOM   2549 O  O   . GLY B 1 27  ? 21.759 -33.245 -46.938 1.00 22.81 ? 27  GLY B O   1 
ATOM   2550 N  N   . PRO B 1 28  ? 19.630 -32.554 -46.735 1.00 22.80 ? 28  PRO B N   1 
ATOM   2551 C  CA  . PRO B 1 28  ? 19.116 -33.882 -46.378 1.00 22.42 ? 28  PRO B CA  1 
ATOM   2552 C  C   . PRO B 1 28  ? 19.508 -35.000 -47.346 1.00 22.15 ? 28  PRO B C   1 
ATOM   2553 O  O   . PRO B 1 28  ? 19.987 -36.054 -46.930 1.00 23.58 ? 28  PRO B O   1 
ATOM   2554 C  CB  . PRO B 1 28  ? 17.603 -33.662 -46.335 1.00 22.60 ? 28  PRO B CB  1 
ATOM   2555 C  CG  . PRO B 1 28  ? 17.482 -32.223 -45.936 1.00 21.33 ? 28  PRO B CG  1 
ATOM   2556 C  CD  . PRO B 1 28  ? 18.531 -31.567 -46.784 1.00 21.52 ? 28  PRO B CD  1 
ATOM   2557 N  N   . THR B 1 29  ? 19.300 -34.768 -48.637 1.00 22.72 ? 29  THR B N   1 
ATOM   2558 C  CA  . THR B 1 29  ? 19.620 -35.761 -49.660 1.00 22.54 ? 29  THR B CA  1 
ATOM   2559 C  C   . THR B 1 29  ? 21.085 -36.183 -49.640 1.00 22.50 ? 29  THR B C   1 
ATOM   2560 O  O   . THR B 1 29  ? 21.397 -37.359 -49.522 1.00 21.11 ? 29  THR B O   1 
ATOM   2561 C  CB  . THR B 1 29  ? 19.244 -35.225 -51.072 1.00 23.30 ? 29  THR B CB  1 
ATOM   2562 O  OG1 . THR B 1 29  ? 17.828 -35.368 -51.266 1.00 26.43 ? 29  THR B OG1 1 
ATOM   2563 C  CG2 . THR B 1 29  ? 19.996 -35.973 -52.173 1.00 21.89 ? 29  THR B CG2 1 
ATOM   2564 N  N   . VAL B 1 30  ? 21.980 -35.213 -49.753 1.00 23.72 ? 30  VAL B N   1 
ATOM   2565 C  CA  . VAL B 1 30  ? 23.403 -35.488 -49.763 1.00 22.99 ? 30  VAL B CA  1 
ATOM   2566 C  C   . VAL B 1 30  ? 23.913 -36.119 -48.459 1.00 22.60 ? 30  VAL B C   1 
ATOM   2567 O  O   . VAL B 1 30  ? 24.947 -36.789 -48.451 1.00 22.12 ? 30  VAL B O   1 
ATOM   2568 C  CB  . VAL B 1 30  ? 24.170 -34.195 -50.085 1.00 22.30 ? 30  VAL B CB  1 
ATOM   2569 C  CG1 . VAL B 1 30  ? 25.663 -34.442 -50.094 1.00 23.41 ? 30  VAL B CG1 1 
ATOM   2570 C  CG2 . VAL B 1 30  ? 23.719 -33.681 -51.440 1.00 24.62 ? 30  VAL B CG2 1 
ATOM   2571 N  N   . LEU B 1 31  ? 23.189 -35.922 -47.361 1.00 22.34 ? 31  LEU B N   1 
ATOM   2572 C  CA  . LEU B 1 31  ? 23.599 -36.496 -46.080 1.00 22.83 ? 31  LEU B CA  1 
ATOM   2573 C  C   . LEU B 1 31  ? 23.217 -37.969 -46.034 1.00 23.46 ? 31  LEU B C   1 
ATOM   2574 O  O   . LEU B 1 31  ? 23.945 -38.795 -45.474 1.00 22.74 ? 31  LEU B O   1 
ATOM   2575 C  CB  . LEU B 1 31  ? 22.954 -35.736 -44.919 1.00 22.77 ? 31  LEU B CB  1 
ATOM   2576 C  CG  . LEU B 1 31  ? 23.514 -34.325 -44.689 1.00 21.10 ? 31  LEU B CG  1 
ATOM   2577 C  CD1 . LEU B 1 31  ? 22.703 -33.589 -43.634 1.00 21.97 ? 31  LEU B CD1 1 
ATOM   2578 C  CD2 . LEU B 1 31  ? 24.963 -34.433 -44.266 1.00 21.33 ? 31  LEU B CD2 1 
ATOM   2579 N  N   . ARG B 1 32  ? 22.073 -38.289 -46.638 1.00 24.38 ? 32  ARG B N   1 
ATOM   2580 C  CA  . ARG B 1 32  ? 21.588 -39.665 -46.703 1.00 26.15 ? 32  ARG B CA  1 
ATOM   2581 C  C   . ARG B 1 32  ? 22.413 -40.481 -47.712 1.00 27.56 ? 32  ARG B C   1 
ATOM   2582 O  O   . ARG B 1 32  ? 22.676 -41.667 -47.491 1.00 29.05 ? 32  ARG B O   1 
ATOM   2583 C  CB  . ARG B 1 32  ? 20.113 -39.702 -47.116 1.00 24.14 ? 32  ARG B CB  1 
ATOM   2584 C  CG  . ARG B 1 32  ? 19.095 -39.395 -46.023 1.00 24.09 ? 32  ARG B CG  1 
ATOM   2585 C  CD  . ARG B 1 32  ? 17.725 -39.856 -46.525 1.00 26.44 ? 32  ARG B CD  1 
ATOM   2586 N  NE  . ARG B 1 32  ? 16.677 -39.909 -45.505 1.00 28.14 ? 32  ARG B NE  1 
ATOM   2587 C  CZ  . ARG B 1 32  ? 15.995 -38.854 -45.078 1.00 30.91 ? 32  ARG B CZ  1 
ATOM   2588 N  NH1 . ARG B 1 32  ? 16.254 -37.652 -45.574 1.00 31.70 ? 32  ARG B NH1 1 
ATOM   2589 N  NH2 . ARG B 1 32  ? 15.035 -39.003 -44.173 1.00 31.98 ? 32  ARG B NH2 1 
ATOM   2590 N  N   . LYS B 1 33  ? 22.816 -39.850 -48.814 1.00 27.82 ? 33  LYS B N   1 
ATOM   2591 C  CA  . LYS B 1 33  ? 23.619 -40.530 -49.836 1.00 29.03 ? 33  LYS B CA  1 
ATOM   2592 C  C   . LYS B 1 33  ? 25.043 -40.797 -49.327 1.00 29.25 ? 33  LYS B C   1 
ATOM   2593 O  O   . LYS B 1 33  ? 25.799 -41.551 -49.947 1.00 28.69 ? 33  LYS B O   1 
ATOM   2594 C  CB  . LYS B 1 33  ? 23.689 -39.691 -51.126 1.00 27.93 ? 33  LYS B CB  1 
ATOM   2595 C  CG  . LYS B 1 33  ? 24.594 -38.452 -51.036 1.00 30.42 ? 33  LYS B CG  1 
ATOM   2596 C  CD  . LYS B 1 33  ? 26.088 -38.816 -51.047 1.00 30.65 ? 33  LYS B CD  1 
ATOM   2597 C  CE  . LYS B 1 33  ? 26.974 -37.643 -50.636 1.00 32.19 ? 33  LYS B CE  1 
ATOM   2598 N  NZ  . LYS B 1 33  ? 26.869 -36.486 -51.566 1.00 34.06 ? 33  LYS B NZ  1 
ATOM   2599 N  N   . ALA B 1 34  ? 25.402 -40.166 -48.207 1.00 29.31 ? 34  ALA B N   1 
ATOM   2600 C  CA  . ALA B 1 34  ? 26.729 -40.322 -47.612 1.00 29.01 ? 34  ALA B CA  1 
ATOM   2601 C  C   . ALA B 1 34  ? 26.833 -41.602 -46.785 1.00 28.83 ? 34  ALA B C   1 
ATOM   2602 O  O   . ALA B 1 34  ? 27.925 -42.140 -46.592 1.00 27.42 ? 34  ALA B O   1 
ATOM   2603 C  CB  . ALA B 1 34  ? 27.063 -39.106 -46.744 1.00 29.35 ? 34  ALA B CB  1 
ATOM   2604 N  N   . GLY B 1 35  ? 25.693 -42.082 -46.296 1.00 29.34 ? 35  GLY B N   1 
ATOM   2605 C  CA  . GLY B 1 35  ? 25.678 -43.296 -45.507 1.00 29.26 ? 35  GLY B CA  1 
ATOM   2606 C  C   . GLY B 1 35  ? 25.377 -43.050 -44.047 1.00 30.71 ? 35  GLY B C   1 
ATOM   2607 O  O   . GLY B 1 35  ? 25.671 -43.902 -43.210 1.00 31.26 ? 35  GLY B O   1 
ATOM   2608 N  N   . LEU B 1 36  ? 24.791 -41.893 -43.738 1.00 31.11 ? 36  LEU B N   1 
ATOM   2609 C  CA  . LEU B 1 36  ? 24.446 -41.539 -42.363 1.00 30.31 ? 36  LEU B CA  1 
ATOM   2610 C  C   . LEU B 1 36  ? 23.616 -42.607 -41.662 1.00 31.19 ? 36  LEU B C   1 
ATOM   2611 O  O   . LEU B 1 36  ? 23.968 -43.058 -40.571 1.00 31.89 ? 36  LEU B O   1 
ATOM   2612 C  CB  . LEU B 1 36  ? 23.666 -40.220 -42.320 1.00 29.22 ? 36  LEU B CB  1 
ATOM   2613 C  CG  . LEU B 1 36  ? 22.986 -39.942 -40.976 1.00 27.63 ? 36  LEU B CG  1 
ATOM   2614 C  CD1 . LEU B 1 36  ? 24.030 -39.528 -39.969 1.00 26.35 ? 36  LEU B CD1 1 
ATOM   2615 C  CD2 . LEU B 1 36  ? 21.930 -38.873 -41.126 1.00 26.90 ? 36  LEU B CD2 1 
ATOM   2616 N  N   . LEU B 1 37  ? 22.512 -43.006 -42.284 1.00 31.56 ? 37  LEU B N   1 
ATOM   2617 C  CA  . LEU B 1 37  ? 21.626 -43.998 -41.685 1.00 31.77 ? 37  LEU B CA  1 
ATOM   2618 C  C   . LEU B 1 37  ? 22.198 -45.417 -41.629 1.00 31.34 ? 37  LEU B C   1 
ATOM   2619 O  O   . LEU B 1 37  ? 22.015 -46.119 -40.632 1.00 29.84 ? 37  LEU B O   1 
ATOM   2620 C  CB  . LEU B 1 37  ? 20.278 -43.979 -42.408 1.00 33.85 ? 37  LEU B CB  1 
ATOM   2621 C  CG  . LEU B 1 37  ? 19.680 -42.572 -42.566 1.00 34.93 ? 37  LEU B CG  1 
ATOM   2622 C  CD1 . LEU B 1 37  ? 18.229 -42.689 -42.994 1.00 36.27 ? 37  LEU B CD1 1 
ATOM   2623 C  CD2 . LEU B 1 37  ? 19.772 -41.800 -41.259 1.00 35.26 ? 37  LEU B CD2 1 
ATOM   2624 N  N   . GLU B 1 38  ? 22.882 -45.855 -42.681 1.00 31.04 ? 38  GLU B N   1 
ATOM   2625 C  CA  . GLU B 1 38  ? 23.473 -47.191 -42.646 1.00 30.99 ? 38  GLU B CA  1 
ATOM   2626 C  C   . GLU B 1 38  ? 24.670 -47.187 -41.695 1.00 29.67 ? 38  GLU B C   1 
ATOM   2627 O  O   . GLU B 1 38  ? 25.026 -48.216 -41.120 1.00 29.64 ? 38  GLU B O   1 
ATOM   2628 C  CB  . GLU B 1 38  ? 23.934 -47.641 -44.037 1.00 32.72 ? 38  GLU B CB  1 
ATOM   2629 C  CG  . GLU B 1 38  ? 22.825 -48.169 -44.940 1.00 35.25 ? 38  GLU B CG  1 
ATOM   2630 C  CD  . GLU B 1 38  ? 22.047 -47.067 -45.649 1.00 38.12 ? 38  GLU B CD  1 
ATOM   2631 O  OE1 . GLU B 1 38  ? 22.684 -46.254 -46.365 1.00 37.66 ? 38  GLU B OE1 1 
ATOM   2632 O  OE2 . GLU B 1 38  ? 20.804 -47.019 -45.499 1.00 39.18 ? 38  GLU B OE2 1 
ATOM   2633 N  N   . LYS B 1 39  ? 25.293 -46.021 -41.539 1.00 28.61 ? 39  LYS B N   1 
ATOM   2634 C  CA  . LYS B 1 39  ? 26.444 -45.887 -40.656 1.00 27.57 ? 39  LYS B CA  1 
ATOM   2635 C  C   . LYS B 1 39  ? 25.993 -45.776 -39.205 1.00 27.15 ? 39  LYS B C   1 
ATOM   2636 O  O   . LYS B 1 39  ? 26.745 -46.125 -38.289 1.00 25.70 ? 39  LYS B O   1 
ATOM   2637 C  CB  . LYS B 1 39  ? 27.305 -44.685 -41.067 1.00 26.19 ? 39  LYS B CB  1 
ATOM   2638 C  CG  . LYS B 1 39  ? 28.154 -44.956 -42.307 1.00 24.06 ? 39  LYS B CG  1 
ATOM   2639 C  CD  . LYS B 1 39  ? 29.003 -43.759 -42.705 1.00 25.41 ? 39  LYS B CD  1 
ATOM   2640 C  CE  . LYS B 1 39  ? 29.865 -44.093 -43.916 1.00 25.51 ? 39  LYS B CE  1 
ATOM   2641 N  NZ  . LYS B 1 39  ? 30.773 -42.983 -44.307 1.00 25.81 ? 39  LYS B NZ  1 
ATOM   2642 N  N   . LEU B 1 40  ? 24.765 -45.296 -39.006 1.00 26.23 ? 40  LEU B N   1 
ATOM   2643 C  CA  . LEU B 1 40  ? 24.183 -45.195 -37.669 1.00 27.59 ? 40  LEU B CA  1 
ATOM   2644 C  C   . LEU B 1 40  ? 23.792 -46.611 -37.240 1.00 28.32 ? 40  LEU B C   1 
ATOM   2645 O  O   . LEU B 1 40  ? 23.891 -46.963 -36.068 1.00 30.05 ? 40  LEU B O   1 
ATOM   2646 C  CB  . LEU B 1 40  ? 22.934 -44.300 -37.668 1.00 26.41 ? 40  LEU B CB  1 
ATOM   2647 C  CG  . LEU B 1 40  ? 23.091 -42.791 -37.892 1.00 25.59 ? 40  LEU B CG  1 
ATOM   2648 C  CD1 . LEU B 1 40  ? 21.711 -42.160 -38.039 1.00 25.66 ? 40  LEU B CD1 1 
ATOM   2649 C  CD2 . LEU B 1 40  ? 23.852 -42.169 -36.735 1.00 23.47 ? 40  LEU B CD2 1 
ATOM   2650 N  N   . LYS B 1 41  ? 23.354 -47.422 -38.199 1.00 29.15 ? 41  LYS B N   1 
ATOM   2651 C  CA  . LYS B 1 41  ? 22.965 -48.799 -37.912 1.00 29.28 ? 41  LYS B CA  1 
ATOM   2652 C  C   . LYS B 1 41  ? 24.177 -49.678 -37.628 1.00 30.31 ? 41  LYS B C   1 
ATOM   2653 O  O   . LYS B 1 41  ? 24.075 -50.668 -36.903 1.00 31.21 ? 41  LYS B O   1 
ATOM   2654 C  CB  . LYS B 1 41  ? 22.160 -49.383 -39.073 1.00 29.19 ? 41  LYS B CB  1 
ATOM   2655 C  CG  . LYS B 1 41  ? 20.710 -48.930 -39.087 1.00 29.83 ? 41  LYS B CG  1 
ATOM   2656 C  CD  . LYS B 1 41  ? 19.903 -49.610 -40.183 1.00 30.46 ? 41  LYS B CD  1 
ATOM   2657 C  CE  . LYS B 1 41  ? 18.400 -49.363 -39.983 1.00 32.27 ? 41  LYS B CE  1 
ATOM   2658 N  NZ  . LYS B 1 41  ? 17.548 -50.000 -41.034 1.00 32.08 ? 41  LYS B NZ  1 
ATOM   2659 N  N   . GLU B 1 42  ? 25.325 -49.317 -38.196 1.00 31.16 ? 42  GLU B N   1 
ATOM   2660 C  CA  . GLU B 1 42  ? 26.543 -50.080 -37.972 1.00 32.80 ? 42  GLU B CA  1 
ATOM   2661 C  C   . GLU B 1 42  ? 26.957 -49.981 -36.510 1.00 32.57 ? 42  GLU B C   1 
ATOM   2662 O  O   . GLU B 1 42  ? 27.913 -50.625 -36.083 1.00 32.72 ? 42  GLU B O   1 
ATOM   2663 C  CB  . GLU B 1 42  ? 27.682 -49.560 -38.857 1.00 35.31 ? 42  GLU B CB  1 
ATOM   2664 C  CG  . GLU B 1 42  ? 27.499 -49.824 -40.345 1.00 39.23 ? 42  GLU B CG  1 
ATOM   2665 C  CD  . GLU B 1 42  ? 28.746 -49.497 -41.155 1.00 41.21 ? 42  GLU B CD  1 
ATOM   2666 O  OE1 . GLU B 1 42  ? 29.786 -50.161 -40.942 1.00 42.93 ? 42  GLU B OE1 1 
ATOM   2667 O  OE2 . GLU B 1 42  ? 28.686 -48.576 -42.002 1.00 42.09 ? 42  GLU B OE2 1 
ATOM   2668 N  N   . GLN B 1 43  ? 26.220 -49.180 -35.744 1.00 33.53 ? 43  GLN B N   1 
ATOM   2669 C  CA  . GLN B 1 43  ? 26.510 -48.974 -34.322 1.00 33.34 ? 43  GLN B CA  1 
ATOM   2670 C  C   . GLN B 1 43  ? 25.400 -49.448 -33.384 1.00 33.39 ? 43  GLN B C   1 
ATOM   2671 O  O   . GLN B 1 43  ? 24.501 -50.198 -33.771 1.00 33.91 ? 43  GLN B O   1 
ATOM   2672 C  CB  . GLN B 1 43  ? 26.779 -47.491 -34.060 1.00 33.42 ? 43  GLN B CB  1 
ATOM   2673 C  CG  . GLN B 1 43  ? 27.811 -46.887 -34.998 1.00 33.27 ? 43  GLN B CG  1 
ATOM   2674 C  CD  . GLN B 1 43  ? 27.741 -45.378 -35.032 1.00 33.32 ? 43  GLN B CD  1 
ATOM   2675 O  OE1 . GLN B 1 43  ? 26.691 -44.795 -34.767 1.00 34.35 ? 43  GLN B OE1 1 
ATOM   2676 N  NE2 . GLN B 1 43  ? 28.852 -44.735 -35.379 1.00 32.31 ? 43  GLN B NE2 1 
ATOM   2677 N  N   . GLU B 1 44  ? 25.481 -48.990 -32.143 1.00 33.69 ? 44  GLU B N   1 
ATOM   2678 C  CA  . GLU B 1 44  ? 24.519 -49.338 -31.105 1.00 34.14 ? 44  GLU B CA  1 
ATOM   2679 C  C   . GLU B 1 44  ? 23.128 -48.780 -31.409 1.00 33.13 ? 44  GLU B C   1 
ATOM   2680 O  O   . GLU B 1 44  ? 22.172 -49.025 -30.670 1.00 32.40 ? 44  GLU B O   1 
ATOM   2681 C  CB  . GLU B 1 44  ? 25.018 -48.785 -29.751 1.00 34.96 ? 44  GLU B CB  1 
ATOM   2682 C  CG  . GLU B 1 44  ? 25.232 -47.246 -29.708 1.00 35.27 ? 44  GLU B CG  1 
ATOM   2683 C  CD  . GLU B 1 44  ? 24.030 -46.471 -29.155 1.00 34.56 ? 44  GLU B CD  1 
ATOM   2684 O  OE1 . GLU B 1 44  ? 24.019 -45.224 -29.228 1.00 32.85 ? 44  GLU B OE1 1 
ATOM   2685 O  OE2 . GLU B 1 44  ? 23.097 -47.109 -28.634 1.00 34.08 ? 44  GLU B OE2 1 
ATOM   2686 N  N   . CYS B 1 45  ? 23.025 -48.056 -32.517 1.00 32.97 ? 45  CYS B N   1 
ATOM   2687 C  CA  . CYS B 1 45  ? 21.791 -47.384 -32.899 1.00 33.29 ? 45  CYS B CA  1 
ATOM   2688 C  C   . CYS B 1 45  ? 20.606 -48.192 -33.418 1.00 34.87 ? 45  CYS B C   1 
ATOM   2689 O  O   . CYS B 1 45  ? 20.747 -49.317 -33.899 1.00 36.27 ? 45  CYS B O   1 
ATOM   2690 C  CB  . CYS B 1 45  ? 22.128 -46.282 -33.904 1.00 30.43 ? 45  CYS B CB  1 
ATOM   2691 S  SG  . CYS B 1 45  ? 23.483 -45.222 -33.349 1.00 27.28 ? 45  CYS B SG  1 
ATOM   2692 N  N   . ASP B 1 46  ? 19.430 -47.580 -33.286 1.00 35.94 ? 46  ASP B N   1 
ATOM   2693 C  CA  . ASP B 1 46  ? 18.168 -48.143 -33.746 1.00 37.21 ? 46  ASP B CA  1 
ATOM   2694 C  C   . ASP B 1 46  ? 17.509 -47.042 -34.564 1.00 37.61 ? 46  ASP B C   1 
ATOM   2695 O  O   . ASP B 1 46  ? 16.543 -46.424 -34.129 1.00 38.79 ? 46  ASP B O   1 
ATOM   2696 C  CB  . ASP B 1 46  ? 17.276 -48.535 -32.558 1.00 37.53 ? 46  ASP B CB  1 
ATOM   2697 C  CG  . ASP B 1 46  ? 15.832 -48.794 -32.966 1.00 37.45 ? 46  ASP B CG  1 
ATOM   2698 O  OD1 . ASP B 1 46  ? 15.611 -49.315 -34.077 1.00 38.65 ? 46  ASP B OD1 1 
ATOM   2699 O  OD2 . ASP B 1 46  ? 14.917 -48.483 -32.176 1.00 37.90 ? 46  ASP B OD2 1 
ATOM   2700 N  N   . VAL B 1 47  ? 18.054 -46.789 -35.748 1.00 38.57 ? 47  VAL B N   1 
ATOM   2701 C  CA  . VAL B 1 47  ? 17.535 -45.750 -36.633 1.00 38.66 ? 47  VAL B CA  1 
ATOM   2702 C  C   . VAL B 1 47  ? 16.054 -45.974 -36.956 1.00 39.22 ? 47  VAL B C   1 
ATOM   2703 O  O   . VAL B 1 47  ? 15.570 -47.106 -36.939 1.00 39.24 ? 47  VAL B O   1 
ATOM   2704 C  CB  . VAL B 1 47  ? 18.349 -45.695 -37.959 1.00 38.34 ? 47  VAL B CB  1 
ATOM   2705 C  CG1 . VAL B 1 47  ? 17.947 -44.481 -38.780 1.00 36.10 ? 47  VAL B CG1 1 
ATOM   2706 C  CG2 . VAL B 1 47  ? 19.839 -45.662 -37.653 1.00 36.63 ? 47  VAL B CG2 1 
ATOM   2707 N  N   . LYS B 1 48  ? 15.345 -44.881 -37.233 1.00 39.99 ? 48  LYS B N   1 
ATOM   2708 C  CA  . LYS B 1 48  ? 13.918 -44.907 -37.573 1.00 40.21 ? 48  LYS B CA  1 
ATOM   2709 C  C   . LYS B 1 48  ? 13.586 -43.648 -38.390 1.00 39.05 ? 48  LYS B C   1 
ATOM   2710 O  O   . LYS B 1 48  ? 13.067 -42.667 -37.868 1.00 38.67 ? 48  LYS B O   1 
ATOM   2711 C  CB  . LYS B 1 48  ? 13.061 -44.938 -36.297 1.00 41.26 ? 48  LYS B CB  1 
ATOM   2712 C  CG  . LYS B 1 48  ? 13.198 -46.203 -35.454 1.00 42.79 ? 48  LYS B CG  1 
ATOM   2713 C  CD  . LYS B 1 48  ? 12.545 -47.405 -36.127 1.00 44.73 ? 48  LYS B CD  1 
ATOM   2714 C  CE  . LYS B 1 48  ? 12.677 -48.658 -35.267 1.00 45.60 ? 48  LYS B CE  1 
ATOM   2715 N  NZ  . LYS B 1 48  ? 11.918 -49.818 -35.829 1.00 45.91 ? 48  LYS B NZ  1 
ATOM   2716 N  N   . ASP B 1 49  ? 13.894 -43.689 -39.679 1.00 37.91 ? 49  ASP B N   1 
ATOM   2717 C  CA  . ASP B 1 49  ? 13.660 -42.562 -40.572 1.00 36.67 ? 49  ASP B CA  1 
ATOM   2718 C  C   . ASP B 1 49  ? 12.202 -42.086 -40.553 1.00 36.36 ? 49  ASP B C   1 
ATOM   2719 O  O   . ASP B 1 49  ? 11.276 -42.894 -40.625 1.00 36.96 ? 49  ASP B O   1 
ATOM   2720 C  CB  . ASP B 1 49  ? 14.051 -42.964 -41.995 1.00 35.17 ? 49  ASP B CB  1 
ATOM   2721 C  CG  . ASP B 1 49  ? 14.381 -41.776 -42.867 1.00 34.22 ? 49  ASP B CG  1 
ATOM   2722 O  OD1 . ASP B 1 49  ? 13.652 -40.765 -42.800 1.00 35.75 ? 49  ASP B OD1 1 
ATOM   2723 O  OD2 . ASP B 1 49  ? 15.368 -41.860 -43.630 1.00 34.68 ? 49  ASP B OD2 1 
ATOM   2724 N  N   . TYR B 1 50  ? 12.002 -40.774 -40.446 1.00 35.42 ? 50  TYR B N   1 
ATOM   2725 C  CA  . TYR B 1 50  ? 10.654 -40.206 -40.453 1.00 34.56 ? 50  TYR B CA  1 
ATOM   2726 C  C   . TYR B 1 50  ? 10.458 -39.388 -41.729 1.00 33.55 ? 50  TYR B C   1 
ATOM   2727 O  O   . TYR B 1 50  ? 9.702  -38.414 -41.756 1.00 34.41 ? 50  TYR B O   1 
ATOM   2728 C  CB  . TYR B 1 50  ? 10.409 -39.332 -39.214 1.00 34.57 ? 50  TYR B CB  1 
ATOM   2729 C  CG  . TYR B 1 50  ? 10.352 -40.122 -37.922 1.00 35.29 ? 50  TYR B CG  1 
ATOM   2730 C  CD1 . TYR B 1 50  ? 11.521 -40.504 -37.267 1.00 36.65 ? 50  TYR B CD1 1 
ATOM   2731 C  CD2 . TYR B 1 50  ? 9.130  -40.535 -37.382 1.00 35.50 ? 50  TYR B CD2 1 
ATOM   2732 C  CE1 . TYR B 1 50  ? 11.483 -41.279 -36.112 1.00 37.00 ? 50  TYR B CE1 1 
ATOM   2733 C  CE2 . TYR B 1 50  ? 9.079  -41.318 -36.223 1.00 35.76 ? 50  TYR B CE2 1 
ATOM   2734 C  CZ  . TYR B 1 50  ? 10.263 -41.686 -35.596 1.00 37.09 ? 50  TYR B CZ  1 
ATOM   2735 O  OH  . TYR B 1 50  ? 10.247 -42.476 -34.468 1.00 38.21 ? 50  TYR B OH  1 
ATOM   2736 N  N   . GLY B 1 51  ? 11.156 -39.808 -42.782 1.00 32.55 ? 51  GLY B N   1 
ATOM   2737 C  CA  . GLY B 1 51  ? 11.078 -39.147 -44.070 1.00 30.28 ? 51  GLY B CA  1 
ATOM   2738 C  C   . GLY B 1 51  ? 11.489 -37.693 -44.050 1.00 30.01 ? 51  GLY B C   1 
ATOM   2739 O  O   . GLY B 1 51  ? 11.875 -37.158 -43.010 1.00 28.82 ? 51  GLY B O   1 
ATOM   2740 N  N   . ASP B 1 52  ? 11.418 -37.055 -45.214 1.00 29.97 ? 52  ASP B N   1 
ATOM   2741 C  CA  . ASP B 1 52  ? 11.759 -35.646 -45.343 1.00 30.78 ? 52  ASP B CA  1 
ATOM   2742 C  C   . ASP B 1 52  ? 10.470 -34.841 -45.321 1.00 31.66 ? 52  ASP B C   1 
ATOM   2743 O  O   . ASP B 1 52  ? 9.483  -35.208 -45.961 1.00 31.98 ? 52  ASP B O   1 
ATOM   2744 C  CB  . ASP B 1 52  ? 12.510 -35.389 -46.651 1.00 30.49 ? 52  ASP B CB  1 
ATOM   2745 C  CG  . ASP B 1 52  ? 13.916 -35.950 -46.633 1.00 30.03 ? 52  ASP B CG  1 
ATOM   2746 O  OD1 . ASP B 1 52  ? 14.064 -37.183 -46.482 1.00 31.24 ? 52  ASP B OD1 1 
ATOM   2747 O  OD2 . ASP B 1 52  ? 14.870 -35.155 -46.770 1.00 30.17 ? 52  ASP B OD2 1 
ATOM   2748 N  N   . LEU B 1 53  ? 10.478 -33.743 -44.581 1.00 32.48 ? 53  LEU B N   1 
ATOM   2749 C  CA  . LEU B 1 53  ? 9.291  -32.921 -44.471 1.00 33.49 ? 53  LEU B CA  1 
ATOM   2750 C  C   . LEU B 1 53  ? 8.982  -32.139 -45.745 1.00 34.29 ? 53  LEU B C   1 
ATOM   2751 O  O   . LEU B 1 53  ? 9.816  -31.386 -46.255 1.00 35.44 ? 53  LEU B O   1 
ATOM   2752 C  CB  . LEU B 1 53  ? 9.426  -31.959 -43.283 1.00 32.26 ? 53  LEU B CB  1 
ATOM   2753 C  CG  . LEU B 1 53  ? 9.840  -32.568 -41.934 1.00 31.53 ? 53  LEU B CG  1 
ATOM   2754 C  CD1 . LEU B 1 53  ? 9.636  -31.523 -40.851 1.00 29.57 ? 53  LEU B CD1 1 
ATOM   2755 C  CD2 . LEU B 1 53  ? 9.024  -33.823 -41.623 1.00 31.14 ? 53  LEU B CD2 1 
ATOM   2756 N  N   . PRO B 1 54  ? 7.780  -32.346 -46.301 1.00 34.71 ? 54  PRO B N   1 
ATOM   2757 C  CA  . PRO B 1 54  ? 7.359  -31.646 -47.516 1.00 34.64 ? 54  PRO B CA  1 
ATOM   2758 C  C   . PRO B 1 54  ? 6.823  -30.294 -47.063 1.00 34.39 ? 54  PRO B C   1 
ATOM   2759 O  O   . PRO B 1 54  ? 5.700  -30.198 -46.585 1.00 34.83 ? 54  PRO B O   1 
ATOM   2760 C  CB  . PRO B 1 54  ? 6.275  -32.559 -48.074 1.00 34.05 ? 54  PRO B CB  1 
ATOM   2761 C  CG  . PRO B 1 54  ? 5.655  -33.117 -46.837 1.00 35.70 ? 54  PRO B CG  1 
ATOM   2762 C  CD  . PRO B 1 54  ? 6.856  -33.449 -45.982 1.00 34.52 ? 54  PRO B CD  1 
ATOM   2763 N  N   . PHE B 1 55  ? 7.636  -29.255 -47.215 1.00 35.36 ? 55  PHE B N   1 
ATOM   2764 C  CA  . PHE B 1 55  ? 7.271  -27.916 -46.767 1.00 35.50 ? 55  PHE B CA  1 
ATOM   2765 C  C   . PHE B 1 55  ? 6.258  -27.125 -47.595 1.00 37.22 ? 55  PHE B C   1 
ATOM   2766 O  O   . PHE B 1 55  ? 6.432  -26.920 -48.806 1.00 37.35 ? 55  PHE B O   1 
ATOM   2767 C  CB  . PHE B 1 55  ? 8.552  -27.102 -46.551 1.00 34.50 ? 55  PHE B CB  1 
ATOM   2768 C  CG  . PHE B 1 55  ? 9.466  -27.709 -45.520 1.00 32.85 ? 55  PHE B CG  1 
ATOM   2769 C  CD1 . PHE B 1 55  ? 9.029  -27.884 -44.207 1.00 32.68 ? 55  PHE B CD1 1 
ATOM   2770 C  CD2 . PHE B 1 55  ? 10.725 -28.175 -45.869 1.00 32.20 ? 55  PHE B CD2 1 
ATOM   2771 C  CE1 . PHE B 1 55  ? 9.830  -28.517 -43.262 1.00 31.05 ? 55  PHE B CE1 1 
ATOM   2772 C  CE2 . PHE B 1 55  ? 11.532 -28.810 -44.924 1.00 31.07 ? 55  PHE B CE2 1 
ATOM   2773 C  CZ  . PHE B 1 55  ? 11.079 -28.980 -43.621 1.00 31.03 ? 55  PHE B CZ  1 
ATOM   2774 N  N   . ALA B 1 56  ? 5.201  -26.689 -46.900 1.00 38.46 ? 56  ALA B N   1 
ATOM   2775 C  CA  . ALA B 1 56  ? 4.101  -25.914 -47.467 1.00 39.09 ? 56  ALA B CA  1 
ATOM   2776 C  C   . ALA B 1 56  ? 4.565  -24.631 -48.133 1.00 40.27 ? 56  ALA B C   1 
ATOM   2777 O  O   . ALA B 1 56  ? 4.857  -23.641 -47.457 1.00 40.36 ? 56  ALA B O   1 
ATOM   2778 C  CB  . ALA B 1 56  ? 3.091  -25.579 -46.378 1.00 38.18 ? 56  ALA B CB  1 
ATOM   2779 N  N   . ASP B 1 57  ? 4.617  -24.648 -49.461 1.00 41.47 ? 57  ASP B N   1 
ATOM   2780 C  CA  . ASP B 1 57  ? 5.032  -23.475 -50.221 1.00 41.79 ? 57  ASP B CA  1 
ATOM   2781 C  C   . ASP B 1 57  ? 3.911  -22.433 -50.179 1.00 41.64 ? 57  ASP B C   1 
ATOM   2782 O  O   . ASP B 1 57  ? 2.771  -22.714 -50.561 1.00 41.74 ? 57  ASP B O   1 
ATOM   2783 C  CB  . ASP B 1 57  ? 5.340  -23.878 -51.664 1.00 42.33 ? 57  ASP B CB  1 
ATOM   2784 C  CG  . ASP B 1 57  ? 6.226  -22.877 -52.364 1.00 42.84 ? 57  ASP B CG  1 
ATOM   2785 O  OD1 . ASP B 1 57  ? 6.790  -23.219 -53.427 1.00 42.71 ? 57  ASP B OD1 1 
ATOM   2786 O  OD2 . ASP B 1 57  ? 6.357  -21.747 -51.850 1.00 43.79 ? 57  ASP B OD2 1 
ATOM   2787 N  N   . ILE B 1 58  ? 4.236  -21.237 -49.697 1.00 41.31 ? 58  ILE B N   1 
ATOM   2788 C  CA  . ILE B 1 58  ? 3.253  -20.162 -49.584 1.00 40.10 ? 58  ILE B CA  1 
ATOM   2789 C  C   . ILE B 1 58  ? 3.411  -19.168 -50.740 1.00 40.17 ? 58  ILE B C   1 
ATOM   2790 O  O   . ILE B 1 58  ? 4.150  -18.187 -50.629 1.00 37.97 ? 58  ILE B O   1 
ATOM   2791 C  CB  . ILE B 1 58  ? 3.415  -19.405 -48.241 1.00 38.82 ? 58  ILE B CB  1 
ATOM   2792 C  CG1 . ILE B 1 58  ? 3.676  -20.396 -47.094 1.00 38.50 ? 58  ILE B CG1 1 
ATOM   2793 C  CG2 . ILE B 1 58  ? 2.170  -18.580 -47.960 1.00 38.53 ? 58  ILE B CG2 1 
ATOM   2794 C  CD1 . ILE B 1 58  ? 2.532  -21.355 -46.787 1.00 35.66 ? 58  ILE B CD1 1 
ATOM   2795 N  N   . PRO B 1 59  ? 2.694  -19.403 -51.858 1.00 40.47 ? 59  PRO B N   1 
ATOM   2796 C  CA  . PRO B 1 59  ? 2.724  -18.563 -53.065 1.00 40.51 ? 59  PRO B CA  1 
ATOM   2797 C  C   . PRO B 1 59  ? 2.823  -17.057 -52.841 1.00 40.12 ? 59  PRO B C   1 
ATOM   2798 O  O   . PRO B 1 59  ? 3.643  -16.384 -53.468 1.00 40.41 ? 59  PRO B O   1 
ATOM   2799 C  CB  . PRO B 1 59  ? 1.440  -18.960 -53.804 1.00 40.76 ? 59  PRO B CB  1 
ATOM   2800 C  CG  . PRO B 1 59  ? 0.559  -19.530 -52.723 1.00 41.53 ? 59  PRO B CG  1 
ATOM   2801 C  CD  . PRO B 1 59  ? 1.547  -20.325 -51.912 1.00 40.83 ? 59  PRO B CD  1 
ATOM   2802 N  N   . ASN B 1 60  ? 1.987  -16.528 -51.957 1.00 39.64 ? 60  ASN B N   1 
ATOM   2803 C  CA  . ASN B 1 60  ? 2.006  -15.102 -51.667 1.00 38.05 ? 60  ASN B CA  1 
ATOM   2804 C  C   . ASN B 1 60  ? 2.546  -14.894 -50.255 1.00 37.03 ? 60  ASN B C   1 
ATOM   2805 O  O   . ASN B 1 60  ? 1.783  -14.848 -49.288 1.00 36.79 ? 60  ASN B O   1 
ATOM   2806 C  CB  . ASN B 1 60  ? 0.592  -14.519 -51.773 1.00 38.82 ? 60  ASN B CB  1 
ATOM   2807 C  CG  . ASN B 1 60  ? 0.572  -13.130 -52.407 1.00 38.92 ? 60  ASN B CG  1 
ATOM   2808 O  OD1 . ASN B 1 60  ? 1.305  -12.226 -51.992 1.00 37.68 ? 60  ASN B OD1 1 
ATOM   2809 N  ND2 . ASN B 1 60  ? -0.281 -12.957 -53.417 1.00 37.36 ? 60  ASN B ND2 1 
ATOM   2810 N  N   . ASP B 1 61  ? 3.866  -14.769 -50.144 1.00 36.42 ? 61  ASP B N   1 
ATOM   2811 C  CA  . ASP B 1 61  ? 4.507  -14.571 -48.848 1.00 35.07 ? 61  ASP B CA  1 
ATOM   2812 C  C   . ASP B 1 61  ? 5.229  -13.226 -48.829 1.00 34.59 ? 61  ASP B C   1 
ATOM   2813 O  O   . ASP B 1 61  ? 6.456  -13.171 -48.900 1.00 34.70 ? 61  ASP B O   1 
ATOM   2814 C  CB  . ASP B 1 61  ? 5.487  -15.725 -48.574 1.00 33.92 ? 61  ASP B CB  1 
ATOM   2815 C  CG  . ASP B 1 61  ? 5.871  -15.846 -47.099 1.00 33.09 ? 61  ASP B CG  1 
ATOM   2816 O  OD1 . ASP B 1 61  ? 5.144  -15.303 -46.240 1.00 32.41 ? 61  ASP B OD1 1 
ATOM   2817 O  OD2 . ASP B 1 61  ? 6.894  -16.503 -46.799 1.00 30.92 ? 61  ASP B OD2 1 
ATOM   2818 N  N   . SER B 1 62  ? 4.459  -12.141 -48.734 1.00 34.11 ? 62  SER B N   1 
ATOM   2819 C  CA  . SER B 1 62  ? 5.031  -10.793 -48.710 1.00 33.68 ? 62  SER B CA  1 
ATOM   2820 C  C   . SER B 1 62  ? 5.930  -10.596 -47.474 1.00 33.19 ? 62  SER B C   1 
ATOM   2821 O  O   . SER B 1 62  ? 5.786  -11.299 -46.474 1.00 32.93 ? 62  SER B O   1 
ATOM   2822 C  CB  . SER B 1 62  ? 3.908  -9.748  -48.726 1.00 33.08 ? 62  SER B CB  1 
ATOM   2823 O  OG  . SER B 1 62  ? 4.412  -8.466  -49.057 1.00 32.91 ? 62  SER B OG  1 
ATOM   2824 N  N   . PRO B 1 63  ? 6.876  -9.641  -47.536 1.00 33.04 ? 63  PRO B N   1 
ATOM   2825 C  CA  . PRO B 1 63  ? 7.786  -9.374  -46.413 1.00 33.52 ? 63  PRO B CA  1 
ATOM   2826 C  C   . PRO B 1 63  ? 7.116  -8.941  -45.093 1.00 33.95 ? 63  PRO B C   1 
ATOM   2827 O  O   . PRO B 1 63  ? 5.888  -8.822  -45.002 1.00 34.49 ? 63  PRO B O   1 
ATOM   2828 C  CB  . PRO B 1 63  ? 8.708  -8.283  -46.971 1.00 33.12 ? 63  PRO B CB  1 
ATOM   2829 C  CG  . PRO B 1 63  ? 8.733  -8.574  -48.449 1.00 33.68 ? 63  PRO B CG  1 
ATOM   2830 C  CD  . PRO B 1 63  ? 7.275  -8.865  -48.727 1.00 33.59 ? 63  PRO B CD  1 
ATOM   2831 N  N   . PHE B 1 64  ? 7.945  -8.725  -44.072 1.00 32.69 ? 64  PHE B N   1 
ATOM   2832 C  CA  . PHE B 1 64  ? 7.497  -8.276  -42.755 1.00 31.31 ? 64  PHE B CA  1 
ATOM   2833 C  C   . PHE B 1 64  ? 8.570  -7.307  -42.283 1.00 32.76 ? 64  PHE B C   1 
ATOM   2834 O  O   . PHE B 1 64  ? 9.668  -7.727  -41.913 1.00 32.80 ? 64  PHE B O   1 
ATOM   2835 C  CB  . PHE B 1 64  ? 7.387  -9.448  -41.772 1.00 27.92 ? 64  PHE B CB  1 
ATOM   2836 C  CG  . PHE B 1 64  ? 7.103  -9.022  -40.353 1.00 25.46 ? 64  PHE B CG  1 
ATOM   2837 C  CD1 . PHE B 1 64  ? 5.991  -8.249  -40.052 1.00 23.51 ? 64  PHE B CD1 1 
ATOM   2838 C  CD2 . PHE B 1 64  ? 7.966  -9.371  -39.323 1.00 23.68 ? 64  PHE B CD2 1 
ATOM   2839 C  CE1 . PHE B 1 64  ? 5.745  -7.828  -38.755 1.00 21.85 ? 64  PHE B CE1 1 
ATOM   2840 C  CE2 . PHE B 1 64  ? 7.722  -8.953  -38.027 1.00 23.17 ? 64  PHE B CE2 1 
ATOM   2841 C  CZ  . PHE B 1 64  ? 6.609  -8.179  -37.748 1.00 21.88 ? 64  PHE B CZ  1 
ATOM   2842 N  N   . GLN B 1 65  ? 8.249  -6.013  -42.282 1.00 33.09 ? 65  GLN B N   1 
ATOM   2843 C  CA  . GLN B 1 65  ? 9.227  -4.998  -41.908 1.00 33.43 ? 65  GLN B CA  1 
ATOM   2844 C  C   . GLN B 1 65  ? 10.332 -5.183  -42.937 1.00 33.19 ? 65  GLN B C   1 
ATOM   2845 O  O   . GLN B 1 65  ? 10.229 -4.674  -44.053 1.00 33.90 ? 65  GLN B O   1 
ATOM   2846 C  CB  . GLN B 1 65  ? 9.777  -5.244  -40.504 1.00 34.39 ? 65  GLN B CB  1 
ATOM   2847 C  CG  . GLN B 1 65  ? 8.891  -4.779  -39.370 1.00 33.93 ? 65  GLN B CG  1 
ATOM   2848 C  CD  . GLN B 1 65  ? 9.517  -5.074  -38.028 1.00 33.63 ? 65  GLN B CD  1 
ATOM   2849 O  OE1 . GLN B 1 65  ? 8.942  -4.783  -36.979 1.00 35.06 ? 65  GLN B OE1 1 
ATOM   2850 N  NE2 . GLN B 1 65  ? 10.711 -5.662  -38.052 1.00 33.32 ? 65  GLN B NE2 1 
ATOM   2851 N  N   . ILE B 1 66  ? 11.379 -5.923  -42.573 1.00 32.63 ? 66  ILE B N   1 
ATOM   2852 C  CA  . ILE B 1 66  ? 12.471 -6.188  -43.508 1.00 32.10 ? 66  ILE B CA  1 
ATOM   2853 C  C   . ILE B 1 66  ? 12.765 -7.690  -43.560 1.00 31.35 ? 66  ILE B C   1 
ATOM   2854 O  O   . ILE B 1 66  ? 13.498 -8.160  -44.428 1.00 31.73 ? 66  ILE B O   1 
ATOM   2855 C  CB  . ILE B 1 66  ? 13.765 -5.376  -43.143 1.00 31.62 ? 66  ILE B CB  1 
ATOM   2856 C  CG1 . ILE B 1 66  ? 14.846 -6.302  -42.578 1.00 30.93 ? 66  ILE B CG1 1 
ATOM   2857 C  CG2 . ILE B 1 66  ? 13.423 -4.258  -42.146 1.00 30.24 ? 66  ILE B CG2 1 
ATOM   2858 C  CD1 . ILE B 1 66  ? 16.170 -5.625  -42.371 1.00 28.63 ? 66  ILE B CD1 1 
ATOM   2859 N  N   . VAL B 1 67  ? 12.168 -8.434  -42.633 1.00 31.58 ? 67  VAL B N   1 
ATOM   2860 C  CA  . VAL B 1 67  ? 12.320 -9.889  -42.548 1.00 31.14 ? 67  VAL B CA  1 
ATOM   2861 C  C   . VAL B 1 67  ? 11.567 -10.556 -43.702 1.00 31.10 ? 67  VAL B C   1 
ATOM   2862 O  O   . VAL B 1 67  ? 10.410 -10.225 -43.964 1.00 31.24 ? 67  VAL B O   1 
ATOM   2863 C  CB  . VAL B 1 67  ? 11.739 -10.417 -41.217 1.00 31.54 ? 67  VAL B CB  1 
ATOM   2864 C  CG1 . VAL B 1 67  ? 11.854 -11.931 -41.159 1.00 30.42 ? 67  VAL B CG1 1 
ATOM   2865 C  CG2 . VAL B 1 67  ? 12.462 -9.773  -40.044 1.00 31.30 ? 67  VAL B CG2 1 
ATOM   2866 N  N   . LYS B 1 68  ? 12.210 -11.507 -44.374 1.00 31.08 ? 68  LYS B N   1 
ATOM   2867 C  CA  . LYS B 1 68  ? 11.584 -12.193 -45.505 1.00 30.39 ? 68  LYS B CA  1 
ATOM   2868 C  C   . LYS B 1 68  ? 11.059 -13.618 -45.239 1.00 30.47 ? 68  LYS B C   1 
ATOM   2869 O  O   . LYS B 1 68  ? 11.485 -14.298 -44.295 1.00 29.77 ? 68  LYS B O   1 
ATOM   2870 C  CB  . LYS B 1 68  ? 12.561 -12.217 -46.693 1.00 29.66 ? 68  LYS B CB  1 
ATOM   2871 C  CG  . LYS B 1 68  ? 12.607 -10.928 -47.509 1.00 27.17 ? 68  LYS B CG  1 
ATOM   2872 C  CD  . LYS B 1 68  ? 13.959 -10.748 -48.180 1.00 26.76 ? 68  LYS B CD  1 
ATOM   2873 C  CE  . LYS B 1 68  ? 15.033 -10.461 -47.138 1.00 28.00 ? 68  LYS B CE  1 
ATOM   2874 N  NZ  . LYS B 1 68  ? 16.401 -10.418 -47.714 1.00 28.42 ? 68  LYS B NZ  1 
ATOM   2875 N  N   . ASN B 1 69  ? 10.118 -14.037 -46.090 1.00 29.79 ? 69  ASN B N   1 
ATOM   2876 C  CA  . ASN B 1 69  ? 9.481  -15.360 -46.048 1.00 29.46 ? 69  ASN B CA  1 
ATOM   2877 C  C   . ASN B 1 69  ? 8.960  -15.782 -44.672 1.00 27.92 ? 69  ASN B C   1 
ATOM   2878 O  O   . ASN B 1 69  ? 9.129  -16.932 -44.272 1.00 25.85 ? 69  ASN B O   1 
ATOM   2879 C  CB  . ASN B 1 69  ? 10.464 -16.430 -46.550 1.00 30.50 ? 69  ASN B CB  1 
ATOM   2880 C  CG  . ASN B 1 69  ? 11.212 -16.005 -47.810 1.00 31.97 ? 69  ASN B CG  1 
ATOM   2881 O  OD1 . ASN B 1 69  ? 10.644 -15.965 -48.904 1.00 33.87 ? 69  ASN B OD1 1 
ATOM   2882 N  ND2 . ASN B 1 69  ? 12.498 -15.684 -47.657 1.00 31.69 ? 69  ASN B ND2 1 
ATOM   2883 N  N   . PRO B 1 70  ? 8.295  -14.873 -43.939 1.00 27.46 ? 70  PRO B N   1 
ATOM   2884 C  CA  . PRO B 1 70  ? 7.791  -15.250 -42.613 1.00 26.74 ? 70  PRO B CA  1 
ATOM   2885 C  C   . PRO B 1 70  ? 6.811  -16.415 -42.577 1.00 26.11 ? 70  PRO B C   1 
ATOM   2886 O  O   . PRO B 1 70  ? 6.921  -17.290 -41.715 1.00 26.60 ? 70  PRO B O   1 
ATOM   2887 C  CB  . PRO B 1 70  ? 7.190  -13.946 -42.085 1.00 27.35 ? 70  PRO B CB  1 
ATOM   2888 C  CG  . PRO B 1 70  ? 6.759  -13.242 -43.322 1.00 27.72 ? 70  PRO B CG  1 
ATOM   2889 C  CD  . PRO B 1 70  ? 7.930  -13.482 -44.259 1.00 27.88 ? 70  PRO B CD  1 
ATOM   2890 N  N   . ARG B 1 71  ? 5.855  -16.433 -43.504 1.00 25.04 ? 71  ARG B N   1 
ATOM   2891 C  CA  . ARG B 1 71  ? 4.875  -17.516 -43.552 1.00 23.61 ? 71  ARG B CA  1 
ATOM   2892 C  C   . ARG B 1 71  ? 5.564  -18.792 -44.028 1.00 23.11 ? 71  ARG B C   1 
ATOM   2893 O  O   . ARG B 1 71  ? 5.257  -19.884 -43.557 1.00 21.26 ? 71  ARG B O   1 
ATOM   2894 C  CB  . ARG B 1 71  ? 3.724  -17.136 -44.484 1.00 23.09 ? 71  ARG B CB  1 
ATOM   2895 C  CG  . ARG B 1 71  ? 3.109  -15.811 -44.099 1.00 24.54 ? 71  ARG B CG  1 
ATOM   2896 C  CD  . ARG B 1 71  ? 2.046  -15.337 -45.059 1.00 26.30 ? 71  ARG B CD  1 
ATOM   2897 N  NE  . ARG B 1 71  ? 1.757  -13.915 -44.859 1.00 27.03 ? 71  ARG B NE  1 
ATOM   2898 C  CZ  . ARG B 1 71  ? 2.595  -12.927 -45.175 1.00 25.87 ? 71  ARG B CZ  1 
ATOM   2899 N  NH1 . ARG B 1 71  ? 3.772  -13.206 -45.709 1.00 25.37 ? 71  ARG B NH1 1 
ATOM   2900 N  NH2 . ARG B 1 71  ? 2.261  -11.660 -44.952 1.00 23.79 ? 71  ARG B NH2 1 
ATOM   2901 N  N   . SER B 1 72  ? 6.500  -18.642 -44.962 1.00 23.98 ? 72  SER B N   1 
ATOM   2902 C  CA  . SER B 1 72  ? 7.253  -19.783 -45.470 1.00 24.60 ? 72  SER B CA  1 
ATOM   2903 C  C   . SER B 1 72  ? 8.157  -20.283 -44.347 1.00 23.70 ? 72  SER B C   1 
ATOM   2904 O  O   . SER B 1 72  ? 8.179  -21.470 -44.041 1.00 21.47 ? 72  SER B O   1 
ATOM   2905 C  CB  . SER B 1 72  ? 8.113  -19.378 -46.671 1.00 25.16 ? 72  SER B CB  1 
ATOM   2906 O  OG  . SER B 1 72  ? 7.308  -19.062 -47.790 1.00 27.24 ? 72  SER B OG  1 
ATOM   2907 N  N   . VAL B 1 73  ? 8.909  -19.368 -43.740 1.00 23.67 ? 73  VAL B N   1 
ATOM   2908 C  CA  . VAL B 1 73  ? 9.796  -19.727 -42.634 1.00 23.34 ? 73  VAL B CA  1 
ATOM   2909 C  C   . VAL B 1 73  ? 8.921  -20.194 -41.479 1.00 22.93 ? 73  VAL B C   1 
ATOM   2910 O  O   . VAL B 1 73  ? 8.973  -21.350 -41.081 1.00 24.03 ? 73  VAL B O   1 
ATOM   2911 C  CB  . VAL B 1 73  ? 10.659 -18.516 -42.181 1.00 22.23 ? 73  VAL B CB  1 
ATOM   2912 C  CG1 . VAL B 1 73  ? 11.412 -18.844 -40.884 1.00 20.14 ? 73  VAL B CG1 1 
ATOM   2913 C  CG2 . VAL B 1 73  ? 11.659 -18.158 -43.278 1.00 22.08 ? 73  VAL B CG2 1 
ATOM   2914 N  N   . GLY B 1 74  ? 8.102  -19.283 -40.966 1.00 22.80 ? 74  GLY B N   1 
ATOM   2915 C  CA  . GLY B 1 74  ? 7.213  -19.597 -39.866 1.00 21.44 ? 74  GLY B CA  1 
ATOM   2916 C  C   . GLY B 1 74  ? 6.493  -20.923 -39.989 1.00 21.39 ? 74  GLY B C   1 
ATOM   2917 O  O   . GLY B 1 74  ? 6.342  -21.619 -38.988 1.00 20.52 ? 74  GLY B O   1 
ATOM   2918 N  N   . LYS B 1 75  ? 6.053  -21.272 -41.200 1.00 21.95 ? 75  LYS B N   1 
ATOM   2919 C  CA  . LYS B 1 75  ? 5.328  -22.528 -41.462 1.00 22.33 ? 75  LYS B CA  1 
ATOM   2920 C  C   . LYS B 1 75  ? 6.223  -23.782 -41.461 1.00 20.31 ? 75  LYS B C   1 
ATOM   2921 O  O   . LYS B 1 75  ? 5.843  -24.829 -40.933 1.00 20.15 ? 75  LYS B O   1 
ATOM   2922 C  CB  . LYS B 1 75  ? 4.599  -22.436 -42.810 1.00 22.68 ? 75  LYS B CB  1 
ATOM   2923 C  CG  . LYS B 1 75  ? 3.757  -23.649 -43.171 1.00 25.67 ? 75  LYS B CG  1 
ATOM   2924 C  CD  . LYS B 1 75  ? 2.558  -23.787 -42.236 1.00 28.61 ? 75  LYS B CD  1 
ATOM   2925 C  CE  . LYS B 1 75  ? 1.600  -24.905 -42.673 1.00 30.07 ? 75  LYS B CE  1 
ATOM   2926 N  NZ  . LYS B 1 75  ? 2.177  -26.277 -42.572 1.00 30.81 ? 75  LYS B NZ  1 
ATOM   2927 N  N   . ALA B 1 76  ? 7.407  -23.677 -42.058 1.00 20.86 ? 76  ALA B N   1 
ATOM   2928 C  CA  . ALA B 1 76  ? 8.339  -24.809 -42.120 1.00 20.75 ? 76  ALA B CA  1 
ATOM   2929 C  C   . ALA B 1 76  ? 8.789  -25.279 -40.737 1.00 19.86 ? 76  ALA B C   1 
ATOM   2930 O  O   . ALA B 1 76  ? 9.109  -26.454 -40.548 1.00 20.42 ? 76  ALA B O   1 
ATOM   2931 C  CB  . ALA B 1 76  ? 9.551  -24.437 -42.963 1.00 19.41 ? 76  ALA B CB  1 
ATOM   2932 N  N   . SER B 1 77  ? 8.824  -24.359 -39.778 1.00 19.99 ? 77  SER B N   1 
ATOM   2933 C  CA  . SER B 1 77  ? 9.231  -24.694 -38.413 1.00 20.34 ? 77  SER B CA  1 
ATOM   2934 C  C   . SER B 1 77  ? 8.043  -25.300 -37.694 1.00 20.76 ? 77  SER B C   1 
ATOM   2935 O  O   . SER B 1 77  ? 8.199  -26.150 -36.817 1.00 21.13 ? 77  SER B O   1 
ATOM   2936 C  CB  . SER B 1 77  ? 9.714  -23.446 -37.663 1.00 18.81 ? 77  SER B CB  1 
ATOM   2937 O  OG  . SER B 1 77  ? 10.953 -22.993 -38.182 1.00 18.63 ? 77  SER B OG  1 
ATOM   2938 N  N   . GLU B 1 78  ? 6.855  -24.839 -38.079 1.00 22.73 ? 78  GLU B N   1 
ATOM   2939 C  CA  . GLU B 1 78  ? 5.593  -25.315 -37.524 1.00 22.90 ? 78  GLU B CA  1 
ATOM   2940 C  C   . GLU B 1 78  ? 5.518  -26.815 -37.772 1.00 22.75 ? 78  GLU B C   1 
ATOM   2941 O  O   . GLU B 1 78  ? 5.247  -27.609 -36.868 1.00 22.81 ? 78  GLU B O   1 
ATOM   2942 C  CB  . GLU B 1 78  ? 4.435  -24.622 -38.240 1.00 25.56 ? 78  GLU B CB  1 
ATOM   2943 C  CG  . GLU B 1 78  ? 3.668  -23.625 -37.404 1.00 27.84 ? 78  GLU B CG  1 
ATOM   2944 C  CD  . GLU B 1 78  ? 2.395  -24.207 -36.828 1.00 31.83 ? 78  GLU B CD  1 
ATOM   2945 O  OE1 . GLU B 1 78  ? 1.519  -24.614 -37.628 1.00 33.50 ? 78  GLU B OE1 1 
ATOM   2946 O  OE2 . GLU B 1 78  ? 2.265  -24.257 -35.582 1.00 32.09 ? 78  GLU B OE2 1 
ATOM   2947 N  N   . GLN B 1 79  ? 5.760  -27.181 -39.023 1.00 23.08 ? 79  GLN B N   1 
ATOM   2948 C  CA  . GLN B 1 79  ? 5.740  -28.571 -39.462 1.00 22.27 ? 79  GLN B CA  1 
ATOM   2949 C  C   . GLN B 1 79  ? 6.802  -29.395 -38.734 1.00 22.28 ? 79  GLN B C   1 
ATOM   2950 O  O   . GLN B 1 79  ? 6.540  -30.493 -38.242 1.00 21.98 ? 79  GLN B O   1 
ATOM   2951 C  CB  . GLN B 1 79  ? 6.029  -28.644 -40.966 1.00 24.22 ? 79  GLN B CB  1 
ATOM   2952 C  CG  . GLN B 1 79  ? 5.127  -27.821 -41.869 1.00 23.67 ? 79  GLN B CG  1 
ATOM   2953 C  CD  . GLN B 1 79  ? 5.533  -27.938 -43.332 1.00 23.90 ? 79  GLN B CD  1 
ATOM   2954 O  OE1 . GLN B 1 79  ? 5.671  -26.803 -44.002 1.00 25.66 ? 79  GLN B OE1 1 
ATOM   2955 N  NE2 . GLN B 1 79  ? 5.717  -29.040 -43.851 1.00 23.19 ? 79  GLN B NE2 1 
ATOM   2956 N  N   . LEU B 1 80  ? 8.014  -28.856 -38.694 1.00 22.10 ? 80  LEU B N   1 
ATOM   2957 C  CA  . LEU B 1 80  ? 9.136  -29.532 -38.063 1.00 22.01 ? 80  LEU B CA  1 
ATOM   2958 C  C   . LEU B 1 80  ? 8.898  -29.754 -36.578 1.00 22.04 ? 80  LEU B C   1 
ATOM   2959 O  O   . LEU B 1 80  ? 9.122  -30.846 -36.071 1.00 23.23 ? 80  LEU B O   1 
ATOM   2960 C  CB  . LEU B 1 80  ? 10.412 -28.717 -38.289 1.00 20.18 ? 80  LEU B CB  1 
ATOM   2961 C  CG  . LEU B 1 80  ? 11.729 -29.294 -37.797 1.00 15.94 ? 80  LEU B CG  1 
ATOM   2962 C  CD1 . LEU B 1 80  ? 11.867 -30.753 -38.208 1.00 18.87 ? 80  LEU B CD1 1 
ATOM   2963 C  CD2 . LEU B 1 80  ? 12.853 -28.448 -38.362 1.00 16.94 ? 80  LEU B CD2 1 
ATOM   2964 N  N   . ALA B 1 81  ? 8.434  -28.713 -35.893 1.00 23.48 ? 81  ALA B N   1 
ATOM   2965 C  CA  . ALA B 1 81  ? 8.155  -28.775 -34.461 1.00 23.88 ? 81  ALA B CA  1 
ATOM   2966 C  C   . ALA B 1 81  ? 7.161  -29.883 -34.116 1.00 25.14 ? 81  ALA B C   1 
ATOM   2967 O  O   . ALA B 1 81  ? 7.217  -30.470 -33.032 1.00 24.80 ? 81  ALA B O   1 
ATOM   2968 C  CB  . ALA B 1 81  ? 7.622  -27.424 -33.977 1.00 24.51 ? 81  ALA B CB  1 
ATOM   2969 N  N   . GLY B 1 82  ? 6.246  -30.162 -35.039 1.00 25.47 ? 82  GLY B N   1 
ATOM   2970 C  CA  . GLY B 1 82  ? 5.266  -31.206 -34.802 1.00 26.10 ? 82  GLY B CA  1 
ATOM   2971 C  C   . GLY B 1 82  ? 5.824  -32.601 -35.023 1.00 26.83 ? 82  GLY B C   1 
ATOM   2972 O  O   . GLY B 1 82  ? 5.468  -33.536 -34.298 1.00 26.75 ? 82  GLY B O   1 
ATOM   2973 N  N   . LYS B 1 83  ? 6.703  -32.735 -36.019 1.00 28.04 ? 83  LYS B N   1 
ATOM   2974 C  CA  . LYS B 1 83  ? 7.316  -34.016 -36.364 1.00 28.97 ? 83  LYS B CA  1 
ATOM   2975 C  C   . LYS B 1 83  ? 8.451  -34.400 -35.416 1.00 28.56 ? 83  LYS B C   1 
ATOM   2976 O  O   . LYS B 1 83  ? 8.903  -35.547 -35.410 1.00 29.10 ? 83  LYS B O   1 
ATOM   2977 C  CB  . LYS B 1 83  ? 7.845  -33.978 -37.800 1.00 30.53 ? 83  LYS B CB  1 
ATOM   2978 C  CG  . LYS B 1 83  ? 7.711  -35.300 -38.528 1.00 35.65 ? 83  LYS B CG  1 
ATOM   2979 C  CD  . LYS B 1 83  ? 6.239  -35.627 -38.775 1.00 38.72 ? 83  LYS B CD  1 
ATOM   2980 C  CE  . LYS B 1 83  ? 6.067  -36.886 -39.600 1.00 39.91 ? 83  LYS B CE  1 
ATOM   2981 N  NZ  . LYS B 1 83  ? 4.660  -37.032 -40.087 1.00 39.78 ? 83  LYS B NZ  1 
ATOM   2982 N  N   . VAL B 1 84  ? 8.917  -33.433 -34.631 1.00 27.50 ? 84  VAL B N   1 
ATOM   2983 C  CA  . VAL B 1 84  ? 9.982  -33.664 -33.665 1.00 26.29 ? 84  VAL B CA  1 
ATOM   2984 C  C   . VAL B 1 84  ? 9.387  -34.221 -32.374 1.00 26.41 ? 84  VAL B C   1 
ATOM   2985 O  O   . VAL B 1 84  ? 9.784  -35.286 -31.908 1.00 26.55 ? 84  VAL B O   1 
ATOM   2986 C  CB  . VAL B 1 84  ? 10.747 -32.357 -33.347 1.00 25.71 ? 84  VAL B CB  1 
ATOM   2987 C  CG1 . VAL B 1 84  ? 11.575 -32.526 -32.073 1.00 23.90 ? 84  VAL B CG1 1 
ATOM   2988 C  CG2 . VAL B 1 84  ? 11.658 -32.000 -34.513 1.00 25.27 ? 84  VAL B CG2 1 
ATOM   2989 N  N   . ALA B 1 85  ? 8.429  -33.502 -31.799 1.00 26.74 ? 85  ALA B N   1 
ATOM   2990 C  CA  . ALA B 1 85  ? 7.792  -33.953 -30.565 1.00 27.61 ? 85  ALA B CA  1 
ATOM   2991 C  C   . ALA B 1 85  ? 7.291  -35.375 -30.756 1.00 28.56 ? 85  ALA B C   1 
ATOM   2992 O  O   . ALA B 1 85  ? 7.226  -36.152 -29.808 1.00 28.15 ? 85  ALA B O   1 
ATOM   2993 C  CB  . ALA B 1 85  ? 6.637  -33.038 -30.203 1.00 26.93 ? 85  ALA B CB  1 
ATOM   2994 N  N   . GLU B 1 86  ? 6.940  -35.702 -31.997 1.00 30.40 ? 86  GLU B N   1 
ATOM   2995 C  CA  . GLU B 1 86  ? 6.455  -37.032 -32.338 1.00 31.55 ? 86  GLU B CA  1 
ATOM   2996 C  C   . GLU B 1 86  ? 7.523  -38.066 -32.013 1.00 31.76 ? 86  GLU B C   1 
ATOM   2997 O  O   . GLU B 1 86  ? 7.245  -39.061 -31.339 1.00 32.69 ? 86  GLU B O   1 
ATOM   2998 C  CB  . GLU B 1 86  ? 6.099  -37.113 -33.829 1.00 32.07 ? 86  GLU B CB  1 
ATOM   2999 C  CG  . GLU B 1 86  ? 5.717  -38.512 -34.298 1.00 33.90 ? 86  GLU B CG  1 
ATOM   3000 C  CD  . GLU B 1 86  ? 5.312  -38.558 -35.760 1.00 34.31 ? 86  GLU B CD  1 
ATOM   3001 O  OE1 . GLU B 1 86  ? 5.064  -39.670 -36.283 1.00 34.67 ? 86  GLU B OE1 1 
ATOM   3002 O  OE2 . GLU B 1 86  ? 5.240  -37.478 -36.386 1.00 35.54 ? 86  GLU B OE2 1 
ATOM   3003 N  N   . VAL B 1 87  ? 8.743  -37.833 -32.491 1.00 31.37 ? 87  VAL B N   1 
ATOM   3004 C  CA  . VAL B 1 87  ? 9.833  -38.768 -32.235 1.00 30.77 ? 87  VAL B CA  1 
ATOM   3005 C  C   . VAL B 1 87  ? 10.244 -38.687 -30.768 1.00 30.96 ? 87  VAL B C   1 
ATOM   3006 O  O   . VAL B 1 87  ? 10.822 -39.630 -30.228 1.00 31.26 ? 87  VAL B O   1 
ATOM   3007 C  CB  . VAL B 1 87  ? 11.061 -38.493 -33.148 1.00 30.53 ? 87  VAL B CB  1 
ATOM   3008 C  CG1 . VAL B 1 87  ? 10.593 -38.154 -34.555 1.00 28.94 ? 87  VAL B CG1 1 
ATOM   3009 C  CG2 . VAL B 1 87  ? 11.912 -37.382 -32.575 1.00 32.59 ? 87  VAL B CG2 1 
ATOM   3010 N  N   . LYS B 1 88  ? 9.947  -37.563 -30.119 1.00 30.51 ? 88  LYS B N   1 
ATOM   3011 C  CA  . LYS B 1 88  ? 10.277 -37.426 -28.707 1.00 29.49 ? 88  LYS B CA  1 
ATOM   3012 C  C   . LYS B 1 88  ? 9.475  -38.464 -27.933 1.00 29.60 ? 88  LYS B C   1 
ATOM   3013 O  O   . LYS B 1 88  ? 10.019 -39.163 -27.081 1.00 29.71 ? 88  LYS B O   1 
ATOM   3014 C  CB  . LYS B 1 88  ? 9.943  -36.023 -28.185 1.00 27.96 ? 88  LYS B CB  1 
ATOM   3015 C  CG  . LYS B 1 88  ? 10.816 -34.906 -28.737 1.00 26.67 ? 88  LYS B CG  1 
ATOM   3016 C  CD  . LYS B 1 88  ? 12.294 -35.272 -28.730 1.00 26.29 ? 88  LYS B CD  1 
ATOM   3017 C  CE  . LYS B 1 88  ? 12.799 -35.661 -27.346 1.00 25.53 ? 88  LYS B CE  1 
ATOM   3018 N  NZ  . LYS B 1 88  ? 14.138 -36.312 -27.412 1.00 23.26 ? 88  LYS B NZ  1 
ATOM   3019 N  N   . LYS B 1 89  ? 8.182  -38.562 -28.236 1.00 29.99 ? 89  LYS B N   1 
ATOM   3020 C  CA  . LYS B 1 89  ? 7.319  -39.531 -27.570 1.00 31.78 ? 89  LYS B CA  1 
ATOM   3021 C  C   . LYS B 1 89  ? 7.638  -40.932 -28.084 1.00 33.17 ? 89  LYS B C   1 
ATOM   3022 O  O   . LYS B 1 89  ? 7.487  -41.926 -27.364 1.00 33.12 ? 89  LYS B O   1 
ATOM   3023 C  CB  . LYS B 1 89  ? 5.855  -39.213 -27.842 1.00 32.84 ? 89  LYS B CB  1 
ATOM   3024 C  CG  . LYS B 1 89  ? 5.460  -37.786 -27.541 1.00 34.37 ? 89  LYS B CG  1 
ATOM   3025 C  CD  . LYS B 1 89  ? 4.022  -37.514 -27.967 1.00 35.99 ? 89  LYS B CD  1 
ATOM   3026 C  CE  . LYS B 1 89  ? 3.845  -37.648 -29.474 1.00 37.83 ? 89  LYS B CE  1 
ATOM   3027 N  NZ  . LYS B 1 89  ? 4.189  -39.007 -30.006 1.00 38.99 ? 89  LYS B NZ  1 
ATOM   3028 N  N   . ASN B 1 90  ? 8.072  -41.008 -29.339 1.00 33.87 ? 90  ASN B N   1 
ATOM   3029 C  CA  . ASN B 1 90  ? 8.440  -42.282 -29.944 1.00 34.21 ? 90  ASN B CA  1 
ATOM   3030 C  C   . ASN B 1 90  ? 9.615  -42.836 -29.148 1.00 34.07 ? 90  ASN B C   1 
ATOM   3031 O  O   . ASN B 1 90  ? 10.048 -43.971 -29.361 1.00 33.98 ? 90  ASN B O   1 
ATOM   3032 C  CB  . ASN B 1 90  ? 8.856  -42.078 -31.404 1.00 35.89 ? 90  ASN B CB  1 
ATOM   3033 C  CG  . ASN B 1 90  ? 7.737  -41.516 -32.257 1.00 37.81 ? 90  ASN B CG  1 
ATOM   3034 O  OD1 . ASN B 1 90  ? 6.521  -41.549 -31.730 1.00 39.60 ? 90  ASN B OD1 1 
ATOM   3035 N  ND2 . ASN B 1 90  ? 7.961  -41.060 -33.378 1.00 39.44 ? 90  ASN B ND2 1 
ATOM   3036 N  N   . GLY B 1 91  ? 10.117 -42.015 -28.226 1.00 33.86 ? 91  GLY B N   1 
ATOM   3037 C  CA  . GLY B 1 91  ? 11.244 -42.399 -27.394 1.00 33.40 ? 91  GLY B CA  1 
ATOM   3038 C  C   . GLY B 1 91  ? 12.518 -42.401 -28.207 1.00 33.46 ? 91  GLY B C   1 
ATOM   3039 O  O   . GLY B 1 91  ? 13.288 -43.362 -28.168 1.00 34.20 ? 91  GLY B O   1 
ATOM   3040 N  N   . ARG B 1 92  ? 12.753 -41.320 -28.944 1.00 32.77 ? 92  ARG B N   1 
ATOM   3041 C  CA  . ARG B 1 92  ? 13.934 -41.232 -29.792 1.00 31.24 ? 92  ARG B CA  1 
ATOM   3042 C  C   . ARG B 1 92  ? 14.551 -39.831 -29.856 1.00 30.19 ? 92  ARG B C   1 
ATOM   3043 O  O   . ARG B 1 92  ? 13.870 -38.819 -29.633 1.00 29.76 ? 92  ARG B O   1 
ATOM   3044 C  CB  . ARG B 1 92  ? 13.573 -41.670 -31.215 1.00 32.46 ? 92  ARG B CB  1 
ATOM   3045 C  CG  . ARG B 1 92  ? 12.950 -43.052 -31.340 1.00 33.73 ? 92  ARG B CG  1 
ATOM   3046 C  CD  . ARG B 1 92  ? 12.528 -43.316 -32.781 1.00 35.69 ? 92  ARG B CD  1 
ATOM   3047 N  NE  . ARG B 1 92  ? 12.336 -44.737 -33.064 1.00 39.37 ? 92  ARG B NE  1 
ATOM   3048 C  CZ  . ARG B 1 92  ? 11.352 -45.484 -32.569 1.00 41.77 ? 92  ARG B CZ  1 
ATOM   3049 N  NH1 . ARG B 1 92  ? 10.449 -44.953 -31.753 1.00 42.98 ? 92  ARG B NH1 1 
ATOM   3050 N  NH2 . ARG B 1 92  ? 11.271 -46.770 -32.893 1.00 43.13 ? 92  ARG B NH2 1 
ATOM   3051 N  N   . ILE B 1 93  ? 15.846 -39.796 -30.175 1.00 28.01 ? 93  ILE B N   1 
ATOM   3052 C  CA  . ILE B 1 93  ? 16.610 -38.558 -30.326 1.00 25.65 ? 93  ILE B CA  1 
ATOM   3053 C  C   . ILE B 1 93  ? 16.306 -38.008 -31.722 1.00 25.80 ? 93  ILE B C   1 
ATOM   3054 O  O   . ILE B 1 93  ? 16.655 -38.638 -32.723 1.00 26.49 ? 93  ILE B O   1 
ATOM   3055 C  CB  . ILE B 1 93  ? 18.139 -38.826 -30.227 1.00 22.76 ? 93  ILE B CB  1 
ATOM   3056 C  CG1 . ILE B 1 93  ? 18.502 -39.291 -28.819 1.00 22.28 ? 93  ILE B CG1 1 
ATOM   3057 C  CG2 . ILE B 1 93  ? 18.922 -37.572 -30.589 1.00 24.01 ? 93  ILE B CG2 1 
ATOM   3058 C  CD1 . ILE B 1 93  ? 19.950 -39.794 -28.691 1.00 22.36 ? 93  ILE B CD1 1 
ATOM   3059 N  N   . SER B 1 94  ? 15.658 -36.848 -31.796 1.00 25.55 ? 94  SER B N   1 
ATOM   3060 C  CA  . SER B 1 94  ? 15.325 -36.254 -33.090 1.00 25.13 ? 94  SER B CA  1 
ATOM   3061 C  C   . SER B 1 94  ? 16.563 -35.723 -33.818 1.00 25.30 ? 94  SER B C   1 
ATOM   3062 O  O   . SER B 1 94  ? 17.263 -34.836 -33.331 1.00 26.43 ? 94  SER B O   1 
ATOM   3063 C  CB  . SER B 1 94  ? 14.291 -35.137 -32.916 1.00 24.94 ? 94  SER B CB  1 
ATOM   3064 O  OG  . SER B 1 94  ? 14.682 -34.202 -31.922 1.00 25.10 ? 94  SER B OG  1 
ATOM   3065 N  N   . LEU B 1 95  ? 16.817 -36.281 -34.995 1.00 24.41 ? 95  LEU B N   1 
ATOM   3066 C  CA  . LEU B 1 95  ? 17.961 -35.912 -35.816 1.00 23.37 ? 95  LEU B CA  1 
ATOM   3067 C  C   . LEU B 1 95  ? 17.452 -35.173 -37.048 1.00 22.81 ? 95  LEU B C   1 
ATOM   3068 O  O   . LEU B 1 95  ? 17.181 -35.778 -38.077 1.00 22.51 ? 95  LEU B O   1 
ATOM   3069 C  CB  . LEU B 1 95  ? 18.727 -37.188 -36.214 1.00 23.56 ? 95  LEU B CB  1 
ATOM   3070 C  CG  . LEU B 1 95  ? 20.085 -37.156 -36.927 1.00 23.03 ? 95  LEU B CG  1 
ATOM   3071 C  CD1 . LEU B 1 95  ? 20.763 -38.519 -36.802 1.00 23.27 ? 95  LEU B CD1 1 
ATOM   3072 C  CD2 . LEU B 1 95  ? 19.903 -36.801 -38.379 1.00 22.92 ? 95  LEU B CD2 1 
ATOM   3073 N  N   . VAL B 1 96  ? 17.312 -33.858 -36.935 1.00 23.04 ? 96  VAL B N   1 
ATOM   3074 C  CA  . VAL B 1 96  ? 16.822 -33.065 -38.049 1.00 23.31 ? 96  VAL B CA  1 
ATOM   3075 C  C   . VAL B 1 96  ? 17.964 -32.699 -38.985 1.00 24.58 ? 96  VAL B C   1 
ATOM   3076 O  O   . VAL B 1 96  ? 18.883 -31.972 -38.601 1.00 24.13 ? 96  VAL B O   1 
ATOM   3077 C  CB  . VAL B 1 96  ? 16.121 -31.752 -37.566 1.00 23.89 ? 96  VAL B CB  1 
ATOM   3078 C  CG1 . VAL B 1 96  ? 15.634 -30.940 -38.771 1.00 23.74 ? 96  VAL B CG1 1 
ATOM   3079 C  CG2 . VAL B 1 96  ? 14.946 -32.084 -36.642 1.00 23.32 ? 96  VAL B CG2 1 
ATOM   3080 N  N   . LEU B 1 97  ? 17.923 -33.239 -40.202 1.00 25.09 ? 97  LEU B N   1 
ATOM   3081 C  CA  . LEU B 1 97  ? 18.927 -32.923 -41.209 1.00 25.99 ? 97  LEU B CA  1 
ATOM   3082 C  C   . LEU B 1 97  ? 18.267 -31.777 -41.971 1.00 26.97 ? 97  LEU B C   1 
ATOM   3083 O  O   . LEU B 1 97  ? 17.679 -31.975 -43.039 1.00 27.44 ? 97  LEU B O   1 
ATOM   3084 C  CB  . LEU B 1 97  ? 19.167 -34.107 -42.152 1.00 26.67 ? 97  LEU B CB  1 
ATOM   3085 C  CG  . LEU B 1 97  ? 19.756 -35.439 -41.664 1.00 26.92 ? 97  LEU B CG  1 
ATOM   3086 C  CD1 . LEU B 1 97  ? 19.980 -36.356 -42.872 1.00 24.25 ? 97  LEU B CD1 1 
ATOM   3087 C  CD2 . LEU B 1 97  ? 21.078 -35.204 -40.943 1.00 27.35 ? 97  LEU B CD2 1 
ATOM   3088 N  N   . GLY B 1 98  ? 18.356 -30.578 -41.403 1.00 27.73 ? 98  GLY B N   1 
ATOM   3089 C  CA  . GLY B 1 98  ? 17.718 -29.426 -42.011 1.00 27.96 ? 98  GLY B CA  1 
ATOM   3090 C  C   . GLY B 1 98  ? 18.576 -28.494 -42.834 1.00 27.92 ? 98  GLY B C   1 
ATOM   3091 O  O   . GLY B 1 98  ? 19.783 -28.378 -42.611 1.00 28.75 ? 98  GLY B O   1 
ATOM   3092 N  N   . GLY B 1 99  ? 17.933 -27.827 -43.792 1.00 25.52 ? 99  GLY B N   1 
ATOM   3093 C  CA  . GLY B 1 99  ? 18.632 -26.883 -44.637 1.00 22.29 ? 99  GLY B CA  1 
ATOM   3094 C  C   . GLY B 1 99  ? 19.159 -25.749 -43.782 1.00 20.45 ? 99  GLY B C   1 
ATOM   3095 O  O   . GLY B 1 99  ? 20.148 -25.926 -43.078 1.00 16.89 ? 99  GLY B O   1 
ATOM   3096 N  N   . ASP B 1 100 ? 18.496 -24.594 -43.816 1.00 19.99 ? 100 ASP B N   1 
ATOM   3097 C  CA  . ASP B 1 100 ? 18.954 -23.451 -43.031 1.00 19.70 ? 100 ASP B CA  1 
ATOM   3098 C  C   . ASP B 1 100 ? 18.522 -23.495 -41.561 1.00 19.16 ? 100 ASP B C   1 
ATOM   3099 O  O   . ASP B 1 100 ? 17.493 -24.074 -41.207 1.00 16.92 ? 100 ASP B O   1 
ATOM   3100 C  CB  . ASP B 1 100 ? 18.523 -22.132 -43.696 1.00 19.49 ? 100 ASP B CB  1 
ATOM   3101 C  CG  . ASP B 1 100 ? 17.022 -21.893 -43.642 1.00 18.97 ? 100 ASP B CG  1 
ATOM   3102 O  OD1 . ASP B 1 100 ? 16.509 -21.562 -42.560 1.00 19.66 ? 100 ASP B OD1 1 
ATOM   3103 O  OD2 . ASP B 1 100 ? 16.358 -22.031 -44.685 1.00 18.40 ? 100 ASP B OD2 1 
ATOM   3104 N  N   . HIS B 1 101 ? 19.344 -22.876 -40.718 1.00 19.49 ? 101 HIS B N   1 
ATOM   3105 C  CA  . HIS B 1 101 ? 19.143 -22.835 -39.274 1.00 20.81 ? 101 HIS B CA  1 
ATOM   3106 C  C   . HIS B 1 101 ? 17.834 -22.202 -38.779 1.00 21.19 ? 101 HIS B C   1 
ATOM   3107 O  O   . HIS B 1 101 ? 17.514 -22.287 -37.591 1.00 19.54 ? 101 HIS B O   1 
ATOM   3108 C  CB  . HIS B 1 101 ? 20.344 -22.124 -38.635 1.00 20.88 ? 101 HIS B CB  1 
ATOM   3109 C  CG  . HIS B 1 101 ? 20.821 -22.754 -37.362 1.00 21.06 ? 101 HIS B CG  1 
ATOM   3110 N  ND1 . HIS B 1 101 ? 22.071 -22.509 -36.837 1.00 19.72 ? 101 HIS B ND1 1 
ATOM   3111 C  CD2 . HIS B 1 101 ? 20.216 -23.610 -36.503 1.00 21.60 ? 101 HIS B CD2 1 
ATOM   3112 C  CE1 . HIS B 1 101 ? 22.218 -23.187 -35.712 1.00 19.15 ? 101 HIS B CE1 1 
ATOM   3113 N  NE2 . HIS B 1 101 ? 21.107 -23.863 -35.487 1.00 20.96 ? 101 HIS B NE2 1 
ATOM   3114 N  N   . SER B 1 102 ? 17.073 -21.576 -39.675 1.00 22.87 ? 102 SER B N   1 
ATOM   3115 C  CA  . SER B 1 102 ? 15.825 -20.946 -39.262 1.00 21.02 ? 102 SER B CA  1 
ATOM   3116 C  C   . SER B 1 102 ? 14.864 -21.975 -38.674 1.00 20.70 ? 102 SER B C   1 
ATOM   3117 O  O   . SER B 1 102 ? 13.965 -21.624 -37.912 1.00 20.99 ? 102 SER B O   1 
ATOM   3118 C  CB  . SER B 1 102 ? 15.158 -20.207 -40.437 1.00 22.03 ? 102 SER B CB  1 
ATOM   3119 O  OG  . SER B 1 102 ? 14.497 -21.089 -41.333 1.00 22.00 ? 102 SER B OG  1 
ATOM   3120 N  N   . LEU B 1 103 ? 15.060 -23.247 -39.006 1.00 19.36 ? 103 LEU B N   1 
ATOM   3121 C  CA  . LEU B 1 103 ? 14.176 -24.291 -38.497 1.00 18.21 ? 103 LEU B CA  1 
ATOM   3122 C  C   . LEU B 1 103 ? 14.468 -24.710 -37.064 1.00 18.19 ? 103 LEU B C   1 
ATOM   3123 O  O   . LEU B 1 103 ? 13.810 -25.606 -36.536 1.00 19.64 ? 103 LEU B O   1 
ATOM   3124 C  CB  . LEU B 1 103 ? 14.221 -25.524 -39.402 1.00 17.00 ? 103 LEU B CB  1 
ATOM   3125 C  CG  . LEU B 1 103 ? 13.775 -25.314 -40.844 1.00 15.13 ? 103 LEU B CG  1 
ATOM   3126 C  CD1 . LEU B 1 103 ? 14.997 -25.127 -41.726 1.00 16.70 ? 103 LEU B CD1 1 
ATOM   3127 C  CD2 . LEU B 1 103 ? 12.973 -26.505 -41.295 1.00 12.78 ? 103 LEU B CD2 1 
ATOM   3128 N  N   . ALA B 1 104 ? 15.451 -24.068 -36.437 1.00 19.27 ? 104 ALA B N   1 
ATOM   3129 C  CA  . ALA B 1 104 ? 15.816 -24.382 -35.058 1.00 19.86 ? 104 ALA B CA  1 
ATOM   3130 C  C   . ALA B 1 104 ? 14.639 -24.094 -34.140 1.00 19.56 ? 104 ALA B C   1 
ATOM   3131 O  O   . ALA B 1 104 ? 14.493 -24.715 -33.091 1.00 19.42 ? 104 ALA B O   1 
ATOM   3132 C  CB  . ALA B 1 104 ? 17.027 -23.556 -34.630 1.00 20.50 ? 104 ALA B CB  1 
ATOM   3133 N  N   . ILE B 1 105 ? 13.810 -23.135 -34.544 1.00 20.29 ? 105 ILE B N   1 
ATOM   3134 C  CA  . ILE B 1 105 ? 12.621 -22.764 -33.784 1.00 19.07 ? 105 ILE B CA  1 
ATOM   3135 C  C   . ILE B 1 105 ? 11.706 -23.989 -33.775 1.00 19.74 ? 105 ILE B C   1 
ATOM   3136 O  O   . ILE B 1 105 ? 11.236 -24.428 -32.722 1.00 20.53 ? 105 ILE B O   1 
ATOM   3137 C  CB  . ILE B 1 105 ? 11.894 -21.570 -34.446 1.00 18.92 ? 105 ILE B CB  1 
ATOM   3138 C  CG1 . ILE B 1 105 ? 12.868 -20.402 -34.608 1.00 17.11 ? 105 ILE B CG1 1 
ATOM   3139 C  CG2 . ILE B 1 105 ? 10.713 -21.124 -33.584 1.00 20.05 ? 105 ILE B CG2 1 
ATOM   3140 C  CD1 . ILE B 1 105 ? 12.330 -19.225 -35.422 1.00 16.25 ? 105 ILE B CD1 1 
ATOM   3141 N  N   . GLY B 1 106 ? 11.476 -24.550 -34.957 1.00 19.03 ? 106 GLY B N   1 
ATOM   3142 C  CA  . GLY B 1 106 ? 10.645 -25.732 -35.051 1.00 19.00 ? 106 GLY B CA  1 
ATOM   3143 C  C   . GLY B 1 106 ? 11.259 -26.847 -34.225 1.00 19.21 ? 106 GLY B C   1 
ATOM   3144 O  O   . GLY B 1 106 ? 10.623 -27.380 -33.312 1.00 18.41 ? 106 GLY B O   1 
ATOM   3145 N  N   . SER B 1 107 ? 12.510 -27.181 -34.530 1.00 19.30 ? 107 SER B N   1 
ATOM   3146 C  CA  . SER B 1 107 ? 13.225 -28.240 -33.828 1.00 20.92 ? 107 SER B CA  1 
ATOM   3147 C  C   . SER B 1 107 ? 13.205 -28.135 -32.307 1.00 21.15 ? 107 SER B C   1 
ATOM   3148 O  O   . SER B 1 107 ? 12.815 -29.079 -31.616 1.00 21.81 ? 107 SER B O   1 
ATOM   3149 C  CB  . SER B 1 107 ? 14.675 -28.280 -34.292 1.00 21.36 ? 107 SER B CB  1 
ATOM   3150 O  OG  . SER B 1 107 ? 15.389 -29.264 -33.572 1.00 23.20 ? 107 SER B OG  1 
ATOM   3151 N  N   . ILE B 1 108 ? 13.636 -26.987 -31.793 1.00 20.91 ? 108 ILE B N   1 
ATOM   3152 C  CA  . ILE B 1 108 ? 13.687 -26.766 -30.359 1.00 21.81 ? 108 ILE B CA  1 
ATOM   3153 C  C   . ILE B 1 108 ? 12.314 -26.726 -29.704 1.00 22.45 ? 108 ILE B C   1 
ATOM   3154 O  O   . ILE B 1 108 ? 12.124 -27.318 -28.644 1.00 23.38 ? 108 ILE B O   1 
ATOM   3155 C  CB  . ILE B 1 108 ? 14.476 -25.474 -30.035 1.00 20.38 ? 108 ILE B CB  1 
ATOM   3156 C  CG1 . ILE B 1 108 ? 15.892 -25.589 -30.624 1.00 18.96 ? 108 ILE B CG1 1 
ATOM   3157 C  CG2 . ILE B 1 108 ? 14.523 -25.251 -28.526 1.00 20.27 ? 108 ILE B CG2 1 
ATOM   3158 C  CD1 . ILE B 1 108 ? 16.865 -24.566 -30.137 1.00 16.83 ? 108 ILE B CD1 1 
ATOM   3159 N  N   . SER B 1 109 ? 11.359 -26.041 -30.330 1.00 25.04 ? 109 SER B N   1 
ATOM   3160 C  CA  . SER B 1 109 ? 9.993  -25.943 -29.799 1.00 26.01 ? 109 SER B CA  1 
ATOM   3161 C  C   . SER B 1 109 ? 9.322  -27.309 -29.705 1.00 25.20 ? 109 SER B C   1 
ATOM   3162 O  O   . SER B 1 109 ? 8.744  -27.657 -28.675 1.00 25.06 ? 109 SER B O   1 
ATOM   3163 C  CB  . SER B 1 109 ? 9.131  -25.048 -30.693 1.00 27.73 ? 109 SER B CB  1 
ATOM   3164 O  OG  . SER B 1 109 ? 9.694  -23.760 -30.827 1.00 31.33 ? 109 SER B OG  1 
ATOM   3165 N  N   . GLY B 1 110 ? 9.394  -28.066 -30.800 1.00 24.62 ? 110 GLY B N   1 
ATOM   3166 C  CA  . GLY B 1 110 ? 8.801  -29.392 -30.865 1.00 22.59 ? 110 GLY B CA  1 
ATOM   3167 C  C   . GLY B 1 110 ? 9.411  -30.372 -29.882 1.00 22.40 ? 110 GLY B C   1 
ATOM   3168 O  O   . GLY B 1 110 ? 8.713  -31.222 -29.330 1.00 21.75 ? 110 GLY B O   1 
ATOM   3169 N  N   . HIS B 1 111 ? 10.719 -30.259 -29.673 1.00 21.56 ? 111 HIS B N   1 
ATOM   3170 C  CA  . HIS B 1 111 ? 11.432 -31.115 -28.731 1.00 21.38 ? 111 HIS B CA  1 
ATOM   3171 C  C   . HIS B 1 111 ? 11.017 -30.681 -27.333 1.00 20.54 ? 111 HIS B C   1 
ATOM   3172 O  O   . HIS B 1 111 ? 10.723 -31.517 -26.480 1.00 21.04 ? 111 HIS B O   1 
ATOM   3173 C  CB  . HIS B 1 111 ? 12.948 -30.942 -28.924 1.00 22.75 ? 111 HIS B CB  1 
ATOM   3174 C  CG  . HIS B 1 111 ? 13.784 -31.517 -27.822 1.00 23.19 ? 111 HIS B CG  1 
ATOM   3175 N  ND1 . HIS B 1 111 ? 15.156 -31.385 -27.796 1.00 23.09 ? 111 HIS B ND1 1 
ATOM   3176 C  CD2 . HIS B 1 111 ? 13.451 -32.191 -26.693 1.00 24.57 ? 111 HIS B CD2 1 
ATOM   3177 C  CE1 . HIS B 1 111 ? 15.631 -31.946 -26.698 1.00 24.57 ? 111 HIS B CE1 1 
ATOM   3178 N  NE2 . HIS B 1 111 ? 14.617 -32.443 -26.011 1.00 24.61 ? 111 HIS B NE2 1 
ATOM   3179 N  N   . ALA B 1 112 ? 10.991 -29.369 -27.116 1.00 20.02 ? 112 ALA B N   1 
ATOM   3180 C  CA  . ALA B 1 112 ? 10.610 -28.781 -25.833 1.00 20.22 ? 112 ALA B CA  1 
ATOM   3181 C  C   . ALA B 1 112 ? 9.152  -29.042 -25.437 1.00 20.36 ? 112 ALA B C   1 
ATOM   3182 O  O   . ALA B 1 112 ? 8.774  -28.846 -24.278 1.00 18.47 ? 112 ALA B O   1 
ATOM   3183 C  CB  . ALA B 1 112 ? 10.874 -27.284 -25.854 1.00 21.08 ? 112 ALA B CB  1 
ATOM   3184 N  N   . ARG B 1 113 ? 8.328  -29.463 -26.391 1.00 22.33 ? 113 ARG B N   1 
ATOM   3185 C  CA  . ARG B 1 113 ? 6.934  -29.752 -26.078 1.00 23.61 ? 113 ARG B CA  1 
ATOM   3186 C  C   . ARG B 1 113 ? 6.889  -30.992 -25.194 1.00 25.09 ? 113 ARG B C   1 
ATOM   3187 O  O   . ARG B 1 113 ? 6.115  -31.051 -24.235 1.00 26.16 ? 113 ARG B O   1 
ATOM   3188 C  CB  . ARG B 1 113 ? 6.119  -29.968 -27.355 1.00 23.31 ? 113 ARG B CB  1 
ATOM   3189 C  CG  . ARG B 1 113 ? 6.037  -28.721 -28.205 1.00 24.71 ? 113 ARG B CG  1 
ATOM   3190 C  CD  . ARG B 1 113 ? 4.969  -28.810 -29.275 1.00 26.58 ? 113 ARG B CD  1 
ATOM   3191 N  NE  . ARG B 1 113 ? 4.982  -27.619 -30.122 1.00 27.12 ? 113 ARG B NE  1 
ATOM   3192 C  CZ  . ARG B 1 113 ? 4.130  -27.390 -31.115 1.00 28.59 ? 113 ARG B CZ  1 
ATOM   3193 N  NH1 . ARG B 1 113 ? 3.177  -28.270 -31.403 1.00 30.93 ? 113 ARG B NH1 1 
ATOM   3194 N  NH2 . ARG B 1 113 ? 4.227  -26.275 -31.823 1.00 29.37 ? 113 ARG B NH2 1 
ATOM   3195 N  N   . VAL B 1 114 ? 7.741  -31.965 -25.506 1.00 25.69 ? 114 VAL B N   1 
ATOM   3196 C  CA  . VAL B 1 114 ? 7.815  -33.203 -24.741 1.00 26.76 ? 114 VAL B CA  1 
ATOM   3197 C  C   . VAL B 1 114 ? 8.825  -33.105 -23.585 1.00 26.71 ? 114 VAL B C   1 
ATOM   3198 O  O   . VAL B 1 114 ? 8.760  -33.882 -22.631 1.00 27.67 ? 114 VAL B O   1 
ATOM   3199 C  CB  . VAL B 1 114 ? 8.225  -34.386 -25.649 1.00 26.81 ? 114 VAL B CB  1 
ATOM   3200 C  CG1 . VAL B 1 114 ? 7.978  -35.703 -24.934 1.00 25.64 ? 114 VAL B CG1 1 
ATOM   3201 C  CG2 . VAL B 1 114 ? 7.453  -34.326 -26.959 1.00 28.33 ? 114 VAL B CG2 1 
ATOM   3202 N  N   . HIS B 1 115 ? 9.757  -32.159 -23.671 1.00 26.49 ? 115 HIS B N   1 
ATOM   3203 C  CA  . HIS B 1 115 ? 10.778 -31.989 -22.636 1.00 25.98 ? 115 HIS B CA  1 
ATOM   3204 C  C   . HIS B 1 115 ? 11.084 -30.510 -22.436 1.00 25.49 ? 115 HIS B C   1 
ATOM   3205 O  O   . HIS B 1 115 ? 12.090 -30.012 -22.942 1.00 25.54 ? 115 HIS B O   1 
ATOM   3206 C  CB  . HIS B 1 115 ? 12.081 -32.706 -23.034 1.00 27.47 ? 115 HIS B CB  1 
ATOM   3207 C  CG  . HIS B 1 115 ? 11.930 -34.179 -23.274 1.00 26.87 ? 115 HIS B CG  1 
ATOM   3208 N  ND1 . HIS B 1 115 ? 11.341 -34.695 -24.408 1.00 28.00 ? 115 HIS B ND1 1 
ATOM   3209 C  CD2 . HIS B 1 115 ? 12.311 -35.246 -22.530 1.00 27.60 ? 115 HIS B CD2 1 
ATOM   3210 C  CE1 . HIS B 1 115 ? 11.368 -36.015 -24.354 1.00 26.87 ? 115 HIS B CE1 1 
ATOM   3211 N  NE2 . HIS B 1 115 ? 11.951 -36.375 -23.225 1.00 26.55 ? 115 HIS B NE2 1 
ATOM   3212 N  N   . PRO B 1 116 ? 10.235 -29.793 -21.678 1.00 25.70 ? 116 PRO B N   1 
ATOM   3213 C  CA  . PRO B 1 116 ? 10.416 -28.360 -21.417 1.00 25.43 ? 116 PRO B CA  1 
ATOM   3214 C  C   . PRO B 1 116 ? 11.611 -27.999 -20.547 1.00 25.44 ? 116 PRO B C   1 
ATOM   3215 O  O   . PRO B 1 116 ? 11.893 -26.821 -20.329 1.00 25.36 ? 116 PRO B O   1 
ATOM   3216 C  CB  . PRO B 1 116 ? 9.089  -27.960 -20.773 1.00 26.09 ? 116 PRO B CB  1 
ATOM   3217 C  CG  . PRO B 1 116 ? 8.726  -29.186 -20.000 1.00 25.12 ? 116 PRO B CG  1 
ATOM   3218 C  CD  . PRO B 1 116 ? 9.036  -30.301 -20.986 1.00 25.21 ? 116 PRO B CD  1 
ATOM   3219 N  N   . ASP B 1 117 ? 12.311 -29.014 -20.054 1.00 25.27 ? 117 ASP B N   1 
ATOM   3220 C  CA  . ASP B 1 117 ? 13.475 -28.798 -19.202 1.00 24.66 ? 117 ASP B CA  1 
ATOM   3221 C  C   . ASP B 1 117 ? 14.796 -28.838 -19.989 1.00 23.22 ? 117 ASP B C   1 
ATOM   3222 O  O   . ASP B 1 117 ? 15.837 -28.422 -19.485 1.00 23.05 ? 117 ASP B O   1 
ATOM   3223 C  CB  . ASP B 1 117 ? 13.483 -29.837 -18.061 1.00 24.18 ? 117 ASP B CB  1 
ATOM   3224 C  CG  . ASP B 1 117 ? 13.551 -31.278 -18.562 1.00 24.15 ? 117 ASP B CG  1 
ATOM   3225 O  OD1 . ASP B 1 117 ? 12.777 -31.651 -19.464 1.00 26.26 ? 117 ASP B OD1 1 
ATOM   3226 O  OD2 . ASP B 1 117 ? 14.379 -32.048 -18.035 1.00 25.65 ? 117 ASP B OD2 1 
ATOM   3227 N  N   . LEU B 1 118 ? 14.732 -29.321 -21.229 1.00 22.24 ? 118 LEU B N   1 
ATOM   3228 C  CA  . LEU B 1 118 ? 15.901 -29.432 -22.105 1.00 20.76 ? 118 LEU B CA  1 
ATOM   3229 C  C   . LEU B 1 118 ? 16.870 -28.248 -22.031 1.00 19.34 ? 118 LEU B C   1 
ATOM   3230 O  O   . LEU B 1 118 ? 16.472 -27.105 -21.800 1.00 18.23 ? 118 LEU B O   1 
ATOM   3231 C  CB  . LEU B 1 118 ? 15.446 -29.644 -23.567 1.00 21.20 ? 118 LEU B CB  1 
ATOM   3232 C  CG  . LEU B 1 118 ? 14.699 -28.541 -24.341 1.00 22.33 ? 118 LEU B CG  1 
ATOM   3233 C  CD1 . LEU B 1 118 ? 15.664 -27.441 -24.743 1.00 21.38 ? 118 LEU B CD1 1 
ATOM   3234 C  CD2 . LEU B 1 118 ? 14.059 -29.120 -25.588 1.00 20.20 ? 118 LEU B CD2 1 
ATOM   3235 N  N   . GLY B 1 119 ? 18.152 -28.547 -22.215 1.00 19.53 ? 119 GLY B N   1 
ATOM   3236 C  CA  . GLY B 1 119 ? 19.186 -27.525 -22.199 1.00 17.82 ? 119 GLY B CA  1 
ATOM   3237 C  C   . GLY B 1 119 ? 19.677 -27.432 -23.627 1.00 16.65 ? 119 GLY B C   1 
ATOM   3238 O  O   . GLY B 1 119 ? 19.715 -28.452 -24.323 1.00 16.79 ? 119 GLY B O   1 
ATOM   3239 N  N   . VAL B 1 120 ? 20.047 -26.231 -24.071 1.00 16.47 ? 120 VAL B N   1 
ATOM   3240 C  CA  . VAL B 1 120 ? 20.493 -26.027 -25.449 1.00 14.12 ? 120 VAL B CA  1 
ATOM   3241 C  C   . VAL B 1 120 ? 21.984 -25.713 -25.628 1.00 14.31 ? 120 VAL B C   1 
ATOM   3242 O  O   . VAL B 1 120 ? 22.537 -24.842 -24.945 1.00 12.63 ? 120 VAL B O   1 
ATOM   3243 C  CB  . VAL B 1 120 ? 19.676 -24.872 -26.133 1.00 13.73 ? 120 VAL B CB  1 
ATOM   3244 C  CG1 . VAL B 1 120 ? 20.091 -24.717 -27.600 1.00 13.05 ? 120 VAL B CG1 1 
ATOM   3245 C  CG2 . VAL B 1 120 ? 18.186 -25.152 -26.043 1.00 10.71 ? 120 VAL B CG2 1 
ATOM   3246 N  N   . ILE B 1 121 ? 22.614 -26.425 -26.563 1.00 12.89 ? 121 ILE B N   1 
ATOM   3247 C  CA  . ILE B 1 121 ? 24.018 -26.223 -26.920 1.00 10.01 ? 121 ILE B CA  1 
ATOM   3248 C  C   . ILE B 1 121 ? 23.965 -25.732 -28.369 1.00 9.87  ? 121 ILE B C   1 
ATOM   3249 O  O   . ILE B 1 121 ? 23.482 -26.439 -29.255 1.00 9.63  ? 121 ILE B O   1 
ATOM   3250 C  CB  . ILE B 1 121 ? 24.841 -27.538 -26.856 1.00 10.60 ? 121 ILE B CB  1 
ATOM   3251 C  CG1 . ILE B 1 121 ? 24.729 -28.159 -25.457 1.00 7.93  ? 121 ILE B CG1 1 
ATOM   3252 C  CG2 . ILE B 1 121 ? 26.300 -27.257 -27.243 1.00 8.12  ? 121 ILE B CG2 1 
ATOM   3253 C  CD1 . ILE B 1 121 ? 25.810 -29.207 -25.138 1.00 8.66  ? 121 ILE B CD1 1 
ATOM   3254 N  N   . TRP B 1 122 ? 24.478 -24.528 -28.601 1.00 9.71  ? 122 TRP B N   1 
ATOM   3255 C  CA  . TRP B 1 122 ? 24.447 -23.890 -29.915 1.00 10.79 ? 122 TRP B CA  1 
ATOM   3256 C  C   . TRP B 1 122 ? 25.837 -23.636 -30.507 1.00 9.66  ? 122 TRP B C   1 
ATOM   3257 O  O   . TRP B 1 122 ? 26.452 -22.603 -30.237 1.00 7.10  ? 122 TRP B O   1 
ATOM   3258 C  CB  . TRP B 1 122 ? 23.684 -22.563 -29.772 1.00 13.23 ? 122 TRP B CB  1 
ATOM   3259 C  CG  . TRP B 1 122 ? 23.156 -21.947 -31.034 1.00 14.70 ? 122 TRP B CG  1 
ATOM   3260 C  CD1 . TRP B 1 122 ? 23.837 -21.156 -31.908 1.00 15.41 ? 122 TRP B CD1 1 
ATOM   3261 C  CD2 . TRP B 1 122 ? 21.815 -22.045 -31.541 1.00 17.13 ? 122 TRP B CD2 1 
ATOM   3262 N  NE1 . TRP B 1 122 ? 23.005 -20.747 -32.926 1.00 15.92 ? 122 TRP B NE1 1 
ATOM   3263 C  CE2 . TRP B 1 122 ? 21.758 -21.280 -32.726 1.00 18.28 ? 122 TRP B CE2 1 
ATOM   3264 C  CE3 . TRP B 1 122 ? 20.653 -22.707 -31.107 1.00 16.47 ? 122 TRP B CE3 1 
ATOM   3265 C  CZ2 . TRP B 1 122 ? 20.586 -21.155 -33.487 1.00 18.53 ? 122 TRP B CZ2 1 
ATOM   3266 C  CZ3 . TRP B 1 122 ? 19.487 -22.584 -31.864 1.00 17.29 ? 122 TRP B CZ3 1 
ATOM   3267 C  CH2 . TRP B 1 122 ? 19.466 -21.812 -33.040 1.00 18.19 ? 122 TRP B CH2 1 
ATOM   3268 N  N   . VAL B 1 123 ? 26.320 -24.572 -31.323 1.00 9.94  ? 123 VAL B N   1 
ATOM   3269 C  CA  . VAL B 1 123 ? 27.645 -24.436 -31.954 1.00 12.11 ? 123 VAL B CA  1 
ATOM   3270 C  C   . VAL B 1 123 ? 27.487 -23.621 -33.237 1.00 12.34 ? 123 VAL B C   1 
ATOM   3271 O  O   . VAL B 1 123 ? 26.733 -23.997 -34.142 1.00 13.73 ? 123 VAL B O   1 
ATOM   3272 C  CB  . VAL B 1 123 ? 28.266 -25.826 -32.257 1.00 11.04 ? 123 VAL B CB  1 
ATOM   3273 C  CG1 . VAL B 1 123 ? 29.674 -25.665 -32.835 1.00 9.16  ? 123 VAL B CG1 1 
ATOM   3274 C  CG2 . VAL B 1 123 ? 28.309 -26.649 -30.971 1.00 10.37 ? 123 VAL B CG2 1 
ATOM   3275 N  N   . ASP B 1 124 ? 28.208 -22.509 -33.326 1.00 12.33 ? 124 ASP B N   1 
ATOM   3276 C  CA  . ASP B 1 124 ? 28.034 -21.637 -34.479 1.00 13.00 ? 124 ASP B CA  1 
ATOM   3277 C  C   . ASP B 1 124 ? 29.032 -20.481 -34.456 1.00 12.51 ? 124 ASP B C   1 
ATOM   3278 O  O   . ASP B 1 124 ? 29.536 -20.114 -33.394 1.00 12.70 ? 124 ASP B O   1 
ATOM   3279 C  CB  . ASP B 1 124 ? 26.612 -21.074 -34.397 1.00 13.51 ? 124 ASP B CB  1 
ATOM   3280 C  CG  . ASP B 1 124 ? 26.117 -20.472 -35.688 1.00 13.72 ? 124 ASP B CG  1 
ATOM   3281 O  OD1 . ASP B 1 124 ? 26.918 -19.969 -36.493 1.00 13.38 ? 124 ASP B OD1 1 
ATOM   3282 O  OD2 . ASP B 1 124 ? 24.887 -20.489 -35.878 1.00 14.73 ? 124 ASP B OD2 1 
ATOM   3283 N  N   . ALA B 1 125 ? 29.312 -19.916 -35.631 1.00 11.68 ? 125 ALA B N   1 
ATOM   3284 C  CA  . ALA B 1 125 ? 30.199 -18.760 -35.737 1.00 12.66 ? 125 ALA B CA  1 
ATOM   3285 C  C   . ALA B 1 125 ? 29.326 -17.528 -35.467 1.00 11.32 ? 125 ALA B C   1 
ATOM   3286 O  O   . ALA B 1 125 ? 29.834 -16.426 -35.284 1.00 12.98 ? 125 ALA B O   1 
ATOM   3287 C  CB  . ALA B 1 125 ? 30.817 -18.672 -37.148 1.00 10.86 ? 125 ALA B CB  1 
ATOM   3288 N  N   . HIS B 1 126 ? 28.010 -17.745 -35.430 1.00 12.24 ? 126 HIS B N   1 
ATOM   3289 C  CA  . HIS B 1 126 ? 27.024 -16.686 -35.190 1.00 12.51 ? 126 HIS B CA  1 
ATOM   3290 C  C   . HIS B 1 126 ? 26.077 -16.978 -34.010 1.00 12.47 ? 126 HIS B C   1 
ATOM   3291 O  O   . HIS B 1 126 ? 25.874 -18.134 -33.624 1.00 13.09 ? 126 HIS B O   1 
ATOM   3292 C  CB  . HIS B 1 126 ? 26.199 -16.458 -36.465 1.00 11.63 ? 126 HIS B CB  1 
ATOM   3293 C  CG  . HIS B 1 126 ? 27.013 -16.505 -37.726 1.00 12.66 ? 126 HIS B CG  1 
ATOM   3294 N  ND1 . HIS B 1 126 ? 27.061 -17.616 -38.541 1.00 10.73 ? 126 HIS B ND1 1 
ATOM   3295 C  CD2 . HIS B 1 126 ? 27.850 -15.595 -38.281 1.00 11.48 ? 126 HIS B CD2 1 
ATOM   3296 C  CE1 . HIS B 1 126 ? 27.897 -17.387 -39.539 1.00 12.84 ? 126 HIS B CE1 1 
ATOM   3297 N  NE2 . HIS B 1 126 ? 28.389 -16.169 -39.403 1.00 9.22  ? 126 HIS B NE2 1 
ATOM   3298 N  N   . THR B 1 127 ? 25.500 -15.920 -33.441 1.00 14.02 ? 127 THR B N   1 
ATOM   3299 C  CA  . THR B 1 127 ? 24.574 -16.063 -32.311 1.00 15.91 ? 127 THR B CA  1 
ATOM   3300 C  C   . THR B 1 127 ? 23.144 -16.280 -32.800 1.00 15.14 ? 127 THR B C   1 
ATOM   3301 O  O   . THR B 1 127 ? 22.337 -16.911 -32.113 1.00 13.88 ? 127 THR B O   1 
ATOM   3302 C  CB  . THR B 1 127 ? 24.615 -14.815 -31.356 1.00 14.79 ? 127 THR B CB  1 
ATOM   3303 O  OG1 . THR B 1 127 ? 24.418 -13.614 -32.107 1.00 17.45 ? 127 THR B OG1 1 
ATOM   3304 C  CG2 . THR B 1 127 ? 25.962 -14.718 -30.659 1.00 14.87 ? 127 THR B CG2 1 
ATOM   3305 N  N   . ASP B 1 128 ? 22.842 -15.773 -33.998 1.00 15.97 ? 128 ASP B N   1 
ATOM   3306 C  CA  . ASP B 1 128 ? 21.507 -15.915 -34.572 1.00 16.15 ? 128 ASP B CA  1 
ATOM   3307 C  C   . ASP B 1 128 ? 20.494 -15.457 -33.519 1.00 17.16 ? 128 ASP B C   1 
ATOM   3308 O  O   . ASP B 1 128 ? 19.466 -16.095 -33.308 1.00 15.91 ? 128 ASP B O   1 
ATOM   3309 C  CB  . ASP B 1 128 ? 21.227 -17.381 -34.937 1.00 16.80 ? 128 ASP B CB  1 
ATOM   3310 C  CG  . ASP B 1 128 ? 22.218 -17.949 -35.947 1.00 15.86 ? 128 ASP B CG  1 
ATOM   3311 O  OD1 . ASP B 1 128 ? 22.269 -19.190 -36.098 1.00 15.31 ? 128 ASP B OD1 1 
ATOM   3312 O  OD2 . ASP B 1 128 ? 22.937 -17.169 -36.599 1.00 14.87 ? 128 ASP B OD2 1 
ATOM   3313 N  N   . ILE B 1 129 ? 20.796 -14.342 -32.865 1.00 18.74 ? 129 ILE B N   1 
ATOM   3314 C  CA  . ILE B 1 129 ? 19.940 -13.824 -31.812 1.00 20.47 ? 129 ILE B CA  1 
ATOM   3315 C  C   . ILE B 1 129 ? 19.330 -12.462 -32.229 1.00 21.88 ? 129 ILE B C   1 
ATOM   3316 O  O   . ILE B 1 129 ? 18.998 -11.611 -31.395 1.00 22.55 ? 129 ILE B O   1 
ATOM   3317 C  CB  . ILE B 1 129 ? 20.774 -13.777 -30.475 1.00 20.46 ? 129 ILE B CB  1 
ATOM   3318 C  CG1 . ILE B 1 129 ? 19.912 -14.222 -29.288 1.00 21.13 ? 129 ILE B CG1 1 
ATOM   3319 C  CG2 . ILE B 1 129 ? 21.406 -12.422 -30.279 1.00 17.61 ? 129 ILE B CG2 1 
ATOM   3320 C  CD1 . ILE B 1 129 ? 18.799 -13.295 -28.930 1.00 22.11 ? 129 ILE B CD1 1 
ATOM   3321 N  N   . ASN B 1 130 ? 19.177 -12.289 -33.546 1.00 23.19 ? 130 ASN B N   1 
ATOM   3322 C  CA  . ASN B 1 130 ? 18.582 -11.085 -34.142 1.00 23.08 ? 130 ASN B CA  1 
ATOM   3323 C  C   . ASN B 1 130 ? 17.055 -11.193 -34.081 1.00 22.51 ? 130 ASN B C   1 
ATOM   3324 O  O   . ASN B 1 130 ? 16.503 -12.288 -34.205 1.00 22.27 ? 130 ASN B O   1 
ATOM   3325 C  CB  . ASN B 1 130 ? 18.971 -10.943 -35.623 1.00 23.46 ? 130 ASN B CB  1 
ATOM   3326 C  CG  . ASN B 1 130 ? 20.320 -10.277 -35.834 1.00 22.61 ? 130 ASN B CG  1 
ATOM   3327 O  OD1 . ASN B 1 130 ? 20.613 -9.239  -35.248 1.00 22.31 ? 130 ASN B OD1 1 
ATOM   3328 N  ND2 . ASN B 1 130 ? 21.139 -10.863 -36.702 1.00 22.22 ? 130 ASN B ND2 1 
ATOM   3329 N  N   . THR B 1 131 ? 16.376 -10.064 -33.888 1.00 23.37 ? 131 THR B N   1 
ATOM   3330 C  CA  . THR B 1 131 ? 14.910 -10.051 -33.857 1.00 24.30 ? 131 THR B CA  1 
ATOM   3331 C  C   . THR B 1 131 ? 14.510 -9.362  -35.163 1.00 24.59 ? 131 THR B C   1 
ATOM   3332 O  O   . THR B 1 131 ? 15.380 -8.902  -35.901 1.00 23.33 ? 131 THR B O   1 
ATOM   3333 C  CB  . THR B 1 131 ? 14.345 -9.245  -32.636 1.00 21.93 ? 131 THR B CB  1 
ATOM   3334 O  OG1 . THR B 1 131 ? 14.296 -7.848  -32.945 1.00 22.89 ? 131 THR B OG1 1 
ATOM   3335 C  CG2 . THR B 1 131 ? 15.225 -9.446  -31.402 1.00 21.80 ? 131 THR B CG2 1 
ATOM   3336 N  N   . PRO B 1 132 ? 13.202 -9.306  -35.485 1.00 25.67 ? 132 PRO B N   1 
ATOM   3337 C  CA  . PRO B 1 132 ? 12.836 -8.635  -36.740 1.00 25.71 ? 132 PRO B CA  1 
ATOM   3338 C  C   . PRO B 1 132 ? 13.277 -7.155  -36.806 1.00 26.74 ? 132 PRO B C   1 
ATOM   3339 O  O   . PRO B 1 132 ? 13.651 -6.669  -37.878 1.00 26.94 ? 132 PRO B O   1 
ATOM   3340 C  CB  . PRO B 1 132 ? 11.317 -8.802  -36.783 1.00 25.71 ? 132 PRO B CB  1 
ATOM   3341 C  CG  . PRO B 1 132 ? 11.117 -10.137 -36.120 1.00 24.54 ? 132 PRO B CG  1 
ATOM   3342 C  CD  . PRO B 1 132 ? 12.047 -10.041 -34.928 1.00 25.07 ? 132 PRO B CD  1 
ATOM   3343 N  N   . LEU B 1 133 ? 13.255 -6.454  -35.668 1.00 25.84 ? 133 LEU B N   1 
ATOM   3344 C  CA  . LEU B 1 133 ? 13.645 -5.039  -35.615 1.00 26.13 ? 133 LEU B CA  1 
ATOM   3345 C  C   . LEU B 1 133 ? 15.125 -4.766  -35.361 1.00 26.99 ? 133 LEU B C   1 
ATOM   3346 O  O   . LEU B 1 133 ? 15.518 -3.616  -35.116 1.00 27.85 ? 133 LEU B O   1 
ATOM   3347 C  CB  . LEU B 1 133 ? 12.848 -4.295  -34.545 1.00 24.76 ? 133 LEU B CB  1 
ATOM   3348 C  CG  . LEU B 1 133 ? 11.332 -4.394  -34.596 1.00 25.22 ? 133 LEU B CG  1 
ATOM   3349 C  CD1 . LEU B 1 133 ? 10.900 -5.693  -33.948 1.00 23.80 ? 133 LEU B CD1 1 
ATOM   3350 C  CD2 . LEU B 1 133 ? 10.722 -3.208  -33.874 1.00 23.49 ? 133 LEU B CD2 1 
ATOM   3351 N  N   . THR B 1 134 ? 15.948 -5.808  -35.416 1.00 27.79 ? 134 THR B N   1 
ATOM   3352 C  CA  . THR B 1 134 ? 17.379 -5.645  -35.181 1.00 25.59 ? 134 THR B CA  1 
ATOM   3353 C  C   . THR B 1 134 ? 18.227 -6.254  -36.303 1.00 24.48 ? 134 THR B C   1 
ATOM   3354 O  O   . THR B 1 134 ? 19.438 -6.024  -36.369 1.00 23.40 ? 134 THR B O   1 
ATOM   3355 C  CB  . THR B 1 134 ? 17.792 -6.285  -33.838 1.00 26.28 ? 134 THR B CB  1 
ATOM   3356 O  OG1 . THR B 1 134 ? 17.715 -7.712  -33.944 1.00 26.38 ? 134 THR B OG1 1 
ATOM   3357 C  CG2 . THR B 1 134 ? 16.858 -5.825  -32.714 1.00 25.45 ? 134 THR B CG2 1 
ATOM   3358 N  N   . THR B 1 135 ? 17.586 -7.018  -37.186 1.00 22.69 ? 135 THR B N   1 
ATOM   3359 C  CA  . THR B 1 135 ? 18.287 -7.664  -38.300 1.00 22.77 ? 135 THR B CA  1 
ATOM   3360 C  C   . THR B 1 135 ? 18.643 -6.683  -39.429 1.00 24.28 ? 135 THR B C   1 
ATOM   3361 O  O   . THR B 1 135 ? 17.948 -5.689  -39.652 1.00 25.06 ? 135 THR B O   1 
ATOM   3362 C  CB  . THR B 1 135 ? 17.442 -8.841  -38.883 1.00 20.05 ? 135 THR B CB  1 
ATOM   3363 O  OG1 . THR B 1 135 ? 18.269 -9.656  -39.721 1.00 17.20 ? 135 THR B OG1 1 
ATOM   3364 C  CG2 . THR B 1 135 ? 16.266 -8.320  -39.704 1.00 16.83 ? 135 THR B CG2 1 
ATOM   3365 N  N   . THR B 1 136 ? 19.743 -6.966  -40.123 1.00 25.15 ? 136 THR B N   1 
ATOM   3366 C  CA  . THR B 1 136 ? 20.199 -6.136  -41.233 1.00 25.86 ? 136 THR B CA  1 
ATOM   3367 C  C   . THR B 1 136 ? 19.767 -6.758  -42.573 1.00 26.64 ? 136 THR B C   1 
ATOM   3368 O  O   . THR B 1 136 ? 18.975 -6.169  -43.315 1.00 27.40 ? 136 THR B O   1 
ATOM   3369 C  CB  . THR B 1 136 ? 21.744 -5.976  -41.212 1.00 26.83 ? 136 THR B CB  1 
ATOM   3370 O  OG1 . THR B 1 136 ? 22.372 -7.223  -41.551 1.00 27.57 ? 136 THR B OG1 1 
ATOM   3371 C  CG2 . THR B 1 136 ? 22.207 -5.536  -39.824 1.00 25.26 ? 136 THR B CG2 1 
ATOM   3372 N  N   . SER B 1 137 ? 20.278 -7.952  -42.867 1.00 25.88 ? 137 SER B N   1 
ATOM   3373 C  CA  . SER B 1 137 ? 19.947 -8.655  -44.106 1.00 25.33 ? 137 SER B CA  1 
ATOM   3374 C  C   . SER B 1 137 ? 18.468 -9.007  -44.172 1.00 24.93 ? 137 SER B C   1 
ATOM   3375 O  O   . SER B 1 137 ? 17.907 -9.166  -45.257 1.00 26.36 ? 137 SER B O   1 
ATOM   3376 C  CB  . SER B 1 137 ? 20.750 -9.945  -44.207 1.00 23.68 ? 137 SER B CB  1 
ATOM   3377 O  OG  . SER B 1 137 ? 20.425 -10.806 -43.129 1.00 21.12 ? 137 SER B OG  1 
ATOM   3378 N  N   . GLY B 1 138 ? 17.849 -9.142  -43.005 1.00 24.65 ? 138 GLY B N   1 
ATOM   3379 C  CA  . GLY B 1 138 ? 16.444 -9.496  -42.950 1.00 24.21 ? 138 GLY B CA  1 
ATOM   3380 C  C   . GLY B 1 138 ? 16.219 -10.981 -43.195 1.00 24.20 ? 138 GLY B C   1 
ATOM   3381 O  O   . GLY B 1 138 ? 15.103 -11.407 -43.510 1.00 24.02 ? 138 GLY B O   1 
ATOM   3382 N  N   . ASN B 1 139 ? 17.273 -11.779 -43.055 1.00 23.24 ? 139 ASN B N   1 
ATOM   3383 C  CA  . ASN B 1 139 ? 17.149 -13.214 -43.266 1.00 22.35 ? 139 ASN B CA  1 
ATOM   3384 C  C   . ASN B 1 139 ? 16.877 -13.897 -41.935 1.00 21.38 ? 139 ASN B C   1 
ATOM   3385 O  O   . ASN B 1 139 ? 17.638 -13.754 -40.982 1.00 21.87 ? 139 ASN B O   1 
ATOM   3386 C  CB  . ASN B 1 139 ? 18.424 -13.753 -43.907 1.00 21.57 ? 139 ASN B CB  1 
ATOM   3387 C  CG  . ASN B 1 139 ? 18.800 -12.983 -45.149 1.00 20.90 ? 139 ASN B CG  1 
ATOM   3388 O  OD1 . ASN B 1 139 ? 17.953 -12.713 -45.992 1.00 21.35 ? 139 ASN B OD1 1 
ATOM   3389 N  ND2 . ASN B 1 139 ? 20.072 -12.627 -45.272 1.00 18.37 ? 139 ASN B ND2 1 
ATOM   3390 N  N   . LEU B 1 140 ? 15.776 -14.634 -41.876 1.00 20.08 ? 140 LEU B N   1 
ATOM   3391 C  CA  . LEU B 1 140 ? 15.373 -15.321 -40.656 1.00 18.63 ? 140 LEU B CA  1 
ATOM   3392 C  C   . LEU B 1 140 ? 16.307 -16.421 -40.148 1.00 17.21 ? 140 LEU B C   1 
ATOM   3393 O  O   . LEU B 1 140 ? 16.241 -16.763 -38.972 1.00 16.20 ? 140 LEU B O   1 
ATOM   3394 C  CB  . LEU B 1 140 ? 13.952 -15.883 -40.819 1.00 19.08 ? 140 LEU B CB  1 
ATOM   3395 C  CG  . LEU B 1 140 ? 12.769 -14.976 -40.433 1.00 20.84 ? 140 LEU B CG  1 
ATOM   3396 C  CD1 . LEU B 1 140 ? 11.508 -15.387 -41.182 1.00 17.71 ? 140 LEU B CD1 1 
ATOM   3397 C  CD2 . LEU B 1 140 ? 12.539 -15.045 -38.913 1.00 17.80 ? 140 LEU B CD2 1 
ATOM   3398 N  N   . HIS B 1 141 ? 17.176 -16.976 -40.994 1.00 16.98 ? 141 HIS B N   1 
ATOM   3399 C  CA  . HIS B 1 141 ? 18.063 -18.036 -40.507 1.00 18.31 ? 141 HIS B CA  1 
ATOM   3400 C  C   . HIS B 1 141 ? 19.025 -17.486 -39.461 1.00 18.71 ? 141 HIS B C   1 
ATOM   3401 O  O   . HIS B 1 141 ? 19.750 -18.238 -38.817 1.00 19.72 ? 141 HIS B O   1 
ATOM   3402 C  CB  . HIS B 1 141 ? 18.859 -18.704 -41.649 1.00 19.76 ? 141 HIS B CB  1 
ATOM   3403 C  CG  . HIS B 1 141 ? 19.979 -17.869 -42.203 1.00 18.97 ? 141 HIS B CG  1 
ATOM   3404 N  ND1 . HIS B 1 141 ? 21.094 -18.426 -42.794 1.00 17.48 ? 141 HIS B ND1 1 
ATOM   3405 C  CD2 . HIS B 1 141 ? 20.153 -16.526 -42.266 1.00 18.28 ? 141 HIS B CD2 1 
ATOM   3406 C  CE1 . HIS B 1 141 ? 21.906 -17.463 -43.193 1.00 19.52 ? 141 HIS B CE1 1 
ATOM   3407 N  NE2 . HIS B 1 141 ? 21.358 -16.301 -42.885 1.00 16.71 ? 141 HIS B NE2 1 
ATOM   3408 N  N   . GLY B 1 142 ? 19.014 -16.166 -39.300 1.00 19.58 ? 142 GLY B N   1 
ATOM   3409 C  CA  . GLY B 1 142 ? 19.873 -15.516 -38.332 1.00 18.22 ? 142 GLY B CA  1 
ATOM   3410 C  C   . GLY B 1 142 ? 19.060 -14.822 -37.253 1.00 17.67 ? 142 GLY B C   1 
ATOM   3411 O  O   . GLY B 1 142 ? 19.442 -13.755 -36.769 1.00 16.74 ? 142 GLY B O   1 
ATOM   3412 N  N   . GLN B 1 143 ? 17.939 -15.440 -36.883 1.00 16.95 ? 143 GLN B N   1 
ATOM   3413 C  CA  . GLN B 1 143 ? 17.032 -14.925 -35.857 1.00 16.41 ? 143 GLN B CA  1 
ATOM   3414 C  C   . GLN B 1 143 ? 16.302 -16.037 -35.092 1.00 17.00 ? 143 GLN B C   1 
ATOM   3415 O  O   . GLN B 1 143 ? 15.365 -15.756 -34.341 1.00 17.92 ? 143 GLN B O   1 
ATOM   3416 C  CB  . GLN B 1 143 ? 15.966 -14.028 -36.496 1.00 16.55 ? 143 GLN B CB  1 
ATOM   3417 C  CG  . GLN B 1 143 ? 16.487 -12.832 -37.238 1.00 16.41 ? 143 GLN B CG  1 
ATOM   3418 C  CD  . GLN B 1 143 ? 15.407 -12.139 -38.027 1.00 17.70 ? 143 GLN B CD  1 
ATOM   3419 O  OE1 . GLN B 1 143 ? 14.348 -11.804 -37.490 1.00 16.95 ? 143 GLN B OE1 1 
ATOM   3420 N  NE2 . GLN B 1 143 ? 15.664 -11.920 -39.313 1.00 16.56 ? 143 GLN B NE2 1 
ATOM   3421 N  N   . PRO B 1 144 ? 16.714 -17.312 -35.256 1.00 16.65 ? 144 PRO B N   1 
ATOM   3422 C  CA  . PRO B 1 144 ? 15.992 -18.357 -34.520 1.00 16.15 ? 144 PRO B CA  1 
ATOM   3423 C  C   . PRO B 1 144 ? 15.945 -18.256 -32.985 1.00 16.27 ? 144 PRO B C   1 
ATOM   3424 O  O   . PRO B 1 144 ? 14.871 -18.378 -32.393 1.00 15.11 ? 144 PRO B O   1 
ATOM   3425 C  CB  . PRO B 1 144 ? 16.672 -19.641 -34.999 1.00 16.55 ? 144 PRO B CB  1 
ATOM   3426 C  CG  . PRO B 1 144 ? 18.076 -19.197 -35.249 1.00 17.09 ? 144 PRO B CG  1 
ATOM   3427 C  CD  . PRO B 1 144 ? 17.869 -17.889 -35.973 1.00 15.69 ? 144 PRO B CD  1 
ATOM   3428 N  N   . VAL B 1 145 ? 17.097 -18.029 -32.351 1.00 15.93 ? 145 VAL B N   1 
ATOM   3429 C  CA  . VAL B 1 145 ? 17.171 -17.957 -30.892 1.00 14.30 ? 145 VAL B CA  1 
ATOM   3430 C  C   . VAL B 1 145 ? 16.333 -16.851 -30.280 1.00 15.62 ? 145 VAL B C   1 
ATOM   3431 O  O   . VAL B 1 145 ? 15.767 -17.033 -29.211 1.00 16.38 ? 145 VAL B O   1 
ATOM   3432 C  CB  . VAL B 1 145 ? 18.637 -17.827 -30.406 1.00 14.21 ? 145 VAL B CB  1 
ATOM   3433 C  CG1 . VAL B 1 145 ? 18.695 -17.787 -28.887 1.00 12.23 ? 145 VAL B CG1 1 
ATOM   3434 C  CG2 . VAL B 1 145 ? 19.439 -19.010 -30.900 1.00 15.12 ? 145 VAL B CG2 1 
ATOM   3435 N  N   . SER B 1 146 ? 16.240 -15.706 -30.948 1.00 17.84 ? 146 SER B N   1 
ATOM   3436 C  CA  . SER B 1 146 ? 15.438 -14.606 -30.414 1.00 18.24 ? 146 SER B CA  1 
ATOM   3437 C  C   . SER B 1 146 ? 13.960 -14.997 -30.323 1.00 19.14 ? 146 SER B C   1 
ATOM   3438 O  O   . SER B 1 146 ? 13.264 -14.586 -29.384 1.00 19.06 ? 146 SER B O   1 
ATOM   3439 C  CB  . SER B 1 146 ? 15.594 -13.349 -31.276 1.00 17.12 ? 146 SER B CB  1 
ATOM   3440 O  OG  . SER B 1 146 ? 14.765 -13.386 -32.420 1.00 15.31 ? 146 SER B OG  1 
ATOM   3441 N  N   . PHE B 1 147 ? 13.488 -15.791 -31.290 1.00 18.83 ? 147 PHE B N   1 
ATOM   3442 C  CA  . PHE B 1 147 ? 12.096 -16.258 -31.311 1.00 19.65 ? 147 PHE B CA  1 
ATOM   3443 C  C   . PHE B 1 147 ? 11.878 -17.362 -30.263 1.00 20.64 ? 147 PHE B C   1 
ATOM   3444 O  O   . PHE B 1 147 ? 10.735 -17.704 -29.935 1.00 19.56 ? 147 PHE B O   1 
ATOM   3445 C  CB  . PHE B 1 147 ? 11.714 -16.829 -32.690 1.00 21.03 ? 147 PHE B CB  1 
ATOM   3446 C  CG  . PHE B 1 147 ? 11.462 -15.786 -33.764 1.00 21.85 ? 147 PHE B CG  1 
ATOM   3447 C  CD1 . PHE B 1 147 ? 12.503 -15.004 -34.268 1.00 21.99 ? 147 PHE B CD1 1 
ATOM   3448 C  CD2 . PHE B 1 147 ? 10.190 -15.655 -34.334 1.00 22.59 ? 147 PHE B CD2 1 
ATOM   3449 C  CE1 . PHE B 1 147 ? 12.283 -14.113 -35.331 1.00 22.01 ? 147 PHE B CE1 1 
ATOM   3450 C  CE2 . PHE B 1 147 ? 9.959  -14.769 -35.394 1.00 21.87 ? 147 PHE B CE2 1 
ATOM   3451 C  CZ  . PHE B 1 147 ? 11.006 -14.000 -35.895 1.00 22.81 ? 147 PHE B CZ  1 
ATOM   3452 N  N   . LEU B 1 148 ? 12.976 -17.913 -29.740 1.00 19.91 ? 148 LEU B N   1 
ATOM   3453 C  CA  . LEU B 1 148 ? 12.905 -18.979 -28.742 1.00 20.58 ? 148 LEU B CA  1 
ATOM   3454 C  C   . LEU B 1 148 ? 13.057 -18.496 -27.298 1.00 20.10 ? 148 LEU B C   1 
ATOM   3455 O  O   . LEU B 1 148 ? 12.356 -18.966 -26.406 1.00 18.91 ? 148 LEU B O   1 
ATOM   3456 C  CB  . LEU B 1 148 ? 13.965 -20.050 -29.044 1.00 19.64 ? 148 LEU B CB  1 
ATOM   3457 C  CG  . LEU B 1 148 ? 13.774 -20.831 -30.353 1.00 18.52 ? 148 LEU B CG  1 
ATOM   3458 C  CD1 . LEU B 1 148 ? 15.086 -21.478 -30.781 1.00 18.96 ? 148 LEU B CD1 1 
ATOM   3459 C  CD2 . LEU B 1 148 ? 12.677 -21.872 -30.169 1.00 18.48 ? 148 LEU B CD2 1 
ATOM   3460 N  N   . LEU B 1 149 ? 13.966 -17.556 -27.066 1.00 22.08 ? 149 LEU B N   1 
ATOM   3461 C  CA  . LEU B 1 149 ? 14.201 -17.047 -25.712 1.00 23.63 ? 149 LEU B CA  1 
ATOM   3462 C  C   . LEU B 1 149 ? 12.968 -16.403 -25.053 1.00 23.28 ? 149 LEU B C   1 
ATOM   3463 O  O   . LEU B 1 149 ? 12.169 -15.733 -25.709 1.00 23.26 ? 149 LEU B O   1 
ATOM   3464 C  CB  . LEU B 1 149 ? 15.366 -16.045 -25.709 1.00 23.01 ? 149 LEU B CB  1 
ATOM   3465 C  CG  . LEU B 1 149 ? 16.791 -16.515 -26.011 1.00 24.76 ? 149 LEU B CG  1 
ATOM   3466 C  CD1 . LEU B 1 149 ? 17.718 -15.324 -25.835 1.00 24.21 ? 149 LEU B CD1 1 
ATOM   3467 C  CD2 . LEU B 1 149 ? 17.218 -17.657 -25.087 1.00 24.01 ? 149 LEU B CD2 1 
ATOM   3468 N  N   . LYS B 1 150 ? 12.832 -16.608 -23.747 1.00 22.62 ? 150 LYS B N   1 
ATOM   3469 C  CA  . LYS B 1 150 ? 11.707 -16.060 -22.999 1.00 21.95 ? 150 LYS B CA  1 
ATOM   3470 C  C   . LYS B 1 150 ? 11.886 -14.588 -22.638 1.00 21.97 ? 150 LYS B C   1 
ATOM   3471 O  O   . LYS B 1 150 ? 10.917 -13.826 -22.654 1.00 21.69 ? 150 LYS B O   1 
ATOM   3472 C  CB  . LYS B 1 150 ? 11.465 -16.869 -21.718 1.00 21.79 ? 150 LYS B CB  1 
ATOM   3473 C  CG  . LYS B 1 150 ? 10.966 -18.283 -21.945 1.00 21.64 ? 150 LYS B CG  1 
ATOM   3474 C  CD  . LYS B 1 150 ? 10.534 -18.922 -20.631 1.00 23.84 ? 150 LYS B CD  1 
ATOM   3475 C  CE  . LYS B 1 150 ? 9.964  -20.312 -20.839 1.00 23.88 ? 150 LYS B CE  1 
ATOM   3476 N  NZ  . LYS B 1 150 ? 9.436  -20.878 -19.570 1.00 23.73 ? 150 LYS B NZ  1 
ATOM   3477 N  N   . GLU B 1 151 ? 13.122 -14.195 -22.326 1.00 20.72 ? 151 GLU B N   1 
ATOM   3478 C  CA  . GLU B 1 151 ? 13.439 -12.819 -21.942 1.00 21.55 ? 151 GLU B CA  1 
ATOM   3479 C  C   . GLU B 1 151 ? 13.240 -11.798 -23.059 1.00 23.37 ? 151 GLU B C   1 
ATOM   3480 O  O   . GLU B 1 151 ? 13.209 -10.592 -22.808 1.00 23.92 ? 151 GLU B O   1 
ATOM   3481 C  CB  . GLU B 1 151 ? 14.889 -12.721 -21.438 1.00 20.54 ? 151 GLU B CB  1 
ATOM   3482 C  CG  . GLU B 1 151 ? 15.186 -13.451 -20.117 1.00 19.93 ? 151 GLU B CG  1 
ATOM   3483 C  CD  . GLU B 1 151 ? 15.164 -14.968 -20.248 1.00 17.39 ? 151 GLU B CD  1 
ATOM   3484 O  OE1 . GLU B 1 151 ? 15.243 -15.467 -21.394 1.00 17.40 ? 151 GLU B OE1 1 
ATOM   3485 O  OE2 . GLU B 1 151 ? 15.086 -15.661 -19.206 1.00 16.62 ? 151 GLU B OE2 1 
ATOM   3486 N  N   . LEU B 1 152 ? 13.116 -12.279 -24.293 1.00 26.32 ? 152 LEU B N   1 
ATOM   3487 C  CA  . LEU B 1 152 ? 12.940 -11.390 -25.432 1.00 27.96 ? 152 LEU B CA  1 
ATOM   3488 C  C   . LEU B 1 152 ? 11.494 -11.247 -25.904 1.00 30.04 ? 152 LEU B C   1 
ATOM   3489 O  O   . LEU B 1 152 ? 11.198 -10.399 -26.749 1.00 30.61 ? 152 LEU B O   1 
ATOM   3490 C  CB  . LEU B 1 152 ? 13.835 -11.838 -26.589 1.00 26.39 ? 152 LEU B CB  1 
ATOM   3491 C  CG  . LEU B 1 152 ? 15.335 -11.600 -26.390 1.00 24.77 ? 152 LEU B CG  1 
ATOM   3492 C  CD1 . LEU B 1 152 ? 16.063 -12.060 -27.636 1.00 23.28 ? 152 LEU B CD1 1 
ATOM   3493 C  CD2 . LEU B 1 152 ? 15.613 -10.116 -26.115 1.00 24.03 ? 152 LEU B CD2 1 
ATOM   3494 N  N   . LYS B 1 153 ? 10.597 -12.071 -25.365 1.00 31.69 ? 153 LYS B N   1 
ATOM   3495 C  CA  . LYS B 1 153 ? 9.184  -11.988 -25.724 1.00 33.26 ? 153 LYS B CA  1 
ATOM   3496 C  C   . LYS B 1 153 ? 8.752  -10.612 -25.225 1.00 33.07 ? 153 LYS B C   1 
ATOM   3497 O  O   . LYS B 1 153 ? 8.739  -10.348 -24.019 1.00 33.81 ? 153 LYS B O   1 
ATOM   3498 C  CB  . LYS B 1 153 ? 8.377  -13.096 -25.030 1.00 35.65 ? 153 LYS B CB  1 
ATOM   3499 C  CG  . LYS B 1 153 ? 6.978  -13.337 -25.613 1.00 36.81 ? 153 LYS B CG  1 
ATOM   3500 C  CD  . LYS B 1 153 ? 6.305  -14.517 -24.929 1.00 39.17 ? 153 LYS B CD  1 
ATOM   3501 C  CE  . LYS B 1 153 ? 4.998  -14.913 -25.607 1.00 39.73 ? 153 LYS B CE  1 
ATOM   3502 N  NZ  . LYS B 1 153 ? 4.355  -16.067 -24.899 1.00 39.02 ? 153 LYS B NZ  1 
ATOM   3503 N  N   . GLY B 1 154 ? 8.423  -9.738  -26.169 1.00 32.77 ? 154 GLY B N   1 
ATOM   3504 C  CA  . GLY B 1 154 ? 8.040  -8.378  -25.846 1.00 31.36 ? 154 GLY B CA  1 
ATOM   3505 C  C   . GLY B 1 154 ? 8.923  -7.473  -26.688 1.00 30.01 ? 154 GLY B C   1 
ATOM   3506 O  O   . GLY B 1 154 ? 8.689  -6.271  -26.806 1.00 27.69 ? 154 GLY B O   1 
ATOM   3507 N  N   . LYS B 1 155 ? 9.962  -8.072  -27.265 1.00 29.92 ? 155 LYS B N   1 
ATOM   3508 C  CA  . LYS B 1 155 ? 10.894 -7.360  -28.135 1.00 29.65 ? 155 LYS B CA  1 
ATOM   3509 C  C   . LYS B 1 155 ? 10.611 -7.869  -29.552 1.00 29.15 ? 155 LYS B C   1 
ATOM   3510 O  O   . LYS B 1 155 ? 10.902 -7.196  -30.544 1.00 27.49 ? 155 LYS B O   1 
ATOM   3511 C  CB  . LYS B 1 155 ? 12.350 -7.683  -27.762 1.00 30.17 ? 155 LYS B CB  1 
ATOM   3512 C  CG  . LYS B 1 155 ? 12.751 -7.413  -26.316 1.00 31.22 ? 155 LYS B CG  1 
ATOM   3513 C  CD  . LYS B 1 155 ? 12.787 -5.929  -25.999 1.00 32.30 ? 155 LYS B CD  1 
ATOM   3514 C  CE  . LYS B 1 155 ? 13.585 -5.648  -24.725 1.00 32.44 ? 155 LYS B CE  1 
ATOM   3515 N  NZ  . LYS B 1 155 ? 13.044 -6.350  -23.525 1.00 33.72 ? 155 LYS B NZ  1 
ATOM   3516 N  N   . ILE B 1 156 ? 10.040 -9.071  -29.624 1.00 29.22 ? 156 ILE B N   1 
ATOM   3517 C  CA  . ILE B 1 156 ? 9.710  -9.717  -30.891 1.00 29.72 ? 156 ILE B CA  1 
ATOM   3518 C  C   . ILE B 1 156 ? 8.274  -9.431  -31.329 1.00 30.75 ? 156 ILE B C   1 
ATOM   3519 O  O   . ILE B 1 156 ? 7.318  -9.758  -30.618 1.00 29.64 ? 156 ILE B O   1 
ATOM   3520 C  CB  . ILE B 1 156 ? 9.918  -11.266 -30.808 1.00 29.98 ? 156 ILE B CB  1 
ATOM   3521 C  CG1 . ILE B 1 156 ? 11.405 -11.616 -30.978 1.00 28.80 ? 156 ILE B CG1 1 
ATOM   3522 C  CG2 . ILE B 1 156 ? 9.107  -11.973 -31.907 1.00 28.71 ? 156 ILE B CG2 1 
ATOM   3523 C  CD1 . ILE B 1 156 ? 12.351 -10.880 -30.050 1.00 27.14 ? 156 ILE B CD1 1 
ATOM   3524 N  N   . PRO B 1 157 ? 8.113  -8.820  -32.519 1.00 31.72 ? 157 PRO B N   1 
ATOM   3525 C  CA  . PRO B 1 157 ? 6.817  -8.466  -33.107 1.00 32.16 ? 157 PRO B CA  1 
ATOM   3526 C  C   . PRO B 1 157 ? 6.177  -9.671  -33.799 1.00 32.45 ? 157 PRO B C   1 
ATOM   3527 O  O   . PRO B 1 157 ? 6.866  -10.634 -34.149 1.00 32.94 ? 157 PRO B O   1 
ATOM   3528 C  CB  . PRO B 1 157 ? 7.193  -7.368  -34.094 1.00 31.40 ? 157 PRO B CB  1 
ATOM   3529 C  CG  . PRO B 1 157 ? 8.472  -7.891  -34.643 1.00 31.86 ? 157 PRO B CG  1 
ATOM   3530 C  CD  . PRO B 1 157 ? 9.211  -8.384  -33.401 1.00 31.34 ? 157 PRO B CD  1 
ATOM   3531 N  N   . ASP B 1 158 ? 4.863  -9.617  -33.996 1.00 33.18 ? 158 ASP B N   1 
ATOM   3532 C  CA  . ASP B 1 158 ? 4.163  -10.713 -34.651 1.00 34.18 ? 158 ASP B CA  1 
ATOM   3533 C  C   . ASP B 1 158 ? 4.664  -10.885 -36.077 1.00 32.55 ? 158 ASP B C   1 
ATOM   3534 O  O   . ASP B 1 158 ? 4.212  -10.190 -36.985 1.00 32.84 ? 158 ASP B O   1 
ATOM   3535 C  CB  . ASP B 1 158 ? 2.648  -10.463 -34.677 1.00 35.69 ? 158 ASP B CB  1 
ATOM   3536 C  CG  . ASP B 1 158 ? 2.035  -10.436 -33.289 1.00 37.93 ? 158 ASP B CG  1 
ATOM   3537 O  OD1 . ASP B 1 158 ? 2.408  -11.295 -32.457 1.00 38.78 ? 158 ASP B OD1 1 
ATOM   3538 O  OD2 . ASP B 1 158 ? 1.171  -9.563  -33.036 1.00 39.35 ? 158 ASP B OD2 1 
ATOM   3539 N  N   . VAL B 1 159 ? 5.615  -11.794 -36.272 1.00 31.41 ? 159 VAL B N   1 
ATOM   3540 C  CA  . VAL B 1 159 ? 6.134  -12.039 -37.606 1.00 29.33 ? 159 VAL B CA  1 
ATOM   3541 C  C   . VAL B 1 159 ? 5.126  -12.994 -38.215 1.00 29.07 ? 159 VAL B C   1 
ATOM   3542 O  O   . VAL B 1 159 ? 4.977  -14.121 -37.756 1.00 29.02 ? 159 VAL B O   1 
ATOM   3543 C  CB  . VAL B 1 159 ? 7.520  -12.716 -37.562 1.00 29.67 ? 159 VAL B CB  1 
ATOM   3544 C  CG1 . VAL B 1 159 ? 8.144  -12.743 -38.959 1.00 27.92 ? 159 VAL B CG1 1 
ATOM   3545 C  CG2 . VAL B 1 159 ? 8.414  -11.984 -36.585 1.00 28.99 ? 159 VAL B CG2 1 
ATOM   3546 N  N   . PRO B 1 160 ? 4.391  -12.545 -39.236 1.00 28.70 ? 160 PRO B N   1 
ATOM   3547 C  CA  . PRO B 1 160 ? 3.408  -13.442 -39.845 1.00 28.41 ? 160 PRO B CA  1 
ATOM   3548 C  C   . PRO B 1 160 ? 3.985  -14.851 -40.011 1.00 27.75 ? 160 PRO B C   1 
ATOM   3549 O  O   . PRO B 1 160 ? 5.101  -15.023 -40.499 1.00 27.93 ? 160 PRO B O   1 
ATOM   3550 C  CB  . PRO B 1 160 ? 3.106  -12.756 -41.173 1.00 29.05 ? 160 PRO B CB  1 
ATOM   3551 C  CG  . PRO B 1 160 ? 3.226  -11.301 -40.815 1.00 28.85 ? 160 PRO B CG  1 
ATOM   3552 C  CD  . PRO B 1 160 ? 4.481  -11.272 -39.973 1.00 28.66 ? 160 PRO B CD  1 
ATOM   3553 N  N   . GLY B 1 161 ? 3.226  -15.851 -39.577 1.00 27.58 ? 161 GLY B N   1 
ATOM   3554 C  CA  . GLY B 1 161 ? 3.685  -17.226 -39.671 1.00 25.95 ? 161 GLY B CA  1 
ATOM   3555 C  C   . GLY B 1 161 ? 4.267  -17.773 -38.374 1.00 24.54 ? 161 GLY B C   1 
ATOM   3556 O  O   . GLY B 1 161 ? 4.467  -18.979 -38.244 1.00 23.96 ? 161 GLY B O   1 
ATOM   3557 N  N   . PHE B 1 162 ? 4.533  -16.901 -37.407 1.00 24.50 ? 162 PHE B N   1 
ATOM   3558 C  CA  . PHE B 1 162 ? 5.113  -17.340 -36.139 1.00 24.69 ? 162 PHE B CA  1 
ATOM   3559 C  C   . PHE B 1 162 ? 4.236  -17.002 -34.936 1.00 24.70 ? 162 PHE B C   1 
ATOM   3560 O  O   . PHE B 1 162 ? 4.731  -16.493 -33.927 1.00 27.23 ? 162 PHE B O   1 
ATOM   3561 C  CB  . PHE B 1 162 ? 6.486  -16.695 -35.926 1.00 25.35 ? 162 PHE B CB  1 
ATOM   3562 C  CG  . PHE B 1 162 ? 7.419  -16.827 -37.090 1.00 25.91 ? 162 PHE B CG  1 
ATOM   3563 C  CD1 . PHE B 1 162 ? 7.250  -16.046 -38.226 1.00 25.83 ? 162 PHE B CD1 1 
ATOM   3564 C  CD2 . PHE B 1 162 ? 8.500  -17.709 -37.036 1.00 25.67 ? 162 PHE B CD2 1 
ATOM   3565 C  CE1 . PHE B 1 162 ? 8.141  -16.135 -39.291 1.00 26.02 ? 162 PHE B CE1 1 
ATOM   3566 C  CE2 . PHE B 1 162 ? 9.400  -17.804 -38.098 1.00 25.52 ? 162 PHE B CE2 1 
ATOM   3567 C  CZ  . PHE B 1 162 ? 9.220  -17.014 -39.227 1.00 26.30 ? 162 PHE B CZ  1 
ATOM   3568 N  N   . SER B 1 163 ? 2.941  -17.270 -35.033 1.00 24.95 ? 163 SER B N   1 
ATOM   3569 C  CA  . SER B 1 163 ? 2.038  -16.982 -33.924 1.00 26.16 ? 163 SER B CA  1 
ATOM   3570 C  C   . SER B 1 163 ? 1.962  -18.185 -33.012 1.00 25.62 ? 163 SER B C   1 
ATOM   3571 O  O   . SER B 1 163 ? 1.755  -18.051 -31.803 1.00 25.49 ? 163 SER B O   1 
ATOM   3572 C  CB  . SER B 1 163 ? 0.633  -16.617 -34.436 1.00 27.65 ? 163 SER B CB  1 
ATOM   3573 O  OG  . SER B 1 163 ? 0.142  -17.568 -35.364 1.00 29.04 ? 163 SER B OG  1 
ATOM   3574 N  N   . TRP B 1 164 ? 2.138  -19.359 -33.611 1.00 26.62 ? 164 TRP B N   1 
ATOM   3575 C  CA  . TRP B 1 164 ? 2.114  -20.629 -32.893 1.00 26.90 ? 164 TRP B CA  1 
ATOM   3576 C  C   . TRP B 1 164 ? 3.286  -20.644 -31.919 1.00 26.30 ? 164 TRP B C   1 
ATOM   3577 O  O   . TRP B 1 164 ? 3.261  -21.327 -30.898 1.00 26.36 ? 164 TRP B O   1 
ATOM   3578 C  CB  . TRP B 1 164 ? 2.276  -21.785 -33.884 1.00 26.30 ? 164 TRP B CB  1 
ATOM   3579 C  CG  . TRP B 1 164 ? 3.557  -21.680 -34.664 1.00 27.20 ? 164 TRP B CG  1 
ATOM   3580 C  CD1 . TRP B 1 164 ? 3.840  -20.788 -35.660 1.00 27.82 ? 164 TRP B CD1 1 
ATOM   3581 C  CD2 . TRP B 1 164 ? 4.756  -22.436 -34.453 1.00 26.81 ? 164 TRP B CD2 1 
ATOM   3582 N  NE1 . TRP B 1 164 ? 5.142  -20.938 -36.080 1.00 26.91 ? 164 TRP B NE1 1 
ATOM   3583 C  CE2 . TRP B 1 164 ? 5.727  -21.945 -35.357 1.00 27.05 ? 164 TRP B CE2 1 
ATOM   3584 C  CE3 . TRP B 1 164 ? 5.109  -23.481 -33.586 1.00 25.44 ? 164 TRP B CE3 1 
ATOM   3585 C  CZ2 . TRP B 1 164 ? 7.024  -22.462 -35.418 1.00 26.23 ? 164 TRP B CZ2 1 
ATOM   3586 C  CZ3 . TRP B 1 164 ? 6.403  -23.995 -33.648 1.00 24.71 ? 164 TRP B CZ3 1 
ATOM   3587 C  CH2 . TRP B 1 164 ? 7.341  -23.484 -34.558 1.00 25.00 ? 164 TRP B CH2 1 
ATOM   3588 N  N   . VAL B 1 165 ? 4.312  -19.874 -32.258 1.00 27.17 ? 165 VAL B N   1 
ATOM   3589 C  CA  . VAL B 1 165 ? 5.523  -19.795 -31.462 1.00 27.42 ? 165 VAL B CA  1 
ATOM   3590 C  C   . VAL B 1 165 ? 5.299  -19.431 -30.009 1.00 27.83 ? 165 VAL B C   1 
ATOM   3591 O  O   . VAL B 1 165 ? 4.872  -18.323 -29.680 1.00 28.05 ? 165 VAL B O   1 
ATOM   3592 C  CB  . VAL B 1 165 ? 6.528  -18.781 -32.074 1.00 29.31 ? 165 VAL B CB  1 
ATOM   3593 C  CG1 . VAL B 1 165 ? 7.789  -18.688 -31.201 1.00 29.43 ? 165 VAL B CG1 1 
ATOM   3594 C  CG2 . VAL B 1 165 ? 6.900  -19.211 -33.492 1.00 27.02 ? 165 VAL B CG2 1 
ATOM   3595 N  N   . THR B 1 166 ? 5.587  -20.393 -29.143 1.00 28.38 ? 166 THR B N   1 
ATOM   3596 C  CA  . THR B 1 166 ? 5.495  -20.200 -27.704 1.00 29.11 ? 166 THR B CA  1 
ATOM   3597 C  C   . THR B 1 166 ? 6.933  -20.289 -27.197 1.00 29.00 ? 166 THR B C   1 
ATOM   3598 O  O   . THR B 1 166 ? 7.491  -21.384 -27.113 1.00 30.00 ? 166 THR B O   1 
ATOM   3599 C  CB  . THR B 1 166 ? 4.658  -21.304 -27.015 1.00 29.68 ? 166 THR B CB  1 
ATOM   3600 O  OG1 . THR B 1 166 ? 4.914  -22.569 -27.643 1.00 30.50 ? 166 THR B OG1 1 
ATOM   3601 C  CG2 . THR B 1 166 ? 3.175  -20.983 -27.092 1.00 29.93 ? 166 THR B CG2 1 
ATOM   3602 N  N   . PRO B 1 167 ? 7.557  -19.137 -26.876 1.00 28.74 ? 167 PRO B N   1 
ATOM   3603 C  CA  . PRO B 1 167 ? 8.941  -19.069 -26.373 1.00 28.39 ? 167 PRO B CA  1 
ATOM   3604 C  C   . PRO B 1 167 ? 9.204  -20.171 -25.336 1.00 28.33 ? 167 PRO B C   1 
ATOM   3605 O  O   . PRO B 1 167 ? 8.598  -20.183 -24.262 1.00 28.17 ? 167 PRO B O   1 
ATOM   3606 C  CB  . PRO B 1 167 ? 9.013  -17.669 -25.782 1.00 27.85 ? 167 PRO B CB  1 
ATOM   3607 C  CG  . PRO B 1 167 ? 8.087  -16.889 -26.699 1.00 28.19 ? 167 PRO B CG  1 
ATOM   3608 C  CD  . PRO B 1 167 ? 6.915  -17.809 -26.849 1.00 26.97 ? 167 PRO B CD  1 
ATOM   3609 N  N   . CYS B 1 168 ? 10.117 -21.084 -25.664 1.00 28.73 ? 168 CYS B N   1 
ATOM   3610 C  CA  . CYS B 1 168 ? 10.419 -22.232 -24.806 1.00 29.38 ? 168 CYS B CA  1 
ATOM   3611 C  C   . CYS B 1 168 ? 11.728 -22.271 -24.007 1.00 29.23 ? 168 CYS B C   1 
ATOM   3612 O  O   . CYS B 1 168 ? 11.769 -22.863 -22.929 1.00 30.78 ? 168 CYS B O   1 
ATOM   3613 C  CB  . CYS B 1 168 ? 10.306 -23.521 -25.638 1.00 29.53 ? 168 CYS B CB  1 
ATOM   3614 S  SG  . CYS B 1 168 ? 11.308 -23.557 -27.151 1.00 28.12 ? 168 CYS B SG  1 
ATOM   3615 N  N   . ILE B 1 169 ? 12.795 -21.667 -24.516 1.00 29.03 ? 169 ILE B N   1 
ATOM   3616 C  CA  . ILE B 1 169 ? 14.062 -21.691 -23.792 1.00 28.48 ? 169 ILE B CA  1 
ATOM   3617 C  C   . ILE B 1 169 ? 14.371 -20.339 -23.162 1.00 27.22 ? 169 ILE B C   1 
ATOM   3618 O  O   . ILE B 1 169 ? 14.344 -19.317 -23.844 1.00 26.45 ? 169 ILE B O   1 
ATOM   3619 C  CB  . ILE B 1 169 ? 15.245 -22.078 -24.727 1.00 30.09 ? 169 ILE B CB  1 
ATOM   3620 C  CG1 . ILE B 1 169 ? 15.326 -21.093 -25.903 1.00 31.65 ? 169 ILE B CG1 1 
ATOM   3621 C  CG2 . ILE B 1 169 ? 15.070 -23.507 -25.238 1.00 31.01 ? 169 ILE B CG2 1 
ATOM   3622 C  CD1 . ILE B 1 169 ? 16.502 -21.310 -26.857 1.00 32.03 ? 169 ILE B CD1 1 
ATOM   3623 N  N   . SER B 1 170 ? 14.652 -20.324 -21.860 1.00 25.20 ? 170 SER B N   1 
ATOM   3624 C  CA  . SER B 1 170 ? 14.998 -19.073 -21.198 1.00 23.82 ? 170 SER B CA  1 
ATOM   3625 C  C   . SER B 1 170 ? 16.517 -18.870 -21.350 1.00 22.94 ? 170 SER B C   1 
ATOM   3626 O  O   . SER B 1 170 ? 17.267 -19.840 -21.515 1.00 20.49 ? 170 SER B O   1 
ATOM   3627 C  CB  . SER B 1 170 ? 14.582 -19.105 -19.715 1.00 23.15 ? 170 SER B CB  1 
ATOM   3628 O  OG  . SER B 1 170 ? 15.324 -20.041 -18.964 1.00 23.98 ? 170 SER B OG  1 
ATOM   3629 N  N   . ALA B 1 171 ? 16.956 -17.611 -21.318 1.00 21.05 ? 171 ALA B N   1 
ATOM   3630 C  CA  . ALA B 1 171 ? 18.370 -17.257 -21.469 1.00 19.14 ? 171 ALA B CA  1 
ATOM   3631 C  C   . ALA B 1 171 ? 19.350 -18.067 -20.612 1.00 18.95 ? 171 ALA B C   1 
ATOM   3632 O  O   . ALA B 1 171 ? 20.495 -18.301 -21.013 1.00 18.45 ? 171 ALA B O   1 
ATOM   3633 C  CB  . ALA B 1 171 ? 18.555 -15.774 -21.187 1.00 18.42 ? 171 ALA B CB  1 
ATOM   3634 N  N   . LYS B 1 172 ? 18.896 -18.499 -19.440 1.00 19.30 ? 172 LYS B N   1 
ATOM   3635 C  CA  . LYS B 1 172 ? 19.731 -19.250 -18.520 1.00 19.70 ? 172 LYS B CA  1 
ATOM   3636 C  C   . LYS B 1 172 ? 20.084 -20.683 -18.928 1.00 19.84 ? 172 LYS B C   1 
ATOM   3637 O  O   . LYS B 1 172 ? 21.016 -21.259 -18.360 1.00 21.33 ? 172 LYS B O   1 
ATOM   3638 C  CB  . LYS B 1 172 ? 19.071 -19.271 -17.137 1.00 20.28 ? 172 LYS B CB  1 
ATOM   3639 C  CG  . LYS B 1 172 ? 17.786 -20.086 -17.088 1.00 23.67 ? 172 LYS B CG  1 
ATOM   3640 C  CD  . LYS B 1 172 ? 17.194 -20.124 -15.693 1.00 24.66 ? 172 LYS B CD  1 
ATOM   3641 C  CE  . LYS B 1 172 ? 16.158 -21.231 -15.574 1.00 26.13 ? 172 LYS B CE  1 
ATOM   3642 N  NZ  . LYS B 1 172 ? 15.036 -21.049 -16.531 1.00 25.50 ? 172 LYS B NZ  1 
ATOM   3643 N  N   . ASP B 1 173 ? 19.378 -21.250 -19.909 1.00 19.73 ? 173 ASP B N   1 
ATOM   3644 C  CA  . ASP B 1 173 ? 19.618 -22.643 -20.324 1.00 19.35 ? 173 ASP B CA  1 
ATOM   3645 C  C   . ASP B 1 173 ? 20.142 -22.920 -21.743 1.00 18.11 ? 173 ASP B C   1 
ATOM   3646 O  O   . ASP B 1 173 ? 19.771 -23.928 -22.362 1.00 16.32 ? 173 ASP B O   1 
ATOM   3647 C  CB  . ASP B 1 173 ? 18.338 -23.469 -20.124 1.00 19.74 ? 173 ASP B CB  1 
ATOM   3648 C  CG  . ASP B 1 173 ? 17.754 -23.320 -18.738 1.00 18.26 ? 173 ASP B CG  1 
ATOM   3649 O  OD1 . ASP B 1 173 ? 18.479 -23.599 -17.761 1.00 16.63 ? 173 ASP B OD1 1 
ATOM   3650 O  OD2 . ASP B 1 173 ? 16.571 -22.927 -18.634 1.00 16.22 ? 173 ASP B OD2 1 
ATOM   3651 N  N   . ILE B 1 174 ? 21.001 -22.043 -22.250 1.00 17.15 ? 174 ILE B N   1 
ATOM   3652 C  CA  . ILE B 1 174 ? 21.571 -22.219 -23.579 1.00 16.64 ? 174 ILE B CA  1 
ATOM   3653 C  C   . ILE B 1 174 ? 23.041 -21.781 -23.586 1.00 15.47 ? 174 ILE B C   1 
ATOM   3654 O  O   . ILE B 1 174 ? 23.430 -20.819 -22.903 1.00 13.63 ? 174 ILE B O   1 
ATOM   3655 C  CB  . ILE B 1 174 ? 20.762 -21.428 -24.666 1.00 17.42 ? 174 ILE B CB  1 
ATOM   3656 C  CG1 . ILE B 1 174 ? 21.294 -21.757 -26.065 1.00 19.12 ? 174 ILE B CG1 1 
ATOM   3657 C  CG2 . ILE B 1 174 ? 20.851 -19.930 -24.413 1.00 17.12 ? 174 ILE B CG2 1 
ATOM   3658 C  CD1 . ILE B 1 174 ? 20.602 -20.995 -27.183 1.00 17.42 ? 174 ILE B CD1 1 
ATOM   3659 N  N   . VAL B 1 175 ? 23.855 -22.510 -24.347 1.00 15.53 ? 175 VAL B N   1 
ATOM   3660 C  CA  . VAL B 1 175 ? 25.284 -22.211 -24.451 1.00 14.38 ? 175 VAL B CA  1 
ATOM   3661 C  C   . VAL B 1 175 ? 25.730 -22.052 -25.897 1.00 12.48 ? 175 VAL B C   1 
ATOM   3662 O  O   . VAL B 1 175 ? 25.330 -22.823 -26.767 1.00 12.08 ? 175 VAL B O   1 
ATOM   3663 C  CB  . VAL B 1 175 ? 26.157 -23.329 -23.805 1.00 11.68 ? 175 VAL B CB  1 
ATOM   3664 C  CG1 . VAL B 1 175 ? 27.636 -22.928 -23.845 1.00 9.13  ? 175 VAL B CG1 1 
ATOM   3665 C  CG2 . VAL B 1 175 ? 25.709 -23.583 -22.383 1.00 13.18 ? 175 VAL B CG2 1 
ATOM   3666 N  N   . TYR B 1 176 ? 26.547 -21.031 -26.141 1.00 13.28 ? 176 TYR B N   1 
ATOM   3667 C  CA  . TYR B 1 176 ? 27.096 -20.766 -27.469 1.00 12.57 ? 176 TYR B CA  1 
ATOM   3668 C  C   . TYR B 1 176 ? 28.552 -21.231 -27.475 1.00 12.91 ? 176 TYR B C   1 
ATOM   3669 O  O   . TYR B 1 176 ? 29.283 -21.019 -26.502 1.00 11.54 ? 176 TYR B O   1 
ATOM   3670 C  CB  . TYR B 1 176 ? 27.052 -19.264 -27.808 1.00 12.20 ? 176 TYR B CB  1 
ATOM   3671 C  CG  . TYR B 1 176 ? 25.688 -18.707 -28.153 1.00 12.94 ? 176 TYR B CG  1 
ATOM   3672 C  CD1 . TYR B 1 176 ? 24.958 -19.195 -29.245 1.00 11.42 ? 176 TYR B CD1 1 
ATOM   3673 C  CD2 . TYR B 1 176 ? 25.140 -17.660 -27.412 1.00 12.08 ? 176 TYR B CD2 1 
ATOM   3674 C  CE1 . TYR B 1 176 ? 23.712 -18.642 -29.588 1.00 11.62 ? 176 TYR B CE1 1 
ATOM   3675 C  CE2 . TYR B 1 176 ? 23.904 -17.105 -27.744 1.00 13.67 ? 176 TYR B CE2 1 
ATOM   3676 C  CZ  . TYR B 1 176 ? 23.196 -17.594 -28.831 1.00 12.69 ? 176 TYR B CZ  1 
ATOM   3677 O  OH  . TYR B 1 176 ? 21.990 -17.014 -29.160 1.00 12.71 ? 176 TYR B OH  1 
ATOM   3678 N  N   . ILE B 1 177 ? 28.962 -21.864 -28.571 1.00 12.97 ? 177 ILE B N   1 
ATOM   3679 C  CA  . ILE B 1 177 ? 30.326 -22.357 -28.731 1.00 13.02 ? 177 ILE B CA  1 
ATOM   3680 C  C   . ILE B 1 177 ? 30.763 -22.091 -30.172 1.00 12.79 ? 177 ILE B C   1 
ATOM   3681 O  O   . ILE B 1 177 ? 30.118 -22.564 -31.112 1.00 11.51 ? 177 ILE B O   1 
ATOM   3682 C  CB  . ILE B 1 177 ? 30.427 -23.898 -28.445 1.00 14.86 ? 177 ILE B CB  1 
ATOM   3683 C  CG1 . ILE B 1 177 ? 29.957 -24.202 -27.016 1.00 13.82 ? 177 ILE B CG1 1 
ATOM   3684 C  CG2 . ILE B 1 177 ? 31.868 -24.375 -28.634 1.00 15.07 ? 177 ILE B CG2 1 
ATOM   3685 C  CD1 . ILE B 1 177 ? 29.931 -25.676 -26.659 1.00 15.76 ? 177 ILE B CD1 1 
ATOM   3686 N  N   . GLY B 1 178 ? 31.833 -21.312 -30.340 1.00 13.13 ? 178 GLY B N   1 
ATOM   3687 C  CA  . GLY B 1 178 ? 32.339 -21.022 -31.673 1.00 14.75 ? 178 GLY B CA  1 
ATOM   3688 C  C   . GLY B 1 178 ? 32.087 -19.651 -32.288 1.00 15.50 ? 178 GLY B C   1 
ATOM   3689 O  O   . GLY B 1 178 ? 32.413 -19.423 -33.455 1.00 15.32 ? 178 GLY B O   1 
ATOM   3690 N  N   . LEU B 1 179 ? 31.524 -18.730 -31.517 1.00 15.66 ? 179 LEU B N   1 
ATOM   3691 C  CA  . LEU B 1 179 ? 31.216 -17.392 -32.022 1.00 13.56 ? 179 LEU B CA  1 
ATOM   3692 C  C   . LEU B 1 179 ? 32.434 -16.574 -32.478 1.00 13.17 ? 179 LEU B C   1 
ATOM   3693 O  O   . LEU B 1 179 ? 33.508 -16.650 -31.883 1.00 11.61 ? 179 LEU B O   1 
ATOM   3694 C  CB  . LEU B 1 179 ? 30.449 -16.616 -30.951 1.00 12.68 ? 179 LEU B CB  1 
ATOM   3695 C  CG  . LEU B 1 179 ? 29.208 -17.324 -30.385 1.00 12.75 ? 179 LEU B CG  1 
ATOM   3696 C  CD1 . LEU B 1 179 ? 28.579 -16.455 -29.312 1.00 10.86 ? 179 LEU B CD1 1 
ATOM   3697 C  CD2 . LEU B 1 179 ? 28.214 -17.613 -31.494 1.00 15.35 ? 179 LEU B CD2 1 
ATOM   3698 N  N   . ARG B 1 180 ? 32.260 -15.798 -33.544 1.00 14.01 ? 180 ARG B N   1 
ATOM   3699 C  CA  . ARG B 1 180 ? 33.344 -14.957 -34.048 1.00 15.83 ? 180 ARG B CA  1 
ATOM   3700 C  C   . ARG B 1 180 ? 32.834 -13.927 -35.068 1.00 15.73 ? 180 ARG B C   1 
ATOM   3701 O  O   . ARG B 1 180 ? 33.617 -13.199 -35.670 1.00 15.94 ? 180 ARG B O   1 
ATOM   3702 C  CB  . ARG B 1 180 ? 34.450 -15.821 -34.663 1.00 15.59 ? 180 ARG B CB  1 
ATOM   3703 C  CG  . ARG B 1 180 ? 34.292 -16.084 -36.135 1.00 16.92 ? 180 ARG B CG  1 
ATOM   3704 C  CD  . ARG B 1 180 ? 34.971 -17.367 -36.540 1.00 17.77 ? 180 ARG B CD  1 
ATOM   3705 N  NE  . ARG B 1 180 ? 34.249 -18.513 -36.002 1.00 18.76 ? 180 ARG B NE  1 
ATOM   3706 C  CZ  . ARG B 1 180 ? 33.981 -19.626 -36.679 1.00 16.38 ? 180 ARG B CZ  1 
ATOM   3707 N  NH1 . ARG B 1 180 ? 34.375 -19.766 -37.936 1.00 12.43 ? 180 ARG B NH1 1 
ATOM   3708 N  NH2 . ARG B 1 180 ? 33.298 -20.598 -36.097 1.00 16.39 ? 180 ARG B NH2 1 
ATOM   3709 N  N   . ASP B 1 181 ? 31.517 -13.885 -35.253 1.00 16.16 ? 181 ASP B N   1 
ATOM   3710 C  CA  . ASP B 1 181 ? 30.872 -12.938 -36.158 1.00 18.80 ? 181 ASP B CA  1 
ATOM   3711 C  C   . ASP B 1 181 ? 29.509 -12.572 -35.560 1.00 18.27 ? 181 ASP B C   1 
ATOM   3712 O  O   . ASP B 1 181 ? 28.461 -12.991 -36.066 1.00 18.56 ? 181 ASP B O   1 
ATOM   3713 C  CB  . ASP B 1 181 ? 30.688 -13.558 -37.551 1.00 21.24 ? 181 ASP B CB  1 
ATOM   3714 C  CG  . ASP B 1 181 ? 30.004 -12.606 -38.536 1.00 22.92 ? 181 ASP B CG  1 
ATOM   3715 O  OD1 . ASP B 1 181 ? 30.550 -11.510 -38.806 1.00 24.17 ? 181 ASP B OD1 1 
ATOM   3716 O  OD2 . ASP B 1 181 ? 28.916 -12.956 -39.040 1.00 24.66 ? 181 ASP B OD2 1 
ATOM   3717 N  N   . VAL B 1 182 ? 29.536 -11.796 -34.475 1.00 18.56 ? 182 VAL B N   1 
ATOM   3718 C  CA  . VAL B 1 182 ? 28.317 -11.382 -33.772 1.00 17.62 ? 182 VAL B CA  1 
ATOM   3719 C  C   . VAL B 1 182 ? 27.959 -9.932  -34.082 1.00 18.72 ? 182 VAL B C   1 
ATOM   3720 O  O   . VAL B 1 182 ? 28.835 -9.073  -34.118 1.00 18.45 ? 182 VAL B O   1 
ATOM   3721 C  CB  . VAL B 1 182 ? 28.492 -11.521 -32.238 1.00 18.05 ? 182 VAL B CB  1 
ATOM   3722 C  CG1 . VAL B 1 182 ? 27.175 -11.231 -31.530 1.00 18.57 ? 182 VAL B CG1 1 
ATOM   3723 C  CG2 . VAL B 1 182 ? 29.007 -12.908 -31.894 1.00 17.08 ? 182 VAL B CG2 1 
ATOM   3724 N  N   . ASP B 1 183 ? 26.671 -9.667  -34.298 1.00 19.16 ? 183 ASP B N   1 
ATOM   3725 C  CA  . ASP B 1 183 ? 26.197 -8.314  -34.603 1.00 20.07 ? 183 ASP B CA  1 
ATOM   3726 C  C   . ASP B 1 183 ? 26.216 -7.416  -33.377 1.00 19.55 ? 183 ASP B C   1 
ATOM   3727 O  O   . ASP B 1 183 ? 25.964 -7.871  -32.269 1.00 20.78 ? 183 ASP B O   1 
ATOM   3728 C  CB  . ASP B 1 183 ? 24.775 -8.366  -35.178 1.00 21.53 ? 183 ASP B CB  1 
ATOM   3729 C  CG  . ASP B 1 183 ? 24.759 -8.413  -36.697 1.00 23.27 ? 183 ASP B CG  1 
ATOM   3730 O  OD1 . ASP B 1 183 ? 25.586 -9.145  -37.287 1.00 25.70 ? 183 ASP B OD1 1 
ATOM   3731 O  OD2 . ASP B 1 183 ? 23.911 -7.722  -37.303 1.00 24.93 ? 183 ASP B OD2 1 
ATOM   3732 N  N   . PRO B 1 184 ? 26.504 -6.116  -33.562 1.00 18.30 ? 184 PRO B N   1 
ATOM   3733 C  CA  . PRO B 1 184 ? 26.527 -5.240  -32.387 1.00 18.00 ? 184 PRO B CA  1 
ATOM   3734 C  C   . PRO B 1 184 ? 25.319 -5.456  -31.467 1.00 16.39 ? 184 PRO B C   1 
ATOM   3735 O  O   . PRO B 1 184 ? 25.464 -5.509  -30.255 1.00 13.21 ? 184 PRO B O   1 
ATOM   3736 C  CB  . PRO B 1 184 ? 26.575 -3.840  -33.004 1.00 18.46 ? 184 PRO B CB  1 
ATOM   3737 C  CG  . PRO B 1 184 ? 27.374 -4.067  -34.256 1.00 18.05 ? 184 PRO B CG  1 
ATOM   3738 C  CD  . PRO B 1 184 ? 26.770 -5.354  -34.795 1.00 18.10 ? 184 PRO B CD  1 
ATOM   3739 N  N   . GLY B 1 185 ? 24.136 -5.599  -32.062 1.00 18.07 ? 185 GLY B N   1 
ATOM   3740 C  CA  . GLY B 1 185 ? 22.925 -5.816  -31.289 1.00 18.32 ? 185 GLY B CA  1 
ATOM   3741 C  C   . GLY B 1 185 ? 22.852 -7.160  -30.579 1.00 18.61 ? 185 GLY B C   1 
ATOM   3742 O  O   . GLY B 1 185 ? 22.454 -7.233  -29.413 1.00 18.38 ? 185 GLY B O   1 
ATOM   3743 N  N   . GLU B 1 186 ? 23.223 -8.230  -31.272 1.00 18.47 ? 186 GLU B N   1 
ATOM   3744 C  CA  . GLU B 1 186 ? 23.186 -9.548  -30.659 1.00 18.92 ? 186 GLU B CA  1 
ATOM   3745 C  C   . GLU B 1 186 ? 24.133 -9.566  -29.480 1.00 18.45 ? 186 GLU B C   1 
ATOM   3746 O  O   . GLU B 1 186 ? 23.847 -10.181 -28.455 1.00 21.60 ? 186 GLU B O   1 
ATOM   3747 C  CB  . GLU B 1 186 ? 23.612 -10.611 -31.654 1.00 20.19 ? 186 GLU B CB  1 
ATOM   3748 C  CG  . GLU B 1 186 ? 22.782 -10.647 -32.904 1.00 21.43 ? 186 GLU B CG  1 
ATOM   3749 C  CD  . GLU B 1 186 ? 23.272 -11.693 -33.869 1.00 20.63 ? 186 GLU B CD  1 
ATOM   3750 O  OE1 . GLU B 1 186 ? 24.388 -11.526 -34.413 1.00 23.81 ? 186 GLU B OE1 1 
ATOM   3751 O  OE2 . GLU B 1 186 ? 22.546 -12.685 -34.072 1.00 23.62 ? 186 GLU B OE2 1 
ATOM   3752 N  N   . HIS B 1 187 ? 25.270 -8.894  -29.631 1.00 17.53 ? 187 HIS B N   1 
ATOM   3753 C  CA  . HIS B 1 187 ? 26.248 -8.831  -28.561 1.00 17.00 ? 187 HIS B CA  1 
ATOM   3754 C  C   . HIS B 1 187 ? 25.614 -8.161  -27.343 1.00 17.31 ? 187 HIS B C   1 
ATOM   3755 O  O   . HIS B 1 187 ? 25.902 -8.546  -26.206 1.00 16.02 ? 187 HIS B O   1 
ATOM   3756 C  CB  . HIS B 1 187 ? 27.495 -8.052  -29.002 1.00 15.41 ? 187 HIS B CB  1 
ATOM   3757 C  CG  . HIS B 1 187 ? 28.550 -7.964  -27.943 1.00 14.65 ? 187 HIS B CG  1 
ATOM   3758 N  ND1 . HIS B 1 187 ? 28.950 -6.770  -27.385 1.00 16.53 ? 187 HIS B ND1 1 
ATOM   3759 C  CD2 . HIS B 1 187 ? 29.248 -8.929  -27.299 1.00 16.41 ? 187 HIS B CD2 1 
ATOM   3760 C  CE1 . HIS B 1 187 ? 29.846 -7.001  -26.442 1.00 16.13 ? 187 HIS B CE1 1 
ATOM   3761 N  NE2 . HIS B 1 187 ? 30.044 -8.304  -26.369 1.00 16.42 ? 187 HIS B NE2 1 
ATOM   3762 N  N   . TYR B 1 188 ? 24.757 -7.164  -27.589 1.00 18.47 ? 188 TYR B N   1 
ATOM   3763 C  CA  . TYR B 1 188 ? 24.052 -6.435  -26.520 1.00 16.78 ? 188 TYR B CA  1 
ATOM   3764 C  C   . TYR B 1 188 ? 23.046 -7.399  -25.907 1.00 16.30 ? 188 TYR B C   1 
ATOM   3765 O  O   . TYR B 1 188 ? 22.897 -7.468  -24.685 1.00 17.12 ? 188 TYR B O   1 
ATOM   3766 C  CB  . TYR B 1 188 ? 23.311 -5.208  -27.086 1.00 16.30 ? 188 TYR B CB  1 
ATOM   3767 C  CG  . TYR B 1 188 ? 22.528 -4.406  -26.058 1.00 17.06 ? 188 TYR B CG  1 
ATOM   3768 C  CD1 . TYR B 1 188 ? 23.150 -3.436  -25.272 1.00 15.83 ? 188 TYR B CD1 1 
ATOM   3769 C  CD2 . TYR B 1 188 ? 21.158 -4.627  -25.866 1.00 17.98 ? 188 TYR B CD2 1 
ATOM   3770 C  CE1 . TYR B 1 188 ? 22.428 -2.708  -24.321 1.00 16.65 ? 188 TYR B CE1 1 
ATOM   3771 C  CE2 . TYR B 1 188 ? 20.433 -3.907  -24.920 1.00 17.56 ? 188 TYR B CE2 1 
ATOM   3772 C  CZ  . TYR B 1 188 ? 21.073 -2.951  -24.151 1.00 18.04 ? 188 TYR B CZ  1 
ATOM   3773 O  OH  . TYR B 1 188 ? 20.362 -2.248  -23.201 1.00 18.69 ? 188 TYR B OH  1 
ATOM   3774 N  N   . ILE B 1 189 ? 22.342 -8.131  -26.767 1.00 16.40 ? 189 ILE B N   1 
ATOM   3775 C  CA  . ILE B 1 189 ? 21.376 -9.108  -26.299 1.00 17.73 ? 189 ILE B CA  1 
ATOM   3776 C  C   . ILE B 1 189 ? 22.140 -10.066 -25.403 1.00 18.61 ? 189 ILE B C   1 
ATOM   3777 O  O   . ILE B 1 189 ? 21.878 -10.176 -24.213 1.00 19.30 ? 189 ILE B O   1 
ATOM   3778 C  CB  . ILE B 1 189 ? 20.776 -9.929  -27.459 1.00 17.66 ? 189 ILE B CB  1 
ATOM   3779 C  CG1 . ILE B 1 189 ? 20.054 -9.005  -28.431 1.00 17.23 ? 189 ILE B CG1 1 
ATOM   3780 C  CG2 . ILE B 1 189 ? 19.835 -10.992 -26.908 1.00 21.25 ? 189 ILE B CG2 1 
ATOM   3781 C  CD1 . ILE B 1 189 ? 19.138 -8.041  -27.768 1.00 14.30 ? 189 ILE B CD1 1 
ATOM   3782 N  N   . LEU B 1 190 ? 23.105 -10.748 -25.996 1.00 19.87 ? 190 LEU B N   1 
ATOM   3783 C  CA  . LEU B 1 190 ? 23.922 -11.701 -25.272 1.00 20.57 ? 190 LEU B CA  1 
ATOM   3784 C  C   . LEU B 1 190 ? 24.367 -11.146 -23.924 1.00 20.62 ? 190 LEU B C   1 
ATOM   3785 O  O   . LEU B 1 190 ? 24.030 -11.705 -22.888 1.00 22.08 ? 190 LEU B O   1 
ATOM   3786 C  CB  . LEU B 1 190 ? 25.133 -12.081 -26.126 1.00 20.55 ? 190 LEU B CB  1 
ATOM   3787 C  CG  . LEU B 1 190 ? 24.876 -12.923 -27.387 1.00 22.83 ? 190 LEU B CG  1 
ATOM   3788 C  CD1 . LEU B 1 190 ? 25.431 -14.301 -27.131 1.00 24.07 ? 190 LEU B CD1 1 
ATOM   3789 C  CD2 . LEU B 1 190 ? 23.391 -12.994 -27.751 1.00 20.80 ? 190 LEU B CD2 1 
ATOM   3790 N  N   . LYS B 1 191 ? 25.109 -10.040 -23.949 1.00 20.87 ? 191 LYS B N   1 
ATOM   3791 C  CA  . LYS B 1 191 ? 25.630 -9.392  -22.744 1.00 21.05 ? 191 LYS B CA  1 
ATOM   3792 C  C   . LYS B 1 191 ? 24.603 -8.950  -21.705 1.00 21.73 ? 191 LYS B C   1 
ATOM   3793 O  O   . LYS B 1 191 ? 24.834 -9.120  -20.504 1.00 21.90 ? 191 LYS B O   1 
ATOM   3794 C  CB  . LYS B 1 191 ? 26.498 -8.194  -23.134 1.00 21.39 ? 191 LYS B CB  1 
ATOM   3795 C  CG  . LYS B 1 191 ? 27.895 -8.576  -23.599 1.00 21.38 ? 191 LYS B CG  1 
ATOM   3796 C  CD  . LYS B 1 191 ? 28.677 -9.216  -22.464 1.00 21.78 ? 191 LYS B CD  1 
ATOM   3797 C  CE  . LYS B 1 191 ? 30.138 -9.374  -22.819 1.00 24.29 ? 191 LYS B CE  1 
ATOM   3798 N  NZ  . LYS B 1 191 ? 30.955 -9.826  -21.659 1.00 25.56 ? 191 LYS B NZ  1 
ATOM   3799 N  N   . THR B 1 192 ? 23.483 -8.375  -22.145 1.00 21.10 ? 192 THR B N   1 
ATOM   3800 C  CA  . THR B 1 192 ? 22.446 -7.944  -21.208 1.00 22.58 ? 192 THR B CA  1 
ATOM   3801 C  C   . THR B 1 192 ? 21.697 -9.150  -20.652 1.00 22.83 ? 192 THR B C   1 
ATOM   3802 O  O   . THR B 1 192 ? 21.586 -9.317  -19.431 1.00 23.34 ? 192 THR B O   1 
ATOM   3803 C  CB  . THR B 1 192 ? 21.420 -6.997  -21.872 1.00 21.81 ? 192 THR B CB  1 
ATOM   3804 O  OG1 . THR B 1 192 ? 22.045 -5.747  -22.182 1.00 20.45 ? 192 THR B OG1 1 
ATOM   3805 C  CG2 . THR B 1 192 ? 20.262 -6.746  -20.941 1.00 21.06 ? 192 THR B CG2 1 
ATOM   3806 N  N   . LEU B 1 193 ? 21.183 -9.987  -21.552 1.00 23.02 ? 193 LEU B N   1 
ATOM   3807 C  CA  . LEU B 1 193 ? 20.457 -11.182 -21.150 1.00 23.38 ? 193 LEU B CA  1 
ATOM   3808 C  C   . LEU B 1 193 ? 21.360 -12.119 -20.343 1.00 23.70 ? 193 LEU B C   1 
ATOM   3809 O  O   . LEU B 1 193 ? 20.876 -12.886 -19.513 1.00 23.74 ? 193 LEU B O   1 
ATOM   3810 C  CB  . LEU B 1 193 ? 19.885 -11.897 -22.381 1.00 24.06 ? 193 LEU B CB  1 
ATOM   3811 C  CG  . LEU B 1 193 ? 18.434 -11.559 -22.758 1.00 24.34 ? 193 LEU B CG  1 
ATOM   3812 C  CD1 . LEU B 1 193 ? 18.260 -10.061 -22.825 1.00 24.47 ? 193 LEU B CD1 1 
ATOM   3813 C  CD2 . LEU B 1 193 ? 18.070 -12.205 -24.086 1.00 23.89 ? 193 LEU B CD2 1 
ATOM   3814 N  N   . GLY B 1 194 ? 22.668 -12.043 -20.586 1.00 22.87 ? 194 GLY B N   1 
ATOM   3815 C  CA  . GLY B 1 194 ? 23.631 -12.867 -19.863 1.00 21.37 ? 194 GLY B CA  1 
ATOM   3816 C  C   . GLY B 1 194 ? 23.778 -14.306 -20.332 1.00 20.04 ? 194 GLY B C   1 
ATOM   3817 O  O   . GLY B 1 194 ? 24.037 -15.208 -19.525 1.00 19.28 ? 194 GLY B O   1 
ATOM   3818 N  N   . ILE B 1 195 ? 23.625 -14.511 -21.637 1.00 18.43 ? 195 ILE B N   1 
ATOM   3819 C  CA  . ILE B 1 195 ? 23.717 -15.826 -22.255 1.00 16.10 ? 195 ILE B CA  1 
ATOM   3820 C  C   . ILE B 1 195 ? 25.146 -16.380 -22.170 1.00 16.13 ? 195 ILE B C   1 
ATOM   3821 O  O   . ILE B 1 195 ? 26.100 -15.702 -22.553 1.00 16.52 ? 195 ILE B O   1 
ATOM   3822 C  CB  . ILE B 1 195 ? 23.263 -15.738 -23.738 1.00 15.73 ? 195 ILE B CB  1 
ATOM   3823 C  CG1 . ILE B 1 195 ? 21.826 -15.198 -23.801 1.00 14.95 ? 195 ILE B CG1 1 
ATOM   3824 C  CG2 . ILE B 1 195 ? 23.366 -17.101 -24.415 1.00 15.44 ? 195 ILE B CG2 1 
ATOM   3825 C  CD1 . ILE B 1 195 ? 21.288 -14.993 -25.200 1.00 14.78 ? 195 ILE B CD1 1 
ATOM   3826 N  N   . LYS B 1 196 ? 25.294 -17.603 -21.660 1.00 14.62 ? 196 LYS B N   1 
ATOM   3827 C  CA  . LYS B 1 196 ? 26.620 -18.213 -21.549 1.00 14.26 ? 196 LYS B CA  1 
ATOM   3828 C  C   . LYS B 1 196 ? 27.186 -18.490 -22.942 1.00 12.99 ? 196 LYS B C   1 
ATOM   3829 O  O   . LYS B 1 196 ? 26.538 -19.109 -23.789 1.00 11.54 ? 196 LYS B O   1 
ATOM   3830 C  CB  . LYS B 1 196 ? 26.571 -19.528 -20.750 1.00 14.57 ? 196 LYS B CB  1 
ATOM   3831 C  CG  . LYS B 1 196 ? 27.961 -20.088 -20.398 1.00 12.77 ? 196 LYS B CG  1 
ATOM   3832 C  CD  . LYS B 1 196 ? 28.740 -19.094 -19.528 1.00 12.70 ? 196 LYS B CD  1 
ATOM   3833 C  CE  . LYS B 1 196 ? 30.185 -19.511 -19.339 1.00 15.95 ? 196 LYS B CE  1 
ATOM   3834 N  NZ  . LYS B 1 196 ? 30.315 -20.927 -18.925 1.00 19.64 ? 196 LYS B NZ  1 
ATOM   3835 N  N   . TYR B 1 197 ? 28.412 -18.048 -23.171 1.00 13.34 ? 197 TYR B N   1 
ATOM   3836 C  CA  . TYR B 1 197 ? 29.007 -18.242 -24.471 1.00 13.33 ? 197 TYR B CA  1 
ATOM   3837 C  C   . TYR B 1 197 ? 30.518 -18.451 -24.436 1.00 13.49 ? 197 TYR B C   1 
ATOM   3838 O  O   . TYR B 1 197 ? 31.233 -17.907 -23.579 1.00 14.35 ? 197 TYR B O   1 
ATOM   3839 C  CB  . TYR B 1 197 ? 28.658 -17.033 -25.365 1.00 10.85 ? 197 TYR B CB  1 
ATOM   3840 C  CG  . TYR B 1 197 ? 29.340 -15.740 -24.948 1.00 10.23 ? 197 TYR B CG  1 
ATOM   3841 C  CD1 . TYR B 1 197 ? 30.674 -15.484 -25.294 1.00 8.03  ? 197 TYR B CD1 1 
ATOM   3842 C  CD2 . TYR B 1 197 ? 28.684 -14.810 -24.148 1.00 12.47 ? 197 TYR B CD2 1 
ATOM   3843 C  CE1 . TYR B 1 197 ? 31.341 -14.347 -24.848 1.00 8.30  ? 197 TYR B CE1 1 
ATOM   3844 C  CE2 . TYR B 1 197 ? 29.346 -13.654 -23.690 1.00 12.48 ? 197 TYR B CE2 1 
ATOM   3845 C  CZ  . TYR B 1 197 ? 30.678 -13.435 -24.043 1.00 10.83 ? 197 TYR B CZ  1 
ATOM   3846 O  OH  . TYR B 1 197 ? 31.344 -12.325 -23.563 1.00 10.85 ? 197 TYR B OH  1 
ATOM   3847 N  N   . PHE B 1 198 ? 30.982 -19.267 -25.372 1.00 12.82 ? 198 PHE B N   1 
ATOM   3848 C  CA  . PHE B 1 198 ? 32.395 -19.524 -25.546 1.00 12.24 ? 198 PHE B CA  1 
ATOM   3849 C  C   . PHE B 1 198 ? 32.732 -19.110 -26.988 1.00 10.91 ? 198 PHE B C   1 
ATOM   3850 O  O   . PHE B 1 198 ? 32.645 -19.923 -27.913 1.00 8.28  ? 198 PHE B O   1 
ATOM   3851 C  CB  . PHE B 1 198 ? 32.720 -21.012 -25.313 1.00 12.77 ? 198 PHE B CB  1 
ATOM   3852 C  CG  . PHE B 1 198 ? 32.557 -21.450 -23.877 1.00 14.90 ? 198 PHE B CG  1 
ATOM   3853 C  CD1 . PHE B 1 198 ? 31.339 -21.948 -23.418 1.00 13.35 ? 198 PHE B CD1 1 
ATOM   3854 C  CD2 . PHE B 1 198 ? 33.607 -21.307 -22.971 1.00 13.53 ? 198 PHE B CD2 1 
ATOM   3855 C  CE1 . PHE B 1 198 ? 31.172 -22.290 -22.087 1.00 12.01 ? 198 PHE B CE1 1 
ATOM   3856 C  CE2 . PHE B 1 198 ? 33.446 -21.646 -21.636 1.00 12.07 ? 198 PHE B CE2 1 
ATOM   3857 C  CZ  . PHE B 1 198 ? 32.224 -22.138 -21.193 1.00 13.05 ? 198 PHE B CZ  1 
ATOM   3858 N  N   . SER B 1 199 ? 33.075 -17.834 -27.178 1.00 11.21 ? 199 SER B N   1 
ATOM   3859 C  CA  . SER B 1 199 ? 33.435 -17.346 -28.505 1.00 11.92 ? 199 SER B CA  1 
ATOM   3860 C  C   . SER B 1 199 ? 34.799 -17.941 -28.804 1.00 12.37 ? 199 SER B C   1 
ATOM   3861 O  O   . SER B 1 199 ? 35.404 -18.568 -27.933 1.00 12.40 ? 199 SER B O   1 
ATOM   3862 C  CB  . SER B 1 199 ? 33.492 -15.803 -28.559 1.00 11.50 ? 199 SER B CB  1 
ATOM   3863 O  OG  . SER B 1 199 ? 34.762 -15.284 -28.175 1.00 10.59 ? 199 SER B OG  1 
ATOM   3864 N  N   . MET B 1 200 ? 35.288 -17.753 -30.025 1.00 12.08 ? 200 MET B N   1 
ATOM   3865 C  CA  . MET B 1 200 ? 36.572 -18.314 -30.395 1.00 11.99 ? 200 MET B CA  1 
ATOM   3866 C  C   . MET B 1 200 ? 37.724 -17.900 -29.503 1.00 11.99 ? 200 MET B C   1 
ATOM   3867 O  O   . MET B 1 200 ? 38.701 -18.631 -29.371 1.00 13.08 ? 200 MET B O   1 
ATOM   3868 C  CB  . MET B 1 200 ? 36.862 -17.993 -31.857 1.00 14.52 ? 200 MET B CB  1 
ATOM   3869 C  CG  . MET B 1 200 ? 35.856 -18.651 -32.795 1.00 13.38 ? 200 MET B CG  1 
ATOM   3870 S  SD  . MET B 1 200 ? 35.914 -20.459 -32.869 1.00 13.67 ? 200 MET B SD  1 
ATOM   3871 C  CE  . MET B 1 200 ? 35.322 -20.939 -31.337 1.00 15.47 ? 200 MET B CE  1 
ATOM   3872 N  N   . THR B 1 201 ? 37.589 -16.737 -28.878 1.00 10.07 ? 201 THR B N   1 
ATOM   3873 C  CA  . THR B 1 201 ? 38.590 -16.188 -27.979 1.00 10.33 ? 201 THR B CA  1 
ATOM   3874 C  C   . THR B 1 201 ? 38.688 -17.055 -26.726 1.00 10.38 ? 201 THR B C   1 
ATOM   3875 O  O   . THR B 1 201 ? 39.776 -17.234 -26.178 1.00 8.42  ? 201 THR B O   1 
ATOM   3876 C  CB  . THR B 1 201 ? 38.213 -14.739 -27.557 1.00 10.78 ? 201 THR B CB  1 
ATOM   3877 O  OG1 . THR B 1 201 ? 37.967 -13.948 -28.727 1.00 8.13  ? 201 THR B OG1 1 
ATOM   3878 C  CG2 . THR B 1 201 ? 39.319 -14.113 -26.713 1.00 12.16 ? 201 THR B CG2 1 
ATOM   3879 N  N   . GLU B 1 202 ? 37.543 -17.584 -26.292 1.00 11.17 ? 202 GLU B N   1 
ATOM   3880 C  CA  . GLU B 1 202 ? 37.446 -18.436 -25.100 1.00 11.58 ? 202 GLU B CA  1 
ATOM   3881 C  C   . GLU B 1 202 ? 37.936 -19.864 -25.353 1.00 11.89 ? 202 GLU B C   1 
ATOM   3882 O  O   . GLU B 1 202 ? 38.459 -20.523 -24.444 1.00 11.03 ? 202 GLU B O   1 
ATOM   3883 C  CB  . GLU B 1 202 ? 36.000 -18.472 -24.590 1.00 11.67 ? 202 GLU B CB  1 
ATOM   3884 C  CG  . GLU B 1 202 ? 35.570 -17.276 -23.727 1.00 12.90 ? 202 GLU B CG  1 
ATOM   3885 C  CD  . GLU B 1 202 ? 35.425 -15.965 -24.497 1.00 13.83 ? 202 GLU B CD  1 
ATOM   3886 O  OE1 . GLU B 1 202 ? 34.714 -15.942 -25.517 1.00 14.53 ? 202 GLU B OE1 1 
ATOM   3887 O  OE2 . GLU B 1 202 ? 36.017 -14.954 -24.075 1.00 12.13 ? 202 GLU B OE2 1 
ATOM   3888 N  N   . VAL B 1 203 ? 37.762 -20.332 -26.589 1.00 11.59 ? 203 VAL B N   1 
ATOM   3889 C  CA  . VAL B 1 203 ? 38.215 -21.659 -27.001 1.00 10.75 ? 203 VAL B CA  1 
ATOM   3890 C  C   . VAL B 1 203 ? 39.745 -21.612 -27.093 1.00 11.71 ? 203 VAL B C   1 
ATOM   3891 O  O   . VAL B 1 203 ? 40.436 -22.570 -26.741 1.00 11.88 ? 203 VAL B O   1 
ATOM   3892 C  CB  . VAL B 1 203 ? 37.627 -22.030 -28.376 1.00 9.43  ? 203 VAL B CB  1 
ATOM   3893 C  CG1 . VAL B 1 203 ? 37.981 -23.464 -28.736 1.00 10.41 ? 203 VAL B CG1 1 
ATOM   3894 C  CG2 . VAL B 1 203 ? 36.124 -21.835 -28.356 1.00 8.88  ? 203 VAL B CG2 1 
ATOM   3895 N  N   . ASP B 1 204 ? 40.271 -20.483 -27.567 1.00 12.76 ? 204 ASP B N   1 
ATOM   3896 C  CA  . ASP B 1 204 ? 41.719 -20.306 -27.683 1.00 12.03 ? 204 ASP B CA  1 
ATOM   3897 C  C   . ASP B 1 204 ? 42.327 -20.219 -26.289 1.00 13.96 ? 204 ASP B C   1 
ATOM   3898 O  O   . ASP B 1 204 ? 43.369 -20.819 -26.014 1.00 13.36 ? 204 ASP B O   1 
ATOM   3899 C  CB  . ASP B 1 204 ? 42.069 -19.014 -28.435 1.00 11.15 ? 204 ASP B CB  1 
ATOM   3900 C  CG  . ASP B 1 204 ? 41.637 -19.032 -29.906 1.00 12.47 ? 204 ASP B CG  1 
ATOM   3901 O  OD1 . ASP B 1 204 ? 41.428 -20.123 -30.497 1.00 13.65 ? 204 ASP B OD1 1 
ATOM   3902 O  OD2 . ASP B 1 204 ? 41.526 -17.933 -30.474 1.00 13.92 ? 204 ASP B OD2 1 
ATOM   3903 N  N   . ARG B 1 205 ? 41.678 -19.435 -25.428 1.00 13.80 ? 205 ARG B N   1 
ATOM   3904 C  CA  . ARG B 1 205 ? 42.111 -19.237 -24.052 1.00 11.84 ? 205 ARG B CA  1 
ATOM   3905 C  C   . ARG B 1 205 ? 42.065 -20.520 -23.231 1.00 12.68 ? 205 ARG B C   1 
ATOM   3906 O  O   . ARG B 1 205 ? 43.091 -20.979 -22.716 1.00 11.45 ? 205 ARG B O   1 
ATOM   3907 C  CB  . ARG B 1 205 ? 41.225 -18.188 -23.371 1.00 9.69  ? 205 ARG B CB  1 
ATOM   3908 C  CG  . ARG B 1 205 ? 41.415 -18.081 -21.859 1.00 7.42  ? 205 ARG B CG  1 
ATOM   3909 C  CD  . ARG B 1 205 ? 40.403 -17.114 -21.257 1.00 9.89  ? 205 ARG B CD  1 
ATOM   3910 N  NE  . ARG B 1 205 ? 40.512 -15.793 -21.863 1.00 12.73 ? 205 ARG B NE  1 
ATOM   3911 C  CZ  . ARG B 1 205 ? 39.500 -15.119 -22.397 1.00 12.12 ? 205 ARG B CZ  1 
ATOM   3912 N  NH1 . ARG B 1 205 ? 38.273 -15.632 -22.402 1.00 15.24 ? 205 ARG B NH1 1 
ATOM   3913 N  NH2 . ARG B 1 205 ? 39.726 -13.934 -22.952 1.00 11.10 ? 205 ARG B NH2 1 
ATOM   3914 N  N   . LEU B 1 206 ? 40.866 -21.087 -23.112 1.00 12.03 ? 206 LEU B N   1 
ATOM   3915 C  CA  . LEU B 1 206 ? 40.655 -22.290 -22.309 1.00 14.29 ? 206 LEU B CA  1 
ATOM   3916 C  C   . LEU B 1 206 ? 41.010 -23.620 -22.957 1.00 15.19 ? 206 LEU B C   1 
ATOM   3917 O  O   . LEU B 1 206 ? 41.393 -24.560 -22.267 1.00 16.82 ? 206 LEU B O   1 
ATOM   3918 C  CB  . LEU B 1 206 ? 39.193 -22.362 -21.857 1.00 14.06 ? 206 LEU B CB  1 
ATOM   3919 C  CG  . LEU B 1 206 ? 38.633 -21.322 -20.889 1.00 15.17 ? 206 LEU B CG  1 
ATOM   3920 C  CD1 . LEU B 1 206 ? 37.138 -21.234 -21.085 1.00 14.39 ? 206 LEU B CD1 1 
ATOM   3921 C  CD2 . LEU B 1 206 ? 38.990 -21.690 -19.453 1.00 16.07 ? 206 LEU B CD2 1 
ATOM   3922 N  N   . GLY B 1 207 ? 40.897 -23.699 -24.276 1.00 14.85 ? 207 GLY B N   1 
ATOM   3923 C  CA  . GLY B 1 207 ? 41.153 -24.957 -24.949 1.00 13.95 ? 207 GLY B CA  1 
ATOM   3924 C  C   . GLY B 1 207 ? 39.783 -25.601 -25.037 1.00 13.34 ? 207 GLY B C   1 
ATOM   3925 O  O   . GLY B 1 207 ? 38.945 -25.408 -24.149 1.00 12.63 ? 207 GLY B O   1 
ATOM   3926 N  N   . ILE B 1 208 ? 39.539 -26.367 -26.092 1.00 13.55 ? 208 ILE B N   1 
ATOM   3927 C  CA  . ILE B 1 208 ? 38.229 -26.988 -26.274 1.00 12.69 ? 208 ILE B CA  1 
ATOM   3928 C  C   . ILE B 1 208 ? 37.800 -27.987 -25.176 1.00 12.11 ? 208 ILE B C   1 
ATOM   3929 O  O   . ILE B 1 208 ? 36.606 -28.265 -25.012 1.00 12.77 ? 208 ILE B O   1 
ATOM   3930 C  CB  . ILE B 1 208 ? 38.140 -27.635 -27.679 1.00 11.32 ? 208 ILE B CB  1 
ATOM   3931 C  CG1 . ILE B 1 208 ? 36.680 -27.785 -28.080 1.00 12.95 ? 208 ILE B CG1 1 
ATOM   3932 C  CG2 . ILE B 1 208 ? 38.870 -28.964 -27.705 1.00 14.38 ? 208 ILE B CG2 1 
ATOM   3933 C  CD1 . ILE B 1 208 ? 35.930 -26.468 -28.163 1.00 11.23 ? 208 ILE B CD1 1 
ATOM   3934 N  N   . GLY B 1 209 ? 38.760 -28.510 -24.416 1.00 12.82 ? 209 GLY B N   1 
ATOM   3935 C  CA  . GLY B 1 209 ? 38.427 -29.446 -23.349 1.00 13.91 ? 209 GLY B CA  1 
ATOM   3936 C  C   . GLY B 1 209 ? 37.831 -28.763 -22.126 1.00 14.18 ? 209 GLY B C   1 
ATOM   3937 O  O   . GLY B 1 209 ? 36.836 -29.222 -21.552 1.00 14.07 ? 209 GLY B O   1 
ATOM   3938 N  N   . LYS B 1 210 ? 38.448 -27.654 -21.726 1.00 14.28 ? 210 LYS B N   1 
ATOM   3939 C  CA  . LYS B 1 210 ? 37.995 -26.884 -20.583 1.00 13.35 ? 210 LYS B CA  1 
ATOM   3940 C  C   . LYS B 1 210 ? 36.655 -26.255 -20.969 1.00 12.26 ? 210 LYS B C   1 
ATOM   3941 O  O   . LYS B 1 210 ? 35.826 -25.946 -20.110 1.00 13.17 ? 210 LYS B O   1 
ATOM   3942 C  CB  . LYS B 1 210 ? 39.043 -25.809 -20.247 1.00 15.28 ? 210 LYS B CB  1 
ATOM   3943 C  CG  . LYS B 1 210 ? 38.882 -25.144 -18.890 1.00 18.10 ? 210 LYS B CG  1 
ATOM   3944 C  CD  . LYS B 1 210 ? 38.965 -26.150 -17.756 1.00 19.30 ? 210 LYS B CD  1 
ATOM   3945 C  CE  . LYS B 1 210 ? 38.826 -25.454 -16.406 1.00 21.92 ? 210 LYS B CE  1 
ATOM   3946 N  NZ  . LYS B 1 210 ? 37.583 -24.613 -16.312 1.00 21.58 ? 210 LYS B NZ  1 
ATOM   3947 N  N   . VAL B 1 211 ? 36.445 -26.091 -22.274 1.00 11.17 ? 211 VAL B N   1 
ATOM   3948 C  CA  . VAL B 1 211 ? 35.206 -25.523 -22.793 1.00 10.48 ? 211 VAL B CA  1 
ATOM   3949 C  C   . VAL B 1 211 ? 34.024 -26.465 -22.588 1.00 11.08 ? 211 VAL B C   1 
ATOM   3950 O  O   . VAL B 1 211 ? 32.974 -26.042 -22.142 1.00 10.99 ? 211 VAL B O   1 
ATOM   3951 C  CB  . VAL B 1 211 ? 35.322 -25.187 -24.312 1.00 11.17 ? 211 VAL B CB  1 
ATOM   3952 C  CG1 . VAL B 1 211 ? 33.932 -25.072 -24.940 1.00 12.60 ? 211 VAL B CG1 1 
ATOM   3953 C  CG2 . VAL B 1 211 ? 36.107 -23.875 -24.502 1.00 11.33 ? 211 VAL B CG2 1 
ATOM   3954 N  N   . MET B 1 212 ? 34.186 -27.742 -22.915 1.00 12.03 ? 212 MET B N   1 
ATOM   3955 C  CA  . MET B 1 212 ? 33.076 -28.681 -22.763 1.00 11.62 ? 212 MET B CA  1 
ATOM   3956 C  C   . MET B 1 212 ? 32.779 -28.956 -21.297 1.00 13.00 ? 212 MET B C   1 
ATOM   3957 O  O   . MET B 1 212 ? 31.634 -29.181 -20.919 1.00 13.20 ? 212 MET B O   1 
ATOM   3958 C  CB  . MET B 1 212 ? 33.365 -29.975 -23.534 1.00 12.59 ? 212 MET B CB  1 
ATOM   3959 C  CG  . MET B 1 212 ? 33.223 -29.812 -25.074 1.00 10.42 ? 212 MET B CG  1 
ATOM   3960 S  SD  . MET B 1 212 ? 31.598 -29.117 -25.544 1.00 16.38 ? 212 MET B SD  1 
ATOM   3961 C  CE  . MET B 1 212 ? 30.531 -30.516 -25.170 1.00 7.85  ? 212 MET B CE  1 
ATOM   3962 N  N   . GLU B 1 213 ? 33.820 -28.909 -20.475 1.00 14.67 ? 213 GLU B N   1 
ATOM   3963 C  CA  . GLU B 1 213 ? 33.702 -29.108 -19.032 1.00 16.42 ? 213 GLU B CA  1 
ATOM   3964 C  C   . GLU B 1 213 ? 32.843 -27.997 -18.427 1.00 15.46 ? 213 GLU B C   1 
ATOM   3965 O  O   . GLU B 1 213 ? 31.926 -28.265 -17.656 1.00 14.69 ? 213 GLU B O   1 
ATOM   3966 C  CB  . GLU B 1 213 ? 35.094 -29.074 -18.396 1.00 19.70 ? 213 GLU B CB  1 
ATOM   3967 C  CG  . GLU B 1 213 ? 35.120 -29.077 -16.871 1.00 23.31 ? 213 GLU B CG  1 
ATOM   3968 C  CD  . GLU B 1 213 ? 36.454 -28.570 -16.325 1.00 26.32 ? 213 GLU B CD  1 
ATOM   3969 O  OE1 . GLU B 1 213 ? 36.585 -27.344 -16.079 1.00 25.22 ? 213 GLU B OE1 1 
ATOM   3970 O  OE2 . GLU B 1 213 ? 37.378 -29.401 -16.167 1.00 26.66 ? 213 GLU B OE2 1 
ATOM   3971 N  N   . GLU B 1 214 ? 33.153 -26.752 -18.781 1.00 16.01 ? 214 GLU B N   1 
ATOM   3972 C  CA  . GLU B 1 214 ? 32.421 -25.587 -18.283 1.00 16.29 ? 214 GLU B CA  1 
ATOM   3973 C  C   . GLU B 1 214 ? 31.015 -25.468 -18.868 1.00 16.10 ? 214 GLU B C   1 
ATOM   3974 O  O   . GLU B 1 214 ? 30.098 -24.960 -18.218 1.00 16.52 ? 214 GLU B O   1 
ATOM   3975 C  CB  . GLU B 1 214 ? 33.202 -24.310 -18.578 1.00 18.81 ? 214 GLU B CB  1 
ATOM   3976 C  CG  . GLU B 1 214 ? 34.458 -24.138 -17.749 1.00 19.28 ? 214 GLU B CG  1 
ATOM   3977 C  CD  . GLU B 1 214 ? 35.136 -22.808 -18.011 1.00 18.63 ? 214 GLU B CD  1 
ATOM   3978 O  OE1 . GLU B 1 214 ? 34.451 -21.872 -18.482 1.00 16.82 ? 214 GLU B OE1 1 
ATOM   3979 O  OE2 . GLU B 1 214 ? 36.349 -22.701 -17.727 1.00 19.42 ? 214 GLU B OE2 1 
ATOM   3980 N  N   . THR B 1 215 ? 30.853 -25.911 -20.109 1.00 16.74 ? 215 THR B N   1 
ATOM   3981 C  CA  . THR B 1 215 ? 29.542 -25.875 -20.744 1.00 15.90 ? 215 THR B CA  1 
ATOM   3982 C  C   . THR B 1 215 ? 28.671 -26.917 -20.056 1.00 15.34 ? 215 THR B C   1 
ATOM   3983 O  O   . THR B 1 215 ? 27.624 -26.588 -19.500 1.00 16.25 ? 215 THR B O   1 
ATOM   3984 C  CB  . THR B 1 215 ? 29.610 -26.244 -22.236 1.00 16.11 ? 215 THR B CB  1 
ATOM   3985 O  OG1 . THR B 1 215 ? 30.153 -27.563 -22.373 1.00 21.08 ? 215 THR B OG1 1 
ATOM   3986 C  CG2 . THR B 1 215 ? 30.468 -25.270 -22.989 1.00 13.52 ? 215 THR B CG2 1 
ATOM   3987 N  N   . LEU B 1 216 ? 29.122 -28.170 -20.096 1.00 14.19 ? 216 LEU B N   1 
ATOM   3988 C  CA  . LEU B 1 216 ? 28.393 -29.284 -19.501 1.00 14.66 ? 216 LEU B CA  1 
ATOM   3989 C  C   . LEU B 1 216 ? 28.159 -29.129 -18.008 1.00 15.28 ? 216 LEU B C   1 
ATOM   3990 O  O   . LEU B 1 216 ? 27.209 -29.686 -17.467 1.00 15.44 ? 216 LEU B O   1 
ATOM   3991 C  CB  . LEU B 1 216 ? 29.115 -30.616 -19.769 1.00 12.90 ? 216 LEU B CB  1 
ATOM   3992 C  CG  . LEU B 1 216 ? 29.262 -31.138 -21.207 1.00 12.35 ? 216 LEU B CG  1 
ATOM   3993 C  CD1 . LEU B 1 216 ? 29.927 -32.511 -21.141 1.00 11.92 ? 216 LEU B CD1 1 
ATOM   3994 C  CD2 . LEU B 1 216 ? 27.906 -31.227 -21.931 1.00 11.51 ? 216 LEU B CD2 1 
ATOM   3995 N  N   . SER B 1 217 ? 29.025 -28.376 -17.340 1.00 16.63 ? 217 SER B N   1 
ATOM   3996 C  CA  . SER B 1 217 ? 28.876 -28.150 -15.907 1.00 18.91 ? 217 SER B CA  1 
ATOM   3997 C  C   . SER B 1 217 ? 27.827 -27.069 -15.702 1.00 18.24 ? 217 SER B C   1 
ATOM   3998 O  O   . SER B 1 217 ? 26.981 -27.154 -14.807 1.00 18.22 ? 217 SER B O   1 
ATOM   3999 C  CB  . SER B 1 217 ? 30.196 -27.689 -15.294 1.00 20.85 ? 217 SER B CB  1 
ATOM   4000 O  OG  . SER B 1 217 ? 30.501 -26.359 -15.686 1.00 28.28 ? 217 SER B OG  1 
ATOM   4001 N  N   . TYR B 1 218 ? 27.889 -26.047 -16.545 1.00 17.85 ? 218 TYR B N   1 
ATOM   4002 C  CA  . TYR B 1 218 ? 26.951 -24.944 -16.471 1.00 18.22 ? 218 TYR B CA  1 
ATOM   4003 C  C   . TYR B 1 218 ? 25.546 -25.431 -16.843 1.00 19.33 ? 218 TYR B C   1 
ATOM   4004 O  O   . TYR B 1 218 ? 24.537 -24.932 -16.330 1.00 17.02 ? 218 TYR B O   1 
ATOM   4005 C  CB  . TYR B 1 218 ? 27.409 -23.841 -17.426 1.00 19.91 ? 218 TYR B CB  1 
ATOM   4006 C  CG  . TYR B 1 218 ? 26.496 -22.642 -17.508 1.00 18.86 ? 218 TYR B CG  1 
ATOM   4007 C  CD1 . TYR B 1 218 ? 26.721 -21.516 -16.723 1.00 18.78 ? 218 TYR B CD1 1 
ATOM   4008 C  CD2 . TYR B 1 218 ? 25.443 -22.609 -18.425 1.00 18.63 ? 218 TYR B CD2 1 
ATOM   4009 C  CE1 . TYR B 1 218 ? 25.925 -20.378 -16.859 1.00 19.00 ? 218 TYR B CE1 1 
ATOM   4010 C  CE2 . TYR B 1 218 ? 24.648 -21.485 -18.565 1.00 17.88 ? 218 TYR B CE2 1 
ATOM   4011 C  CZ  . TYR B 1 218 ? 24.898 -20.372 -17.785 1.00 18.70 ? 218 TYR B CZ  1 
ATOM   4012 O  OH  . TYR B 1 218 ? 24.147 -19.241 -17.964 1.00 17.97 ? 218 TYR B OH  1 
ATOM   4013 N  N   . LEU B 1 219 ? 25.498 -26.427 -17.718 1.00 19.08 ? 219 LEU B N   1 
ATOM   4014 C  CA  . LEU B 1 219 ? 24.238 -26.984 -18.192 1.00 20.91 ? 219 LEU B CA  1 
ATOM   4015 C  C   . LEU B 1 219 ? 23.674 -28.158 -17.397 1.00 21.61 ? 219 LEU B C   1 
ATOM   4016 O  O   . LEU B 1 219 ? 22.467 -28.225 -17.168 1.00 21.18 ? 219 LEU B O   1 
ATOM   4017 C  CB  . LEU B 1 219 ? 24.387 -27.403 -19.662 1.00 21.39 ? 219 LEU B CB  1 
ATOM   4018 C  CG  . LEU B 1 219 ? 23.802 -26.460 -20.721 1.00 22.79 ? 219 LEU B CG  1 
ATOM   4019 C  CD1 . LEU B 1 219 ? 24.531 -26.612 -22.050 1.00 20.22 ? 219 LEU B CD1 1 
ATOM   4020 C  CD2 . LEU B 1 219 ? 22.323 -26.768 -20.877 1.00 21.54 ? 219 LEU B CD2 1 
ATOM   4021 N  N   . LEU B 1 220 ? 24.534 -29.082 -16.980 1.00 23.70 ? 220 LEU B N   1 
ATOM   4022 C  CA  . LEU B 1 220 ? 24.081 -30.269 -16.250 1.00 26.45 ? 220 LEU B CA  1 
ATOM   4023 C  C   . LEU B 1 220 ? 24.401 -30.287 -14.755 1.00 28.15 ? 220 LEU B C   1 
ATOM   4024 O  O   . LEU B 1 220 ? 24.133 -31.278 -14.068 1.00 27.71 ? 220 LEU B O   1 
ATOM   4025 C  CB  . LEU B 1 220 ? 24.667 -31.517 -16.910 1.00 28.16 ? 220 LEU B CB  1 
ATOM   4026 C  CG  . LEU B 1 220 ? 24.373 -31.616 -18.409 1.00 29.10 ? 220 LEU B CG  1 
ATOM   4027 C  CD1 . LEU B 1 220 ? 25.127 -32.793 -19.002 1.00 28.14 ? 220 LEU B CD1 1 
ATOM   4028 C  CD2 . LEU B 1 220 ? 22.865 -31.754 -18.626 1.00 27.86 ? 220 LEU B CD2 1 
ATOM   4029 N  N   . GLY B 1 221 ? 24.959 -29.189 -14.254 1.00 29.47 ? 221 GLY B N   1 
ATOM   4030 C  CA  . GLY B 1 221 ? 25.310 -29.112 -12.848 1.00 31.63 ? 221 GLY B CA  1 
ATOM   4031 C  C   . GLY B 1 221 ? 24.236 -29.567 -11.876 1.00 33.59 ? 221 GLY B C   1 
ATOM   4032 O  O   . GLY B 1 221 ? 24.322 -30.660 -11.313 1.00 34.92 ? 221 GLY B O   1 
ATOM   4033 N  N   . ARG B 1 222 ? 23.222 -28.728 -11.684 1.00 34.33 ? 222 ARG B N   1 
ATOM   4034 C  CA  . ARG B 1 222 ? 22.129 -29.019 -10.759 1.00 35.02 ? 222 ARG B CA  1 
ATOM   4035 C  C   . ARG B 1 222 ? 21.159 -30.115 -11.201 1.00 35.35 ? 222 ARG B C   1 
ATOM   4036 O  O   . ARG B 1 222 ? 20.810 -31.001 -10.419 1.00 35.92 ? 222 ARG B O   1 
ATOM   4037 C  CB  . ARG B 1 222 ? 21.351 -27.734 -10.478 1.00 35.34 ? 222 ARG B CB  1 
ATOM   4038 C  CG  . ARG B 1 222 ? 22.145 -26.713 -9.688  1.00 36.96 ? 222 ARG B CG  1 
ATOM   4039 C  CD  . ARG B 1 222 ? 21.331 -25.457 -9.388  1.00 38.26 ? 222 ARG B CD  1 
ATOM   4040 N  NE  . ARG B 1 222 ? 21.172 -24.593 -10.558 1.00 38.42 ? 222 ARG B NE  1 
ATOM   4041 C  CZ  . ARG B 1 222 ? 20.604 -23.391 -10.528 1.00 37.77 ? 222 ARG B CZ  1 
ATOM   4042 N  NH1 . ARG B 1 222 ? 20.135 -22.904 -9.389  1.00 38.16 ? 222 ARG B NH1 1 
ATOM   4043 N  NH2 . ARG B 1 222 ? 20.519 -22.669 -11.635 1.00 37.92 ? 222 ARG B NH2 1 
ATOM   4044 N  N   . LYS B 1 223 ? 20.727 -30.044 -12.455 1.00 34.61 ? 223 LYS B N   1 
ATOM   4045 C  CA  . LYS B 1 223 ? 19.781 -31.002 -13.018 1.00 33.47 ? 223 LYS B CA  1 
ATOM   4046 C  C   . LYS B 1 223 ? 20.364 -31.690 -14.241 1.00 31.92 ? 223 LYS B C   1 
ATOM   4047 O  O   . LYS B 1 223 ? 20.953 -31.041 -15.101 1.00 31.35 ? 223 LYS B O   1 
ATOM   4048 C  CB  . LYS B 1 223 ? 18.493 -30.282 -13.440 1.00 33.46 ? 223 LYS B CB  1 
ATOM   4049 C  CG  . LYS B 1 223 ? 17.477 -30.032 -12.343 1.00 34.16 ? 223 LYS B CG  1 
ATOM   4050 C  CD  . LYS B 1 223 ? 16.584 -31.243 -12.141 1.00 35.28 ? 223 LYS B CD  1 
ATOM   4051 C  CE  . LYS B 1 223 ? 15.385 -30.915 -11.252 1.00 35.96 ? 223 LYS B CE  1 
ATOM   4052 N  NZ  . LYS B 1 223 ? 15.768 -30.437 -9.892  1.00 35.59 ? 223 LYS B NZ  1 
ATOM   4053 N  N   . LYS B 1 224 ? 20.187 -33.004 -14.311 1.00 31.41 ? 224 LYS B N   1 
ATOM   4054 C  CA  . LYS B 1 224 ? 20.652 -33.781 -15.449 1.00 31.85 ? 224 LYS B CA  1 
ATOM   4055 C  C   . LYS B 1 224 ? 19.495 -33.910 -16.439 1.00 30.80 ? 224 LYS B C   1 
ATOM   4056 O  O   . LYS B 1 224 ? 18.980 -35.007 -16.656 1.00 33.05 ? 224 LYS B O   1 
ATOM   4057 C  CB  . LYS B 1 224 ? 21.107 -35.176 -15.000 1.00 31.87 ? 224 LYS B CB  1 
ATOM   4058 C  CG  . LYS B 1 224 ? 22.624 -35.371 -14.984 1.00 34.20 ? 224 LYS B CG  1 
ATOM   4059 C  CD  . LYS B 1 224 ? 23.321 -34.385 -14.051 1.00 35.33 ? 224 LYS B CD  1 
ATOM   4060 C  CE  . LYS B 1 224 ? 24.835 -34.545 -14.094 1.00 35.34 ? 224 LYS B CE  1 
ATOM   4061 N  NZ  . LYS B 1 224 ? 25.520 -33.578 -13.186 1.00 37.33 ? 224 LYS B NZ  1 
ATOM   4062 N  N   . ARG B 1 225 ? 19.094 -32.787 -17.034 1.00 28.94 ? 225 ARG B N   1 
ATOM   4063 C  CA  . ARG B 1 225 ? 17.995 -32.753 -18.003 1.00 25.78 ? 225 ARG B CA  1 
ATOM   4064 C  C   . ARG B 1 225 ? 18.448 -32.901 -19.467 1.00 24.70 ? 225 ARG B C   1 
ATOM   4065 O  O   . ARG B 1 225 ? 19.623 -32.721 -19.781 1.00 25.23 ? 225 ARG B O   1 
ATOM   4066 C  CB  . ARG B 1 225 ? 17.190 -31.460 -17.828 1.00 24.94 ? 225 ARG B CB  1 
ATOM   4067 C  CG  . ARG B 1 225 ? 18.023 -30.188 -17.697 1.00 24.40 ? 225 ARG B CG  1 
ATOM   4068 C  CD  . ARG B 1 225 ? 18.929 -29.938 -18.895 1.00 21.78 ? 225 ARG B CD  1 
ATOM   4069 N  NE  . ARG B 1 225 ? 19.770 -28.778 -18.650 1.00 22.88 ? 225 ARG B NE  1 
ATOM   4070 C  CZ  . ARG B 1 225 ? 19.328 -27.527 -18.624 1.00 23.82 ? 225 ARG B CZ  1 
ATOM   4071 N  NH1 . ARG B 1 225 ? 18.047 -27.271 -18.844 1.00 26.24 ? 225 ARG B NH1 1 
ATOM   4072 N  NH2 . ARG B 1 225 ? 20.157 -26.532 -18.344 1.00 23.16 ? 225 ARG B NH2 1 
ATOM   4073 N  N   . PRO B 1 226 ? 17.511 -33.233 -20.375 1.00 23.37 ? 226 PRO B N   1 
ATOM   4074 C  CA  . PRO B 1 226 ? 17.742 -33.426 -21.815 1.00 22.21 ? 226 PRO B CA  1 
ATOM   4075 C  C   . PRO B 1 226 ? 18.557 -32.320 -22.499 1.00 21.31 ? 226 PRO B C   1 
ATOM   4076 O  O   . PRO B 1 226 ? 18.432 -31.150 -22.150 1.00 20.26 ? 226 PRO B O   1 
ATOM   4077 C  CB  . PRO B 1 226 ? 16.320 -33.511 -22.376 1.00 23.71 ? 226 PRO B CB  1 
ATOM   4078 C  CG  . PRO B 1 226 ? 15.547 -34.143 -21.251 1.00 21.86 ? 226 PRO B CG  1 
ATOM   4079 C  CD  . PRO B 1 226 ? 16.076 -33.396 -20.055 1.00 23.20 ? 226 PRO B CD  1 
ATOM   4080 N  N   . ILE B 1 227 ? 19.367 -32.705 -23.489 1.00 20.02 ? 227 ILE B N   1 
ATOM   4081 C  CA  . ILE B 1 227 ? 20.208 -31.763 -24.237 1.00 18.83 ? 227 ILE B CA  1 
ATOM   4082 C  C   . ILE B 1 227 ? 19.802 -31.665 -25.706 1.00 17.94 ? 227 ILE B C   1 
ATOM   4083 O  O   . ILE B 1 227 ? 19.584 -32.678 -26.363 1.00 17.13 ? 227 ILE B O   1 
ATOM   4084 C  CB  . ILE B 1 227 ? 21.711 -32.180 -24.222 1.00 18.63 ? 227 ILE B CB  1 
ATOM   4085 C  CG1 . ILE B 1 227 ? 22.256 -32.232 -22.789 1.00 19.20 ? 227 ILE B CG1 1 
ATOM   4086 C  CG2 . ILE B 1 227 ? 22.527 -31.203 -25.070 1.00 17.26 ? 227 ILE B CG2 1 
ATOM   4087 C  CD1 . ILE B 1 227 ? 22.387 -30.888 -22.123 1.00 20.82 ? 227 ILE B CD1 1 
ATOM   4088 N  N   . HIS B 1 228 ? 19.707 -30.439 -26.211 1.00 18.28 ? 228 HIS B N   1 
ATOM   4089 C  CA  . HIS B 1 228 ? 19.384 -30.200 -27.618 1.00 17.17 ? 228 HIS B CA  1 
ATOM   4090 C  C   . HIS B 1 228 ? 20.593 -29.479 -28.227 1.00 16.68 ? 228 HIS B C   1 
ATOM   4091 O  O   . HIS B 1 228 ? 20.874 -28.326 -27.887 1.00 15.95 ? 228 HIS B O   1 
ATOM   4092 C  CB  . HIS B 1 228 ? 18.133 -29.309 -27.762 1.00 16.72 ? 228 HIS B CB  1 
ATOM   4093 C  CG  . HIS B 1 228 ? 17.698 -29.086 -29.186 1.00 15.30 ? 228 HIS B CG  1 
ATOM   4094 N  ND1 . HIS B 1 228 ? 16.667 -29.790 -29.771 1.00 15.91 ? 228 HIS B ND1 1 
ATOM   4095 C  CD2 . HIS B 1 228 ? 18.169 -28.254 -30.145 1.00 15.39 ? 228 HIS B CD2 1 
ATOM   4096 C  CE1 . HIS B 1 228 ? 16.524 -29.402 -31.025 1.00 12.88 ? 228 HIS B CE1 1 
ATOM   4097 N  NE2 . HIS B 1 228 ? 17.423 -28.471 -31.279 1.00 9.98  ? 228 HIS B NE2 1 
ATOM   4098 N  N   . LEU B 1 229 ? 21.323 -30.166 -29.100 1.00 17.43 ? 229 LEU B N   1 
ATOM   4099 C  CA  . LEU B 1 229 ? 22.473 -29.554 -29.765 1.00 16.44 ? 229 LEU B CA  1 
ATOM   4100 C  C   . LEU B 1 229 ? 22.083 -29.053 -31.156 1.00 16.80 ? 229 LEU B C   1 
ATOM   4101 O  O   . LEU B 1 229 ? 21.693 -29.844 -32.026 1.00 15.61 ? 229 LEU B O   1 
ATOM   4102 C  CB  . LEU B 1 229 ? 23.641 -30.548 -29.901 1.00 15.92 ? 229 LEU B CB  1 
ATOM   4103 C  CG  . LEU B 1 229 ? 24.853 -30.094 -30.749 1.00 16.31 ? 229 LEU B CG  1 
ATOM   4104 C  CD1 . LEU B 1 229 ? 25.432 -28.794 -30.203 1.00 16.56 ? 229 LEU B CD1 1 
ATOM   4105 C  CD2 . LEU B 1 229 ? 25.931 -31.174 -30.760 1.00 18.60 ? 229 LEU B CD2 1 
ATOM   4106 N  N   . SER B 1 230 ? 22.169 -27.740 -31.357 1.00 16.66 ? 230 SER B N   1 
ATOM   4107 C  CA  . SER B 1 230 ? 21.870 -27.155 -32.660 1.00 15.36 ? 230 SER B CA  1 
ATOM   4108 C  C   . SER B 1 230 ? 23.230 -26.849 -33.282 1.00 16.12 ? 230 SER B C   1 
ATOM   4109 O  O   . SER B 1 230 ? 23.947 -25.954 -32.837 1.00 15.17 ? 230 SER B O   1 
ATOM   4110 C  CB  . SER B 1 230 ? 21.051 -25.878 -32.512 1.00 14.90 ? 230 SER B CB  1 
ATOM   4111 O  OG  . SER B 1 230 ? 20.273 -25.661 -33.674 1.00 14.36 ? 230 SER B OG  1 
ATOM   4112 N  N   . PHE B 1 231 ? 23.576 -27.599 -34.320 1.00 16.45 ? 231 PHE B N   1 
ATOM   4113 C  CA  . PHE B 1 231 ? 24.873 -27.449 -34.964 1.00 16.13 ? 231 PHE B CA  1 
ATOM   4114 C  C   . PHE B 1 231 ? 24.864 -26.828 -36.364 1.00 16.14 ? 231 PHE B C   1 
ATOM   4115 O  O   . PHE B 1 231 ? 24.400 -27.439 -37.330 1.00 15.86 ? 231 PHE B O   1 
ATOM   4116 C  CB  . PHE B 1 231 ? 25.561 -28.827 -34.985 1.00 15.71 ? 231 PHE B CB  1 
ATOM   4117 C  CG  . PHE B 1 231 ? 27.020 -28.784 -35.331 1.00 15.38 ? 231 PHE B CG  1 
ATOM   4118 C  CD1 . PHE B 1 231 ? 27.440 -28.611 -36.653 1.00 16.75 ? 231 PHE B CD1 1 
ATOM   4119 C  CD2 . PHE B 1 231 ? 27.981 -28.923 -34.335 1.00 15.86 ? 231 PHE B CD2 1 
ATOM   4120 C  CE1 . PHE B 1 231 ? 28.798 -28.576 -36.969 1.00 15.66 ? 231 PHE B CE1 1 
ATOM   4121 C  CE2 . PHE B 1 231 ? 29.336 -28.892 -34.642 1.00 14.13 ? 231 PHE B CE2 1 
ATOM   4122 C  CZ  . PHE B 1 231 ? 29.744 -28.717 -35.960 1.00 15.12 ? 231 PHE B CZ  1 
ATOM   4123 N  N   . ASP B 1 232 ? 25.384 -25.604 -36.461 1.00 16.23 ? 232 ASP B N   1 
ATOM   4124 C  CA  . ASP B 1 232 ? 25.478 -24.917 -37.747 1.00 17.74 ? 232 ASP B CA  1 
ATOM   4125 C  C   . ASP B 1 232 ? 26.841 -25.252 -38.336 1.00 19.12 ? 232 ASP B C   1 
ATOM   4126 O  O   . ASP B 1 232 ? 27.873 -24.830 -37.820 1.00 20.96 ? 232 ASP B O   1 
ATOM   4127 C  CB  . ASP B 1 232 ? 25.371 -23.409 -37.584 1.00 15.86 ? 232 ASP B CB  1 
ATOM   4128 C  CG  . ASP B 1 232 ? 25.424 -22.674 -38.913 1.00 16.92 ? 232 ASP B CG  1 
ATOM   4129 O  OD1 . ASP B 1 232 ? 25.890 -23.257 -39.911 1.00 17.13 ? 232 ASP B OD1 1 
ATOM   4130 O  OD2 . ASP B 1 232 ? 25.009 -21.502 -38.962 1.00 16.71 ? 232 ASP B OD2 1 
ATOM   4131 N  N   . VAL B 1 233 ? 26.822 -26.038 -39.406 1.00 19.82 ? 233 VAL B N   1 
ATOM   4132 C  CA  . VAL B 1 233 ? 28.020 -26.462 -40.109 1.00 18.06 ? 233 VAL B CA  1 
ATOM   4133 C  C   . VAL B 1 233 ? 29.084 -25.365 -40.149 1.00 16.68 ? 233 VAL B C   1 
ATOM   4134 O  O   . VAL B 1 233 ? 30.271 -25.647 -40.025 1.00 14.60 ? 233 VAL B O   1 
ATOM   4135 C  CB  . VAL B 1 233 ? 27.623 -26.910 -41.541 1.00 19.28 ? 233 VAL B CB  1 
ATOM   4136 C  CG1 . VAL B 1 233 ? 28.834 -27.090 -42.426 1.00 20.68 ? 233 VAL B CG1 1 
ATOM   4137 C  CG2 . VAL B 1 233 ? 26.835 -28.196 -41.449 1.00 18.53 ? 233 VAL B CG2 1 
ATOM   4138 N  N   . ASP B 1 234 ? 28.658 -24.110 -40.278 1.00 17.87 ? 234 ASP B N   1 
ATOM   4139 C  CA  . ASP B 1 234 ? 29.604 -22.999 -40.360 1.00 18.76 ? 234 ASP B CA  1 
ATOM   4140 C  C   . ASP B 1 234 ? 30.284 -22.595 -39.050 1.00 19.66 ? 234 ASP B C   1 
ATOM   4141 O  O   . ASP B 1 234 ? 30.971 -21.573 -38.986 1.00 20.52 ? 234 ASP B O   1 
ATOM   4142 C  CB  . ASP B 1 234 ? 28.949 -21.774 -41.007 1.00 18.03 ? 234 ASP B CB  1 
ATOM   4143 C  CG  . ASP B 1 234 ? 28.088 -20.978 -40.046 1.00 19.39 ? 234 ASP B CG  1 
ATOM   4144 O  OD1 . ASP B 1 234 ? 28.265 -21.105 -38.811 1.00 17.81 ? 234 ASP B OD1 1 
ATOM   4145 O  OD2 . ASP B 1 234 ? 27.241 -20.196 -40.541 1.00 19.01 ? 234 ASP B OD2 1 
ATOM   4146 N  N   . GLY B 1 235 ? 30.086 -23.403 -38.014 1.00 19.77 ? 235 GLY B N   1 
ATOM   4147 C  CA  . GLY B 1 235 ? 30.713 -23.144 -36.735 1.00 19.13 ? 235 GLY B CA  1 
ATOM   4148 C  C   . GLY B 1 235 ? 32.159 -23.606 -36.785 1.00 18.42 ? 235 GLY B C   1 
ATOM   4149 O  O   . GLY B 1 235 ? 33.002 -23.119 -36.031 1.00 18.88 ? 235 GLY B O   1 
ATOM   4150 N  N   . LEU B 1 236 ? 32.438 -24.564 -37.663 1.00 18.17 ? 236 LEU B N   1 
ATOM   4151 C  CA  . LEU B 1 236 ? 33.796 -25.079 -37.838 1.00 18.56 ? 236 LEU B CA  1 
ATOM   4152 C  C   . LEU B 1 236 ? 34.428 -24.300 -38.998 1.00 17.51 ? 236 LEU B C   1 
ATOM   4153 O  O   . LEU B 1 236 ? 33.706 -23.756 -39.839 1.00 18.40 ? 236 LEU B O   1 
ATOM   4154 C  CB  . LEU B 1 236 ? 33.785 -26.575 -38.174 1.00 18.75 ? 236 LEU B CB  1 
ATOM   4155 C  CG  . LEU B 1 236 ? 33.006 -27.598 -37.338 1.00 19.54 ? 236 LEU B CG  1 
ATOM   4156 C  CD1 . LEU B 1 236 ? 33.513 -28.990 -37.741 1.00 20.66 ? 236 LEU B CD1 1 
ATOM   4157 C  CD2 . LEU B 1 236 ? 33.190 -27.381 -35.834 1.00 17.20 ? 236 LEU B CD2 1 
ATOM   4158 N  N   . ASP B 1 237 ? 35.761 -24.251 -39.037 1.00 17.75 ? 237 ASP B N   1 
ATOM   4159 C  CA  . ASP B 1 237 ? 36.513 -23.533 -40.077 1.00 18.05 ? 237 ASP B CA  1 
ATOM   4160 C  C   . ASP B 1 237 ? 36.144 -23.996 -41.496 1.00 17.66 ? 237 ASP B C   1 
ATOM   4161 O  O   . ASP B 1 237 ? 35.970 -25.191 -41.753 1.00 16.44 ? 237 ASP B O   1 
ATOM   4162 C  CB  . ASP B 1 237 ? 38.025 -23.702 -39.833 1.00 17.54 ? 237 ASP B CB  1 
ATOM   4163 C  CG  . ASP B 1 237 ? 38.888 -22.795 -40.720 1.00 17.17 ? 237 ASP B CG  1 
ATOM   4164 O  OD1 . ASP B 1 237 ? 38.960 -23.028 -41.943 1.00 18.71 ? 237 ASP B OD1 1 
ATOM   4165 O  OD2 . ASP B 1 237 ? 39.500 -21.846 -40.192 1.00 14.68 ? 237 ASP B OD2 1 
ATOM   4166 N  N   . PRO B 1 238 ? 36.006 -23.041 -42.436 1.00 18.32 ? 238 PRO B N   1 
ATOM   4167 C  CA  . PRO B 1 238 ? 35.652 -23.332 -43.832 1.00 17.50 ? 238 PRO B CA  1 
ATOM   4168 C  C   . PRO B 1 238 ? 36.625 -24.255 -44.573 1.00 18.28 ? 238 PRO B C   1 
ATOM   4169 O  O   . PRO B 1 238 ? 36.365 -24.654 -45.714 1.00 16.21 ? 238 PRO B O   1 
ATOM   4170 C  CB  . PRO B 1 238 ? 35.574 -21.944 -44.460 1.00 18.03 ? 238 PRO B CB  1 
ATOM   4171 C  CG  . PRO B 1 238 ? 35.127 -21.093 -43.326 1.00 18.64 ? 238 PRO B CG  1 
ATOM   4172 C  CD  . PRO B 1 238 ? 35.996 -21.588 -42.195 1.00 17.35 ? 238 PRO B CD  1 
ATOM   4173 N  N   . SER B 1 239 ? 37.744 -24.581 -43.928 1.00 17.87 ? 239 SER B N   1 
ATOM   4174 C  CA  . SER B 1 239 ? 38.730 -25.472 -44.526 1.00 17.72 ? 239 SER B CA  1 
ATOM   4175 C  C   . SER B 1 239 ? 38.268 -26.898 -44.248 1.00 18.17 ? 239 SER B C   1 
ATOM   4176 O  O   . SER B 1 239 ? 38.790 -27.863 -44.805 1.00 19.67 ? 239 SER B O   1 
ATOM   4177 C  CB  . SER B 1 239 ? 40.126 -25.223 -43.927 1.00 18.04 ? 239 SER B CB  1 
ATOM   4178 O  OG  . SER B 1 239 ? 40.173 -25.503 -42.535 1.00 17.62 ? 239 SER B OG  1 
ATOM   4179 N  N   . PHE B 1 240 ? 37.271 -27.013 -43.380 1.00 18.34 ? 240 PHE B N   1 
ATOM   4180 C  CA  . PHE B 1 240 ? 36.713 -28.308 -43.019 1.00 19.20 ? 240 PHE B CA  1 
ATOM   4181 C  C   . PHE B 1 240 ? 35.277 -28.449 -43.515 1.00 18.74 ? 240 PHE B C   1 
ATOM   4182 O  O   . PHE B 1 240 ? 34.827 -29.553 -43.803 1.00 20.98 ? 240 PHE B O   1 
ATOM   4183 C  CB  . PHE B 1 240 ? 36.766 -28.500 -41.498 1.00 17.79 ? 240 PHE B CB  1 
ATOM   4184 C  CG  . PHE B 1 240 ? 38.162 -28.606 -40.953 1.00 17.89 ? 240 PHE B CG  1 
ATOM   4185 C  CD1 . PHE B 1 240 ? 38.905 -29.765 -41.137 1.00 17.02 ? 240 PHE B CD1 1 
ATOM   4186 C  CD2 . PHE B 1 240 ? 38.740 -27.540 -40.278 1.00 18.16 ? 240 PHE B CD2 1 
ATOM   4187 C  CE1 . PHE B 1 240 ? 40.201 -29.860 -40.657 1.00 17.94 ? 240 PHE B CE1 1 
ATOM   4188 C  CE2 . PHE B 1 240 ? 40.041 -27.621 -39.792 1.00 17.55 ? 240 PHE B CE2 1 
ATOM   4189 C  CZ  . PHE B 1 240 ? 40.773 -28.784 -39.982 1.00 18.66 ? 240 PHE B CZ  1 
ATOM   4190 N  N   . THR B 1 241 ? 34.565 -27.331 -43.617 1.00 18.72 ? 241 THR B N   1 
ATOM   4191 C  CA  . THR B 1 241 ? 33.167 -27.332 -44.074 1.00 18.11 ? 241 THR B CA  1 
ATOM   4192 C  C   . THR B 1 241 ? 32.855 -26.115 -44.982 1.00 17.66 ? 241 THR B C   1 
ATOM   4193 O  O   . THR B 1 241 ? 31.915 -25.333 -44.717 1.00 14.82 ? 241 THR B O   1 
ATOM   4194 C  CB  . THR B 1 241 ? 32.206 -27.343 -42.852 1.00 18.80 ? 241 THR B CB  1 
ATOM   4195 O  OG1 . THR B 1 241 ? 32.566 -26.290 -41.943 1.00 19.91 ? 241 THR B OG1 1 
ATOM   4196 C  CG2 . THR B 1 241 ? 32.291 -28.675 -42.117 1.00 18.40 ? 241 THR B CG2 1 
ATOM   4197 N  N   . PRO B 1 242 ? 33.629 -25.963 -46.077 1.00 18.17 ? 242 PRO B N   1 
ATOM   4198 C  CA  . PRO B 1 242 ? 33.527 -24.884 -47.070 1.00 18.69 ? 242 PRO B CA  1 
ATOM   4199 C  C   . PRO B 1 242 ? 32.183 -24.656 -47.758 1.00 17.73 ? 242 PRO B C   1 
ATOM   4200 O  O   . PRO B 1 242 ? 31.864 -23.527 -48.115 1.00 18.23 ? 242 PRO B O   1 
ATOM   4201 C  CB  . PRO B 1 242 ? 34.639 -25.226 -48.069 1.00 18.65 ? 242 PRO B CB  1 
ATOM   4202 C  CG  . PRO B 1 242 ? 34.694 -26.718 -48.013 1.00 18.40 ? 242 PRO B CG  1 
ATOM   4203 C  CD  . PRO B 1 242 ? 34.625 -26.963 -46.515 1.00 19.01 ? 242 PRO B CD  1 
ATOM   4204 N  N   . ALA B 1 243 ? 31.403 -25.716 -47.940 1.00 17.32 ? 243 ALA B N   1 
ATOM   4205 C  CA  . ALA B 1 243 ? 30.104 -25.609 -48.595 1.00 15.60 ? 243 ALA B CA  1 
ATOM   4206 C  C   . ALA B 1 243 ? 28.997 -25.199 -47.621 1.00 14.06 ? 243 ALA B C   1 
ATOM   4207 O  O   . ALA B 1 243 ? 28.168 -26.014 -47.224 1.00 11.48 ? 243 ALA B O   1 
ATOM   4208 C  CB  . ALA B 1 243 ? 29.746 -26.944 -49.280 1.00 17.32 ? 243 ALA B CB  1 
ATOM   4209 N  N   . THR B 1 244 ? 28.998 -23.921 -47.259 1.00 13.65 ? 244 THR B N   1 
ATOM   4210 C  CA  . THR B 1 244 ? 28.016 -23.356 -46.346 1.00 14.84 ? 244 THR B CA  1 
ATOM   4211 C  C   . THR B 1 244 ? 27.763 -21.884 -46.748 1.00 14.57 ? 244 THR B C   1 
ATOM   4212 O  O   . THR B 1 244 ? 28.667 -21.209 -47.247 1.00 14.86 ? 244 THR B O   1 
ATOM   4213 C  CB  . THR B 1 244 ? 28.516 -23.478 -44.854 1.00 13.24 ? 244 THR B CB  1 
ATOM   4214 O  OG1 . THR B 1 244 ? 27.388 -23.573 -43.974 1.00 11.71 ? 244 THR B OG1 1 
ATOM   4215 C  CG2 . THR B 1 244 ? 29.376 -22.279 -44.461 1.00 13.59 ? 244 THR B CG2 1 
ATOM   4216 N  N   . GLY B 1 245 ? 26.533 -21.405 -46.535 1.00 16.93 ? 245 GLY B N   1 
ATOM   4217 C  CA  . GLY B 1 245 ? 26.155 -20.045 -46.904 1.00 16.31 ? 245 GLY B CA  1 
ATOM   4218 C  C   . GLY B 1 245 ? 26.936 -18.856 -46.359 1.00 19.07 ? 245 GLY B C   1 
ATOM   4219 O  O   . GLY B 1 245 ? 27.213 -17.901 -47.086 1.00 19.02 ? 245 GLY B O   1 
ATOM   4220 N  N   . THR B 1 246 ? 27.285 -18.891 -45.079 1.00 20.06 ? 246 THR B N   1 
ATOM   4221 C  CA  . THR B 1 246 ? 28.017 -17.780 -44.472 1.00 20.80 ? 246 THR B CA  1 
ATOM   4222 C  C   . THR B 1 246 ? 29.240 -18.242 -43.680 1.00 20.54 ? 246 THR B C   1 
ATOM   4223 O  O   . THR B 1 246 ? 29.201 -18.324 -42.457 1.00 21.75 ? 246 THR B O   1 
ATOM   4224 C  CB  . THR B 1 246 ? 27.097 -16.977 -43.532 1.00 20.41 ? 246 THR B CB  1 
ATOM   4225 O  OG1 . THR B 1 246 ? 26.604 -17.845 -42.509 1.00 19.69 ? 246 THR B OG1 1 
ATOM   4226 C  CG2 . THR B 1 246 ? 25.903 -16.409 -44.294 1.00 18.56 ? 246 THR B CG2 1 
ATOM   4227 N  N   . PRO B 1 247 ? 30.343 -18.558 -44.376 1.00 20.01 ? 247 PRO B N   1 
ATOM   4228 C  CA  . PRO B 1 247 ? 31.567 -19.009 -43.705 1.00 20.03 ? 247 PRO B CA  1 
ATOM   4229 C  C   . PRO B 1 247 ? 32.348 -17.894 -43.001 1.00 19.84 ? 247 PRO B C   1 
ATOM   4230 O  O   . PRO B 1 247 ? 32.299 -16.733 -43.407 1.00 18.84 ? 247 PRO B O   1 
ATOM   4231 C  CB  . PRO B 1 247 ? 32.361 -19.660 -44.838 1.00 20.16 ? 247 PRO B CB  1 
ATOM   4232 C  CG  . PRO B 1 247 ? 31.916 -18.905 -46.041 1.00 20.26 ? 247 PRO B CG  1 
ATOM   4233 C  CD  . PRO B 1 247 ? 30.435 -18.773 -45.831 1.00 20.26 ? 247 PRO B CD  1 
ATOM   4234 N  N   . VAL B 1 248 ? 33.062 -18.256 -41.938 1.00 18.27 ? 248 VAL B N   1 
ATOM   4235 C  CA  . VAL B 1 248 ? 33.848 -17.292 -41.178 1.00 17.61 ? 248 VAL B CA  1 
ATOM   4236 C  C   . VAL B 1 248 ? 35.198 -17.920 -40.839 1.00 18.86 ? 248 VAL B C   1 
ATOM   4237 O  O   . VAL B 1 248 ? 35.266 -19.074 -40.398 1.00 19.22 ? 248 VAL B O   1 
ATOM   4238 C  CB  . VAL B 1 248 ? 33.121 -16.886 -39.859 1.00 16.66 ? 248 VAL B CB  1 
ATOM   4239 C  CG1 . VAL B 1 248 ? 33.777 -15.655 -39.250 1.00 13.90 ? 248 VAL B CG1 1 
ATOM   4240 C  CG2 . VAL B 1 248 ? 31.653 -16.635 -40.133 1.00 14.03 ? 248 VAL B CG2 1 
ATOM   4241 N  N   . VAL B 1 249 ? 36.272 -17.165 -41.061 1.00 18.25 ? 249 VAL B N   1 
ATOM   4242 C  CA  . VAL B 1 249 ? 37.620 -17.647 -40.779 1.00 17.20 ? 249 VAL B CA  1 
ATOM   4243 C  C   . VAL B 1 249 ? 37.869 -17.713 -39.285 1.00 17.07 ? 249 VAL B C   1 
ATOM   4244 O  O   . VAL B 1 249 ? 37.211 -17.019 -38.504 1.00 16.65 ? 249 VAL B O   1 
ATOM   4245 C  CB  . VAL B 1 249 ? 38.679 -16.732 -41.384 1.00 16.20 ? 249 VAL B CB  1 
ATOM   4246 C  CG1 . VAL B 1 249 ? 38.522 -16.691 -42.892 1.00 17.65 ? 249 VAL B CG1 1 
ATOM   4247 C  CG2 . VAL B 1 249 ? 38.556 -15.352 -40.787 1.00 17.12 ? 249 VAL B CG2 1 
ATOM   4248 N  N   . GLY B 1 250 ? 38.835 -18.545 -38.903 1.00 16.04 ? 250 GLY B N   1 
ATOM   4249 C  CA  . GLY B 1 250 ? 39.174 -18.713 -37.501 1.00 16.63 ? 250 GLY B CA  1 
ATOM   4250 C  C   . GLY B 1 250 ? 38.154 -19.541 -36.731 1.00 15.64 ? 250 GLY B C   1 
ATOM   4251 O  O   . GLY B 1 250 ? 37.933 -19.298 -35.552 1.00 15.50 ? 250 GLY B O   1 
ATOM   4252 N  N   . GLY B 1 251 ? 37.542 -20.527 -37.385 1.00 15.74 ? 251 GLY B N   1 
ATOM   4253 C  CA  . GLY B 1 251 ? 36.545 -21.353 -36.720 1.00 15.35 ? 251 GLY B CA  1 
ATOM   4254 C  C   . GLY B 1 251 ? 37.059 -22.574 -35.973 1.00 15.12 ? 251 GLY B C   1 
ATOM   4255 O  O   . GLY B 1 251 ? 38.255 -22.720 -35.746 1.00 11.50 ? 251 GLY B O   1 
ATOM   4256 N  N   . LEU B 1 252 ? 36.138 -23.459 -35.595 1.00 15.09 ? 252 LEU B N   1 
ATOM   4257 C  CA  . LEU B 1 252 ? 36.485 -24.677 -34.874 1.00 14.84 ? 252 LEU B CA  1 
ATOM   4258 C  C   . LEU B 1 252 ? 37.156 -25.728 -35.777 1.00 16.25 ? 252 LEU B C   1 
ATOM   4259 O  O   . LEU B 1 252 ? 36.763 -25.946 -36.934 1.00 15.94 ? 252 LEU B O   1 
ATOM   4260 C  CB  . LEU B 1 252 ? 35.231 -25.272 -34.222 1.00 14.56 ? 252 LEU B CB  1 
ATOM   4261 C  CG  . LEU B 1 252 ? 34.498 -24.463 -33.149 1.00 10.86 ? 252 LEU B CG  1 
ATOM   4262 C  CD1 . LEU B 1 252 ? 33.042 -24.879 -33.136 1.00 13.02 ? 252 LEU B CD1 1 
ATOM   4263 C  CD2 . LEU B 1 252 ? 35.128 -24.673 -31.793 1.00 10.11 ? 252 LEU B CD2 1 
ATOM   4264 N  N   . THR B 1 253 ? 38.170 -26.384 -35.225 1.00 15.35 ? 253 THR B N   1 
ATOM   4265 C  CA  . THR B 1 253 ? 38.916 -27.403 -35.944 1.00 16.26 ? 253 THR B CA  1 
ATOM   4266 C  C   . THR B 1 253 ? 38.082 -28.664 -36.141 1.00 14.44 ? 253 THR B C   1 
ATOM   4267 O  O   . THR B 1 253 ? 37.041 -28.821 -35.512 1.00 10.86 ? 253 THR B O   1 
ATOM   4268 C  CB  . THR B 1 253 ? 40.194 -27.774 -35.171 1.00 17.60 ? 253 THR B CB  1 
ATOM   4269 O  OG1 . THR B 1 253 ? 40.930 -26.576 -34.865 1.00 19.98 ? 253 THR B OG1 1 
ATOM   4270 C  CG2 . THR B 1 253 ? 41.066 -28.697 -36.008 1.00 20.51 ? 253 THR B CG2 1 
ATOM   4271 N  N   . TYR B 1 254 ? 38.544 -29.551 -37.025 1.00 14.64 ? 254 TYR B N   1 
ATOM   4272 C  CA  . TYR B 1 254 ? 37.853 -30.817 -37.279 1.00 13.18 ? 254 TYR B CA  1 
ATOM   4273 C  C   . TYR B 1 254 ? 37.868 -31.585 -35.962 1.00 13.13 ? 254 TYR B C   1 
ATOM   4274 O  O   . TYR B 1 254 ? 36.848 -32.098 -35.508 1.00 11.52 ? 254 TYR B O   1 
ATOM   4275 C  CB  . TYR B 1 254 ? 38.595 -31.635 -38.334 1.00 12.08 ? 254 TYR B CB  1 
ATOM   4276 C  CG  . TYR B 1 254 ? 37.892 -32.916 -38.739 1.00 14.64 ? 254 TYR B CG  1 
ATOM   4277 C  CD1 . TYR B 1 254 ? 37.018 -32.939 -39.831 1.00 16.92 ? 254 TYR B CD1 1 
ATOM   4278 C  CD2 . TYR B 1 254 ? 38.115 -34.112 -38.047 1.00 14.73 ? 254 TYR B CD2 1 
ATOM   4279 C  CE1 . TYR B 1 254 ? 36.384 -34.129 -40.230 1.00 17.92 ? 254 TYR B CE1 1 
ATOM   4280 C  CE2 . TYR B 1 254 ? 37.487 -35.304 -38.438 1.00 16.00 ? 254 TYR B CE2 1 
ATOM   4281 C  CZ  . TYR B 1 254 ? 36.626 -35.302 -39.530 1.00 17.55 ? 254 TYR B CZ  1 
ATOM   4282 O  OH  . TYR B 1 254 ? 36.029 -36.472 -39.940 1.00 17.89 ? 254 TYR B OH  1 
ATOM   4283 N  N   . ARG B 1 255 ? 39.057 -31.665 -35.369 1.00 13.92 ? 255 ARG B N   1 
ATOM   4284 C  CA  . ARG B 1 255 ? 39.256 -32.340 -34.096 1.00 13.24 ? 255 ARG B CA  1 
ATOM   4285 C  C   . ARG B 1 255 ? 38.345 -31.764 -33.015 1.00 13.33 ? 255 ARG B C   1 
ATOM   4286 O  O   . ARG B 1 255 ? 37.745 -32.524 -32.260 1.00 13.93 ? 255 ARG B O   1 
ATOM   4287 C  CB  . ARG B 1 255 ? 40.715 -32.218 -33.665 1.00 14.52 ? 255 ARG B CB  1 
ATOM   4288 C  CG  . ARG B 1 255 ? 41.674 -33.024 -34.523 1.00 12.19 ? 255 ARG B CG  1 
ATOM   4289 C  CD  . ARG B 1 255 ? 43.128 -32.596 -34.302 1.00 12.79 ? 255 ARG B CD  1 
ATOM   4290 N  NE  . ARG B 1 255 ? 43.512 -32.540 -32.892 1.00 11.91 ? 255 ARG B NE  1 
ATOM   4291 C  CZ  . ARG B 1 255 ? 44.760 -32.340 -32.467 1.00 9.96  ? 255 ARG B CZ  1 
ATOM   4292 N  NH1 . ARG B 1 255 ? 45.743 -32.189 -33.342 1.00 8.95  ? 255 ARG B NH1 1 
ATOM   4293 N  NH2 . ARG B 1 255 ? 45.021 -32.260 -31.170 1.00 8.84  ? 255 ARG B NH2 1 
ATOM   4294 N  N   . GLU B 1 256 ? 38.248 -30.434 -32.934 1.00 12.05 ? 256 GLU B N   1 
ATOM   4295 C  CA  . GLU B 1 256 ? 37.379 -29.792 -31.942 1.00 11.14 ? 256 GLU B CA  1 
ATOM   4296 C  C   . GLU B 1 256 ? 35.912 -30.087 -32.249 1.00 11.30 ? 256 GLU B C   1 
ATOM   4297 O  O   . GLU B 1 256 ? 35.072 -30.115 -31.343 1.00 12.04 ? 256 GLU B O   1 
ATOM   4298 C  CB  . GLU B 1 256 ? 37.590 -28.265 -31.916 1.00 11.36 ? 256 GLU B CB  1 
ATOM   4299 C  CG  . GLU B 1 256 ? 38.926 -27.839 -31.356 1.00 13.46 ? 256 GLU B CG  1 
ATOM   4300 C  CD  . GLU B 1 256 ? 39.211 -26.361 -31.543 1.00 14.21 ? 256 GLU B CD  1 
ATOM   4301 O  OE1 . GLU B 1 256 ? 38.657 -25.770 -32.484 1.00 13.25 ? 256 GLU B OE1 1 
ATOM   4302 O  OE2 . GLU B 1 256 ? 40.012 -25.794 -30.761 1.00 14.87 ? 256 GLU B OE2 1 
ATOM   4303 N  N   . GLY B 1 257 ? 35.603 -30.287 -33.527 1.00 11.09 ? 257 GLY B N   1 
ATOM   4304 C  CA  . GLY B 1 257 ? 34.235 -30.585 -33.915 1.00 12.10 ? 257 GLY B CA  1 
ATOM   4305 C  C   . GLY B 1 257 ? 33.856 -31.916 -33.299 1.00 12.63 ? 257 GLY B C   1 
ATOM   4306 O  O   . GLY B 1 257 ? 32.768 -32.080 -32.733 1.00 13.76 ? 257 GLY B O   1 
ATOM   4307 N  N   . LEU B 1 258 ? 34.774 -32.871 -33.406 1.00 11.90 ? 258 LEU B N   1 
ATOM   4308 C  CA  . LEU B 1 258 ? 34.574 -34.196 -32.846 1.00 10.65 ? 258 LEU B CA  1 
ATOM   4309 C  C   . LEU B 1 258 ? 34.607 -34.138 -31.315 1.00 11.24 ? 258 LEU B C   1 
ATOM   4310 O  O   . LEU B 1 258 ? 33.895 -34.885 -30.660 1.00 11.99 ? 258 LEU B O   1 
ATOM   4311 C  CB  . LEU B 1 258 ? 35.655 -35.163 -33.356 1.00 10.24 ? 258 LEU B CB  1 
ATOM   4312 C  CG  . LEU B 1 258 ? 35.807 -35.365 -34.872 1.00 11.79 ? 258 LEU B CG  1 
ATOM   4313 C  CD1 . LEU B 1 258 ? 36.861 -36.434 -35.153 1.00 14.90 ? 258 LEU B CD1 1 
ATOM   4314 C  CD2 . LEU B 1 258 ? 34.483 -35.773 -35.472 1.00 12.78 ? 258 LEU B CD2 1 
ATOM   4315 N  N   . TYR B 1 259 ? 35.416 -33.255 -30.733 1.00 11.68 ? 259 TYR B N   1 
ATOM   4316 C  CA  . TYR B 1 259 ? 35.475 -33.197 -29.274 1.00 12.19 ? 259 TYR B CA  1 
ATOM   4317 C  C   . TYR B 1 259 ? 34.159 -32.747 -28.639 1.00 12.94 ? 259 TYR B C   1 
ATOM   4318 O  O   . TYR B 1 259 ? 33.698 -33.339 -27.656 1.00 12.25 ? 259 TYR B O   1 
ATOM   4319 C  CB  . TYR B 1 259 ? 36.607 -32.277 -28.783 1.00 12.85 ? 259 TYR B CB  1 
ATOM   4320 C  CG  . TYR B 1 259 ? 36.879 -32.475 -27.306 1.00 11.99 ? 259 TYR B CG  1 
ATOM   4321 C  CD1 . TYR B 1 259 ? 37.638 -33.558 -26.858 1.00 10.95 ? 259 TYR B CD1 1 
ATOM   4322 C  CD2 . TYR B 1 259 ? 36.269 -31.666 -26.352 1.00 11.65 ? 259 TYR B CD2 1 
ATOM   4323 C  CE1 . TYR B 1 259 ? 37.771 -33.836 -25.494 1.00 10.58 ? 259 TYR B CE1 1 
ATOM   4324 C  CE2 . TYR B 1 259 ? 36.391 -31.936 -24.986 1.00 10.71 ? 259 TYR B CE2 1 
ATOM   4325 C  CZ  . TYR B 1 259 ? 37.137 -33.022 -24.564 1.00 10.08 ? 259 TYR B CZ  1 
ATOM   4326 O  OH  . TYR B 1 259 ? 37.216 -33.322 -23.217 1.00 8.93  ? 259 TYR B OH  1 
ATOM   4327 N  N   . ILE B 1 260 ? 33.566 -31.691 -29.194 1.00 12.84 ? 260 ILE B N   1 
ATOM   4328 C  CA  . ILE B 1 260 ? 32.308 -31.160 -28.685 1.00 11.69 ? 260 ILE B CA  1 
ATOM   4329 C  C   . ILE B 1 260 ? 31.304 -32.282 -28.604 1.00 11.24 ? 260 ILE B C   1 
ATOM   4330 O  O   . ILE B 1 260 ? 30.777 -32.584 -27.548 1.00 10.73 ? 260 ILE B O   1 
ATOM   4331 C  CB  . ILE B 1 260 ? 31.700 -30.070 -29.623 1.00 12.72 ? 260 ILE B CB  1 
ATOM   4332 C  CG1 . ILE B 1 260 ? 32.688 -28.907 -29.811 1.00 12.16 ? 260 ILE B CG1 1 
ATOM   4333 C  CG2 . ILE B 1 260 ? 30.339 -29.604 -29.065 1.00 11.23 ? 260 ILE B CG2 1 
ATOM   4334 C  CD1 . ILE B 1 260 ? 33.189 -28.312 -28.533 1.00 16.68 ? 260 ILE B CD1 1 
ATOM   4335 N  N   . THR B 1 261 ? 31.066 -32.903 -29.749 1.00 12.84 ? 261 THR B N   1 
ATOM   4336 C  CA  . THR B 1 261 ? 30.099 -33.981 -29.891 1.00 13.73 ? 261 THR B CA  1 
ATOM   4337 C  C   . THR B 1 261 ? 30.368 -35.292 -29.132 1.00 14.02 ? 261 THR B C   1 
ATOM   4338 O  O   . THR B 1 261 ? 29.430 -35.908 -28.640 1.00 14.51 ? 261 THR B O   1 
ATOM   4339 C  CB  . THR B 1 261 ? 29.871 -34.270 -31.400 1.00 14.06 ? 261 THR B CB  1 
ATOM   4340 O  OG1 . THR B 1 261 ? 31.134 -34.435 -32.059 1.00 13.94 ? 261 THR B OG1 1 
ATOM   4341 C  CG2 . THR B 1 261 ? 29.117 -33.114 -32.054 1.00 13.54 ? 261 THR B CG2 1 
ATOM   4342 N  N   . GLU B 1 262 ? 31.623 -35.725 -29.044 1.00 14.93 ? 262 GLU B N   1 
ATOM   4343 C  CA  . GLU B 1 262 ? 31.952 -36.952 -28.307 1.00 16.14 ? 262 GLU B CA  1 
ATOM   4344 C  C   . GLU B 1 262 ? 31.649 -36.754 -26.817 1.00 15.70 ? 262 GLU B C   1 
ATOM   4345 O  O   . GLU B 1 262 ? 31.257 -37.695 -26.131 1.00 16.88 ? 262 GLU B O   1 
ATOM   4346 C  CB  . GLU B 1 262 ? 33.440 -37.332 -28.480 1.00 17.04 ? 262 GLU B CB  1 
ATOM   4347 C  CG  . GLU B 1 262 ? 33.867 -37.650 -29.927 1.00 18.15 ? 262 GLU B CG  1 
ATOM   4348 C  CD  . GLU B 1 262 ? 35.340 -38.041 -30.062 1.00 16.94 ? 262 GLU B CD  1 
ATOM   4349 O  OE1 . GLU B 1 262 ? 36.169 -37.498 -29.296 1.00 15.87 ? 262 GLU B OE1 1 
ATOM   4350 O  OE2 . GLU B 1 262 ? 35.672 -38.872 -30.937 1.00 14.37 ? 262 GLU B OE2 1 
ATOM   4351 N  N   . GLU B 1 263 ? 31.812 -35.524 -26.326 1.00 15.42 ? 263 GLU B N   1 
ATOM   4352 C  CA  . GLU B 1 263 ? 31.570 -35.207 -24.913 1.00 15.09 ? 263 GLU B CA  1 
ATOM   4353 C  C   . GLU B 1 263 ? 30.101 -34.985 -24.586 1.00 16.07 ? 263 GLU B C   1 
ATOM   4354 O  O   . GLU B 1 263 ? 29.671 -35.192 -23.451 1.00 17.01 ? 263 GLU B O   1 
ATOM   4355 C  CB  . GLU B 1 263 ? 32.385 -33.976 -24.500 1.00 15.99 ? 263 GLU B CB  1 
ATOM   4356 C  CG  . GLU B 1 263 ? 33.895 -34.186 -24.567 1.00 18.08 ? 263 GLU B CG  1 
ATOM   4357 C  CD  . GLU B 1 263 ? 34.423 -35.165 -23.521 1.00 17.07 ? 263 GLU B CD  1 
ATOM   4358 O  OE1 . GLU B 1 263 ? 34.168 -34.943 -22.325 1.00 17.35 ? 263 GLU B OE1 1 
ATOM   4359 O  OE2 . GLU B 1 263 ? 35.105 -36.147 -23.885 1.00 20.30 ? 263 GLU B OE2 1 
ATOM   4360 N  N   . ILE B 1 264 ? 29.337 -34.537 -25.574 1.00 16.32 ? 264 ILE B N   1 
ATOM   4361 C  CA  . ILE B 1 264 ? 27.914 -34.331 -25.393 1.00 15.02 ? 264 ILE B CA  1 
ATOM   4362 C  C   . ILE B 1 264 ? 27.306 -35.742 -25.434 1.00 16.33 ? 264 ILE B C   1 
ATOM   4363 O  O   . ILE B 1 264 ? 26.339 -36.053 -24.726 1.00 15.47 ? 264 ILE B O   1 
ATOM   4364 C  CB  . ILE B 1 264 ? 27.346 -33.447 -26.533 1.00 15.12 ? 264 ILE B CB  1 
ATOM   4365 C  CG1 . ILE B 1 264 ? 27.885 -32.019 -26.393 1.00 13.89 ? 264 ILE B CG1 1 
ATOM   4366 C  CG2 . ILE B 1 264 ? 25.823 -33.456 -26.505 1.00 15.96 ? 264 ILE B CG2 1 
ATOM   4367 C  CD1 . ILE B 1 264 ? 27.448 -31.080 -27.505 1.00 14.92 ? 264 ILE B CD1 1 
ATOM   4368 N  N   . TYR B 1 265 ? 27.894 -36.599 -26.262 1.00 15.81 ? 265 TYR B N   1 
ATOM   4369 C  CA  . TYR B 1 265 ? 27.441 -37.977 -26.387 1.00 16.09 ? 265 TYR B CA  1 
ATOM   4370 C  C   . TYR B 1 265 ? 27.651 -38.738 -25.071 1.00 17.05 ? 265 TYR B C   1 
ATOM   4371 O  O   . TYR B 1 265 ? 26.769 -39.462 -24.598 1.00 18.80 ? 265 TYR B O   1 
ATOM   4372 C  CB  . TYR B 1 265 ? 28.211 -38.701 -27.497 1.00 17.16 ? 265 TYR B CB  1 
ATOM   4373 C  CG  . TYR B 1 265 ? 28.056 -40.202 -27.400 1.00 19.85 ? 265 TYR B CG  1 
ATOM   4374 C  CD1 . TYR B 1 265 ? 26.823 -40.808 -27.640 1.00 20.33 ? 265 TYR B CD1 1 
ATOM   4375 C  CD2 . TYR B 1 265 ? 29.108 -41.003 -26.964 1.00 19.20 ? 265 TYR B CD2 1 
ATOM   4376 C  CE1 . TYR B 1 265 ? 26.636 -42.173 -27.443 1.00 20.66 ? 265 TYR B CE1 1 
ATOM   4377 C  CE2 . TYR B 1 265 ? 28.935 -42.371 -26.764 1.00 21.10 ? 265 TYR B CE2 1 
ATOM   4378 C  CZ  . TYR B 1 265 ? 27.693 -42.947 -27.006 1.00 21.66 ? 265 TYR B CZ  1 
ATOM   4379 O  OH  . TYR B 1 265 ? 27.511 -44.296 -26.827 1.00 26.12 ? 265 TYR B OH  1 
ATOM   4380 N  N   . LYS B 1 266 ? 28.830 -38.571 -24.486 1.00 17.99 ? 266 LYS B N   1 
ATOM   4381 C  CA  . LYS B 1 266 ? 29.166 -39.262 -23.251 1.00 20.43 ? 266 LYS B CA  1 
ATOM   4382 C  C   . LYS B 1 266 ? 28.326 -38.849 -22.031 1.00 20.34 ? 266 LYS B C   1 
ATOM   4383 O  O   . LYS B 1 266 ? 28.318 -39.554 -21.023 1.00 19.76 ? 266 LYS B O   1 
ATOM   4384 C  CB  . LYS B 1 266 ? 30.678 -39.113 -22.990 1.00 21.88 ? 266 LYS B CB  1 
ATOM   4385 C  CG  . LYS B 1 266 ? 31.563 -39.874 -24.027 1.00 22.85 ? 266 LYS B CG  1 
ATOM   4386 C  CD  . LYS B 1 266 ? 32.987 -39.321 -24.123 1.00 23.48 ? 266 LYS B CD  1 
ATOM   4387 C  CE  . LYS B 1 266 ? 33.710 -39.406 -22.791 1.00 23.39 ? 266 LYS B CE  1 
ATOM   4388 N  NZ  . LYS B 1 266 ? 34.750 -38.355 -22.616 1.00 25.26 ? 266 LYS B NZ  1 
ATOM   4389 N  N   . THR B 1 267 ? 27.612 -37.727 -22.118 1.00 19.75 ? 267 THR B N   1 
ATOM   4390 C  CA  . THR B 1 267 ? 26.754 -37.294 -21.009 1.00 21.20 ? 267 THR B CA  1 
ATOM   4391 C  C   . THR B 1 267 ? 25.510 -38.198 -20.983 1.00 22.33 ? 267 THR B C   1 
ATOM   4392 O  O   . THR B 1 267 ? 24.986 -38.540 -19.922 1.00 21.29 ? 267 THR B O   1 
ATOM   4393 C  CB  . THR B 1 267 ? 26.263 -35.824 -21.172 1.00 19.98 ? 267 THR B CB  1 
ATOM   4394 O  OG1 . THR B 1 267 ? 25.257 -35.750 -22.199 1.00 18.48 ? 267 THR B OG1 1 
ATOM   4395 C  CG2 . THR B 1 267 ? 27.424 -34.913 -21.518 1.00 18.08 ? 267 THR B CG2 1 
ATOM   4396 N  N   . GLY B 1 268 ? 25.046 -38.562 -22.175 1.00 23.08 ? 268 GLY B N   1 
ATOM   4397 C  CA  . GLY B 1 268 ? 23.879 -39.413 -22.308 1.00 23.50 ? 268 GLY B CA  1 
ATOM   4398 C  C   . GLY B 1 268 ? 22.576 -38.660 -22.131 1.00 22.82 ? 268 GLY B C   1 
ATOM   4399 O  O   . GLY B 1 268 ? 21.554 -39.253 -21.766 1.00 23.53 ? 268 GLY B O   1 
ATOM   4400 N  N   . LEU B 1 269 ? 22.599 -37.357 -22.398 1.00 21.26 ? 269 LEU B N   1 
ATOM   4401 C  CA  . LEU B 1 269 ? 21.401 -36.542 -22.236 1.00 20.62 ? 269 LEU B CA  1 
ATOM   4402 C  C   . LEU B 1 269 ? 20.848 -35.926 -23.515 1.00 20.77 ? 269 LEU B C   1 
ATOM   4403 O  O   . LEU B 1 269 ? 19.893 -35.148 -23.480 1.00 18.89 ? 269 LEU B O   1 
ATOM   4404 C  CB  . LEU B 1 269 ? 21.654 -35.449 -21.192 1.00 19.49 ? 269 LEU B CB  1 
ATOM   4405 C  CG  . LEU B 1 269 ? 21.388 -35.898 -19.754 1.00 19.34 ? 269 LEU B CG  1 
ATOM   4406 C  CD1 . LEU B 1 269 ? 21.879 -34.852 -18.787 1.00 20.00 ? 269 LEU B CD1 1 
ATOM   4407 C  CD2 . LEU B 1 269 ? 19.894 -36.142 -19.576 1.00 19.97 ? 269 LEU B CD2 1 
ATOM   4408 N  N   . LEU B 1 270 ? 21.436 -36.289 -24.646 1.00 21.29 ? 270 LEU B N   1 
ATOM   4409 C  CA  . LEU B 1 270 ? 20.968 -35.764 -25.922 1.00 21.74 ? 270 LEU B CA  1 
ATOM   4410 C  C   . LEU B 1 270 ? 19.527 -36.197 -26.217 1.00 22.75 ? 270 LEU B C   1 
ATOM   4411 O  O   . LEU B 1 270 ? 19.141 -37.345 -25.968 1.00 22.30 ? 270 LEU B O   1 
ATOM   4412 C  CB  . LEU B 1 270 ? 21.890 -36.226 -27.051 1.00 18.88 ? 270 LEU B CB  1 
ATOM   4413 C  CG  . LEU B 1 270 ? 21.709 -35.516 -28.393 1.00 15.76 ? 270 LEU B CG  1 
ATOM   4414 C  CD1 . LEU B 1 270 ? 21.908 -34.014 -28.205 1.00 15.30 ? 270 LEU B CD1 1 
ATOM   4415 C  CD2 . LEU B 1 270 ? 22.690 -36.088 -29.403 1.00 11.51 ? 270 LEU B CD2 1 
ATOM   4416 N  N   . SER B 1 271 ? 18.730 -35.262 -26.726 1.00 23.45 ? 271 SER B N   1 
ATOM   4417 C  CA  . SER B 1 271 ? 17.340 -35.535 -27.077 1.00 24.40 ? 271 SER B CA  1 
ATOM   4418 C  C   . SER B 1 271 ? 17.102 -35.023 -28.491 1.00 24.08 ? 271 SER B C   1 
ATOM   4419 O  O   . SER B 1 271 ? 16.383 -35.642 -29.275 1.00 25.36 ? 271 SER B O   1 
ATOM   4420 C  CB  . SER B 1 271 ? 16.375 -34.837 -26.105 1.00 26.28 ? 271 SER B CB  1 
ATOM   4421 O  OG  . SER B 1 271 ? 16.203 -35.547 -24.892 1.00 28.36 ? 271 SER B OG  1 
ATOM   4422 N  N   . GLY B 1 272 ? 17.714 -33.888 -28.811 1.00 24.47 ? 272 GLY B N   1 
ATOM   4423 C  CA  . GLY B 1 272 ? 17.573 -33.304 -30.134 1.00 22.95 ? 272 GLY B CA  1 
ATOM   4424 C  C   . GLY B 1 272 ? 18.928 -32.950 -30.726 1.00 22.68 ? 272 GLY B C   1 
ATOM   4425 O  O   . GLY B 1 272 ? 19.840 -32.548 -30.002 1.00 22.45 ? 272 GLY B O   1 
ATOM   4426 N  N   . LEU B 1 273 ? 19.059 -33.099 -32.044 1.00 23.08 ? 273 LEU B N   1 
ATOM   4427 C  CA  . LEU B 1 273 ? 20.309 -32.805 -32.756 1.00 21.96 ? 273 LEU B CA  1 
ATOM   4428 C  C   . LEU B 1 273 ? 19.975 -32.234 -34.135 1.00 22.46 ? 273 LEU B C   1 
ATOM   4429 O  O   . LEU B 1 273 ? 19.258 -32.865 -34.915 1.00 24.98 ? 273 LEU B O   1 
ATOM   4430 C  CB  . LEU B 1 273 ? 21.151 -34.095 -32.899 1.00 21.16 ? 273 LEU B CB  1 
ATOM   4431 C  CG  . LEU B 1 273 ? 22.583 -34.170 -33.477 1.00 18.88 ? 273 LEU B CG  1 
ATOM   4432 C  CD1 . LEU B 1 273 ? 22.568 -34.774 -34.878 1.00 18.78 ? 273 LEU B CD1 1 
ATOM   4433 C  CD2 . LEU B 1 273 ? 23.235 -32.801 -33.466 1.00 18.05 ? 273 LEU B CD2 1 
ATOM   4434 N  N   . ASP B 1 274 ? 20.470 -31.034 -34.423 1.00 20.40 ? 274 ASP B N   1 
ATOM   4435 C  CA  . ASP B 1 274 ? 20.229 -30.393 -35.712 1.00 19.83 ? 274 ASP B CA  1 
ATOM   4436 C  C   . ASP B 1 274 ? 21.557 -30.302 -36.467 1.00 19.44 ? 274 ASP B C   1 
ATOM   4437 O  O   . ASP B 1 274 ? 22.574 -29.938 -35.872 1.00 20.43 ? 274 ASP B O   1 
ATOM   4438 C  CB  . ASP B 1 274 ? 19.679 -28.965 -35.527 1.00 17.09 ? 274 ASP B CB  1 
ATOM   4439 C  CG  . ASP B 1 274 ? 18.385 -28.916 -34.719 1.00 16.52 ? 274 ASP B CG  1 
ATOM   4440 O  OD1 . ASP B 1 274 ? 17.484 -29.746 -34.953 1.00 15.20 ? 274 ASP B OD1 1 
ATOM   4441 O  OD2 . ASP B 1 274 ? 18.253 -28.024 -33.854 1.00 17.12 ? 274 ASP B OD2 1 
ATOM   4442 N  N   . ILE B 1 275 ? 21.555 -30.654 -37.756 1.00 19.77 ? 275 ILE B N   1 
ATOM   4443 C  CA  . ILE B 1 275 ? 22.753 -30.549 -38.610 1.00 19.09 ? 275 ILE B CA  1 
ATOM   4444 C  C   . ILE B 1 275 ? 22.323 -29.550 -39.686 1.00 19.18 ? 275 ILE B C   1 
ATOM   4445 O  O   . ILE B 1 275 ? 21.706 -29.930 -40.683 1.00 19.06 ? 275 ILE B O   1 
ATOM   4446 C  CB  . ILE B 1 275 ? 23.138 -31.899 -39.294 1.00 19.22 ? 275 ILE B CB  1 
ATOM   4447 C  CG1 . ILE B 1 275 ? 23.400 -32.989 -38.245 1.00 18.65 ? 275 ILE B CG1 1 
ATOM   4448 C  CG2 . ILE B 1 275 ? 24.362 -31.703 -40.173 1.00 16.48 ? 275 ILE B CG2 1 
ATOM   4449 C  CD1 . ILE B 1 275 ? 24.445 -32.650 -37.197 1.00 17.67 ? 275 ILE B CD1 1 
ATOM   4450 N  N   . MET B 1 276 ? 22.657 -28.276 -39.479 1.00 19.47 ? 276 MET B N   1 
ATOM   4451 C  CA  . MET B 1 276 ? 22.242 -27.207 -40.388 1.00 18.33 ? 276 MET B CA  1 
ATOM   4452 C  C   . MET B 1 276 ? 23.254 -26.623 -41.370 1.00 18.50 ? 276 MET B C   1 
ATOM   4453 O  O   . MET B 1 276 ? 24.433 -26.964 -41.380 1.00 18.04 ? 276 MET B O   1 
ATOM   4454 C  CB  . MET B 1 276 ? 21.670 -26.035 -39.577 1.00 19.09 ? 276 MET B CB  1 
ATOM   4455 C  CG  . MET B 1 276 ? 20.772 -26.417 -38.403 1.00 20.82 ? 276 MET B CG  1 
ATOM   4456 S  SD  . MET B 1 276 ? 19.443 -27.558 -38.778 1.00 27.42 ? 276 MET B SD  1 
ATOM   4457 C  CE  . MET B 1 276 ? 18.299 -26.512 -39.671 1.00 23.62 ? 276 MET B CE  1 
ATOM   4458 N  N   . GLU B 1 277 ? 22.734 -25.710 -42.185 1.00 17.44 ? 277 GLU B N   1 
ATOM   4459 C  CA  . GLU B 1 277 ? 23.464 -24.959 -43.202 1.00 17.11 ? 277 GLU B CA  1 
ATOM   4460 C  C   . GLU B 1 277 ? 24.318 -25.734 -44.193 1.00 16.13 ? 277 GLU B C   1 
ATOM   4461 O  O   . GLU B 1 277 ? 25.054 -25.140 -44.979 1.00 16.45 ? 277 GLU B O   1 
ATOM   4462 C  CB  . GLU B 1 277 ? 24.302 -23.861 -42.538 1.00 17.16 ? 277 GLU B CB  1 
ATOM   4463 C  CG  . GLU B 1 277 ? 23.486 -22.880 -41.688 1.00 20.47 ? 277 GLU B CG  1 
ATOM   4464 C  CD  . GLU B 1 277 ? 22.385 -22.161 -42.465 1.00 22.79 ? 277 GLU B CD  1 
ATOM   4465 O  OE1 . GLU B 1 277 ? 22.645 -21.710 -43.605 1.00 25.54 ? 277 GLU B OE1 1 
ATOM   4466 O  OE2 . GLU B 1 277 ? 21.263 -22.035 -41.925 1.00 22.19 ? 277 GLU B OE2 1 
ATOM   4467 N  N   . VAL B 1 278 ? 24.239 -27.055 -44.171 1.00 17.21 ? 278 VAL B N   1 
ATOM   4468 C  CA  . VAL B 1 278 ? 24.993 -27.824 -45.151 1.00 18.25 ? 278 VAL B CA  1 
ATOM   4469 C  C   . VAL B 1 278 ? 24.428 -27.432 -46.534 1.00 18.42 ? 278 VAL B C   1 
ATOM   4470 O  O   . VAL B 1 278 ? 23.246 -27.610 -46.804 1.00 16.34 ? 278 VAL B O   1 
ATOM   4471 C  CB  . VAL B 1 278 ? 24.837 -29.349 -44.906 1.00 19.42 ? 278 VAL B CB  1 
ATOM   4472 C  CG1 . VAL B 1 278 ? 26.010 -29.859 -44.071 1.00 20.16 ? 278 VAL B CG1 1 
ATOM   4473 C  CG2 . VAL B 1 278 ? 23.506 -29.639 -44.176 1.00 17.99 ? 278 VAL B CG2 1 
ATOM   4474 N  N   . ASN B 1 279 ? 25.271 -26.878 -47.397 1.00 19.45 ? 279 ASN B N   1 
ATOM   4475 C  CA  . ASN B 1 279 ? 24.825 -26.448 -48.727 1.00 20.09 ? 279 ASN B CA  1 
ATOM   4476 C  C   . ASN B 1 279 ? 25.795 -26.928 -49.822 1.00 20.00 ? 279 ASN B C   1 
ATOM   4477 O  O   . ASN B 1 279 ? 26.798 -26.271 -50.113 1.00 19.23 ? 279 ASN B O   1 
ATOM   4478 C  CB  . ASN B 1 279 ? 24.715 -24.914 -48.757 1.00 18.48 ? 279 ASN B CB  1 
ATOM   4479 C  CG  . ASN B 1 279 ? 24.105 -24.390 -50.050 1.00 20.25 ? 279 ASN B CG  1 
ATOM   4480 O  OD1 . ASN B 1 279 ? 23.991 -23.177 -50.255 1.00 20.77 ? 279 ASN B OD1 1 
ATOM   4481 N  ND2 . ASN B 1 279 ? 23.709 -25.301 -50.924 1.00 17.46 ? 279 ASN B ND2 1 
ATOM   4482 N  N   . PRO B 1 280 ? 25.505 -28.083 -50.444 1.00 21.25 ? 280 PRO B N   1 
ATOM   4483 C  CA  . PRO B 1 280 ? 26.403 -28.583 -51.491 1.00 21.66 ? 280 PRO B CA  1 
ATOM   4484 C  C   . PRO B 1 280 ? 26.649 -27.756 -52.775 1.00 23.02 ? 280 PRO B C   1 
ATOM   4485 O  O   . PRO B 1 280 ? 27.578 -28.062 -53.519 1.00 23.00 ? 280 PRO B O   1 
ATOM   4486 C  CB  . PRO B 1 280 ? 25.865 -29.998 -51.771 1.00 21.34 ? 280 PRO B CB  1 
ATOM   4487 C  CG  . PRO B 1 280 ? 24.473 -29.995 -51.204 1.00 20.48 ? 280 PRO B CG  1 
ATOM   4488 C  CD  . PRO B 1 280 ? 24.576 -29.138 -49.996 1.00 20.55 ? 280 PRO B CD  1 
ATOM   4489 N  N   . SER B 1 281 ? 25.856 -26.714 -53.036 1.00 24.10 ? 281 SER B N   1 
ATOM   4490 C  CA  . SER B 1 281 ? 26.068 -25.889 -54.237 1.00 24.84 ? 281 SER B CA  1 
ATOM   4491 C  C   . SER B 1 281 ? 27.116 -24.785 -54.016 1.00 25.13 ? 281 SER B C   1 
ATOM   4492 O  O   . SER B 1 281 ? 27.598 -24.162 -54.973 1.00 24.79 ? 281 SER B O   1 
ATOM   4493 C  CB  . SER B 1 281 ? 24.755 -25.245 -54.699 1.00 23.69 ? 281 SER B CB  1 
ATOM   4494 O  OG  . SER B 1 281 ? 24.405 -24.148 -53.872 1.00 25.73 ? 281 SER B OG  1 
ATOM   4495 N  N   . LEU B 1 282 ? 27.459 -24.546 -52.753 1.00 25.56 ? 282 LEU B N   1 
ATOM   4496 C  CA  . LEU B 1 282 ? 28.443 -23.532 -52.382 1.00 25.56 ? 282 LEU B CA  1 
ATOM   4497 C  C   . LEU B 1 282 ? 29.878 -24.070 -52.388 1.00 25.93 ? 282 LEU B C   1 
ATOM   4498 O  O   . LEU B 1 282 ? 30.824 -23.345 -52.068 1.00 26.49 ? 282 LEU B O   1 
ATOM   4499 C  CB  . LEU B 1 282 ? 28.114 -22.959 -51.002 1.00 24.89 ? 282 LEU B CB  1 
ATOM   4500 C  CG  . LEU B 1 282 ? 26.954 -21.965 -50.920 1.00 23.39 ? 282 LEU B CG  1 
ATOM   4501 C  CD1 . LEU B 1 282 ? 26.412 -21.948 -49.516 1.00 23.36 ? 282 LEU B CD1 1 
ATOM   4502 C  CD2 . LEU B 1 282 ? 27.419 -20.572 -51.333 1.00 24.41 ? 282 LEU B CD2 1 
ATOM   4503 N  N   . GLY B 1 283 ? 30.041 -25.342 -52.737 1.00 26.14 ? 283 GLY B N   1 
ATOM   4504 C  CA  . GLY B 1 283 ? 31.379 -25.897 -52.807 1.00 27.18 ? 283 GLY B CA  1 
ATOM   4505 C  C   . GLY B 1 283 ? 32.057 -25.325 -54.042 1.00 27.29 ? 283 GLY B C   1 
ATOM   4506 O  O   . GLY B 1 283 ? 31.405 -25.123 -55.067 1.00 28.51 ? 283 GLY B O   1 
ATOM   4507 N  N   . LYS B 1 284 ? 33.350 -25.037 -53.966 1.00 27.83 ? 284 LYS B N   1 
ATOM   4508 C  CA  . LYS B 1 284 ? 34.036 -24.494 -55.132 1.00 28.57 ? 284 LYS B CA  1 
ATOM   4509 C  C   . LYS B 1 284 ? 34.434 -25.647 -56.048 1.00 27.92 ? 284 LYS B C   1 
ATOM   4510 O  O   . LYS B 1 284 ? 34.738 -25.446 -57.220 1.00 28.41 ? 284 LYS B O   1 
ATOM   4511 C  CB  . LYS B 1 284 ? 35.279 -23.706 -54.712 1.00 30.96 ? 284 LYS B CB  1 
ATOM   4512 C  CG  . LYS B 1 284 ? 35.973 -22.983 -55.862 1.00 33.20 ? 284 LYS B CG  1 
ATOM   4513 C  CD  . LYS B 1 284 ? 37.436 -22.682 -55.540 1.00 33.08 ? 284 LYS B CD  1 
ATOM   4514 C  CE  . LYS B 1 284 ? 37.588 -21.743 -54.353 1.00 33.25 ? 284 LYS B CE  1 
ATOM   4515 N  NZ  . LYS B 1 284 ? 39.021 -21.573 -53.959 1.00 32.85 ? 284 LYS B NZ  1 
ATOM   4516 N  N   . THR B 1 285 ? 34.426 -26.856 -55.492 1.00 27.94 ? 285 THR B N   1 
ATOM   4517 C  CA  . THR B 1 285 ? 34.768 -28.078 -56.224 1.00 26.69 ? 285 THR B CA  1 
ATOM   4518 C  C   . THR B 1 285 ? 33.953 -29.248 -55.663 1.00 26.92 ? 285 THR B C   1 
ATOM   4519 O  O   . THR B 1 285 ? 33.410 -29.164 -54.561 1.00 27.36 ? 285 THR B O   1 
ATOM   4520 C  CB  . THR B 1 285 ? 36.272 -28.437 -56.086 1.00 25.76 ? 285 THR B CB  1 
ATOM   4521 O  OG1 . THR B 1 285 ? 36.554 -28.827 -54.737 1.00 23.85 ? 285 THR B OG1 1 
ATOM   4522 C  CG2 . THR B 1 285 ? 37.144 -27.250 -56.456 1.00 26.83 ? 285 THR B CG2 1 
ATOM   4523 N  N   . PRO B 1 286 ? 33.856 -30.354 -56.419 1.00 26.04 ? 286 PRO B N   1 
ATOM   4524 C  CA  . PRO B 1 286 ? 33.101 -31.533 -55.974 1.00 25.61 ? 286 PRO B CA  1 
ATOM   4525 C  C   . PRO B 1 286 ? 33.605 -32.095 -54.644 1.00 26.05 ? 286 PRO B C   1 
ATOM   4526 O  O   . PRO B 1 286 ? 32.823 -32.602 -53.835 1.00 25.35 ? 286 PRO B O   1 
ATOM   4527 C  CB  . PRO B 1 286 ? 33.300 -32.515 -57.120 1.00 25.39 ? 286 PRO B CB  1 
ATOM   4528 C  CG  . PRO B 1 286 ? 33.381 -31.606 -58.313 1.00 25.46 ? 286 PRO B CG  1 
ATOM   4529 C  CD  . PRO B 1 286 ? 34.294 -30.514 -57.818 1.00 26.69 ? 286 PRO B CD  1 
ATOM   4530 N  N   . GLU B 1 287 ? 34.916 -31.999 -54.435 1.00 25.92 ? 287 GLU B N   1 
ATOM   4531 C  CA  . GLU B 1 287 ? 35.542 -32.490 -53.214 1.00 26.23 ? 287 GLU B CA  1 
ATOM   4532 C  C   . GLU B 1 287 ? 35.332 -31.538 -52.032 1.00 25.32 ? 287 GLU B C   1 
ATOM   4533 O  O   . GLU B 1 287 ? 35.445 -31.950 -50.878 1.00 24.55 ? 287 GLU B O   1 
ATOM   4534 C  CB  . GLU B 1 287 ? 37.039 -32.739 -53.443 1.00 27.72 ? 287 GLU B CB  1 
ATOM   4535 C  CG  . GLU B 1 287 ? 37.927 -31.503 -53.513 1.00 29.55 ? 287 GLU B CG  1 
ATOM   4536 C  CD  . GLU B 1 287 ? 38.215 -30.891 -52.145 1.00 29.96 ? 287 GLU B CD  1 
ATOM   4537 O  OE1 . GLU B 1 287 ? 38.305 -31.643 -51.151 1.00 29.11 ? 287 GLU B OE1 1 
ATOM   4538 O  OE2 . GLU B 1 287 ? 38.372 -29.655 -52.069 1.00 32.02 ? 287 GLU B OE2 1 
ATOM   4539 N  N   . GLU B 1 288 ? 35.039 -30.271 -52.316 1.00 25.33 ? 288 GLU B N   1 
ATOM   4540 C  CA  . GLU B 1 288 ? 34.766 -29.315 -51.244 1.00 25.52 ? 288 GLU B CA  1 
ATOM   4541 C  C   . GLU B 1 288 ? 33.390 -29.665 -50.687 1.00 25.22 ? 288 GLU B C   1 
ATOM   4542 O  O   . GLU B 1 288 ? 33.112 -29.433 -49.516 1.00 24.47 ? 288 GLU B O   1 
ATOM   4543 C  CB  . GLU B 1 288 ? 34.783 -27.869 -51.764 1.00 26.12 ? 288 GLU B CB  1 
ATOM   4544 C  CG  . GLU B 1 288 ? 36.189 -27.262 -51.798 1.00 26.84 ? 288 GLU B CG  1 
ATOM   4545 C  CD  . GLU B 1 288 ? 36.211 -25.768 -52.085 1.00 25.78 ? 288 GLU B CD  1 
ATOM   4546 O  OE1 . GLU B 1 288 ? 35.393 -25.025 -51.503 1.00 24.79 ? 288 GLU B OE1 1 
ATOM   4547 O  OE2 . GLU B 1 288 ? 37.071 -25.334 -52.883 1.00 28.80 ? 288 GLU B OE2 1 
ATOM   4548 N  N   . VAL B 1 289 ? 32.546 -30.251 -51.538 1.00 24.74 ? 289 VAL B N   1 
ATOM   4549 C  CA  . VAL B 1 289 ? 31.196 -30.668 -51.141 1.00 23.85 ? 289 VAL B CA  1 
ATOM   4550 C  C   . VAL B 1 289 ? 31.332 -31.908 -50.280 1.00 22.09 ? 289 VAL B C   1 
ATOM   4551 O  O   . VAL B 1 289 ? 30.766 -31.999 -49.195 1.00 20.44 ? 289 VAL B O   1 
ATOM   4552 C  CB  . VAL B 1 289 ? 30.312 -31.041 -52.360 1.00 24.19 ? 289 VAL B CB  1 
ATOM   4553 C  CG1 . VAL B 1 289 ? 28.952 -31.544 -51.880 1.00 25.14 ? 289 VAL B CG1 1 
ATOM   4554 C  CG2 . VAL B 1 289 ? 30.133 -29.836 -53.269 1.00 24.35 ? 289 VAL B CG2 1 
ATOM   4555 N  N   . THR B 1 290 ? 32.083 -32.871 -50.793 1.00 21.47 ? 290 THR B N   1 
ATOM   4556 C  CA  . THR B 1 290 ? 32.322 -34.113 -50.088 1.00 21.62 ? 290 THR B CA  1 
ATOM   4557 C  C   . THR B 1 290 ? 33.006 -33.788 -48.744 1.00 21.50 ? 290 THR B C   1 
ATOM   4558 O  O   . THR B 1 290 ? 32.643 -34.341 -47.699 1.00 21.15 ? 290 THR B O   1 
ATOM   4559 C  CB  . THR B 1 290 ? 33.177 -35.043 -50.986 1.00 21.72 ? 290 THR B CB  1 
ATOM   4560 O  OG1 . THR B 1 290 ? 32.374 -35.493 -52.087 1.00 22.61 ? 290 THR B OG1 1 
ATOM   4561 C  CG2 . THR B 1 290 ? 33.691 -36.241 -50.224 1.00 23.38 ? 290 THR B CG2 1 
ATOM   4562 N  N   . ARG B 1 291 ? 33.970 -32.867 -48.777 1.00 21.30 ? 291 ARG B N   1 
ATOM   4563 C  CA  . ARG B 1 291 ? 34.706 -32.436 -47.581 1.00 22.15 ? 291 ARG B CA  1 
ATOM   4564 C  C   . ARG B 1 291 ? 33.745 -32.019 -46.466 1.00 21.32 ? 291 ARG B C   1 
ATOM   4565 O  O   . ARG B 1 291 ? 33.915 -32.384 -45.301 1.00 21.74 ? 291 ARG B O   1 
ATOM   4566 C  CB  . ARG B 1 291 ? 35.615 -31.242 -47.924 1.00 22.25 ? 291 ARG B CB  1 
ATOM   4567 C  CG  . ARG B 1 291 ? 36.505 -30.760 -46.774 1.00 23.53 ? 291 ARG B CG  1 
ATOM   4568 C  CD  . ARG B 1 291 ? 37.029 -29.332 -46.991 1.00 24.85 ? 291 ARG B CD  1 
ATOM   4569 N  NE  . ARG B 1 291 ? 37.767 -29.160 -48.246 1.00 26.08 ? 291 ARG B NE  1 
ATOM   4570 C  CZ  . ARG B 1 291 ? 38.363 -28.028 -48.619 1.00 26.71 ? 291 ARG B CZ  1 
ATOM   4571 N  NH1 . ARG B 1 291 ? 38.313 -26.959 -47.839 1.00 26.27 ? 291 ARG B NH1 1 
ATOM   4572 N  NH2 . ARG B 1 291 ? 39.011 -27.962 -49.777 1.00 27.00 ? 291 ARG B NH2 1 
ATOM   4573 N  N   . THR B 1 292 ? 32.735 -31.248 -46.856 1.00 20.29 ? 292 THR B N   1 
ATOM   4574 C  CA  . THR B 1 292 ? 31.715 -30.722 -45.957 1.00 19.88 ? 292 THR B CA  1 
ATOM   4575 C  C   . THR B 1 292 ? 30.688 -31.762 -45.513 1.00 20.17 ? 292 THR B C   1 
ATOM   4576 O  O   . THR B 1 292 ? 30.322 -31.819 -44.340 1.00 20.40 ? 292 THR B O   1 
ATOM   4577 C  CB  . THR B 1 292 ? 30.976 -29.550 -46.645 1.00 18.81 ? 292 THR B CB  1 
ATOM   4578 O  OG1 . THR B 1 292 ? 31.924 -28.530 -46.975 1.00 18.32 ? 292 THR B OG1 1 
ATOM   4579 C  CG2 . THR B 1 292 ? 29.900 -28.974 -45.740 1.00 19.37 ? 292 THR B CG2 1 
ATOM   4580 N  N   . VAL B 1 293 ? 30.213 -32.563 -46.463 1.00 20.20 ? 293 VAL B N   1 
ATOM   4581 C  CA  . VAL B 1 293 ? 29.228 -33.599 -46.181 1.00 19.88 ? 293 VAL B CA  1 
ATOM   4582 C  C   . VAL B 1 293 ? 29.819 -34.648 -45.244 1.00 19.37 ? 293 VAL B C   1 
ATOM   4583 O  O   . VAL B 1 293 ? 29.176 -35.067 -44.277 1.00 18.52 ? 293 VAL B O   1 
ATOM   4584 C  CB  . VAL B 1 293 ? 28.751 -34.279 -47.494 1.00 21.31 ? 293 VAL B CB  1 
ATOM   4585 C  CG1 . VAL B 1 293 ? 27.911 -35.511 -47.184 1.00 20.18 ? 293 VAL B CG1 1 
ATOM   4586 C  CG2 . VAL B 1 293 ? 27.950 -33.289 -48.322 1.00 21.10 ? 293 VAL B CG2 1 
ATOM   4587 N  N   . ASN B 1 294 ? 31.049 -35.065 -45.528 1.00 19.35 ? 294 ASN B N   1 
ATOM   4588 C  CA  . ASN B 1 294 ? 31.705 -36.068 -44.701 1.00 18.57 ? 294 ASN B CA  1 
ATOM   4589 C  C   . ASN B 1 294 ? 31.992 -35.563 -43.285 1.00 17.77 ? 294 ASN B C   1 
ATOM   4590 O  O   . ASN B 1 294 ? 31.953 -36.334 -42.331 1.00 18.91 ? 294 ASN B O   1 
ATOM   4591 C  CB  . ASN B 1 294 ? 33.000 -36.540 -45.357 1.00 18.73 ? 294 ASN B CB  1 
ATOM   4592 C  CG  . ASN B 1 294 ? 32.762 -37.270 -46.671 1.00 18.39 ? 294 ASN B CG  1 
ATOM   4593 O  OD1 . ASN B 1 294 ? 31.709 -37.874 -46.887 1.00 18.60 ? 294 ASN B OD1 1 
ATOM   4594 N  ND2 . ASN B 1 294 ? 33.755 -37.235 -47.546 1.00 20.22 ? 294 ASN B ND2 1 
ATOM   4595 N  N   . THR B 1 295 ? 32.282 -34.275 -43.144 1.00 17.73 ? 295 THR B N   1 
ATOM   4596 C  CA  . THR B 1 295 ? 32.546 -33.711 -41.824 1.00 18.07 ? 295 THR B CA  1 
ATOM   4597 C  C   . THR B 1 295 ? 31.261 -33.664 -41.011 1.00 17.11 ? 295 THR B C   1 
ATOM   4598 O  O   . THR B 1 295 ? 31.273 -33.918 -39.812 1.00 16.88 ? 295 THR B O   1 
ATOM   4599 C  CB  . THR B 1 295 ? 33.143 -32.302 -41.932 1.00 19.47 ? 295 THR B CB  1 
ATOM   4600 O  OG1 . THR B 1 295 ? 34.492 -32.409 -42.407 1.00 20.65 ? 295 THR B OG1 1 
ATOM   4601 C  CG2 . THR B 1 295 ? 33.120 -31.588 -40.580 1.00 17.94 ? 295 THR B CG2 1 
ATOM   4602 N  N   . ALA B 1 296 ? 30.154 -33.341 -41.678 1.00 17.22 ? 296 ALA B N   1 
ATOM   4603 C  CA  . ALA B 1 296 ? 28.845 -33.284 -41.038 1.00 15.26 ? 296 ALA B CA  1 
ATOM   4604 C  C   . ALA B 1 296 ? 28.501 -34.701 -40.597 1.00 14.41 ? 296 ALA B C   1 
ATOM   4605 O  O   . ALA B 1 296 ? 28.113 -34.924 -39.453 1.00 14.85 ? 296 ALA B O   1 
ATOM   4606 C  CB  . ALA B 1 296 ? 27.790 -32.763 -42.025 1.00 11.97 ? 296 ALA B CB  1 
ATOM   4607 N  N   . VAL B 1 297 ? 28.642 -35.655 -41.516 1.00 14.65 ? 297 VAL B N   1 
ATOM   4608 C  CA  . VAL B 1 297 ? 28.357 -37.057 -41.213 1.00 16.84 ? 297 VAL B CA  1 
ATOM   4609 C  C   . VAL B 1 297 ? 29.163 -37.521 -40.008 1.00 17.49 ? 297 VAL B C   1 
ATOM   4610 O  O   . VAL B 1 297 ? 28.605 -38.040 -39.039 1.00 19.97 ? 297 VAL B O   1 
ATOM   4611 C  CB  . VAL B 1 297 ? 28.699 -37.997 -42.407 1.00 16.87 ? 297 VAL B CB  1 
ATOM   4612 C  CG1 . VAL B 1 297 ? 28.676 -39.470 -41.944 1.00 17.32 ? 297 VAL B CG1 1 
ATOM   4613 C  CG2 . VAL B 1 297 ? 27.708 -37.792 -43.528 1.00 15.27 ? 297 VAL B CG2 1 
ATOM   4614 N  N   . ALA B 1 298 ? 30.477 -37.322 -40.077 1.00 18.45 ? 298 ALA B N   1 
ATOM   4615 C  CA  . ALA B 1 298 ? 31.387 -37.726 -39.007 1.00 17.80 ? 298 ALA B CA  1 
ATOM   4616 C  C   . ALA B 1 298 ? 31.021 -37.086 -37.675 1.00 17.31 ? 298 ALA B C   1 
ATOM   4617 O  O   . ALA B 1 298 ? 31.224 -37.685 -36.624 1.00 17.92 ? 298 ALA B O   1 
ATOM   4618 C  CB  . ALA B 1 298 ? 32.815 -37.370 -39.380 1.00 19.43 ? 298 ALA B CB  1 
ATOM   4619 N  N   . ILE B 1 299 ? 30.483 -35.870 -37.722 1.00 16.62 ? 299 ILE B N   1 
ATOM   4620 C  CA  . ILE B 1 299 ? 30.079 -35.156 -36.512 1.00 15.95 ? 299 ILE B CA  1 
ATOM   4621 C  C   . ILE B 1 299 ? 28.763 -35.709 -35.955 1.00 15.38 ? 299 ILE B C   1 
ATOM   4622 O  O   . ILE B 1 299 ? 28.575 -35.780 -34.744 1.00 13.96 ? 299 ILE B O   1 
ATOM   4623 C  CB  . ILE B 1 299 ? 29.980 -33.614 -36.776 1.00 15.04 ? 299 ILE B CB  1 
ATOM   4624 C  CG1 . ILE B 1 299 ? 31.349 -32.978 -36.536 1.00 13.51 ? 299 ILE B CG1 1 
ATOM   4625 C  CG2 . ILE B 1 299 ? 28.924 -32.962 -35.876 1.00 15.12 ? 299 ILE B CG2 1 
ATOM   4626 C  CD1 . ILE B 1 299 ? 31.422 -31.518 -36.862 1.00 16.00 ? 299 ILE B CD1 1 
ATOM   4627 N  N   . THR B 1 300 ? 27.859 -36.116 -36.837 1.00 15.58 ? 300 THR B N   1 
ATOM   4628 C  CA  . THR B 1 300 ? 26.596 -36.681 -36.391 1.00 15.06 ? 300 THR B CA  1 
ATOM   4629 C  C   . THR B 1 300 ? 26.889 -38.023 -35.715 1.00 13.63 ? 300 THR B C   1 
ATOM   4630 O  O   . THR B 1 300 ? 26.390 -38.312 -34.624 1.00 14.47 ? 300 THR B O   1 
ATOM   4631 C  CB  . THR B 1 300 ? 25.651 -36.889 -37.592 1.00 13.16 ? 300 THR B CB  1 
ATOM   4632 O  OG1 . THR B 1 300 ? 25.390 -35.618 -38.199 1.00 16.33 ? 300 THR B OG1 1 
ATOM   4633 C  CG2 . THR B 1 300 ? 24.340 -37.516 -37.157 1.00 13.49 ? 300 THR B CG2 1 
ATOM   4634 N  N   . LEU B 1 301 ? 27.719 -38.838 -36.363 1.00 15.43 ? 301 LEU B N   1 
ATOM   4635 C  CA  . LEU B 1 301 ? 28.061 -40.147 -35.817 1.00 14.81 ? 301 LEU B CA  1 
ATOM   4636 C  C   . LEU B 1 301 ? 28.682 -40.059 -34.419 1.00 15.15 ? 301 LEU B C   1 
ATOM   4637 O  O   . LEU B 1 301 ? 28.413 -40.896 -33.565 1.00 15.95 ? 301 LEU B O   1 
ATOM   4638 C  CB  . LEU B 1 301 ? 28.992 -40.899 -36.773 1.00 15.43 ? 301 LEU B CB  1 
ATOM   4639 C  CG  . LEU B 1 301 ? 28.471 -41.248 -38.182 1.00 14.52 ? 301 LEU B CG  1 
ATOM   4640 C  CD1 . LEU B 1 301 ? 29.433 -42.233 -38.795 1.00 13.40 ? 301 LEU B CD1 1 
ATOM   4641 C  CD2 . LEU B 1 301 ? 27.079 -41.858 -38.146 1.00 12.36 ? 301 LEU B CD2 1 
ATOM   4642 N  N   . ALA B 1 302 ? 29.498 -39.037 -34.183 1.00 15.84 ? 302 ALA B N   1 
ATOM   4643 C  CA  . ALA B 1 302 ? 30.121 -38.848 -32.873 1.00 14.95 ? 302 ALA B CA  1 
ATOM   4644 C  C   . ALA B 1 302 ? 29.052 -38.600 -31.808 1.00 15.35 ? 302 ALA B C   1 
ATOM   4645 O  O   . ALA B 1 302 ? 29.252 -38.895 -30.624 1.00 15.38 ? 302 ALA B O   1 
ATOM   4646 C  CB  . ALA B 1 302 ? 31.089 -37.682 -32.923 1.00 13.81 ? 302 ALA B CB  1 
ATOM   4647 N  N   . CYS B 1 303 ? 27.916 -38.055 -32.234 1.00 15.68 ? 303 CYS B N   1 
ATOM   4648 C  CA  . CYS B 1 303 ? 26.804 -37.775 -31.334 1.00 14.67 ? 303 CYS B CA  1 
ATOM   4649 C  C   . CYS B 1 303 ? 26.085 -39.059 -30.913 1.00 15.56 ? 303 CYS B C   1 
ATOM   4650 O  O   . CYS B 1 303 ? 25.289 -39.055 -29.977 1.00 16.84 ? 303 CYS B O   1 
ATOM   4651 C  CB  . CYS B 1 303 ? 25.799 -36.835 -32.010 1.00 14.45 ? 303 CYS B CB  1 
ATOM   4652 S  SG  . CYS B 1 303 ? 26.425 -35.171 -32.375 1.00 17.39 ? 303 CYS B SG  1 
ATOM   4653 N  N   . PHE B 1 304 ? 26.357 -40.157 -31.606 1.00 15.33 ? 304 PHE B N   1 
ATOM   4654 C  CA  . PHE B 1 304 ? 25.707 -41.418 -31.276 1.00 16.21 ? 304 PHE B CA  1 
ATOM   4655 C  C   . PHE B 1 304 ? 26.648 -42.583 -30.973 1.00 16.01 ? 304 PHE B C   1 
ATOM   4656 O  O   . PHE B 1 304 ? 26.330 -43.737 -31.259 1.00 17.38 ? 304 PHE B O   1 
ATOM   4657 C  CB  . PHE B 1 304 ? 24.732 -41.795 -32.391 1.00 14.51 ? 304 PHE B CB  1 
ATOM   4658 C  CG  . PHE B 1 304 ? 23.697 -40.742 -32.654 1.00 14.56 ? 304 PHE B CG  1 
ATOM   4659 C  CD1 . PHE B 1 304 ? 22.627 -40.573 -31.789 1.00 12.67 ? 304 PHE B CD1 1 
ATOM   4660 C  CD2 . PHE B 1 304 ? 23.825 -39.879 -33.736 1.00 13.49 ? 304 PHE B CD2 1 
ATOM   4661 C  CE1 . PHE B 1 304 ? 21.694 -39.553 -31.994 1.00 13.10 ? 304 PHE B CE1 1 
ATOM   4662 C  CE2 . PHE B 1 304 ? 22.900 -38.860 -33.947 1.00 14.47 ? 304 PHE B CE2 1 
ATOM   4663 C  CZ  . PHE B 1 304 ? 21.836 -38.697 -33.076 1.00 12.21 ? 304 PHE B CZ  1 
ATOM   4664 N  N   . GLY B 1 305 ? 27.814 -42.284 -30.412 1.00 17.33 ? 305 GLY B N   1 
ATOM   4665 C  CA  . GLY B 1 305 ? 28.710 -43.358 -30.037 1.00 17.81 ? 305 GLY B CA  1 
ATOM   4666 C  C   . GLY B 1 305 ? 30.109 -43.454 -30.599 1.00 18.09 ? 305 GLY B C   1 
ATOM   4667 O  O   . GLY B 1 305 ? 31.027 -43.909 -29.900 1.00 16.89 ? 305 GLY B O   1 
ATOM   4668 N  N   . LEU B 1 306 ? 30.279 -43.045 -31.850 1.00 17.15 ? 306 LEU B N   1 
ATOM   4669 C  CA  . LEU B 1 306 ? 31.581 -43.128 -32.493 1.00 15.67 ? 306 LEU B CA  1 
ATOM   4670 C  C   . LEU B 1 306 ? 32.642 -42.314 -31.763 1.00 14.13 ? 306 LEU B C   1 
ATOM   4671 O  O   . LEU B 1 306 ? 32.588 -41.083 -31.733 1.00 13.44 ? 306 LEU B O   1 
ATOM   4672 C  CB  . LEU B 1 306 ? 31.466 -42.681 -33.954 1.00 15.61 ? 306 LEU B CB  1 
ATOM   4673 C  CG  . LEU B 1 306 ? 32.670 -42.815 -34.889 1.00 17.25 ? 306 LEU B CG  1 
ATOM   4674 C  CD1 . LEU B 1 306 ? 32.215 -42.512 -36.315 1.00 17.85 ? 306 LEU B CD1 1 
ATOM   4675 C  CD2 . LEU B 1 306 ? 33.786 -41.854 -34.476 1.00 20.45 ? 306 LEU B CD2 1 
ATOM   4676 N  N   . ALA B 1 307 ? 33.598 -43.030 -31.174 1.00 14.06 ? 307 ALA B N   1 
ATOM   4677 C  CA  . ALA B 1 307 ? 34.718 -42.448 -30.438 1.00 13.60 ? 307 ALA B CA  1 
ATOM   4678 C  C   . ALA B 1 307 ? 36.021 -42.757 -31.160 1.00 13.11 ? 307 ALA B C   1 
ATOM   4679 O  O   . ALA B 1 307 ? 36.232 -43.867 -31.652 1.00 12.87 ? 307 ALA B O   1 
ATOM   4680 C  CB  . ALA B 1 307 ? 34.778 -43.018 -29.028 1.00 15.50 ? 307 ALA B CB  1 
ATOM   4681 N  N   . ARG B 1 308 ? 36.901 -41.769 -31.204 1.00 13.45 ? 308 ARG B N   1 
ATOM   4682 C  CA  . ARG B 1 308 ? 38.188 -41.908 -31.852 1.00 13.91 ? 308 ARG B CA  1 
ATOM   4683 C  C   . ARG B 1 308 ? 39.126 -42.895 -31.157 1.00 13.91 ? 308 ARG B C   1 
ATOM   4684 O  O   . ARG B 1 308 ? 40.067 -43.371 -31.761 1.00 14.70 ? 308 ARG B O   1 
ATOM   4685 C  CB  . ARG B 1 308 ? 38.829 -40.526 -31.990 1.00 12.03 ? 308 ARG B CB  1 
ATOM   4686 C  CG  . ARG B 1 308 ? 38.127 -39.685 -33.058 1.00 10.79 ? 308 ARG B CG  1 
ATOM   4687 C  CD  . ARG B 1 308 ? 38.636 -38.265 -33.103 1.00 12.62 ? 308 ARG B CD  1 
ATOM   4688 N  NE  . ARG B 1 308 ? 38.126 -37.471 -31.993 1.00 11.21 ? 308 ARG B NE  1 
ATOM   4689 C  CZ  . ARG B 1 308 ? 38.561 -36.260 -31.661 1.00 10.20 ? 308 ARG B CZ  1 
ATOM   4690 N  NH1 . ARG B 1 308 ? 39.528 -35.678 -32.357 1.00 10.40 ? 308 ARG B NH1 1 
ATOM   4691 N  NH2 . ARG B 1 308 ? 38.042 -35.639 -30.614 1.00 10.77 ? 308 ARG B NH2 1 
ATOM   4692 N  N   . GLU B 1 309 ? 38.854 -43.217 -29.895 1.00 16.51 ? 309 GLU B N   1 
ATOM   4693 C  CA  . GLU B 1 309 ? 39.685 -44.178 -29.154 1.00 16.24 ? 309 GLU B CA  1 
ATOM   4694 C  C   . GLU B 1 309 ? 39.328 -45.603 -29.582 1.00 16.77 ? 309 GLU B C   1 
ATOM   4695 O  O   . GLU B 1 309 ? 40.119 -46.531 -29.444 1.00 15.40 ? 309 GLU B O   1 
ATOM   4696 C  CB  . GLU B 1 309 ? 39.455 -44.058 -27.644 1.00 15.73 ? 309 GLU B CB  1 
ATOM   4697 C  CG  . GLU B 1 309 ? 38.096 -44.565 -27.179 1.00 15.61 ? 309 GLU B CG  1 
ATOM   4698 C  CD  . GLU B 1 309 ? 38.036 -44.800 -25.682 1.00 17.10 ? 309 GLU B CD  1 
ATOM   4699 O  OE1 . GLU B 1 309 ? 38.425 -43.888 -24.921 1.00 17.70 ? 309 GLU B OE1 1 
ATOM   4700 O  OE2 . GLU B 1 309 ? 37.590 -45.894 -25.261 1.00 16.69 ? 309 GLU B OE2 1 
ATOM   4701 N  N   . GLY B 1 310 ? 38.117 -45.765 -30.093 1.00 17.04 ? 310 GLY B N   1 
ATOM   4702 C  CA  . GLY B 1 310 ? 37.664 -47.075 -30.519 1.00 17.87 ? 310 GLY B CA  1 
ATOM   4703 C  C   . GLY B 1 310 ? 36.288 -47.399 -29.968 1.00 16.19 ? 310 GLY B C   1 
ATOM   4704 O  O   . GLY B 1 310 ? 35.799 -46.727 -29.062 1.00 14.59 ? 310 GLY B O   1 
ATOM   4705 N  N   . ASN B 1 311 ? 35.664 -48.432 -30.520 1.00 18.65 ? 311 ASN B N   1 
ATOM   4706 C  CA  . ASN B 1 311 ? 34.338 -48.867 -30.085 1.00 21.49 ? 311 ASN B CA  1 
ATOM   4707 C  C   . ASN B 1 311 ? 34.242 -50.372 -30.260 1.00 22.62 ? 311 ASN B C   1 
ATOM   4708 O  O   . ASN B 1 311 ? 34.848 -50.940 -31.170 1.00 23.42 ? 311 ASN B O   1 
ATOM   4709 C  CB  . ASN B 1 311 ? 33.221 -48.239 -30.933 1.00 22.65 ? 311 ASN B CB  1 
ATOM   4710 C  CG  . ASN B 1 311 ? 33.102 -46.731 -30.757 1.00 25.94 ? 311 ASN B CG  1 
ATOM   4711 O  OD1 . ASN B 1 311 ? 33.856 -45.967 -31.353 1.00 27.51 ? 311 ASN B OD1 1 
ATOM   4712 N  ND2 . ASN B 1 311 ? 32.141 -46.299 -29.939 1.00 27.33 ? 311 ASN B ND2 1 
ATOM   4713 N  N   . HIS B 1 312 ? 33.476 -51.021 -29.391 1.00 24.57 ? 312 HIS B N   1 
ATOM   4714 C  CA  . HIS B 1 312 ? 33.285 -52.459 -29.505 1.00 25.51 ? 312 HIS B CA  1 
ATOM   4715 C  C   . HIS B 1 312 ? 31.989 -52.883 -28.830 1.00 27.63 ? 312 HIS B C   1 
ATOM   4716 O  O   . HIS B 1 312 ? 31.454 -52.158 -27.982 1.00 27.45 ? 312 HIS B O   1 
ATOM   4717 C  CB  . HIS B 1 312 ? 34.499 -53.226 -28.937 1.00 25.15 ? 312 HIS B CB  1 
ATOM   4718 C  CG  . HIS B 1 312 ? 34.775 -52.972 -27.484 1.00 23.92 ? 312 HIS B CG  1 
ATOM   4719 N  ND1 . HIS B 1 312 ? 36.048 -52.747 -27.004 1.00 21.52 ? 312 HIS B ND1 1 
ATOM   4720 C  CD2 . HIS B 1 312 ? 33.961 -52.971 -26.400 1.00 22.80 ? 312 HIS B CD2 1 
ATOM   4721 C  CE1 . HIS B 1 312 ? 36.006 -52.620 -25.690 1.00 21.85 ? 312 HIS B CE1 1 
ATOM   4722 N  NE2 . HIS B 1 312 ? 34.752 -52.752 -25.299 1.00 23.04 ? 312 HIS B NE2 1 
ATOM   4723 N  N   . LYS B 1 313 ? 31.473 -54.042 -29.238 1.00 25.34 ? 313 LYS B N   1 
ATOM   4724 C  CA  . LYS B 1 313 ? 30.241 -54.580 -28.671 1.00 28.01 ? 313 LYS B CA  1 
ATOM   4725 C  C   . LYS B 1 313 ? 30.597 -55.654 -27.646 1.00 29.08 ? 313 LYS B C   1 
ATOM   4726 O  O   . LYS B 1 313 ? 31.697 -56.216 -27.690 1.00 28.87 ? 313 LYS B O   1 
ATOM   4727 C  CB  . LYS B 1 313 ? 29.358 -55.174 -29.777 1.00 28.93 ? 313 LYS B CB  1 
ATOM   4728 C  CG  . LYS B 1 313 ? 28.974 -54.188 -30.896 1.00 31.14 ? 313 LYS B CG  1 
ATOM   4729 C  CD  . LYS B 1 313 ? 29.685 -54.528 -32.212 1.00 31.72 ? 313 LYS B CD  1 
ATOM   4730 C  CE  . LYS B 1 313 ? 29.261 -53.599 -33.360 1.00 33.82 ? 313 LYS B CE  1 
ATOM   4731 N  NZ  . LYS B 1 313 ? 29.718 -52.182 -33.213 1.00 34.86 ? 313 LYS B NZ  1 
ATOM   4732 N  N   . PRO B 1 314 ? 29.674 -55.947 -26.707 1.00 30.96 ? 314 PRO B N   1 
ATOM   4733 C  CA  . PRO B 1 314 ? 29.893 -56.957 -25.657 1.00 31.56 ? 314 PRO B CA  1 
ATOM   4734 C  C   . PRO B 1 314 ? 30.090 -58.388 -26.172 1.00 32.98 ? 314 PRO B C   1 
ATOM   4735 O  O   . PRO B 1 314 ? 29.236 -59.260 -25.977 1.00 34.55 ? 314 PRO B O   1 
ATOM   4736 C  CB  . PRO B 1 314 ? 28.648 -56.828 -24.776 1.00 32.28 ? 314 PRO B CB  1 
ATOM   4737 C  CG  . PRO B 1 314 ? 28.186 -55.409 -25.012 1.00 32.30 ? 314 PRO B CG  1 
ATOM   4738 C  CD  . PRO B 1 314 ? 28.390 -55.251 -26.502 1.00 31.27 ? 314 PRO B CD  1 
ATOM   4739 N  N   . ILE B 1 315 ? 31.222 -58.612 -26.833 1.00 33.03 ? 315 ILE B N   1 
ATOM   4740 C  CA  . ILE B 1 315 ? 31.575 -59.917 -27.375 1.00 34.29 ? 315 ILE B CA  1 
ATOM   4741 C  C   . ILE B 1 315 ? 33.075 -60.088 -27.158 1.00 34.07 ? 315 ILE B C   1 
ATOM   4742 O  O   . ILE B 1 315 ? 33.827 -59.112 -27.197 1.00 34.17 ? 315 ILE B O   1 
ATOM   4743 C  CB  . ILE B 1 315 ? 31.284 -60.001 -28.885 1.00 34.22 ? 315 ILE B CB  1 
ATOM   4744 C  CG1 . ILE B 1 315 ? 29.810 -59.682 -29.149 1.00 34.82 ? 315 ILE B CG1 1 
ATOM   4745 C  CG2 . ILE B 1 315 ? 31.644 -61.393 -29.401 1.00 34.70 ? 315 ILE B CG2 1 
ATOM   4746 C  CD1 . ILE B 1 315 ? 29.419 -59.703 -30.628 1.00 33.08 ? 315 ILE B CD1 1 
ATOM   4747 N  N   . ASP B 1 316 ? 33.524 -61.317 -26.930 1.00 33.63 ? 316 ASP B N   1 
ATOM   4748 C  CA  . ASP B 1 316 ? 34.947 -61.526 -26.715 1.00 33.15 ? 316 ASP B CA  1 
ATOM   4749 C  C   . ASP B 1 316 ? 35.678 -61.713 -28.030 1.00 32.05 ? 316 ASP B C   1 
ATOM   4750 O  O   . ASP B 1 316 ? 35.548 -62.748 -28.689 1.00 31.49 ? 316 ASP B O   1 
ATOM   4751 C  CB  . ASP B 1 316 ? 35.192 -62.731 -25.805 1.00 34.53 ? 316 ASP B CB  1 
ATOM   4752 C  CG  . ASP B 1 316 ? 36.610 -62.764 -25.266 1.00 35.53 ? 316 ASP B CG  1 
ATOM   4753 O  OD1 . ASP B 1 316 ? 36.914 -63.625 -24.412 1.00 36.66 ? 316 ASP B OD1 1 
ATOM   4754 O  OD2 . ASP B 1 316 ? 37.426 -61.920 -25.701 1.00 36.19 ? 316 ASP B OD2 1 
ATOM   4755 N  N   . TYR B 1 317 ? 36.446 -60.696 -28.406 1.00 31.72 ? 317 TYR B N   1 
ATOM   4756 C  CA  . TYR B 1 317 ? 37.212 -60.736 -29.645 1.00 31.65 ? 317 TYR B CA  1 
ATOM   4757 C  C   . TYR B 1 317 ? 38.419 -61.647 -29.489 1.00 32.04 ? 317 TYR B C   1 
ATOM   4758 O  O   . TYR B 1 317 ? 38.884 -62.243 -30.461 1.00 33.12 ? 317 TYR B O   1 
ATOM   4759 C  CB  . TYR B 1 317 ? 37.628 -59.323 -30.047 1.00 28.58 ? 317 TYR B CB  1 
ATOM   4760 C  CG  . TYR B 1 317 ? 36.436 -58.486 -30.455 1.00 26.07 ? 317 TYR B CG  1 
ATOM   4761 C  CD1 . TYR B 1 317 ? 36.306 -58.002 -31.758 1.00 25.88 ? 317 TYR B CD1 1 
ATOM   4762 C  CD2 . TYR B 1 317 ? 35.420 -58.206 -29.545 1.00 24.56 ? 317 TYR B CD2 1 
ATOM   4763 C  CE1 . TYR B 1 317 ? 35.188 -57.256 -32.146 1.00 24.81 ? 317 TYR B CE1 1 
ATOM   4764 C  CE2 . TYR B 1 317 ? 34.299 -57.467 -29.914 1.00 23.80 ? 317 TYR B CE2 1 
ATOM   4765 C  CZ  . TYR B 1 317 ? 34.185 -56.995 -31.213 1.00 24.73 ? 317 TYR B CZ  1 
ATOM   4766 O  OH  . TYR B 1 317 ? 33.065 -56.269 -31.575 1.00 23.72 ? 317 TYR B OH  1 
ATOM   4767 N  N   . LEU B 1 318 ? 38.920 -61.751 -28.263 1.00 32.90 ? 318 LEU B N   1 
ATOM   4768 C  CA  . LEU B 1 318 ? 40.030 -62.642 -27.982 1.00 33.22 ? 318 LEU B CA  1 
ATOM   4769 C  C   . LEU B 1 318 ? 39.406 -63.969 -27.557 1.00 33.39 ? 318 LEU B C   1 
ATOM   4770 O  O   . LEU B 1 318 ? 39.353 -64.244 -26.339 1.00 32.61 ? 318 LEU B O   1 
ATOM   4771 C  CB  . LEU B 1 318 ? 40.917 -62.089 -26.862 1.00 33.44 ? 318 LEU B CB  1 
ATOM   4772 C  CG  . LEU B 1 318 ? 42.011 -61.103 -27.269 1.00 33.78 ? 318 LEU B CG  1 
ATOM   4773 C  CD1 . LEU B 1 318 ? 42.823 -60.711 -26.040 1.00 34.45 ? 318 LEU B CD1 1 
ATOM   4774 C  CD2 . LEU B 1 318 ? 42.913 -61.741 -28.314 1.00 32.19 ? 318 LEU B CD2 1 
HETATM 4775 MN MN  . MN  C 2 .   ? 17.942 -8.873  -3.684  1.00 14.28 ? 323 MN  A MN  1 
HETATM 4776 MN MN  . MN  D 2 .   ? 21.107 -8.165  -2.857  1.00 15.79 ? 324 MN  A MN  1 
HETATM 4777 MN MN  . MN  E 2 .   ? 26.221 -19.570 -38.653 1.00 15.38 ? 323 MN  B MN  1 
HETATM 4778 MN MN  . MN  F 2 .   ? 23.166 -20.571 -37.512 1.00 21.85 ? 324 MN  B MN  1 
HETATM 4779 O  O   . HOH G 3 .   ? 26.787 -13.759 -17.721 1.00 12.04 ? 325 HOH A O   1 
HETATM 4780 O  O   . HOH G 3 .   ? 15.737 12.775  5.405   1.00 6.98  ? 326 HOH A O   1 
HETATM 4781 O  O   . HOH G 3 .   ? 6.246  -11.458 -1.837  1.00 9.36  ? 327 HOH A O   1 
HETATM 4782 O  O   . HOH G 3 .   ? 10.347 8.977   -8.175  1.00 20.21 ? 328 HOH A O   1 
HETATM 4783 O  O   . HOH G 3 .   ? 20.434 -5.499  -11.192 1.00 8.12  ? 329 HOH A O   1 
HETATM 4784 O  O   . HOH G 3 .   ? 12.039 -4.304  -7.641  1.00 9.18  ? 330 HOH A O   1 
HETATM 4785 O  O   . HOH G 3 .   ? 13.714 -12.687 -9.032  1.00 11.00 ? 331 HOH A O   1 
HETATM 4786 O  O   . HOH G 3 .   ? 20.447 -8.902  -9.330  1.00 12.58 ? 332 HOH A O   1 
HETATM 4787 O  O   . HOH G 3 .   ? -0.463 -4.204  10.535  1.00 3.20  ? 333 HOH A O   1 
HETATM 4788 O  O   . HOH G 3 .   ? 35.228 8.465   9.122   1.00 19.27 ? 334 HOH A O   1 
HETATM 4789 O  O   . HOH G 3 .   ? 8.568  14.348  9.558   1.00 15.26 ? 335 HOH A O   1 
HETATM 4790 O  O   . HOH G 3 .   ? 9.914  4.500   13.758  1.00 6.93  ? 336 HOH A O   1 
HETATM 4791 O  O   . HOH G 3 .   ? 32.948 -7.238  -6.160  1.00 17.37 ? 337 HOH A O   1 
HETATM 4792 O  O   . HOH G 3 .   ? 2.690  -13.393 14.598  1.00 37.33 ? 338 HOH A O   1 
HETATM 4793 O  O   . HOH G 3 .   ? 21.018 -13.963 -9.397  1.00 19.80 ? 339 HOH A O   1 
HETATM 4794 O  O   . HOH G 3 .   ? 39.398 8.545   -6.151  1.00 37.86 ? 340 HOH A O   1 
HETATM 4795 O  O   . HOH G 3 .   ? 0.626  -5.306  4.648   1.00 7.30  ? 341 HOH A O   1 
HETATM 4796 O  O   . HOH G 3 .   ? 17.809 -14.754 -0.439  1.00 14.11 ? 342 HOH A O   1 
HETATM 4797 O  O   . HOH G 3 .   ? 11.830 -6.798  -6.176  1.00 5.24  ? 343 HOH A O   1 
HETATM 4798 O  O   . HOH G 3 .   ? 25.431 13.791  12.633  1.00 18.74 ? 344 HOH A O   1 
HETATM 4799 O  O   . HOH G 3 .   ? 13.690 18.881  7.842   1.00 25.53 ? 345 HOH A O   1 
HETATM 4800 O  O   . HOH G 3 .   ? 37.295 -17.186 -19.814 1.00 15.83 ? 346 HOH A O   1 
HETATM 4801 O  O   . HOH G 3 .   ? 41.680 -10.355 -5.257  1.00 10.39 ? 347 HOH A O   1 
HETATM 4802 O  O   . HOH G 3 .   ? 30.987 -4.424  15.204  1.00 16.04 ? 348 HOH A O   1 
HETATM 4803 O  O   . HOH G 3 .   ? 21.282 -15.652 -1.821  1.00 14.26 ? 349 HOH A O   1 
HETATM 4804 O  O   . HOH G 3 .   ? 9.991  13.397  11.922  1.00 36.86 ? 350 HOH A O   1 
HETATM 4805 O  O   . HOH G 3 .   ? 14.914 -2.936  -8.143  1.00 38.29 ? 351 HOH A O   1 
HETATM 4806 O  O   . HOH G 3 .   ? 19.499 -14.600 -12.105 1.00 24.49 ? 352 HOH A O   1 
HETATM 4807 O  O   . HOH G 3 .   ? 27.333 -15.520 -11.579 1.00 32.44 ? 353 HOH A O   1 
HETATM 4808 O  O   . HOH G 3 .   ? 39.882 -13.748 12.548  1.00 35.97 ? 354 HOH A O   1 
HETATM 4809 O  O   . HOH G 3 .   ? 0.391  -3.613  7.106   1.00 11.60 ? 355 HOH A O   1 
HETATM 4810 O  O   . HOH G 3 .   ? 23.434 10.797  6.807   1.00 15.91 ? 356 HOH A O   1 
HETATM 4811 O  O   . HOH G 3 .   ? 18.123 -7.265  -8.277  1.00 14.33 ? 357 HOH A O   1 
HETATM 4812 O  O   . HOH G 3 .   ? 19.914 -16.911 -4.437  1.00 29.12 ? 358 HOH A O   1 
HETATM 4813 O  O   . HOH G 3 .   ? 28.932 -23.900 4.044   1.00 14.54 ? 359 HOH A O   1 
HETATM 4814 O  O   . HOH G 3 .   ? 35.507 -0.192  -14.948 1.00 26.79 ? 360 HOH A O   1 
HETATM 4815 O  O   . HOH G 3 .   ? 43.033 -14.294 -3.603  1.00 17.32 ? 361 HOH A O   1 
HETATM 4816 O  O   . HOH G 3 .   ? 14.549 11.365  -7.492  1.00 20.71 ? 362 HOH A O   1 
HETATM 4817 O  O   . HOH G 3 .   ? 18.364 -1.750  22.716  1.00 32.21 ? 363 HOH A O   1 
HETATM 4818 O  O   . HOH G 3 .   ? 44.640 -3.026  2.022   1.00 28.44 ? 364 HOH A O   1 
HETATM 4819 O  O   . HOH G 3 .   ? 15.924 11.586  -10.364 1.00 14.95 ? 365 HOH A O   1 
HETATM 4820 O  O   . HOH G 3 .   ? 19.768 -11.140 -6.173  1.00 12.94 ? 366 HOH A O   1 
HETATM 4821 O  O   . HOH G 3 .   ? 4.211  -0.380  6.938   1.00 13.43 ? 367 HOH A O   1 
HETATM 4822 O  O   . HOH G 3 .   ? 8.506  -12.580 -7.870  1.00 10.29 ? 368 HOH A O   1 
HETATM 4823 O  O   . HOH G 3 .   ? 26.353 10.275  9.948   1.00 12.94 ? 369 HOH A O   1 
HETATM 4824 O  O   . HOH G 3 .   ? 14.560 12.367  8.085   1.00 17.99 ? 370 HOH A O   1 
HETATM 4825 O  O   . HOH G 3 .   ? 12.152 -9.589  13.983  1.00 15.45 ? 371 HOH A O   1 
HETATM 4826 O  O   . HOH G 3 .   ? 35.363 -14.948 5.097   1.00 13.45 ? 372 HOH A O   1 
HETATM 4827 O  O   . HOH G 3 .   ? 38.120 14.287  -1.666  1.00 23.36 ? 373 HOH A O   1 
HETATM 4828 O  O   . HOH G 3 .   ? 17.292 -16.123 -3.100  1.00 16.64 ? 374 HOH A O   1 
HETATM 4829 O  O   . HOH G 3 .   ? 3.238  -5.250  -3.492  1.00 19.44 ? 375 HOH A O   1 
HETATM 4830 O  O   . HOH G 3 .   ? 14.469 8.997   -20.029 1.00 44.12 ? 376 HOH A O   1 
HETATM 4831 O  O   . HOH G 3 .   ? 25.472 13.492  -10.600 1.00 26.71 ? 377 HOH A O   1 
HETATM 4832 O  O   . HOH G 3 .   ? 12.490 11.933  2.277   1.00 7.55  ? 378 HOH A O   1 
HETATM 4833 O  O   . HOH G 3 .   ? 29.965 21.452  6.494   1.00 23.81 ? 379 HOH A O   1 
HETATM 4834 O  O   . HOH G 3 .   ? 11.876 13.605  8.413   1.00 31.29 ? 380 HOH A O   1 
HETATM 4835 O  O   . HOH G 3 .   ? 5.608  -14.673 -2.099  1.00 32.15 ? 381 HOH A O   1 
HETATM 4836 O  O   . HOH G 3 .   ? 20.655 -22.302 -2.701  1.00 25.19 ? 382 HOH A O   1 
HETATM 4837 O  O   . HOH G 3 .   ? 38.740 15.371  4.321   1.00 42.04 ? 383 HOH A O   1 
HETATM 4838 O  O   . HOH G 3 .   ? 9.549  -8.809  15.149  1.00 23.86 ? 384 HOH A O   1 
HETATM 4839 O  O   . HOH G 3 .   ? 9.581  -16.459 12.808  1.00 35.26 ? 385 HOH A O   1 
HETATM 4840 O  O   . HOH G 3 .   ? 15.069 15.078  9.512   1.00 36.65 ? 386 HOH A O   1 
HETATM 4841 O  O   . HOH G 3 .   ? 1.730  -3.217  -1.260  1.00 21.63 ? 387 HOH A O   1 
HETATM 4842 O  O   . HOH G 3 .   ? 19.909 -10.062 -3.570  1.00 30.16 ? 388 HOH A O   1 
HETATM 4843 O  O   . HOH G 3 .   ? 2.593  -0.093  -6.506  1.00 22.70 ? 389 HOH A O   1 
HETATM 4844 O  O   . HOH G 3 .   ? 36.245 -12.573 -16.484 1.00 41.34 ? 390 HOH A O   1 
HETATM 4845 O  O   . HOH G 3 .   ? 15.012 15.847  -6.970  1.00 21.38 ? 391 HOH A O   1 
HETATM 4846 O  O   . HOH G 3 .   ? 33.581 -18.484 -13.757 1.00 13.17 ? 392 HOH A O   1 
HETATM 4847 O  O   . HOH G 3 .   ? 24.786 13.355  15.560  1.00 27.01 ? 393 HOH A O   1 
HETATM 4848 O  O   . HOH G 3 .   ? 21.448 -9.966  14.009  1.00 30.34 ? 394 HOH A O   1 
HETATM 4849 O  O   . HOH G 3 .   ? 43.800 -13.345 -16.849 1.00 37.51 ? 395 HOH A O   1 
HETATM 4850 O  O   . HOH G 3 .   ? 40.888 -20.130 -15.275 1.00 39.82 ? 396 HOH A O   1 
HETATM 4851 O  O   . HOH G 3 .   ? 5.241  -4.478  -15.981 1.00 41.37 ? 397 HOH A O   1 
HETATM 4852 O  O   . HOH G 3 .   ? 17.287 -0.840  -21.330 1.00 37.32 ? 398 HOH A O   1 
HETATM 4853 O  O   . HOH G 3 .   ? 12.580 15.186  12.595  1.00 37.01 ? 399 HOH A O   1 
HETATM 4854 O  O   . HOH G 3 .   ? 46.241 -4.440  -7.389  1.00 29.88 ? 400 HOH A O   1 
HETATM 4855 O  O   . HOH G 3 .   ? 26.381 10.304  -16.346 1.00 42.07 ? 401 HOH A O   1 
HETATM 4856 O  O   . HOH G 3 .   ? 16.523 -15.100 14.146  1.00 32.49 ? 402 HOH A O   1 
HETATM 4857 O  O   . HOH G 3 .   ? 39.230 -22.280 -11.138 1.00 23.62 ? 403 HOH A O   1 
HETATM 4858 O  O   . HOH G 3 .   ? 41.604 -3.636  0.049   1.00 28.93 ? 404 HOH A O   1 
HETATM 4859 O  O   . HOH G 3 .   ? 25.398 17.388  13.428  1.00 38.68 ? 405 HOH A O   1 
HETATM 4860 O  O   . HOH G 3 .   ? 42.960 1.766   1.714   1.00 35.42 ? 406 HOH A O   1 
HETATM 4861 O  O   . HOH G 3 .   ? 30.362 -5.396  18.246  1.00 33.94 ? 407 HOH A O   1 
HETATM 4862 O  O   . HOH G 3 .   ? 38.454 17.338  0.324   1.00 43.20 ? 408 HOH A O   1 
HETATM 4863 O  O   . HOH G 3 .   ? 8.636  -7.455  17.918  1.00 39.64 ? 409 HOH A O   1 
HETATM 4864 O  O   . HOH G 3 .   ? 8.793  -15.050 -3.093  1.00 29.01 ? 410 HOH A O   1 
HETATM 4865 O  O   . HOH G 3 .   ? 12.284 16.352  9.686   1.00 39.36 ? 411 HOH A O   1 
HETATM 4866 O  O   . HOH G 3 .   ? 41.184 1.950   12.545  1.00 28.74 ? 412 HOH A O   1 
HETATM 4867 O  O   . HOH G 3 .   ? 21.936 -16.863 -12.939 1.00 25.89 ? 413 HOH A O   1 
HETATM 4868 O  O   . HOH G 3 .   ? 30.461 18.338  6.976   1.00 48.88 ? 414 HOH A O   1 
HETATM 4869 O  O   . HOH G 3 .   ? 43.350 9.408   5.763   1.00 38.00 ? 415 HOH A O   1 
HETATM 4870 O  O   . HOH G 3 .   ? 1.373  -1.314  1.335   1.00 44.08 ? 416 HOH A O   1 
HETATM 4871 O  O   . HOH G 3 .   ? 15.799 17.234  -4.480  1.00 33.65 ? 417 HOH A O   1 
HETATM 4872 O  O   . HOH G 3 .   ? 46.321 -12.667 -0.532  1.00 32.60 ? 418 HOH A O   1 
HETATM 4873 O  O   . HOH G 3 .   ? 2.813  -1.028  -3.635  1.00 32.53 ? 419 HOH A O   1 
HETATM 4874 O  O   . HOH G 3 .   ? 2.401  -5.661  -15.626 1.00 33.65 ? 420 HOH A O   1 
HETATM 4875 O  O   . HOH G 3 .   ? 9.595  14.106  6.590   1.00 26.31 ? 421 HOH A O   1 
HETATM 4876 O  O   . HOH G 3 .   ? -0.333 -3.694  2.390   1.00 31.18 ? 422 HOH A O   1 
HETATM 4877 O  O   . HOH G 3 .   ? 24.485 -17.415 -4.504  1.00 29.91 ? 423 HOH A O   1 
HETATM 4878 O  O   . HOH G 3 .   ? 7.301  5.178   20.472  1.00 34.86 ? 424 HOH A O   1 
HETATM 4879 O  O   . HOH G 3 .   ? 13.851 14.052  -9.593  1.00 35.86 ? 425 HOH A O   1 
HETATM 4880 O  O   . HOH G 3 .   ? 20.800 -7.150  -13.612 1.00 31.77 ? 426 HOH A O   1 
HETATM 4881 O  O   . HOH G 3 .   ? 28.895 8.150   12.139  1.00 51.63 ? 427 HOH A O   1 
HETATM 4882 O  O   . HOH G 3 .   ? 28.133 8.402   18.441  1.00 36.92 ? 428 HOH A O   1 
HETATM 4883 O  O   . HOH G 3 .   ? 36.208 -16.928 13.172  1.00 37.55 ? 429 HOH A O   1 
HETATM 4884 O  O   . HOH G 3 .   ? 13.080 12.930  -5.170  1.00 39.53 ? 430 HOH A O   1 
HETATM 4885 O  O   . HOH G 3 .   ? 11.433 12.019  -8.266  1.00 37.72 ? 431 HOH A O   1 
HETATM 4886 O  O   . HOH G 3 .   ? -1.782 -1.718  4.161   1.00 47.72 ? 432 HOH A O   1 
HETATM 4887 O  O   . HOH G 3 .   ? 3.986  -9.708  -0.798  1.00 43.90 ? 433 HOH A O   1 
HETATM 4888 O  O   . HOH G 3 .   ? 35.914 -21.099 -2.046  1.00 46.07 ? 434 HOH A O   1 
HETATM 4889 O  O   . HOH G 3 .   ? 34.900 -5.178  12.416  1.00 21.95 ? 435 HOH A O   1 
HETATM 4890 O  O   . HOH G 3 .   ? 25.475 15.945  10.647  1.00 37.59 ? 436 HOH A O   1 
HETATM 4891 O  O   . HOH G 3 .   ? 18.992 -24.330 -0.787  1.00 27.81 ? 437 HOH A O   1 
HETATM 4892 O  O   . HOH G 3 .   ? 16.184 -13.098 -11.914 1.00 23.13 ? 438 HOH A O   1 
HETATM 4893 O  O   . HOH G 3 .   ? 18.126 -19.472 -5.893  1.00 45.60 ? 439 HOH A O   1 
HETATM 4894 O  O   . HOH G 3 .   ? 23.032 -12.875 17.447  1.00 25.50 ? 440 HOH A O   1 
HETATM 4895 O  O   . HOH G 3 .   ? 15.000 21.523  8.780   1.00 38.08 ? 441 HOH A O   1 
HETATM 4896 O  O   . HOH G 3 .   ? 22.434 -9.351  -5.056  1.00 33.52 ? 442 HOH A O   1 
HETATM 4897 O  O   . HOH G 3 .   ? 22.489 9.321   9.743   1.00 27.42 ? 443 HOH A O   1 
HETATM 4898 O  O   . HOH G 3 .   ? 10.472 -11.855 -11.250 1.00 45.64 ? 444 HOH A O   1 
HETATM 4899 O  O   . HOH G 3 .   ? 37.058 -15.013 2.021   1.00 30.47 ? 445 HOH A O   1 
HETATM 4900 O  O   . HOH G 3 .   ? 2.087  2.880   -7.629  1.00 28.76 ? 446 HOH A O   1 
HETATM 4901 O  O   . HOH G 3 .   ? 13.442 12.002  -1.384  1.00 23.03 ? 447 HOH A O   1 
HETATM 4902 O  O   . HOH G 3 .   ? 22.824 24.516  -3.722  1.00 32.31 ? 448 HOH A O   1 
HETATM 4903 O  O   . HOH G 3 .   ? 29.491 20.312  -2.666  1.00 35.14 ? 449 HOH A O   1 
HETATM 4904 O  O   . HOH G 3 .   ? 29.600 -14.300 -9.561  1.00 24.23 ? 450 HOH A O   1 
HETATM 4905 O  O   . HOH G 3 .   ? 31.904 -23.629 -4.253  1.00 37.24 ? 451 HOH A O   1 
HETATM 4906 O  O   . HOH G 3 .   ? 22.643 0.632   -8.374  1.00 21.85 ? 452 HOH A O   1 
HETATM 4907 O  O   . HOH G 3 .   ? 29.763 22.872  -5.291  1.00 28.08 ? 453 HOH A O   1 
HETATM 4908 O  O   . HOH G 3 .   ? 33.300 -16.531 6.919   1.00 19.13 ? 454 HOH A O   1 
HETATM 4909 O  O   . HOH G 3 .   ? 35.159 -8.650  5.598   1.00 41.92 ? 455 HOH A O   1 
HETATM 4910 O  O   . HOH G 3 .   ? 34.091 -19.839 13.796  1.00 27.83 ? 456 HOH A O   1 
HETATM 4911 O  O   . HOH G 3 .   ? 12.847 -18.915 -1.723  1.00 25.16 ? 457 HOH A O   1 
HETATM 4912 O  O   . HOH G 3 .   ? 18.075 18.167  -2.659  1.00 41.01 ? 458 HOH A O   1 
HETATM 4913 O  O   . HOH G 3 .   ? 21.325 -25.848 0.721   1.00 11.21 ? 459 HOH A O   1 
HETATM 4914 O  O   . HOH G 3 .   ? 37.027 -8.021  -13.494 1.00 48.56 ? 460 HOH A O   1 
HETATM 4915 O  O   . HOH G 3 .   ? 3.066  -6.761  -6.305  1.00 25.92 ? 461 HOH A O   1 
HETATM 4916 O  O   . HOH G 3 .   ? 11.847 34.260  2.169   1.00 30.09 ? 462 HOH A O   1 
HETATM 4917 O  O   . HOH G 3 .   ? 16.411 16.987  7.431   1.00 37.76 ? 463 HOH A O   1 
HETATM 4918 O  O   . HOH G 3 .   ? 31.600 7.643   10.303  1.00 26.84 ? 464 HOH A O   1 
HETATM 4919 O  O   . HOH G 3 .   ? 8.783  18.159  1.176   1.00 18.92 ? 465 HOH A O   1 
HETATM 4920 O  O   . HOH G 3 .   ? 26.791 -27.620 1.187   1.00 40.43 ? 466 HOH A O   1 
HETATM 4921 O  O   . HOH H 3 .   ? 38.875 -41.281 -25.916 1.00 19.59 ? 325 HOH B O   1 
HETATM 4922 O  O   . HOH H 3 .   ? 30.691 -37.595 -49.307 1.00 19.60 ? 326 HOH B O   1 
HETATM 4923 O  O   . HOH H 3 .   ? 42.690 -25.603 -31.555 1.00 14.01 ? 327 HOH B O   1 
HETATM 4924 O  O   . HOH H 3 .   ? 44.350 -23.574 -28.008 1.00 33.55 ? 328 HOH B O   1 
HETATM 4925 O  O   . HOH H 3 .   ? 30.785 -34.583 -54.593 1.00 15.05 ? 329 HOH B O   1 
HETATM 4926 O  O   . HOH H 3 .   ? 19.193 -12.051 -39.590 1.00 26.50 ? 330 HOH B O   1 
HETATM 4927 O  O   . HOH H 3 .   ? 42.236 -28.477 -32.743 1.00 16.32 ? 331 HOH B O   1 
HETATM 4928 O  O   . HOH H 3 .   ? 13.885 -25.391 -20.418 1.00 14.44 ? 332 HOH B O   1 
HETATM 4929 O  O   . HOH H 3 .   ? 26.117 -21.453 -43.418 1.00 10.05 ? 333 HOH B O   1 
HETATM 4930 O  O   . HOH H 3 .   ? 22.912 -19.169 -20.235 1.00 9.37  ? 334 HOH B O   1 
HETATM 4931 O  O   . HOH H 3 .   ? 7.509  -39.963 -40.598 1.00 18.23 ? 335 HOH B O   1 
HETATM 4932 O  O   . HOH H 3 .   ? 30.451 -19.930 -49.314 1.00 13.53 ? 336 HOH B O   1 
HETATM 4933 O  O   . HOH H 3 .   ? 31.551 -13.271 -20.906 1.00 36.41 ? 337 HOH B O   1 
HETATM 4934 O  O   . HOH H 3 .   ? 22.350 -43.654 -30.807 1.00 16.67 ? 338 HOH B O   1 
HETATM 4935 O  O   . HOH H 3 .   ? 12.479 -23.459 -49.024 1.00 14.77 ? 339 HOH B O   1 
HETATM 4936 O  O   . HOH H 3 .   ? 32.521 -20.911 -17.183 1.00 14.23 ? 340 HOH B O   1 
HETATM 4937 O  O   . HOH H 3 .   ? 14.673 -14.956 -44.801 1.00 47.95 ? 341 HOH B O   1 
HETATM 4938 O  O   . HOH H 3 .   ? 37.921 -14.722 -36.949 1.00 28.65 ? 342 HOH B O   1 
HETATM 4939 O  O   . HOH H 3 .   ? 33.313 -32.436 -21.166 1.00 7.09  ? 343 HOH B O   1 
HETATM 4940 O  O   . HOH H 3 .   ? 41.444 -27.653 -22.016 1.00 15.21 ? 344 HOH B O   1 
HETATM 4941 O  O   . HOH H 3 .   ? 28.277 -45.277 -47.703 1.00 14.49 ? 345 HOH B O   1 
HETATM 4942 O  O   . HOH H 3 .   ? 28.273 -17.721 -49.564 1.00 24.51 ? 346 HOH B O   1 
HETATM 4943 O  O   . HOH H 3 .   ? 35.495 -19.628 -18.379 1.00 18.62 ? 347 HOH B O   1 
HETATM 4944 O  O   . HOH H 3 .   ? 0.029  -27.521 -30.721 1.00 34.18 ? 348 HOH B O   1 
HETATM 4945 O  O   . HOH H 3 .   ? 27.504 -50.868 -43.687 1.00 29.98 ? 349 HOH B O   1 
HETATM 4946 O  O   . HOH H 3 .   ? 22.711 -53.096 -33.309 1.00 28.71 ? 350 HOH B O   1 
HETATM 4947 O  O   . HOH H 3 .   ? 24.290 -22.753 -45.742 1.00 30.74 ? 351 HOH B O   1 
HETATM 4948 O  O   . HOH H 3 .   ? 41.208 -26.283 -28.528 1.00 13.63 ? 352 HOH B O   1 
HETATM 4949 O  O   . HOH H 3 .   ? 36.118 -31.715 -21.423 1.00 16.48 ? 353 HOH B O   1 
HETATM 4950 O  O   . HOH H 3 .   ? 37.793 -23.401 -47.448 1.00 27.60 ? 354 HOH B O   1 
HETATM 4951 O  O   . HOH H 3 .   ? 1.323  -11.810 -37.730 1.00 25.88 ? 355 HOH B O   1 
HETATM 4952 O  O   . HOH H 3 .   ? 12.171 -22.435 -40.588 1.00 22.53 ? 356 HOH B O   1 
HETATM 4953 O  O   . HOH H 3 .   ? 16.396 -20.322 -53.259 1.00 17.87 ? 357 HOH B O   1 
HETATM 4954 O  O   . HOH H 3 .   ? 37.917 -17.012 -34.835 1.00 18.52 ? 358 HOH B O   1 
HETATM 4955 O  O   . HOH H 3 .   ? 44.356 -21.232 -30.013 1.00 22.23 ? 359 HOH B O   1 
HETATM 4956 O  O   . HOH H 3 .   ? 20.209 -30.701 -44.152 1.00 31.00 ? 360 HOH B O   1 
HETATM 4957 O  O   . HOH H 3 .   ? 16.637 -37.010 -49.473 1.00 21.02 ? 361 HOH B O   1 
HETATM 4958 O  O   . HOH H 3 .   ? 30.776 -23.463 -58.064 1.00 20.74 ? 362 HOH B O   1 
HETATM 4959 O  O   . HOH H 3 .   ? 28.481 -47.758 -44.543 1.00 18.06 ? 363 HOH B O   1 
HETATM 4960 O  O   . HOH H 3 .   ? 18.774 -9.259  -47.862 1.00 30.87 ? 364 HOH B O   1 
HETATM 4961 O  O   . HOH H 3 .   ? 35.882 -40.111 -20.608 1.00 21.08 ? 365 HOH B O   1 
HETATM 4962 O  O   . HOH H 3 .   ? 14.740 -22.721 -20.452 1.00 19.67 ? 366 HOH B O   1 
HETATM 4963 O  O   . HOH H 3 .   ? 12.406 -21.628 -18.115 1.00 24.44 ? 367 HOH B O   1 
HETATM 4964 O  O   . HOH H 3 .   ? 20.008 -24.688 -13.345 1.00 23.27 ? 368 HOH B O   1 
HETATM 4965 O  O   . HOH H 3 .   ? 37.410 -12.163 -23.589 1.00 29.85 ? 369 HOH B O   1 
HETATM 4966 O  O   . HOH H 3 .   ? 4.963  -24.855 -29.438 1.00 27.25 ? 370 HOH B O   1 
HETATM 4967 O  O   . HOH H 3 .   ? 34.806 -13.498 -21.833 1.00 20.79 ? 371 HOH B O   1 
HETATM 4968 O  O   . HOH H 3 .   ? 33.654 -26.816 -14.948 1.00 18.97 ? 372 HOH B O   1 
HETATM 4969 O  O   . HOH H 3 .   ? 8.803  -15.238 -29.142 1.00 27.96 ? 373 HOH B O   1 
HETATM 4970 O  O   . HOH H 3 .   ? 18.296 -21.115 -8.657  1.00 42.99 ? 374 HOH B O   1 
HETATM 4971 O  O   . HOH H 3 .   ? 25.980 -42.293 -34.775 1.00 38.71 ? 375 HOH B O   1 
HETATM 4972 O  O   . HOH H 3 .   ? 2.247  -17.661 -28.734 1.00 34.54 ? 376 HOH B O   1 
HETATM 4973 O  O   . HOH H 3 .   ? 16.232 -49.204 -29.469 1.00 34.74 ? 377 HOH B O   1 
HETATM 4974 O  O   . HOH H 3 .   ? 30.206 -16.219 -21.031 1.00 18.02 ? 378 HOH B O   1 
HETATM 4975 O  O   . HOH H 3 .   ? 36.397 -43.155 -19.934 1.00 31.43 ? 379 HOH B O   1 
HETATM 4976 O  O   . HOH H 3 .   ? 32.598 -50.664 -40.199 1.00 45.45 ? 380 HOH B O   1 
HETATM 4977 O  O   . HOH H 3 .   ? 33.506 -17.768 -16.949 1.00 28.84 ? 381 HOH B O   1 
HETATM 4978 O  O   . HOH H 3 .   ? 12.313 -17.271 -18.287 1.00 39.86 ? 382 HOH B O   1 
HETATM 4979 O  O   . HOH H 3 .   ? 16.472 -14.471 -47.211 1.00 29.84 ? 383 HOH B O   1 
HETATM 4980 O  O   . HOH H 3 .   ? 31.357 -40.373 -29.240 1.00 29.27 ? 384 HOH B O   1 
HETATM 4981 O  O   . HOH H 3 .   ? 29.222 -6.909  -32.686 1.00 41.01 ? 385 HOH B O   1 
HETATM 4982 O  O   . HOH H 3 .   ? 23.335 -21.105 -48.170 1.00 36.61 ? 386 HOH B O   1 
HETATM 4983 O  O   . HOH H 3 .   ? 44.012 -24.865 -34.204 1.00 44.66 ? 387 HOH B O   1 
HETATM 4984 O  O   . HOH H 3 .   ? 41.738 -24.185 -19.313 1.00 41.39 ? 388 HOH B O   1 
HETATM 4985 O  O   . HOH H 3 .   ? 2.217  -11.513 -29.646 1.00 30.69 ? 389 HOH B O   1 
HETATM 4986 O  O   . HOH H 3 .   ? 14.148 -24.179 -17.103 1.00 23.63 ? 390 HOH B O   1 
HETATM 4987 O  O   . HOH H 3 .   ? 29.690 -35.262 -51.148 1.00 24.92 ? 391 HOH B O   1 
HETATM 4988 O  O   . HOH H 3 .   ? 30.961 -36.271 -21.344 1.00 25.87 ? 392 HOH B O   1 
HETATM 4989 O  O   . HOH H 3 .   ? 27.100 -29.261 -47.299 1.00 35.30 ? 393 HOH B O   1 
HETATM 4990 O  O   . HOH H 3 .   ? 41.667 -23.056 -16.419 1.00 37.31 ? 394 HOH B O   1 
HETATM 4991 O  O   . HOH H 3 .   ? 33.109 -45.031 -44.485 1.00 45.98 ? 395 HOH B O   1 
HETATM 4992 O  O   . HOH H 3 .   ? 34.208 -47.005 -26.881 1.00 30.39 ? 396 HOH B O   1 
HETATM 4993 O  O   . HOH H 3 .   ? 16.459 -35.426 -17.870 1.00 38.68 ? 397 HOH B O   1 
HETATM 4994 O  O   . HOH H 3 .   ? 32.569 -20.822 -41.121 1.00 29.13 ? 398 HOH B O   1 
HETATM 4995 O  O   . HOH H 3 .   ? 27.426 -46.542 -25.309 1.00 50.05 ? 399 HOH B O   1 
HETATM 4996 O  O   . HOH H 3 .   ? -0.737 -17.200 -50.707 1.00 31.15 ? 400 HOH B O   1 
HETATM 4997 O  O   . HOH H 3 .   ? 31.648 -47.183 -42.848 1.00 33.59 ? 401 HOH B O   1 
HETATM 4998 O  O   . HOH H 3 .   ? 31.095 -35.187 -18.570 1.00 41.90 ? 402 HOH B O   1 
HETATM 4999 O  O   . HOH H 3 .   ? 45.238 -22.113 -24.923 1.00 33.43 ? 403 HOH B O   1 
HETATM 5000 O  O   . HOH H 3 .   ? 44.935 -23.370 -15.561 1.00 33.83 ? 404 HOH B O   1 
HETATM 5001 O  O   . HOH H 3 .   ? 19.982 0.406   -22.693 1.00 43.26 ? 405 HOH B O   1 
HETATM 5002 O  O   . HOH H 3 .   ? 40.976 -30.013 -19.701 1.00 35.08 ? 406 HOH B O   1 
HETATM 5003 O  O   . HOH H 3 .   ? 31.918 -28.050 -57.473 1.00 31.71 ? 407 HOH B O   1 
HETATM 5004 O  O   . HOH H 3 .   ? 8.485  -47.415 -34.434 1.00 42.30 ? 408 HOH B O   1 
HETATM 5005 O  O   . HOH H 3 .   ? 42.770 -22.685 -36.521 1.00 47.36 ? 409 HOH B O   1 
HETATM 5006 O  O   . HOH H 3 .   ? 1.160  -27.452 -44.880 1.00 34.87 ? 410 HOH B O   1 
HETATM 5007 O  O   . HOH H 3 .   ? 8.485  -37.102 -21.658 1.00 46.06 ? 411 HOH B O   1 
HETATM 5008 O  O   . HOH H 3 .   ? 32.325 -23.551 -42.320 1.00 32.64 ? 412 HOH B O   1 
HETATM 5009 O  O   . HOH H 3 .   ? 7.001  -5.999  -45.619 1.00 34.38 ? 413 HOH B O   1 
HETATM 5010 O  O   . HOH H 3 .   ? 6.684  -18.217 -50.072 1.00 48.51 ? 414 HOH B O   1 
HETATM 5011 O  O   . HOH H 3 .   ? 3.500  -34.836 -37.389 1.00 30.45 ? 415 HOH B O   1 
HETATM 5012 O  O   . HOH H 3 .   ? 30.504 -48.927 -28.504 1.00 21.07 ? 416 HOH B O   1 
HETATM 5013 O  O   . HOH H 3 .   ? 33.940 -48.148 -39.634 1.00 45.22 ? 417 HOH B O   1 
HETATM 5014 O  O   . HOH H 3 .   ? 15.899 -31.924 -33.055 1.00 19.15 ? 418 HOH B O   1 
HETATM 5015 O  O   . HOH H 3 .   ? 10.816 -25.297 -51.118 1.00 38.78 ? 419 HOH B O   1 
HETATM 5016 O  O   . HOH H 3 .   ? 8.915  -39.647 -23.920 1.00 35.99 ? 420 HOH B O   1 
HETATM 5017 O  O   . HOH H 3 .   ? -1.172 -25.005 -44.545 1.00 40.95 ? 421 HOH B O   1 
HETATM 5018 O  O   . HOH H 3 .   ? 20.540 -39.964 -24.171 1.00 47.16 ? 422 HOH B O   1 
HETATM 5019 O  O   . HOH H 3 .   ? 13.435 -35.769 -17.113 1.00 26.19 ? 423 HOH B O   1 
HETATM 5020 O  O   . HOH H 3 .   ? 13.321 -25.298 -54.661 1.00 30.64 ? 424 HOH B O   1 
HETATM 5021 O  O   . HOH H 3 .   ? 19.774 -20.983 -13.879 1.00 30.61 ? 425 HOH B O   1 
HETATM 5022 O  O   . HOH H 3 .   ? 28.117 -33.013 -55.704 1.00 33.26 ? 426 HOH B O   1 
HETATM 5023 O  O   . HOH H 3 .   ? 26.413 -35.323 -54.052 1.00 29.74 ? 427 HOH B O   1 
HETATM 5024 O  O   . HOH H 3 .   ? 10.220 -37.290 -19.160 1.00 42.62 ? 428 HOH B O   1 
HETATM 5025 O  O   . HOH H 3 .   ? 34.328 -56.243 -27.044 1.00 48.17 ? 429 HOH B O   1 
HETATM 5026 O  O   . HOH H 3 .   ? 21.970 -19.710 -39.750 1.00 40.43 ? 430 HOH B O   1 
HETATM 5027 O  O   . HOH H 3 .   ? 4.552  -6.223  -50.879 1.00 27.35 ? 431 HOH B O   1 
HETATM 5028 O  O   . HOH H 3 .   ? 28.157 -46.645 -28.453 1.00 35.62 ? 432 HOH B O   1 
HETATM 5029 O  O   . HOH H 3 .   ? 35.255 -14.707 -42.607 1.00 45.57 ? 433 HOH B O   1 
HETATM 5030 O  O   . HOH H 3 .   ? 42.086 -26.942 -50.542 1.00 33.81 ? 434 HOH B O   1 
HETATM 5031 O  O   . HOH H 3 .   ? -2.779 -14.634 -53.554 1.00 20.40 ? 435 HOH B O   1 
HETATM 5032 O  O   . HOH H 3 .   ? 24.090 -18.730 -37.910 1.00 40.43 ? 436 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   LYS 4   4   ?   ?   ?   A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  GLN 43  43  43  GLN GLN A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  CYS 45  45  45  CYS CYS A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  TYR 50  50  50  TYR TYR A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  ASP 57  57  57  ASP ASP A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  ASN 69  69  69  ASN ASN A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  ARG 71  71  71  ARG ARG A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  GLN 79  79  79  GLN GLN A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 HIS 101 101 101 HIS HIS A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 SER 107 107 107 SER SER A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 HIS 111 111 111 HIS HIS A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 HIS 115 115 115 HIS HIS A . n 
A 1 116 PRO 116 116 116 PRO PRO A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 TRP 122 122 122 TRP TRP A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 ASP 124 124 124 ASP ASP A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 HIS 126 126 126 HIS HIS A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 ASN 130 130 130 ASN ASN A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 PRO 132 132 132 PRO PRO A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 ASN 139 139 139 ASN ASN A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 HIS 141 141 141 HIS HIS A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 GLN 143 143 143 GLN GLN A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 PHE 162 162 162 PHE PHE A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 TRP 164 164 164 TRP TRP A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 THR 166 166 166 THR THR A . n 
A 1 167 PRO 167 167 167 PRO PRO A . n 
A 1 168 CYS 168 168 168 CYS CYS A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 SER 170 170 170 SER SER A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 LYS 172 172 172 LYS LYS A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 TYR 176 176 176 TYR TYR A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 HIS 187 187 187 HIS HIS A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 THR 192 192 192 THR THR A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 GLY 194 194 194 GLY GLY A . n 
A 1 195 ILE 195 195 195 ILE ILE A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 TYR 197 197 197 TYR TYR A . n 
A 1 198 PHE 198 198 198 PHE PHE A . n 
A 1 199 SER 199 199 199 SER SER A . n 
A 1 200 MET 200 200 200 MET MET A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 ARG 205 205 205 ARG ARG A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 ILE 208 208 208 ILE ILE A . n 
A 1 209 GLY 209 209 209 GLY GLY A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 MET 212 212 212 MET MET A . n 
A 1 213 GLU 213 213 213 GLU GLU A . n 
A 1 214 GLU 214 214 214 GLU GLU A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 SER 217 217 217 SER SER A . n 
A 1 218 TYR 218 218 218 TYR TYR A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 LYS 224 224 224 LYS LYS A . n 
A 1 225 ARG 225 225 225 ARG ARG A . n 
A 1 226 PRO 226 226 226 PRO PRO A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 HIS 228 228 228 HIS HIS A . n 
A 1 229 LEU 229 229 229 LEU LEU A . n 
A 1 230 SER 230 230 230 SER SER A . n 
A 1 231 PHE 231 231 231 PHE PHE A . n 
A 1 232 ASP 232 232 232 ASP ASP A . n 
A 1 233 VAL 233 233 233 VAL VAL A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 ASP 237 237 237 ASP ASP A . n 
A 1 238 PRO 238 238 238 PRO PRO A . n 
A 1 239 SER 239 239 239 SER SER A . n 
A 1 240 PHE 240 240 240 PHE PHE A . n 
A 1 241 THR 241 241 241 THR THR A . n 
A 1 242 PRO 242 242 242 PRO PRO A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 THR 246 246 246 THR THR A . n 
A 1 247 PRO 247 247 247 PRO PRO A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 VAL 249 249 249 VAL VAL A . n 
A 1 250 GLY 250 250 250 GLY GLY A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 TYR 254 254 254 TYR TYR A . n 
A 1 255 ARG 255 255 255 ARG ARG A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 GLY 257 257 257 GLY GLY A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 TYR 259 259 259 TYR TYR A . n 
A 1 260 ILE 260 260 260 ILE ILE A . n 
A 1 261 THR 261 261 261 THR THR A . n 
A 1 262 GLU 262 262 262 GLU GLU A . n 
A 1 263 GLU 263 263 263 GLU GLU A . n 
A 1 264 ILE 264 264 264 ILE ILE A . n 
A 1 265 TYR 265 265 265 TYR TYR A . n 
A 1 266 LYS 266 266 266 LYS LYS A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 LEU 270 270 270 LEU LEU A . n 
A 1 271 SER 271 271 271 SER SER A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ASP 274 274 274 ASP ASP A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 MET 276 276 276 MET MET A . n 
A 1 277 GLU 277 277 277 GLU GLU A . n 
A 1 278 VAL 278 278 278 VAL VAL A . n 
A 1 279 ASN 279 279 279 ASN ASN A . n 
A 1 280 PRO 280 280 280 PRO PRO A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 LYS 284 284 284 LYS LYS A . n 
A 1 285 THR 285 285 285 THR THR A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 GLU 287 287 287 GLU GLU A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 VAL 289 289 289 VAL VAL A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 THR 292 292 292 THR THR A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 ASN 294 294 294 ASN ASN A . n 
A 1 295 THR 295 295 295 THR THR A . n 
A 1 296 ALA 296 296 296 ALA ALA A . n 
A 1 297 VAL 297 297 297 VAL VAL A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 ILE 299 299 299 ILE ILE A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 ALA 302 302 302 ALA ALA A . n 
A 1 303 CYS 303 303 303 CYS CYS A . n 
A 1 304 PHE 304 304 304 PHE PHE A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 ALA 307 307 307 ALA ALA A . n 
A 1 308 ARG 308 308 308 ARG ARG A . n 
A 1 309 GLU 309 309 309 GLU GLU A . n 
A 1 310 GLY 310 310 310 GLY GLY A . n 
A 1 311 ASN 311 311 311 ASN ASN A . n 
A 1 312 HIS 312 312 312 HIS HIS A . n 
A 1 313 LYS 313 313 313 LYS LYS A . n 
A 1 314 PRO 314 314 314 PRO PRO A . n 
A 1 315 ILE 315 315 315 ILE ILE A . n 
A 1 316 ASP 316 316 316 ASP ASP A . n 
A 1 317 TYR 317 317 317 TYR TYR A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 ASN 319 319 ?   ?   ?   A . n 
A 1 320 PRO 320 320 ?   ?   ?   A . n 
A 1 321 PRO 321 321 ?   ?   ?   A . n 
A 1 322 LYS 322 322 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   ALA 3   3   ?   ?   ?   B . n 
B 1 4   LYS 4   4   ?   ?   ?   B . n 
B 1 5   SER 5   5   5   SER SER B . n 
B 1 6   ARG 6   6   6   ARG ARG B . n 
B 1 7   THR 7   7   7   THR THR B . n 
B 1 8   ILE 8   8   8   ILE ILE B . n 
B 1 9   GLY 9   9   9   GLY GLY B . n 
B 1 10  ILE 10  10  10  ILE ILE B . n 
B 1 11  ILE 11  11  11  ILE ILE B . n 
B 1 12  GLY 12  12  12  GLY GLY B . n 
B 1 13  ALA 13  13  13  ALA ALA B . n 
B 1 14  PRO 14  14  14  PRO PRO B . n 
B 1 15  PHE 15  15  15  PHE PHE B . n 
B 1 16  SER 16  16  16  SER SER B . n 
B 1 17  LYS 17  17  17  LYS LYS B . n 
B 1 18  GLY 18  18  18  GLY GLY B . n 
B 1 19  GLN 19  19  19  GLN GLN B . n 
B 1 20  PRO 20  20  20  PRO PRO B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  GLY 22  22  22  GLY GLY B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  GLU 25  25  25  GLU GLU B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  THR 29  29  29  THR THR B . n 
B 1 30  VAL 30  30  30  VAL VAL B . n 
B 1 31  LEU 31  31  31  LEU LEU B . n 
B 1 32  ARG 32  32  32  ARG ARG B . n 
B 1 33  LYS 33  33  33  LYS LYS B . n 
B 1 34  ALA 34  34  34  ALA ALA B . n 
B 1 35  GLY 35  35  35  GLY GLY B . n 
B 1 36  LEU 36  36  36  LEU LEU B . n 
B 1 37  LEU 37  37  37  LEU LEU B . n 
B 1 38  GLU 38  38  38  GLU GLU B . n 
B 1 39  LYS 39  39  39  LYS LYS B . n 
B 1 40  LEU 40  40  40  LEU LEU B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  GLU 42  42  42  GLU GLU B . n 
B 1 43  GLN 43  43  43  GLN GLN B . n 
B 1 44  GLU 44  44  44  GLU GLU B . n 
B 1 45  CYS 45  45  45  CYS CYS B . n 
B 1 46  ASP 46  46  46  ASP ASP B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  LYS 48  48  48  LYS LYS B . n 
B 1 49  ASP 49  49  49  ASP ASP B . n 
B 1 50  TYR 50  50  50  TYR TYR B . n 
B 1 51  GLY 51  51  51  GLY GLY B . n 
B 1 52  ASP 52  52  52  ASP ASP B . n 
B 1 53  LEU 53  53  53  LEU LEU B . n 
B 1 54  PRO 54  54  54  PRO PRO B . n 
B 1 55  PHE 55  55  55  PHE PHE B . n 
B 1 56  ALA 56  56  56  ALA ALA B . n 
B 1 57  ASP 57  57  57  ASP ASP B . n 
B 1 58  ILE 58  58  58  ILE ILE B . n 
B 1 59  PRO 59  59  59  PRO PRO B . n 
B 1 60  ASN 60  60  60  ASN ASN B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  SER 62  62  62  SER SER B . n 
B 1 63  PRO 63  63  63  PRO PRO B . n 
B 1 64  PHE 64  64  64  PHE PHE B . n 
B 1 65  GLN 65  65  65  GLN GLN B . n 
B 1 66  ILE 66  66  66  ILE ILE B . n 
B 1 67  VAL 67  67  67  VAL VAL B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  ASN 69  69  69  ASN ASN B . n 
B 1 70  PRO 70  70  70  PRO PRO B . n 
B 1 71  ARG 71  71  71  ARG ARG B . n 
B 1 72  SER 72  72  72  SER SER B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  GLY 74  74  74  GLY GLY B . n 
B 1 75  LYS 75  75  75  LYS LYS B . n 
B 1 76  ALA 76  76  76  ALA ALA B . n 
B 1 77  SER 77  77  77  SER SER B . n 
B 1 78  GLU 78  78  78  GLU GLU B . n 
B 1 79  GLN 79  79  79  GLN GLN B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  ALA 81  81  81  ALA ALA B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  LYS 83  83  83  LYS LYS B . n 
B 1 84  VAL 84  84  84  VAL VAL B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  GLU 86  86  86  GLU GLU B . n 
B 1 87  VAL 87  87  87  VAL VAL B . n 
B 1 88  LYS 88  88  88  LYS LYS B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  ASN 90  90  90  ASN ASN B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  ARG 92  92  92  ARG ARG B . n 
B 1 93  ILE 93  93  93  ILE ILE B . n 
B 1 94  SER 94  94  94  SER SER B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  VAL 96  96  96  VAL VAL B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  GLY 98  98  98  GLY GLY B . n 
B 1 99  GLY 99  99  99  GLY GLY B . n 
B 1 100 ASP 100 100 100 ASP ASP B . n 
B 1 101 HIS 101 101 101 HIS HIS B . n 
B 1 102 SER 102 102 102 SER SER B . n 
B 1 103 LEU 103 103 103 LEU LEU B . n 
B 1 104 ALA 104 104 104 ALA ALA B . n 
B 1 105 ILE 105 105 105 ILE ILE B . n 
B 1 106 GLY 106 106 106 GLY GLY B . n 
B 1 107 SER 107 107 107 SER SER B . n 
B 1 108 ILE 108 108 108 ILE ILE B . n 
B 1 109 SER 109 109 109 SER SER B . n 
B 1 110 GLY 110 110 110 GLY GLY B . n 
B 1 111 HIS 111 111 111 HIS HIS B . n 
B 1 112 ALA 112 112 112 ALA ALA B . n 
B 1 113 ARG 113 113 113 ARG ARG B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 HIS 115 115 115 HIS HIS B . n 
B 1 116 PRO 116 116 116 PRO PRO B . n 
B 1 117 ASP 117 117 117 ASP ASP B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 GLY 119 119 119 GLY GLY B . n 
B 1 120 VAL 120 120 120 VAL VAL B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 TRP 122 122 122 TRP TRP B . n 
B 1 123 VAL 123 123 123 VAL VAL B . n 
B 1 124 ASP 124 124 124 ASP ASP B . n 
B 1 125 ALA 125 125 125 ALA ALA B . n 
B 1 126 HIS 126 126 126 HIS HIS B . n 
B 1 127 THR 127 127 127 THR THR B . n 
B 1 128 ASP 128 128 128 ASP ASP B . n 
B 1 129 ILE 129 129 129 ILE ILE B . n 
B 1 130 ASN 130 130 130 ASN ASN B . n 
B 1 131 THR 131 131 131 THR THR B . n 
B 1 132 PRO 132 132 132 PRO PRO B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 THR 134 134 134 THR THR B . n 
B 1 135 THR 135 135 135 THR THR B . n 
B 1 136 THR 136 136 136 THR THR B . n 
B 1 137 SER 137 137 137 SER SER B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 ASN 139 139 139 ASN ASN B . n 
B 1 140 LEU 140 140 140 LEU LEU B . n 
B 1 141 HIS 141 141 141 HIS HIS B . n 
B 1 142 GLY 142 142 142 GLY GLY B . n 
B 1 143 GLN 143 143 143 GLN GLN B . n 
B 1 144 PRO 144 144 144 PRO PRO B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 SER 146 146 146 SER SER B . n 
B 1 147 PHE 147 147 147 PHE PHE B . n 
B 1 148 LEU 148 148 148 LEU LEU B . n 
B 1 149 LEU 149 149 149 LEU LEU B . n 
B 1 150 LYS 150 150 150 LYS LYS B . n 
B 1 151 GLU 151 151 151 GLU GLU B . n 
B 1 152 LEU 152 152 152 LEU LEU B . n 
B 1 153 LYS 153 153 153 LYS LYS B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 LYS 155 155 155 LYS LYS B . n 
B 1 156 ILE 156 156 156 ILE ILE B . n 
B 1 157 PRO 157 157 157 PRO PRO B . n 
B 1 158 ASP 158 158 158 ASP ASP B . n 
B 1 159 VAL 159 159 159 VAL VAL B . n 
B 1 160 PRO 160 160 160 PRO PRO B . n 
B 1 161 GLY 161 161 161 GLY GLY B . n 
B 1 162 PHE 162 162 162 PHE PHE B . n 
B 1 163 SER 163 163 163 SER SER B . n 
B 1 164 TRP 164 164 164 TRP TRP B . n 
B 1 165 VAL 165 165 165 VAL VAL B . n 
B 1 166 THR 166 166 166 THR THR B . n 
B 1 167 PRO 167 167 167 PRO PRO B . n 
B 1 168 CYS 168 168 168 CYS CYS B . n 
B 1 169 ILE 169 169 169 ILE ILE B . n 
B 1 170 SER 170 170 170 SER SER B . n 
B 1 171 ALA 171 171 171 ALA ALA B . n 
B 1 172 LYS 172 172 172 LYS LYS B . n 
B 1 173 ASP 173 173 173 ASP ASP B . n 
B 1 174 ILE 174 174 174 ILE ILE B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 TYR 176 176 176 TYR TYR B . n 
B 1 177 ILE 177 177 177 ILE ILE B . n 
B 1 178 GLY 178 178 178 GLY GLY B . n 
B 1 179 LEU 179 179 179 LEU LEU B . n 
B 1 180 ARG 180 180 180 ARG ARG B . n 
B 1 181 ASP 181 181 181 ASP ASP B . n 
B 1 182 VAL 182 182 182 VAL VAL B . n 
B 1 183 ASP 183 183 183 ASP ASP B . n 
B 1 184 PRO 184 184 184 PRO PRO B . n 
B 1 185 GLY 185 185 185 GLY GLY B . n 
B 1 186 GLU 186 186 186 GLU GLU B . n 
B 1 187 HIS 187 187 187 HIS HIS B . n 
B 1 188 TYR 188 188 188 TYR TYR B . n 
B 1 189 ILE 189 189 189 ILE ILE B . n 
B 1 190 LEU 190 190 190 LEU LEU B . n 
B 1 191 LYS 191 191 191 LYS LYS B . n 
B 1 192 THR 192 192 192 THR THR B . n 
B 1 193 LEU 193 193 193 LEU LEU B . n 
B 1 194 GLY 194 194 194 GLY GLY B . n 
B 1 195 ILE 195 195 195 ILE ILE B . n 
B 1 196 LYS 196 196 196 LYS LYS B . n 
B 1 197 TYR 197 197 197 TYR TYR B . n 
B 1 198 PHE 198 198 198 PHE PHE B . n 
B 1 199 SER 199 199 199 SER SER B . n 
B 1 200 MET 200 200 200 MET MET B . n 
B 1 201 THR 201 201 201 THR THR B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 VAL 203 203 203 VAL VAL B . n 
B 1 204 ASP 204 204 204 ASP ASP B . n 
B 1 205 ARG 205 205 205 ARG ARG B . n 
B 1 206 LEU 206 206 206 LEU LEU B . n 
B 1 207 GLY 207 207 207 GLY GLY B . n 
B 1 208 ILE 208 208 208 ILE ILE B . n 
B 1 209 GLY 209 209 209 GLY GLY B . n 
B 1 210 LYS 210 210 210 LYS LYS B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 MET 212 212 212 MET MET B . n 
B 1 213 GLU 213 213 213 GLU GLU B . n 
B 1 214 GLU 214 214 214 GLU GLU B . n 
B 1 215 THR 215 215 215 THR THR B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 SER 217 217 217 SER SER B . n 
B 1 218 TYR 218 218 218 TYR TYR B . n 
B 1 219 LEU 219 219 219 LEU LEU B . n 
B 1 220 LEU 220 220 220 LEU LEU B . n 
B 1 221 GLY 221 221 221 GLY GLY B . n 
B 1 222 ARG 222 222 222 ARG ARG B . n 
B 1 223 LYS 223 223 223 LYS LYS B . n 
B 1 224 LYS 224 224 224 LYS LYS B . n 
B 1 225 ARG 225 225 225 ARG ARG B . n 
B 1 226 PRO 226 226 226 PRO PRO B . n 
B 1 227 ILE 227 227 227 ILE ILE B . n 
B 1 228 HIS 228 228 228 HIS HIS B . n 
B 1 229 LEU 229 229 229 LEU LEU B . n 
B 1 230 SER 230 230 230 SER SER B . n 
B 1 231 PHE 231 231 231 PHE PHE B . n 
B 1 232 ASP 232 232 232 ASP ASP B . n 
B 1 233 VAL 233 233 233 VAL VAL B . n 
B 1 234 ASP 234 234 234 ASP ASP B . n 
B 1 235 GLY 235 235 235 GLY GLY B . n 
B 1 236 LEU 236 236 236 LEU LEU B . n 
B 1 237 ASP 237 237 237 ASP ASP B . n 
B 1 238 PRO 238 238 238 PRO PRO B . n 
B 1 239 SER 239 239 239 SER SER B . n 
B 1 240 PHE 240 240 240 PHE PHE B . n 
B 1 241 THR 241 241 241 THR THR B . n 
B 1 242 PRO 242 242 242 PRO PRO B . n 
B 1 243 ALA 243 243 243 ALA ALA B . n 
B 1 244 THR 244 244 244 THR THR B . n 
B 1 245 GLY 245 245 245 GLY GLY B . n 
B 1 246 THR 246 246 246 THR THR B . n 
B 1 247 PRO 247 247 247 PRO PRO B . n 
B 1 248 VAL 248 248 248 VAL VAL B . n 
B 1 249 VAL 249 249 249 VAL VAL B . n 
B 1 250 GLY 250 250 250 GLY GLY B . n 
B 1 251 GLY 251 251 251 GLY GLY B . n 
B 1 252 LEU 252 252 252 LEU LEU B . n 
B 1 253 THR 253 253 253 THR THR B . n 
B 1 254 TYR 254 254 254 TYR TYR B . n 
B 1 255 ARG 255 255 255 ARG ARG B . n 
B 1 256 GLU 256 256 256 GLU GLU B . n 
B 1 257 GLY 257 257 257 GLY GLY B . n 
B 1 258 LEU 258 258 258 LEU LEU B . n 
B 1 259 TYR 259 259 259 TYR TYR B . n 
B 1 260 ILE 260 260 260 ILE ILE B . n 
B 1 261 THR 261 261 261 THR THR B . n 
B 1 262 GLU 262 262 262 GLU GLU B . n 
B 1 263 GLU 263 263 263 GLU GLU B . n 
B 1 264 ILE 264 264 264 ILE ILE B . n 
B 1 265 TYR 265 265 265 TYR TYR B . n 
B 1 266 LYS 266 266 266 LYS LYS B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLY 268 268 268 GLY GLY B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 LEU 270 270 270 LEU LEU B . n 
B 1 271 SER 271 271 271 SER SER B . n 
B 1 272 GLY 272 272 272 GLY GLY B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ASP 274 274 274 ASP ASP B . n 
B 1 275 ILE 275 275 275 ILE ILE B . n 
B 1 276 MET 276 276 276 MET MET B . n 
B 1 277 GLU 277 277 277 GLU GLU B . n 
B 1 278 VAL 278 278 278 VAL VAL B . n 
B 1 279 ASN 279 279 279 ASN ASN B . n 
B 1 280 PRO 280 280 280 PRO PRO B . n 
B 1 281 SER 281 281 281 SER SER B . n 
B 1 282 LEU 282 282 282 LEU LEU B . n 
B 1 283 GLY 283 283 283 GLY GLY B . n 
B 1 284 LYS 284 284 284 LYS LYS B . n 
B 1 285 THR 285 285 285 THR THR B . n 
B 1 286 PRO 286 286 286 PRO PRO B . n 
B 1 287 GLU 287 287 287 GLU GLU B . n 
B 1 288 GLU 288 288 288 GLU GLU B . n 
B 1 289 VAL 289 289 289 VAL VAL B . n 
B 1 290 THR 290 290 290 THR THR B . n 
B 1 291 ARG 291 291 291 ARG ARG B . n 
B 1 292 THR 292 292 292 THR THR B . n 
B 1 293 VAL 293 293 293 VAL VAL B . n 
B 1 294 ASN 294 294 294 ASN ASN B . n 
B 1 295 THR 295 295 295 THR THR B . n 
B 1 296 ALA 296 296 296 ALA ALA B . n 
B 1 297 VAL 297 297 297 VAL VAL B . n 
B 1 298 ALA 298 298 298 ALA ALA B . n 
B 1 299 ILE 299 299 299 ILE ILE B . n 
B 1 300 THR 300 300 300 THR THR B . n 
B 1 301 LEU 301 301 301 LEU LEU B . n 
B 1 302 ALA 302 302 302 ALA ALA B . n 
B 1 303 CYS 303 303 303 CYS CYS B . n 
B 1 304 PHE 304 304 304 PHE PHE B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 LEU 306 306 306 LEU LEU B . n 
B 1 307 ALA 307 307 307 ALA ALA B . n 
B 1 308 ARG 308 308 308 ARG ARG B . n 
B 1 309 GLU 309 309 309 GLU GLU B . n 
B 1 310 GLY 310 310 310 GLY GLY B . n 
B 1 311 ASN 311 311 311 ASN ASN B . n 
B 1 312 HIS 312 312 312 HIS HIS B . n 
B 1 313 LYS 313 313 313 LYS LYS B . n 
B 1 314 PRO 314 314 314 PRO PRO B . n 
B 1 315 ILE 315 315 315 ILE ILE B . n 
B 1 316 ASP 316 316 316 ASP ASP B . n 
B 1 317 TYR 317 317 317 TYR TYR B . n 
B 1 318 LEU 318 318 318 LEU LEU B . n 
B 1 319 ASN 319 319 ?   ?   ?   B . n 
B 1 320 PRO 320 320 ?   ?   ?   B . n 
B 1 321 PRO 321 321 ?   ?   ?   B . n 
B 1 322 LYS 322 322 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA,PQS trimeric  3 
2 author_and_software_defined_assembly PISA     monomeric 1 
3 software_defined_assembly            PQS      trimeric  3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2,3 A,C,D,G 
2 1     B,E,F,H 
3 1,4,5 B,E,F,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6440  ? 
1 MORE         -52   ? 
1 'SSA (A^2)'  32940 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  1.0000000000 
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_555 -y,x-y,z    -0.5000000000 -0.8660254038 0.0000000000 0.0000000000  0.8660254038  
-0.5000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_555 -x+y,-x,z   -0.5000000000 0.8660254038  0.0000000000 0.0000000000  -0.8660254038 
-0.5000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 2_545 -y,x-y-1,z  -0.5000000000 -0.8660254038 0.0000000000 45.3850000000 0.8660254038  
-0.5000000000 0.0000000000 -78.6091259015 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
5 'crystal symmetry operation' 3_655 -x+y+1,-x,z -0.5000000000 0.8660254038  0.0000000000 90.7700000000 -0.8660254038 
-0.5000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? C MN . ? A MN 323 ? 1_555 OD1 ? A ASP 234 ? A ASP 234 ? 1_555 77.6  ? 
2  OD1 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? C MN . ? A MN 323 ? 1_555 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 130.2 ? 
3  OD1 ? A ASP 234 ? A ASP 234 ? 1_555 MN ? C MN . ? A MN 323 ? 1_555 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 52.8  ? 
4  OD1 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? C MN . ? A MN 323 ? 1_555 O   ? G HOH .   ? A HOH 388 ? 1_555 103.9 ? 
5  OD1 ? A ASP 234 ? A ASP 234 ? 1_555 MN ? C MN . ? A MN 323 ? 1_555 O   ? G HOH .   ? A HOH 388 ? 1_555 165.0 ? 
6  OD2 ? A ASP 234 ? A ASP 234 ? 1_555 MN ? C MN . ? A MN 323 ? 1_555 O   ? G HOH .   ? A HOH 388 ? 1_555 122.5 ? 
7  OD1 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? C MN . ? A MN 323 ? 1_555 ND1 ? A HIS 126 ? A HIS 126 ? 1_555 94.5  ? 
8  OD1 ? A ASP 234 ? A ASP 234 ? 1_555 MN ? C MN . ? A MN 323 ? 1_555 ND1 ? A HIS 126 ? A HIS 126 ? 1_555 105.5 ? 
9  OD2 ? A ASP 234 ? A ASP 234 ? 1_555 MN ? C MN . ? A MN 323 ? 1_555 ND1 ? A HIS 126 ? A HIS 126 ? 1_555 102.7 ? 
10 O   ? G HOH .   ? A HOH 388 ? 1_555 MN ? C MN . ? A MN 323 ? 1_555 ND1 ? A HIS 126 ? A HIS 126 ? 1_555 89.3  ? 
11 OD1 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? C MN . ? A MN 323 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 90.5  ? 
12 OD1 ? A ASP 234 ? A ASP 234 ? 1_555 MN ? C MN . ? A MN 323 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 76.6  ? 
13 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 MN ? C MN . ? A MN 323 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 74.7  ? 
14 O   ? G HOH .   ? A HOH 388 ? 1_555 MN ? C MN . ? A MN 323 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 88.4  ? 
15 ND1 ? A HIS 126 ? A HIS 126 ? 1_555 MN ? C MN . ? A MN 323 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 174.9 ? 
16 OD2 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? D MN . ? A MN 324 ? 1_555 OD1 ? A ASP 128 ? A ASP 128 ? 1_555 93.2  ? 
17 OD2 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? D MN . ? A MN 324 ? 1_555 O   ? G HOH .   ? A HOH 388 ? 1_555 92.7  ? 
18 OD1 ? A ASP 128 ? A ASP 128 ? 1_555 MN ? D MN . ? A MN 324 ? 1_555 O   ? G HOH .   ? A HOH 388 ? 1_555 84.0  ? 
19 OD2 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? D MN . ? A MN 324 ? 1_555 ND1 ? A HIS 101 ? A HIS 101 ? 1_555 94.8  ? 
20 OD1 ? A ASP 128 ? A ASP 128 ? 1_555 MN ? D MN . ? A MN 324 ? 1_555 ND1 ? A HIS 101 ? A HIS 101 ? 1_555 83.2  ? 
21 O   ? G HOH .   ? A HOH 388 ? 1_555 MN ? D MN . ? A MN 324 ? 1_555 ND1 ? A HIS 101 ? A HIS 101 ? 1_555 165.6 ? 
22 OD2 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? D MN . ? A MN 324 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 77.0  ? 
23 OD1 ? A ASP 128 ? A ASP 128 ? 1_555 MN ? D MN . ? A MN 324 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 167.1 ? 
24 O   ? G HOH .   ? A HOH 388 ? 1_555 MN ? D MN . ? A MN 324 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 88.0  ? 
25 ND1 ? A HIS 101 ? A HIS 101 ? 1_555 MN ? D MN . ? A MN 324 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 105.7 ? 
26 OD1 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? E MN . ? B MN 323 ? 1_555 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 98.0  ? 
27 OD1 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? E MN . ? B MN 323 ? 1_555 OD2 ? B ASP 234 ? B ASP 234 ? 1_555 127.2 ? 
28 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 MN ? E MN . ? B MN 323 ? 1_555 OD2 ? B ASP 234 ? B ASP 234 ? 1_555 83.8  ? 
29 OD1 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? E MN . ? B MN 323 ? 1_555 O   ? H HOH .   ? B HOH 436 ? 1_555 92.2  ? 
30 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 MN ? E MN . ? B MN 323 ? 1_555 O   ? H HOH .   ? B HOH 436 ? 1_555 82.4  ? 
31 OD2 ? B ASP 234 ? B ASP 234 ? 1_555 MN ? E MN . ? B MN 323 ? 1_555 O   ? H HOH .   ? B HOH 436 ? 1_555 139.6 ? 
32 OD1 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? E MN . ? B MN 323 ? 1_555 OD1 ? B ASP 234 ? B ASP 234 ? 1_555 73.3  ? 
33 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 MN ? E MN . ? B MN 323 ? 1_555 OD1 ? B ASP 234 ? B ASP 234 ? 1_555 84.8  ? 
34 OD2 ? B ASP 234 ? B ASP 234 ? 1_555 MN ? E MN . ? B MN 323 ? 1_555 OD1 ? B ASP 234 ? B ASP 234 ? 1_555 54.3  ? 
35 O   ? H HOH .   ? B HOH 436 ? 1_555 MN ? E MN . ? B MN 323 ? 1_555 OD1 ? B ASP 234 ? B ASP 234 ? 1_555 159.1 ? 
36 OD1 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? E MN . ? B MN 323 ? 1_555 ND1 ? B HIS 126 ? B HIS 126 ? 1_555 89.4  ? 
37 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 MN ? E MN . ? B MN 323 ? 1_555 ND1 ? B HIS 126 ? B HIS 126 ? 1_555 170.0 ? 
38 OD2 ? B ASP 234 ? B ASP 234 ? 1_555 MN ? E MN . ? B MN 323 ? 1_555 ND1 ? B HIS 126 ? B HIS 126 ? 1_555 97.0  ? 
39 O   ? H HOH .   ? B HOH 436 ? 1_555 MN ? E MN . ? B MN 323 ? 1_555 ND1 ? B HIS 126 ? B HIS 126 ? 1_555 90.7  ? 
40 OD1 ? B ASP 234 ? B ASP 234 ? 1_555 MN ? E MN . ? B MN 323 ? 1_555 ND1 ? B HIS 126 ? B HIS 126 ? 1_555 103.8 ? 
41 OD2 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? F MN . ? B MN 324 ? 1_555 OD1 ? B ASP 128 ? B ASP 128 ? 1_555 80.2  ? 
42 OD2 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? F MN . ? B MN 324 ? 1_555 O   ? H HOH .   ? B HOH 436 ? 1_555 77.4  ? 
43 OD1 ? B ASP 128 ? B ASP 128 ? 1_555 MN ? F MN . ? B MN 324 ? 1_555 O   ? H HOH .   ? B HOH 436 ? 1_555 75.4  ? 
44 OD2 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? F MN . ? B MN 324 ? 1_555 ND1 ? B HIS 101 ? B HIS 101 ? 1_555 99.8  ? 
45 OD1 ? B ASP 128 ? B ASP 128 ? 1_555 MN ? F MN . ? B MN 324 ? 1_555 ND1 ? B HIS 101 ? B HIS 101 ? 1_555 98.4  ? 
46 O   ? H HOH .   ? B HOH 436 ? 1_555 MN ? F MN . ? B MN 324 ? 1_555 ND1 ? B HIS 101 ? B HIS 101 ? 1_555 173.5 ? 
47 OD2 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? F MN . ? B MN 324 ? 1_555 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 83.0  ? 
48 OD1 ? B ASP 128 ? B ASP 128 ? 1_555 MN ? F MN . ? B MN 324 ? 1_555 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 155.6 ? 
49 O   ? H HOH .   ? B HOH 436 ? 1_555 MN ? F MN . ? B MN 324 ? 1_555 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 83.9  ? 
50 ND1 ? B HIS 101 ? B HIS 101 ? 1_555 MN ? F MN . ? B MN 324 ? 1_555 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 101.7 ? 
51 OD2 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? F MN . ? B MN 324 ? 1_555 O   ? H HOH .   ? B HOH 430 ? 1_555 152.5 ? 
52 OD1 ? B ASP 128 ? B ASP 128 ? 1_555 MN ? F MN . ? B MN 324 ? 1_555 O   ? H HOH .   ? B HOH 430 ? 1_555 98.9  ? 
53 O   ? H HOH .   ? B HOH 436 ? 1_555 MN ? F MN . ? B MN 324 ? 1_555 O   ? H HOH .   ? B HOH 430 ? 1_555 75.9  ? 
54 ND1 ? B HIS 101 ? B HIS 101 ? 1_555 MN ? F MN . ? B MN 324 ? 1_555 O   ? H HOH .   ? B HOH 430 ? 1_555 107.5 ? 
55 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 MN ? F MN . ? B MN 324 ? 1_555 O   ? H HOH .   ? B HOH 430 ? 1_555 88.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-05-08 
2 'Structure model' 1 1 2007-12-17 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC   'data collection' Quantum   ? 1 
PHASER phasing           .         ? 2 
CNS    refinement        1.1       ? 3 
MOSFLM 'data reduction'  .         ? 4 
CCP4   'data scaling'    '(SCALA)' ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 17  ? ? -61.10  13.98   
2  1 GLU A 44  ? ? -84.86  38.31   
3  1 ALA A 56  ? ? -58.24  174.81  
4  1 GLN A 65  ? ? 59.69   -109.42 
5  1 ASN A 69  ? ? 39.55   49.14   
6  1 ASP A 158 ? ? -68.64  90.12   
7  1 ARG A 180 ? ? -168.02 0.57    
8  1 PRO A 238 ? ? -66.35  5.88    
9  1 THR A 246 ? ? -119.19 70.48   
10 1 SER A 271 ? ? -132.05 -30.29  
11 1 PRO B 14  ? ? -72.02  42.20   
12 1 GLN B 43  ? ? -117.03 -164.32 
13 1 LYS B 48  ? ? -155.91 80.48   
14 1 ALA B 56  ? ? -56.96  102.63  
15 1 ASP B 61  ? ? -117.96 74.14   
16 1 GLN B 65  ? ? 60.49   -97.06  
17 1 HIS B 101 ? ? -59.31  -9.13   
18 1 THR B 136 ? ? -98.98  -63.39  
19 1 GLN B 143 ? ? -149.23 11.19   
20 1 ASP B 158 ? ? -62.72  95.47   
21 1 ARG B 180 ? ? -167.11 5.00    
22 1 VAL B 233 ? ? -36.45  -36.29  
23 1 PRO B 238 ? ? -59.21  -6.60   
24 1 THR B 241 ? ? -141.48 56.30   
25 1 SER B 271 ? ? -130.31 -37.66  
26 1 GLU B 277 ? ? 51.35   7.17    
27 1 PRO B 314 ? ? -62.92  68.93   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A ALA 3   ? A ALA 3   
4  1 Y 1 A LYS 4   ? A LYS 4   
5  1 Y 1 A ASN 319 ? A ASN 319 
6  1 Y 1 A PRO 320 ? A PRO 320 
7  1 Y 1 A PRO 321 ? A PRO 321 
8  1 Y 1 A LYS 322 ? A LYS 322 
9  1 Y 1 B MET 1   ? B MET 1   
10 1 Y 1 B SER 2   ? B SER 2   
11 1 Y 1 B ALA 3   ? B ALA 3   
12 1 Y 1 B LYS 4   ? B LYS 4   
13 1 Y 1 B ASN 319 ? B ASN 319 
14 1 Y 1 B PRO 320 ? B PRO 320 
15 1 Y 1 B PRO 321 ? B PRO 321 
16 1 Y 1 B LYS 322 ? B LYS 322 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 water                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MN  1   323 322 MN  MN  A . 
D 2 MN  1   324 323 MN  MN  A . 
E 2 MN  1   323 320 MN  MN  B . 
F 2 MN  1   324 321 MN  MN  B . 
G 3 HOH 1   325 2   HOH TIP A . 
G 3 HOH 2   326 3   HOH TIP A . 
G 3 HOH 3   327 4   HOH TIP A . 
G 3 HOH 4   328 7   HOH TIP A . 
G 3 HOH 5   329 9   HOH TIP A . 
G 3 HOH 6   330 10  HOH TIP A . 
G 3 HOH 7   331 12  HOH TIP A . 
G 3 HOH 8   332 14  HOH TIP A . 
G 3 HOH 9   333 15  HOH TIP A . 
G 3 HOH 10  334 17  HOH TIP A . 
G 3 HOH 11  335 19  HOH TIP A . 
G 3 HOH 12  336 20  HOH TIP A . 
G 3 HOH 13  337 21  HOH TIP A . 
G 3 HOH 14  338 22  HOH TIP A . 
G 3 HOH 15  339 24  HOH TIP A . 
G 3 HOH 16  340 27  HOH TIP A . 
G 3 HOH 17  341 32  HOH TIP A . 
G 3 HOH 18  342 34  HOH TIP A . 
G 3 HOH 19  343 37  HOH TIP A . 
G 3 HOH 20  344 38  HOH TIP A . 
G 3 HOH 21  345 39  HOH TIP A . 
G 3 HOH 22  346 40  HOH TIP A . 
G 3 HOH 23  347 41  HOH TIP A . 
G 3 HOH 24  348 42  HOH TIP A . 
G 3 HOH 25  349 45  HOH TIP A . 
G 3 HOH 26  350 46  HOH TIP A . 
G 3 HOH 27  351 47  HOH TIP A . 
G 3 HOH 28  352 49  HOH TIP A . 
G 3 HOH 29  353 50  HOH TIP A . 
G 3 HOH 30  354 52  HOH TIP A . 
G 3 HOH 31  355 54  HOH TIP A . 
G 3 HOH 32  356 56  HOH TIP A . 
G 3 HOH 33  357 58  HOH TIP A . 
G 3 HOH 34  358 61  HOH TIP A . 
G 3 HOH 35  359 63  HOH TIP A . 
G 3 HOH 36  360 64  HOH TIP A . 
G 3 HOH 37  361 68  HOH TIP A . 
G 3 HOH 38  362 71  HOH TIP A . 
G 3 HOH 39  363 72  HOH TIP A . 
G 3 HOH 40  364 73  HOH TIP A . 
G 3 HOH 41  365 75  HOH TIP A . 
G 3 HOH 42  366 76  HOH TIP A . 
G 3 HOH 43  367 77  HOH TIP A . 
G 3 HOH 44  368 81  HOH TIP A . 
G 3 HOH 45  369 82  HOH TIP A . 
G 3 HOH 46  370 83  HOH TIP A . 
G 3 HOH 47  371 84  HOH TIP A . 
G 3 HOH 48  372 86  HOH TIP A . 
G 3 HOH 49  373 89  HOH TIP A . 
G 3 HOH 50  374 91  HOH TIP A . 
G 3 HOH 51  375 94  HOH TIP A . 
G 3 HOH 52  376 95  HOH TIP A . 
G 3 HOH 53  377 96  HOH TIP A . 
G 3 HOH 54  378 97  HOH TIP A . 
G 3 HOH 55  379 100 HOH TIP A . 
G 3 HOH 56  380 108 HOH TIP A . 
G 3 HOH 57  381 109 HOH TIP A . 
G 3 HOH 58  382 110 HOH TIP A . 
G 3 HOH 59  383 111 HOH TIP A . 
G 3 HOH 60  384 112 HOH TIP A . 
G 3 HOH 61  385 113 HOH TIP A . 
G 3 HOH 62  386 117 HOH TIP A . 
G 3 HOH 63  387 118 HOH TIP A . 
G 3 HOH 64  388 119 HOH TIP A . 
G 3 HOH 65  389 120 HOH TIP A . 
G 3 HOH 66  390 121 HOH TIP A . 
G 3 HOH 67  391 122 HOH TIP A . 
G 3 HOH 68  392 123 HOH TIP A . 
G 3 HOH 69  393 127 HOH TIP A . 
G 3 HOH 70  394 129 HOH TIP A . 
G 3 HOH 71  395 130 HOH TIP A . 
G 3 HOH 72  396 132 HOH TIP A . 
G 3 HOH 73  397 133 HOH TIP A . 
G 3 HOH 74  398 134 HOH TIP A . 
G 3 HOH 75  399 135 HOH TIP A . 
G 3 HOH 76  400 137 HOH TIP A . 
G 3 HOH 77  401 138 HOH TIP A . 
G 3 HOH 78  402 142 HOH TIP A . 
G 3 HOH 79  403 146 HOH TIP A . 
G 3 HOH 80  404 149 HOH TIP A . 
G 3 HOH 81  405 151 HOH TIP A . 
G 3 HOH 82  406 153 HOH TIP A . 
G 3 HOH 83  407 154 HOH TIP A . 
G 3 HOH 84  408 157 HOH TIP A . 
G 3 HOH 85  409 158 HOH TIP A . 
G 3 HOH 86  410 159 HOH TIP A . 
G 3 HOH 87  411 160 HOH TIP A . 
G 3 HOH 88  412 162 HOH TIP A . 
G 3 HOH 89  413 164 HOH TIP A . 
G 3 HOH 90  414 168 HOH TIP A . 
G 3 HOH 91  415 171 HOH TIP A . 
G 3 HOH 92  416 173 HOH TIP A . 
G 3 HOH 93  417 174 HOH TIP A . 
G 3 HOH 94  418 175 HOH TIP A . 
G 3 HOH 95  419 181 HOH TIP A . 
G 3 HOH 96  420 182 HOH TIP A . 
G 3 HOH 97  421 183 HOH TIP A . 
G 3 HOH 98  422 184 HOH TIP A . 
G 3 HOH 99  423 185 HOH TIP A . 
G 3 HOH 100 424 186 HOH TIP A . 
G 3 HOH 101 425 187 HOH TIP A . 
G 3 HOH 102 426 189 HOH TIP A . 
G 3 HOH 103 427 240 HOH TIP A . 
G 3 HOH 104 428 192 HOH TIP A . 
G 3 HOH 105 429 194 HOH TIP A . 
G 3 HOH 106 430 196 HOH TIP A . 
G 3 HOH 107 431 197 HOH TIP A . 
G 3 HOH 108 432 199 HOH TIP A . 
G 3 HOH 109 433 200 HOH TIP A . 
G 3 HOH 110 434 201 HOH TIP A . 
G 3 HOH 111 435 202 HOH TIP A . 
G 3 HOH 112 436 204 HOH TIP A . 
G 3 HOH 113 437 206 HOH TIP A . 
G 3 HOH 114 438 207 HOH TIP A . 
G 3 HOH 115 439 208 HOH TIP A . 
G 3 HOH 116 440 241 HOH TIP A . 
G 3 HOH 117 441 210 HOH TIP A . 
G 3 HOH 118 442 211 HOH TIP A . 
G 3 HOH 119 443 212 HOH TIP A . 
G 3 HOH 120 444 214 HOH TIP A . 
G 3 HOH 121 445 215 HOH TIP A . 
G 3 HOH 122 446 216 HOH TIP A . 
G 3 HOH 123 447 218 HOH TIP A . 
G 3 HOH 124 448 219 HOH TIP A . 
G 3 HOH 125 449 222 HOH TIP A . 
G 3 HOH 126 450 223 HOH TIP A . 
G 3 HOH 127 451 224 HOH TIP A . 
G 3 HOH 128 452 225 HOH TIP A . 
G 3 HOH 129 453 227 HOH TIP A . 
G 3 HOH 130 454 228 HOH TIP A . 
G 3 HOH 131 455 229 HOH TIP A . 
G 3 HOH 132 456 230 HOH TIP A . 
G 3 HOH 133 457 233 HOH TIP A . 
G 3 HOH 134 458 235 HOH TIP A . 
G 3 HOH 135 459 242 HOH TIP A . 
G 3 HOH 136 460 244 HOH TIP A . 
G 3 HOH 137 461 248 HOH TIP A . 
G 3 HOH 138 462 249 HOH TIP A . 
G 3 HOH 139 463 251 HOH TIP A . 
G 3 HOH 140 464 253 HOH TIP A . 
G 3 HOH 141 465 257 HOH TIP A . 
G 3 HOH 142 466 259 HOH TIP A . 
H 3 HOH 1   325 1   HOH TIP B . 
H 3 HOH 2   326 5   HOH TIP B . 
H 3 HOH 3   327 6   HOH TIP B . 
H 3 HOH 4   328 8   HOH TIP B . 
H 3 HOH 5   329 11  HOH TIP B . 
H 3 HOH 6   330 13  HOH TIP B . 
H 3 HOH 7   331 16  HOH TIP B . 
H 3 HOH 8   332 18  HOH TIP B . 
H 3 HOH 9   333 23  HOH TIP B . 
H 3 HOH 10  334 25  HOH TIP B . 
H 3 HOH 11  335 26  HOH TIP B . 
H 3 HOH 12  336 28  HOH TIP B . 
H 3 HOH 13  337 29  HOH TIP B . 
H 3 HOH 14  338 30  HOH TIP B . 
H 3 HOH 15  339 31  HOH TIP B . 
H 3 HOH 16  340 33  HOH TIP B . 
H 3 HOH 17  341 35  HOH TIP B . 
H 3 HOH 18  342 36  HOH TIP B . 
H 3 HOH 19  343 43  HOH TIP B . 
H 3 HOH 20  344 44  HOH TIP B . 
H 3 HOH 21  345 48  HOH TIP B . 
H 3 HOH 22  346 51  HOH TIP B . 
H 3 HOH 23  347 53  HOH TIP B . 
H 3 HOH 24  348 55  HOH TIP B . 
H 3 HOH 25  349 57  HOH TIP B . 
H 3 HOH 26  350 59  HOH TIP B . 
H 3 HOH 27  351 60  HOH TIP B . 
H 3 HOH 28  352 62  HOH TIP B . 
H 3 HOH 29  353 65  HOH TIP B . 
H 3 HOH 30  354 66  HOH TIP B . 
H 3 HOH 31  355 67  HOH TIP B . 
H 3 HOH 32  356 69  HOH TIP B . 
H 3 HOH 33  357 70  HOH TIP B . 
H 3 HOH 34  358 74  HOH TIP B . 
H 3 HOH 35  359 78  HOH TIP B . 
H 3 HOH 36  360 79  HOH TIP B . 
H 3 HOH 37  361 80  HOH TIP B . 
H 3 HOH 38  362 85  HOH TIP B . 
H 3 HOH 39  363 87  HOH TIP B . 
H 3 HOH 40  364 88  HOH TIP B . 
H 3 HOH 41  365 90  HOH TIP B . 
H 3 HOH 42  366 92  HOH TIP B . 
H 3 HOH 43  367 93  HOH TIP B . 
H 3 HOH 44  368 98  HOH TIP B . 
H 3 HOH 45  369 99  HOH TIP B . 
H 3 HOH 46  370 101 HOH TIP B . 
H 3 HOH 47  371 102 HOH TIP B . 
H 3 HOH 48  372 103 HOH TIP B . 
H 3 HOH 49  373 104 HOH TIP B . 
H 3 HOH 50  374 105 HOH TIP B . 
H 3 HOH 51  375 106 HOH TIP B . 
H 3 HOH 52  376 107 HOH TIP B . 
H 3 HOH 53  377 114 HOH TIP B . 
H 3 HOH 54  378 115 HOH TIP B . 
H 3 HOH 55  379 116 HOH TIP B . 
H 3 HOH 56  380 124 HOH TIP B . 
H 3 HOH 57  381 125 HOH TIP B . 
H 3 HOH 58  382 126 HOH TIP B . 
H 3 HOH 59  383 128 HOH TIP B . 
H 3 HOH 60  384 131 HOH TIP B . 
H 3 HOH 61  385 136 HOH TIP B . 
H 3 HOH 62  386 139 HOH TIP B . 
H 3 HOH 63  387 140 HOH TIP B . 
H 3 HOH 64  388 141 HOH TIP B . 
H 3 HOH 65  389 143 HOH TIP B . 
H 3 HOH 66  390 144 HOH TIP B . 
H 3 HOH 67  391 145 HOH TIP B . 
H 3 HOH 68  392 147 HOH TIP B . 
H 3 HOH 69  393 148 HOH TIP B . 
H 3 HOH 70  394 150 HOH TIP B . 
H 3 HOH 71  395 152 HOH TIP B . 
H 3 HOH 72  396 155 HOH TIP B . 
H 3 HOH 73  397 156 HOH TIP B . 
H 3 HOH 74  398 161 HOH TIP B . 
H 3 HOH 75  399 163 HOH TIP B . 
H 3 HOH 76  400 165 HOH TIP B . 
H 3 HOH 77  401 166 HOH TIP B . 
H 3 HOH 78  402 167 HOH TIP B . 
H 3 HOH 79  403 169 HOH TIP B . 
H 3 HOH 80  404 170 HOH TIP B . 
H 3 HOH 81  405 172 HOH TIP B . 
H 3 HOH 82  406 176 HOH TIP B . 
H 3 HOH 83  407 177 HOH TIP B . 
H 3 HOH 84  408 178 HOH TIP B . 
H 3 HOH 85  409 179 HOH TIP B . 
H 3 HOH 86  410 180 HOH TIP B . 
H 3 HOH 87  411 188 HOH TIP B . 
H 3 HOH 88  412 190 HOH TIP B . 
H 3 HOH 89  413 193 HOH TIP B . 
H 3 HOH 90  414 195 HOH TIP B . 
H 3 HOH 91  415 198 HOH TIP B . 
H 3 HOH 92  416 203 HOH TIP B . 
H 3 HOH 93  417 205 HOH TIP B . 
H 3 HOH 94  418 213 HOH TIP B . 
H 3 HOH 95  419 217 HOH TIP B . 
H 3 HOH 96  420 220 HOH TIP B . 
H 3 HOH 97  421 221 HOH TIP B . 
H 3 HOH 98  422 226 HOH TIP B . 
H 3 HOH 99  423 231 HOH TIP B . 
H 3 HOH 100 424 232 HOH TIP B . 
H 3 HOH 101 425 234 HOH TIP B . 
H 3 HOH 102 426 243 HOH TIP B . 
H 3 HOH 103 427 245 HOH TIP B . 
H 3 HOH 104 428 246 HOH TIP B . 
H 3 HOH 105 429 247 HOH TIP B . 
H 3 HOH 106 430 250 HOH TIP B . 
H 3 HOH 107 431 252 HOH TIP B . 
H 3 HOH 108 432 254 HOH TIP B . 
H 3 HOH 109 433 255 HOH TIP B . 
H 3 HOH 110 434 256 HOH TIP B . 
H 3 HOH 111 435 258 HOH TIP B . 
H 3 HOH 112 436 260 HOH TIP B . 
#