data_2PI8
# 
_entry.id   2PI8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2PI8         
RCSB  RCSB042403   
WWPDB D_1000042403 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2AE0 'Apo-form of Escherichia coli MltA with catalytic Asp308 intact' unspecified 
PDB 2PIC 'E.coli MltA-D308A in apo-2 form'                                unspecified 
PDB 2PJJ 'E.coli lytic transglycosylase MltA-D308A in apo-1 form'         unspecified 
# 
_pdbx_database_status.entry_id                        2PI8 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'van Straaten, K.E.'   1 
'Barends, T.R.M.'      2 
'Dijkstra, B.W.'       3 
'Thunnissen, A.M.W.H.' 4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Structure of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose: implications for peptidoglycan binding and cleavage
;
J.Biol.Chem.               282 21197 21205 2007 JBCHA3 US 0021-9258 0071 ? 17502382 10.1074/jbc.M701818200 
1       'Escherichia coli MltA: MAD phasing and refinement of a tetartohedrally twinned protein crystal structure' 
'Acta Crystallogr.,Sect.D' 61  613   621   2005 ABCRE6 DK 0907-4449 0766 ? ?        ?                      
2       'Crystal structure of MltA from Escherichia coli reveals a unique lytic transglycosylase fold' J.Mol.Biol.                
352 1068  1080  2005 JMOBAK UK 0022-2836 0070 ? ?        ?                      
3       'Purification, crystallization and preliminary X-ray analysis of the lytic transglycosylase MltA from Escherichia coli' 
'Acta Crystallogr.,Sect.D' 60  758   760   2004 ABCRE6 DK 0907-4449 0766 ? ?        ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'van Straaten, K.E.'   1  ? 
primary 'Barends, T.R.M.'      2  ? 
primary 'Dijkstra, B.W.'       3  ? 
primary 'Thunnissen, A.M.W.H.' 4  ? 
1       'Barends, T.R.M.'      5  ? 
1       'de Jong, R.M.'        6  ? 
1       'van Straaten, K.E.'   7  ? 
1       'Thunnissen, A.M.W.H.' 8  ? 
1       'Dijkstra, B.W.'       9  ? 
2       'van Straaten, K.E.'   10 ? 
2       'Dijkstra, B.W.'       11 ? 
2       'Vollmer, W.'          12 ? 
2       'Thunnissen, A.M.W.H.' 13 ? 
3       'van Straaten, K.E.'   14 ? 
3       'Dijkstra, B.W.'       15 ? 
3       'Thunnissen, A.M.W.H.' 16 ? 
# 
_cell.length_a           91.0 
_cell.length_b           91.0 
_cell.length_c           187.2 
_cell.angle_alpha        90.0 
_cell.angle_beta         90.0 
_cell.angle_gamma        120.0 
_cell.entry_id           2PI8 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.entry_id                         2PI8 
_symmetry.Int_Tables_number                144 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Membrane-bound lytic murein transglycosylase A' 38628.730 4   3.2.1.- D308A ? ? 
2 branched    man 
;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
1237.172  4   ?       ?     ? ? 
3 non-polymer syn 'PHOSPHATE ION' 94.971    6   ?       ?     ? ? 
4 water       nat water 18.015    198 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Murein hydrolase A; Mlt38' 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.3.2.1.- 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)SSKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRN
(MSE)RQFGIDAWQ(MSE)EGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYR(MSE)PPKRGRLSSRAEIYAGALSDK
YILAYSNSL(MSE)DNFI(MSE)DVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKED(MSE)S(MSE)
QAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLIAEVPLLDNNGKFNGQY
ELRL(MSE)VALDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAPGAGNVFSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSSKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQF
GIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMD
VQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQS
FAPVKGASAVPLVGRASVASDRSIIPPGTTLIAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFAIYQGIGPEAGHR
AGWYNHYGRVWVLKTAPGAGNVFSG
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   SER n 
1 3   SER n 
1 4   LYS n 
1 5   PRO n 
1 6   THR n 
1 7   ASP n 
1 8   ARG n 
1 9   GLY n 
1 10  GLN n 
1 11  GLN n 
1 12  TYR n 
1 13  LYS n 
1 14  ASP n 
1 15  GLY n 
1 16  LYS n 
1 17  PHE n 
1 18  THR n 
1 19  GLN n 
1 20  PRO n 
1 21  PHE n 
1 22  SER n 
1 23  LEU n 
1 24  VAL n 
1 25  ASN n 
1 26  GLN n 
1 27  PRO n 
1 28  ASP n 
1 29  ALA n 
1 30  VAL n 
1 31  GLY n 
1 32  ALA n 
1 33  PRO n 
1 34  ILE n 
1 35  ASN n 
1 36  ALA n 
1 37  GLY n 
1 38  ASP n 
1 39  PHE n 
1 40  ALA n 
1 41  GLU n 
1 42  GLN n 
1 43  ILE n 
1 44  ASN n 
1 45  HIS n 
1 46  ILE n 
1 47  ARG n 
1 48  ASN n 
1 49  SER n 
1 50  SER n 
1 51  PRO n 
1 52  ARG n 
1 53  LEU n 
1 54  TYR n 
1 55  GLY n 
1 56  ASN n 
1 57  GLN n 
1 58  SER n 
1 59  ASN n 
1 60  VAL n 
1 61  TYR n 
1 62  ASN n 
1 63  ALA n 
1 64  VAL n 
1 65  GLN n 
1 66  GLU n 
1 67  TRP n 
1 68  LEU n 
1 69  ARG n 
1 70  ALA n 
1 71  GLY n 
1 72  GLY n 
1 73  ASP n 
1 74  THR n 
1 75  ARG n 
1 76  ASN n 
1 77  MSE n 
1 78  ARG n 
1 79  GLN n 
1 80  PHE n 
1 81  GLY n 
1 82  ILE n 
1 83  ASP n 
1 84  ALA n 
1 85  TRP n 
1 86  GLN n 
1 87  MSE n 
1 88  GLU n 
1 89  GLY n 
1 90  ALA n 
1 91  ASP n 
1 92  ASN n 
1 93  TYR n 
1 94  GLY n 
1 95  ASN n 
1 96  VAL n 
1 97  GLN n 
1 98  PHE n 
1 99  THR n 
1 100 GLY n 
1 101 TYR n 
1 102 TYR n 
1 103 THR n 
1 104 PRO n 
1 105 VAL n 
1 106 ILE n 
1 107 GLN n 
1 108 ALA n 
1 109 ARG n 
1 110 HIS n 
1 111 THR n 
1 112 ARG n 
1 113 GLN n 
1 114 GLY n 
1 115 GLU n 
1 116 PHE n 
1 117 GLN n 
1 118 TYR n 
1 119 PRO n 
1 120 ILE n 
1 121 TYR n 
1 122 ARG n 
1 123 MSE n 
1 124 PRO n 
1 125 PRO n 
1 126 LYS n 
1 127 ARG n 
1 128 GLY n 
1 129 ARG n 
1 130 LEU n 
1 131 SER n 
1 132 SER n 
1 133 ARG n 
1 134 ALA n 
1 135 GLU n 
1 136 ILE n 
1 137 TYR n 
1 138 ALA n 
1 139 GLY n 
1 140 ALA n 
1 141 LEU n 
1 142 SER n 
1 143 ASP n 
1 144 LYS n 
1 145 TYR n 
1 146 ILE n 
1 147 LEU n 
1 148 ALA n 
1 149 TYR n 
1 150 SER n 
1 151 ASN n 
1 152 SER n 
1 153 LEU n 
1 154 MSE n 
1 155 ASP n 
1 156 ASN n 
1 157 PHE n 
1 158 ILE n 
1 159 MSE n 
1 160 ASP n 
1 161 VAL n 
1 162 GLN n 
1 163 GLY n 
1 164 SER n 
1 165 GLY n 
1 166 TYR n 
1 167 ILE n 
1 168 ASP n 
1 169 PHE n 
1 170 GLY n 
1 171 ASP n 
1 172 GLY n 
1 173 SER n 
1 174 PRO n 
1 175 LEU n 
1 176 ASN n 
1 177 PHE n 
1 178 PHE n 
1 179 SER n 
1 180 TYR n 
1 181 ALA n 
1 182 GLY n 
1 183 LYS n 
1 184 ASN n 
1 185 GLY n 
1 186 HIS n 
1 187 ALA n 
1 188 TYR n 
1 189 ARG n 
1 190 SER n 
1 191 ILE n 
1 192 GLY n 
1 193 LYS n 
1 194 VAL n 
1 195 LEU n 
1 196 ILE n 
1 197 ASP n 
1 198 ARG n 
1 199 GLY n 
1 200 GLU n 
1 201 VAL n 
1 202 LYS n 
1 203 LYS n 
1 204 GLU n 
1 205 ASP n 
1 206 MSE n 
1 207 SER n 
1 208 MSE n 
1 209 GLN n 
1 210 ALA n 
1 211 ILE n 
1 212 ARG n 
1 213 HIS n 
1 214 TRP n 
1 215 GLY n 
1 216 GLU n 
1 217 THR n 
1 218 HIS n 
1 219 SER n 
1 220 GLU n 
1 221 ALA n 
1 222 GLU n 
1 223 VAL n 
1 224 ARG n 
1 225 GLU n 
1 226 LEU n 
1 227 LEU n 
1 228 GLU n 
1 229 GLN n 
1 230 ASN n 
1 231 PRO n 
1 232 SER n 
1 233 PHE n 
1 234 VAL n 
1 235 PHE n 
1 236 PHE n 
1 237 LYS n 
1 238 PRO n 
1 239 GLN n 
1 240 SER n 
1 241 PHE n 
1 242 ALA n 
1 243 PRO n 
1 244 VAL n 
1 245 LYS n 
1 246 GLY n 
1 247 ALA n 
1 248 SER n 
1 249 ALA n 
1 250 VAL n 
1 251 PRO n 
1 252 LEU n 
1 253 VAL n 
1 254 GLY n 
1 255 ARG n 
1 256 ALA n 
1 257 SER n 
1 258 VAL n 
1 259 ALA n 
1 260 SER n 
1 261 ASP n 
1 262 ARG n 
1 263 SER n 
1 264 ILE n 
1 265 ILE n 
1 266 PRO n 
1 267 PRO n 
1 268 GLY n 
1 269 THR n 
1 270 THR n 
1 271 LEU n 
1 272 ILE n 
1 273 ALA n 
1 274 GLU n 
1 275 VAL n 
1 276 PRO n 
1 277 LEU n 
1 278 LEU n 
1 279 ASP n 
1 280 ASN n 
1 281 ASN n 
1 282 GLY n 
1 283 LYS n 
1 284 PHE n 
1 285 ASN n 
1 286 GLY n 
1 287 GLN n 
1 288 TYR n 
1 289 GLU n 
1 290 LEU n 
1 291 ARG n 
1 292 LEU n 
1 293 MSE n 
1 294 VAL n 
1 295 ALA n 
1 296 LEU n 
1 297 ASP n 
1 298 VAL n 
1 299 GLY n 
1 300 GLY n 
1 301 ALA n 
1 302 ILE n 
1 303 LYS n 
1 304 GLY n 
1 305 GLN n 
1 306 HIS n 
1 307 PHE n 
1 308 ALA n 
1 309 ILE n 
1 310 TYR n 
1 311 GLN n 
1 312 GLY n 
1 313 ILE n 
1 314 GLY n 
1 315 PRO n 
1 316 GLU n 
1 317 ALA n 
1 318 GLY n 
1 319 HIS n 
1 320 ARG n 
1 321 ALA n 
1 322 GLY n 
1 323 TRP n 
1 324 TYR n 
1 325 ASN n 
1 326 HIS n 
1 327 TYR n 
1 328 GLY n 
1 329 ARG n 
1 330 VAL n 
1 331 TRP n 
1 332 VAL n 
1 333 LEU n 
1 334 LYS n 
1 335 THR n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 ALA n 
1 340 GLY n 
1 341 ASN n 
1 342 VAL n 
1 343 PHE n 
1 344 SER n 
1 345 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 'mltA, mlt' 
_entity_src_gen.gene_src_species                   'Escherichia coli' 
_entity_src_gen.gene_src_strain                    K12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pMSS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MLTA_ECOLI 
_struct_ref.pdbx_db_accession          P0A935 
_struct_ref.pdbx_align_begin           22 
_struct_ref.pdbx_seq_one_letter_code   
;SSKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFG
IDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLPSRAEIYAGALSDKYILAYSNSLMDNFIMDV
QGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSF
APVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRA
GWYNHYGRVWVLKTAPGAGNVFSG
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2PI8 A 2 ? 345 ? P0A935 22 ? 365 ? 2 345 
2 1 2PI8 B 2 ? 345 ? P0A935 22 ? 365 ? 2 345 
3 1 2PI8 C 2 ? 345 ? P0A935 22 ? 365 ? 2 345 
4 1 2PI8 D 2 ? 345 ? P0A935 22 ? 365 ? 2 345 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2PI8 MSE A 1   ? UNP P0A935 ?   ?   'modified residue'    1   1  
1 2PI8 MSE A 77  ? UNP P0A935 MET 97  'modified residue'    77  2  
1 2PI8 MSE A 87  ? UNP P0A935 MET 107 'modified residue'    87  3  
1 2PI8 MSE A 123 ? UNP P0A935 MET 143 'modified residue'    123 4  
1 2PI8 SER A 131 ? UNP P0A935 PRO 151 conflict              131 5  
1 2PI8 MSE A 154 ? UNP P0A935 MET 174 'modified residue'    154 6  
1 2PI8 MSE A 159 ? UNP P0A935 MET 179 'modified residue'    159 7  
1 2PI8 MSE A 206 ? UNP P0A935 MET 226 'modified residue'    206 8  
1 2PI8 MSE A 208 ? UNP P0A935 MET 228 'modified residue'    208 9  
1 2PI8 ILE A 272 ? UNP P0A935 LEU 292 conflict              272 10 
1 2PI8 MSE A 293 ? UNP P0A935 MET 313 'modified residue'    293 11 
1 2PI8 ALA A 308 ? UNP P0A935 ASP 328 'engineered mutation' 308 12 
2 2PI8 MSE B 1   ? UNP P0A935 ?   ?   'modified residue'    1   13 
2 2PI8 MSE B 77  ? UNP P0A935 MET 97  'modified residue'    77  14 
2 2PI8 MSE B 87  ? UNP P0A935 MET 107 'modified residue'    87  15 
2 2PI8 MSE B 123 ? UNP P0A935 MET 143 'modified residue'    123 16 
2 2PI8 SER B 131 ? UNP P0A935 PRO 151 conflict              131 17 
2 2PI8 MSE B 154 ? UNP P0A935 MET 174 'modified residue'    154 18 
2 2PI8 MSE B 159 ? UNP P0A935 MET 179 'modified residue'    159 19 
2 2PI8 MSE B 206 ? UNP P0A935 MET 226 'modified residue'    206 20 
2 2PI8 MSE B 208 ? UNP P0A935 MET 228 'modified residue'    208 21 
2 2PI8 ILE B 272 ? UNP P0A935 LEU 292 conflict              272 22 
2 2PI8 MSE B 293 ? UNP P0A935 MET 313 'modified residue'    293 23 
2 2PI8 ALA B 308 ? UNP P0A935 ASP 328 'engineered mutation' 308 24 
3 2PI8 MSE C 1   ? UNP P0A935 ?   ?   'modified residue'    1   25 
3 2PI8 MSE C 77  ? UNP P0A935 MET 97  'modified residue'    77  26 
3 2PI8 MSE C 87  ? UNP P0A935 MET 107 'modified residue'    87  27 
3 2PI8 MSE C 123 ? UNP P0A935 MET 143 'modified residue'    123 28 
3 2PI8 SER C 131 ? UNP P0A935 PRO 151 conflict              131 29 
3 2PI8 MSE C 154 ? UNP P0A935 MET 174 'modified residue'    154 30 
3 2PI8 MSE C 159 ? UNP P0A935 MET 179 'modified residue'    159 31 
3 2PI8 MSE C 206 ? UNP P0A935 MET 226 'modified residue'    206 32 
3 2PI8 MSE C 208 ? UNP P0A935 MET 228 'modified residue'    208 33 
3 2PI8 ILE C 272 ? UNP P0A935 LEU 292 conflict              272 34 
3 2PI8 MSE C 293 ? UNP P0A935 MET 313 'modified residue'    293 35 
3 2PI8 ALA C 308 ? UNP P0A935 ASP 328 'engineered mutation' 308 36 
4 2PI8 MSE D 1   ? UNP P0A935 ?   ?   'modified residue'    1   37 
4 2PI8 MSE D 77  ? UNP P0A935 MET 97  'modified residue'    77  38 
4 2PI8 MSE D 87  ? UNP P0A935 MET 107 'modified residue'    87  39 
4 2PI8 MSE D 123 ? UNP P0A935 MET 143 'modified residue'    123 40 
4 2PI8 SER D 131 ? UNP P0A935 PRO 151 conflict              131 41 
4 2PI8 MSE D 154 ? UNP P0A935 MET 174 'modified residue'    154 42 
4 2PI8 MSE D 159 ? UNP P0A935 MET 179 'modified residue'    159 43 
4 2PI8 MSE D 206 ? UNP P0A935 MET 226 'modified residue'    206 44 
4 2PI8 MSE D 208 ? UNP P0A935 MET 228 'modified residue'    208 45 
4 2PI8 ILE D 272 ? UNP P0A935 LEU 292 conflict              272 46 
4 2PI8 MSE D 293 ? UNP P0A935 MET 313 'modified residue'    293 47 
4 2PI8 ALA D 308 ? UNP P0A935 ASP 328 'engineered mutation' 308 48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking'          n SELENOMETHIONINE                         ? 'C5 H11 N O2 Se' 196.106 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PO4 non-polymer                  . 'PHOSPHATE ION'                          ? 'O4 P -3'        94.971  
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2PI8 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.89 
_exptl_crystal.density_percent_sol   57.51 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'vapor diffusion, hanging drop, cocrystallization' 
_exptl_crystal_grow.pH              4.2 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
;1.5-2.0 M ammonium sulfate, 100mM phosphate/citrate buffer, 15mg/ml hexa-N-acetyl glucosamine, pH 4.2, vapor diffusion, hanging drop, cocrystallization, temperature 298K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
3 ?   ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 4' ? ? 
2 CCD 'MAR CCD 165 mm' ? ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.monochromator 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.pdbx_scattering_type 
1 'SINGLE WAVELENGTH' ? 1 M x-ray 
2 MAD                 ? 1 M x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.934  1.0 
2 0.9792 1.0 
3 0.9794 1.0 
4 0.9393 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_wavelength_list 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
1 SYNCHROTRON 'ESRF BEAMLINE ID14-1'             0.934                    ? ESRF                 ID14-1 
2 SYNCHROTRON 'EMBL/DESY, HAMBURG BEAMLINE BW7A' '0.9792, 0.9794, 0.9393' ? 'EMBL/DESY, HAMBURG' BW7A   
# 
_reflns.entry_id                     2PI8 
_reflns.d_resolution_high            2.150 
_reflns.d_resolution_low             40.000 
_reflns.number_obs                   93064 
_reflns.pdbx_Rmerge_I_obs            0.092 
_reflns.pdbx_netI_over_sigmaI        8.700 
_reflns.pdbx_chi_squared             1.049 
_reflns.percent_possible_obs         99.100 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.number_all                   278139 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.15 2.23  ? ? ? 0.692 ? ? 0.987 ? ? 8561 91.60  1  1,2 
2.23 2.32  ? ? ? 0.680 ? ? 1.022 ? ? 9408 99.70  2  1,2 
2.32 2.42  ? ? ? 0.518 ? ? 1.079 ? ? 9341 100.00 3  1,2 
2.42 2.55  ? ? ? 0.390 ? ? 1.092 ? ? 9389 100.00 4  1,2 
2.55 2.71  ? ? ? 0.269 ? ? 1.156 ? ? 9390 100.00 5  1,2 
2.71 2.92  ? ? ? 0.172 ? ? 1.126 ? ? 9409 100.00 6  1,2 
2.92 3.21  ? ? ? 0.110 ? ? 1.050 ? ? 9395 100.00 7  1,2 
3.21 3.68  ? ? ? 0.070 ? ? 0.985 ? ? 9361 100.00 8  1,2 
3.68 4.63  ? ? ? 0.054 ? ? 0.936 ? ? 9412 100.00 9  1,2 
4.63 40.00 ? ? ? 0.059 ? ? 1.037 ? ? 9398 99.90  10 1,2 
# 
_refine.entry_id                                 2PI8 
_refine.ls_d_res_high                            2.250 
_refine.ls_d_res_low                             36.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    100.000 
_refine.ls_number_reflns_obs                     82094 
_refine.ls_R_factor_R_work                       0.182 
_refine.ls_R_factor_R_free                       0.226 
_refine.ls_percent_reflns_R_free                 7.200 
_refine.ls_number_reflns_R_free                  5887 
_refine.B_iso_mean                               37.250 
_refine.solvent_model_param_bsol                 29.404 
_refine.aniso_B[1][1]                            -0.504 
_refine.aniso_B[2][2]                            -0.504 
_refine.aniso_B[3][3]                            1.008 
_refine.aniso_B[1][2]                            -1.707 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_ls_sigma_I                          0.00 
_refine.ls_number_reflns_all                     82094 
_refine.ls_R_factor_all                          0.184 
_refine.ls_R_factor_obs                          0.184 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            'thin resolution shells' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             anisotropic 
_refine.details                                  
'REFLECTION DATA ARE TETARTOHEDRALLY TWINNED. REFINEMENT REQUIRED SPECIAL TWIN-ADAPTED REFINEMENT SCRIPTS FOR CNS' 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2PI8 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           5 
_refine_analyze.Luzzati_coordinate_error_free   0.3 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10475 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         370 
_refine_hist.number_atoms_solvent             198 
_refine_hist.number_atoms_total               11043 
_refine_hist.d_res_high                       2.250 
_refine_hist.d_res_low                        36.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.005 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.0   ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23    ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.80  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.107 1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.896 2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.476 2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.263 2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.250 2.350  8 . 9657 . 0.290 0.323 . 537 . . 10194 . 'X-RAY DIFFRACTION' 
2.350 2.480  8 . 9397 . 0.270 0.281 . 919 . . 10316 . 'X-RAY DIFFRACTION' 
2.480 2.630  8 . 9775 . 0.258 0.258 . 482 . . 10257 . 'X-RAY DIFFRACTION' 
2.630 2.830  8 . 9418 . 0.218 0.254 . 852 . . 10270 . 'X-RAY DIFFRACTION' 
2.830 3.120  8 . 9294 . 0.200 0.254 . 961 . . 10255 . 'X-RAY DIFFRACTION' 
3.120 3.570  8 . 9583 . 0.177 0.235 . 676 . . 10259 . 'X-RAY DIFFRACTION' 
3.570 4.500  8 . 9571 . 0.138 0.182 . 722 . . 10293 . 'X-RAY DIFFRACTION' 
4.500 36.000 8 . 9512 . 0.153 0.204 . 738 . . 10250 . 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 CNS_TOPPAR:protein.param   ? 'X-RAY DIFFRACTION' 
2 param_peptidogl_sugars.dat ? 'X-RAY DIFFRACTION' 
3 CNS_TOPPAR:water.param     ? 'X-RAY DIFFRACTION' 
4 CNS_TOPPAR:ion.param       ? 'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 1.0000  0.0000  0.0000 0.0000 1.0000  0.0000 0.0000  0.0000 1.0000 0.0000   0.0000  0.0000 
2 given ? -0.9999 -0.0112 0.0031 0.0108 -0.7932 0.6089 -0.0044 0.6089 0.7932 174.4428 -1.5140 0.7045 
# 
_struct.entry_id                  2PI8 
_struct.title                     'Crystal structure of E. coli MltA with bound chitohexaose' 
_struct.pdbx_descriptor           'Membrane-bound lytic murein transglycosylase A (E.C.3.2.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2PI8 
_struct_keywords.text            'double-psi beta-barrel; protein-sugar complex; lytic transglycosylase, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 35  ? SER A 50  ? ASN A 35  SER A 50  1 ? 16 
HELX_P HELX_P2  2  SER A 50  ? GLN A 57  ? SER A 50  GLN A 57  1 ? 8  
HELX_P HELX_P3  3  GLN A 57  ? GLY A 71  ? GLN A 57  GLY A 71  1 ? 15 
HELX_P HELX_P4  4  MSE A 77  ? PHE A 80  ? MSE A 77  PHE A 80  5 ? 4  
HELX_P HELX_P5  5  PRO A 125 ? SER A 131 ? PRO A 125 SER A 131 5 ? 7  
HELX_P HELX_P6  6  SER A 132 ? GLY A 139 ? SER A 132 GLY A 139 1 ? 8  
HELX_P HELX_P7  7  SER A 142 ? LYS A 144 ? SER A 142 LYS A 144 5 ? 3  
HELX_P HELX_P8  8  SER A 152 ? GLY A 163 ? SER A 152 GLY A 163 1 ? 12 
HELX_P HELX_P9  9  SER A 190 ? ARG A 198 ? SER A 190 ARG A 198 1 ? 9  
HELX_P HELX_P10 10 SER A 207 ? HIS A 218 ? SER A 207 HIS A 218 1 ? 12 
HELX_P HELX_P11 11 SER A 219 ? GLU A 228 ? SER A 219 GLU A 228 1 ? 10 
HELX_P HELX_P12 12 GLY A 314 ? TYR A 324 ? GLY A 314 TYR A 324 1 ? 11 
HELX_P HELX_P13 13 ASN B 35  ? SER B 50  ? ASN B 35  SER B 50  1 ? 16 
HELX_P HELX_P14 14 SER B 50  ? ALA B 70  ? SER B 50  ALA B 70  1 ? 21 
HELX_P HELX_P15 15 ARG B 75  ? GLY B 81  ? ARG B 75  GLY B 81  5 ? 7  
HELX_P HELX_P16 16 PRO B 125 ? SER B 131 ? PRO B 125 SER B 131 5 ? 7  
HELX_P HELX_P17 17 SER B 132 ? GLY B 139 ? SER B 132 GLY B 139 1 ? 8  
HELX_P HELX_P18 18 SER B 142 ? LYS B 144 ? SER B 142 LYS B 144 5 ? 3  
HELX_P HELX_P19 19 SER B 152 ? GLY B 163 ? SER B 152 GLY B 163 1 ? 12 
HELX_P HELX_P20 20 SER B 190 ? GLY B 199 ? SER B 190 GLY B 199 1 ? 10 
HELX_P HELX_P21 21 SER B 207 ? HIS B 218 ? SER B 207 HIS B 218 1 ? 12 
HELX_P HELX_P22 22 SER B 219 ? GLU B 228 ? SER B 219 GLU B 228 1 ? 10 
HELX_P HELX_P23 23 GLY B 314 ? GLY B 322 ? GLY B 314 GLY B 322 1 ? 9  
HELX_P HELX_P24 24 ASN C 35  ? SER C 50  ? ASN C 35  SER C 50  1 ? 16 
HELX_P HELX_P25 25 SER C 50  ? ALA C 70  ? SER C 50  ALA C 70  1 ? 21 
HELX_P HELX_P26 26 ASN C 76  ? PHE C 80  ? ASN C 76  PHE C 80  5 ? 5  
HELX_P HELX_P27 27 LYS C 126 ? SER C 131 ? LYS C 126 SER C 131 5 ? 6  
HELX_P HELX_P28 28 SER C 132 ? ALA C 138 ? SER C 132 ALA C 138 1 ? 7  
HELX_P HELX_P29 29 SER C 142 ? LYS C 144 ? SER C 142 LYS C 144 5 ? 3  
HELX_P HELX_P30 30 SER C 152 ? GLY C 163 ? SER C 152 GLY C 163 1 ? 12 
HELX_P HELX_P31 31 SER C 190 ? GLY C 199 ? SER C 190 GLY C 199 1 ? 10 
HELX_P HELX_P32 32 GLN C 209 ? HIS C 218 ? GLN C 209 HIS C 218 1 ? 10 
HELX_P HELX_P33 33 SER C 219 ? GLU C 228 ? SER C 219 GLU C 228 1 ? 10 
HELX_P HELX_P34 34 GLY C 314 ? TYR C 324 ? GLY C 314 TYR C 324 1 ? 11 
HELX_P HELX_P35 35 PRO D 5   ? GLY D 9   ? PRO D 5   GLY D 9   5 ? 5  
HELX_P HELX_P36 36 ASN D 35  ? SER D 50  ? ASN D 35  SER D 50  1 ? 16 
HELX_P HELX_P37 37 SER D 50  ? GLN D 57  ? SER D 50  GLN D 57  1 ? 8  
HELX_P HELX_P38 38 GLN D 57  ? GLY D 71  ? GLN D 57  GLY D 71  1 ? 15 
HELX_P HELX_P39 39 MSE D 77  ? PHE D 80  ? MSE D 77  PHE D 80  5 ? 4  
HELX_P HELX_P40 40 LYS D 126 ? SER D 131 ? LYS D 126 SER D 131 5 ? 6  
HELX_P HELX_P41 41 SER D 132 ? GLY D 139 ? SER D 132 GLY D 139 1 ? 8  
HELX_P HELX_P42 42 SER D 142 ? LYS D 144 ? SER D 142 LYS D 144 5 ? 3  
HELX_P HELX_P43 43 SER D 152 ? GLY D 163 ? SER D 152 GLY D 163 1 ? 12 
HELX_P HELX_P44 44 ILE D 191 ? ARG D 198 ? ILE D 191 ARG D 198 1 ? 8  
HELX_P HELX_P45 45 SER D 207 ? HIS D 218 ? SER D 207 HIS D 218 1 ? 12 
HELX_P HELX_P46 46 SER D 219 ? GLU D 228 ? SER D 219 GLU D 228 1 ? 10 
HELX_P HELX_P47 47 GLY D 314 ? TYR D 324 ? GLY D 314 TYR D 324 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A ASN 76  C  ? ? ? 1_555 A MSE 77  N  ? ? A ASN 76  A MSE 77  1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale2  covale both ? A MSE 77  C  ? ? ? 1_555 A ARG 78  N  ? ? A MSE 77  A ARG 78  1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale3  covale both ? A GLN 86  C  ? ? ? 1_555 A MSE 87  N  ? ? A GLN 86  A MSE 87  1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale4  covale both ? A MSE 87  C  ? ? ? 1_555 A GLU 88  N  ? ? A MSE 87  A GLU 88  1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale5  covale both ? A ARG 122 C  ? ? ? 1_555 A MSE 123 N  ? ? A ARG 122 A MSE 123 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale6  covale both ? A MSE 123 C  ? ? ? 1_555 A PRO 124 N  ? ? A MSE 123 A PRO 124 1_555 ? ? ? ? ? ? ? 1.344 ? ? 
covale7  covale both ? A LEU 153 C  ? ? ? 1_555 A MSE 154 N  ? ? A LEU 153 A MSE 154 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale8  covale both ? A MSE 154 C  ? ? ? 1_555 A ASP 155 N  ? ? A MSE 154 A ASP 155 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale9  covale both ? A ILE 158 C  ? ? ? 1_555 A MSE 159 N  ? ? A ILE 158 A MSE 159 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale10 covale both ? A MSE 159 C  ? ? ? 1_555 A ASP 160 N  ? ? A MSE 159 A ASP 160 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale11 covale both ? A MSE 206 C  ? ? ? 1_555 A SER 207 N  ? ? A MSE 206 A SER 207 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale12 covale both ? A SER 207 C  ? ? ? 1_555 A MSE 208 N  ? ? A SER 207 A MSE 208 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale13 covale both ? A MSE 208 C  ? ? ? 1_555 A GLN 209 N  ? ? A MSE 208 A GLN 209 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale14 covale both ? A LEU 292 C  ? ? ? 1_555 A MSE 293 N  ? ? A LEU 292 A MSE 293 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale15 covale both ? A MSE 293 C  ? ? ? 1_555 A VAL 294 N  ? ? A MSE 293 A VAL 294 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale16 covale both ? B ASN 76  C  ? ? ? 1_555 B MSE 77  N  ? ? B ASN 76  B MSE 77  1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale17 covale both ? B MSE 77  C  ? ? ? 1_555 B ARG 78  N  ? ? B MSE 77  B ARG 78  1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale18 covale both ? B GLN 86  C  ? ? ? 1_555 B MSE 87  N  ? ? B GLN 86  B MSE 87  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale19 covale both ? B MSE 87  C  ? ? ? 1_555 B GLU 88  N  ? ? B MSE 87  B GLU 88  1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale20 covale both ? B ARG 122 C  ? ? ? 1_555 B MSE 123 N  ? ? B ARG 122 B MSE 123 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale21 covale both ? B MSE 123 C  ? ? ? 1_555 B PRO 124 N  ? ? B MSE 123 B PRO 124 1_555 ? ? ? ? ? ? ? 1.345 ? ? 
covale22 covale both ? B LEU 153 C  ? ? ? 1_555 B MSE 154 N  ? ? B LEU 153 B MSE 154 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale23 covale both ? B MSE 154 C  ? ? ? 1_555 B ASP 155 N  ? ? B MSE 154 B ASP 155 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale24 covale both ? B ILE 158 C  ? ? ? 1_555 B MSE 159 N  ? ? B ILE 158 B MSE 159 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale25 covale both ? B MSE 159 C  ? ? ? 1_555 B ASP 160 N  ? ? B MSE 159 B ASP 160 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale26 covale both ? B ASP 205 C  ? ? ? 1_555 B MSE 206 N  ? ? B ASP 205 B MSE 206 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale27 covale both ? B MSE 206 C  ? ? ? 1_555 B SER 207 N  ? ? B MSE 206 B SER 207 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale28 covale both ? B SER 207 C  ? ? ? 1_555 B MSE 208 N  ? ? B SER 207 B MSE 208 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale29 covale both ? B MSE 208 C  ? ? ? 1_555 B GLN 209 N  ? ? B MSE 208 B GLN 209 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale30 covale both ? B LEU 292 C  ? ? ? 1_555 B MSE 293 N  ? ? B LEU 292 B MSE 293 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale31 covale both ? B MSE 293 C  ? ? ? 1_555 B VAL 294 N  ? ? B MSE 293 B VAL 294 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale32 covale both ? C ASN 76  C  ? ? ? 1_555 C MSE 77  N  ? ? C ASN 76  C MSE 77  1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale33 covale both ? C MSE 77  C  ? ? ? 1_555 C ARG 78  N  ? ? C MSE 77  C ARG 78  1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale34 covale both ? C GLN 86  C  ? ? ? 1_555 C MSE 87  N  ? ? C GLN 86  C MSE 87  1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale35 covale both ? C MSE 87  C  ? ? ? 1_555 C GLU 88  N  ? ? C MSE 87  C GLU 88  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale36 covale both ? C ARG 122 C  ? ? ? 1_555 C MSE 123 N  ? ? C ARG 122 C MSE 123 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale37 covale both ? C MSE 123 C  ? ? ? 1_555 C PRO 124 N  ? ? C MSE 123 C PRO 124 1_555 ? ? ? ? ? ? ? 1.346 ? ? 
covale38 covale both ? C LEU 153 C  ? ? ? 1_555 C MSE 154 N  ? ? C LEU 153 C MSE 154 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale39 covale both ? C MSE 154 C  ? ? ? 1_555 C ASP 155 N  ? ? C MSE 154 C ASP 155 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale40 covale both ? C ILE 158 C  ? ? ? 1_555 C MSE 159 N  ? ? C ILE 158 C MSE 159 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale41 covale both ? C MSE 159 C  ? ? ? 1_555 C ASP 160 N  ? ? C MSE 159 C ASP 160 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale42 covale both ? C MSE 206 C  ? ? ? 1_555 C SER 207 N  ? ? C MSE 206 C SER 207 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale43 covale both ? C SER 207 C  ? ? ? 1_555 C MSE 208 N  ? ? C SER 207 C MSE 208 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale44 covale both ? C MSE 208 C  ? ? ? 1_555 C GLN 209 N  ? ? C MSE 208 C GLN 209 1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale45 covale both ? C LEU 292 C  ? ? ? 1_555 C MSE 293 N  ? ? C LEU 292 C MSE 293 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale46 covale both ? C MSE 293 C  ? ? ? 1_555 C VAL 294 N  ? ? C MSE 293 C VAL 294 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale47 covale both ? D ASN 76  C  ? ? ? 1_555 D MSE 77  N  ? ? D ASN 76  D MSE 77  1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale48 covale both ? D MSE 77  C  ? ? ? 1_555 D ARG 78  N  ? ? D MSE 77  D ARG 78  1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale49 covale both ? D GLN 86  C  ? ? ? 1_555 D MSE 87  N  ? ? D GLN 86  D MSE 87  1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale50 covale both ? D MSE 87  C  ? ? ? 1_555 D GLU 88  N  ? ? D MSE 87  D GLU 88  1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale51 covale both ? D ARG 122 C  ? ? ? 1_555 D MSE 123 N  ? ? D ARG 122 D MSE 123 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale52 covale both ? D MSE 123 C  ? ? ? 1_555 D PRO 124 N  ? ? D MSE 123 D PRO 124 1_555 ? ? ? ? ? ? ? 1.345 ? ? 
covale53 covale both ? D LEU 153 C  ? ? ? 1_555 D MSE 154 N  ? ? D LEU 153 D MSE 154 1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale54 covale both ? D MSE 154 C  ? ? ? 1_555 D ASP 155 N  ? ? D MSE 154 D ASP 155 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale55 covale both ? D ILE 158 C  ? ? ? 1_555 D MSE 159 N  ? ? D ILE 158 D MSE 159 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale56 covale both ? D MSE 159 C  ? ? ? 1_555 D ASP 160 N  ? ? D MSE 159 D ASP 160 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale57 covale both ? D ASP 205 C  ? ? ? 1_555 D MSE 206 N  ? ? D ASP 205 D MSE 206 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale58 covale both ? D MSE 206 C  ? ? ? 1_555 D SER 207 N  ? ? D MSE 206 D SER 207 1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale59 covale both ? D SER 207 C  ? ? ? 1_555 D MSE 208 N  ? ? D SER 207 D MSE 208 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale60 covale both ? D MSE 208 C  ? ? ? 1_555 D GLN 209 N  ? ? D MSE 208 D GLN 209 1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale61 covale both ? D LEU 292 C  ? ? ? 1_555 D MSE 293 N  ? ? D LEU 292 D MSE 293 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale62 covale both ? D MSE 293 C  ? ? ? 1_555 D VAL 294 N  ? ? D MSE 293 D VAL 294 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale63 covale both ? E NAG .   O4 ? ? ? 1_555 E NAG .   C1 ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.387 ? ? 
covale64 covale both ? E NAG .   O4 ? ? ? 1_555 E NAG .   C1 ? ? E NAG 2   E NAG 3   1_555 ? ? ? ? ? ? ? 1.385 ? ? 
covale65 covale both ? E NAG .   O4 ? ? ? 1_555 E NAG .   C1 ? ? E NAG 3   E NAG 4   1_555 ? ? ? ? ? ? ? 1.383 ? ? 
covale66 covale both ? E NAG .   O4 ? ? ? 1_555 E NAG .   C1 ? ? E NAG 4   E NAG 5   1_555 ? ? ? ? ? ? ? 1.385 ? ? 
covale67 covale both ? E NAG .   O4 ? ? ? 1_555 E NAG .   C1 ? ? E NAG 5   E NAG 6   1_555 ? ? ? ? ? ? ? 1.384 ? ? 
covale68 covale both ? F NAG .   O4 ? ? ? 1_555 F NAG .   C1 ? ? F NAG 1   F NAG 2   1_555 ? ? ? ? ? ? ? 1.386 ? ? 
covale69 covale both ? F NAG .   O4 ? ? ? 1_555 F NAG .   C1 ? ? F NAG 2   F NAG 3   1_555 ? ? ? ? ? ? ? 1.384 ? ? 
covale70 covale both ? F NAG .   O4 ? ? ? 1_555 F NAG .   C1 ? ? F NAG 3   F NAG 4   1_555 ? ? ? ? ? ? ? 1.383 ? ? 
covale71 covale both ? F NAG .   O4 ? ? ? 1_555 F NAG .   C1 ? ? F NAG 4   F NAG 5   1_555 ? ? ? ? ? ? ? 1.384 ? ? 
covale72 covale both ? F NAG .   O4 ? ? ? 1_555 F NAG .   C1 ? ? F NAG 5   F NAG 6   1_555 ? ? ? ? ? ? ? 1.384 ? ? 
covale73 covale both ? G NAG .   O4 ? ? ? 1_555 G NAG .   C1 ? ? G NAG 1   G NAG 2   1_555 ? ? ? ? ? ? ? 1.386 ? ? 
covale74 covale both ? G NAG .   O4 ? ? ? 1_555 G NAG .   C1 ? ? G NAG 2   G NAG 3   1_555 ? ? ? ? ? ? ? 1.384 ? ? 
covale75 covale both ? G NAG .   O4 ? ? ? 1_555 G NAG .   C1 ? ? G NAG 3   G NAG 4   1_555 ? ? ? ? ? ? ? 1.384 ? ? 
covale76 covale both ? G NAG .   O4 ? ? ? 1_555 G NAG .   C1 ? ? G NAG 4   G NAG 5   1_555 ? ? ? ? ? ? ? 1.383 ? ? 
covale77 covale both ? G NAG .   O4 ? ? ? 1_555 G NAG .   C1 ? ? G NAG 5   G NAG 6   1_555 ? ? ? ? ? ? ? 1.385 ? ? 
covale78 covale both ? H NAG .   O4 ? ? ? 1_555 H NAG .   C1 ? ? H NAG 1   H NAG 2   1_555 ? ? ? ? ? ? ? 1.387 ? ? 
covale79 covale both ? H NAG .   O4 ? ? ? 1_555 H NAG .   C1 ? ? H NAG 2   H NAG 3   1_555 ? ? ? ? ? ? ? 1.385 ? ? 
covale80 covale both ? H NAG .   O4 ? ? ? 1_555 H NAG .   C1 ? ? H NAG 3   H NAG 4   1_555 ? ? ? ? ? ? ? 1.384 ? ? 
covale81 covale both ? H NAG .   O4 ? ? ? 1_555 H NAG .   C1 ? ? H NAG 4   H NAG 5   1_555 ? ? ? ? ? ? ? 1.384 ? ? 
covale82 covale both ? H NAG .   O4 ? ? ? 1_555 H NAG .   C1 ? ? H NAG 5   H NAG 6   1_555 ? ? ? ? ? ? ? 1.386 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 6 ? 
C ? 9 ? 
D ? 6 ? 
E ? 9 ? 
F ? 6 ? 
G ? 9 ? 
H ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
A 7 8 ? parallel      
A 8 9 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? parallel      
C 6 7 ? anti-parallel 
C 7 8 ? parallel      
C 8 9 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? parallel      
E 6 7 ? anti-parallel 
E 7 8 ? parallel      
E 8 9 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? parallel      
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? parallel      
G 6 7 ? anti-parallel 
G 7 8 ? parallel      
G 8 9 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
H 4 5 ? anti-parallel 
H 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 21  ? LEU A 23  ? PHE A 21  LEU A 23  
A 2 ILE A 82  ? MSE A 87  ? ILE A 82  MSE A 87  
A 3 VAL A 330 ? THR A 335 ? VAL A 330 THR A 335 
A 4 THR A 270 ? LEU A 278 ? THR A 270 LEU A 278 
A 5 PHE A 284 ? ASP A 297 ? PHE A 284 ASP A 297 
A 6 SER A 257 ? ALA A 259 ? SER A 257 ALA A 259 
A 7 HIS A 306 ? ILE A 313 ? HIS A 306 ILE A 313 
A 8 VAL A 96  ? THR A 103 ? VAL A 96  THR A 103 
A 9 ASN A 325 ? GLY A 328 ? ASN A 325 GLY A 328 
B 1 TYR A 118 ? TYR A 121 ? TYR A 118 TYR A 121 
B 2 ILE A 146 ? SER A 150 ? ILE A 146 SER A 150 
B 3 VAL A 105 ? ARG A 109 ? VAL A 105 ARG A 109 
B 4 GLY A 165 ? ASP A 168 ? GLY A 165 ASP A 168 
B 5 ASN A 176 ? LYS A 183 ? ASN A 176 LYS A 183 
B 6 VAL A 234 ? PRO A 238 ? VAL A 234 PRO A 238 
C 1 PHE B 21  ? VAL B 24  ? PHE B 21  VAL B 24  
C 2 ASP B 83  ? MSE B 87  ? ASP B 83  MSE B 87  
C 3 HIS B 326 ? LYS B 334 ? HIS B 326 LYS B 334 
C 4 THR B 270 ? LEU B 278 ? THR B 270 LEU B 278 
C 5 PHE B 284 ? ASP B 297 ? PHE B 284 ASP B 297 
C 6 SER B 257 ? ALA B 259 ? SER B 257 ALA B 259 
C 7 HIS B 306 ? ILE B 313 ? HIS B 306 ILE B 313 
C 8 ASN B 95  ? THR B 103 ? ASN B 95  THR B 103 
C 9 HIS B 326 ? LYS B 334 ? HIS B 326 LYS B 334 
D 1 TYR B 118 ? TYR B 121 ? TYR B 118 TYR B 121 
D 2 ILE B 146 ? SER B 150 ? ILE B 146 SER B 150 
D 3 VAL B 105 ? ARG B 109 ? VAL B 105 ARG B 109 
D 4 GLY B 165 ? ASP B 168 ? GLY B 165 ASP B 168 
D 5 ASN B 176 ? LYS B 183 ? ASN B 176 LYS B 183 
D 6 VAL B 234 ? PRO B 238 ? VAL B 234 PRO B 238 
E 1 PHE C 21  ? VAL C 24  ? PHE C 21  VAL C 24  
E 2 ILE C 82  ? MSE C 87  ? ILE C 82  MSE C 87  
E 3 ASN C 325 ? THR C 335 ? ASN C 325 THR C 335 
E 4 THR C 270 ? GLU C 274 ? THR C 270 GLU C 274 
E 5 LEU C 290 ? ASP C 297 ? LEU C 290 ASP C 297 
E 6 SER C 257 ? ALA C 259 ? SER C 257 ALA C 259 
E 7 HIS C 306 ? ILE C 313 ? HIS C 306 ILE C 313 
E 8 ASN C 95  ? THR C 103 ? ASN C 95  THR C 103 
E 9 ASN C 325 ? THR C 335 ? ASN C 325 THR C 335 
F 1 TYR C 118 ? TYR C 121 ? TYR C 118 TYR C 121 
F 2 ILE C 146 ? SER C 150 ? ILE C 146 SER C 150 
F 3 VAL C 105 ? ARG C 109 ? VAL C 105 ARG C 109 
F 4 GLY C 165 ? ASP C 168 ? GLY C 165 ASP C 168 
F 5 ASN C 176 ? LYS C 183 ? ASN C 176 LYS C 183 
F 6 VAL C 234 ? PRO C 238 ? VAL C 234 PRO C 238 
G 1 PHE D 21  ? VAL D 24  ? PHE D 21  VAL D 24  
G 2 ILE D 82  ? MSE D 87  ? ILE D 82  MSE D 87  
G 3 VAL D 330 ? THR D 335 ? VAL D 330 THR D 335 
G 4 THR D 270 ? LEU D 278 ? THR D 270 LEU D 278 
G 5 PHE D 284 ? ASP D 297 ? PHE D 284 ASP D 297 
G 6 SER D 257 ? ALA D 259 ? SER D 257 ALA D 259 
G 7 HIS D 306 ? ILE D 313 ? HIS D 306 ILE D 313 
G 8 VAL D 96  ? THR D 103 ? VAL D 96  THR D 103 
G 9 ASN D 325 ? GLY D 328 ? ASN D 325 GLY D 328 
H 1 TYR D 118 ? TYR D 121 ? TYR D 118 TYR D 121 
H 2 ILE D 146 ? SER D 150 ? ILE D 146 SER D 150 
H 3 VAL D 105 ? ARG D 109 ? VAL D 105 ARG D 109 
H 4 GLY D 165 ? ASP D 168 ? GLY D 165 ASP D 168 
H 5 ASN D 176 ? LYS D 183 ? ASN D 176 LYS D 183 
H 6 VAL D 234 ? PRO D 238 ? VAL D 234 PRO D 238 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 22  ? N SER A 22  O GLN A 86  ? O GLN A 86  
A 2 3 N TRP A 85  ? N TRP A 85  O VAL A 332 ? O VAL A 332 
A 3 4 O TRP A 331 ? O TRP A 331 N ILE A 272 ? N ILE A 272 
A 4 5 N LEU A 271 ? N LEU A 271 O MSE A 293 ? O MSE A 293 
A 5 6 O VAL A 294 ? O VAL A 294 N VAL A 258 ? N VAL A 258 
A 6 7 N ALA A 259 ? N ALA A 259 O ALA A 308 ? O ALA A 308 
A 7 8 O PHE A 307 ? O PHE A 307 N THR A 99  ? N THR A 99  
A 8 9 N PHE A 98  ? N PHE A 98  O HIS A 326 ? O HIS A 326 
B 1 2 N ILE A 120 ? N ILE A 120 O LEU A 147 ? O LEU A 147 
B 2 3 O TYR A 149 ? O TYR A 149 N ARG A 109 ? N ARG A 109 
B 3 4 N ILE A 106 ? N ILE A 106 O TYR A 166 ? O TYR A 166 
B 4 5 N GLY A 165 ? N GLY A 165 O PHE A 178 ? O PHE A 178 
B 5 6 N GLY A 182 ? N GLY A 182 O PHE A 235 ? O PHE A 235 
C 1 2 N SER B 22  ? N SER B 22  O GLN B 86  ? O GLN B 86  
C 2 3 N TRP B 85  ? N TRP B 85  O VAL B 332 ? O VAL B 332 
C 3 4 O TRP B 331 ? O TRP B 331 N ILE B 272 ? N ILE B 272 
C 4 5 N LEU B 271 ? N LEU B 271 O MSE B 293 ? O MSE B 293 
C 5 6 O VAL B 294 ? O VAL B 294 N VAL B 258 ? N VAL B 258 
C 6 7 N ALA B 259 ? N ALA B 259 O ALA B 308 ? O ALA B 308 
C 7 8 O GLY B 312 ? O GLY B 312 N THR B 103 ? N THR B 103 
C 8 9 N PHE B 98  ? N PHE B 98  O HIS B 326 ? O HIS B 326 
D 1 2 N ILE B 120 ? N ILE B 120 O LEU B 147 ? O LEU B 147 
D 2 3 O TYR B 149 ? O TYR B 149 N ARG B 109 ? N ARG B 109 
D 3 4 N ILE B 106 ? N ILE B 106 O TYR B 166 ? O TYR B 166 
D 4 5 N GLY B 165 ? N GLY B 165 O PHE B 178 ? O PHE B 178 
D 5 6 N GLY B 182 ? N GLY B 182 O PHE B 235 ? O PHE B 235 
E 1 2 N SER C 22  ? N SER C 22  O GLN C 86  ? O GLN C 86  
E 2 3 N ASP C 83  ? N ASP C 83  O LYS C 334 ? O LYS C 334 
E 3 4 O ARG C 329 ? O ARG C 329 N GLU C 274 ? N GLU C 274 
E 4 5 N LEU C 271 ? N LEU C 271 O MSE C 293 ? O MSE C 293 
E 5 6 O VAL C 294 ? O VAL C 294 N VAL C 258 ? N VAL C 258 
E 6 7 N SER C 257 ? N SER C 257 O TYR C 310 ? O TYR C 310 
E 7 8 O GLY C 312 ? O GLY C 312 N THR C 103 ? N THR C 103 
E 8 9 N VAL C 96  ? N VAL C 96  O GLY C 328 ? O GLY C 328 
F 1 2 N ILE C 120 ? N ILE C 120 O LEU C 147 ? O LEU C 147 
F 2 3 O TYR C 149 ? O TYR C 149 N ARG C 109 ? N ARG C 109 
F 3 4 N ILE C 106 ? N ILE C 106 O ASP C 168 ? O ASP C 168 
F 4 5 N ILE C 167 ? N ILE C 167 O ASN C 176 ? O ASN C 176 
F 5 6 N SER C 179 ? N SER C 179 O LYS C 237 ? O LYS C 237 
G 1 2 N SER D 22  ? N SER D 22  O GLN D 86  ? O GLN D 86  
G 2 3 N ASP D 83  ? N ASP D 83  O LYS D 334 ? O LYS D 334 
G 3 4 O TRP D 331 ? O TRP D 331 N ILE D 272 ? N ILE D 272 
G 4 5 N LEU D 271 ? N LEU D 271 O MSE D 293 ? O MSE D 293 
G 5 6 O LEU D 296 ? O LEU D 296 N VAL D 258 ? N VAL D 258 
G 6 7 N ALA D 259 ? N ALA D 259 O ALA D 308 ? O ALA D 308 
G 7 8 O PHE D 307 ? O PHE D 307 N THR D 99  ? N THR D 99  
G 8 9 N PHE D 98  ? N PHE D 98  O HIS D 326 ? O HIS D 326 
H 1 2 N ILE D 120 ? N ILE D 120 O LEU D 147 ? O LEU D 147 
H 2 3 O TYR D 149 ? O TYR D 149 N ARG D 109 ? N ARG D 109 
H 3 4 N ILE D 106 ? N ILE D 106 O ASP D 168 ? O ASP D 168 
H 4 5 N ILE D 167 ? N ILE D 167 O ASN D 176 ? O ASN D 176 
H 5 6 N GLY D 182 ? N GLY D 182 O PHE D 235 ? O PHE D 235 
# 
_atom_sites.entry_id                    2PI8 
_atom_sites.fract_transf_matrix[1][1]   0.010989 
_atom_sites.fract_transf_matrix[1][2]   0.006345 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012689 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005342 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A 1 3   ? 67.790  59.727  89.037  1.00 49.35 ? 3    SER A N   1 
ATOM   2     C  CA  . SER A 1 3   ? 67.858  60.990  89.829  1.00 50.50 ? 3    SER A CA  1 
ATOM   3     C  C   . SER A 1 3   ? 66.716  61.933  89.458  1.00 49.88 ? 3    SER A C   1 
ATOM   4     O  O   . SER A 1 3   ? 65.919  62.325  90.313  1.00 49.23 ? 3    SER A O   1 
ATOM   5     C  CB  . SER A 1 3   ? 69.209  61.683  89.611  1.00 51.57 ? 3    SER A CB  1 
ATOM   6     O  OG  . SER A 1 3   ? 69.437  61.963  88.238  1.00 53.11 ? 3    SER A OG  1 
ATOM   7     N  N   . LYS A 1 4   ? 66.649  62.292  88.177  1.00 49.43 ? 4    LYS A N   1 
ATOM   8     C  CA  . LYS A 1 4   ? 65.613  63.182  87.657  1.00 48.91 ? 4    LYS A CA  1 
ATOM   9     C  C   . LYS A 1 4   ? 65.124  62.632  86.315  1.00 48.48 ? 4    LYS A C   1 
ATOM   10    O  O   . LYS A 1 4   ? 65.491  63.139  85.253  1.00 49.23 ? 4    LYS A O   1 
ATOM   11    C  CB  . LYS A 1 4   ? 66.171  64.600  87.475  1.00 48.89 ? 4    LYS A CB  1 
ATOM   12    C  CG  . LYS A 1 4   ? 66.671  65.255  88.759  1.00 47.70 ? 4    LYS A CG  1 
ATOM   13    C  CD  . LYS A 1 4   ? 67.295  66.619  88.497  1.00 46.00 ? 4    LYS A CD  1 
ATOM   14    C  CE  . LYS A 1 4   ? 66.286  67.597  87.918  1.00 45.17 ? 4    LYS A CE  1 
ATOM   15    N  NZ  . LYS A 1 4   ? 65.118  67.786  88.821  1.00 46.34 ? 4    LYS A NZ  1 
ATOM   16    N  N   . PRO A 1 5   ? 64.304  61.565  86.351  1.00 48.11 ? 5    PRO A N   1 
ATOM   17    C  CA  . PRO A 1 5   ? 63.755  60.918  85.154  1.00 46.42 ? 5    PRO A CA  1 
ATOM   18    C  C   . PRO A 1 5   ? 62.503  61.566  84.561  1.00 44.24 ? 5    PRO A C   1 
ATOM   19    O  O   . PRO A 1 5   ? 61.862  62.414  85.185  1.00 43.70 ? 5    PRO A O   1 
ATOM   20    C  CB  . PRO A 1 5   ? 63.452  59.512  85.657  1.00 47.31 ? 5    PRO A CB  1 
ATOM   21    C  CG  . PRO A 1 5   ? 62.956  59.778  87.038  1.00 47.31 ? 5    PRO A CG  1 
ATOM   22    C  CD  . PRO A 1 5   ? 63.956  60.794  87.562  1.00 48.11 ? 5    PRO A CD  1 
ATOM   23    N  N   . THR A 1 6   ? 62.167  61.136  83.347  1.00 42.36 ? 6    THR A N   1 
ATOM   24    C  CA  . THR A 1 6   ? 60.994  61.612  82.618  1.00 40.67 ? 6    THR A CA  1 
ATOM   25    C  C   . THR A 1 6   ? 60.494  60.475  81.719  1.00 40.31 ? 6    THR A C   1 
ATOM   26    O  O   . THR A 1 6   ? 59.666  60.678  80.829  1.00 39.70 ? 6    THR A O   1 
ATOM   27    C  CB  . THR A 1 6   ? 61.322  62.859  81.760  1.00 40.27 ? 6    THR A CB  1 
ATOM   28    O  OG1 . THR A 1 6   ? 60.120  63.360  81.160  1.00 39.95 ? 6    THR A OG1 1 
ATOM   29    C  CG2 . THR A 1 6   ? 62.332  62.518  80.667  1.00 39.68 ? 6    THR A CG2 1 
ATOM   30    N  N   . ASP A 1 7   ? 61.001  59.274  81.991  1.00 40.38 ? 7    ASP A N   1 
ATOM   31    C  CA  . ASP A 1 7   ? 60.660  58.062  81.250  1.00 40.00 ? 7    ASP A CA  1 
ATOM   32    C  C   . ASP A 1 7   ? 59.209  57.611  81.410  1.00 40.07 ? 7    ASP A C   1 
ATOM   33    O  O   . ASP A 1 7   ? 58.586  57.170  80.445  1.00 40.54 ? 7    ASP A O   1 
ATOM   34    C  CB  . ASP A 1 7   ? 61.612  56.925  81.639  1.00 39.33 ? 7    ASP A CB  1 
ATOM   35    C  CG  . ASP A 1 7   ? 61.983  56.946  83.117  1.00 39.14 ? 7    ASP A CG  1 
ATOM   36    O  OD1 . ASP A 1 7   ? 61.078  56.873  83.975  1.00 39.80 ? 7    ASP A OD1 1 
ATOM   37    O  OD2 . ASP A 1 7   ? 63.190  57.043  83.419  1.00 40.57 ? 7    ASP A OD2 1 
ATOM   38    N  N   . ARG A 1 8   ? 58.686  57.695  82.631  1.00 38.99 ? 8    ARG A N   1 
ATOM   39    C  CA  . ARG A 1 8   ? 57.305  57.303  82.909  1.00 37.00 ? 8    ARG A CA  1 
ATOM   40    C  C   . ARG A 1 8   ? 56.337  58.458  82.660  1.00 34.83 ? 8    ARG A C   1 
ATOM   41    O  O   . ARG A 1 8   ? 55.158  58.375  83.009  1.00 33.91 ? 8    ARG A O   1 
ATOM   42    C  CB  . ARG A 1 8   ? 57.161  56.829  84.357  1.00 40.15 ? 8    ARG A CB  1 
ATOM   43    C  CG  . ARG A 1 8   ? 57.881  55.533  84.694  1.00 42.14 ? 8    ARG A CG  1 
ATOM   44    C  CD  . ARG A 1 8   ? 57.641  55.171  86.151  1.00 44.74 ? 8    ARG A CD  1 
ATOM   45    N  NE  . ARG A 1 8   ? 58.263  53.907  86.535  1.00 46.27 ? 8    ARG A NE  1 
ATOM   46    C  CZ  . ARG A 1 8   ? 58.234  53.404  87.766  1.00 47.41 ? 8    ARG A CZ  1 
ATOM   47    N  NH1 . ARG A 1 8   ? 57.611  54.056  88.740  1.00 47.51 ? 8    ARG A NH1 1 
ATOM   48    N  NH2 . ARG A 1 8   ? 58.827  52.247  88.024  1.00 49.15 ? 8    ARG A NH2 1 
ATOM   49    N  N   . GLY A 1 9   ? 56.839  59.534  82.060  1.00 33.56 ? 9    GLY A N   1 
ATOM   50    C  CA  . GLY A 1 9   ? 56.007  60.690  81.783  1.00 30.58 ? 9    GLY A CA  1 
ATOM   51    C  C   . GLY A 1 9   ? 55.963  61.669  82.939  1.00 29.75 ? 9    GLY A C   1 
ATOM   52    O  O   . GLY A 1 9   ? 54.953  62.340  83.151  1.00 29.12 ? 9    GLY A O   1 
ATOM   53    N  N   . GLN A 1 10  ? 57.058  61.742  83.693  1.00 30.77 ? 10   GLN A N   1 
ATOM   54    C  CA  . GLN A 1 10  ? 57.152  62.646  84.835  1.00 32.15 ? 10   GLN A CA  1 
ATOM   55    C  C   . GLN A 1 10  ? 57.303  64.089  84.367  1.00 33.11 ? 10   GLN A C   1 
ATOM   56    O  O   . GLN A 1 10  ? 58.087  64.379  83.461  1.00 32.18 ? 10   GLN A O   1 
ATOM   57    C  CB  . GLN A 1 10  ? 58.332  62.269  85.742  1.00 32.05 ? 10   GLN A CB  1 
ATOM   58    C  CG  . GLN A 1 10  ? 58.238  60.893  86.394  1.00 29.24 ? 10   GLN A CG  1 
ATOM   59    C  CD  . GLN A 1 10  ? 58.821  59.786  85.535  1.00 28.32 ? 10   GLN A CD  1 
ATOM   60    O  OE1 . GLN A 1 10  ? 58.762  59.838  84.310  1.00 27.98 ? 10   GLN A OE1 1 
ATOM   61    N  NE2 . GLN A 1 10  ? 59.397  58.778  86.181  1.00 28.19 ? 10   GLN A NE2 1 
ATOM   62    N  N   . GLN A 1 11  ? 56.541  64.986  84.987  1.00 35.17 ? 11   GLN A N   1 
ATOM   63    C  CA  . GLN A 1 11  ? 56.577  66.401  84.642  1.00 37.20 ? 11   GLN A CA  1 
ATOM   64    C  C   . GLN A 1 11  ? 57.315  67.253  85.668  1.00 38.56 ? 11   GLN A C   1 
ATOM   65    O  O   . GLN A 1 11  ? 57.487  66.862  86.822  1.00 38.53 ? 11   GLN A O   1 
ATOM   66    C  CB  . GLN A 1 11  ? 55.159  66.941  84.429  1.00 38.15 ? 11   GLN A CB  1 
ATOM   67    C  CG  . GLN A 1 11  ? 54.455  66.367  83.207  1.00 39.47 ? 11   GLN A CG  1 
ATOM   68    C  CD  . GLN A 1 11  ? 55.224  66.617  81.921  1.00 39.89 ? 11   GLN A CD  1 
ATOM   69    O  OE1 . GLN A 1 11  ? 55.988  65.622  81.486  1.00 39.74 ? 11   GLN A OE1 1 
ATOM   70    N  NE2 . GLN A 1 11  ? 55.136  67.693  81.332  1.00 40.75 ? 11   GLN A NE2 1 
ATOM   71    N  N   . TYR A 1 12  ? 57.742  68.427  85.218  1.00 40.14 ? 12   TYR A N   1 
ATOM   72    C  CA  . TYR A 1 12  ? 58.477  69.387  86.034  1.00 41.72 ? 12   TYR A CA  1 
ATOM   73    C  C   . TYR A 1 12  ? 57.951  70.766  85.630  1.00 42.01 ? 12   TYR A C   1 
ATOM   74    O  O   . TYR A 1 12  ? 58.162  71.763  86.323  1.00 42.05 ? 12   TYR A O   1 
ATOM   75    C  CB  . TYR A 1 12  ? 59.972  69.272  85.702  1.00 44.44 ? 12   TYR A CB  1 
ATOM   76    C  CG  . TYR A 1 12  ? 60.932  69.880  86.708  1.00 46.59 ? 12   TYR A CG  1 
ATOM   77    C  CD1 . TYR A 1 12  ? 61.153  71.259  86.753  1.00 46.87 ? 12   TYR A CD1 1 
ATOM   78    C  CD2 . TYR A 1 12  ? 61.656  69.070  87.585  1.00 47.10 ? 12   TYR A CD2 1 
ATOM   79    C  CE1 . TYR A 1 12  ? 62.071  71.814  87.644  1.00 45.39 ? 12   TYR A CE1 1 
ATOM   80    C  CE2 . TYR A 1 12  ? 62.577  69.616  88.479  1.00 46.49 ? 12   TYR A CE2 1 
ATOM   81    C  CZ  . TYR A 1 12  ? 62.780  70.988  88.502  1.00 46.03 ? 12   TYR A CZ  1 
ATOM   82    O  OH  . TYR A 1 12  ? 63.692  71.531  89.378  1.00 45.49 ? 12   TYR A OH  1 
ATOM   83    N  N   . LYS A 1 13  ? 57.226  70.786  84.513  1.00 42.09 ? 13   LYS A N   1 
ATOM   84    C  CA  . LYS A 1 13  ? 56.646  71.995  83.935  1.00 41.44 ? 13   LYS A CA  1 
ATOM   85    C  C   . LYS A 1 13  ? 55.355  72.433  84.628  1.00 42.47 ? 13   LYS A C   1 
ATOM   86    O  O   . LYS A 1 13  ? 54.347  72.711  83.972  1.00 42.96 ? 13   LYS A O   1 
ATOM   87    C  CB  . LYS A 1 13  ? 56.390  71.760  82.445  1.00 39.26 ? 13   LYS A CB  1 
ATOM   88    C  CG  . LYS A 1 13  ? 57.581  71.157  81.722  1.00 37.16 ? 13   LYS A CG  1 
ATOM   89    C  CD  . LYS A 1 13  ? 57.203  70.619  80.357  1.00 35.61 ? 13   LYS A CD  1 
ATOM   90    C  CE  . LYS A 1 13  ? 58.355  69.837  79.748  1.00 34.35 ? 13   LYS A CE  1 
ATOM   91    N  NZ  . LYS A 1 13  ? 58.744  68.676  80.598  1.00 34.24 ? 13   LYS A NZ  1 
ATOM   92    N  N   . ASP A 1 14  ? 55.401  72.511  85.955  1.00 43.18 ? 14   ASP A N   1 
ATOM   93    C  CA  . ASP A 1 14  ? 54.258  72.922  86.765  1.00 43.64 ? 14   ASP A CA  1 
ATOM   94    C  C   . ASP A 1 14  ? 54.714  73.432  88.125  1.00 43.74 ? 14   ASP A C   1 
ATOM   95    O  O   . ASP A 1 14  ? 53.986  74.161  88.802  1.00 43.96 ? 14   ASP A O   1 
ATOM   96    C  CB  . ASP A 1 14  ? 53.277  71.761  86.957  1.00 45.06 ? 14   ASP A CB  1 
ATOM   97    C  CG  . ASP A 1 14  ? 52.188  71.734  85.900  1.00 46.04 ? 14   ASP A CG  1 
ATOM   98    O  OD1 . ASP A 1 14  ? 51.390  72.694  85.840  1.00 45.91 ? 14   ASP A OD1 1 
ATOM   99    O  OD2 . ASP A 1 14  ? 52.128  70.753  85.131  1.00 48.52 ? 14   ASP A OD2 1 
ATOM   100   N  N   . GLY A 1 15  ? 55.927  73.050  88.514  1.00 43.79 ? 15   GLY A N   1 
ATOM   101   C  CA  . GLY A 1 15  ? 56.466  73.468  89.794  1.00 43.07 ? 15   GLY A CA  1 
ATOM   102   C  C   . GLY A 1 15  ? 55.975  72.591  90.927  1.00 42.31 ? 15   GLY A C   1 
ATOM   103   O  O   . GLY A 1 15  ? 55.041  71.805  90.753  1.00 42.76 ? 15   GLY A O   1 
ATOM   104   N  N   . LYS A 1 16  ? 56.618  72.714  92.085  1.00 41.41 ? 16   LYS A N   1 
ATOM   105   C  CA  . LYS A 1 16  ? 56.254  71.935  93.264  1.00 41.03 ? 16   LYS A CA  1 
ATOM   106   C  C   . LYS A 1 16  ? 54.875  72.310  93.791  1.00 40.33 ? 16   LYS A C   1 
ATOM   107   O  O   . LYS A 1 16  ? 54.489  73.481  93.779  1.00 39.79 ? 16   LYS A O   1 
ATOM   108   C  CB  . LYS A 1 16  ? 57.288  72.133  94.376  1.00 41.57 ? 16   LYS A CB  1 
ATOM   109   C  CG  . LYS A 1 16  ? 58.530  71.259  94.268  1.00 43.33 ? 16   LYS A CG  1 
ATOM   110   C  CD  . LYS A 1 16  ? 58.239  69.817  94.671  1.00 43.22 ? 16   LYS A CD  1 
ATOM   111   C  CE  . LYS A 1 16  ? 59.526  69.016  94.818  1.00 44.76 ? 16   LYS A CE  1 
ATOM   112   N  NZ  . LYS A 1 16  ? 59.279  67.612  95.255  1.00 44.47 ? 16   LYS A NZ  1 
ATOM   113   N  N   . PHE A 1 17  ? 54.131  71.300  94.230  1.00 39.63 ? 17   PHE A N   1 
ATOM   114   C  CA  . PHE A 1 17  ? 52.801  71.508  94.785  1.00 38.90 ? 17   PHE A CA  1 
ATOM   115   C  C   . PHE A 1 17  ? 52.878  71.437  96.306  1.00 40.06 ? 17   PHE A C   1 
ATOM   116   O  O   . PHE A 1 17  ? 53.316  70.433  96.872  1.00 39.96 ? 17   PHE A O   1 
ATOM   117   C  CB  . PHE A 1 17  ? 51.815  70.469  94.241  1.00 35.80 ? 17   PHE A CB  1 
ATOM   118   C  CG  . PHE A 1 17  ? 51.389  70.723  92.820  1.00 32.42 ? 17   PHE A CG  1 
ATOM   119   C  CD1 . PHE A 1 17  ? 52.256  70.472  91.761  1.00 31.54 ? 17   PHE A CD1 1 
ATOM   120   C  CD2 . PHE A 1 17  ? 50.125  71.232  92.542  1.00 32.26 ? 17   PHE A CD2 1 
ATOM   121   C  CE1 . PHE A 1 17  ? 51.871  70.726  90.444  1.00 30.25 ? 17   PHE A CE1 1 
ATOM   122   C  CE2 . PHE A 1 17  ? 49.730  71.489  91.228  1.00 30.81 ? 17   PHE A CE2 1 
ATOM   123   C  CZ  . PHE A 1 17  ? 50.607  71.235  90.178  1.00 28.62 ? 17   PHE A CZ  1 
ATOM   124   N  N   . THR A 1 18  ? 52.487  72.530  96.955  1.00 41.81 ? 18   THR A N   1 
ATOM   125   C  CA  . THR A 1 18  ? 52.509  72.624  98.413  1.00 43.43 ? 18   THR A CA  1 
ATOM   126   C  C   . THR A 1 18  ? 51.264  72.026  99.071  1.00 44.36 ? 18   THR A C   1 
ATOM   127   O  O   . THR A 1 18  ? 51.136  72.036  100.299 1.00 45.20 ? 18   THR A O   1 
ATOM   128   C  CB  . THR A 1 18  ? 52.678  74.091  98.872  1.00 43.32 ? 18   THR A CB  1 
ATOM   129   O  OG1 . THR A 1 18  ? 51.645  74.902  98.297  1.00 42.83 ? 18   THR A OG1 1 
ATOM   130   C  CG2 . THR A 1 18  ? 54.036  74.629  98.442  1.00 42.62 ? 18   THR A CG2 1 
ATOM   131   N  N   . GLN A 1 19  ? 50.362  71.493  98.250  1.00 44.51 ? 19   GLN A N   1 
ATOM   132   C  CA  . GLN A 1 19  ? 49.125  70.883  98.735  1.00 44.05 ? 19   GLN A CA  1 
ATOM   133   C  C   . GLN A 1 19  ? 48.617  69.814  97.764  1.00 43.35 ? 19   GLN A C   1 
ATOM   134   O  O   . GLN A 1 19  ? 48.904  69.866  96.565  1.00 43.32 ? 19   GLN A O   1 
ATOM   135   C  CB  . GLN A 1 19  ? 48.056  71.960  98.968  1.00 44.96 ? 19   GLN A CB  1 
ATOM   136   C  CG  . GLN A 1 19  ? 47.751  72.825  97.757  1.00 47.38 ? 19   GLN A CG  1 
ATOM   137   C  CD  . GLN A 1 19  ? 46.788  73.952  98.075  1.00 48.79 ? 19   GLN A CD  1 
ATOM   138   O  OE1 . GLN A 1 19  ? 47.183  75.116  98.150  1.00 50.91 ? 19   GLN A OE1 1 
ATOM   139   N  NE2 . GLN A 1 19  ? 45.518  73.612  98.264  1.00 49.13 ? 19   GLN A NE2 1 
ATOM   140   N  N   . PRO A 1 20  ? 47.867  68.819  98.277  1.00 42.99 ? 20   PRO A N   1 
ATOM   141   C  CA  . PRO A 1 20  ? 47.304  67.715  97.488  1.00 42.00 ? 20   PRO A CA  1 
ATOM   142   C  C   . PRO A 1 20  ? 46.442  68.143  96.302  1.00 41.13 ? 20   PRO A C   1 
ATOM   143   O  O   . PRO A 1 20  ? 46.503  67.530  95.234  1.00 38.62 ? 20   PRO A O   1 
ATOM   144   C  CB  . PRO A 1 20  ? 46.482  66.948  98.523  1.00 41.85 ? 20   PRO A CB  1 
ATOM   145   C  CG  . PRO A 1 20  ? 47.253  67.162  99.779  1.00 42.27 ? 20   PRO A CG  1 
ATOM   146   C  CD  . PRO A 1 20  ? 47.557  68.637  99.707  1.00 42.59 ? 20   PRO A CD  1 
ATOM   147   N  N   . PHE A 1 21  ? 45.636  69.185  96.499  1.00 41.85 ? 21   PHE A N   1 
ATOM   148   C  CA  . PHE A 1 21  ? 44.750  69.694  95.452  1.00 41.69 ? 21   PHE A CA  1 
ATOM   149   C  C   . PHE A 1 21  ? 44.895  71.211  95.318  1.00 41.22 ? 21   PHE A C   1 
ATOM   150   O  O   . PHE A 1 21  ? 44.626  71.952  96.264  1.00 40.99 ? 21   PHE A O   1 
ATOM   151   C  CB  . PHE A 1 21  ? 43.292  69.341  95.776  1.00 41.19 ? 21   PHE A CB  1 
ATOM   152   C  CG  . PHE A 1 21  ? 43.083  67.898  96.152  1.00 42.15 ? 21   PHE A CG  1 
ATOM   153   C  CD1 . PHE A 1 21  ? 43.256  66.885  95.214  1.00 42.64 ? 21   PHE A CD1 1 
ATOM   154   C  CD2 . PHE A 1 21  ? 42.729  67.551  97.453  1.00 41.74 ? 21   PHE A CD2 1 
ATOM   155   C  CE1 . PHE A 1 21  ? 43.081  65.547  95.568  1.00 42.59 ? 21   PHE A CE1 1 
ATOM   156   C  CE2 . PHE A 1 21  ? 42.552  66.216  97.816  1.00 41.35 ? 21   PHE A CE2 1 
ATOM   157   C  CZ  . PHE A 1 21  ? 42.729  65.213  96.871  1.00 41.48 ? 21   PHE A CZ  1 
ATOM   158   N  N   . SER A 1 22  ? 45.314  71.665  94.139  1.00 41.22 ? 22   SER A N   1 
ATOM   159   C  CA  . SER A 1 22  ? 45.502  73.091  93.879  1.00 41.37 ? 22   SER A CA  1 
ATOM   160   C  C   . SER A 1 22  ? 44.565  73.618  92.796  1.00 42.33 ? 22   SER A C   1 
ATOM   161   O  O   . SER A 1 22  ? 44.658  73.221  91.634  1.00 43.04 ? 22   SER A O   1 
ATOM   162   C  CB  . SER A 1 22  ? 46.954  73.372  93.480  1.00 40.36 ? 22   SER A CB  1 
ATOM   163   O  OG  . SER A 1 22  ? 47.850  73.032  94.522  1.00 38.77 ? 22   SER A OG  1 
ATOM   164   N  N   . LEU A 1 23  ? 43.676  74.529  93.183  1.00 43.19 ? 23   LEU A N   1 
ATOM   165   C  CA  . LEU A 1 23  ? 42.720  75.125  92.254  1.00 43.69 ? 23   LEU A CA  1 
ATOM   166   C  C   . LEU A 1 23  ? 43.362  76.108  91.273  1.00 43.94 ? 23   LEU A C   1 
ATOM   167   O  O   . LEU A 1 23  ? 43.838  77.176  91.663  1.00 44.73 ? 23   LEU A O   1 
ATOM   168   C  CB  . LEU A 1 23  ? 41.568  75.798  93.017  1.00 44.19 ? 23   LEU A CB  1 
ATOM   169   C  CG  . LEU A 1 23  ? 41.763  76.302  94.455  1.00 45.47 ? 23   LEU A CG  1 
ATOM   170   C  CD1 . LEU A 1 23  ? 42.878  77.336  94.550  1.00 47.15 ? 23   LEU A CD1 1 
ATOM   171   C  CD2 . LEU A 1 23  ? 40.455  76.890  94.963  1.00 45.22 ? 23   LEU A CD2 1 
ATOM   172   N  N   . VAL A 1 24  ? 43.388  75.726  89.999  1.00 42.61 ? 24   VAL A N   1 
ATOM   173   C  CA  . VAL A 1 24  ? 43.964  76.567  88.953  1.00 41.65 ? 24   VAL A CA  1 
ATOM   174   C  C   . VAL A 1 24  ? 42.878  77.380  88.244  1.00 42.44 ? 24   VAL A C   1 
ATOM   175   O  O   . VAL A 1 24  ? 41.813  77.634  88.811  1.00 43.25 ? 24   VAL A O   1 
ATOM   176   C  CB  . VAL A 1 24  ? 44.756  75.725  87.916  1.00 40.37 ? 24   VAL A CB  1 
ATOM   177   C  CG1 . VAL A 1 24  ? 45.936  75.039  88.584  1.00 40.67 ? 24   VAL A CG1 1 
ATOM   178   C  CG2 . VAL A 1 24  ? 43.851  74.695  87.258  1.00 40.91 ? 24   VAL A CG2 1 
ATOM   179   N  N   . ASN A 1 25  ? 43.157  77.795  87.011  1.00 42.54 ? 25   ASN A N   1 
ATOM   180   C  CA  . ASN A 1 25  ? 42.208  78.574  86.222  1.00 42.65 ? 25   ASN A CA  1 
ATOM   181   C  C   . ASN A 1 25  ? 42.030  77.952  84.842  1.00 43.35 ? 25   ASN A C   1 
ATOM   182   O  O   . ASN A 1 25  ? 40.912  77.817  84.344  1.00 43.74 ? 25   ASN A O   1 
ATOM   183   C  CB  . ASN A 1 25  ? 42.685  80.026  86.088  1.00 42.03 ? 25   ASN A CB  1 
ATOM   184   C  CG  . ASN A 1 25  ? 43.987  80.152  85.310  1.00 40.18 ? 25   ASN A CG  1 
ATOM   185   O  OD1 . ASN A 1 25  ? 44.992  79.524  85.645  1.00 40.62 ? 25   ASN A OD1 1 
ATOM   186   N  ND2 . ASN A 1 25  ? 43.970  80.966  84.261  1.00 38.29 ? 25   ASN A ND2 1 
ATOM   187   N  N   . GLN A 1 26  ? 43.151  77.576  84.234  1.00 44.28 ? 26   GLN A N   1 
ATOM   188   C  CA  . GLN A 1 26  ? 43.175  76.965  82.911  1.00 44.47 ? 26   GLN A CA  1 
ATOM   189   C  C   . GLN A 1 26  ? 44.237  75.869  82.951  1.00 44.00 ? 26   GLN A C   1 
ATOM   190   O  O   . GLN A 1 26  ? 45.433  76.149  82.843  1.00 44.69 ? 26   GLN A O   1 
ATOM   191   C  CB  . GLN A 1 26  ? 43.536  78.011  81.849  1.00 45.07 ? 26   GLN A CB  1 
ATOM   192   C  CG  . GLN A 1 26  ? 42.590  79.208  81.797  1.00 46.84 ? 26   GLN A CG  1 
ATOM   193   C  CD  . GLN A 1 26  ? 43.109  80.344  80.931  1.00 47.39 ? 26   GLN A CD  1 
ATOM   194   O  OE1 . GLN A 1 26  ? 43.675  80.121  79.859  1.00 48.54 ? 26   GLN A OE1 1 
ATOM   195   N  NE2 . GLN A 1 26  ? 42.913  81.574  81.395  1.00 46.45 ? 26   GLN A NE2 1 
ATOM   196   N  N   . PRO A 1 27  ? 43.811  74.606  83.127  1.00 43.39 ? 27   PRO A N   1 
ATOM   197   C  CA  . PRO A 1 27  ? 44.698  73.439  83.192  1.00 41.94 ? 27   PRO A CA  1 
ATOM   198   C  C   . PRO A 1 27  ? 45.752  73.354  82.089  1.00 41.31 ? 27   PRO A C   1 
ATOM   199   O  O   . PRO A 1 27  ? 45.549  73.837  80.972  1.00 40.72 ? 27   PRO A O   1 
ATOM   200   C  CB  . PRO A 1 27  ? 43.718  72.258  83.151  1.00 40.90 ? 27   PRO A CB  1 
ATOM   201   C  CG  . PRO A 1 27  ? 42.469  72.832  82.551  1.00 41.57 ? 27   PRO A CG  1 
ATOM   202   C  CD  . PRO A 1 27  ? 42.403  74.182  83.192  1.00 42.85 ? 27   PRO A CD  1 
ATOM   203   N  N   . ASP A 1 28  ? 46.885  72.744  82.429  1.00 41.52 ? 28   ASP A N   1 
ATOM   204   C  CA  . ASP A 1 28  ? 48.007  72.576  81.508  1.00 40.80 ? 28   ASP A CA  1 
ATOM   205   C  C   . ASP A 1 28  ? 47.787  71.444  80.504  1.00 39.62 ? 28   ASP A C   1 
ATOM   206   O  O   . ASP A 1 28  ? 48.742  70.932  79.917  1.00 38.73 ? 28   ASP A O   1 
ATOM   207   C  CB  . ASP A 1 28  ? 49.298  72.324  82.295  1.00 41.36 ? 28   ASP A CB  1 
ATOM   208   C  CG  . ASP A 1 28  ? 49.705  73.508  83.150  1.00 42.17 ? 28   ASP A CG  1 
ATOM   209   O  OD1 . ASP A 1 28  ? 48.967  73.848  84.101  1.00 42.39 ? 28   ASP A OD1 1 
ATOM   210   O  OD2 . ASP A 1 28  ? 50.773  74.095  82.877  1.00 42.93 ? 28   ASP A OD2 1 
ATOM   211   N  N   . ALA A 1 29  ? 46.527  71.069  80.301  1.00 39.83 ? 29   ALA A N   1 
ATOM   212   C  CA  . ALA A 1 29  ? 46.172  70.003  79.370  1.00 41.02 ? 29   ALA A CA  1 
ATOM   213   C  C   . ALA A 1 29  ? 46.394  70.417  77.915  1.00 42.00 ? 29   ALA A C   1 
ATOM   214   O  O   . ALA A 1 29  ? 46.699  71.576  77.631  1.00 42.79 ? 29   ALA A O   1 
ATOM   215   C  CB  . ALA A 1 29  ? 44.730  69.582  79.587  1.00 40.94 ? 29   ALA A CB  1 
ATOM   216   N  N   . VAL A 1 30  ? 46.225  69.466  76.999  1.00 43.35 ? 30   VAL A N   1 
ATOM   217   C  CA  . VAL A 1 30  ? 46.421  69.721  75.574  1.00 43.97 ? 30   VAL A CA  1 
ATOM   218   C  C   . VAL A 1 30  ? 45.320  70.551  74.900  1.00 45.05 ? 30   VAL A C   1 
ATOM   219   O  O   . VAL A 1 30  ? 45.569  71.685  74.485  1.00 46.22 ? 30   VAL A O   1 
ATOM   220   C  CB  . VAL A 1 30  ? 46.674  68.400  74.791  1.00 43.77 ? 30   VAL A CB  1 
ATOM   221   C  CG1 . VAL A 1 30  ? 45.529  67.412  74.998  1.00 42.62 ? 30   VAL A CG1 1 
ATOM   222   C  CG2 . VAL A 1 30  ? 46.887  68.691  73.314  1.00 43.71 ? 30   VAL A CG2 1 
ATOM   223   N  N   . GLY A 1 31  ? 44.113  69.999  74.798  1.00 45.84 ? 31   GLY A N   1 
ATOM   224   C  CA  . GLY A 1 31  ? 43.025  70.723  74.161  1.00 45.62 ? 31   GLY A CA  1 
ATOM   225   C  C   . GLY A 1 31  ? 41.642  70.163  74.440  1.00 45.51 ? 31   GLY A C   1 
ATOM   226   O  O   . GLY A 1 31  ? 41.042  70.469  75.471  1.00 46.14 ? 31   GLY A O   1 
ATOM   227   N  N   . ALA A 1 32  ? 41.131  69.351  73.518  1.00 45.16 ? 32   ALA A N   1 
ATOM   228   C  CA  . ALA A 1 32  ? 39.806  68.755  73.668  1.00 44.50 ? 32   ALA A CA  1 
ATOM   229   C  C   . ALA A 1 32  ? 39.864  67.251  73.932  1.00 44.11 ? 32   ALA A C   1 
ATOM   230   O  O   . ALA A 1 32  ? 40.652  66.533  73.312  1.00 43.90 ? 32   ALA A O   1 
ATOM   231   C  CB  . ALA A 1 32  ? 38.961  69.042  72.434  1.00 43.92 ? 32   ALA A CB  1 
ATOM   232   N  N   . PRO A 1 33  ? 39.035  66.760  74.874  1.00 44.43 ? 33   PRO A N   1 
ATOM   233   C  CA  . PRO A 1 33  ? 38.965  65.341  75.245  1.00 44.71 ? 33   PRO A CA  1 
ATOM   234   C  C   . PRO A 1 33  ? 38.544  64.462  74.070  1.00 44.84 ? 33   PRO A C   1 
ATOM   235   O  O   . PRO A 1 33  ? 37.834  64.914  73.167  1.00 45.01 ? 33   PRO A O   1 
ATOM   236   C  CB  . PRO A 1 33  ? 37.906  65.333  76.349  1.00 44.16 ? 33   PRO A CB  1 
ATOM   237   C  CG  . PRO A 1 33  ? 38.063  66.679  76.974  1.00 43.55 ? 33   PRO A CG  1 
ATOM   238   C  CD  . PRO A 1 33  ? 38.176  67.565  75.760  1.00 43.97 ? 33   PRO A CD  1 
ATOM   239   N  N   . ILE A 1 34  ? 38.978  63.205  74.092  1.00 44.27 ? 34   ILE A N   1 
ATOM   240   C  CA  . ILE A 1 34  ? 38.654  62.272  73.018  1.00 44.37 ? 34   ILE A CA  1 
ATOM   241   C  C   . ILE A 1 34  ? 37.441  61.390  73.312  1.00 44.01 ? 34   ILE A C   1 
ATOM   242   O  O   . ILE A 1 34  ? 36.659  61.082  72.410  1.00 44.10 ? 34   ILE A O   1 
ATOM   243   C  CB  . ILE A 1 34  ? 39.864  61.373  72.661  1.00 43.95 ? 34   ILE A CB  1 
ATOM   244   C  CG1 . ILE A 1 34  ? 40.186  60.419  73.811  1.00 43.71 ? 34   ILE A CG1 1 
ATOM   245   C  CG2 . ILE A 1 34  ? 41.083  62.234  72.348  1.00 43.48 ? 34   ILE A CG2 1 
ATOM   246   C  CD1 . ILE A 1 34  ? 41.113  59.304  73.415  1.00 42.79 ? 34   ILE A CD1 1 
ATOM   247   N  N   . ASN A 1 35  ? 37.290  60.988  74.571  1.00 43.58 ? 35   ASN A N   1 
ATOM   248   C  CA  . ASN A 1 35  ? 36.178  60.133  74.977  1.00 43.10 ? 35   ASN A CA  1 
ATOM   249   C  C   . ASN A 1 35  ? 35.010  60.918  75.573  1.00 43.23 ? 35   ASN A C   1 
ATOM   250   O  O   . ASN A 1 35  ? 34.500  60.579  76.644  1.00 44.71 ? 35   ASN A O   1 
ATOM   251   C  CB  . ASN A 1 35  ? 36.661  59.054  75.957  1.00 42.74 ? 35   ASN A CB  1 
ATOM   252   C  CG  . ASN A 1 35  ? 37.212  59.632  77.252  1.00 42.70 ? 35   ASN A CG  1 
ATOM   253   O  OD1 . ASN A 1 35  ? 37.547  60.815  77.333  1.00 43.72 ? 35   ASN A OD1 1 
ATOM   254   N  ND2 . ASN A 1 35  ? 37.305  58.792  78.275  1.00 43.29 ? 35   ASN A ND2 1 
ATOM   255   N  N   . ALA A 1 36  ? 34.584  61.964  74.869  1.00 42.59 ? 36   ALA A N   1 
ATOM   256   C  CA  . ALA A 1 36  ? 33.472  62.796  75.317  1.00 40.83 ? 36   ALA A CA  1 
ATOM   257   C  C   . ALA A 1 36  ? 32.177  61.989  75.335  1.00 39.54 ? 36   ALA A C   1 
ATOM   258   O  O   . ALA A 1 36  ? 31.346  62.152  76.231  1.00 38.80 ? 36   ALA A O   1 
ATOM   259   C  CB  . ALA A 1 36  ? 33.329  64.011  74.409  1.00 40.88 ? 36   ALA A CB  1 
ATOM   260   N  N   . GLY A 1 37  ? 32.028  61.107  74.347  1.00 39.20 ? 37   GLY A N   1 
ATOM   261   C  CA  . GLY A 1 37  ? 30.846  60.269  74.246  1.00 39.10 ? 37   GLY A CA  1 
ATOM   262   C  C   . GLY A 1 37  ? 30.829  59.150  75.270  1.00 39.20 ? 37   GLY A C   1 
ATOM   263   O  O   . GLY A 1 37  ? 29.802  58.900  75.903  1.00 39.22 ? 37   GLY A O   1 
ATOM   264   N  N   . ASP A 1 38  ? 31.965  58.473  75.428  1.00 38.92 ? 38   ASP A N   1 
ATOM   265   C  CA  . ASP A 1 38  ? 32.094  57.377  76.389  1.00 38.52 ? 38   ASP A CA  1 
ATOM   266   C  C   . ASP A 1 38  ? 31.830  57.864  77.812  1.00 37.64 ? 38   ASP A C   1 
ATOM   267   O  O   . ASP A 1 38  ? 31.323  57.118  78.649  1.00 37.75 ? 38   ASP A O   1 
ATOM   268   C  CB  . ASP A 1 38  ? 33.492  56.753  76.310  1.00 39.86 ? 38   ASP A CB  1 
ATOM   269   C  CG  . ASP A 1 38  ? 33.696  55.924  75.055  1.00 39.95 ? 38   ASP A CG  1 
ATOM   270   O  OD1 . ASP A 1 38  ? 33.527  56.466  73.942  1.00 42.12 ? 38   ASP A OD1 1 
ATOM   271   O  OD2 . ASP A 1 38  ? 34.033  54.728  75.185  1.00 40.28 ? 38   ASP A OD2 1 
ATOM   272   N  N   . PHE A 1 39  ? 32.187  59.119  78.074  1.00 36.68 ? 39   PHE A N   1 
ATOM   273   C  CA  . PHE A 1 39  ? 31.985  59.729  79.382  1.00 35.37 ? 39   PHE A CA  1 
ATOM   274   C  C   . PHE A 1 39  ? 30.490  59.912  79.639  1.00 35.09 ? 39   PHE A C   1 
ATOM   275   O  O   . PHE A 1 39  ? 30.011  59.678  80.749  1.00 35.03 ? 39   PHE A O   1 
ATOM   276   C  CB  . PHE A 1 39  ? 32.700  61.081  79.451  1.00 34.39 ? 39   PHE A CB  1 
ATOM   277   C  CG  . PHE A 1 39  ? 32.588  61.762  80.786  1.00 33.90 ? 39   PHE A CG  1 
ATOM   278   C  CD1 . PHE A 1 39  ? 33.288  61.281  81.888  1.00 32.21 ? 39   PHE A CD1 1 
ATOM   279   C  CD2 . PHE A 1 39  ? 31.786  62.888  80.941  1.00 34.15 ? 39   PHE A CD2 1 
ATOM   280   C  CE1 . PHE A 1 39  ? 33.192  61.913  83.123  1.00 31.12 ? 39   PHE A CE1 1 
ATOM   281   C  CE2 . PHE A 1 39  ? 31.684  63.526  82.174  1.00 34.39 ? 39   PHE A CE2 1 
ATOM   282   C  CZ  . PHE A 1 39  ? 32.390  63.036  83.267  1.00 33.02 ? 39   PHE A CZ  1 
ATOM   283   N  N   . ALA A 1 40  ? 29.761  60.327  78.604  1.00 34.66 ? 40   ALA A N   1 
ATOM   284   C  CA  . ALA A 1 40  ? 28.318  60.528  78.703  1.00 33.83 ? 40   ALA A CA  1 
ATOM   285   C  C   . ALA A 1 40  ? 27.637  59.194  78.993  1.00 33.51 ? 40   ALA A C   1 
ATOM   286   O  O   . ALA A 1 40  ? 26.656  59.136  79.737  1.00 33.36 ? 40   ALA A O   1 
ATOM   287   C  CB  . ALA A 1 40  ? 27.780  61.130  77.412  1.00 34.22 ? 40   ALA A CB  1 
ATOM   288   N  N   . GLU A 1 41  ? 28.174  58.127  78.402  1.00 33.36 ? 41   GLU A N   1 
ATOM   289   C  CA  . GLU A 1 41  ? 27.654  56.776  78.596  1.00 32.09 ? 41   GLU A CA  1 
ATOM   290   C  C   . GLU A 1 41  ? 27.908  56.332  80.032  1.00 30.47 ? 41   GLU A C   1 
ATOM   291   O  O   . GLU A 1 41  ? 27.150  55.542  80.590  1.00 31.91 ? 41   GLU A O   1 
ATOM   292   C  CB  . GLU A 1 41  ? 28.327  55.797  77.631  1.00 33.39 ? 41   GLU A CB  1 
ATOM   293   C  CG  . GLU A 1 41  ? 27.985  56.013  76.164  1.00 36.27 ? 41   GLU A CG  1 
ATOM   294   C  CD  . GLU A 1 41  ? 28.753  55.082  75.238  1.00 38.69 ? 41   GLU A CD  1 
ATOM   295   O  OE1 . GLU A 1 41  ? 28.753  53.856  75.481  1.00 39.85 ? 41   GLU A OE1 1 
ATOM   296   O  OE2 . GLU A 1 41  ? 29.358  55.578  74.264  1.00 41.17 ? 41   GLU A OE2 1 
ATOM   297   N  N   . GLN A 1 42  ? 28.982  56.849  80.622  1.00 28.93 ? 42   GLN A N   1 
ATOM   298   C  CA  . GLN A 1 42  ? 29.346  56.525  81.993  1.00 27.46 ? 42   GLN A CA  1 
ATOM   299   C  C   . GLN A 1 42  ? 28.460  57.290  82.972  1.00 27.18 ? 42   GLN A C   1 
ATOM   300   O  O   . GLN A 1 42  ? 28.130  56.787  84.045  1.00 27.90 ? 42   GLN A O   1 
ATOM   301   C  CB  . GLN A 1 42  ? 30.821  56.864  82.240  1.00 26.61 ? 42   GLN A CB  1 
ATOM   302   C  CG  . GLN A 1 42  ? 31.353  56.439  83.603  1.00 24.25 ? 42   GLN A CG  1 
ATOM   303   C  CD  . GLN A 1 42  ? 31.333  54.937  83.798  1.00 23.51 ? 42   GLN A CD  1 
ATOM   304   O  OE1 . GLN A 1 42  ? 32.309  54.251  83.501  1.00 23.10 ? 42   GLN A OE1 1 
ATOM   305   N  NE2 . GLN A 1 42  ? 30.217  54.417  84.298  1.00 23.86 ? 42   GLN A NE2 1 
ATOM   306   N  N   . ILE A 1 43  ? 28.066  58.500  82.586  1.00 26.90 ? 43   ILE A N   1 
ATOM   307   C  CA  . ILE A 1 43  ? 27.222  59.342  83.427  1.00 27.23 ? 43   ILE A CA  1 
ATOM   308   C  C   . ILE A 1 43  ? 25.829  58.750  83.626  1.00 26.81 ? 43   ILE A C   1 
ATOM   309   O  O   . ILE A 1 43  ? 25.338  58.690  84.754  1.00 27.48 ? 43   ILE A O   1 
ATOM   310   C  CB  . ILE A 1 43  ? 27.112  60.784  82.860  1.00 26.12 ? 43   ILE A CB  1 
ATOM   311   C  CG1 . ILE A 1 43  ? 28.499  61.425  82.783  1.00 22.97 ? 43   ILE A CG1 1 
ATOM   312   C  CG2 . ILE A 1 43  ? 26.199  61.638  83.733  1.00 25.61 ? 43   ILE A CG2 1 
ATOM   313   C  CD1 . ILE A 1 43  ? 29.259  61.412  84.093  1.00 21.64 ? 43   ILE A CD1 1 
ATOM   314   N  N   . ASN A 1 44  ? 25.197  58.306  82.541  1.00 27.54 ? 44   ASN A N   1 
ATOM   315   C  CA  . ASN A 1 44  ? 23.864  57.718  82.650  1.00 28.71 ? 44   ASN A CA  1 
ATOM   316   C  C   . ASN A 1 44  ? 23.929  56.360  83.350  1.00 28.63 ? 44   ASN A C   1 
ATOM   317   O  O   . ASN A 1 44  ? 22.950  55.925  83.953  1.00 30.56 ? 44   ASN A O   1 
ATOM   318   C  CB  . ASN A 1 44  ? 23.175  57.608  81.280  1.00 29.06 ? 44   ASN A CB  1 
ATOM   319   C  CG  . ASN A 1 44  ? 23.785  56.543  80.394  1.00 28.66 ? 44   ASN A CG  1 
ATOM   320   O  OD1 . ASN A 1 44  ? 24.914  56.674  79.938  1.00 29.68 ? 44   ASN A OD1 1 
ATOM   321   N  ND2 . ASN A 1 44  ? 23.026  55.484  80.134  1.00 29.35 ? 44   ASN A ND2 1 
ATOM   322   N  N   . HIS A 1 45  ? 25.089  55.707  83.279  1.00 28.22 ? 45   HIS A N   1 
ATOM   323   C  CA  . HIS A 1 45  ? 25.291  54.416  83.937  1.00 26.76 ? 45   HIS A CA  1 
ATOM   324   C  C   . HIS A 1 45  ? 25.205  54.607  85.446  1.00 26.28 ? 45   HIS A C   1 
ATOM   325   O  O   . HIS A 1 45  ? 24.709  53.740  86.165  1.00 26.01 ? 45   HIS A O   1 
ATOM   326   C  CB  . HIS A 1 45  ? 26.655  53.823  83.572  1.00 26.65 ? 45   HIS A CB  1 
ATOM   327   C  CG  . HIS A 1 45  ? 26.631  52.941  82.363  1.00 26.99 ? 45   HIS A CG  1 
ATOM   328   N  ND1 . HIS A 1 45  ? 25.498  52.272  81.951  1.00 26.88 ? 45   HIS A ND1 1 
ATOM   329   C  CD2 . HIS A 1 45  ? 27.606  52.601  81.488  1.00 26.95 ? 45   HIS A CD2 1 
ATOM   330   C  CE1 . HIS A 1 45  ? 25.778  51.557  80.875  1.00 27.29 ? 45   HIS A CE1 1 
ATOM   331   N  NE2 . HIS A 1 45  ? 27.051  51.740  80.574  1.00 25.84 ? 45   HIS A NE2 1 
ATOM   332   N  N   . ILE A 1 46  ? 25.703  55.751  85.914  1.00 26.63 ? 46   ILE A N   1 
ATOM   333   C  CA  . ILE A 1 46  ? 25.679  56.100  87.332  1.00 26.80 ? 46   ILE A CA  1 
ATOM   334   C  C   . ILE A 1 46  ? 24.242  56.440  87.725  1.00 28.37 ? 46   ILE A C   1 
ATOM   335   O  O   . ILE A 1 46  ? 23.791  56.100  88.818  1.00 29.12 ? 46   ILE A O   1 
ATOM   336   C  CB  . ILE A 1 46  ? 26.594  57.318  87.624  1.00 24.78 ? 46   ILE A CB  1 
ATOM   337   C  CG1 . ILE A 1 46  ? 28.028  57.012  87.184  1.00 21.83 ? 46   ILE A CG1 1 
ATOM   338   C  CG2 . ILE A 1 46  ? 26.564  57.667  89.110  1.00 23.29 ? 46   ILE A CG2 1 
ATOM   339   C  CD1 . ILE A 1 46  ? 28.967  58.192  87.271  1.00 18.30 ? 46   ILE A CD1 1 
ATOM   340   N  N   . ARG A 1 47  ? 23.528  57.098  86.815  1.00 30.15 ? 47   ARG A N   1 
ATOM   341   C  CA  . ARG A 1 47  ? 22.139  57.487  87.037  1.00 32.12 ? 47   ARG A CA  1 
ATOM   342   C  C   . ARG A 1 47  ? 21.262  56.260  87.251  1.00 33.09 ? 47   ARG A C   1 
ATOM   343   O  O   . ARG A 1 47  ? 20.511  56.182  88.225  1.00 32.83 ? 47   ARG A O   1 
ATOM   344   C  CB  . ARG A 1 47  ? 21.616  58.283  85.836  1.00 33.63 ? 47   ARG A CB  1 
ATOM   345   C  CG  . ARG A 1 47  ? 20.123  58.592  85.888  1.00 36.94 ? 47   ARG A CG  1 
ATOM   346   C  CD  . ARG A 1 47  ? 19.616  59.194  84.584  1.00 39.10 ? 47   ARG A CD  1 
ATOM   347   N  NE  . ARG A 1 47  ? 20.158  60.527  84.332  1.00 42.09 ? 47   ARG A NE  1 
ATOM   348   C  CZ  . ARG A 1 47  ? 19.634  61.401  83.477  1.00 43.62 ? 47   ARG A CZ  1 
ATOM   349   N  NH1 . ARG A 1 47  ? 18.548  61.089  82.782  1.00 45.03 ? 47   ARG A NH1 1 
ATOM   350   N  NH2 . ARG A 1 47  ? 20.194  62.592  83.318  1.00 44.12 ? 47   ARG A NH2 1 
ATOM   351   N  N   . ASN A 1 48  ? 21.387  55.300  86.340  1.00 33.96 ? 48   ASN A N   1 
ATOM   352   C  CA  . ASN A 1 48  ? 20.611  54.067  86.376  1.00 34.89 ? 48   ASN A CA  1 
ATOM   353   C  C   . ASN A 1 48  ? 20.999  53.119  87.509  1.00 36.53 ? 48   ASN A C   1 
ATOM   354   O  O   . ASN A 1 48  ? 20.128  52.525  88.149  1.00 38.59 ? 48   ASN A O   1 
ATOM   355   C  CB  . ASN A 1 48  ? 20.735  53.338  85.033  1.00 35.77 ? 48   ASN A CB  1 
ATOM   356   C  CG  . ASN A 1 48  ? 20.384  54.225  83.846  1.00 36.19 ? 48   ASN A CG  1 
ATOM   357   O  OD1 . ASN A 1 48  ? 19.654  55.207  83.978  1.00 37.46 ? 48   ASN A OD1 1 
ATOM   358   N  ND2 . ASN A 1 48  ? 20.907  53.875  82.676  1.00 36.19 ? 48   ASN A ND2 1 
ATOM   359   N  N   . SER A 1 49  ? 22.300  52.987  87.757  1.00 37.63 ? 49   SER A N   1 
ATOM   360   C  CA  . SER A 1 49  ? 22.811  52.092  88.796  1.00 37.92 ? 49   SER A CA  1 
ATOM   361   C  C   . SER A 1 49  ? 22.777  52.652  90.215  1.00 39.21 ? 49   SER A C   1 
ATOM   362   O  O   . SER A 1 49  ? 22.174  52.054  91.108  1.00 39.92 ? 49   SER A O   1 
ATOM   363   C  CB  . SER A 1 49  ? 24.233  51.649  88.454  1.00 36.57 ? 49   SER A CB  1 
ATOM   364   O  OG  . SER A 1 49  ? 24.262  50.982  87.207  1.00 36.33 ? 49   SER A OG  1 
ATOM   365   N  N   . SER A 1 50  ? 23.453  53.777  90.427  1.00 39.70 ? 50   SER A N   1 
ATOM   366   C  CA  . SER A 1 50  ? 23.501  54.407  91.743  1.00 39.76 ? 50   SER A CA  1 
ATOM   367   C  C   . SER A 1 50  ? 22.815  55.768  91.741  1.00 39.25 ? 50   SER A C   1 
ATOM   368   O  O   . SER A 1 50  ? 23.461  56.798  91.539  1.00 38.62 ? 50   SER A O   1 
ATOM   369   C  CB  . SER A 1 50  ? 24.951  54.549  92.212  1.00 40.44 ? 50   SER A CB  1 
ATOM   370   O  OG  . SER A 1 50  ? 25.560  53.281  92.388  1.00 43.24 ? 50   SER A OG  1 
ATOM   371   N  N   . PRO A 1 51  ? 21.490  55.788  91.970  1.00 39.22 ? 51   PRO A N   1 
ATOM   372   C  CA  . PRO A 1 51  ? 20.691  57.017  92.000  1.00 39.42 ? 51   PRO A CA  1 
ATOM   373   C  C   . PRO A 1 51  ? 21.072  57.952  93.148  1.00 39.40 ? 51   PRO A C   1 
ATOM   374   O  O   . PRO A 1 51  ? 20.881  59.166  93.057  1.00 39.27 ? 51   PRO A O   1 
ATOM   375   C  CB  . PRO A 1 51  ? 19.264  56.488  92.146  1.00 39.18 ? 51   PRO A CB  1 
ATOM   376   C  CG  . PRO A 1 51  ? 19.454  55.228  92.921  1.00 39.95 ? 51   PRO A CG  1 
ATOM   377   C  CD  . PRO A 1 51  ? 20.641  54.613  92.234  1.00 39.18 ? 51   PRO A CD  1 
ATOM   378   N  N   . ARG A 1 52  ? 21.611  57.380  94.223  1.00 38.80 ? 52   ARG A N   1 
ATOM   379   C  CA  . ARG A 1 52  ? 22.029  58.162  95.382  1.00 38.34 ? 52   ARG A CA  1 
ATOM   380   C  C   . ARG A 1 52  ? 23.320  58.913  95.061  1.00 38.33 ? 52   ARG A C   1 
ATOM   381   O  O   . ARG A 1 52  ? 23.481  60.076  95.435  1.00 39.96 ? 52   ARG A O   1 
ATOM   382   C  CB  . ARG A 1 52  ? 22.246  57.257  96.597  1.00 38.13 ? 52   ARG A CB  1 
ATOM   383   C  CG  . ARG A 1 52  ? 22.504  58.030  97.878  1.00 40.22 ? 52   ARG A CG  1 
ATOM   384   C  CD  . ARG A 1 52  ? 23.008  57.140  98.999  1.00 41.67 ? 52   ARG A CD  1 
ATOM   385   N  NE  . ARG A 1 52  ? 23.316  57.914  100.201 1.00 44.02 ? 52   ARG A NE  1 
ATOM   386   C  CZ  . ARG A 1 52  ? 24.329  58.771  100.315 1.00 44.02 ? 52   ARG A CZ  1 
ATOM   387   N  NH1 . ARG A 1 52  ? 25.158  58.978  99.299  1.00 43.20 ? 52   ARG A NH1 1 
ATOM   388   N  NH2 . ARG A 1 52  ? 24.509  59.435  101.448 1.00 44.07 ? 52   ARG A NH2 1 
ATOM   389   N  N   . LEU A 1 53  ? 24.233  58.238  94.367  1.00 37.69 ? 53   LEU A N   1 
ATOM   390   C  CA  . LEU A 1 53  ? 25.510  58.828  93.978  1.00 36.46 ? 53   LEU A CA  1 
ATOM   391   C  C   . LEU A 1 53  ? 25.294  59.878  92.892  1.00 36.95 ? 53   LEU A C   1 
ATOM   392   O  O   . LEU A 1 53  ? 25.939  60.928  92.894  1.00 37.90 ? 53   LEU A O   1 
ATOM   393   C  CB  . LEU A 1 53  ? 26.465  57.743  93.477  1.00 36.78 ? 53   LEU A CB  1 
ATOM   394   C  CG  . LEU A 1 53  ? 27.898  58.173  93.161  1.00 36.72 ? 53   LEU A CG  1 
ATOM   395   C  CD1 . LEU A 1 53  ? 28.549  58.766  94.402  1.00 38.29 ? 53   LEU A CD1 1 
ATOM   396   C  CD2 . LEU A 1 53  ? 28.694  56.979  92.657  1.00 36.58 ? 53   LEU A CD2 1 
ATOM   397   N  N   . TYR A 1 54  ? 24.380  59.588  91.970  1.00 37.11 ? 54   TYR A N   1 
ATOM   398   C  CA  . TYR A 1 54  ? 24.059  60.508  90.885  1.00 36.78 ? 54   TYR A CA  1 
ATOM   399   C  C   . TYR A 1 54  ? 23.359  61.752  91.431  1.00 36.85 ? 54   TYR A C   1 
ATOM   400   O  O   . TYR A 1 54  ? 23.365  62.800  90.793  1.00 37.38 ? 54   TYR A O   1 
ATOM   401   C  CB  . TYR A 1 54  ? 23.164  59.827  89.843  1.00 36.26 ? 54   TYR A CB  1 
ATOM   402   C  CG  . TYR A 1 54  ? 22.901  60.670  88.611  1.00 36.70 ? 54   TYR A CG  1 
ATOM   403   C  CD1 . TYR A 1 54  ? 23.852  60.768  87.596  1.00 36.92 ? 54   TYR A CD1 1 
ATOM   404   C  CD2 . TYR A 1 54  ? 21.709  61.383  88.467  1.00 35.84 ? 54   TYR A CD2 1 
ATOM   405   C  CE1 . TYR A 1 54  ? 23.626  61.554  86.469  1.00 37.34 ? 54   TYR A CE1 1 
ATOM   406   C  CE2 . TYR A 1 54  ? 21.473  62.174  87.343  1.00 35.36 ? 54   TYR A CE2 1 
ATOM   407   C  CZ  . TYR A 1 54  ? 22.437  62.254  86.349  1.00 37.27 ? 54   TYR A CZ  1 
ATOM   408   O  OH  . TYR A 1 54  ? 22.220  63.037  85.237  1.00 38.49 ? 54   TYR A OH  1 
ATOM   409   N  N   . GLY A 1 55  ? 22.752  61.623  92.608  1.00 36.51 ? 55   GLY A N   1 
ATOM   410   C  CA  . GLY A 1 55  ? 22.057  62.744  93.219  1.00 37.11 ? 55   GLY A CA  1 
ATOM   411   C  C   . GLY A 1 55  ? 22.988  63.764  93.850  1.00 37.24 ? 55   GLY A C   1 
ATOM   412   O  O   . GLY A 1 55  ? 22.699  64.963  93.844  1.00 37.64 ? 55   GLY A O   1 
ATOM   413   N  N   . ASN A 1 56  ? 24.105  63.289  94.395  1.00 37.05 ? 56   ASN A N   1 
ATOM   414   C  CA  . ASN A 1 56  ? 25.087  64.157  95.039  1.00 36.63 ? 56   ASN A CA  1 
ATOM   415   C  C   . ASN A 1 56  ? 26.082  64.749  94.045  1.00 36.63 ? 56   ASN A C   1 
ATOM   416   O  O   . ASN A 1 56  ? 26.709  65.775  94.319  1.00 36.78 ? 56   ASN A O   1 
ATOM   417   C  CB  . ASN A 1 56  ? 25.841  63.388  96.127  1.00 36.77 ? 56   ASN A CB  1 
ATOM   418   C  CG  . ASN A 1 56  ? 24.921  62.844  97.202  1.00 36.38 ? 56   ASN A CG  1 
ATOM   419   O  OD1 . ASN A 1 56  ? 23.995  63.524  97.646  1.00 36.47 ? 56   ASN A OD1 1 
ATOM   420   N  ND2 . ASN A 1 56  ? 25.170  61.611  97.624  1.00 37.60 ? 56   ASN A ND2 1 
ATOM   421   N  N   . GLN A 1 57  ? 26.226  64.096  92.896  1.00 35.78 ? 57   GLN A N   1 
ATOM   422   C  CA  . GLN A 1 57  ? 27.145  64.553  91.861  1.00 35.37 ? 57   GLN A CA  1 
ATOM   423   C  C   . GLN A 1 57  ? 26.432  64.956  90.573  1.00 34.81 ? 57   GLN A C   1 
ATOM   424   O  O   . GLN A 1 57  ? 27.072  65.157  89.540  1.00 34.67 ? 57   GLN A O   1 
ATOM   425   C  CB  . GLN A 1 57  ? 28.194  63.477  91.572  1.00 36.10 ? 57   GLN A CB  1 
ATOM   426   C  CG  . GLN A 1 57  ? 29.206  63.273  92.689  1.00 36.42 ? 57   GLN A CG  1 
ATOM   427   C  CD  . GLN A 1 57  ? 30.058  64.504  92.934  1.00 38.25 ? 57   GLN A CD  1 
ATOM   428   O  OE1 . GLN A 1 57  ? 29.829  65.252  93.885  1.00 40.22 ? 57   GLN A OE1 1 
ATOM   429   N  NE2 . GLN A 1 57  ? 31.045  64.723  92.072  1.00 39.98 ? 57   GLN A NE2 1 
ATOM   430   N  N   . SER A 1 58  ? 25.110  65.095  90.649  1.00 35.92 ? 58   SER A N   1 
ATOM   431   C  CA  . SER A 1 58  ? 24.290  65.480  89.501  1.00 36.18 ? 58   SER A CA  1 
ATOM   432   C  C   . SER A 1 58  ? 24.757  66.818  88.946  1.00 36.36 ? 58   SER A C   1 
ATOM   433   O  O   . SER A 1 58  ? 24.881  66.994  87.734  1.00 35.71 ? 58   SER A O   1 
ATOM   434   C  CB  . SER A 1 58  ? 22.819  65.585  89.919  1.00 36.90 ? 58   SER A CB  1 
ATOM   435   O  OG  . SER A 1 58  ? 21.983  65.889  88.817  1.00 39.23 ? 58   SER A OG  1 
ATOM   436   N  N   . ASN A 1 59  ? 25.042  67.743  89.857  1.00 37.09 ? 59   ASN A N   1 
ATOM   437   C  CA  . ASN A 1 59  ? 25.495  69.085  89.514  1.00 37.18 ? 59   ASN A CA  1 
ATOM   438   C  C   . ASN A 1 59  ? 26.820  69.059  88.757  1.00 35.86 ? 59   ASN A C   1 
ATOM   439   O  O   . ASN A 1 59  ? 26.977  69.742  87.745  1.00 35.66 ? 59   ASN A O   1 
ATOM   440   C  CB  . ASN A 1 59  ? 25.639  69.920  90.789  1.00 38.15 ? 59   ASN A CB  1 
ATOM   441   C  CG  . ASN A 1 59  ? 24.398  69.866  91.663  1.00 40.53 ? 59   ASN A CG  1 
ATOM   442   O  OD1 . ASN A 1 59  ? 24.212  68.930  92.444  1.00 39.77 ? 59   ASN A OD1 1 
ATOM   443   N  ND2 . ASN A 1 59  ? 23.538  70.868  91.529  1.00 41.31 ? 59   ASN A ND2 1 
ATOM   444   N  N   . VAL A 1 60  ? 27.760  68.256  89.249  1.00 35.63 ? 60   VAL A N   1 
ATOM   445   C  CA  . VAL A 1 60  ? 29.081  68.127  88.639  1.00 35.66 ? 60   VAL A CA  1 
ATOM   446   C  C   . VAL A 1 60  ? 29.026  67.495  87.247  1.00 35.62 ? 60   VAL A C   1 
ATOM   447   O  O   . VAL A 1 60  ? 29.722  67.937  86.332  1.00 36.10 ? 60   VAL A O   1 
ATOM   448   C  CB  . VAL A 1 60  ? 30.034  67.306  89.545  1.00 35.15 ? 60   VAL A CB  1 
ATOM   449   C  CG1 . VAL A 1 60  ? 31.396  67.154  88.888  1.00 34.67 ? 60   VAL A CG1 1 
ATOM   450   C  CG2 . VAL A 1 60  ? 30.178  67.981  90.902  1.00 34.97 ? 60   VAL A CG2 1 
ATOM   451   N  N   . TYR A 1 61  ? 28.188  66.472  87.090  1.00 36.08 ? 61   TYR A N   1 
ATOM   452   C  CA  . TYR A 1 61  ? 28.040  65.780  85.811  1.00 35.71 ? 61   TYR A CA  1 
ATOM   453   C  C   . TYR A 1 61  ? 27.430  66.683  84.742  1.00 37.37 ? 61   TYR A C   1 
ATOM   454   O  O   . TYR A 1 61  ? 27.824  66.628  83.576  1.00 36.65 ? 61   TYR A O   1 
ATOM   455   C  CB  . TYR A 1 61  ? 27.185  64.521  85.977  1.00 33.08 ? 61   TYR A CB  1 
ATOM   456   C  CG  . TYR A 1 61  ? 27.768  63.495  86.925  1.00 30.51 ? 61   TYR A CG  1 
ATOM   457   C  CD1 . TYR A 1 61  ? 29.143  63.428  87.161  1.00 30.45 ? 61   TYR A CD1 1 
ATOM   458   C  CD2 . TYR A 1 61  ? 26.943  62.594  87.593  1.00 28.88 ? 61   TYR A CD2 1 
ATOM   459   C  CE1 . TYR A 1 61  ? 29.678  62.491  88.041  1.00 27.80 ? 61   TYR A CE1 1 
ATOM   460   C  CE2 . TYR A 1 61  ? 27.466  61.654  88.472  1.00 26.74 ? 61   TYR A CE2 1 
ATOM   461   C  CZ  . TYR A 1 61  ? 28.832  61.608  88.692  1.00 25.53 ? 61   TYR A CZ  1 
ATOM   462   O  OH  . TYR A 1 61  ? 29.347  60.682  89.566  1.00 24.99 ? 61   TYR A OH  1 
ATOM   463   N  N   . ASN A 1 62  ? 26.463  67.503  85.144  1.00 39.56 ? 62   ASN A N   1 
ATOM   464   C  CA  . ASN A 1 62  ? 25.807  68.427  84.226  1.00 40.62 ? 62   ASN A CA  1 
ATOM   465   C  C   . ASN A 1 62  ? 26.688  69.636  83.928  1.00 41.36 ? 62   ASN A C   1 
ATOM   466   O  O   . ASN A 1 62  ? 26.624  70.200  82.837  1.00 41.38 ? 62   ASN A O   1 
ATOM   467   C  CB  . ASN A 1 62  ? 24.461  68.885  84.792  1.00 42.21 ? 62   ASN A CB  1 
ATOM   468   C  CG  . ASN A 1 62  ? 23.410  67.793  84.750  1.00 44.07 ? 62   ASN A CG  1 
ATOM   469   O  OD1 . ASN A 1 62  ? 22.993  67.359  83.674  1.00 44.04 ? 62   ASN A OD1 1 
ATOM   470   N  ND2 . ASN A 1 62  ? 22.971  67.345  85.921  1.00 43.47 ? 62   ASN A ND2 1 
ATOM   471   N  N   . ALA A 1 63  ? 27.517  70.019  84.896  1.00 42.70 ? 63   ALA A N   1 
ATOM   472   C  CA  . ALA A 1 63  ? 28.420  71.159  84.743  1.00 44.02 ? 63   ALA A CA  1 
ATOM   473   C  C   . ALA A 1 63  ? 29.404  70.918  83.603  1.00 45.41 ? 63   ALA A C   1 
ATOM   474   O  O   . ALA A 1 63  ? 29.635  71.798  82.771  1.00 46.56 ? 63   ALA A O   1 
ATOM   475   C  CB  . ALA A 1 63  ? 29.172  71.414  86.043  1.00 43.65 ? 63   ALA A CB  1 
ATOM   476   N  N   . VAL A 1 64  ? 29.974  69.717  83.573  1.00 46.36 ? 64   VAL A N   1 
ATOM   477   C  CA  . VAL A 1 64  ? 30.929  69.334  82.538  1.00 47.21 ? 64   VAL A CA  1 
ATOM   478   C  C   . VAL A 1 64  ? 30.199  68.902  81.261  1.00 47.50 ? 64   VAL A C   1 
ATOM   479   O  O   . VAL A 1 64  ? 30.805  68.799  80.194  1.00 48.97 ? 64   VAL A O   1 
ATOM   480   C  CB  . VAL A 1 64  ? 31.862  68.197  83.038  1.00 47.10 ? 64   VAL A CB  1 
ATOM   481   C  CG1 . VAL A 1 64  ? 31.068  66.928  83.300  1.00 48.71 ? 64   VAL A CG1 1 
ATOM   482   C  CG2 . VAL A 1 64  ? 32.983  67.942  82.042  1.00 46.87 ? 64   VAL A CG2 1 
ATOM   483   N  N   . GLN A 1 65  ? 28.890  68.682  81.375  1.00 47.63 ? 65   GLN A N   1 
ATOM   484   C  CA  . GLN A 1 65  ? 28.063  68.261  80.246  1.00 46.53 ? 65   GLN A CA  1 
ATOM   485   C  C   . GLN A 1 65  ? 27.886  69.390  79.231  1.00 45.93 ? 65   GLN A C   1 
ATOM   486   O  O   . GLN A 1 65  ? 27.735  69.138  78.036  1.00 45.85 ? 65   GLN A O   1 
ATOM   487   C  CB  . GLN A 1 65  ? 26.692  67.788  80.739  1.00 47.24 ? 65   GLN A CB  1 
ATOM   488   C  CG  . GLN A 1 65  ? 26.073  66.668  79.914  1.00 47.07 ? 65   GLN A CG  1 
ATOM   489   C  CD  . GLN A 1 65  ? 26.746  65.325  80.146  1.00 46.56 ? 65   GLN A CD  1 
ATOM   490   O  OE1 . GLN A 1 65  ? 27.893  65.111  79.750  1.00 46.75 ? 65   GLN A OE1 1 
ATOM   491   N  NE2 . GLN A 1 65  ? 26.030  64.411  80.792  1.00 46.04 ? 65   GLN A NE2 1 
ATOM   492   N  N   . GLU A 1 66  ? 27.879  70.630  79.718  1.00 45.41 ? 66   GLU A N   1 
ATOM   493   C  CA  . GLU A 1 66  ? 27.737  71.801  78.855  1.00 44.21 ? 66   GLU A CA  1 
ATOM   494   C  C   . GLU A 1 66  ? 29.080  72.201  78.247  1.00 43.22 ? 66   GLU A C   1 
ATOM   495   O  O   . GLU A 1 66  ? 29.133  72.776  77.159  1.00 42.96 ? 66   GLU A O   1 
ATOM   496   C  CB  . GLU A 1 66  ? 27.148  72.986  79.630  1.00 44.84 ? 66   GLU A CB  1 
ATOM   497   C  CG  . GLU A 1 66  ? 25.630  72.968  79.781  1.00 45.66 ? 66   GLU A CG  1 
ATOM   498   C  CD  . GLU A 1 66  ? 25.140  71.942  80.783  1.00 46.50 ? 66   GLU A CD  1 
ATOM   499   O  OE1 . GLU A 1 66  ? 24.863  70.793  80.379  1.00 47.66 ? 66   GLU A OE1 1 
ATOM   500   O  OE2 . GLU A 1 66  ? 25.023  72.289  81.978  1.00 47.85 ? 66   GLU A OE2 1 
ATOM   501   N  N   . TRP A 1 67  ? 30.158  71.899  78.965  1.00 42.29 ? 67   TRP A N   1 
ATOM   502   C  CA  . TRP A 1 67  ? 31.512  72.209  78.515  1.00 43.36 ? 67   TRP A CA  1 
ATOM   503   C  C   . TRP A 1 67  ? 31.837  71.452  77.230  1.00 43.46 ? 67   TRP A C   1 
ATOM   504   O  O   . TRP A 1 67  ? 32.266  72.048  76.240  1.00 44.09 ? 67   TRP A O   1 
ATOM   505   C  CB  . TRP A 1 67  ? 32.519  71.848  79.611  1.00 44.24 ? 67   TRP A CB  1 
ATOM   506   C  CG  . TRP A 1 67  ? 33.954  72.089  79.244  1.00 45.73 ? 67   TRP A CG  1 
ATOM   507   C  CD1 . TRP A 1 67  ? 34.521  73.275  78.875  1.00 46.05 ? 67   TRP A CD1 1 
ATOM   508   C  CD2 . TRP A 1 67  ? 35.009  71.119  79.231  1.00 46.83 ? 67   TRP A CD2 1 
ATOM   509   N  NE1 . TRP A 1 67  ? 35.864  73.105  78.637  1.00 46.67 ? 67   TRP A NE1 1 
ATOM   510   C  CE2 . TRP A 1 67  ? 36.190  71.791  78.849  1.00 47.01 ? 67   TRP A CE2 1 
ATOM   511   C  CE3 . TRP A 1 67  ? 35.071  69.746  79.509  1.00 46.96 ? 67   TRP A CE3 1 
ATOM   512   C  CZ2 . TRP A 1 67  ? 37.424  71.137  78.736  1.00 47.04 ? 67   TRP A CZ2 1 
ATOM   513   C  CZ3 . TRP A 1 67  ? 36.298  69.095  79.395  1.00 46.77 ? 67   TRP A CZ3 1 
ATOM   514   C  CH2 . TRP A 1 67  ? 37.458  69.794  79.013  1.00 46.71 ? 67   TRP A CH2 1 
ATOM   515   N  N   . LEU A 1 68  ? 31.620  70.139  77.256  1.00 43.65 ? 68   LEU A N   1 
ATOM   516   C  CA  . LEU A 1 68  ? 31.880  69.287  76.101  1.00 44.07 ? 68   LEU A CA  1 
ATOM   517   C  C   . LEU A 1 68  ? 30.835  69.449  74.998  1.00 44.25 ? 68   LEU A C   1 
ATOM   518   O  O   . LEU A 1 68  ? 31.128  69.226  73.821  1.00 45.72 ? 68   LEU A O   1 
ATOM   519   C  CB  . LEU A 1 68  ? 32.002  67.817  76.533  1.00 44.48 ? 68   LEU A CB  1 
ATOM   520   C  CG  . LEU A 1 68  ? 30.943  67.156  77.426  1.00 43.97 ? 68   LEU A CG  1 
ATOM   521   C  CD1 . LEU A 1 68  ? 29.647  66.905  76.665  1.00 44.03 ? 68   LEU A CD1 1 
ATOM   522   C  CD2 . LEU A 1 68  ? 31.496  65.838  77.951  1.00 42.61 ? 68   LEU A CD2 1 
ATOM   523   N  N   . ARG A 1 69  ? 29.624  69.850  75.382  1.00 44.29 ? 69   ARG A N   1 
ATOM   524   C  CA  . ARG A 1 69  ? 28.528  70.052  74.436  1.00 44.20 ? 69   ARG A CA  1 
ATOM   525   C  C   . ARG A 1 69  ? 28.921  71.107  73.406  1.00 44.04 ? 69   ARG A C   1 
ATOM   526   O  O   . ARG A 1 69  ? 28.787  70.895  72.200  1.00 45.00 ? 69   ARG A O   1 
ATOM   527   C  CB  . ARG A 1 69  ? 27.266  70.503  75.177  1.00 43.41 ? 69   ARG A CB  1 
ATOM   528   C  CG  . ARG A 1 69  ? 26.003  70.507  74.331  1.00 42.87 ? 69   ARG A CG  1 
ATOM   529   C  CD  . ARG A 1 69  ? 25.527  69.093  74.040  1.00 42.33 ? 69   ARG A CD  1 
ATOM   530   N  NE  . ARG A 1 69  ? 25.206  68.369  75.268  1.00 43.67 ? 69   ARG A NE  1 
ATOM   531   C  CZ  . ARG A 1 69  ? 24.426  67.293  75.328  1.00 43.99 ? 69   ARG A CZ  1 
ATOM   532   N  NH1 . ARG A 1 69  ? 23.875  66.801  74.224  1.00 43.98 ? 69   ARG A NH1 1 
ATOM   533   N  NH2 . ARG A 1 69  ? 24.196  66.707  76.496  1.00 43.15 ? 69   ARG A NH2 1 
ATOM   534   N  N   . ALA A 1 70  ? 29.411  72.241  73.900  1.00 43.23 ? 70   ALA A N   1 
ATOM   535   C  CA  . ALA A 1 70  ? 29.842  73.343  73.050  1.00 42.36 ? 70   ALA A CA  1 
ATOM   536   C  C   . ALA A 1 70  ? 31.137  72.964  72.342  1.00 41.67 ? 70   ALA A C   1 
ATOM   537   O  O   . ALA A 1 70  ? 31.176  72.834  71.117  1.00 40.59 ? 70   ALA A O   1 
ATOM   538   C  CB  . ALA A 1 70  ? 30.046  74.598  73.890  1.00 44.16 ? 70   ALA A CB  1 
ATOM   539   N  N   . GLY A 1 71  ? 32.188  72.773  73.132  1.00 41.97 ? 71   GLY A N   1 
ATOM   540   C  CA  . GLY A 1 71  ? 33.480  72.403  72.587  1.00 41.97 ? 71   GLY A CA  1 
ATOM   541   C  C   . GLY A 1 71  ? 34.208  71.479  73.540  1.00 41.28 ? 71   GLY A C   1 
ATOM   542   O  O   . GLY A 1 71  ? 33.940  70.277  73.577  1.00 42.45 ? 71   GLY A O   1 
ATOM   543   N  N   . GLY A 1 72  ? 35.119  72.042  74.325  1.00 40.15 ? 72   GLY A N   1 
ATOM   544   C  CA  . GLY A 1 72  ? 35.868  71.241  75.272  1.00 37.97 ? 72   GLY A CA  1 
ATOM   545   C  C   . GLY A 1 72  ? 37.286  71.737  75.462  1.00 36.90 ? 72   GLY A C   1 
ATOM   546   O  O   . GLY A 1 72  ? 38.205  70.937  75.642  1.00 35.49 ? 72   GLY A O   1 
ATOM   547   N  N   . ASP A 1 73  ? 37.466  73.055  75.419  1.00 37.86 ? 73   ASP A N   1 
ATOM   548   C  CA  . ASP A 1 73  ? 38.785  73.655  75.594  1.00 38.64 ? 73   ASP A CA  1 
ATOM   549   C  C   . ASP A 1 73  ? 39.098  73.812  77.076  1.00 38.51 ? 73   ASP A C   1 
ATOM   550   O  O   . ASP A 1 73  ? 38.306  74.374  77.835  1.00 37.33 ? 73   ASP A O   1 
ATOM   551   C  CB  . ASP A 1 73  ? 38.865  75.013  74.887  1.00 39.98 ? 73   ASP A CB  1 
ATOM   552   C  CG  . ASP A 1 73  ? 40.276  75.591  74.879  1.00 40.98 ? 73   ASP A CG  1 
ATOM   553   O  OD1 . ASP A 1 73  ? 41.251  74.810  74.808  1.00 41.08 ? 73   ASP A OD1 1 
ATOM   554   O  OD2 . ASP A 1 73  ? 40.410  76.831  74.933  1.00 41.93 ? 73   ASP A OD2 1 
ATOM   555   N  N   . THR A 1 74  ? 40.262  73.309  77.474  1.00 39.69 ? 74   THR A N   1 
ATOM   556   C  CA  . THR A 1 74  ? 40.712  73.365  78.860  1.00 40.55 ? 74   THR A CA  1 
ATOM   557   C  C   . THR A 1 74  ? 40.935  74.785  79.373  1.00 42.15 ? 74   THR A C   1 
ATOM   558   O  O   . THR A 1 74  ? 40.822  75.039  80.573  1.00 42.17 ? 74   THR A O   1 
ATOM   559   C  CB  . THR A 1 74  ? 41.998  72.538  79.054  1.00 41.40 ? 74   THR A CB  1 
ATOM   560   O  OG1 . THR A 1 74  ? 43.005  72.984  78.137  1.00 40.95 ? 74   THR A OG1 1 
ATOM   561   C  CG2 . THR A 1 74  ? 41.715  71.064  78.812  1.00 40.76 ? 74   THR A CG2 1 
ATOM   562   N  N   . ARG A 1 75  ? 41.247  75.705  78.463  1.00 44.25 ? 75   ARG A N   1 
ATOM   563   C  CA  . ARG A 1 75  ? 41.476  77.100  78.828  1.00 44.64 ? 75   ARG A CA  1 
ATOM   564   C  C   . ARG A 1 75  ? 40.174  77.796  79.223  1.00 45.88 ? 75   ARG A C   1 
ATOM   565   O  O   . ARG A 1 75  ? 40.175  78.719  80.038  1.00 45.50 ? 75   ARG A O   1 
ATOM   566   C  CB  . ARG A 1 75  ? 42.132  77.864  77.673  1.00 43.80 ? 75   ARG A CB  1 
ATOM   567   C  CG  . ARG A 1 75  ? 43.515  77.371  77.281  1.00 41.98 ? 75   ARG A CG  1 
ATOM   568   C  CD  . ARG A 1 75  ? 44.137  78.294  76.242  1.00 41.24 ? 75   ARG A CD  1 
ATOM   569   N  NE  . ARG A 1 75  ? 45.424  77.801  75.758  1.00 40.76 ? 75   ARG A NE  1 
ATOM   570   C  CZ  . ARG A 1 75  ? 46.253  78.497  74.985  1.00 39.86 ? 75   ARG A CZ  1 
ATOM   571   N  NH1 . ARG A 1 75  ? 45.940  79.728  74.604  1.00 40.97 ? 75   ARG A NH1 1 
ATOM   572   N  NH2 . ARG A 1 75  ? 47.394  77.956  74.580  1.00 40.66 ? 75   ARG A NH2 1 
ATOM   573   N  N   . ASN A 1 76  ? 39.064  77.341  78.645  1.00 47.24 ? 76   ASN A N   1 
ATOM   574   C  CA  . ASN A 1 76  ? 37.754  77.921  78.926  1.00 48.06 ? 76   ASN A CA  1 
ATOM   575   C  C   . ASN A 1 76  ? 36.806  76.899  79.553  1.00 49.01 ? 76   ASN A C   1 
ATOM   576   O  O   . ASN A 1 76  ? 36.216  76.075  78.851  1.00 49.62 ? 76   ASN A O   1 
ATOM   577   C  CB  . ASN A 1 76  ? 37.141  78.481  77.638  1.00 48.46 ? 76   ASN A CB  1 
ATOM   578   C  CG  . ASN A 1 76  ? 38.027  79.522  76.973  1.00 48.71 ? 76   ASN A CG  1 
ATOM   579   O  OD1 . ASN A 1 76  ? 37.964  80.709  77.299  1.00 49.23 ? 76   ASN A OD1 1 
ATOM   580   N  ND2 . ASN A 1 76  ? 38.858  79.081  76.036  1.00 48.21 ? 76   ASN A ND2 1 
HETATM 581   N  N   . MSE A 1 77  ? 36.668  76.960  80.876  1.00 49.29 ? 77   MSE A N   1 
HETATM 582   C  CA  . MSE A 1 77  ? 35.795  76.046  81.613  1.00 49.75 ? 77   MSE A CA  1 
HETATM 583   C  C   . MSE A 1 77  ? 34.918  76.783  82.623  1.00 49.85 ? 77   MSE A C   1 
HETATM 584   O  O   . MSE A 1 77  ? 33.885  76.266  83.055  1.00 50.01 ? 77   MSE A O   1 
HETATM 585   C  CB  . MSE A 1 77  ? 36.622  74.988  82.351  1.00 50.61 ? 77   MSE A CB  1 
HETATM 586   C  CG  . MSE A 1 77  ? 37.420  74.059  81.455  1.00 50.26 ? 77   MSE A CG  1 
HETATM 587   SE SE  . MSE A 1 77  ? 38.251  72.629  82.446  1.00 49.17 ? 77   MSE A SE  1 
HETATM 588   C  CE  . MSE A 1 77  ? 36.749  71.427  82.533  1.00 48.87 ? 77   MSE A CE  1 
ATOM   589   N  N   . ARG A 1 78  ? 35.338  77.989  82.995  1.00 49.32 ? 78   ARG A N   1 
ATOM   590   C  CA  . ARG A 1 78  ? 34.617  78.812  83.963  1.00 48.41 ? 78   ARG A CA  1 
ATOM   591   C  C   . ARG A 1 78  ? 33.287  79.361  83.448  1.00 47.54 ? 78   ARG A C   1 
ATOM   592   O  O   . ARG A 1 78  ? 32.436  79.776  84.235  1.00 47.73 ? 78   ARG A O   1 
ATOM   593   C  CB  . ARG A 1 78  ? 35.511  79.958  84.450  1.00 49.75 ? 78   ARG A CB  1 
ATOM   594   C  CG  . ARG A 1 78  ? 36.548  79.553  85.500  1.00 51.18 ? 78   ARG A CG  1 
ATOM   595   C  CD  . ARG A 1 78  ? 37.519  78.490  84.991  1.00 51.72 ? 78   ARG A CD  1 
ATOM   596   N  NE  . ARG A 1 78  ? 38.356  77.956  86.065  1.00 51.57 ? 78   ARG A NE  1 
ATOM   597   C  CZ  . ARG A 1 78  ? 38.624  76.664  86.241  1.00 50.37 ? 78   ARG A CZ  1 
ATOM   598   N  NH1 . ARG A 1 78  ? 38.124  75.757  85.411  1.00 49.05 ? 78   ARG A NH1 1 
ATOM   599   N  NH2 . ARG A 1 78  ? 39.385  76.278  87.257  1.00 48.13 ? 78   ARG A NH2 1 
ATOM   600   N  N   . GLN A 1 79  ? 33.111  79.351  82.130  1.00 47.14 ? 79   GLN A N   1 
ATOM   601   C  CA  . GLN A 1 79  ? 31.886  79.844  81.500  1.00 46.62 ? 79   GLN A CA  1 
ATOM   602   C  C   . GLN A 1 79  ? 30.758  78.818  81.600  1.00 46.41 ? 79   GLN A C   1 
ATOM   603   O  O   . GLN A 1 79  ? 29.630  79.073  81.171  1.00 45.86 ? 79   GLN A O   1 
ATOM   604   C  CB  . GLN A 1 79  ? 32.141  80.188  80.028  1.00 46.61 ? 79   GLN A CB  1 
ATOM   605   C  CG  . GLN A 1 79  ? 33.174  81.286  79.795  1.00 47.54 ? 79   GLN A CG  1 
ATOM   606   C  CD  . GLN A 1 79  ? 34.583  80.874  80.189  1.00 48.13 ? 79   GLN A CD  1 
ATOM   607   O  OE1 . GLN A 1 79  ? 34.959  79.708  80.070  1.00 47.96 ? 79   GLN A OE1 1 
ATOM   608   N  NE2 . GLN A 1 79  ? 35.366  81.832  80.667  1.00 49.61 ? 79   GLN A NE2 1 
ATOM   609   N  N   . PHE A 1 80  ? 31.078  77.658  82.166  1.00 46.74 ? 80   PHE A N   1 
ATOM   610   C  CA  . PHE A 1 80  ? 30.115  76.575  82.337  1.00 46.01 ? 80   PHE A CA  1 
ATOM   611   C  C   . PHE A 1 80  ? 29.982  76.208  83.816  1.00 45.23 ? 80   PHE A C   1 
ATOM   612   O  O   . PHE A 1 80  ? 29.226  75.303  84.174  1.00 44.32 ? 80   PHE A O   1 
ATOM   613   C  CB  . PHE A 1 80  ? 30.554  75.350  81.528  1.00 45.42 ? 80   PHE A CB  1 
ATOM   614   C  CG  . PHE A 1 80  ? 30.867  75.655  80.088  1.00 44.64 ? 80   PHE A CG  1 
ATOM   615   C  CD1 . PHE A 1 80  ? 29.851  75.722  79.139  1.00 45.44 ? 80   PHE A CD1 1 
ATOM   616   C  CD2 . PHE A 1 80  ? 32.178  75.883  79.682  1.00 43.51 ? 80   PHE A CD2 1 
ATOM   617   C  CE1 . PHE A 1 80  ? 30.136  76.012  77.803  1.00 45.40 ? 80   PHE A CE1 1 
ATOM   618   C  CE2 . PHE A 1 80  ? 32.473  76.174  78.351  1.00 44.71 ? 80   PHE A CE2 1 
ATOM   619   C  CZ  . PHE A 1 80  ? 31.450  76.238  77.410  1.00 44.57 ? 80   PHE A CZ  1 
ATOM   620   N  N   . GLY A 1 81  ? 30.717  76.927  84.664  1.00 44.22 ? 81   GLY A N   1 
ATOM   621   C  CA  . GLY A 1 81  ? 30.683  76.683  86.096  1.00 43.95 ? 81   GLY A CA  1 
ATOM   622   C  C   . GLY A 1 81  ? 31.452  75.443  86.508  1.00 44.05 ? 81   GLY A C   1 
ATOM   623   O  O   . GLY A 1 81  ? 30.879  74.514  87.078  1.00 43.94 ? 81   GLY A O   1 
ATOM   624   N  N   . ILE A 1 82  ? 32.753  75.431  86.227  1.00 44.32 ? 82   ILE A N   1 
ATOM   625   C  CA  . ILE A 1 82  ? 33.604  74.292  86.564  1.00 44.09 ? 82   ILE A CA  1 
ATOM   626   C  C   . ILE A 1 82  ? 34.916  74.735  87.210  1.00 43.96 ? 82   ILE A C   1 
ATOM   627   O  O   . ILE A 1 82  ? 35.513  75.733  86.805  1.00 43.93 ? 82   ILE A O   1 
ATOM   628   C  CB  . ILE A 1 82  ? 33.959  73.454  85.305  1.00 45.20 ? 82   ILE A CB  1 
ATOM   629   C  CG1 . ILE A 1 82  ? 32.698  73.111  84.506  1.00 45.82 ? 82   ILE A CG1 1 
ATOM   630   C  CG2 . ILE A 1 82  ? 34.662  72.166  85.712  1.00 44.07 ? 82   ILE A CG2 1 
ATOM   631   C  CD1 . ILE A 1 82  ? 32.981  72.436  83.181  1.00 42.89 ? 82   ILE A CD1 1 
ATOM   632   N  N   . ASP A 1 83  ? 35.344  73.993  88.229  1.00 44.05 ? 83   ASP A N   1 
ATOM   633   C  CA  . ASP A 1 83  ? 36.597  74.265  88.928  1.00 43.38 ? 83   ASP A CA  1 
ATOM   634   C  C   . ASP A 1 83  ? 37.624  73.235  88.477  1.00 43.87 ? 83   ASP A C   1 
ATOM   635   O  O   . ASP A 1 83  ? 37.263  72.194  87.927  1.00 43.20 ? 83   ASP A O   1 
ATOM   636   C  CB  . ASP A 1 83  ? 36.416  74.161  90.443  1.00 42.20 ? 83   ASP A CB  1 
ATOM   637   C  CG  . ASP A 1 83  ? 35.557  75.270  91.007  1.00 42.34 ? 83   ASP A CG  1 
ATOM   638   O  OD1 . ASP A 1 83  ? 36.050  76.411  91.124  1.00 42.27 ? 83   ASP A OD1 1 
ATOM   639   O  OD2 . ASP A 1 83  ? 34.390  74.997  91.345  1.00 42.32 ? 83   ASP A OD2 1 
ATOM   640   N  N   . ALA A 1 84  ? 38.899  73.513  88.730  1.00 45.14 ? 84   ALA A N   1 
ATOM   641   C  CA  . ALA A 1 84  ? 39.962  72.596  88.336  1.00 45.00 ? 84   ALA A CA  1 
ATOM   642   C  C   . ALA A 1 84  ? 41.015  72.410  89.422  1.00 44.02 ? 84   ALA A C   1 
ATOM   643   O  O   . ALA A 1 84  ? 42.056  73.068  89.412  1.00 45.25 ? 84   ALA A O   1 
ATOM   644   C  CB  . ALA A 1 84  ? 40.611  73.067  87.036  1.00 45.53 ? 84   ALA A CB  1 
ATOM   645   N  N   . TRP A 1 85  ? 40.726  71.522  90.369  1.00 43.00 ? 85   TRP A N   1 
ATOM   646   C  CA  . TRP A 1 85  ? 41.652  71.228  91.456  1.00 41.96 ? 85   TRP A CA  1 
ATOM   647   C  C   . TRP A 1 85  ? 42.713  70.247  90.968  1.00 41.73 ? 85   TRP A C   1 
ATOM   648   O  O   . TRP A 1 85  ? 42.455  69.048  90.845  1.00 42.64 ? 85   TRP A O   1 
ATOM   649   C  CB  . TRP A 1 85  ? 40.904  70.648  92.660  1.00 41.51 ? 85   TRP A CB  1 
ATOM   650   C  CG  . TRP A 1 85  ? 40.465  71.677  93.665  1.00 42.10 ? 85   TRP A CG  1 
ATOM   651   C  CD1 . TRP A 1 85  ? 41.229  72.234  94.651  1.00 41.80 ? 85   TRP A CD1 1 
ATOM   652   C  CD2 . TRP A 1 85  ? 39.158  72.255  93.797  1.00 42.27 ? 85   TRP A CD2 1 
ATOM   653   N  NE1 . TRP A 1 85  ? 40.480  73.118  95.391  1.00 41.49 ? 85   TRP A NE1 1 
ATOM   654   C  CE2 . TRP A 1 85  ? 39.206  73.150  94.889  1.00 41.94 ? 85   TRP A CE2 1 
ATOM   655   C  CE3 . TRP A 1 85  ? 37.951  72.100  93.101  1.00 42.76 ? 85   TRP A CE3 1 
ATOM   656   C  CZ2 . TRP A 1 85  ? 38.091  73.891  95.301  1.00 42.58 ? 85   TRP A CZ2 1 
ATOM   657   C  CZ3 . TRP A 1 85  ? 36.842  72.838  93.514  1.00 42.14 ? 85   TRP A CZ3 1 
ATOM   658   C  CH2 . TRP A 1 85  ? 36.922  73.721  94.604  1.00 42.02 ? 85   TRP A CH2 1 
ATOM   659   N  N   . GLN A 1 86  ? 43.901  70.769  90.675  1.00 40.92 ? 86   GLN A N   1 
ATOM   660   C  CA  . GLN A 1 86  ? 45.007  69.951  90.189  1.00 41.17 ? 86   GLN A CA  1 
ATOM   661   C  C   . GLN A 1 86  ? 45.676  69.151  91.300  1.00 42.08 ? 86   GLN A C   1 
ATOM   662   O  O   . GLN A 1 86  ? 46.141  69.710  92.293  1.00 42.23 ? 86   GLN A O   1 
ATOM   663   C  CB  . GLN A 1 86  ? 46.041  70.824  89.472  1.00 41.44 ? 86   GLN A CB  1 
ATOM   664   C  CG  . GLN A 1 86  ? 47.128  70.035  88.751  1.00 40.34 ? 86   GLN A CG  1 
ATOM   665   C  CD  . GLN A 1 86  ? 47.966  70.891  87.816  1.00 39.63 ? 86   GLN A CD  1 
ATOM   666   O  OE1 . GLN A 1 86  ? 47.743  72.096  87.684  1.00 39.18 ? 86   GLN A OE1 1 
ATOM   667   N  NE2 . GLN A 1 86  ? 48.932  70.266  87.153  1.00 40.27 ? 86   GLN A NE2 1 
HETATM 668   N  N   . MSE A 1 87  ? 45.716  67.834  91.117  1.00 43.43 ? 87   MSE A N   1 
HETATM 669   C  CA  . MSE A 1 87  ? 46.323  66.923  92.081  1.00 43.30 ? 87   MSE A CA  1 
HETATM 670   C  C   . MSE A 1 87  ? 47.842  66.900  91.922  1.00 42.49 ? 87   MSE A C   1 
HETATM 671   O  O   . MSE A 1 87  ? 48.362  67.185  90.845  1.00 42.50 ? 87   MSE A O   1 
HETATM 672   C  CB  . MSE A 1 87  ? 45.773  65.508  91.879  1.00 43.82 ? 87   MSE A CB  1 
HETATM 673   C  CG  . MSE A 1 87  ? 44.264  65.382  92.024  1.00 45.93 ? 87   MSE A CG  1 
HETATM 674   SE SE  . MSE A 1 87  ? 43.625  63.597  91.627  1.00 48.99 ? 87   MSE A SE  1 
HETATM 675   C  CE  . MSE A 1 87  ? 44.393  62.670  93.136  1.00 46.63 ? 87   MSE A CE  1 
ATOM   676   N  N   . GLU A 1 88  ? 48.548  66.575  93.003  1.00 42.74 ? 88   GLU A N   1 
ATOM   677   C  CA  . GLU A 1 88  ? 50.007  66.492  92.973  1.00 42.95 ? 88   GLU A CA  1 
ATOM   678   C  C   . GLU A 1 88  ? 50.435  65.043  92.731  1.00 43.33 ? 88   GLU A C   1 
ATOM   679   O  O   . GLU A 1 88  ? 49.646  64.236  92.235  1.00 43.86 ? 88   GLU A O   1 
ATOM   680   C  CB  . GLU A 1 88  ? 50.609  67.022  94.280  1.00 41.87 ? 88   GLU A CB  1 
ATOM   681   C  CG  . GLU A 1 88  ? 50.130  66.307  95.537  1.00 42.57 ? 88   GLU A CG  1 
ATOM   682   C  CD  . GLU A 1 88  ? 50.797  66.818  96.804  1.00 43.41 ? 88   GLU A CD  1 
ATOM   683   O  OE1 . GLU A 1 88  ? 51.223  67.994  96.836  1.00 42.79 ? 88   GLU A OE1 1 
ATOM   684   O  OE2 . GLU A 1 88  ? 50.890  66.038  97.776  1.00 43.89 ? 88   GLU A OE2 1 
ATOM   685   N  N   . GLY A 1 89  ? 51.672  64.708  93.085  1.00 43.65 ? 89   GLY A N   1 
ATOM   686   C  CA  . GLY A 1 89  ? 52.140  63.348  92.884  1.00 45.73 ? 89   GLY A CA  1 
ATOM   687   C  C   . GLY A 1 89  ? 53.174  62.881  93.888  1.00 47.38 ? 89   GLY A C   1 
ATOM   688   O  O   . GLY A 1 89  ? 53.338  63.483  94.951  1.00 47.93 ? 89   GLY A O   1 
ATOM   689   N  N   . ALA A 1 90  ? 53.855  61.785  93.555  1.00 48.30 ? 90   ALA A N   1 
ATOM   690   C  CA  . ALA A 1 90  ? 54.893  61.216  94.411  1.00 48.13 ? 90   ALA A CA  1 
ATOM   691   C  C   . ALA A 1 90  ? 56.049  62.206  94.531  1.00 47.72 ? 90   ALA A C   1 
ATOM   692   O  O   . ALA A 1 90  ? 56.596  62.414  95.615  1.00 47.69 ? 90   ALA A O   1 
ATOM   693   C  CB  . ALA A 1 90  ? 55.383  59.892  93.833  1.00 48.53 ? 90   ALA A CB  1 
ATOM   694   N  N   . ASP A 1 91  ? 56.411  62.808  93.401  1.00 46.59 ? 91   ASP A N   1 
ATOM   695   C  CA  . ASP A 1 91  ? 57.480  63.799  93.350  1.00 44.60 ? 91   ASP A CA  1 
ATOM   696   C  C   . ASP A 1 91  ? 56.920  65.203  93.588  1.00 43.84 ? 91   ASP A C   1 
ATOM   697   O  O   . ASP A 1 91  ? 57.666  66.184  93.622  1.00 43.91 ? 91   ASP A O   1 
ATOM   698   C  CB  . ASP A 1 91  ? 58.221  63.728  92.004  1.00 43.75 ? 91   ASP A CB  1 
ATOM   699   C  CG  . ASP A 1 91  ? 57.281  63.665  90.801  1.00 41.40 ? 91   ASP A CG  1 
ATOM   700   O  OD1 . ASP A 1 91  ? 56.116  64.109  90.896  1.00 40.63 ? 91   ASP A OD1 1 
ATOM   701   O  OD2 . ASP A 1 91  ? 57.721  63.169  89.743  1.00 40.92 ? 91   ASP A OD2 1 
ATOM   702   N  N   . ASN A 1 92  ? 55.599  65.274  93.754  1.00 42.34 ? 92   ASN A N   1 
ATOM   703   C  CA  . ASN A 1 92  ? 54.869  66.519  93.998  1.00 41.13 ? 92   ASN A CA  1 
ATOM   704   C  C   . ASN A 1 92  ? 54.889  67.498  92.824  1.00 40.67 ? 92   ASN A C   1 
ATOM   705   O  O   . ASN A 1 92  ? 54.787  68.712  93.015  1.00 40.07 ? 92   ASN A O   1 
ATOM   706   C  CB  . ASN A 1 92  ? 55.365  67.202  95.279  1.00 40.69 ? 92   ASN A CB  1 
ATOM   707   C  CG  . ASN A 1 92  ? 55.136  66.356  96.521  1.00 40.38 ? 92   ASN A CG  1 
ATOM   708   O  OD1 . ASN A 1 92  ? 54.012  65.942  96.808  1.00 39.01 ? 92   ASN A OD1 1 
ATOM   709   N  ND2 . ASN A 1 92  ? 56.206  66.096  97.264  1.00 39.19 ? 92   ASN A ND2 1 
ATOM   710   N  N   . TYR A 1 93  ? 55.011  66.963  91.612  1.00 39.21 ? 93   TYR A N   1 
ATOM   711   C  CA  . TYR A 1 93  ? 55.024  67.783  90.403  1.00 38.56 ? 93   TYR A CA  1 
ATOM   712   C  C   . TYR A 1 93  ? 53.779  67.538  89.555  1.00 39.00 ? 93   TYR A C   1 
ATOM   713   O  O   . TYR A 1 93  ? 53.798  67.722  88.336  1.00 39.23 ? 93   TYR A O   1 
ATOM   714   C  CB  . TYR A 1 93  ? 56.285  67.513  89.579  1.00 37.66 ? 93   TYR A CB  1 
ATOM   715   C  CG  . TYR A 1 93  ? 57.515  68.238  90.079  1.00 37.15 ? 93   TYR A CG  1 
ATOM   716   C  CD1 . TYR A 1 93  ? 57.647  69.616  89.915  1.00 34.53 ? 93   TYR A CD1 1 
ATOM   717   C  CD2 . TYR A 1 93  ? 58.546  67.549  90.714  1.00 35.95 ? 93   TYR A CD2 1 
ATOM   718   C  CE1 . TYR A 1 93  ? 58.775  70.291  90.374  1.00 34.84 ? 93   TYR A CE1 1 
ATOM   719   C  CE2 . TYR A 1 93  ? 59.678  68.213  91.176  1.00 35.21 ? 93   TYR A CE2 1 
ATOM   720   C  CZ  . TYR A 1 93  ? 59.786  69.583  91.003  1.00 34.83 ? 93   TYR A CZ  1 
ATOM   721   O  OH  . TYR A 1 93  ? 60.902  70.246  91.464  1.00 34.60 ? 93   TYR A OH  1 
ATOM   722   N  N   . GLY A 1 94  ? 52.696  67.135  90.216  1.00 39.39 ? 94   GLY A N   1 
ATOM   723   C  CA  . GLY A 1 94  ? 51.445  66.869  89.528  1.00 37.78 ? 94   GLY A CA  1 
ATOM   724   C  C   . GLY A 1 94  ? 51.389  65.498  88.884  1.00 36.71 ? 94   GLY A C   1 
ATOM   725   O  O   . GLY A 1 94  ? 50.393  65.144  88.255  1.00 37.93 ? 94   GLY A O   1 
ATOM   726   N  N   . ASN A 1 95  ? 52.455  64.721  89.056  1.00 36.33 ? 95   ASN A N   1 
ATOM   727   C  CA  . ASN A 1 95  ? 52.544  63.383  88.482  1.00 35.69 ? 95   ASN A CA  1 
ATOM   728   C  C   . ASN A 1 95  ? 51.742  62.334  89.239  1.00 35.72 ? 95   ASN A C   1 
ATOM   729   O  O   . ASN A 1 95  ? 52.263  61.659  90.130  1.00 36.34 ? 95   ASN A O   1 
ATOM   730   C  CB  . ASN A 1 95  ? 54.005  62.947  88.371  1.00 34.15 ? 95   ASN A CB  1 
ATOM   731   C  CG  . ASN A 1 95  ? 54.757  63.714  87.310  1.00 33.92 ? 95   ASN A CG  1 
ATOM   732   O  OD1 . ASN A 1 95  ? 54.335  63.770  86.155  1.00 32.30 ? 95   ASN A OD1 1 
ATOM   733   N  ND2 . ASN A 1 95  ? 55.877  64.316  87.694  1.00 35.55 ? 95   ASN A ND2 1 
ATOM   734   N  N   . VAL A 1 96  ? 50.472  62.202  88.872  1.00 35.22 ? 96   VAL A N   1 
ATOM   735   C  CA  . VAL A 1 96  ? 49.587  61.228  89.497  1.00 34.95 ? 96   VAL A CA  1 
ATOM   736   C  C   . VAL A 1 96  ? 49.827  59.868  88.853  1.00 34.57 ? 96   VAL A C   1 
ATOM   737   O  O   . VAL A 1 96  ? 49.758  59.729  87.630  1.00 33.80 ? 96   VAL A O   1 
ATOM   738   C  CB  . VAL A 1 96  ? 48.106  61.625  89.333  1.00 34.57 ? 96   VAL A CB  1 
ATOM   739   C  CG1 . VAL A 1 96  ? 47.214  60.640  90.069  1.00 34.81 ? 96   VAL A CG1 1 
ATOM   740   C  CG2 . VAL A 1 96  ? 47.886  63.034  89.852  1.00 33.02 ? 96   VAL A CG2 1 
ATOM   741   N  N   . GLN A 1 97  ? 50.122  58.876  89.686  1.00 35.05 ? 97   GLN A N   1 
ATOM   742   C  CA  . GLN A 1 97  ? 50.393  57.521  89.219  1.00 34.65 ? 97   GLN A CA  1 
ATOM   743   C  C   . GLN A 1 97  ? 49.186  56.889  88.528  1.00 34.24 ? 97   GLN A C   1 
ATOM   744   O  O   . GLN A 1 97  ? 48.065  56.930  89.041  1.00 32.31 ? 97   GLN A O   1 
ATOM   745   C  CB  . GLN A 1 97  ? 50.853  56.646  90.388  1.00 34.14 ? 97   GLN A CB  1 
ATOM   746   C  CG  . GLN A 1 97  ? 51.426  55.300  89.975  1.00 34.04 ? 97   GLN A CG  1 
ATOM   747   C  CD  . GLN A 1 97  ? 51.869  54.463  91.161  1.00 34.60 ? 97   GLN A CD  1 
ATOM   748   O  OE1 . GLN A 1 97  ? 51.901  54.938  92.299  1.00 33.40 ? 97   GLN A OE1 1 
ATOM   749   N  NE2 . GLN A 1 97  ? 52.212  53.205  90.900  1.00 35.68 ? 97   GLN A NE2 1 
ATOM   750   N  N   . PHE A 1 98  ? 49.433  56.320  87.351  1.00 33.92 ? 98   PHE A N   1 
ATOM   751   C  CA  . PHE A 1 98  ? 48.397  55.672  86.556  1.00 32.65 ? 98   PHE A CA  1 
ATOM   752   C  C   . PHE A 1 98  ? 48.739  54.224  86.230  1.00 31.18 ? 98   PHE A C   1 
ATOM   753   O  O   . PHE A 1 98  ? 49.683  53.954  85.487  1.00 31.57 ? 98   PHE A O   1 
ATOM   754   C  CB  . PHE A 1 98  ? 48.175  56.425  85.237  1.00 33.71 ? 98   PHE A CB  1 
ATOM   755   C  CG  . PHE A 1 98  ? 47.372  57.685  85.374  1.00 34.53 ? 98   PHE A CG  1 
ATOM   756   C  CD1 . PHE A 1 98  ? 46.186  57.698  86.101  1.00 35.22 ? 98   PHE A CD1 1 
ATOM   757   C  CD2 . PHE A 1 98  ? 47.788  58.857  84.752  1.00 34.27 ? 98   PHE A CD2 1 
ATOM   758   C  CE1 . PHE A 1 98  ? 45.426  58.860  86.204  1.00 36.38 ? 98   PHE A CE1 1 
ATOM   759   C  CE2 . PHE A 1 98  ? 47.036  60.022  84.849  1.00 36.04 ? 98   PHE A CE2 1 
ATOM   760   C  CZ  . PHE A 1 98  ? 45.852  60.023  85.577  1.00 36.49 ? 98   PHE A CZ  1 
ATOM   761   N  N   . THR A 1 99  ? 47.983  53.296  86.806  1.00 30.88 ? 99   THR A N   1 
ATOM   762   C  CA  . THR A 1 99  ? 48.179  51.878  86.533  1.00 31.14 ? 99   THR A CA  1 
ATOM   763   C  C   . THR A 1 99  ? 46.950  51.425  85.744  1.00 30.04 ? 99   THR A C   1 
ATOM   764   O  O   . THR A 1 99  ? 46.091  52.247  85.414  1.00 30.02 ? 99   THR A O   1 
ATOM   765   C  CB  . THR A 1 99  ? 48.348  51.048  87.831  1.00 32.05 ? 99   THR A CB  1 
ATOM   766   O  OG1 . THR A 1 99  ? 48.797  49.729  87.500  1.00 35.52 ? 99   THR A OG1 1 
ATOM   767   C  CG2 . THR A 1 99  ? 47.039  50.949  88.594  1.00 32.10 ? 99   THR A CG2 1 
ATOM   768   N  N   . GLY A 1 100 ? 46.859  50.136  85.431  1.00 29.38 ? 100  GLY A N   1 
ATOM   769   C  CA  . GLY A 1 100 ? 45.712  49.671  84.674  1.00 28.26 ? 100  GLY A CA  1 
ATOM   770   C  C   . GLY A 1 100 ? 45.249  48.257  84.951  1.00 28.19 ? 100  GLY A C   1 
ATOM   771   O  O   . GLY A 1 100 ? 46.012  47.414  85.425  1.00 28.16 ? 100  GLY A O   1 
ATOM   772   N  N   . TYR A 1 101 ? 43.976  48.012  84.656  1.00 26.42 ? 101  TYR A N   1 
ATOM   773   C  CA  . TYR A 1 101 ? 43.363  46.702  84.835  1.00 25.21 ? 101  TYR A CA  1 
ATOM   774   C  C   . TYR A 1 101 ? 42.215  46.559  83.843  1.00 24.64 ? 101  TYR A C   1 
ATOM   775   O  O   . TYR A 1 101 ? 41.667  47.555  83.366  1.00 25.49 ? 101  TYR A O   1 
ATOM   776   C  CB  . TYR A 1 101 ? 42.869  46.508  86.277  1.00 24.62 ? 101  TYR A CB  1 
ATOM   777   C  CG  . TYR A 1 101 ? 41.664  47.337  86.668  1.00 23.77 ? 101  TYR A CG  1 
ATOM   778   C  CD1 . TYR A 1 101 ? 41.744  48.727  86.760  1.00 25.55 ? 101  TYR A CD1 1 
ATOM   779   C  CD2 . TYR A 1 101 ? 40.446  46.728  86.967  1.00 23.25 ? 101  TYR A CD2 1 
ATOM   780   C  CE1 . TYR A 1 101 ? 40.642  49.488  87.140  1.00 23.73 ? 101  TYR A CE1 1 
ATOM   781   C  CE2 . TYR A 1 101 ? 39.339  47.481  87.349  1.00 24.19 ? 101  TYR A CE2 1 
ATOM   782   C  CZ  . TYR A 1 101 ? 39.445  48.860  87.434  1.00 23.05 ? 101  TYR A CZ  1 
ATOM   783   O  OH  . TYR A 1 101 ? 38.356  49.608  87.813  1.00 25.58 ? 101  TYR A OH  1 
ATOM   784   N  N   . TYR A 1 102 ? 41.859  45.319  83.530  1.00 24.55 ? 102  TYR A N   1 
ATOM   785   C  CA  . TYR A 1 102 ? 40.787  45.055  82.580  1.00 23.09 ? 102  TYR A CA  1 
ATOM   786   C  C   . TYR A 1 102 ? 39.948  43.858  83.006  1.00 23.93 ? 102  TYR A C   1 
ATOM   787   O  O   . TYR A 1 102 ? 40.147  43.295  84.084  1.00 23.90 ? 102  TYR A O   1 
ATOM   788   C  CB  . TYR A 1 102 ? 41.377  44.802  81.184  1.00 21.90 ? 102  TYR A CB  1 
ATOM   789   C  CG  . TYR A 1 102 ? 42.119  43.486  81.047  1.00 19.26 ? 102  TYR A CG  1 
ATOM   790   C  CD1 . TYR A 1 102 ? 43.204  43.179  81.872  1.00 17.86 ? 102  TYR A CD1 1 
ATOM   791   C  CD2 . TYR A 1 102 ? 41.726  42.540  80.101  1.00 16.93 ? 102  TYR A CD2 1 
ATOM   792   C  CE1 . TYR A 1 102 ? 43.874  41.964  81.760  1.00 16.78 ? 102  TYR A CE1 1 
ATOM   793   C  CE2 . TYR A 1 102 ? 42.391  41.323  79.980  1.00 18.55 ? 102  TYR A CE2 1 
ATOM   794   C  CZ  . TYR A 1 102 ? 43.462  41.042  80.813  1.00 18.29 ? 102  TYR A CZ  1 
ATOM   795   O  OH  . TYR A 1 102 ? 44.120  39.839  80.698  1.00 19.46 ? 102  TYR A OH  1 
ATOM   796   N  N   . THR A 1 103 ? 39.006  43.480  82.147  1.00 25.07 ? 103  THR A N   1 
ATOM   797   C  CA  . THR A 1 103 ? 38.133  42.344  82.398  1.00 25.64 ? 103  THR A CA  1 
ATOM   798   C  C   . THR A 1 103 ? 38.436  41.275  81.354  1.00 25.41 ? 103  THR A C   1 
ATOM   799   O  O   . THR A 1 103 ? 37.997  41.369  80.206  1.00 25.90 ? 103  THR A O   1 
ATOM   800   C  CB  . THR A 1 103 ? 36.652  42.750  82.309  1.00 25.79 ? 103  THR A CB  1 
ATOM   801   O  OG1 . THR A 1 103 ? 36.397  43.823  83.223  1.00 27.04 ? 103  THR A OG1 1 
ATOM   802   C  CG2 . THR A 1 103 ? 35.755  41.576  82.662  1.00 26.47 ? 103  THR A CG2 1 
ATOM   803   N  N   . PRO A 1 104 ? 39.233  40.263  81.732  1.00 24.74 ? 104  PRO A N   1 
ATOM   804   C  CA  . PRO A 1 104 ? 39.612  39.167  80.838  1.00 26.07 ? 104  PRO A CA  1 
ATOM   805   C  C   . PRO A 1 104 ? 38.479  38.189  80.540  1.00 27.11 ? 104  PRO A C   1 
ATOM   806   O  O   . PRO A 1 104 ? 37.644  37.905  81.400  1.00 28.55 ? 104  PRO A O   1 
ATOM   807   C  CB  . PRO A 1 104 ? 40.745  38.487  81.606  1.00 26.13 ? 104  PRO A CB  1 
ATOM   808   C  CG  . PRO A 1 104 ? 40.340  38.681  83.029  1.00 23.05 ? 104  PRO A CG  1 
ATOM   809   C  CD  . PRO A 1 104 ? 39.894  40.121  83.043  1.00 23.56 ? 104  PRO A CD  1 
ATOM   810   N  N   . VAL A 1 105 ? 38.446  37.703  79.303  1.00 27.33 ? 105  VAL A N   1 
ATOM   811   C  CA  . VAL A 1 105 ? 37.442  36.736  78.875  1.00 27.39 ? 105  VAL A CA  1 
ATOM   812   C  C   . VAL A 1 105 ? 38.114  35.363  78.869  1.00 28.31 ? 105  VAL A C   1 
ATOM   813   O  O   . VAL A 1 105 ? 39.027  35.113  78.079  1.00 28.42 ? 105  VAL A O   1 
ATOM   814   C  CB  . VAL A 1 105 ? 36.905  37.062  77.461  1.00 26.98 ? 105  VAL A CB  1 
ATOM   815   C  CG1 . VAL A 1 105 ? 35.880  36.022  77.028  1.00 28.63 ? 105  VAL A CG1 1 
ATOM   816   C  CG2 . VAL A 1 105 ? 36.290  38.454  77.438  1.00 23.78 ? 105  VAL A CG2 1 
ATOM   817   N  N   . ILE A 1 106 ? 37.686  34.492  79.777  1.00 29.11 ? 106  ILE A N   1 
ATOM   818   C  CA  . ILE A 1 106 ? 38.259  33.153  79.885  1.00 29.96 ? 106  ILE A CA  1 
ATOM   819   C  C   . ILE A 1 106 ? 37.275  32.072  79.455  1.00 30.09 ? 106  ILE A C   1 
ATOM   820   O  O   . ILE A 1 106 ? 36.125  32.055  79.896  1.00 31.01 ? 106  ILE A O   1 
ATOM   821   C  CB  . ILE A 1 106 ? 38.731  32.869  81.330  1.00 31.24 ? 106  ILE A CB  1 
ATOM   822   C  CG1 . ILE A 1 106 ? 39.751  33.925  81.763  1.00 31.36 ? 106  ILE A CG1 1 
ATOM   823   C  CG2 . ILE A 1 106 ? 39.346  31.478  81.426  1.00 32.09 ? 106  ILE A CG2 1 
ATOM   824   C  CD1 . ILE A 1 106 ? 40.215  33.775  83.186  1.00 32.14 ? 106  ILE A CD1 1 
ATOM   825   N  N   . GLN A 1 107 ? 37.735  31.172  78.590  1.00 30.59 ? 107  GLN A N   1 
ATOM   826   C  CA  . GLN A 1 107 ? 36.901  30.080  78.100  1.00 32.11 ? 107  GLN A CA  1 
ATOM   827   C  C   . GLN A 1 107 ? 36.942  28.900  79.070  1.00 32.05 ? 107  GLN A C   1 
ATOM   828   O  O   . GLN A 1 107 ? 37.997  28.569  79.618  1.00 31.32 ? 107  GLN A O   1 
ATOM   829   C  CB  . GLN A 1 107 ? 37.352  29.644  76.702  1.00 33.95 ? 107  GLN A CB  1 
ATOM   830   C  CG  . GLN A 1 107 ? 36.353  28.743  75.982  1.00 36.39 ? 107  GLN A CG  1 
ATOM   831   C  CD  . GLN A 1 107 ? 36.783  28.380  74.570  1.00 37.33 ? 107  GLN A CD  1 
ATOM   832   O  OE1 . GLN A 1 107 ? 36.369  27.353  74.030  1.00 36.97 ? 107  GLN A OE1 1 
ATOM   833   N  NE2 . GLN A 1 107 ? 37.610  29.224  73.963  1.00 38.58 ? 107  GLN A NE2 1 
ATOM   834   N  N   . ALA A 1 108 ? 35.788  28.271  79.278  1.00 32.86 ? 108  ALA A N   1 
ATOM   835   C  CA  . ALA A 1 108 ? 35.682  27.140  80.194  1.00 32.88 ? 108  ALA A CA  1 
ATOM   836   C  C   . ALA A 1 108 ? 34.389  26.354  80.001  1.00 33.98 ? 108  ALA A C   1 
ATOM   837   O  O   . ALA A 1 108 ? 33.532  26.732  79.204  1.00 32.94 ? 108  ALA A O   1 
ATOM   838   C  CB  . ALA A 1 108 ? 35.774  27.638  81.634  1.00 31.26 ? 108  ALA A CB  1 
ATOM   839   N  N   . ARG A 1 109 ? 34.275  25.242  80.723  1.00 36.86 ? 109  ARG A N   1 
ATOM   840   C  CA  . ARG A 1 109 ? 33.090  24.389  80.679  1.00 39.63 ? 109  ARG A CA  1 
ATOM   841   C  C   . ARG A 1 109 ? 32.596  24.180  82.109  1.00 40.85 ? 109  ARG A C   1 
ATOM   842   O  O   . ARG A 1 109 ? 33.288  24.522  83.069  1.00 39.23 ? 109  ARG A O   1 
ATOM   843   C  CB  . ARG A 1 109 ? 33.413  23.027  80.050  1.00 40.17 ? 109  ARG A CB  1 
ATOM   844   C  CG  . ARG A 1 109 ? 33.942  23.079  78.623  1.00 42.35 ? 109  ARG A CG  1 
ATOM   845   C  CD  . ARG A 1 109 ? 32.919  23.632  77.639  1.00 46.84 ? 109  ARG A CD  1 
ATOM   846   N  NE  . ARG A 1 109 ? 33.484  23.780  76.297  1.00 48.46 ? 109  ARG A NE  1 
ATOM   847   C  CZ  . ARG A 1 109 ? 34.229  24.811  75.902  1.00 47.77 ? 109  ARG A CZ  1 
ATOM   848   N  NH1 . ARG A 1 109 ? 34.507  25.801  76.739  1.00 48.44 ? 109  ARG A NH1 1 
ATOM   849   N  NH2 . ARG A 1 109 ? 34.701  24.853  74.664  1.00 46.22 ? 109  ARG A NH2 1 
ATOM   850   N  N   . HIS A 1 110 ? 31.397  23.625  82.245  1.00 44.42 ? 110  HIS A N   1 
ATOM   851   C  CA  . HIS A 1 110 ? 30.816  23.365  83.557  1.00 47.17 ? 110  HIS A CA  1 
ATOM   852   C  C   . HIS A 1 110 ? 31.425  22.119  84.196  1.00 49.81 ? 110  HIS A C   1 
ATOM   853   O  O   . HIS A 1 110 ? 31.449  21.988  85.420  1.00 51.41 ? 110  HIS A O   1 
ATOM   854   C  CB  . HIS A 1 110 ? 29.298  23.213  83.444  1.00 46.93 ? 110  HIS A CB  1 
ATOM   855   C  CG  . HIS A 1 110 ? 28.598  24.460  82.999  1.00 47.17 ? 110  HIS A CG  1 
ATOM   856   N  ND1 . HIS A 1 110 ? 28.176  24.654  81.701  1.00 47.82 ? 110  HIS A ND1 1 
ATOM   857   C  CD2 . HIS A 1 110 ? 28.246  25.576  83.680  1.00 46.99 ? 110  HIS A CD2 1 
ATOM   858   C  CE1 . HIS A 1 110 ? 27.594  25.836  81.602  1.00 48.14 ? 110  HIS A CE1 1 
ATOM   859   N  NE2 . HIS A 1 110 ? 27.623  26.416  82.789  1.00 47.04 ? 110  HIS A NE2 1 
ATOM   860   N  N   . THR A 1 111 ? 31.915  21.209  83.356  1.00 51.80 ? 111  THR A N   1 
ATOM   861   C  CA  . THR A 1 111 ? 32.535  19.967  83.813  1.00 53.60 ? 111  THR A CA  1 
ATOM   862   C  C   . THR A 1 111 ? 33.938  19.837  83.224  1.00 53.48 ? 111  THR A C   1 
ATOM   863   O  O   . THR A 1 111 ? 34.180  20.263  82.093  1.00 53.12 ? 111  THR A O   1 
ATOM   864   C  CB  . THR A 1 111 ? 31.699  18.734  83.401  1.00 54.55 ? 111  THR A CB  1 
ATOM   865   O  OG1 . THR A 1 111 ? 31.463  18.762  81.987  1.00 56.49 ? 111  THR A OG1 1 
ATOM   866   C  CG2 . THR A 1 111 ? 30.365  18.717  84.137  1.00 54.87 ? 111  THR A CG2 1 
ATOM   867   N  N   . ARG A 1 112 ? 34.860  19.259  83.993  1.00 54.69 ? 112  ARG A N   1 
ATOM   868   C  CA  . ARG A 1 112 ? 36.239  19.085  83.537  1.00 56.01 ? 112  ARG A CA  1 
ATOM   869   C  C   . ARG A 1 112 ? 36.365  18.086  82.392  1.00 55.54 ? 112  ARG A C   1 
ATOM   870   O  O   . ARG A 1 112 ? 35.867  16.962  82.473  1.00 55.00 ? 112  ARG A O   1 
ATOM   871   C  CB  . ARG A 1 112 ? 37.162  18.686  84.695  1.00 57.50 ? 112  ARG A CB  1 
ATOM   872   C  CG  . ARG A 1 112 ? 36.684  17.512  85.532  1.00 60.71 ? 112  ARG A CG  1 
ATOM   873   C  CD  . ARG A 1 112 ? 37.781  17.038  86.477  1.00 62.36 ? 112  ARG A CD  1 
ATOM   874   N  NE  . ARG A 1 112 ? 38.296  18.117  87.319  1.00 63.94 ? 112  ARG A NE  1 
ATOM   875   C  CZ  . ARG A 1 112 ? 39.502  18.120  87.883  1.00 65.14 ? 112  ARG A CZ  1 
ATOM   876   N  NH1 . ARG A 1 112 ? 40.328  17.098  87.699  1.00 66.40 ? 112  ARG A NH1 1 
ATOM   877   N  NH2 . ARG A 1 112 ? 39.883  19.148  88.630  1.00 63.76 ? 112  ARG A NH2 1 
ATOM   878   N  N   . GLN A 1 113 ? 37.038  18.512  81.326  1.00 55.33 ? 113  GLN A N   1 
ATOM   879   C  CA  . GLN A 1 113 ? 37.231  17.683  80.142  1.00 54.85 ? 113  GLN A CA  1 
ATOM   880   C  C   . GLN A 1 113 ? 38.374  18.209  79.279  1.00 53.80 ? 113  GLN A C   1 
ATOM   881   O  O   . GLN A 1 113 ? 38.433  19.399  78.968  1.00 53.22 ? 113  GLN A O   1 
ATOM   882   C  CB  . GLN A 1 113 ? 35.936  17.631  79.321  1.00 56.67 ? 113  GLN A CB  1 
ATOM   883   C  CG  . GLN A 1 113 ? 35.387  19.001  78.926  1.00 58.62 ? 113  GLN A CG  1 
ATOM   884   C  CD  . GLN A 1 113 ? 34.021  18.923  78.271  1.00 60.37 ? 113  GLN A CD  1 
ATOM   885   O  OE1 . GLN A 1 113 ? 33.910  18.824  77.048  1.00 61.67 ? 113  GLN A OE1 1 
ATOM   886   N  NE2 . GLN A 1 113 ? 32.971  18.978  79.083  1.00 60.39 ? 113  GLN A NE2 1 
ATOM   887   N  N   . GLY A 1 114 ? 39.284  17.312  78.909  1.00 53.49 ? 114  GLY A N   1 
ATOM   888   C  CA  . GLY A 1 114 ? 40.416  17.685  78.078  1.00 52.76 ? 114  GLY A CA  1 
ATOM   889   C  C   . GLY A 1 114 ? 41.359  18.693  78.711  1.00 52.23 ? 114  GLY A C   1 
ATOM   890   O  O   . GLY A 1 114 ? 41.947  18.432  79.763  1.00 52.28 ? 114  GLY A O   1 
ATOM   891   N  N   . GLU A 1 115 ? 41.497  19.848  78.063  1.00 51.24 ? 115  GLU A N   1 
ATOM   892   C  CA  . GLU A 1 115 ? 42.371  20.916  78.539  1.00 49.94 ? 115  GLU A CA  1 
ATOM   893   C  C   . GLU A 1 115 ? 41.775  21.679  79.720  1.00 48.17 ? 115  GLU A C   1 
ATOM   894   O  O   . GLU A 1 115 ? 42.494  22.358  80.457  1.00 47.70 ? 115  GLU A O   1 
ATOM   895   C  CB  . GLU A 1 115 ? 42.685  21.891  77.400  1.00 51.25 ? 115  GLU A CB  1 
ATOM   896   C  CG  . GLU A 1 115 ? 43.343  21.248  76.182  1.00 54.30 ? 115  GLU A CG  1 
ATOM   897   C  CD  . GLU A 1 115 ? 44.649  20.547  76.515  1.00 56.27 ? 115  GLU A CD  1 
ATOM   898   O  OE1 . GLU A 1 115 ? 45.625  21.238  76.879  1.00 57.86 ? 115  GLU A OE1 1 
ATOM   899   O  OE2 . GLU A 1 115 ? 44.702  19.303  76.409  1.00 56.51 ? 115  GLU A OE2 1 
ATOM   900   N  N   . PHE A 1 116 ? 40.461  21.562  79.893  1.00 46.28 ? 116  PHE A N   1 
ATOM   901   C  CA  . PHE A 1 116 ? 39.750  22.237  80.976  1.00 44.42 ? 116  PHE A CA  1 
ATOM   902   C  C   . PHE A 1 116 ? 39.833  21.426  82.267  1.00 42.85 ? 116  PHE A C   1 
ATOM   903   O  O   . PHE A 1 116 ? 39.007  20.547  82.510  1.00 43.00 ? 116  PHE A O   1 
ATOM   904   C  CB  . PHE A 1 116 ? 38.285  22.458  80.585  1.00 43.01 ? 116  PHE A CB  1 
ATOM   905   C  CG  . PHE A 1 116 ? 38.108  23.146  79.261  1.00 42.22 ? 116  PHE A CG  1 
ATOM   906   C  CD1 . PHE A 1 116 ? 38.431  24.492  79.109  1.00 42.78 ? 116  PHE A CD1 1 
ATOM   907   C  CD2 . PHE A 1 116 ? 37.631  22.445  78.161  1.00 43.23 ? 116  PHE A CD2 1 
ATOM   908   C  CE1 . PHE A 1 116 ? 38.281  25.128  77.877  1.00 42.42 ? 116  PHE A CE1 1 
ATOM   909   C  CE2 . PHE A 1 116 ? 37.478  23.072  76.925  1.00 44.22 ? 116  PHE A CE2 1 
ATOM   910   C  CZ  . PHE A 1 116 ? 37.804  24.416  76.784  1.00 42.31 ? 116  PHE A CZ  1 
ATOM   911   N  N   . GLN A 1 117 ? 40.832  21.733  83.092  1.00 41.95 ? 117  GLN A N   1 
ATOM   912   C  CA  . GLN A 1 117 ? 41.039  21.026  84.357  1.00 41.48 ? 117  GLN A CA  1 
ATOM   913   C  C   . GLN A 1 117 ? 41.329  21.976  85.522  1.00 39.83 ? 117  GLN A C   1 
ATOM   914   O  O   . GLN A 1 117 ? 41.683  21.529  86.617  1.00 40.48 ? 117  GLN A O   1 
ATOM   915   C  CB  . GLN A 1 117 ? 42.208  20.037  84.224  1.00 42.29 ? 117  GLN A CB  1 
ATOM   916   C  CG  . GLN A 1 117 ? 42.074  19.004  83.109  1.00 42.21 ? 117  GLN A CG  1 
ATOM   917   C  CD  . GLN A 1 117 ? 40.907  18.058  83.314  1.00 43.59 ? 117  GLN A CD  1 
ATOM   918   O  OE1 . GLN A 1 117 ? 40.666  17.580  84.424  1.00 45.87 ? 117  GLN A OE1 1 
ATOM   919   N  NE2 . GLN A 1 117 ? 40.174  17.782  82.241  1.00 44.27 ? 117  GLN A NE2 1 
ATOM   920   N  N   . TYR A 1 118 ? 41.166  23.277  85.294  1.00 37.67 ? 118  TYR A N   1 
ATOM   921   C  CA  . TYR A 1 118 ? 41.444  24.277  86.325  1.00 34.69 ? 118  TYR A CA  1 
ATOM   922   C  C   . TYR A 1 118 ? 40.180  24.965  86.841  1.00 32.56 ? 118  TYR A C   1 
ATOM   923   O  O   . TYR A 1 118 ? 39.620  25.841  86.183  1.00 32.99 ? 118  TYR A O   1 
ATOM   924   C  CB  . TYR A 1 118 ? 42.455  25.295  85.793  1.00 35.33 ? 118  TYR A CB  1 
ATOM   925   C  CG  . TYR A 1 118 ? 43.653  24.637  85.141  1.00 35.84 ? 118  TYR A CG  1 
ATOM   926   C  CD1 . TYR A 1 118 ? 44.638  24.018  85.911  1.00 36.45 ? 118  TYR A CD1 1 
ATOM   927   C  CD2 . TYR A 1 118 ? 43.778  24.593  83.753  1.00 37.35 ? 118  TYR A CD2 1 
ATOM   928   C  CE1 . TYR A 1 118 ? 45.716  23.369  85.314  1.00 38.38 ? 118  TYR A CE1 1 
ATOM   929   C  CE2 . TYR A 1 118 ? 44.852  23.947  83.145  1.00 38.38 ? 118  TYR A CE2 1 
ATOM   930   C  CZ  . TYR A 1 118 ? 45.817  23.336  83.932  1.00 39.77 ? 118  TYR A CZ  1 
ATOM   931   O  OH  . TYR A 1 118 ? 46.880  22.694  83.338  1.00 41.97 ? 118  TYR A OH  1 
ATOM   932   N  N   . PRO A 1 119 ? 39.733  24.581  88.048  1.00 31.12 ? 119  PRO A N   1 
ATOM   933   C  CA  . PRO A 1 119 ? 38.544  25.092  88.740  1.00 28.41 ? 119  PRO A CA  1 
ATOM   934   C  C   . PRO A 1 119 ? 38.546  26.569  89.129  1.00 26.58 ? 119  PRO A C   1 
ATOM   935   O  O   . PRO A 1 119 ? 39.575  27.134  89.507  1.00 25.93 ? 119  PRO A O   1 
ATOM   936   C  CB  . PRO A 1 119 ? 38.478  24.214  89.993  1.00 29.17 ? 119  PRO A CB  1 
ATOM   937   C  CG  . PRO A 1 119 ? 39.189  22.964  89.593  1.00 30.16 ? 119  PRO A CG  1 
ATOM   938   C  CD  . PRO A 1 119 ? 40.358  23.505  88.835  1.00 29.97 ? 119  PRO A CD  1 
ATOM   939   N  N   . ILE A 1 120 ? 37.366  27.174  89.033  1.00 24.99 ? 120  ILE A N   1 
ATOM   940   C  CA  . ILE A 1 120 ? 37.138  28.567  89.401  1.00 22.14 ? 120  ILE A CA  1 
ATOM   941   C  C   . ILE A 1 120 ? 36.109  28.452  90.521  1.00 22.04 ? 120  ILE A C   1 
ATOM   942   O  O   . ILE A 1 120 ? 34.997  27.979  90.298  1.00 22.36 ? 120  ILE A O   1 
ATOM   943   C  CB  . ILE A 1 120 ? 36.549  29.382  88.226  1.00 21.00 ? 120  ILE A CB  1 
ATOM   944   C  CG1 . ILE A 1 120 ? 37.511  29.356  87.037  1.00 20.27 ? 120  ILE A CG1 1 
ATOM   945   C  CG2 . ILE A 1 120 ? 36.293  30.820  88.657  1.00 18.61 ? 120  ILE A CG2 1 
ATOM   946   C  CD1 . ILE A 1 120 ? 36.987  30.057  85.804  1.00 21.27 ? 120  ILE A CD1 1 
ATOM   947   N  N   . TYR A 1 121 ? 36.493  28.858  91.725  1.00 22.23 ? 121  TYR A N   1 
ATOM   948   C  CA  . TYR A 1 121 ? 35.617  28.742  92.886  1.00 21.65 ? 121  TYR A CA  1 
ATOM   949   C  C   . TYR A 1 121 ? 34.761  29.949  93.253  1.00 21.62 ? 121  TYR A C   1 
ATOM   950   O  O   . TYR A 1 121 ? 35.085  31.091  92.922  1.00 20.94 ? 121  TYR A O   1 
ATOM   951   C  CB  . TYR A 1 121 ? 36.438  28.323  94.109  1.00 22.05 ? 121  TYR A CB  1 
ATOM   952   C  CG  . TYR A 1 121 ? 37.188  27.021  93.940  1.00 22.32 ? 121  TYR A CG  1 
ATOM   953   C  CD1 . TYR A 1 121 ? 38.414  26.980  93.276  1.00 24.23 ? 121  TYR A CD1 1 
ATOM   954   C  CD2 . TYR A 1 121 ? 36.681  25.830  94.457  1.00 24.13 ? 121  TYR A CD2 1 
ATOM   955   C  CE1 . TYR A 1 121 ? 39.117  25.787  93.132  1.00 24.17 ? 121  TYR A CE1 1 
ATOM   956   C  CE2 . TYR A 1 121 ? 37.375  24.631  94.318  1.00 25.06 ? 121  TYR A CE2 1 
ATOM   957   C  CZ  . TYR A 1 121 ? 38.591  24.617  93.655  1.00 24.40 ? 121  TYR A CZ  1 
ATOM   958   O  OH  . TYR A 1 121 ? 39.279  23.434  93.517  1.00 24.84 ? 121  TYR A OH  1 
ATOM   959   N  N   . ARG A 1 122 ? 33.661  29.665  93.949  1.00 21.74 ? 122  ARG A N   1 
ATOM   960   C  CA  . ARG A 1 122 ? 32.729  30.680  94.429  1.00 22.36 ? 122  ARG A CA  1 
ATOM   961   C  C   . ARG A 1 122 ? 32.934  30.846  95.934  1.00 22.14 ? 122  ARG A C   1 
ATOM   962   O  O   . ARG A 1 122 ? 33.782  30.178  96.522  1.00 21.87 ? 122  ARG A O   1 
ATOM   963   C  CB  . ARG A 1 122 ? 31.279  30.271  94.138  1.00 22.37 ? 122  ARG A CB  1 
ATOM   964   C  CG  . ARG A 1 122 ? 30.847  28.950  94.760  1.00 21.29 ? 122  ARG A CG  1 
ATOM   965   C  CD  . ARG A 1 122 ? 29.396  28.639  94.435  1.00 23.02 ? 122  ARG A CD  1 
ATOM   966   N  NE  . ARG A 1 122 ? 29.000  27.306  94.885  1.00 26.08 ? 122  ARG A NE  1 
ATOM   967   C  CZ  . ARG A 1 122 ? 28.498  27.031  96.086  1.00 26.81 ? 122  ARG A CZ  1 
ATOM   968   N  NH1 . ARG A 1 122 ? 28.325  27.998  96.979  1.00 29.57 ? 122  ARG A NH1 1 
ATOM   969   N  NH2 . ARG A 1 122 ? 28.163  25.786  96.395  1.00 23.94 ? 122  ARG A NH2 1 
HETATM 970   N  N   . MSE A 1 123 ? 32.148  31.723  96.551  1.00 25.87 ? 123  MSE A N   1 
HETATM 971   C  CA  . MSE A 1 123 ? 32.242  31.986  97.987  1.00 29.16 ? 123  MSE A CA  1 
HETATM 972   C  C   . MSE A 1 123 ? 31.843  30.813  98.883  1.00 28.96 ? 123  MSE A C   1 
HETATM 973   O  O   . MSE A 1 123 ? 30.668  30.448  98.962  1.00 29.63 ? 123  MSE A O   1 
HETATM 974   C  CB  . MSE A 1 123 ? 31.407  33.215  98.352  1.00 33.13 ? 123  MSE A CB  1 
HETATM 975   C  CG  . MSE A 1 123 ? 32.166  34.526  98.289  1.00 36.67 ? 123  MSE A CG  1 
HETATM 976   SE SE  . MSE A 1 123 ? 33.386  34.750  99.770  1.00 42.62 ? 123  MSE A SE  1 
HETATM 977   C  CE  . MSE A 1 123 ? 32.243  35.780  100.937 1.00 39.05 ? 123  MSE A CE  1 
ATOM   978   N  N   . PRO A 1 124 ? 32.827  30.202  99.565  1.00 29.62 ? 124  PRO A N   1 
ATOM   979   C  CA  . PRO A 1 124 ? 32.610  29.070  100.469 1.00 30.38 ? 124  PRO A CA  1 
ATOM   980   C  C   . PRO A 1 124 ? 32.262  29.594  101.868 1.00 32.86 ? 124  PRO A C   1 
ATOM   981   O  O   . PRO A 1 124 ? 32.204  30.809  102.081 1.00 32.64 ? 124  PRO A O   1 
ATOM   982   C  CB  . PRO A 1 124 ? 33.968  28.376  100.442 1.00 28.00 ? 124  PRO A CB  1 
ATOM   983   C  CG  . PRO A 1 124 ? 34.902  29.526  100.417 1.00 26.73 ? 124  PRO A CG  1 
ATOM   984   C  CD  . PRO A 1 124 ? 34.270  30.478  99.419  1.00 27.54 ? 124  PRO A CD  1 
ATOM   985   N  N   . PRO A 1 125 ? 32.011  28.691  102.836 1.00 34.69 ? 125  PRO A N   1 
ATOM   986   C  CA  . PRO A 1 125 ? 31.676  29.127  104.197 1.00 36.97 ? 125  PRO A CA  1 
ATOM   987   C  C   . PRO A 1 125 ? 32.836  29.833  104.908 1.00 39.31 ? 125  PRO A C   1 
ATOM   988   O  O   . PRO A 1 125 ? 33.930  29.967  104.356 1.00 39.19 ? 125  PRO A O   1 
ATOM   989   C  CB  . PRO A 1 125 ? 31.295  27.817  104.888 1.00 36.50 ? 125  PRO A CB  1 
ATOM   990   C  CG  . PRO A 1 125 ? 32.133  26.804  104.175 1.00 37.05 ? 125  PRO A CG  1 
ATOM   991   C  CD  . PRO A 1 125 ? 31.958  27.223  102.739 1.00 36.15 ? 125  PRO A CD  1 
ATOM   992   N  N   . LYS A 1 126 ? 32.584  30.264  106.140 1.00 42.31 ? 126  LYS A N   1 
ATOM   993   C  CA  . LYS A 1 126 ? 33.570  30.974  106.952 1.00 44.99 ? 126  LYS A CA  1 
ATOM   994   C  C   . LYS A 1 126 ? 34.906  30.254  107.111 1.00 45.09 ? 126  LYS A C   1 
ATOM   995   O  O   . LYS A 1 126 ? 35.963  30.838  106.861 1.00 45.28 ? 126  LYS A O   1 
ATOM   996   C  CB  . LYS A 1 126 ? 32.986  31.301  108.335 1.00 47.33 ? 126  LYS A CB  1 
ATOM   997   C  CG  . LYS A 1 126 ? 31.976  32.450  108.349 1.00 50.28 ? 126  LYS A CG  1 
ATOM   998   C  CD  . LYS A 1 126 ? 30.748  32.155  107.492 1.00 51.37 ? 126  LYS A CD  1 
ATOM   999   C  CE  . LYS A 1 126 ? 29.880  33.391  107.314 1.00 51.82 ? 126  LYS A CE  1 
ATOM   1000  N  NZ  . LYS A 1 126 ? 28.804  33.164  106.313 1.00 50.96 ? 126  LYS A NZ  1 
ATOM   1001  N  N   . ARG A 1 127 ? 34.856  28.987  107.512 1.00 45.40 ? 127  ARG A N   1 
ATOM   1002  C  CA  . ARG A 1 127 ? 36.072  28.205  107.716 1.00 44.97 ? 127  ARG A CA  1 
ATOM   1003  C  C   . ARG A 1 127 ? 36.716  27.678  106.432 1.00 41.90 ? 127  ARG A C   1 
ATOM   1004  O  O   . ARG A 1 127 ? 37.857  27.213  106.448 1.00 41.31 ? 127  ARG A O   1 
ATOM   1005  C  CB  . ARG A 1 127 ? 35.818  27.070  108.716 1.00 48.16 ? 127  ARG A CB  1 
ATOM   1006  C  CG  . ARG A 1 127 ? 34.851  25.984  108.267 1.00 51.86 ? 127  ARG A CG  1 
ATOM   1007  C  CD  . ARG A 1 127 ? 34.579  25.017  109.419 1.00 54.21 ? 127  ARG A CD  1 
ATOM   1008  N  NE  . ARG A 1 127 ? 33.919  23.787  108.990 1.00 56.15 ? 127  ARG A NE  1 
ATOM   1009  C  CZ  . ARG A 1 127 ? 34.559  22.678  108.627 1.00 56.58 ? 127  ARG A CZ  1 
ATOM   1010  N  NH1 . ARG A 1 127 ? 35.885  22.637  108.635 1.00 57.38 ? 127  ARG A NH1 1 
ATOM   1011  N  NH2 . ARG A 1 127 ? 33.871  21.602  108.267 1.00 56.15 ? 127  ARG A NH2 1 
ATOM   1012  N  N   . GLY A 1 128 ? 35.987  27.767  105.322 1.00 38.63 ? 128  GLY A N   1 
ATOM   1013  C  CA  . GLY A 1 128 ? 36.516  27.313  104.048 1.00 34.52 ? 128  GLY A CA  1 
ATOM   1014  C  C   . GLY A 1 128 ? 37.371  28.383  103.393 1.00 32.96 ? 128  GLY A C   1 
ATOM   1015  O  O   . GLY A 1 128 ? 38.166  28.096  102.495 1.00 30.35 ? 128  GLY A O   1 
ATOM   1016  N  N   . ARG A 1 129 ? 37.206  29.620  103.854 1.00 32.24 ? 129  ARG A N   1 
ATOM   1017  C  CA  . ARG A 1 129 ? 37.945  30.769  103.336 1.00 30.94 ? 129  ARG A CA  1 
ATOM   1018  C  C   . ARG A 1 129 ? 39.328  30.948  103.959 1.00 30.73 ? 129  ARG A C   1 
ATOM   1019  O  O   . ARG A 1 129 ? 40.055  31.878  103.610 1.00 30.86 ? 129  ARG A O   1 
ATOM   1020  C  CB  . ARG A 1 129 ? 37.124  32.045  103.528 1.00 30.46 ? 129  ARG A CB  1 
ATOM   1021  C  CG  . ARG A 1 129 ? 36.014  32.218  102.511 1.00 31.27 ? 129  ARG A CG  1 
ATOM   1022  C  CD  . ARG A 1 129 ? 35.162  33.431  102.820 1.00 32.83 ? 129  ARG A CD  1 
ATOM   1023  N  NE  . ARG A 1 129 ? 34.017  33.097  103.662 1.00 36.63 ? 129  ARG A NE  1 
ATOM   1024  C  CZ  . ARG A 1 129 ? 33.296  33.988  104.336 1.00 38.15 ? 129  ARG A CZ  1 
ATOM   1025  N  NH1 . ARG A 1 129 ? 33.601  35.277  104.282 1.00 39.67 ? 129  ARG A NH1 1 
ATOM   1026  N  NH2 . ARG A 1 129 ? 32.243  33.593  105.037 1.00 40.08 ? 129  ARG A NH2 1 
ATOM   1027  N  N   . LEU A 1 130 ? 39.688  30.058  104.877 1.00 29.29 ? 130  LEU A N   1 
ATOM   1028  C  CA  . LEU A 1 130 ? 40.982  30.122  105.548 1.00 27.22 ? 130  LEU A CA  1 
ATOM   1029  C  C   . LEU A 1 130 ? 42.102  29.529  104.700 1.00 25.68 ? 130  LEU A C   1 
ATOM   1030  O  O   . LEU A 1 130 ? 43.254  29.953  104.797 1.00 26.04 ? 130  LEU A O   1 
ATOM   1031  C  CB  . LEU A 1 130 ? 40.910  29.390  106.888 1.00 27.41 ? 130  LEU A CB  1 
ATOM   1032  C  CG  . LEU A 1 130 ? 39.930  29.961  107.912 1.00 24.64 ? 130  LEU A CG  1 
ATOM   1033  C  CD1 . LEU A 1 130 ? 39.728  28.968  109.038 1.00 28.10 ? 130  LEU A CD1 1 
ATOM   1034  C  CD2 . LEU A 1 130 ? 40.443  31.290  108.438 1.00 25.76 ? 130  LEU A CD2 1 
ATOM   1035  N  N   . SER A 1 131 ? 41.746  28.561  103.859 1.00 25.01 ? 131  SER A N   1 
ATOM   1036  C  CA  . SER A 1 131 ? 42.695  27.873  102.988 1.00 24.77 ? 131  SER A CA  1 
ATOM   1037  C  C   . SER A 1 131 ? 43.437  28.779  102.004 1.00 24.81 ? 131  SER A C   1 
ATOM   1038  O  O   . SER A 1 131 ? 42.848  29.675  101.399 1.00 25.04 ? 131  SER A O   1 
ATOM   1039  C  CB  . SER A 1 131 ? 41.981  26.757  102.223 1.00 24.37 ? 131  SER A CB  1 
ATOM   1040  O  OG  . SER A 1 131 ? 41.389  25.827  103.113 1.00 26.11 ? 131  SER A OG  1 
ATOM   1041  N  N   . SER A 1 132 ? 44.736  28.529  101.854 1.00 24.74 ? 132  SER A N   1 
ATOM   1042  C  CA  . SER A 1 132 ? 45.584  29.298  100.947 1.00 24.05 ? 132  SER A CA  1 
ATOM   1043  C  C   . SER A 1 132 ? 45.487  28.769  99.517  1.00 24.62 ? 132  SER A C   1 
ATOM   1044  O  O   . SER A 1 132 ? 44.939  27.692  99.281  1.00 26.36 ? 132  SER A O   1 
ATOM   1045  C  CB  . SER A 1 132 ? 47.042  29.262  101.421 1.00 22.56 ? 132  SER A CB  1 
ATOM   1046  O  OG  . SER A 1 132 ? 47.544  27.938  101.464 1.00 19.11 ? 132  SER A OG  1 
ATOM   1047  N  N   . ARG A 1 133 ? 46.036  29.527  98.571  1.00 23.76 ? 133  ARG A N   1 
ATOM   1048  C  CA  . ARG A 1 133 ? 46.016  29.156  97.158  1.00 23.22 ? 133  ARG A CA  1 
ATOM   1049  C  C   . ARG A 1 133 ? 46.623  27.779  96.891  1.00 23.85 ? 133  ARG A C   1 
ATOM   1050  O  O   . ARG A 1 133 ? 46.042  26.975  96.163  1.00 26.82 ? 133  ARG A O   1 
ATOM   1051  C  CB  . ARG A 1 133 ? 46.742  30.215  96.324  1.00 21.78 ? 133  ARG A CB  1 
ATOM   1052  C  CG  . ARG A 1 133 ? 46.821  29.894  94.842  1.00 21.06 ? 133  ARG A CG  1 
ATOM   1053  C  CD  . ARG A 1 133 ? 47.552  30.979  94.066  1.00 21.14 ? 133  ARG A CD  1 
ATOM   1054  N  NE  . ARG A 1 133 ? 46.823  32.244  94.060  1.00 19.10 ? 133  ARG A NE  1 
ATOM   1055  C  CZ  . ARG A 1 133 ? 45.833  32.537  93.222  1.00 16.60 ? 133  ARG A CZ  1 
ATOM   1056  N  NH1 . ARG A 1 133 ? 45.443  31.659  92.308  1.00 18.23 ? 133  ARG A NH1 1 
ATOM   1057  N  NH2 . ARG A 1 133 ? 45.228  33.712  93.302  1.00 19.83 ? 133  ARG A NH2 1 
ATOM   1058  N  N   . ALA A 1 134 ? 47.783  27.515  97.489  1.00 24.78 ? 134  ALA A N   1 
ATOM   1059  C  CA  . ALA A 1 134 ? 48.482  26.242  97.319  1.00 23.78 ? 134  ALA A CA  1 
ATOM   1060  C  C   . ALA A 1 134 ? 47.654  25.054  97.800  1.00 23.24 ? 134  ALA A C   1 
ATOM   1061  O  O   . ALA A 1 134 ? 47.710  23.970  97.218  1.00 22.37 ? 134  ALA A O   1 
ATOM   1062  C  CB  . ALA A 1 134 ? 49.818  26.278  98.048  1.00 24.47 ? 134  ALA A CB  1 
ATOM   1063  N  N   . GLU A 1 135 ? 46.890  25.270  98.867  1.00 24.74 ? 135  GLU A N   1 
ATOM   1064  C  CA  . GLU A 1 135 ? 46.041  24.233  99.442  1.00 25.87 ? 135  GLU A CA  1 
ATOM   1065  C  C   . GLU A 1 135 ? 44.789  24.008  98.603  1.00 26.80 ? 135  GLU A C   1 
ATOM   1066  O  O   . GLU A 1 135 ? 44.307  22.881  98.483  1.00 26.21 ? 135  GLU A O   1 
ATOM   1067  C  CB  . GLU A 1 135 ? 45.649  24.611  100.866 1.00 26.61 ? 135  GLU A CB  1 
ATOM   1068  C  CG  . GLU A 1 135 ? 46.833  24.760  101.806 1.00 28.63 ? 135  GLU A CG  1 
ATOM   1069  C  CD  . GLU A 1 135 ? 46.441  25.322  103.156 1.00 29.06 ? 135  GLU A CD  1 
ATOM   1070  O  OE1 . GLU A 1 135 ? 45.256  25.204  103.532 1.00 29.88 ? 135  GLU A OE1 1 
ATOM   1071  O  OE2 . GLU A 1 135 ? 47.320  25.884  103.841 1.00 31.19 ? 135  GLU A OE2 1 
ATOM   1072  N  N   . ILE A 1 136 ? 44.260  25.090  98.037  1.00 28.37 ? 136  ILE A N   1 
ATOM   1073  C  CA  . ILE A 1 136 ? 43.071  25.023  97.194  1.00 28.49 ? 136  ILE A CA  1 
ATOM   1074  C  C   . ILE A 1 136 ? 43.417  24.312  95.887  1.00 28.64 ? 136  ILE A C   1 
ATOM   1075  O  O   . ILE A 1 136 ? 42.586  23.606  95.314  1.00 31.07 ? 136  ILE A O   1 
ATOM   1076  C  CB  . ILE A 1 136 ? 42.499  26.435  96.922  1.00 27.63 ? 136  ILE A CB  1 
ATOM   1077  C  CG1 . ILE A 1 136 ? 42.049  27.068  98.243  1.00 27.40 ? 136  ILE A CG1 1 
ATOM   1078  C  CG2 . ILE A 1 136 ? 41.325  26.360  95.956  1.00 26.86 ? 136  ILE A CG2 1 
ATOM   1079  C  CD1 . ILE A 1 136 ? 41.568  28.497  98.126  1.00 29.12 ? 136  ILE A CD1 1 
ATOM   1080  N  N   . TYR A 1 137 ? 44.659  24.486  95.437  1.00 29.06 ? 137  TYR A N   1 
ATOM   1081  C  CA  . TYR A 1 137 ? 45.146  23.842  94.221  1.00 30.28 ? 137  TYR A CA  1 
ATOM   1082  C  C   . TYR A 1 137 ? 45.206  22.334  94.446  1.00 32.54 ? 137  TYR A C   1 
ATOM   1083  O  O   . TYR A 1 137 ? 44.937  21.547  93.536  1.00 34.32 ? 137  TYR A O   1 
ATOM   1084  C  CB  . TYR A 1 137 ? 46.546  24.351  93.866  1.00 28.72 ? 137  TYR A CB  1 
ATOM   1085  C  CG  . TYR A 1 137 ? 46.586  25.687  93.155  1.00 29.43 ? 137  TYR A CG  1 
ATOM   1086  C  CD1 . TYR A 1 137 ? 45.414  26.355  92.801  1.00 29.72 ? 137  TYR A CD1 1 
ATOM   1087  C  CD2 . TYR A 1 137 ? 47.805  26.271  92.811  1.00 29.52 ? 137  TYR A CD2 1 
ATOM   1088  C  CE1 . TYR A 1 137 ? 45.457  27.571  92.118  1.00 30.14 ? 137  TYR A CE1 1 
ATOM   1089  C  CE2 . TYR A 1 137 ? 47.859  27.483  92.131  1.00 30.27 ? 137  TYR A CE2 1 
ATOM   1090  C  CZ  . TYR A 1 137 ? 46.682  28.128  91.786  1.00 30.36 ? 137  TYR A CZ  1 
ATOM   1091  O  OH  . TYR A 1 137 ? 46.732  29.322  91.103  1.00 29.95 ? 137  TYR A OH  1 
ATOM   1092  N  N   . ALA A 1 138 ? 45.568  21.946  95.667  1.00 33.57 ? 138  ALA A N   1 
ATOM   1093  C  CA  . ALA A 1 138 ? 45.669  20.542  96.046  1.00 33.84 ? 138  ALA A CA  1 
ATOM   1094  C  C   . ALA A 1 138 ? 44.306  19.937  96.386  1.00 34.87 ? 138  ALA A C   1 
ATOM   1095  O  O   . ALA A 1 138 ? 44.179  18.719  96.507  1.00 37.30 ? 138  ALA A O   1 
ATOM   1096  C  CB  . ALA A 1 138 ? 46.630  20.383  97.212  1.00 33.49 ? 138  ALA A CB  1 
ATOM   1097  N  N   . GLY A 1 139 ? 43.300  20.793  96.565  1.00 34.91 ? 139  GLY A N   1 
ATOM   1098  C  CA  . GLY A 1 139 ? 41.960  20.318  96.866  1.00 34.35 ? 139  GLY A CA  1 
ATOM   1099  C  C   . GLY A 1 139 ? 41.424  20.569  98.265  1.00 34.06 ? 139  GLY A C   1 
ATOM   1100  O  O   . GLY A 1 139 ? 40.730  19.718  98.815  1.00 33.34 ? 139  GLY A O   1 
ATOM   1101  N  N   . ALA A 1 140 ? 41.702  21.742  98.828  1.00 34.70 ? 140  ALA A N   1 
ATOM   1102  C  CA  . ALA A 1 140 ? 41.228  22.079  100.170 1.00 35.16 ? 140  ALA A CA  1 
ATOM   1103  C  C   . ALA A 1 140 ? 39.725  22.358  100.210 1.00 35.06 ? 140  ALA A C   1 
ATOM   1104  O  O   . ALA A 1 140 ? 39.077  22.156  101.238 1.00 35.52 ? 140  ALA A O   1 
ATOM   1105  C  CB  . ALA A 1 140 ? 41.996  23.271  100.718 1.00 34.97 ? 140  ALA A CB  1 
ATOM   1106  N  N   . LEU A 1 141 ? 39.183  22.831  99.091  1.00 34.89 ? 141  LEU A N   1 
ATOM   1107  C  CA  . LEU A 1 141 ? 37.760  23.143  98.990  1.00 33.18 ? 141  LEU A CA  1 
ATOM   1108  C  C   . LEU A 1 141 ? 36.972  22.032  98.310  1.00 32.89 ? 141  LEU A C   1 
ATOM   1109  O  O   . LEU A 1 141 ? 37.493  21.329  97.442  1.00 31.72 ? 141  LEU A O   1 
ATOM   1110  C  CB  . LEU A 1 141 ? 37.553  24.453  98.226  1.00 31.45 ? 141  LEU A CB  1 
ATOM   1111  C  CG  . LEU A 1 141 ? 38.007  25.746  98.901  1.00 28.47 ? 141  LEU A CG  1 
ATOM   1112  C  CD1 . LEU A 1 141 ? 37.795  26.911  97.954  1.00 27.67 ? 141  LEU A CD1 1 
ATOM   1113  C  CD2 . LEU A 1 141 ? 37.229  25.957  100.187 1.00 29.37 ? 141  LEU A CD2 1 
ATOM   1114  N  N   . SER A 1 142 ? 35.709  21.892  98.705  1.00 33.67 ? 142  SER A N   1 
ATOM   1115  C  CA  . SER A 1 142 ? 34.825  20.879  98.137  1.00 34.60 ? 142  SER A CA  1 
ATOM   1116  C  C   . SER A 1 142 ? 34.489  21.217  96.686  1.00 35.93 ? 142  SER A C   1 
ATOM   1117  O  O   . SER A 1 142 ? 34.450  22.388  96.303  1.00 35.39 ? 142  SER A O   1 
ATOM   1118  C  CB  . SER A 1 142 ? 33.541  20.773  98.964  1.00 34.40 ? 142  SER A CB  1 
ATOM   1119  O  OG  . SER A 1 142 ? 32.682  19.767  98.454  1.00 33.89 ? 142  SER A OG  1 
ATOM   1120  N  N   . ASP A 1 143 ? 34.244  20.182  95.888  1.00 37.39 ? 143  ASP A N   1 
ATOM   1121  C  CA  . ASP A 1 143 ? 33.921  20.344  94.474  1.00 39.61 ? 143  ASP A CA  1 
ATOM   1122  C  C   . ASP A 1 143 ? 32.595  21.048  94.208  1.00 39.56 ? 143  ASP A C   1 
ATOM   1123  O  O   . ASP A 1 143 ? 32.331  21.467  93.080  1.00 39.71 ? 143  ASP A O   1 
ATOM   1124  C  CB  . ASP A 1 143 ? 33.935  18.985  93.766  1.00 43.75 ? 143  ASP A CB  1 
ATOM   1125  C  CG  . ASP A 1 143 ? 35.338  18.431  93.589  1.00 46.77 ? 143  ASP A CG  1 
ATOM   1126  O  OD1 . ASP A 1 143 ? 36.148  18.523  94.538  1.00 49.29 ? 143  ASP A OD1 1 
ATOM   1127  O  OD2 . ASP A 1 143 ? 35.630  17.902  92.494  1.00 48.04 ? 143  ASP A OD2 1 
ATOM   1128  N  N   . LYS A 1 144 ? 31.762  21.174  95.239  1.00 39.56 ? 144  LYS A N   1 
ATOM   1129  C  CA  . LYS A 1 144 ? 30.470  21.835  95.086  1.00 38.21 ? 144  LYS A CA  1 
ATOM   1130  C  C   . LYS A 1 144 ? 30.599  23.358  95.074  1.00 36.84 ? 144  LYS A C   1 
ATOM   1131  O  O   . LYS A 1 144 ? 29.619  24.070  94.851  1.00 38.75 ? 144  LYS A O   1 
ATOM   1132  C  CB  . LYS A 1 144 ? 29.487  21.381  96.173  1.00 37.91 ? 144  LYS A CB  1 
ATOM   1133  C  CG  . LYS A 1 144 ? 29.865  21.757  97.593  1.00 39.75 ? 144  LYS A CG  1 
ATOM   1134  C  CD  . LYS A 1 144 ? 28.789  21.300  98.565  1.00 42.03 ? 144  LYS A CD  1 
ATOM   1135  C  CE  . LYS A 1 144 ? 29.123  21.679  99.996  1.00 42.95 ? 144  LYS A CE  1 
ATOM   1136  N  NZ  . LYS A 1 144 ? 28.080  21.195  100.943 1.00 43.97 ? 144  LYS A NZ  1 
ATOM   1137  N  N   . TYR A 1 145 ? 31.814  23.848  95.307  1.00 34.09 ? 145  TYR A N   1 
ATOM   1138  C  CA  . TYR A 1 145 ? 32.082  25.282  95.308  1.00 32.49 ? 145  TYR A CA  1 
ATOM   1139  C  C   . TYR A 1 145 ? 32.734  25.728  94.002  1.00 31.41 ? 145  TYR A C   1 
ATOM   1140  O  O   . TYR A 1 145 ? 33.107  26.891  93.847  1.00 30.65 ? 145  TYR A O   1 
ATOM   1141  C  CB  . TYR A 1 145 ? 32.951  25.664  96.509  1.00 33.22 ? 145  TYR A CB  1 
ATOM   1142  C  CG  . TYR A 1 145 ? 32.253  25.443  97.830  1.00 34.21 ? 145  TYR A CG  1 
ATOM   1143  C  CD1 . TYR A 1 145 ? 31.180  26.246  98.213  1.00 33.95 ? 145  TYR A CD1 1 
ATOM   1144  C  CD2 . TYR A 1 145 ? 32.631  24.400  98.674  1.00 34.77 ? 145  TYR A CD2 1 
ATOM   1145  C  CE1 . TYR A 1 145 ? 30.495  26.013  99.400  1.00 34.82 ? 145  TYR A CE1 1 
ATOM   1146  C  CE2 . TYR A 1 145 ? 31.952  24.158  99.864  1.00 35.21 ? 145  TYR A CE2 1 
ATOM   1147  C  CZ  . TYR A 1 145 ? 30.885  24.967  100.219 1.00 36.26 ? 145  TYR A CZ  1 
ATOM   1148  O  OH  . TYR A 1 145 ? 30.198  24.721  101.387 1.00 39.73 ? 145  TYR A OH  1 
ATOM   1149  N  N   . ILE A 1 146 ? 32.859  24.794  93.063  1.00 30.30 ? 146  ILE A N   1 
ATOM   1150  C  CA  . ILE A 1 146 ? 33.448  25.075  91.759  1.00 27.87 ? 146  ILE A CA  1 
ATOM   1151  C  C   . ILE A 1 146 ? 32.367  25.604  90.823  1.00 27.50 ? 146  ILE A C   1 
ATOM   1152  O  O   . ILE A 1 146 ? 31.235  25.117  90.828  1.00 28.60 ? 146  ILE A O   1 
ATOM   1153  C  CB  . ILE A 1 146 ? 34.084  23.805  91.145  1.00 28.05 ? 146  ILE A CB  1 
ATOM   1154  C  CG1 . ILE A 1 146 ? 35.150  23.243  92.091  1.00 27.28 ? 146  ILE A CG1 1 
ATOM   1155  C  CG2 . ILE A 1 146 ? 34.701  24.123  89.789  1.00 28.53 ? 146  ILE A CG2 1 
ATOM   1156  C  CD1 . ILE A 1 146 ? 35.827  21.982  91.594  1.00 25.91 ? 146  ILE A CD1 1 
ATOM   1157  N  N   . LEU A 1 147 ? 32.718  26.619  90.039  1.00 26.55 ? 147  LEU A N   1 
ATOM   1158  C  CA  . LEU A 1 147 ? 31.792  27.233  89.092  1.00 26.28 ? 147  LEU A CA  1 
ATOM   1159  C  C   . LEU A 1 147 ? 32.069  26.783  87.661  1.00 26.04 ? 147  LEU A C   1 
ATOM   1160  O  O   . LEU A 1 147 ? 31.141  26.557  86.882  1.00 25.68 ? 147  LEU A O   1 
ATOM   1161  C  CB  . LEU A 1 147 ? 31.888  28.756  89.178  1.00 25.08 ? 147  LEU A CB  1 
ATOM   1162  C  CG  . LEU A 1 147 ? 31.447  29.392  90.496  1.00 22.56 ? 147  LEU A CG  1 
ATOM   1163  C  CD1 . LEU A 1 147 ? 31.878  30.846  90.542  1.00 22.70 ? 147  LEU A CD1 1 
ATOM   1164  C  CD2 . LEU A 1 147 ? 29.939  29.259  90.652  1.00 22.71 ? 147  LEU A CD2 1 
ATOM   1165  N  N   . ALA A 1 148 ? 33.350  26.654  87.326  1.00 27.06 ? 148  ALA A N   1 
ATOM   1166  C  CA  . ALA A 1 148 ? 33.764  26.240  85.992  1.00 28.64 ? 148  ALA A CA  1 
ATOM   1167  C  C   . ALA A 1 148 ? 35.218  25.778  85.969  1.00 29.18 ? 148  ALA A C   1 
ATOM   1168  O  O   . ALA A 1 148 ? 35.968  26.001  86.918  1.00 29.38 ? 148  ALA A O   1 
ATOM   1169  C  CB  . ALA A 1 148 ? 33.565  27.384  85.006  1.00 28.84 ? 148  ALA A CB  1 
ATOM   1170  N  N   . TYR A 1 149 ? 35.599  25.123  84.875  1.00 31.05 ? 149  TYR A N   1 
ATOM   1171  C  CA  . TYR A 1 149 ? 36.958  24.621  84.691  1.00 32.21 ? 149  TYR A CA  1 
ATOM   1172  C  C   . TYR A 1 149 ? 37.568  25.272  83.455  1.00 33.49 ? 149  TYR A C   1 
ATOM   1173  O  O   . TYR A 1 149 ? 37.095  25.054  82.340  1.00 34.02 ? 149  TYR A O   1 
ATOM   1174  C  CB  . TYR A 1 149 ? 36.950  23.101  84.503  1.00 31.58 ? 149  TYR A CB  1 
ATOM   1175  C  CG  . TYR A 1 149 ? 36.448  22.313  85.690  1.00 30.52 ? 149  TYR A CG  1 
ATOM   1176  C  CD1 . TYR A 1 149 ? 35.092  22.031  85.842  1.00 31.47 ? 149  TYR A CD1 1 
ATOM   1177  C  CD2 . TYR A 1 149 ? 37.333  21.822  86.648  1.00 30.61 ? 149  TYR A CD2 1 
ATOM   1178  C  CE1 . TYR A 1 149 ? 34.628  21.277  86.918  1.00 32.59 ? 149  TYR A CE1 1 
ATOM   1179  C  CE2 . TYR A 1 149 ? 36.882  21.067  87.725  1.00 32.65 ? 149  TYR A CE2 1 
ATOM   1180  C  CZ  . TYR A 1 149 ? 35.530  20.797  87.855  1.00 33.08 ? 149  TYR A CZ  1 
ATOM   1181  O  OH  . TYR A 1 149 ? 35.084  20.041  88.915  1.00 33.80 ? 149  TYR A OH  1 
ATOM   1182  N  N   . SER A 1 150 ? 38.616  26.066  83.652  1.00 35.40 ? 150  SER A N   1 
ATOM   1183  C  CA  . SER A 1 150 ? 39.282  26.746  82.543  1.00 37.10 ? 150  SER A CA  1 
ATOM   1184  C  C   . SER A 1 150 ? 40.409  25.914  81.932  1.00 37.50 ? 150  SER A C   1 
ATOM   1185  O  O   . SER A 1 150 ? 40.781  24.864  82.461  1.00 36.62 ? 150  SER A O   1 
ATOM   1186  C  CB  . SER A 1 150 ? 39.831  28.100  82.996  1.00 37.42 ? 150  SER A CB  1 
ATOM   1187  O  OG  . SER A 1 150 ? 40.910  27.938  83.898  1.00 36.73 ? 150  SER A OG  1 
ATOM   1188  N  N   . ASN A 1 151 ? 40.953  26.406  80.821  1.00 38.59 ? 151  ASN A N   1 
ATOM   1189  C  CA  . ASN A 1 151 ? 42.037  25.735  80.109  1.00 38.68 ? 151  ASN A CA  1 
ATOM   1190  C  C   . ASN A 1 151 ? 43.424  26.284  80.448  1.00 37.95 ? 151  ASN A C   1 
ATOM   1191  O  O   . ASN A 1 151 ? 44.424  25.863  79.861  1.00 37.90 ? 151  ASN A O   1 
ATOM   1192  C  CB  . ASN A 1 151 ? 41.802  25.813  78.596  1.00 41.18 ? 151  ASN A CB  1 
ATOM   1193  C  CG  . ASN A 1 151 ? 41.553  27.234  78.108  1.00 45.21 ? 151  ASN A CG  1 
ATOM   1194  O  OD1 . ASN A 1 151 ? 41.751  28.208  78.841  1.00 46.66 ? 151  ASN A OD1 1 
ATOM   1195  N  ND2 . ASN A 1 151 ? 41.110  27.357  76.861  1.00 46.07 ? 151  ASN A ND2 1 
ATOM   1196  N  N   . SER A 1 152 ? 43.484  27.215  81.395  1.00 37.06 ? 152  SER A N   1 
ATOM   1197  C  CA  . SER A 1 152 ? 44.755  27.809  81.794  1.00 35.94 ? 152  SER A CA  1 
ATOM   1198  C  C   . SER A 1 152 ? 44.758  28.227  83.257  1.00 35.38 ? 152  SER A C   1 
ATOM   1199  O  O   . SER A 1 152 ? 43.840  28.904  83.722  1.00 35.18 ? 152  SER A O   1 
ATOM   1200  C  CB  . SER A 1 152 ? 45.076  29.017  80.910  1.00 35.23 ? 152  SER A CB  1 
ATOM   1201  O  OG  . SER A 1 152 ? 46.304  29.616  81.285  1.00 33.62 ? 152  SER A OG  1 
ATOM   1202  N  N   . LEU A 1 153 ? 45.797  27.809  83.976  1.00 34.75 ? 153  LEU A N   1 
ATOM   1203  C  CA  . LEU A 1 153 ? 45.949  28.143  85.388  1.00 34.12 ? 153  LEU A CA  1 
ATOM   1204  C  C   . LEU A 1 153 ? 46.419  29.593  85.510  1.00 34.44 ? 153  LEU A C   1 
ATOM   1205  O  O   . LEU A 1 153 ? 46.170  30.257  86.518  1.00 36.42 ? 153  LEU A O   1 
ATOM   1206  C  CB  . LEU A 1 153 ? 46.964  27.205  86.051  1.00 32.45 ? 153  LEU A CB  1 
ATOM   1207  C  CG  . LEU A 1 153 ? 47.074  27.262  87.577  1.00 31.94 ? 153  LEU A CG  1 
ATOM   1208  C  CD1 . LEU A 1 153 ? 45.769  26.799  88.209  1.00 31.73 ? 153  LEU A CD1 1 
ATOM   1209  C  CD2 . LEU A 1 153 ? 48.224  26.393  88.048  1.00 30.04 ? 153  LEU A CD2 1 
HETATM 1210  N  N   . MSE A 1 154 ? 47.099  30.069  84.468  1.00 33.68 ? 154  MSE A N   1 
HETATM 1211  C  CA  . MSE A 1 154 ? 47.611  31.434  84.415  1.00 32.72 ? 154  MSE A CA  1 
HETATM 1212  C  C   . MSE A 1 154 ? 46.462  32.416  84.205  1.00 31.08 ? 154  MSE A C   1 
HETATM 1213  O  O   . MSE A 1 154 ? 46.446  33.495  84.797  1.00 30.74 ? 154  MSE A O   1 
HETATM 1214  C  CB  . MSE A 1 154 ? 48.640  31.569  83.289  1.00 34.59 ? 154  MSE A CB  1 
HETATM 1215  C  CG  . MSE A 1 154 ? 49.301  32.938  83.196  1.00 35.30 ? 154  MSE A CG  1 
HETATM 1216  SE SE  . MSE A 1 154 ? 50.180  33.466  84.836  1.00 40.60 ? 154  MSE A SE  1 
HETATM 1217  C  CE  . MSE A 1 154 ? 51.864  32.559  84.576  1.00 35.04 ? 154  MSE A CE  1 
ATOM   1218  N  N   . ASP A 1 155 ? 45.503  32.033  83.364  1.00 30.04 ? 155  ASP A N   1 
ATOM   1219  C  CA  . ASP A 1 155 ? 44.341  32.871  83.088  1.00 28.71 ? 155  ASP A CA  1 
ATOM   1220  C  C   . ASP A 1 155 ? 43.523  33.068  84.358  1.00 27.68 ? 155  ASP A C   1 
ATOM   1221  O  O   . ASP A 1 155 ? 43.033  34.165  84.622  1.00 27.83 ? 155  ASP A O   1 
ATOM   1222  C  CB  . ASP A 1 155 ? 43.465  32.244  81.997  1.00 29.50 ? 155  ASP A CB  1 
ATOM   1223  C  CG  . ASP A 1 155 ? 44.088  32.334  80.611  1.00 30.75 ? 155  ASP A CG  1 
ATOM   1224  O  OD1 . ASP A 1 155 ? 45.169  32.944  80.461  1.00 31.46 ? 155  ASP A OD1 1 
ATOM   1225  O  OD2 . ASP A 1 155 ? 43.483  31.793  79.661  1.00 33.07 ? 155  ASP A OD2 1 
ATOM   1226  N  N   . ASN A 1 156 ? 43.382  31.999  85.139  1.00 26.67 ? 156  ASN A N   1 
ATOM   1227  C  CA  . ASN A 1 156 ? 42.640  32.045  86.396  1.00 26.85 ? 156  ASN A CA  1 
ATOM   1228  C  C   . ASN A 1 156 ? 43.354  32.953  87.386  1.00 27.10 ? 156  ASN A C   1 
ATOM   1229  O  O   . ASN A 1 156 ? 42.716  33.651  88.176  1.00 27.57 ? 156  ASN A O   1 
ATOM   1230  C  CB  . ASN A 1 156 ? 42.508  30.644  87.000  1.00 26.79 ? 156  ASN A CB  1 
ATOM   1231  C  CG  . ASN A 1 156 ? 41.535  29.767  86.239  1.00 26.01 ? 156  ASN A CG  1 
ATOM   1232  O  OD1 . ASN A 1 156 ? 40.892  30.211  85.288  1.00 27.23 ? 156  ASN A OD1 1 
ATOM   1233  N  ND2 . ASN A 1 156 ? 41.416  28.512  86.661  1.00 22.24 ? 156  ASN A ND2 1 
ATOM   1234  N  N   . PHE A 1 157 ? 44.682  32.936  87.333  1.00 27.28 ? 157  PHE A N   1 
ATOM   1235  C  CA  . PHE A 1 157 ? 45.500  33.754  88.216  1.00 27.18 ? 157  PHE A CA  1 
ATOM   1236  C  C   . PHE A 1 157 ? 45.398  35.229  87.841  1.00 26.93 ? 157  PHE A C   1 
ATOM   1237  O  O   . PHE A 1 157 ? 45.289  36.087  88.714  1.00 27.28 ? 157  PHE A O   1 
ATOM   1238  C  CB  . PHE A 1 157 ? 46.958  33.298  88.169  1.00 27.02 ? 157  PHE A CB  1 
ATOM   1239  C  CG  . PHE A 1 157 ? 47.817  33.918  89.231  1.00 26.49 ? 157  PHE A CG  1 
ATOM   1240  C  CD1 . PHE A 1 157 ? 47.930  33.323  90.482  1.00 26.84 ? 157  PHE A CD1 1 
ATOM   1241  C  CD2 . PHE A 1 157 ? 48.495  35.108  88.990  1.00 27.20 ? 157  PHE A CD2 1 
ATOM   1242  C  CE1 . PHE A 1 157 ? 48.704  33.903  91.481  1.00 26.87 ? 157  PHE A CE1 1 
ATOM   1243  C  CE2 . PHE A 1 157 ? 49.271  35.697  89.982  1.00 28.81 ? 157  PHE A CE2 1 
ATOM   1244  C  CZ  . PHE A 1 157 ? 49.375  35.092  91.231  1.00 27.92 ? 157  PHE A CZ  1 
ATOM   1245  N  N   . ILE A 1 158 ? 45.443  35.519  86.543  1.00 27.56 ? 158  ILE A N   1 
ATOM   1246  C  CA  . ILE A 1 158 ? 45.344  36.894  86.059  1.00 27.45 ? 158  ILE A CA  1 
ATOM   1247  C  C   . ILE A 1 158 ? 43.967  37.465  86.386  1.00 27.71 ? 158  ILE A C   1 
ATOM   1248  O  O   . ILE A 1 158 ? 43.859  38.592  86.866  1.00 30.11 ? 158  ILE A O   1 
ATOM   1249  C  CB  . ILE A 1 158 ? 45.615  36.981  84.539  1.00 27.20 ? 158  ILE A CB  1 
ATOM   1250  C  CG1 . ILE A 1 158 ? 47.059  36.562  84.252  1.00 27.82 ? 158  ILE A CG1 1 
ATOM   1251  C  CG2 . ILE A 1 158 ? 45.367  38.398  84.030  1.00 26.78 ? 158  ILE A CG2 1 
ATOM   1252  C  CD1 . ILE A 1 158 ? 47.439  36.595  82.792  1.00 30.03 ? 158  ILE A CD1 1 
HETATM 1253  N  N   . MSE A 1 159 ? 42.925  36.670  86.149  1.00 27.06 ? 159  MSE A N   1 
HETATM 1254  C  CA  . MSE A 1 159 ? 41.551  37.073  86.442  1.00 27.42 ? 159  MSE A CA  1 
HETATM 1255  C  C   . MSE A 1 159 ? 41.419  37.309  87.943  1.00 27.90 ? 159  MSE A C   1 
HETATM 1256  O  O   . MSE A 1 159 ? 40.685  38.193  88.387  1.00 28.39 ? 159  MSE A O   1 
HETATM 1257  C  CB  . MSE A 1 159 ? 40.578  35.977  86.001  1.00 28.83 ? 159  MSE A CB  1 
HETATM 1258  C  CG  . MSE A 1 159 ? 39.133  36.210  86.414  1.00 31.97 ? 159  MSE A CG  1 
HETATM 1259  SE SE  . MSE A 1 159 ? 37.971  34.751  85.915  1.00 38.11 ? 159  MSE A SE  1 
HETATM 1260  C  CE  . MSE A 1 159 ? 38.708  33.380  87.058  1.00 33.45 ? 159  MSE A CE  1 
ATOM   1261  N  N   . ASP A 1 160 ? 42.150  36.508  88.711  1.00 29.09 ? 160  ASP A N   1 
ATOM   1262  C  CA  . ASP A 1 160 ? 42.166  36.594  90.165  1.00 29.63 ? 160  ASP A CA  1 
ATOM   1263  C  C   . ASP A 1 160 ? 42.724  37.959  90.567  1.00 28.82 ? 160  ASP A C   1 
ATOM   1264  O  O   . ASP A 1 160 ? 42.196  38.619  91.463  1.00 30.47 ? 160  ASP A O   1 
ATOM   1265  C  CB  . ASP A 1 160 ? 43.051  35.474  90.721  1.00 31.10 ? 160  ASP A CB  1 
ATOM   1266  C  CG  . ASP A 1 160 ? 42.864  35.255  92.203  1.00 32.71 ? 160  ASP A CG  1 
ATOM   1267  O  OD1 . ASP A 1 160 ? 43.390  36.060  92.999  1.00 34.59 ? 160  ASP A OD1 1 
ATOM   1268  O  OD2 . ASP A 1 160 ? 42.209  34.258  92.572  1.00 34.64 ? 160  ASP A OD2 1 
ATOM   1269  N  N   . VAL A 1 161 ? 43.779  38.381  89.873  1.00 28.01 ? 161  VAL A N   1 
ATOM   1270  C  CA  . VAL A 1 161 ? 44.434  39.662  90.127  1.00 25.69 ? 161  VAL A CA  1 
ATOM   1271  C  C   . VAL A 1 161 ? 43.569  40.837  89.681  1.00 24.27 ? 161  VAL A C   1 
ATOM   1272  O  O   . VAL A 1 161 ? 43.519  41.862  90.356  1.00 24.31 ? 161  VAL A O   1 
ATOM   1273  C  CB  . VAL A 1 161 ? 45.809  39.740  89.413  1.00 25.41 ? 161  VAL A CB  1 
ATOM   1274  C  CG1 . VAL A 1 161 ? 46.447  41.109  89.619  1.00 25.74 ? 161  VAL A CG1 1 
ATOM   1275  C  CG2 . VAL A 1 161 ? 46.732  38.651  89.933  1.00 25.12 ? 161  VAL A CG2 1 
ATOM   1276  N  N   . GLN A 1 162 ? 42.883  40.682  88.552  1.00 23.20 ? 162  GLN A N   1 
ATOM   1277  C  CA  . GLN A 1 162 ? 42.025  41.740  88.023  1.00 21.18 ? 162  GLN A CA  1 
ATOM   1278  C  C   . GLN A 1 162 ? 40.809  41.997  88.904  1.00 18.95 ? 162  GLN A C   1 
ATOM   1279  O  O   . GLN A 1 162 ? 40.281  43.106  88.935  1.00 19.15 ? 162  GLN A O   1 
ATOM   1280  C  CB  . GLN A 1 162 ? 41.573  41.411  86.598  1.00 23.01 ? 162  GLN A CB  1 
ATOM   1281  C  CG  . GLN A 1 162 ? 42.705  41.106  85.627  1.00 23.58 ? 162  GLN A CG  1 
ATOM   1282  C  CD  . GLN A 1 162 ? 43.840  42.109  85.705  1.00 25.13 ? 162  GLN A CD  1 
ATOM   1283  O  OE1 . GLN A 1 162 ? 43.663  43.292  85.419  1.00 25.42 ? 162  GLN A OE1 1 
ATOM   1284  N  NE2 . GLN A 1 162 ? 45.016  41.637  86.102  1.00 25.81 ? 162  GLN A NE2 1 
ATOM   1285  N  N   . GLY A 1 163 ? 40.373  40.965  89.620  1.00 20.07 ? 163  GLY A N   1 
ATOM   1286  C  CA  . GLY A 1 163 ? 39.223  41.096  90.497  1.00 20.99 ? 163  GLY A CA  1 
ATOM   1287  C  C   . GLY A 1 163 ? 37.954  40.496  89.922  1.00 21.67 ? 163  GLY A C   1 
ATOM   1288  O  O   . GLY A 1 163 ? 37.019  40.194  90.663  1.00 21.45 ? 163  GLY A O   1 
ATOM   1289  N  N   . SER A 1 164 ? 37.924  40.316  88.604  1.00 23.29 ? 164  SER A N   1 
ATOM   1290  C  CA  . SER A 1 164 ? 36.761  39.753  87.922  1.00 22.79 ? 164  SER A CA  1 
ATOM   1291  C  C   . SER A 1 164 ? 37.080  39.376  86.479  1.00 22.87 ? 164  SER A C   1 
ATOM   1292  O  O   . SER A 1 164 ? 38.198  39.584  86.004  1.00 22.87 ? 164  SER A O   1 
ATOM   1293  C  CB  . SER A 1 164 ? 35.601  40.752  87.943  1.00 23.16 ? 164  SER A CB  1 
ATOM   1294  O  OG  . SER A 1 164 ? 35.938  41.943  87.251  1.00 25.43 ? 164  SER A OG  1 
ATOM   1295  N  N   . GLY A 1 165 ? 36.086  38.824  85.790  1.00 23.12 ? 165  GLY A N   1 
ATOM   1296  C  CA  . GLY A 1 165 ? 36.265  38.431  84.405  1.00 21.23 ? 165  GLY A CA  1 
ATOM   1297  C  C   . GLY A 1 165 ? 35.064  37.718  83.815  1.00 21.58 ? 165  GLY A C   1 
ATOM   1298  O  O   . GLY A 1 165 ? 34.264  37.126  84.541  1.00 20.01 ? 165  GLY A O   1 
ATOM   1299  N  N   . TYR A 1 166 ? 34.921  37.805  82.494  1.00 22.79 ? 166  TYR A N   1 
ATOM   1300  C  CA  . TYR A 1 166 ? 33.827  37.148  81.787  1.00 22.31 ? 166  TYR A CA  1 
ATOM   1301  C  C   . TYR A 1 166 ? 34.201  35.705  81.485  1.00 24.19 ? 166  TYR A C   1 
ATOM   1302  O  O   . TYR A 1 166 ? 35.342  35.414  81.120  1.00 23.89 ? 166  TYR A O   1 
ATOM   1303  C  CB  . TYR A 1 166 ? 33.519  37.861  80.471  1.00 21.52 ? 166  TYR A CB  1 
ATOM   1304  C  CG  . TYR A 1 166 ? 32.656  39.090  80.606  1.00 21.75 ? 166  TYR A CG  1 
ATOM   1305  C  CD1 . TYR A 1 166 ? 31.305  38.985  80.935  1.00 21.11 ? 166  TYR A CD1 1 
ATOM   1306  C  CD2 . TYR A 1 166 ? 33.179  40.359  80.374  1.00 21.86 ? 166  TYR A CD2 1 
ATOM   1307  C  CE1 . TYR A 1 166 ? 30.496  40.116  81.026  1.00 20.31 ? 166  TYR A CE1 1 
ATOM   1308  C  CE2 . TYR A 1 166 ? 32.381  41.494  80.462  1.00 19.82 ? 166  TYR A CE2 1 
ATOM   1309  C  CZ  . TYR A 1 166 ? 31.043  41.367  80.787  1.00 18.94 ? 166  TYR A CZ  1 
ATOM   1310  O  OH  . TYR A 1 166 ? 30.256  42.491  80.870  1.00 20.40 ? 166  TYR A OH  1 
ATOM   1311  N  N   . ILE A 1 167 ? 33.236  34.804  81.644  1.00 25.40 ? 167  ILE A N   1 
ATOM   1312  C  CA  . ILE A 1 167 ? 33.463  33.391  81.376  1.00 25.04 ? 167  ILE A CA  1 
ATOM   1313  C  C   . ILE A 1 167 ? 32.704  32.956  80.129  1.00 25.99 ? 167  ILE A C   1 
ATOM   1314  O  O   . ILE A 1 167 ? 31.474  32.997  80.085  1.00 25.60 ? 167  ILE A O   1 
ATOM   1315  C  CB  . ILE A 1 167 ? 33.057  32.510  82.579  1.00 23.64 ? 167  ILE A CB  1 
ATOM   1316  C  CG1 . ILE A 1 167 ? 33.892  32.884  83.808  1.00 23.52 ? 167  ILE A CG1 1 
ATOM   1317  C  CG2 . ILE A 1 167 ? 33.246  31.033  82.247  1.00 22.64 ? 167  ILE A CG2 1 
ATOM   1318  C  CD1 . ILE A 1 167 ? 35.388  32.718  83.629  1.00 20.64 ? 167  ILE A CD1 1 
ATOM   1319  N  N   . ASP A 1 168 ? 33.460  32.579  79.105  1.00 27.68 ? 168  ASP A N   1 
ATOM   1320  C  CA  . ASP A 1 168 ? 32.897  32.126  77.841  1.00 30.56 ? 168  ASP A CA  1 
ATOM   1321  C  C   . ASP A 1 168 ? 32.843  30.600  77.843  1.00 31.80 ? 168  ASP A C   1 
ATOM   1322  O  O   . ASP A 1 168 ? 33.880  29.938  77.865  1.00 32.32 ? 168  ASP A O   1 
ATOM   1323  C  CB  . ASP A 1 168 ? 33.762  32.630  76.679  1.00 32.89 ? 168  ASP A CB  1 
ATOM   1324  C  CG  . ASP A 1 168 ? 33.246  32.184  75.323  1.00 34.81 ? 168  ASP A CG  1 
ATOM   1325  O  OD1 . ASP A 1 168 ? 32.154  32.634  74.916  1.00 40.28 ? 168  ASP A OD1 1 
ATOM   1326  O  OD2 . ASP A 1 168 ? 33.939  31.386  74.660  1.00 37.95 ? 168  ASP A OD2 1 
ATOM   1327  N  N   . PHE A 1 169 ? 31.634  30.045  77.839  1.00 32.57 ? 169  PHE A N   1 
ATOM   1328  C  CA  . PHE A 1 169 ? 31.462  28.594  77.839  1.00 34.67 ? 169  PHE A CA  1 
ATOM   1329  C  C   . PHE A 1 169 ? 31.555  27.960  76.449  1.00 35.61 ? 169  PHE A C   1 
ATOM   1330  O  O   . PHE A 1 169 ? 31.458  26.738  76.310  1.00 35.00 ? 169  PHE A O   1 
ATOM   1331  C  CB  . PHE A 1 169 ? 30.153  28.208  78.532  1.00 34.80 ? 169  PHE A CB  1 
ATOM   1332  C  CG  . PHE A 1 169 ? 30.177  28.412  80.023  1.00 35.20 ? 169  PHE A CG  1 
ATOM   1333  C  CD1 . PHE A 1 169 ? 30.852  27.517  80.849  1.00 34.58 ? 169  PHE A CD1 1 
ATOM   1334  C  CD2 . PHE A 1 169 ? 29.538  29.503  80.601  1.00 36.06 ? 169  PHE A CD2 1 
ATOM   1335  C  CE1 . PHE A 1 169 ? 30.892  27.706  82.229  1.00 33.97 ? 169  PHE A CE1 1 
ATOM   1336  C  CE2 . PHE A 1 169 ? 29.571  29.701  81.982  1.00 35.38 ? 169  PHE A CE2 1 
ATOM   1337  C  CZ  . PHE A 1 169 ? 30.250  28.801  82.796  1.00 34.46 ? 169  PHE A CZ  1 
ATOM   1338  N  N   . GLY A 1 170 ? 31.747  28.802  75.433  1.00 36.27 ? 170  GLY A N   1 
ATOM   1339  C  CA  . GLY A 1 170 ? 31.877  28.342  74.059  1.00 36.31 ? 170  GLY A CA  1 
ATOM   1340  C  C   . GLY A 1 170 ? 30.796  27.411  73.543  1.00 37.24 ? 170  GLY A C   1 
ATOM   1341  O  O   . GLY A 1 170 ? 31.074  26.543  72.716  1.00 37.69 ? 170  GLY A O   1 
ATOM   1342  N  N   . ASP A 1 171 ? 29.566  27.600  74.013  1.00 38.00 ? 171  ASP A N   1 
ATOM   1343  C  CA  . ASP A 1 171 ? 28.439  26.766  73.598  1.00 36.16 ? 171  ASP A CA  1 
ATOM   1344  C  C   . ASP A 1 171 ? 27.294  27.577  73.000  1.00 34.89 ? 171  ASP A C   1 
ATOM   1345  O  O   . ASP A 1 171 ? 26.259  27.024  72.626  1.00 35.38 ? 171  ASP A O   1 
ATOM   1346  C  CB  . ASP A 1 171 ? 27.930  25.926  74.781  1.00 37.66 ? 171  ASP A CB  1 
ATOM   1347  C  CG  . ASP A 1 171 ? 27.521  26.772  75.986  1.00 37.72 ? 171  ASP A CG  1 
ATOM   1348  O  OD1 . ASP A 1 171 ? 27.626  28.015  75.934  1.00 36.57 ? 171  ASP A OD1 1 
ATOM   1349  O  OD2 . ASP A 1 171 ? 27.094  26.179  76.999  1.00 40.55 ? 171  ASP A OD2 1 
ATOM   1350  N  N   . GLY A 1 172 ? 27.489  28.890  72.914  1.00 34.51 ? 172  GLY A N   1 
ATOM   1351  C  CA  . GLY A 1 172 ? 26.467  29.762  72.367  1.00 34.63 ? 172  GLY A CA  1 
ATOM   1352  C  C   . GLY A 1 172 ? 25.886  30.699  73.408  1.00 35.11 ? 172  GLY A C   1 
ATOM   1353  O  O   . GLY A 1 172 ? 25.475  31.813  73.082  1.00 34.94 ? 172  GLY A O   1 
ATOM   1354  N  N   . SER A 1 173 ? 25.855  30.251  74.661  1.00 35.54 ? 173  SER A N   1 
ATOM   1355  C  CA  . SER A 1 173 ? 25.321  31.054  75.757  1.00 36.23 ? 173  SER A CA  1 
ATOM   1356  C  C   . SER A 1 173 ? 26.162  32.311  75.988  1.00 35.87 ? 173  SER A C   1 
ATOM   1357  O  O   . SER A 1 173 ? 27.362  32.327  75.701  1.00 37.59 ? 173  SER A O   1 
ATOM   1358  C  CB  . SER A 1 173 ? 25.245  30.223  77.045  1.00 36.19 ? 173  SER A CB  1 
ATOM   1359  O  OG  . SER A 1 173 ? 26.534  29.873  77.519  1.00 36.54 ? 173  SER A OG  1 
ATOM   1360  N  N   . PRO A 1 174 ? 25.531  33.391  76.483  1.00 34.68 ? 174  PRO A N   1 
ATOM   1361  C  CA  . PRO A 1 174 ? 26.202  34.666  76.759  1.00 33.34 ? 174  PRO A CA  1 
ATOM   1362  C  C   . PRO A 1 174 ? 27.316  34.538  77.794  1.00 32.30 ? 174  PRO A C   1 
ATOM   1363  O  O   . PRO A 1 174 ? 27.334  33.596  78.588  1.00 32.73 ? 174  PRO A O   1 
ATOM   1364  C  CB  . PRO A 1 174 ? 25.062  35.535  77.286  1.00 34.08 ? 174  PRO A CB  1 
ATOM   1365  C  CG  . PRO A 1 174 ? 23.870  35.000  76.567  1.00 34.26 ? 174  PRO A CG  1 
ATOM   1366  C  CD  . PRO A 1 174 ? 24.079  33.517  76.702  1.00 34.31 ? 174  PRO A CD  1 
ATOM   1367  N  N   . LEU A 1 175 ? 28.244  35.489  77.772  1.00 32.32 ? 175  LEU A N   1 
ATOM   1368  C  CA  . LEU A 1 175 ? 29.366  35.502  78.705  1.00 31.74 ? 175  LEU A CA  1 
ATOM   1369  C  C   . LEU A 1 175 ? 28.890  35.825  80.116  1.00 31.06 ? 175  LEU A C   1 
ATOM   1370  O  O   . LEU A 1 175 ? 28.242  36.844  80.340  1.00 31.78 ? 175  LEU A O   1 
ATOM   1371  C  CB  . LEU A 1 175 ? 30.416  36.525  78.264  1.00 32.70 ? 175  LEU A CB  1 
ATOM   1372  C  CG  . LEU A 1 175 ? 31.339  36.168  77.094  1.00 32.76 ? 175  LEU A CG  1 
ATOM   1373  C  CD1 . LEU A 1 175 ? 30.539  35.822  75.851  1.00 34.68 ? 175  LEU A CD1 1 
ATOM   1374  C  CD2 . LEU A 1 175 ? 32.274  37.333  76.819  1.00 33.61 ? 175  LEU A CD2 1 
ATOM   1375  N  N   . ASN A 1 176 ? 29.204  34.943  81.060  1.00 30.80 ? 176  ASN A N   1 
ATOM   1376  C  CA  . ASN A 1 176 ? 28.809  35.127  82.454  1.00 29.40 ? 176  ASN A CA  1 
ATOM   1377  C  C   . ASN A 1 176 ? 29.867  35.921  83.215  1.00 27.45 ? 176  ASN A C   1 
ATOM   1378  O  O   . ASN A 1 176 ? 31.023  35.507  83.303  1.00 27.79 ? 176  ASN A O   1 
ATOM   1379  C  CB  . ASN A 1 176 ? 28.595  33.764  83.122  1.00 31.61 ? 176  ASN A CB  1 
ATOM   1380  C  CG  . ASN A 1 176 ? 27.870  33.868  84.454  1.00 34.08 ? 176  ASN A CG  1 
ATOM   1381  O  OD1 . ASN A 1 176 ? 28.168  34.734  85.276  1.00 35.38 ? 176  ASN A OD1 1 
ATOM   1382  N  ND2 . ASN A 1 176 ? 26.907  32.978  84.670  1.00 34.47 ? 176  ASN A ND2 1 
ATOM   1383  N  N   . PHE A 1 177 ? 29.462  37.058  83.774  1.00 26.65 ? 177  PHE A N   1 
ATOM   1384  C  CA  . PHE A 1 177 ? 30.376  37.909  84.527  1.00 25.83 ? 177  PHE A CA  1 
ATOM   1385  C  C   . PHE A 1 177 ? 30.601  37.419  85.956  1.00 25.53 ? 177  PHE A C   1 
ATOM   1386  O  O   . PHE A 1 177 ? 29.694  37.455  86.788  1.00 24.76 ? 177  PHE A O   1 
ATOM   1387  C  CB  . PHE A 1 177 ? 29.872  39.356  84.545  1.00 24.95 ? 177  PHE A CB  1 
ATOM   1388  C  CG  . PHE A 1 177 ? 30.779  40.306  85.280  1.00 25.03 ? 177  PHE A CG  1 
ATOM   1389  C  CD1 . PHE A 1 177 ? 32.083  40.521  84.844  1.00 25.29 ? 177  PHE A CD1 1 
ATOM   1390  C  CD2 . PHE A 1 177 ? 30.333  40.980  86.411  1.00 24.84 ? 177  PHE A CD2 1 
ATOM   1391  C  CE1 . PHE A 1 177 ? 32.929  41.392  85.526  1.00 25.34 ? 177  PHE A CE1 1 
ATOM   1392  C  CE2 . PHE A 1 177 ? 31.172  41.853  87.100  1.00 25.41 ? 177  PHE A CE2 1 
ATOM   1393  C  CZ  . PHE A 1 177 ? 32.471  42.059  86.657  1.00 23.96 ? 177  PHE A CZ  1 
ATOM   1394  N  N   . PHE A 1 178 ? 31.816  36.951  86.226  1.00 24.16 ? 178  PHE A N   1 
ATOM   1395  C  CA  . PHE A 1 178 ? 32.188  36.471  87.553  1.00 22.77 ? 178  PHE A CA  1 
ATOM   1396  C  C   . PHE A 1 178 ? 32.726  37.647  88.364  1.00 22.73 ? 178  PHE A C   1 
ATOM   1397  O  O   . PHE A 1 178 ? 33.916  37.960  88.307  1.00 23.78 ? 178  PHE A O   1 
ATOM   1398  C  CB  . PHE A 1 178 ? 33.253  35.372  87.452  1.00 21.46 ? 178  PHE A CB  1 
ATOM   1399  C  CG  . PHE A 1 178 ? 32.706  34.019  87.084  1.00 20.46 ? 178  PHE A CG  1 
ATOM   1400  C  CD1 . PHE A 1 178 ? 31.509  33.893  86.384  1.00 21.50 ? 178  PHE A CD1 1 
ATOM   1401  C  CD2 . PHE A 1 178 ? 33.396  32.864  87.439  1.00 19.00 ? 178  PHE A CD2 1 
ATOM   1402  C  CE1 . PHE A 1 178 ? 31.007  32.637  86.044  1.00 20.95 ? 178  PHE A CE1 1 
ATOM   1403  C  CE2 . PHE A 1 178 ? 32.903  31.603  87.103  1.00 18.98 ? 178  PHE A CE2 1 
ATOM   1404  C  CZ  . PHE A 1 178 ? 31.707  31.489  86.404  1.00 18.97 ? 178  PHE A CZ  1 
ATOM   1405  N  N   . SER A 1 179 ? 31.837  38.300  89.107  1.00 23.35 ? 179  SER A N   1 
ATOM   1406  C  CA  . SER A 1 179 ? 32.196  39.454  89.927  1.00 22.71 ? 179  SER A CA  1 
ATOM   1407  C  C   . SER A 1 179 ? 32.975  39.087  91.185  1.00 23.59 ? 179  SER A C   1 
ATOM   1408  O  O   . SER A 1 179 ? 32.946  37.943  91.638  1.00 23.89 ? 179  SER A O   1 
ATOM   1409  C  CB  . SER A 1 179 ? 30.939  40.232  90.324  1.00 21.83 ? 179  SER A CB  1 
ATOM   1410  O  OG  . SER A 1 179 ? 30.103  39.457  91.168  1.00 19.20 ? 179  SER A OG  1 
ATOM   1411  N  N   . TYR A 1 180 ? 33.658  40.079  91.748  1.00 23.45 ? 180  TYR A N   1 
ATOM   1412  C  CA  . TYR A 1 180 ? 34.441  39.903  92.965  1.00 22.76 ? 180  TYR A CA  1 
ATOM   1413  C  C   . TYR A 1 180 ? 33.471  39.656  94.122  1.00 23.79 ? 180  TYR A C   1 
ATOM   1414  O  O   . TYR A 1 180 ? 32.733  40.556  94.526  1.00 25.17 ? 180  TYR A O   1 
ATOM   1415  C  CB  . TYR A 1 180 ? 35.277  41.165  93.225  1.00 21.92 ? 180  TYR A CB  1 
ATOM   1416  C  CG  . TYR A 1 180 ? 36.266  41.057  94.367  1.00 21.62 ? 180  TYR A CG  1 
ATOM   1417  C  CD1 . TYR A 1 180 ? 35.867  41.274  95.687  1.00 23.31 ? 180  TYR A CD1 1 
ATOM   1418  C  CD2 . TYR A 1 180 ? 37.605  40.752  94.127  1.00 21.65 ? 180  TYR A CD2 1 
ATOM   1419  C  CE1 . TYR A 1 180 ? 36.775  41.188  96.738  1.00 22.24 ? 180  TYR A CE1 1 
ATOM   1420  C  CE2 . TYR A 1 180 ? 38.522  40.664  95.171  1.00 22.34 ? 180  TYR A CE2 1 
ATOM   1421  C  CZ  . TYR A 1 180 ? 38.100  40.883  96.473  1.00 23.42 ? 180  TYR A CZ  1 
ATOM   1422  O  OH  . TYR A 1 180 ? 39.001  40.789  97.509  1.00 24.95 ? 180  TYR A OH  1 
ATOM   1423  N  N   . ALA A 1 181 ? 33.455  38.427  94.628  1.00 23.74 ? 181  ALA A N   1 
ATOM   1424  C  CA  . ALA A 1 181 ? 32.570  38.066  95.731  1.00 23.17 ? 181  ALA A CA  1 
ATOM   1425  C  C   . ALA A 1 181 ? 33.284  38.093  97.078  1.00 22.93 ? 181  ALA A C   1 
ATOM   1426  O  O   . ALA A 1 181 ? 32.680  38.408  98.104  1.00 25.38 ? 181  ALA A O   1 
ATOM   1427  C  CB  . ALA A 1 181 ? 31.960  36.696  95.486  1.00 22.42 ? 181  ALA A CB  1 
ATOM   1428  N  N   . GLY A 1 182 ? 34.569  37.755  97.070  1.00 22.82 ? 182  GLY A N   1 
ATOM   1429  C  CA  . GLY A 1 182 ? 35.340  37.742  98.299  1.00 21.67 ? 182  GLY A CA  1 
ATOM   1430  C  C   . GLY A 1 182 ? 36.751  37.234  98.088  1.00 23.07 ? 182  GLY A C   1 
ATOM   1431  O  O   . GLY A 1 182 ? 37.167  36.992  96.955  1.00 22.48 ? 182  GLY A O   1 
ATOM   1432  N  N   . LYS A 1 183 ? 37.476  37.043  99.186  1.00 25.36 ? 183  LYS A N   1 
ATOM   1433  C  CA  . LYS A 1 183 ? 38.856  36.571  99.132  1.00 28.04 ? 183  LYS A CA  1 
ATOM   1434  C  C   . LYS A 1 183 ? 39.147  35.666  100.329 1.00 28.96 ? 183  LYS A C   1 
ATOM   1435  O  O   . LYS A 1 183 ? 38.327  35.554  101.241 1.00 30.03 ? 183  LYS A O   1 
ATOM   1436  C  CB  . LYS A 1 183 ? 39.803  37.776  99.145  1.00 29.61 ? 183  LYS A CB  1 
ATOM   1437  C  CG  . LYS A 1 183 ? 41.228  37.476  98.712  1.00 33.01 ? 183  LYS A CG  1 
ATOM   1438  C  CD  . LYS A 1 183 ? 42.102  38.719  98.793  1.00 33.20 ? 183  LYS A CD  1 
ATOM   1439  C  CE  . LYS A 1 183 ? 42.342  39.138  100.231 1.00 31.57 ? 183  LYS A CE  1 
ATOM   1440  N  NZ  . LYS A 1 183 ? 43.072  38.087  100.988 1.00 33.10 ? 183  LYS A NZ  1 
ATOM   1441  N  N   . ASN A 1 184 ? 40.305  35.011  100.315 1.00 30.99 ? 184  ASN A N   1 
ATOM   1442  C  CA  . ASN A 1 184 ? 40.694  34.127  101.413 1.00 32.56 ? 184  ASN A CA  1 
ATOM   1443  C  C   . ASN A 1 184 ? 41.405  34.889  102.535 1.00 33.70 ? 184  ASN A C   1 
ATOM   1444  O  O   . ASN A 1 184 ? 41.627  36.097  102.433 1.00 35.66 ? 184  ASN A O   1 
ATOM   1445  C  CB  . ASN A 1 184 ? 41.563  32.968  100.903 1.00 31.26 ? 184  ASN A CB  1 
ATOM   1446  C  CG  . ASN A 1 184 ? 42.899  33.425  100.346 1.00 28.91 ? 184  ASN A CG  1 
ATOM   1447  O  OD1 . ASN A 1 184 ? 43.131  34.615  100.133 1.00 29.39 ? 184  ASN A OD1 1 
ATOM   1448  N  ND2 . ASN A 1 184 ? 43.787  32.468  100.104 1.00 27.21 ? 184  ASN A ND2 1 
ATOM   1449  N  N   . GLY A 1 185 ? 41.760  34.176  103.601 1.00 34.92 ? 185  GLY A N   1 
ATOM   1450  C  CA  . GLY A 1 185 ? 42.427  34.803  104.731 1.00 35.11 ? 185  GLY A CA  1 
ATOM   1451  C  C   . GLY A 1 185 ? 43.938  34.897  104.631 1.00 35.83 ? 185  GLY A C   1 
ATOM   1452  O  O   . GLY A 1 185 ? 44.639  34.693  105.624 1.00 37.68 ? 185  GLY A O   1 
ATOM   1453  N  N   . HIS A 1 186 ? 44.444  35.217  103.442 1.00 34.76 ? 186  HIS A N   1 
ATOM   1454  C  CA  . HIS A 1 186 ? 45.882  35.342  103.225 1.00 32.60 ? 186  HIS A CA  1 
ATOM   1455  C  C   . HIS A 1 186 ? 46.224  36.604  102.447 1.00 33.00 ? 186  HIS A C   1 
ATOM   1456  O  O   . HIS A 1 186 ? 45.528  36.968  101.498 1.00 33.86 ? 186  HIS A O   1 
ATOM   1457  C  CB  . HIS A 1 186 ? 46.423  34.116  102.488 1.00 31.48 ? 186  HIS A CB  1 
ATOM   1458  C  CG  . HIS A 1 186 ? 46.423  32.866  103.311 1.00 32.07 ? 186  HIS A CG  1 
ATOM   1459  N  ND1 . HIS A 1 186 ? 47.498  32.487  104.086 1.00 30.92 ? 186  HIS A ND1 1 
ATOM   1460  C  CD2 . HIS A 1 186 ? 45.481  31.909  103.481 1.00 33.09 ? 186  HIS A CD2 1 
ATOM   1461  C  CE1 . HIS A 1 186 ? 47.217  31.350  104.698 1.00 31.03 ? 186  HIS A CE1 1 
ATOM   1462  N  NE2 . HIS A 1 186 ? 46.000  30.978  104.348 1.00 32.25 ? 186  HIS A NE2 1 
ATOM   1463  N  N   . ALA A 1 187 ? 47.309  37.261  102.853 1.00 32.95 ? 187  ALA A N   1 
ATOM   1464  C  CA  . ALA A 1 187 ? 47.768  38.493  102.215 1.00 32.31 ? 187  ALA A CA  1 
ATOM   1465  C  C   . ALA A 1 187 ? 48.343  38.251  100.821 1.00 31.94 ? 187  ALA A C   1 
ATOM   1466  O  O   . ALA A 1 187 ? 48.997  37.237  100.572 1.00 31.43 ? 187  ALA A O   1 
ATOM   1467  C  CB  . ALA A 1 187 ? 48.797  39.188  103.095 1.00 32.33 ? 187  ALA A CB  1 
ATOM   1468  N  N   . TYR A 1 188 ? 48.105  39.205  99.925  1.00 31.20 ? 188  TYR A N   1 
ATOM   1469  C  CA  . TYR A 1 188 ? 48.578  39.126  98.548  1.00 31.09 ? 188  TYR A CA  1 
ATOM   1470  C  C   . TYR A 1 188 ? 50.091  39.292  98.423  1.00 31.68 ? 188  TYR A C   1 
ATOM   1471  O  O   . TYR A 1 188 ? 50.679  40.211  98.995  1.00 32.49 ? 188  TYR A O   1 
ATOM   1472  C  CB  . TYR A 1 188 ? 47.860  40.177  97.688  1.00 33.38 ? 188  TYR A CB  1 
ATOM   1473  C  CG  . TYR A 1 188 ? 48.354  40.269  96.258  1.00 35.26 ? 188  TYR A CG  1 
ATOM   1474  C  CD1 . TYR A 1 188 ? 47.957  39.336  95.297  1.00 36.24 ? 188  TYR A CD1 1 
ATOM   1475  C  CD2 . TYR A 1 188 ? 49.229  41.284  95.867  1.00 35.46 ? 188  TYR A CD2 1 
ATOM   1476  C  CE1 . TYR A 1 188 ? 48.422  39.411  93.984  1.00 35.71 ? 188  TYR A CE1 1 
ATOM   1477  C  CE2 . TYR A 1 188 ? 49.700  41.366  94.558  1.00 37.02 ? 188  TYR A CE2 1 
ATOM   1478  C  CZ  . TYR A 1 188 ? 49.293  40.428  93.622  1.00 36.86 ? 188  TYR A CZ  1 
ATOM   1479  O  OH  . TYR A 1 188 ? 49.767  40.505  92.330  1.00 37.19 ? 188  TYR A OH  1 
ATOM   1480  N  N   . ARG A 1 189 ? 50.710  38.380  97.679  1.00 31.63 ? 189  ARG A N   1 
ATOM   1481  C  CA  . ARG A 1 189 ? 52.147  38.413  97.433  1.00 32.30 ? 189  ARG A CA  1 
ATOM   1482  C  C   . ARG A 1 189 ? 52.417  38.653  95.951  1.00 33.89 ? 189  ARG A C   1 
ATOM   1483  O  O   . ARG A 1 189 ? 51.723  38.116  95.084  1.00 32.81 ? 189  ARG A O   1 
ATOM   1484  C  CB  . ARG A 1 189 ? 52.816  37.109  97.876  1.00 32.37 ? 189  ARG A CB  1 
ATOM   1485  C  CG  . ARG A 1 189 ? 53.280  37.097  99.325  1.00 33.07 ? 189  ARG A CG  1 
ATOM   1486  C  CD  . ARG A 1 189 ? 54.164  35.887  99.601  1.00 32.69 ? 189  ARG A CD  1 
ATOM   1487  N  NE  . ARG A 1 189 ? 54.761  35.916  100.934 1.00 32.22 ? 189  ARG A NE  1 
ATOM   1488  C  CZ  . ARG A 1 189 ? 54.130  35.569  102.053 1.00 32.15 ? 189  ARG A CZ  1 
ATOM   1489  N  NH1 . ARG A 1 189 ? 52.869  35.162  102.013 1.00 32.89 ? 189  ARG A NH1 1 
ATOM   1490  N  NH2 . ARG A 1 189 ? 54.764  35.625  103.216 1.00 33.50 ? 189  ARG A NH2 1 
ATOM   1491  N  N   . SER A 1 190 ? 53.434  39.461  95.672  1.00 35.66 ? 190  SER A N   1 
ATOM   1492  C  CA  . SER A 1 190 ? 53.813  39.794  94.305  1.00 37.58 ? 190  SER A CA  1 
ATOM   1493  C  C   . SER A 1 190 ? 54.517  38.634  93.599  1.00 39.43 ? 190  SER A C   1 
ATOM   1494  O  O   . SER A 1 190 ? 55.335  37.933  94.198  1.00 39.17 ? 190  SER A O   1 
ATOM   1495  C  CB  . SER A 1 190 ? 54.711  41.034  94.305  1.00 36.94 ? 190  SER A CB  1 
ATOM   1496  O  OG  . SER A 1 190 ? 55.036  41.438  92.988  1.00 37.86 ? 190  SER A OG  1 
ATOM   1497  N  N   . ILE A 1 191 ? 54.175  38.432  92.327  1.00 41.92 ? 191  ILE A N   1 
ATOM   1498  C  CA  . ILE A 1 191 ? 54.765  37.373  91.511  1.00 43.10 ? 191  ILE A CA  1 
ATOM   1499  C  C   . ILE A 1 191 ? 56.116  37.813  90.954  1.00 43.48 ? 191  ILE A C   1 
ATOM   1500  O  O   . ILE A 1 191 ? 57.047  37.012  90.861  1.00 44.03 ? 191  ILE A O   1 
ATOM   1501  C  CB  . ILE A 1 191 ? 53.816  36.961  90.358  1.00 42.99 ? 191  ILE A CB  1 
ATOM   1502  C  CG1 . ILE A 1 191 ? 52.591  36.246  90.929  1.00 42.68 ? 191  ILE A CG1 1 
ATOM   1503  C  CG2 . ILE A 1 191 ? 54.531  36.063  89.352  1.00 44.70 ? 191  ILE A CG2 1 
ATOM   1504  C  CD1 . ILE A 1 191 ? 52.921  35.008  91.750  1.00 39.44 ? 191  ILE A CD1 1 
ATOM   1505  N  N   . GLY A 1 192 ? 56.212  39.089  90.585  1.00 44.88 ? 192  GLY A N   1 
ATOM   1506  C  CA  . GLY A 1 192 ? 57.458  39.626  90.067  1.00 46.24 ? 192  GLY A CA  1 
ATOM   1507  C  C   . GLY A 1 192 ? 58.526  39.576  91.144  1.00 47.18 ? 192  GLY A C   1 
ATOM   1508  O  O   . GLY A 1 192 ? 59.718  39.518  90.849  1.00 48.49 ? 192  GLY A O   1 
ATOM   1509  N  N   . LYS A 1 193 ? 58.076  39.594  92.397  1.00 47.89 ? 193  LYS A N   1 
ATOM   1510  C  CA  . LYS A 1 193 ? 58.943  39.530  93.571  1.00 48.39 ? 193  LYS A CA  1 
ATOM   1511  C  C   . LYS A 1 193 ? 59.745  38.232  93.562  1.00 48.91 ? 193  LYS A C   1 
ATOM   1512  O  O   . LYS A 1 193 ? 60.961  38.238  93.762  1.00 49.49 ? 193  LYS A O   1 
ATOM   1513  C  CB  . LYS A 1 193 ? 58.085  39.597  94.840  1.00 48.30 ? 193  LYS A CB  1 
ATOM   1514  C  CG  . LYS A 1 193 ? 58.764  39.107  96.113  1.00 49.25 ? 193  LYS A CG  1 
ATOM   1515  C  CD  . LYS A 1 193 ? 57.775  39.039  97.267  1.00 48.71 ? 193  LYS A CD  1 
ATOM   1516  C  CE  . LYS A 1 193 ? 58.404  38.414  98.503  1.00 49.44 ? 193  LYS A CE  1 
ATOM   1517  N  NZ  . LYS A 1 193 ? 58.796  36.994  98.274  1.00 49.12 ? 193  LYS A NZ  1 
ATOM   1518  N  N   . VAL A 1 194 ? 59.048  37.126  93.316  1.00 48.96 ? 194  VAL A N   1 
ATOM   1519  C  CA  . VAL A 1 194 ? 59.653  35.799  93.276  1.00 49.09 ? 194  VAL A CA  1 
ATOM   1520  C  C   . VAL A 1 194 ? 60.583  35.647  92.072  1.00 50.52 ? 194  VAL A C   1 
ATOM   1521  O  O   . VAL A 1 194 ? 61.555  34.891  92.119  1.00 51.60 ? 194  VAL A O   1 
ATOM   1522  C  CB  . VAL A 1 194 ? 58.568  34.702  93.233  1.00 47.16 ? 194  VAL A CB  1 
ATOM   1523  C  CG1 . VAL A 1 194 ? 59.178  33.345  93.515  1.00 45.40 ? 194  VAL A CG1 1 
ATOM   1524  C  CG2 . VAL A 1 194 ? 57.469  35.012  94.236  1.00 45.76 ? 194  VAL A CG2 1 
ATOM   1525  N  N   . LEU A 1 195 ? 60.277  36.371  90.997  1.00 51.46 ? 195  LEU A N   1 
ATOM   1526  C  CA  . LEU A 1 195 ? 61.085  36.337  89.780  1.00 52.45 ? 195  LEU A CA  1 
ATOM   1527  C  C   . LEU A 1 195 ? 62.391  37.111  89.970  1.00 53.15 ? 195  LEU A C   1 
ATOM   1528  O  O   . LEU A 1 195 ? 63.338  36.951  89.198  1.00 52.59 ? 195  LEU A O   1 
ATOM   1529  C  CB  . LEU A 1 195 ? 60.292  36.911  88.603  1.00 52.29 ? 195  LEU A CB  1 
ATOM   1530  C  CG  . LEU A 1 195 ? 59.053  36.110  88.191  1.00 51.96 ? 195  LEU A CG  1 
ATOM   1531  C  CD1 . LEU A 1 195 ? 58.219  36.895  87.190  1.00 53.87 ? 195  LEU A CD1 1 
ATOM   1532  C  CD2 . LEU A 1 195 ? 59.473  34.771  87.613  1.00 51.56 ? 195  LEU A CD2 1 
ATOM   1533  N  N   . ILE A 1 196 ? 62.421  37.957  91.000  1.00 54.02 ? 196  ILE A N   1 
ATOM   1534  C  CA  . ILE A 1 196 ? 63.598  38.756  91.331  1.00 53.80 ? 196  ILE A CA  1 
ATOM   1535  C  C   . ILE A 1 196 ? 64.503  37.983  92.293  1.00 54.09 ? 196  ILE A C   1 
ATOM   1536  O  O   . ILE A 1 196 ? 65.728  38.082  92.212  1.00 55.06 ? 196  ILE A O   1 
ATOM   1537  C  CB  . ILE A 1 196 ? 63.198  40.118  91.965  1.00 53.31 ? 196  ILE A CB  1 
ATOM   1538  C  CG1 . ILE A 1 196 ? 62.443  40.973  90.943  1.00 53.28 ? 196  ILE A CG1 1 
ATOM   1539  C  CG2 . ILE A 1 196 ? 64.434  40.869  92.456  1.00 53.87 ? 196  ILE A CG2 1 
ATOM   1540  C  CD1 . ILE A 1 196 ? 61.980  42.315  91.479  1.00 52.77 ? 196  ILE A CD1 1 
ATOM   1541  N  N   . ASP A 1 197 ? 63.892  37.203  93.187  1.00 54.95 ? 197  ASP A N   1 
ATOM   1542  C  CA  . ASP A 1 197 ? 64.626  36.400  94.169  1.00 55.45 ? 197  ASP A CA  1 
ATOM   1543  C  C   . ASP A 1 197 ? 65.708  35.541  93.521  1.00 56.10 ? 197  ASP A C   1 
ATOM   1544  O  O   . ASP A 1 197 ? 66.897  35.728  93.785  1.00 55.98 ? 197  ASP A O   1 
ATOM   1545  C  CB  . ASP A 1 197 ? 63.666  35.510  94.968  1.00 55.63 ? 197  ASP A CB  1 
ATOM   1546  C  CG  . ASP A 1 197 ? 63.054  36.227  96.158  1.00 55.77 ? 197  ASP A CG  1 
ATOM   1547  O  OD1 . ASP A 1 197 ? 62.421  37.286  95.964  1.00 56.72 ? 197  ASP A OD1 1 
ATOM   1548  O  OD2 . ASP A 1 197 ? 63.209  35.726  97.292  1.00 54.83 ? 197  ASP A OD2 1 
ATOM   1549  N  N   . ARG A 1 198 ? 65.291  34.593  92.686  1.00 56.21 ? 198  ARG A N   1 
ATOM   1550  C  CA  . ARG A 1 198 ? 66.236  33.725  91.992  1.00 56.65 ? 198  ARG A CA  1 
ATOM   1551  C  C   . ARG A 1 198 ? 66.701  34.333  90.670  1.00 57.20 ? 198  ARG A C   1 
ATOM   1552  O  O   . ARG A 1 198 ? 67.587  33.787  90.008  1.00 58.14 ? 198  ARG A O   1 
ATOM   1553  C  CB  . ARG A 1 198 ? 65.659  32.318  91.772  1.00 56.11 ? 198  ARG A CB  1 
ATOM   1554  C  CG  . ARG A 1 198 ? 64.156  32.233  91.515  1.00 55.77 ? 198  ARG A CG  1 
ATOM   1555  C  CD  . ARG A 1 198 ? 63.377  32.161  92.824  1.00 55.69 ? 198  ARG A CD  1 
ATOM   1556  N  NE  . ARG A 1 198 ? 62.008  31.683  92.635  1.00 54.95 ? 198  ARG A NE  1 
ATOM   1557  C  CZ  . ARG A 1 198 ? 61.447  30.713  93.355  1.00 53.75 ? 198  ARG A CZ  1 
ATOM   1558  N  NH1 . ARG A 1 198 ? 62.136  30.112  94.317  1.00 53.69 ? 198  ARG A NH1 1 
ATOM   1559  N  NH2 . ARG A 1 198 ? 60.197  30.340  93.112  1.00 51.50 ? 198  ARG A NH2 1 
ATOM   1560  N  N   . GLY A 1 199 ? 66.112  35.472  90.307  1.00 57.10 ? 199  GLY A N   1 
ATOM   1561  C  CA  . GLY A 1 199 ? 66.471  36.159  89.075  1.00 56.24 ? 199  GLY A CA  1 
ATOM   1562  C  C   . GLY A 1 199 ? 66.190  35.355  87.821  1.00 55.87 ? 199  GLY A C   1 
ATOM   1563  O  O   . GLY A 1 199 ? 66.995  34.507  87.431  1.00 55.97 ? 199  GLY A O   1 
ATOM   1564  N  N   . GLU A 1 200 ? 65.062  35.634  87.173  1.00 55.70 ? 200  GLU A N   1 
ATOM   1565  C  CA  . GLU A 1 200 ? 64.687  34.916  85.959  1.00 55.43 ? 200  GLU A CA  1 
ATOM   1566  C  C   . GLU A 1 200 ? 64.281  35.850  84.818  1.00 55.29 ? 200  GLU A C   1 
ATOM   1567  O  O   . GLU A 1 200 ? 64.561  35.568  83.651  1.00 55.67 ? 200  GLU A O   1 
ATOM   1568  C  CB  . GLU A 1 200 ? 63.557  33.925  86.264  1.00 55.18 ? 200  GLU A CB  1 
ATOM   1569  C  CG  . GLU A 1 200 ? 63.228  32.954  85.129  1.00 54.54 ? 200  GLU A CG  1 
ATOM   1570  C  CD  . GLU A 1 200 ? 64.294  31.893  84.891  1.00 53.73 ? 200  GLU A CD  1 
ATOM   1571  O  OE1 . GLU A 1 200 ? 65.090  31.605  85.812  1.00 54.67 ? 200  GLU A OE1 1 
ATOM   1572  O  OE2 . GLU A 1 200 ? 64.323  31.332  83.776  1.00 52.75 ? 200  GLU A OE2 1 
ATOM   1573  N  N   . VAL A 1 201 ? 63.624  36.958  85.155  1.00 54.91 ? 201  VAL A N   1 
ATOM   1574  C  CA  . VAL A 1 201 ? 63.186  37.926  84.150  1.00 54.29 ? 201  VAL A CA  1 
ATOM   1575  C  C   . VAL A 1 201 ? 64.238  39.011  83.920  1.00 53.68 ? 201  VAL A C   1 
ATOM   1576  O  O   . VAL A 1 201 ? 64.614  39.734  84.843  1.00 53.68 ? 201  VAL A O   1 
ATOM   1577  C  CB  . VAL A 1 201 ? 61.837  38.584  84.544  1.00 54.18 ? 201  VAL A CB  1 
ATOM   1578  C  CG1 . VAL A 1 201 ? 61.414  39.607  83.494  1.00 53.44 ? 201  VAL A CG1 1 
ATOM   1579  C  CG2 . VAL A 1 201 ? 60.763  37.519  84.696  1.00 53.52 ? 201  VAL A CG2 1 
HETATM 1580  N  N   . MSE A 1 206 ? 59.577  44.167  82.710  1.00 69.90 ? 206  MSE A N   1 
HETATM 1581  C  CA  . MSE A 1 206 ? 58.720  43.287  83.495  1.00 71.05 ? 206  MSE A CA  1 
HETATM 1582  C  C   . MSE A 1 206 ? 57.330  43.896  83.642  1.00 70.87 ? 206  MSE A C   1 
HETATM 1583  O  O   . MSE A 1 206 ? 57.189  45.069  83.991  1.00 70.72 ? 206  MSE A O   1 
HETATM 1584  C  CB  . MSE A 1 206 ? 59.337  43.040  84.876  1.00 69.51 ? 206  MSE A CB  1 
HETATM 1585  C  CG  . MSE A 1 206 ? 58.682  41.924  85.691  1.00 70.44 ? 206  MSE A CG  1 
HETATM 1586  SE SE  . MSE A 1 206 ? 56.867  42.278  86.269  1.00 70.86 ? 206  MSE A SE  1 
HETATM 1587  C  CE  . MSE A 1 206 ? 57.250  43.481  87.730  1.00 70.24 ? 206  MSE A CE  1 
ATOM   1588  N  N   . SER A 1 207 ? 56.310  43.088  83.366  1.00 70.54 ? 207  SER A N   1 
ATOM   1589  C  CA  . SER A 1 207 ? 54.917  43.519  83.462  1.00 71.45 ? 207  SER A CA  1 
ATOM   1590  C  C   . SER A 1 207 ? 54.002  42.299  83.416  1.00 70.46 ? 207  SER A C   1 
ATOM   1591  O  O   . SER A 1 207 ? 54.462  41.166  83.559  1.00 70.61 ? 207  SER A O   1 
ATOM   1592  C  CB  . SER A 1 207 ? 54.576  44.461  82.303  1.00 72.75 ? 207  SER A CB  1 
ATOM   1593  O  OG  . SER A 1 207 ? 54.746  43.812  81.055  1.00 74.47 ? 207  SER A OG  1 
HETATM 1594  N  N   . MSE A 1 208 ? 52.707  42.535  83.216  1.00 69.55 ? 208  MSE A N   1 
HETATM 1595  C  CA  . MSE A 1 208 ? 51.731  41.452  83.130  1.00 69.26 ? 208  MSE A CA  1 
HETATM 1596  C  C   . MSE A 1 208 ? 51.912  40.702  81.807  1.00 67.42 ? 208  MSE A C   1 
HETATM 1597  O  O   . MSE A 1 208 ? 51.349  39.625  81.603  1.00 68.49 ? 208  MSE A O   1 
HETATM 1598  C  CB  . MSE A 1 208 ? 50.307  42.008  83.257  1.00 69.92 ? 208  MSE A CB  1 
HETATM 1599  C  CG  . MSE A 1 208 ? 49.197  40.961  83.211  1.00 71.15 ? 208  MSE A CG  1 
HETATM 1600  SE SE  . MSE A 1 208 ? 49.533  39.429  84.347  1.00 73.85 ? 208  MSE A SE  1 
HETATM 1601  C  CE  . MSE A 1 208 ? 49.202  40.232  86.071  1.00 73.01 ? 208  MSE A CE  1 
ATOM   1602  N  N   . GLN A 1 209 ? 52.721  41.279  80.922  1.00 65.36 ? 209  GLN A N   1 
ATOM   1603  C  CA  . GLN A 1 209 ? 53.010  40.688  79.621  1.00 62.25 ? 209  GLN A CA  1 
ATOM   1604  C  C   . GLN A 1 209 ? 54.274  39.833  79.725  1.00 60.40 ? 209  GLN A C   1 
ATOM   1605  O  O   . GLN A 1 209 ? 54.401  38.808  79.052  1.00 59.50 ? 209  GLN A O   1 
ATOM   1606  C  CB  . GLN A 1 209 ? 53.208  41.789  78.575  1.00 61.73 ? 209  GLN A CB  1 
ATOM   1607  C  CG  . GLN A 1 209 ? 53.219  41.299  77.132  1.00 61.63 ? 209  GLN A CG  1 
ATOM   1608  C  CD  . GLN A 1 209 ? 51.852  40.831  76.662  1.00 59.96 ? 209  GLN A CD  1 
ATOM   1609  O  OE1 . GLN A 1 209 ? 50.989  41.641  76.324  1.00 60.47 ? 209  GLN A OE1 1 
ATOM   1610  N  NE2 . GLN A 1 209 ? 51.651  39.518  76.635  1.00 59.97 ? 209  GLN A NE2 1 
ATOM   1611  N  N   . ALA A 1 210 ? 55.203  40.267  80.575  1.00 58.55 ? 210  ALA A N   1 
ATOM   1612  C  CA  . ALA A 1 210 ? 56.463  39.561  80.788  1.00 57.21 ? 210  ALA A CA  1 
ATOM   1613  C  C   . ALA A 1 210 ? 56.266  38.293  81.617  1.00 56.43 ? 210  ALA A C   1 
ATOM   1614  O  O   . ALA A 1 210 ? 57.016  37.326  81.475  1.00 55.19 ? 210  ALA A O   1 
ATOM   1615  C  CB  . ALA A 1 210 ? 57.470  40.480  81.462  1.00 56.99 ? 210  ALA A CB  1 
ATOM   1616  N  N   . ILE A 1 211 ? 55.263  38.317  82.493  1.00 55.75 ? 211  ILE A N   1 
ATOM   1617  C  CA  . ILE A 1 211 ? 54.943  37.175  83.347  1.00 55.90 ? 211  ILE A CA  1 
ATOM   1618  C  C   . ILE A 1 211 ? 54.219  36.105  82.528  1.00 55.31 ? 211  ILE A C   1 
ATOM   1619  O  O   . ILE A 1 211 ? 54.415  34.906  82.741  1.00 54.56 ? 211  ILE A O   1 
ATOM   1620  C  CB  . ILE A 1 211 ? 54.066  37.603  84.553  1.00 55.67 ? 211  ILE A CB  1 
ATOM   1621  C  CG1 . ILE A 1 211 ? 54.826  38.613  85.419  1.00 55.11 ? 211  ILE A CG1 1 
ATOM   1622  C  CG2 . ILE A 1 211 ? 53.672  36.387  85.388  1.00 55.10 ? 211  ILE A CG2 1 
ATOM   1623  C  CD1 . ILE A 1 211 ? 54.020  39.173  86.575  1.00 55.16 ? 211  ILE A CD1 1 
ATOM   1624  N  N   . ARG A 1 212 ? 53.396  36.552  81.583  1.00 55.13 ? 212  ARG A N   1 
ATOM   1625  C  CA  . ARG A 1 212 ? 52.650  35.652  80.711  1.00 55.92 ? 212  ARG A CA  1 
ATOM   1626  C  C   . ARG A 1 212 ? 53.609  34.869  79.812  1.00 55.18 ? 212  ARG A C   1 
ATOM   1627  O  O   . ARG A 1 212 ? 53.396  33.685  79.545  1.00 54.98 ? 212  ARG A O   1 
ATOM   1628  C  CB  . ARG A 1 212 ? 51.650  36.450  79.868  1.00 57.62 ? 212  ARG A CB  1 
ATOM   1629  C  CG  . ARG A 1 212 ? 50.934  35.641  78.797  1.00 61.07 ? 212  ARG A CG  1 
ATOM   1630  C  CD  . ARG A 1 212 ? 49.860  36.469  78.107  1.00 64.85 ? 212  ARG A CD  1 
ATOM   1631  N  NE  . ARG A 1 212 ? 48.694  36.688  78.962  1.00 66.93 ? 212  ARG A NE  1 
ATOM   1632  C  CZ  . ARG A 1 212 ? 47.708  35.808  79.124  1.00 69.24 ? 212  ARG A CZ  1 
ATOM   1633  N  NH1 . ARG A 1 212 ? 47.741  34.641  78.492  1.00 70.54 ? 212  ARG A NH1 1 
ATOM   1634  N  NH2 . ARG A 1 212 ? 46.681  36.099  79.910  1.00 69.16 ? 212  ARG A NH2 1 
ATOM   1635  N  N   . HIS A 1 213 ? 54.670  35.539  79.367  1.00 54.48 ? 213  HIS A N   1 
ATOM   1636  C  CA  . HIS A 1 213 ? 55.683  34.924  78.511  1.00 53.45 ? 213  HIS A CA  1 
ATOM   1637  C  C   . HIS A 1 213 ? 56.485  33.888  79.296  1.00 51.98 ? 213  HIS A C   1 
ATOM   1638  O  O   . HIS A 1 213 ? 56.854  32.842  78.762  1.00 51.33 ? 213  HIS A O   1 
ATOM   1639  C  CB  . HIS A 1 213 ? 56.624  35.994  77.949  1.00 55.32 ? 213  HIS A CB  1 
ATOM   1640  C  CG  . HIS A 1 213 ? 57.729  35.446  77.098  1.00 56.79 ? 213  HIS A CG  1 
ATOM   1641  N  ND1 . HIS A 1 213 ? 57.495  34.718  75.951  1.00 57.62 ? 213  HIS A ND1 1 
ATOM   1642  C  CD2 . HIS A 1 213 ? 59.075  35.518  77.230  1.00 57.27 ? 213  HIS A CD2 1 
ATOM   1643  C  CE1 . HIS A 1 213 ? 58.649  34.365  75.413  1.00 56.58 ? 213  HIS A CE1 1 
ATOM   1644  N  NE2 . HIS A 1 213 ? 59.623  34.838  76.169  1.00 57.19 ? 213  HIS A NE2 1 
ATOM   1645  N  N   . TRP A 1 214 ? 56.750  34.195  80.565  1.00 50.95 ? 214  TRP A N   1 
ATOM   1646  C  CA  . TRP A 1 214 ? 57.497  33.309  81.453  1.00 49.45 ? 214  TRP A CA  1 
ATOM   1647  C  C   . TRP A 1 214 ? 56.745  31.993  81.619  1.00 49.49 ? 214  TRP A C   1 
ATOM   1648  O  O   . TRP A 1 214 ? 57.343  30.917  81.573  1.00 48.76 ? 214  TRP A O   1 
ATOM   1649  C  CB  . TRP A 1 214 ? 57.678  33.975  82.823  1.00 50.08 ? 214  TRP A CB  1 
ATOM   1650  C  CG  . TRP A 1 214 ? 58.541  33.202  83.783  1.00 50.43 ? 214  TRP A CG  1 
ATOM   1651  C  CD1 . TRP A 1 214 ? 59.869  33.402  84.030  1.00 50.05 ? 214  TRP A CD1 1 
ATOM   1652  C  CD2 . TRP A 1 214 ? 58.137  32.111  84.625  1.00 49.95 ? 214  TRP A CD2 1 
ATOM   1653  N  NE1 . TRP A 1 214 ? 60.317  32.507  84.971  1.00 49.29 ? 214  TRP A NE1 1 
ATOM   1654  C  CE2 . TRP A 1 214 ? 59.277  31.703  85.353  1.00 49.77 ? 214  TRP A CE2 1 
ATOM   1655  C  CE3 . TRP A 1 214 ? 56.924  31.439  84.834  1.00 48.25 ? 214  TRP A CE3 1 
ATOM   1656  C  CZ2 . TRP A 1 214 ? 59.241  30.651  86.276  1.00 49.68 ? 214  TRP A CZ2 1 
ATOM   1657  C  CZ3 . TRP A 1 214 ? 56.889  30.393  85.750  1.00 48.91 ? 214  TRP A CZ3 1 
ATOM   1658  C  CH2 . TRP A 1 214 ? 58.042  30.010  86.459  1.00 50.55 ? 214  TRP A CH2 1 
ATOM   1659  N  N   . GLY A 1 215 ? 55.432  32.096  81.820  1.00 49.55 ? 215  GLY A N   1 
ATOM   1660  C  CA  . GLY A 1 215 ? 54.599  30.920  81.993  1.00 50.02 ? 215  GLY A CA  1 
ATOM   1661  C  C   . GLY A 1 215 ? 54.601  30.006  80.784  1.00 50.77 ? 215  GLY A C   1 
ATOM   1662  O  O   . GLY A 1 215 ? 54.529  28.784  80.923  1.00 52.28 ? 215  GLY A O   1 
ATOM   1663  N  N   . GLU A 1 216 ? 54.693  30.599  79.597  1.00 50.35 ? 216  GLU A N   1 
ATOM   1664  C  CA  . GLU A 1 216 ? 54.710  29.842  78.349  1.00 49.56 ? 216  GLU A CA  1 
ATOM   1665  C  C   . GLU A 1 216 ? 56.071  29.196  78.098  1.00 49.26 ? 216  GLU A C   1 
ATOM   1666  O  O   . GLU A 1 216 ? 56.165  28.180  77.408  1.00 50.11 ? 216  GLU A O   1 
ATOM   1667  C  CB  . GLU A 1 216 ? 54.335  30.755  77.181  1.00 49.53 ? 216  GLU A CB  1 
ATOM   1668  C  CG  . GLU A 1 216 ? 52.950  31.368  77.309  1.00 50.40 ? 216  GLU A CG  1 
ATOM   1669  C  CD  . GLU A 1 216 ? 52.657  32.394  76.235  1.00 51.37 ? 216  GLU A CD  1 
ATOM   1670  O  OE1 . GLU A 1 216 ? 53.381  33.410  76.167  1.00 51.21 ? 216  GLU A OE1 1 
ATOM   1671  O  OE2 . GLU A 1 216 ? 51.696  32.191  75.463  1.00 53.42 ? 216  GLU A OE2 1 
ATOM   1672  N  N   . THR A 1 217 ? 57.117  29.788  78.671  1.00 49.19 ? 217  THR A N   1 
ATOM   1673  C  CA  . THR A 1 217 ? 58.484  29.289  78.525  1.00 48.08 ? 217  THR A CA  1 
ATOM   1674  C  C   . THR A 1 217 ? 58.751  28.105  79.457  1.00 48.01 ? 217  THR A C   1 
ATOM   1675  O  O   . THR A 1 217 ? 59.487  27.180  79.106  1.00 47.22 ? 217  THR A O   1 
ATOM   1676  C  CB  . THR A 1 217 ? 59.518  30.403  78.827  1.00 47.38 ? 217  THR A CB  1 
ATOM   1677  O  OG1 . THR A 1 217 ? 59.265  31.535  77.988  1.00 47.07 ? 217  THR A OG1 1 
ATOM   1678  C  CG2 . THR A 1 217 ? 60.935  29.910  78.573  1.00 48.22 ? 217  THR A CG2 1 
ATOM   1679  N  N   . HIS A 1 218 ? 58.144  28.140  80.641  1.00 48.91 ? 218  HIS A N   1 
ATOM   1680  C  CA  . HIS A 1 218 ? 58.321  27.085  81.634  1.00 49.50 ? 218  HIS A CA  1 
ATOM   1681  C  C   . HIS A 1 218 ? 57.166  26.086  81.667  1.00 49.45 ? 218  HIS A C   1 
ATOM   1682  O  O   . HIS A 1 218 ? 56.094  26.341  81.117  1.00 50.20 ? 218  HIS A O   1 
ATOM   1683  C  CB  . HIS A 1 218 ? 58.538  27.704  83.017  1.00 50.25 ? 218  HIS A CB  1 
ATOM   1684  C  CG  . HIS A 1 218 ? 59.757  28.571  83.103  1.00 51.74 ? 218  HIS A CG  1 
ATOM   1685  N  ND1 . HIS A 1 218 ? 59.955  29.658  82.279  1.00 52.33 ? 218  HIS A ND1 1 
ATOM   1686  C  CD2 . HIS A 1 218 ? 60.846  28.502  83.903  1.00 52.80 ? 218  HIS A CD2 1 
ATOM   1687  C  CE1 . HIS A 1 218 ? 61.115  30.221  82.568  1.00 52.71 ? 218  HIS A CE1 1 
ATOM   1688  N  NE2 . HIS A 1 218 ? 61.676  29.540  83.551  1.00 52.43 ? 218  HIS A NE2 1 
ATOM   1689  N  N   . SER A 1 219 ? 57.399  24.947  82.316  1.00 49.64 ? 219  SER A N   1 
ATOM   1690  C  CA  . SER A 1 219 ? 56.401  23.884  82.423  1.00 50.42 ? 219  SER A CA  1 
ATOM   1691  C  C   . SER A 1 219 ? 55.309  24.163  83.451  1.00 50.78 ? 219  SER A C   1 
ATOM   1692  O  O   . SER A 1 219 ? 55.436  25.063  84.280  1.00 51.59 ? 219  SER A O   1 
ATOM   1693  C  CB  . SER A 1 219 ? 57.081  22.553  82.752  1.00 50.27 ? 219  SER A CB  1 
ATOM   1694  O  OG  . SER A 1 219 ? 57.694  22.597  84.030  1.00 51.00 ? 219  SER A OG  1 
ATOM   1695  N  N   . GLU A 1 220 ? 54.253  23.354  83.399  1.00 51.47 ? 220  GLU A N   1 
ATOM   1696  C  CA  . GLU A 1 220 ? 53.107  23.462  84.301  1.00 51.65 ? 220  GLU A CA  1 
ATOM   1697  C  C   . GLU A 1 220 ? 53.514  23.401  85.773  1.00 50.66 ? 220  GLU A C   1 
ATOM   1698  O  O   . GLU A 1 220 ? 53.017  24.174  86.593  1.00 49.71 ? 220  GLU A O   1 
ATOM   1699  C  CB  . GLU A 1 220 ? 52.103  22.346  83.993  1.00 53.59 ? 220  GLU A CB  1 
ATOM   1700  C  CG  . GLU A 1 220 ? 50.868  22.318  84.887  1.00 56.53 ? 220  GLU A CG  1 
ATOM   1701  C  CD  . GLU A 1 220 ? 50.014  23.567  84.763  1.00 58.03 ? 220  GLU A CD  1 
ATOM   1702  O  OE1 . GLU A 1 220 ? 49.806  24.045  83.626  1.00 58.51 ? 220  GLU A OE1 1 
ATOM   1703  O  OE2 . GLU A 1 220 ? 49.547  24.065  85.807  1.00 59.95 ? 220  GLU A OE2 1 
ATOM   1704  N  N   . ALA A 1 221 ? 54.420  22.480  86.096  1.00 50.01 ? 221  ALA A N   1 
ATOM   1705  C  CA  . ALA A 1 221 ? 54.905  22.307  87.463  1.00 49.35 ? 221  ALA A CA  1 
ATOM   1706  C  C   . ALA A 1 221 ? 55.665  23.538  87.945  1.00 49.21 ? 221  ALA A C   1 
ATOM   1707  O  O   . ALA A 1 221 ? 55.589  23.905  89.119  1.00 48.90 ? 221  ALA A O   1 
ATOM   1708  C  CB  . ALA A 1 221 ? 55.792  21.074  87.550  1.00 48.95 ? 221  ALA A CB  1 
ATOM   1709  N  N   . GLU A 1 222 ? 56.391  24.172  87.028  1.00 49.62 ? 222  GLU A N   1 
ATOM   1710  C  CA  . GLU A 1 222 ? 57.167  25.368  87.340  1.00 49.91 ? 222  GLU A CA  1 
ATOM   1711  C  C   . GLU A 1 222 ? 56.277  26.604  87.447  1.00 48.80 ? 222  GLU A C   1 
ATOM   1712  O  O   . GLU A 1 222 ? 56.580  27.532  88.200  1.00 48.40 ? 222  GLU A O   1 
ATOM   1713  C  CB  . GLU A 1 222 ? 58.253  25.585  86.284  1.00 52.09 ? 222  GLU A CB  1 
ATOM   1714  C  CG  . GLU A 1 222 ? 59.273  24.455  86.210  1.00 53.78 ? 222  GLU A CG  1 
ATOM   1715  C  CD  . GLU A 1 222 ? 60.355  24.705  85.178  1.00 54.67 ? 222  GLU A CD  1 
ATOM   1716  O  OE1 . GLU A 1 222 ? 60.127  24.396  83.989  1.00 55.40 ? 222  GLU A OE1 1 
ATOM   1717  O  OE2 . GLU A 1 222 ? 61.436  25.204  85.557  1.00 55.27 ? 222  GLU A OE2 1 
ATOM   1718  N  N   . VAL A 1 223 ? 55.185  26.612  86.686  1.00 47.15 ? 223  VAL A N   1 
ATOM   1719  C  CA  . VAL A 1 223 ? 54.236  27.723  86.700  1.00 45.64 ? 223  VAL A CA  1 
ATOM   1720  C  C   . VAL A 1 223 ? 53.408  27.673  87.981  1.00 45.16 ? 223  VAL A C   1 
ATOM   1721  O  O   . VAL A 1 223 ? 53.267  28.679  88.677  1.00 45.19 ? 223  VAL A O   1 
ATOM   1722  C  CB  . VAL A 1 223 ? 53.290  27.679  85.476  1.00 44.83 ? 223  VAL A CB  1 
ATOM   1723  C  CG1 . VAL A 1 223 ? 52.257  28.794  85.560  1.00 44.06 ? 223  VAL A CG1 1 
ATOM   1724  C  CG2 . VAL A 1 223 ? 54.090  27.812  84.194  1.00 45.50 ? 223  VAL A CG2 1 
ATOM   1725  N  N   . ARG A 1 224 ? 52.881  26.490  88.290  1.00 44.21 ? 224  ARG A N   1 
ATOM   1726  C  CA  . ARG A 1 224 ? 52.073  26.281  89.487  1.00 41.96 ? 224  ARG A CA  1 
ATOM   1727  C  C   . ARG A 1 224 ? 52.856  26.677  90.733  1.00 41.72 ? 224  ARG A C   1 
ATOM   1728  O  O   . ARG A 1 224 ? 52.343  27.390  91.592  1.00 42.95 ? 224  ARG A O   1 
ATOM   1729  C  CB  . ARG A 1 224 ? 51.640  24.815  89.583  1.00 41.52 ? 224  ARG A CB  1 
ATOM   1730  C  CG  . ARG A 1 224 ? 50.802  24.484  90.808  1.00 40.33 ? 224  ARG A CG  1 
ATOM   1731  C  CD  . ARG A 1 224 ? 50.378  23.026  90.806  1.00 40.66 ? 224  ARG A CD  1 
ATOM   1732  N  NE  . ARG A 1 224 ? 49.667  22.663  92.030  1.00 42.85 ? 224  ARG A NE  1 
ATOM   1733  C  CZ  . ARG A 1 224 ? 49.065  21.494  92.233  1.00 45.06 ? 224  ARG A CZ  1 
ATOM   1734  N  NH1 . ARG A 1 224 ? 49.079  20.560  91.291  1.00 46.25 ? 224  ARG A NH1 1 
ATOM   1735  N  NH2 . ARG A 1 224 ? 48.454  21.255  93.385  1.00 46.36 ? 224  ARG A NH2 1 
ATOM   1736  N  N   . GLU A 1 225 ? 54.111  26.238  90.799  1.00 41.61 ? 225  GLU A N   1 
ATOM   1737  C  CA  . GLU A 1 225 ? 54.995  26.538  91.925  1.00 41.18 ? 225  GLU A CA  1 
ATOM   1738  C  C   . GLU A 1 225 ? 55.131  28.046  92.135  1.00 38.52 ? 225  GLU A C   1 
ATOM   1739  O  O   . GLU A 1 225 ? 55.091  28.527  93.268  1.00 38.16 ? 225  GLU A O   1 
ATOM   1740  C  CB  . GLU A 1 225 ? 56.372  25.900  91.687  1.00 43.83 ? 225  GLU A CB  1 
ATOM   1741  C  CG  . GLU A 1 225 ? 57.395  26.074  92.816  1.00 46.75 ? 225  GLU A CG  1 
ATOM   1742  C  CD  . GLU A 1 225 ? 58.104  27.424  92.794  1.00 48.41 ? 225  GLU A CD  1 
ATOM   1743  O  OE1 . GLU A 1 225 ? 58.503  27.880  91.701  1.00 49.06 ? 225  GLU A OE1 1 
ATOM   1744  O  OE2 . GLU A 1 225 ? 58.263  28.028  93.876  1.00 50.74 ? 225  GLU A OE2 1 
ATOM   1745  N  N   . LEU A 1 226 ? 55.287  28.783  91.038  1.00 35.95 ? 226  LEU A N   1 
ATOM   1746  C  CA  . LEU A 1 226 ? 55.427  30.235  91.095  1.00 33.30 ? 226  LEU A CA  1 
ATOM   1747  C  C   . LEU A 1 226 ? 54.132  30.915  91.529  1.00 31.04 ? 226  LEU A C   1 
ATOM   1748  O  O   . LEU A 1 226 ? 54.152  31.840  92.341  1.00 30.97 ? 226  LEU A O   1 
ATOM   1749  C  CB  . LEU A 1 226 ? 55.856  30.787  89.732  1.00 32.95 ? 226  LEU A CB  1 
ATOM   1750  C  CG  . LEU A 1 226 ? 56.008  32.309  89.652  1.00 31.36 ? 226  LEU A CG  1 
ATOM   1751  C  CD1 . LEU A 1 226 ? 57.198  32.756  90.477  1.00 31.38 ? 226  LEU A CD1 1 
ATOM   1752  C  CD2 . LEU A 1 226 ? 56.170  32.744  88.209  1.00 32.30 ? 226  LEU A CD2 1 
ATOM   1753  N  N   . LEU A 1 227 ? 53.012  30.460  90.976  1.00 28.65 ? 227  LEU A N   1 
ATOM   1754  C  CA  . LEU A 1 227 ? 51.713  31.033  91.303  1.00 26.61 ? 227  LEU A CA  1 
ATOM   1755  C  C   . LEU A 1 227 ? 51.308  30.763  92.752  1.00 26.52 ? 227  LEU A C   1 
ATOM   1756  O  O   . LEU A 1 227 ? 50.551  31.534  93.343  1.00 26.30 ? 227  LEU A O   1 
ATOM   1757  C  CB  . LEU A 1 227 ? 50.642  30.522  90.335  1.00 22.90 ? 227  LEU A CB  1 
ATOM   1758  C  CG  . LEU A 1 227 ? 50.881  30.811  88.848  1.00 18.64 ? 227  LEU A CG  1 
ATOM   1759  C  CD1 . LEU A 1 227 ? 49.672  30.374  88.040  1.00 18.26 ? 227  LEU A CD1 1 
ATOM   1760  C  CD2 . LEU A 1 227 ? 51.159  32.289  88.629  1.00 17.06 ? 227  LEU A CD2 1 
ATOM   1761  N  N   . GLU A 1 228 ? 51.835  29.682  93.323  1.00 27.26 ? 228  GLU A N   1 
ATOM   1762  C  CA  . GLU A 1 228 ? 51.544  29.319  94.707  1.00 27.68 ? 228  GLU A CA  1 
ATOM   1763  C  C   . GLU A 1 228 ? 52.268  30.236  95.686  1.00 28.03 ? 228  GLU A C   1 
ATOM   1764  O  O   . GLU A 1 228 ? 52.020  30.189  96.892  1.00 28.43 ? 228  GLU A O   1 
ATOM   1765  C  CB  . GLU A 1 228 ? 51.929  27.865  94.980  1.00 28.12 ? 228  GLU A CB  1 
ATOM   1766  C  CG  . GLU A 1 228 ? 51.033  26.849  94.291  1.00 30.28 ? 228  GLU A CG  1 
ATOM   1767  C  CD  . GLU A 1 228 ? 51.405  25.414  94.612  1.00 30.99 ? 228  GLU A CD  1 
ATOM   1768  O  OE1 . GLU A 1 228 ? 52.607  25.130  94.811  1.00 33.17 ? 228  GLU A OE1 1 
ATOM   1769  O  OE2 . GLU A 1 228 ? 50.491  24.565  94.661  1.00 35.28 ? 228  GLU A OE2 1 
ATOM   1770  N  N   . GLN A 1 229 ? 53.169  31.062  95.159  1.00 30.14 ? 229  GLN A N   1 
ATOM   1771  C  CA  . GLN A 1 229 ? 53.925  32.006  95.976  1.00 32.47 ? 229  GLN A CA  1 
ATOM   1772  C  C   . GLN A 1 229 ? 53.021  33.142  96.443  1.00 31.86 ? 229  GLN A C   1 
ATOM   1773  O  O   . GLN A 1 229 ? 53.410  33.962  97.273  1.00 31.63 ? 229  GLN A O   1 
ATOM   1774  C  CB  . GLN A 1 229 ? 55.122  32.554  95.198  1.00 34.05 ? 229  GLN A CB  1 
ATOM   1775  C  CG  . GLN A 1 229 ? 56.114  31.484  94.752  1.00 36.58 ? 229  GLN A CG  1 
ATOM   1776  C  CD  . GLN A 1 229 ? 56.624  30.636  95.903  1.00 38.66 ? 229  GLN A CD  1 
ATOM   1777  O  OE1 . GLN A 1 229 ? 57.291  31.134  96.811  1.00 39.75 ? 229  GLN A OE1 1 
ATOM   1778  N  NE2 . GLN A 1 229 ? 56.306  29.346  95.871  1.00 39.07 ? 229  GLN A NE2 1 
ATOM   1779  N  N   . ASN A 1 230 ? 51.821  33.191  95.871  1.00 32.15 ? 230  ASN A N   1 
ATOM   1780  C  CA  . ASN A 1 230 ? 50.810  34.179  96.221  1.00 30.75 ? 230  ASN A CA  1 
ATOM   1781  C  C   . ASN A 1 230 ? 49.727  33.389  96.955  1.00 31.38 ? 230  ASN A C   1 
ATOM   1782  O  O   . ASN A 1 230 ? 48.879  32.755  96.330  1.00 31.28 ? 230  ASN A O   1 
ATOM   1783  C  CB  . ASN A 1 230 ? 50.239  34.828  94.955  1.00 30.01 ? 230  ASN A CB  1 
ATOM   1784  C  CG  . ASN A 1 230 ? 49.124  35.818  95.252  1.00 29.06 ? 230  ASN A CG  1 
ATOM   1785  O  OD1 . ASN A 1 230 ? 49.116  36.472  96.294  1.00 31.11 ? 230  ASN A OD1 1 
ATOM   1786  N  ND2 . ASN A 1 230 ? 48.174  35.931  94.332  1.00 25.37 ? 230  ASN A ND2 1 
ATOM   1787  N  N   . PRO A 1 231 ? 49.770  33.389  98.298  1.00 32.45 ? 231  PRO A N   1 
ATOM   1788  C  CA  . PRO A 1 231 ? 48.804  32.673  99.139  1.00 33.01 ? 231  PRO A CA  1 
ATOM   1789  C  C   . PRO A 1 231 ? 47.365  33.182  99.050  1.00 33.21 ? 231  PRO A C   1 
ATOM   1790  O  O   . PRO A 1 231 ? 46.439  32.506  99.499  1.00 34.12 ? 231  PRO A O   1 
ATOM   1791  C  CB  . PRO A 1 231 ? 49.381  32.856  100.543 1.00 33.27 ? 231  PRO A CB  1 
ATOM   1792  C  CG  . PRO A 1 231 ? 50.025  34.198  100.461 1.00 32.94 ? 231  PRO A CG  1 
ATOM   1793  C  CD  . PRO A 1 231 ? 50.738  34.122  99.133  1.00 33.41 ? 231  PRO A CD  1 
ATOM   1794  N  N   . SER A 1 232 ? 47.184  34.365  98.469  1.00 32.56 ? 232  SER A N   1 
ATOM   1795  C  CA  . SER A 1 232 ? 45.858  34.958  98.326  1.00 31.82 ? 232  SER A CA  1 
ATOM   1796  C  C   . SER A 1 232 ? 45.072  34.306  97.187  1.00 30.64 ? 232  SER A C   1 
ATOM   1797  O  O   . SER A 1 232 ? 45.637  33.967  96.147  1.00 30.94 ? 232  SER A O   1 
ATOM   1798  C  CB  . SER A 1 232 ? 45.978  36.464  98.092  1.00 33.03 ? 232  SER A CB  1 
ATOM   1799  O  OG  . SER A 1 232 ? 44.710  37.090  98.150  1.00 38.50 ? 232  SER A OG  1 
ATOM   1800  N  N   . PHE A 1 233 ? 43.767  34.148  97.393  1.00 29.25 ? 233  PHE A N   1 
ATOM   1801  C  CA  . PHE A 1 233 ? 42.882  33.531  96.405  1.00 26.48 ? 233  PHE A CA  1 
ATOM   1802  C  C   . PHE A 1 233 ? 41.524  34.240  96.414  1.00 25.16 ? 233  PHE A C   1 
ATOM   1803  O  O   . PHE A 1 233 ? 40.920  34.427  97.471  1.00 25.33 ? 233  PHE A O   1 
ATOM   1804  C  CB  . PHE A 1 233 ? 42.702  32.044  96.735  1.00 24.02 ? 233  PHE A CB  1 
ATOM   1805  C  CG  . PHE A 1 233 ? 42.078  31.240  95.627  1.00 21.73 ? 233  PHE A CG  1 
ATOM   1806  C  CD1 . PHE A 1 233 ? 42.873  30.651  94.649  1.00 19.44 ? 233  PHE A CD1 1 
ATOM   1807  C  CD2 . PHE A 1 233 ? 40.701  31.048  95.575  1.00 18.62 ? 233  PHE A CD2 1 
ATOM   1808  C  CE1 . PHE A 1 233 ? 42.307  29.882  93.637  1.00 19.35 ? 233  PHE A CE1 1 
ATOM   1809  C  CE2 . PHE A 1 233 ? 40.126  30.280  94.568  1.00 18.80 ? 233  PHE A CE2 1 
ATOM   1810  C  CZ  . PHE A 1 233 ? 40.931  29.695  93.597  1.00 19.10 ? 233  PHE A CZ  1 
ATOM   1811  N  N   . VAL A 1 234 ? 41.049  34.622  95.232  1.00 23.84 ? 234  VAL A N   1 
ATOM   1812  C  CA  . VAL A 1 234 ? 39.772  35.319  95.094  1.00 20.79 ? 234  VAL A CA  1 
ATOM   1813  C  C   . VAL A 1 234 ? 38.617  34.407  94.679  1.00 20.53 ? 234  VAL A C   1 
ATOM   1814  O  O   . VAL A 1 234 ? 38.780  33.510  93.850  1.00 18.64 ? 234  VAL A O   1 
ATOM   1815  C  CB  . VAL A 1 234 ? 39.889  36.499  94.090  1.00 19.88 ? 234  VAL A CB  1 
ATOM   1816  C  CG1 . VAL A 1 234 ? 38.528  37.130  93.826  1.00 20.41 ? 234  VAL A CG1 1 
ATOM   1817  C  CG2 . VAL A 1 234 ? 40.851  37.544  94.627  1.00 17.61 ? 234  VAL A CG2 1 
ATOM   1818  N  N   . PHE A 1 235 ? 37.454  34.647  95.282  1.00 22.12 ? 235  PHE A N   1 
ATOM   1819  C  CA  . PHE A 1 235 ? 36.236  33.893  95.001  1.00 22.11 ? 235  PHE A CA  1 
ATOM   1820  C  C   . PHE A 1 235 ? 35.288  34.785  94.209  1.00 22.46 ? 235  PHE A C   1 
ATOM   1821  O  O   . PHE A 1 235 ? 35.177  35.980  94.487  1.00 24.98 ? 235  PHE A O   1 
ATOM   1822  C  CB  . PHE A 1 235 ? 35.589  33.439  96.308  1.00 19.62 ? 235  PHE A CB  1 
ATOM   1823  C  CG  . PHE A 1 235 ? 36.486  32.584  97.150  1.00 18.89 ? 235  PHE A CG  1 
ATOM   1824  C  CD1 . PHE A 1 235 ? 36.826  31.299  96.739  1.00 18.86 ? 235  PHE A CD1 1 
ATOM   1825  C  CD2 . PHE A 1 235 ? 37.025  33.074  98.334  1.00 19.95 ? 235  PHE A CD2 1 
ATOM   1826  C  CE1 . PHE A 1 235 ? 37.692  30.514  97.493  1.00 18.24 ? 235  PHE A CE1 1 
ATOM   1827  C  CE2 . PHE A 1 235 ? 37.893  32.297  99.097  1.00 19.96 ? 235  PHE A CE2 1 
ATOM   1828  C  CZ  . PHE A 1 235 ? 38.228  31.015  98.676  1.00 18.82 ? 235  PHE A CZ  1 
ATOM   1829  N  N   . PHE A 1 236 ? 34.602  34.203  93.230  1.00 24.20 ? 236  PHE A N   1 
ATOM   1830  C  CA  . PHE A 1 236 ? 33.700  34.966  92.371  1.00 24.44 ? 236  PHE A CA  1 
ATOM   1831  C  C   . PHE A 1 236 ? 32.218  34.631  92.504  1.00 24.76 ? 236  PHE A C   1 
ATOM   1832  O  O   . PHE A 1 236 ? 31.840  33.644  93.133  1.00 26.57 ? 236  PHE A O   1 
ATOM   1833  C  CB  . PHE A 1 236 ? 34.127  34.803  90.909  1.00 22.56 ? 236  PHE A CB  1 
ATOM   1834  C  CG  . PHE A 1 236 ? 35.587  35.074  90.669  1.00 21.59 ? 236  PHE A CG  1 
ATOM   1835  C  CD1 . PHE A 1 236 ? 36.048  36.373  90.490  1.00 21.32 ? 236  PHE A CD1 1 
ATOM   1836  C  CD2 . PHE A 1 236 ? 36.504  34.027  90.637  1.00 21.26 ? 236  PHE A CD2 1 
ATOM   1837  C  CE1 . PHE A 1 236 ? 37.403  36.627  90.284  1.00 21.80 ? 236  PHE A CE1 1 
ATOM   1838  C  CE2 . PHE A 1 236 ? 37.860  34.272  90.432  1.00 21.33 ? 236  PHE A CE2 1 
ATOM   1839  C  CZ  . PHE A 1 236 ? 38.310  35.573  90.255  1.00 19.50 ? 236  PHE A CZ  1 
ATOM   1840  N  N   . LYS A 1 237 ? 31.385  35.483  91.910  1.00 25.57 ? 237  LYS A N   1 
ATOM   1841  C  CA  . LYS A 1 237 ? 29.937  35.301  91.917  1.00 25.80 ? 237  LYS A CA  1 
ATOM   1842  C  C   . LYS A 1 237 ? 29.380  35.611  90.531  1.00 26.08 ? 237  LYS A C   1 
ATOM   1843  O  O   . LYS A 1 237 ? 29.442  36.751  90.067  1.00 27.12 ? 237  LYS A O   1 
ATOM   1844  C  CB  . LYS A 1 237 ? 29.267  36.207  92.955  1.00 26.34 ? 237  LYS A CB  1 
ATOM   1845  C  CG  . LYS A 1 237 ? 27.753  36.045  93.007  1.00 24.60 ? 237  LYS A CG  1 
ATOM   1846  C  CD  . LYS A 1 237 ? 27.111  36.945  94.047  1.00 27.96 ? 237  LYS A CD  1 
ATOM   1847  C  CE  . LYS A 1 237 ? 25.604  36.737  94.087  1.00 26.75 ? 237  LYS A CE  1 
ATOM   1848  N  NZ  . LYS A 1 237 ? 24.951  37.602  95.103  1.00 31.14 ? 237  LYS A NZ  1 
ATOM   1849  N  N   . PRO A 1 238 ? 28.838  34.590  89.849  1.00 27.14 ? 238  PRO A N   1 
ATOM   1850  C  CA  . PRO A 1 238 ? 28.259  34.711  88.507  1.00 27.69 ? 238  PRO A CA  1 
ATOM   1851  C  C   . PRO A 1 238 ? 27.088  35.688  88.459  1.00 28.60 ? 238  PRO A C   1 
ATOM   1852  O  O   . PRO A 1 238 ? 26.111  35.534  89.195  1.00 30.65 ? 238  PRO A O   1 
ATOM   1853  C  CB  . PRO A 1 238 ? 27.786  33.287  88.213  1.00 27.56 ? 238  PRO A CB  1 
ATOM   1854  C  CG  . PRO A 1 238 ? 28.729  32.446  89.000  1.00 27.84 ? 238  PRO A CG  1 
ATOM   1855  C  CD  . PRO A 1 238 ? 28.803  33.189  90.301  1.00 27.15 ? 238  PRO A CD  1 
ATOM   1856  N  N   . GLN A 1 239 ? 27.207  36.707  87.612  1.00 28.65 ? 239  GLN A N   1 
ATOM   1857  C  CA  . GLN A 1 239 ? 26.150  37.699  87.459  1.00 27.64 ? 239  GLN A CA  1 
ATOM   1858  C  C   . GLN A 1 239 ? 25.308  37.377  86.235  1.00 28.34 ? 239  GLN A C   1 
ATOM   1859  O  O   . GLN A 1 239 ? 24.339  38.074  85.935  1.00 30.87 ? 239  GLN A O   1 
ATOM   1860  C  CB  . GLN A 1 239 ? 26.729  39.111  87.352  1.00 25.47 ? 239  GLN A CB  1 
ATOM   1861  C  CG  . GLN A 1 239 ? 27.437  39.593  88.612  1.00 24.65 ? 239  GLN A CG  1 
ATOM   1862  C  CD  . GLN A 1 239 ? 26.564  39.518  89.858  1.00 25.57 ? 239  GLN A CD  1 
ATOM   1863  O  OE1 . GLN A 1 239 ? 25.362  39.784  89.812  1.00 24.91 ? 239  GLN A OE1 1 
ATOM   1864  N  NE2 . GLN A 1 239 ? 27.172  39.154  90.980  1.00 22.52 ? 239  GLN A NE2 1 
ATOM   1865  N  N   . SER A 1 240 ? 25.706  36.322  85.529  1.00 28.85 ? 240  SER A N   1 
ATOM   1866  C  CA  . SER A 1 240 ? 25.003  35.853  84.344  1.00 30.15 ? 240  SER A CA  1 
ATOM   1867  C  C   . SER A 1 240 ? 24.797  36.948  83.297  1.00 30.73 ? 240  SER A C   1 
ATOM   1868  O  O   . SER A 1 240 ? 23.710  37.511  83.178  1.00 35.21 ? 240  SER A O   1 
ATOM   1869  C  CB  . SER A 1 240 ? 23.666  35.236  84.764  1.00 30.01 ? 240  SER A CB  1 
ATOM   1870  O  OG  . SER A 1 240 ? 22.996  34.649  83.668  1.00 36.08 ? 240  SER A OG  1 
ATOM   1871  N  N   . PHE A 1 241 ? 25.854  37.242  82.548  1.00 29.00 ? 241  PHE A N   1 
ATOM   1872  C  CA  . PHE A 1 241 ? 25.832  38.262  81.501  1.00 29.20 ? 241  PHE A CA  1 
ATOM   1873  C  C   . PHE A 1 241 ? 25.370  39.639  81.974  1.00 29.38 ? 241  PHE A C   1 
ATOM   1874  O  O   . PHE A 1 241 ? 24.366  40.176  81.500  1.00 27.41 ? 241  PHE A O   1 
ATOM   1875  C  CB  . PHE A 1 241 ? 24.995  37.809  80.299  1.00 27.28 ? 241  PHE A CB  1 
ATOM   1876  C  CG  . PHE A 1 241 ? 25.251  38.613  79.053  1.00 27.03 ? 241  PHE A CG  1 
ATOM   1877  C  CD1 . PHE A 1 241 ? 26.543  38.750  78.558  1.00 27.64 ? 241  PHE A CD1 1 
ATOM   1878  C  CD2 . PHE A 1 241 ? 24.209  39.241  78.381  1.00 28.86 ? 241  PHE A CD2 1 
ATOM   1879  C  CE1 . PHE A 1 241 ? 26.797  39.500  77.416  1.00 26.95 ? 241  PHE A CE1 1 
ATOM   1880  C  CE2 . PHE A 1 241 ? 24.453  39.996  77.234  1.00 26.96 ? 241  PHE A CE2 1 
ATOM   1881  C  CZ  . PHE A 1 241 ? 25.750  40.124  76.753  1.00 27.91 ? 241  PHE A CZ  1 
ATOM   1882  N  N   . ALA A 1 242 ? 26.115  40.199  82.919  1.00 30.04 ? 242  ALA A N   1 
ATOM   1883  C  CA  . ALA A 1 242 ? 25.824  41.519  83.460  1.00 28.71 ? 242  ALA A CA  1 
ATOM   1884  C  C   . ALA A 1 242 ? 27.021  42.409  83.150  1.00 29.31 ? 242  ALA A C   1 
ATOM   1885  O  O   . ALA A 1 242 ? 28.140  41.916  82.998  1.00 31.75 ? 242  ALA A O   1 
ATOM   1886  C  CB  . ALA A 1 242 ? 25.603  41.432  84.961  1.00 27.91 ? 242  ALA A CB  1 
ATOM   1887  N  N   . PRO A 1 243 ? 26.803  43.730  83.031  1.00 28.21 ? 243  PRO A N   1 
ATOM   1888  C  CA  . PRO A 1 243 ? 27.907  44.648  82.735  1.00 26.40 ? 243  PRO A CA  1 
ATOM   1889  C  C   . PRO A 1 243 ? 28.971  44.632  83.832  1.00 24.89 ? 243  PRO A C   1 
ATOM   1890  O  O   . PRO A 1 243 ? 28.675  44.335  84.991  1.00 25.37 ? 243  PRO A O   1 
ATOM   1891  C  CB  . PRO A 1 243 ? 27.204  46.002  82.637  1.00 25.66 ? 243  PRO A CB  1 
ATOM   1892  C  CG  . PRO A 1 243 ? 26.030  45.846  83.553  1.00 25.83 ? 243  PRO A CG  1 
ATOM   1893  C  CD  . PRO A 1 243 ? 25.541  44.471  83.196  1.00 27.55 ? 243  PRO A CD  1 
ATOM   1894  N  N   . VAL A 1 244 ? 30.214  44.916  83.452  1.00 24.52 ? 244  VAL A N   1 
ATOM   1895  C  CA  . VAL A 1 244 ? 31.320  44.932  84.402  1.00 23.54 ? 244  VAL A CA  1 
ATOM   1896  C  C   . VAL A 1 244 ? 31.128  46.042  85.424  1.00 22.51 ? 244  VAL A C   1 
ATOM   1897  O  O   . VAL A 1 244 ? 31.131  47.219  85.080  1.00 24.12 ? 244  VAL A O   1 
ATOM   1898  C  CB  . VAL A 1 244 ? 32.676  45.133  83.696  1.00 23.64 ? 244  VAL A CB  1 
ATOM   1899  C  CG1 . VAL A 1 244 ? 33.807  45.150  84.720  1.00 22.72 ? 244  VAL A CG1 1 
ATOM   1900  C  CG2 . VAL A 1 244 ? 32.903  44.037  82.679  1.00 20.52 ? 244  VAL A CG2 1 
ATOM   1901  N  N   . LYS A 1 245 ? 30.946  45.652  86.680  1.00 22.64 ? 245  LYS A N   1 
ATOM   1902  C  CA  . LYS A 1 245 ? 30.752  46.606  87.761  1.00 22.96 ? 245  LYS A CA  1 
ATOM   1903  C  C   . LYS A 1 245 ? 31.880  46.500  88.779  1.00 24.78 ? 245  LYS A C   1 
ATOM   1904  O  O   . LYS A 1 245 ? 32.457  45.428  88.972  1.00 26.16 ? 245  LYS A O   1 
ATOM   1905  C  CB  . LYS A 1 245 ? 29.404  46.368  88.448  1.00 23.11 ? 245  LYS A CB  1 
ATOM   1906  C  CG  . LYS A 1 245 ? 28.201  46.536  87.536  1.00 20.96 ? 245  LYS A CG  1 
ATOM   1907  C  CD  . LYS A 1 245 ? 26.900  46.312  88.284  1.00 21.51 ? 245  LYS A CD  1 
ATOM   1908  C  CE  . LYS A 1 245 ? 25.707  46.509  87.367  1.00 23.05 ? 245  LYS A CE  1 
ATOM   1909  N  NZ  . LYS A 1 245 ? 24.421  46.361  88.092  1.00 26.77 ? 245  LYS A NZ  1 
ATOM   1910  N  N   . GLY A 1 246 ? 32.199  47.624  89.413  1.00 26.33 ? 246  GLY A N   1 
ATOM   1911  C  CA  . GLY A 1 246 ? 33.252  47.644  90.411  1.00 25.66 ? 246  GLY A CA  1 
ATOM   1912  C  C   . GLY A 1 246 ? 32.690  47.736  91.816  1.00 27.06 ? 246  GLY A C   1 
ATOM   1913  O  O   . GLY A 1 246 ? 31.631  47.176  92.106  1.00 27.22 ? 246  GLY A O   1 
ATOM   1914  N  N   . ALA A 1 247 ? 33.393  48.460  92.683  1.00 27.94 ? 247  ALA A N   1 
ATOM   1915  C  CA  . ALA A 1 247 ? 32.977  48.636  94.071  1.00 28.81 ? 247  ALA A CA  1 
ATOM   1916  C  C   . ALA A 1 247 ? 31.717  49.489  94.210  1.00 31.02 ? 247  ALA A C   1 
ATOM   1917  O  O   . ALA A 1 247 ? 30.900  49.256  95.104  1.00 33.21 ? 247  ALA A O   1 
ATOM   1918  C  CB  . ALA A 1 247 ? 34.109  49.242  94.880  1.00 26.64 ? 247  ALA A CB  1 
ATOM   1919  N  N   . SER A 1 248 ? 31.563  50.469  93.322  1.00 31.64 ? 248  SER A N   1 
ATOM   1920  C  CA  . SER A 1 248 ? 30.407  51.365  93.339  1.00 30.67 ? 248  SER A CA  1 
ATOM   1921  C  C   . SER A 1 248 ? 29.150  50.741  92.736  1.00 30.19 ? 248  SER A C   1 
ATOM   1922  O  O   . SER A 1 248 ? 28.091  51.369  92.721  1.00 31.09 ? 248  SER A O   1 
ATOM   1923  C  CB  . SER A 1 248 ? 30.732  52.667  92.604  1.00 30.61 ? 248  SER A CB  1 
ATOM   1924  O  OG  . SER A 1 248 ? 31.802  53.354  93.228  1.00 31.60 ? 248  SER A OG  1 
ATOM   1925  N  N   . ALA A 1 249 ? 29.277  49.511  92.241  1.00 30.33 ? 249  ALA A N   1 
ATOM   1926  C  CA  . ALA A 1 249 ? 28.166  48.780  91.628  1.00 29.21 ? 249  ALA A CA  1 
ATOM   1927  C  C   . ALA A 1 249 ? 27.617  49.487  90.388  1.00 27.87 ? 249  ALA A C   1 
ATOM   1928  O  O   . ALA A 1 249 ? 26.422  49.414  90.093  1.00 26.44 ? 249  ALA A O   1 
ATOM   1929  C  CB  . ALA A 1 249 ? 27.052  48.544  92.651  1.00 31.11 ? 249  ALA A CB  1 
ATOM   1930  N  N   . VAL A 1 250 ? 28.506  50.167  89.669  1.00 26.90 ? 250  VAL A N   1 
ATOM   1931  C  CA  . VAL A 1 250 ? 28.144  50.895  88.457  1.00 25.78 ? 250  VAL A CA  1 
ATOM   1932  C  C   . VAL A 1 250 ? 28.945  50.342  87.281  1.00 25.81 ? 250  VAL A C   1 
ATOM   1933  O  O   . VAL A 1 250 ? 30.167  50.224  87.362  1.00 27.81 ? 250  VAL A O   1 
ATOM   1934  C  CB  . VAL A 1 250 ? 28.446  52.411  88.601  1.00 23.35 ? 250  VAL A CB  1 
ATOM   1935  C  CG1 . VAL A 1 250 ? 28.100  53.147  87.319  1.00 21.59 ? 250  VAL A CG1 1 
ATOM   1936  C  CG2 . VAL A 1 250 ? 27.676  53.000  89.772  1.00 20.92 ? 250  VAL A CG2 1 
ATOM   1937  N  N   . PRO A 1 251 ? 28.263  49.976  86.179  1.00 26.13 ? 251  PRO A N   1 
ATOM   1938  C  CA  . PRO A 1 251 ? 28.926  49.435  84.988  1.00 26.21 ? 251  PRO A CA  1 
ATOM   1939  C  C   . PRO A 1 251 ? 30.048  50.333  84.474  1.00 26.16 ? 251  PRO A C   1 
ATOM   1940  O  O   . PRO A 1 251 ? 29.823  51.483  84.094  1.00 27.54 ? 251  PRO A O   1 
ATOM   1941  C  CB  . PRO A 1 251 ? 27.776  49.299  83.982  1.00 25.55 ? 251  PRO A CB  1 
ATOM   1942  C  CG  . PRO A 1 251 ? 26.721  50.229  84.497  1.00 27.04 ? 251  PRO A CG  1 
ATOM   1943  C  CD  . PRO A 1 251 ? 26.809  50.035  85.975  1.00 26.73 ? 251  PRO A CD  1 
ATOM   1944  N  N   . LEU A 1 252 ? 31.260  49.789  84.499  1.00 25.99 ? 252  LEU A N   1 
ATOM   1945  C  CA  . LEU A 1 252 ? 32.466  50.489  84.075  1.00 25.34 ? 252  LEU A CA  1 
ATOM   1946  C  C   . LEU A 1 252 ? 32.629  50.590  82.561  1.00 26.72 ? 252  LEU A C   1 
ATOM   1947  O  O   . LEU A 1 252 ? 32.462  49.606  81.837  1.00 26.87 ? 252  LEU A O   1 
ATOM   1948  C  CB  . LEU A 1 252 ? 33.694  49.799  84.673  1.00 22.79 ? 252  LEU A CB  1 
ATOM   1949  C  CG  . LEU A 1 252 ? 33.722  49.628  86.192  1.00 20.09 ? 252  LEU A CG  1 
ATOM   1950  C  CD1 . LEU A 1 252 ? 34.883  48.734  86.591  1.00 18.92 ? 252  LEU A CD1 1 
ATOM   1951  C  CD2 . LEU A 1 252 ? 33.820  50.983  86.868  1.00 19.30 ? 252  LEU A CD2 1 
ATOM   1952  N  N   . VAL A 1 253 ? 32.966  51.791  82.096  1.00 27.94 ? 253  VAL A N   1 
ATOM   1953  C  CA  . VAL A 1 253 ? 33.180  52.050  80.676  1.00 28.32 ? 253  VAL A CA  1 
ATOM   1954  C  C   . VAL A 1 253 ? 34.683  52.115  80.408  1.00 28.18 ? 253  VAL A C   1 
ATOM   1955  O  O   . VAL A 1 253 ? 35.434  52.712  81.182  1.00 30.04 ? 253  VAL A O   1 
ATOM   1956  C  CB  . VAL A 1 253 ? 32.509  53.375  80.234  1.00 28.94 ? 253  VAL A CB  1 
ATOM   1957  C  CG1 . VAL A 1 253 ? 32.779  53.644  78.759  1.00 29.92 ? 253  VAL A CG1 1 
ATOM   1958  C  CG2 . VAL A 1 253 ? 31.011  53.308  80.481  1.00 27.84 ? 253  VAL A CG2 1 
ATOM   1959  N  N   . GLY A 1 254 ? 35.107  51.491  79.313  1.00 26.95 ? 254  GLY A N   1 
ATOM   1960  C  CA  . GLY A 1 254 ? 36.513  51.463  78.950  1.00 26.43 ? 254  GLY A CA  1 
ATOM   1961  C  C   . GLY A 1 254 ? 37.199  52.812  78.872  1.00 26.26 ? 254  GLY A C   1 
ATOM   1962  O  O   . GLY A 1 254 ? 36.823  53.666  78.068  1.00 27.90 ? 254  GLY A O   1 
ATOM   1963  N  N   . ARG A 1 255 ? 38.207  52.992  79.725  1.00 25.41 ? 255  ARG A N   1 
ATOM   1964  C  CA  . ARG A 1 255 ? 39.003  54.218  79.797  1.00 23.44 ? 255  ARG A CA  1 
ATOM   1965  C  C   . ARG A 1 255 ? 38.214  55.485  80.127  1.00 24.55 ? 255  ARG A C   1 
ATOM   1966  O  O   . ARG A 1 255 ? 38.682  56.602  79.892  1.00 24.38 ? 255  ARG A O   1 
ATOM   1967  C  CB  . ARG A 1 255 ? 39.819  54.399  78.513  1.00 23.83 ? 255  ARG A CB  1 
ATOM   1968  C  CG  . ARG A 1 255 ? 40.975  53.418  78.386  1.00 21.82 ? 255  ARG A CG  1 
ATOM   1969  C  CD  . ARG A 1 255 ? 41.659  53.515  77.033  1.00 23.19 ? 255  ARG A CD  1 
ATOM   1970  N  NE  . ARG A 1 255 ? 40.824  52.988  75.957  1.00 23.02 ? 255  ARG A NE  1 
ATOM   1971  C  CZ  . ARG A 1 255 ? 41.174  52.971  74.674  1.00 24.53 ? 255  ARG A CZ  1 
ATOM   1972  N  NH1 . ARG A 1 255 ? 42.349  53.456  74.295  1.00 25.00 ? 255  ARG A NH1 1 
ATOM   1973  N  NH2 . ARG A 1 255 ? 40.354  52.456  73.769  1.00 25.11 ? 255  ARG A NH2 1 
ATOM   1974  N  N   . ALA A 1 256 ? 37.023  55.297  80.688  1.00 24.20 ? 256  ALA A N   1 
ATOM   1975  C  CA  . ALA A 1 256 ? 36.154  56.402  81.079  1.00 23.08 ? 256  ALA A CA  1 
ATOM   1976  C  C   . ALA A 1 256 ? 35.873  56.305  82.575  1.00 23.64 ? 256  ALA A C   1 
ATOM   1977  O  O   . ALA A 1 256 ? 35.051  57.045  83.119  1.00 23.49 ? 256  ALA A O   1 
ATOM   1978  C  CB  . ALA A 1 256 ? 34.857  56.354  80.291  1.00 20.78 ? 256  ALA A CB  1 
ATOM   1979  N  N   . SER A 1 257 ? 36.586  55.394  83.232  1.00 23.60 ? 257  SER A N   1 
ATOM   1980  C  CA  . SER A 1 257 ? 36.451  55.160  84.663  1.00 25.54 ? 257  SER A CA  1 
ATOM   1981  C  C   . SER A 1 257 ? 37.776  54.663  85.235  1.00 26.83 ? 257  SER A C   1 
ATOM   1982  O  O   . SER A 1 257 ? 38.581  54.058  84.524  1.00 26.37 ? 257  SER A O   1 
ATOM   1983  C  CB  . SER A 1 257 ? 35.349  54.129  84.926  1.00 25.64 ? 257  SER A CB  1 
ATOM   1984  O  OG  . SER A 1 257 ? 35.574  52.940  84.188  1.00 23.37 ? 257  SER A OG  1 
ATOM   1985  N  N   . VAL A 1 258 ? 38.002  54.933  86.518  1.00 28.20 ? 258  VAL A N   1 
ATOM   1986  C  CA  . VAL A 1 258 ? 39.232  54.517  87.191  1.00 29.58 ? 258  VAL A CA  1 
ATOM   1987  C  C   . VAL A 1 258 ? 38.978  54.041  88.619  1.00 29.45 ? 258  VAL A C   1 
ATOM   1988  O  O   . VAL A 1 258 ? 37.923  54.302  89.199  1.00 29.57 ? 258  VAL A O   1 
ATOM   1989  C  CB  . VAL A 1 258 ? 40.278  55.669  87.255  1.00 29.57 ? 258  VAL A CB  1 
ATOM   1990  C  CG1 . VAL A 1 258 ? 40.734  56.062  85.863  1.00 30.03 ? 258  VAL A CG1 1 
ATOM   1991  C  CG2 . VAL A 1 258 ? 39.703  56.874  87.987  1.00 30.44 ? 258  VAL A CG2 1 
ATOM   1992  N  N   . ALA A 1 259 ? 39.947  53.313  89.165  1.00 29.54 ? 259  ALA A N   1 
ATOM   1993  C  CA  . ALA A 1 259 ? 39.871  52.821  90.534  1.00 29.14 ? 259  ALA A CA  1 
ATOM   1994  C  C   . ALA A 1 259 ? 40.682  53.803  91.371  1.00 30.24 ? 259  ALA A C   1 
ATOM   1995  O  O   . ALA A 1 259 ? 41.757  54.236  90.955  1.00 30.53 ? 259  ALA A O   1 
ATOM   1996  C  CB  . ALA A 1 259 ? 40.458  51.421  90.632  1.00 28.34 ? 259  ALA A CB  1 
ATOM   1997  N  N   . SER A 1 260 ? 40.171  54.158  92.545  1.00 32.08 ? 260  SER A N   1 
ATOM   1998  C  CA  . SER A 1 260 ? 40.861  55.117  93.398  1.00 33.40 ? 260  SER A CA  1 
ATOM   1999  C  C   . SER A 1 260 ? 40.742  54.825  94.885  1.00 34.48 ? 260  SER A C   1 
ATOM   2000  O  O   . SER A 1 260 ? 40.075  53.877  95.299  1.00 34.49 ? 260  SER A O   1 
ATOM   2001  C  CB  . SER A 1 260 ? 40.321  56.523  93.131  1.00 33.52 ? 260  SER A CB  1 
ATOM   2002  O  OG  . SER A 1 260 ? 38.948  56.613  93.475  1.00 34.70 ? 260  SER A OG  1 
ATOM   2003  N  N   . ASP A 1 261 ? 41.421  55.649  95.678  1.00 36.96 ? 261  ASP A N   1 
ATOM   2004  C  CA  . ASP A 1 261 ? 41.395  55.542  97.128  1.00 38.07 ? 261  ASP A CA  1 
ATOM   2005  C  C   . ASP A 1 261 ? 40.173  56.349  97.556  1.00 39.74 ? 261  ASP A C   1 
ATOM   2006  O  O   . ASP A 1 261 ? 40.169  57.577  97.455  1.00 38.93 ? 261  ASP A O   1 
ATOM   2007  C  CB  . ASP A 1 261 ? 42.674  56.145  97.722  1.00 38.03 ? 261  ASP A CB  1 
ATOM   2008  C  CG  . ASP A 1 261 ? 42.843  55.843  99.206  1.00 38.70 ? 261  ASP A CG  1 
ATOM   2009  O  OD1 . ASP A 1 261 ? 42.065  55.039  99.764  1.00 40.28 ? 261  ASP A OD1 1 
ATOM   2010  O  OD2 . ASP A 1 261 ? 43.774  56.411  99.817  1.00 36.39 ? 261  ASP A OD2 1 
ATOM   2011  N  N   . ARG A 1 262 ? 39.131  55.649  98.000  1.00 41.80 ? 262  ARG A N   1 
ATOM   2012  C  CA  . ARG A 1 262 ? 37.883  56.285  98.417  1.00 44.18 ? 262  ARG A CA  1 
ATOM   2013  C  C   . ARG A 1 262 ? 38.033  57.345  99.508  1.00 46.04 ? 262  ARG A C   1 
ATOM   2014  O  O   . ARG A 1 262 ? 37.197  58.244  99.622  1.00 46.38 ? 262  ARG A O   1 
ATOM   2015  C  CB  . ARG A 1 262 ? 36.861  55.227  98.845  1.00 44.14 ? 262  ARG A CB  1 
ATOM   2016  C  CG  . ARG A 1 262 ? 37.251  54.426  100.079 1.00 46.48 ? 262  ARG A CG  1 
ATOM   2017  C  CD  . ARG A 1 262 ? 36.135  53.476  100.481 1.00 48.58 ? 262  ARG A CD  1 
ATOM   2018  N  NE  . ARG A 1 262 ? 34.865  54.177  100.653 1.00 51.53 ? 262  ARG A NE  1 
ATOM   2019  C  CZ  . ARG A 1 262 ? 33.696  53.580  100.864 1.00 54.20 ? 262  ARG A CZ  1 
ATOM   2020  N  NH1 . ARG A 1 262 ? 33.620  52.256  100.934 1.00 56.25 ? 262  ARG A NH1 1 
ATOM   2021  N  NH2 . ARG A 1 262 ? 32.595  54.309  100.991 1.00 54.27 ? 262  ARG A NH2 1 
ATOM   2022  N  N   . SER A 1 263 ? 39.095  57.240  100.303 1.00 48.52 ? 263  SER A N   1 
ATOM   2023  C  CA  . SER A 1 263 ? 39.349  58.196  101.377 1.00 51.09 ? 263  SER A CA  1 
ATOM   2024  C  C   . SER A 1 263 ? 39.822  59.548  100.835 1.00 51.72 ? 263  SER A C   1 
ATOM   2025  O  O   . SER A 1 263 ? 39.450  60.599  101.361 1.00 52.69 ? 263  SER A O   1 
ATOM   2026  C  CB  . SER A 1 263 ? 40.376  57.632  102.366 1.00 52.22 ? 263  SER A CB  1 
ATOM   2027  O  OG  . SER A 1 263 ? 41.604  57.332  101.725 1.00 54.43 ? 263  SER A OG  1 
ATOM   2028  N  N   . ILE A 1 264 ? 40.636  59.512  99.782  1.00 51.58 ? 264  ILE A N   1 
ATOM   2029  C  CA  . ILE A 1 264 ? 41.155  60.729  99.162  1.00 51.31 ? 264  ILE A CA  1 
ATOM   2030  C  C   . ILE A 1 264 ? 40.236  61.174  98.023  1.00 50.88 ? 264  ILE A C   1 
ATOM   2031  O  O   . ILE A 1 264 ? 39.776  62.317  97.997  1.00 51.15 ? 264  ILE A O   1 
ATOM   2032  C  CB  . ILE A 1 264 ? 42.590  60.520  98.620  1.00 51.75 ? 264  ILE A CB  1 
ATOM   2033  C  CG1 . ILE A 1 264 ? 43.503  59.975  99.725  1.00 52.31 ? 264  ILE A CG1 1 
ATOM   2034  C  CG2 . ILE A 1 264 ? 43.150  61.831  98.076  1.00 51.31 ? 264  ILE A CG2 1 
ATOM   2035  C  CD1 . ILE A 1 264 ? 43.613  60.872  100.948 1.00 54.33 ? 264  ILE A CD1 1 
ATOM   2036  N  N   . ILE A 1 265 ? 39.986  60.268  97.079  1.00 49.25 ? 265  ILE A N   1 
ATOM   2037  C  CA  . ILE A 1 265 ? 39.110  60.553  95.945  1.00 47.83 ? 265  ILE A CA  1 
ATOM   2038  C  C   . ILE A 1 265 ? 37.887  59.636  96.032  1.00 46.04 ? 265  ILE A C   1 
ATOM   2039  O  O   . ILE A 1 265 ? 37.937  58.477  95.610  1.00 45.81 ? 265  ILE A O   1 
ATOM   2040  C  CB  . ILE A 1 265 ? 39.815  60.321  94.578  1.00 48.74 ? 265  ILE A CB  1 
ATOM   2041  C  CG1 . ILE A 1 265 ? 41.156  61.056  94.523  1.00 48.61 ? 265  ILE A CG1 1 
ATOM   2042  C  CG2 . ILE A 1 265 ? 38.926  60.797  93.437  1.00 48.01 ? 265  ILE A CG2 1 
ATOM   2043  C  CD1 . ILE A 1 265 ? 42.333  60.212  94.967  1.00 51.68 ? 265  ILE A CD1 1 
ATOM   2044  N  N   . PRO A 1 266 ? 36.777  60.143  96.596  1.00 44.52 ? 266  PRO A N   1 
ATOM   2045  C  CA  . PRO A 1 266 ? 35.527  59.388  96.752  1.00 43.84 ? 266  PRO A CA  1 
ATOM   2046  C  C   . PRO A 1 266 ? 34.862  59.035  95.419  1.00 43.46 ? 266  PRO A C   1 
ATOM   2047  O  O   . PRO A 1 266 ? 35.094  59.695  94.405  1.00 44.76 ? 266  PRO A O   1 
ATOM   2048  C  CB  . PRO A 1 266 ? 34.663  60.340  97.580  1.00 43.30 ? 266  PRO A CB  1 
ATOM   2049  C  CG  . PRO A 1 266 ? 35.133  61.686  97.138  1.00 43.77 ? 266  PRO A CG  1 
ATOM   2050  C  CD  . PRO A 1 266 ? 36.629  61.508  97.131  1.00 44.07 ? 266  PRO A CD  1 
ATOM   2051  N  N   . PRO A 1 267 ? 34.036  57.973  95.405  1.00 43.02 ? 267  PRO A N   1 
ATOM   2052  C  CA  . PRO A 1 267 ? 33.340  57.536  94.190  1.00 42.63 ? 267  PRO A CA  1 
ATOM   2053  C  C   . PRO A 1 267 ? 32.385  58.586  93.622  1.00 41.16 ? 267  PRO A C   1 
ATOM   2054  O  O   . PRO A 1 267 ? 31.726  59.314  94.367  1.00 41.18 ? 267  PRO A O   1 
ATOM   2055  C  CB  . PRO A 1 267 ? 32.602  56.277  94.653  1.00 43.02 ? 267  PRO A CB  1 
ATOM   2056  C  CG  . PRO A 1 267 ? 32.390  56.518  96.117  1.00 42.51 ? 267  PRO A CG  1 
ATOM   2057  C  CD  . PRO A 1 267 ? 33.716  57.083  96.535  1.00 42.64 ? 267  PRO A CD  1 
ATOM   2058  N  N   . GLY A 1 268 ? 32.331  58.659  92.295  1.00 39.57 ? 268  GLY A N   1 
ATOM   2059  C  CA  . GLY A 1 268 ? 31.470  59.621  91.629  1.00 38.75 ? 268  GLY A CA  1 
ATOM   2060  C  C   . GLY A 1 268 ? 32.199  60.895  91.248  1.00 37.39 ? 268  GLY A C   1 
ATOM   2061  O  O   . GLY A 1 268 ? 31.629  61.779  90.609  1.00 38.32 ? 268  GLY A O   1 
ATOM   2062  N  N   . THR A 1 269 ? 33.468  60.983  91.636  1.00 36.66 ? 269  THR A N   1 
ATOM   2063  C  CA  . THR A 1 269 ? 34.294  62.149  91.348  1.00 35.93 ? 269  THR A CA  1 
ATOM   2064  C  C   . THR A 1 269 ? 34.747  62.206  89.889  1.00 35.51 ? 269  THR A C   1 
ATOM   2065  O  O   . THR A 1 269 ? 35.347  61.260  89.375  1.00 34.85 ? 269  THR A O   1 
ATOM   2066  C  CB  . THR A 1 269 ? 35.535  62.183  92.267  1.00 34.40 ? 269  THR A CB  1 
ATOM   2067  O  OG1 . THR A 1 269 ? 35.114  62.284  93.633  1.00 33.07 ? 269  THR A OG1 1 
ATOM   2068  C  CG2 . THR A 1 269 ? 36.423  63.368  91.934  1.00 34.88 ? 269  THR A CG2 1 
ATOM   2069  N  N   . THR A 1 270 ? 34.443  63.323  89.232  1.00 35.35 ? 270  THR A N   1 
ATOM   2070  C  CA  . THR A 1 270 ? 34.825  63.534  87.838  1.00 34.93 ? 270  THR A CA  1 
ATOM   2071  C  C   . THR A 1 270 ? 36.306  63.910  87.794  1.00 34.41 ? 270  THR A C   1 
ATOM   2072  O  O   . THR A 1 270 ? 36.764  64.760  88.561  1.00 33.86 ? 270  THR A O   1 
ATOM   2073  C  CB  . THR A 1 270 ? 33.980  64.655  87.188  1.00 34.91 ? 270  THR A CB  1 
ATOM   2074  O  OG1 . THR A 1 270 ? 32.588  64.332  87.303  1.00 33.89 ? 270  THR A OG1 1 
ATOM   2075  C  CG2 . THR A 1 270 ? 34.334  64.812  85.714  1.00 32.82 ? 270  THR A CG2 1 
ATOM   2076  N  N   . LEU A 1 271 ? 37.049  63.273  86.893  1.00 34.99 ? 271  LEU A N   1 
ATOM   2077  C  CA  . LEU A 1 271 ? 38.482  63.516  86.767  1.00 35.23 ? 271  LEU A CA  1 
ATOM   2078  C  C   . LEU A 1 271 ? 38.949  63.667  85.322  1.00 35.62 ? 271  LEU A C   1 
ATOM   2079  O  O   . LEU A 1 271 ? 38.795  62.750  84.516  1.00 38.01 ? 271  LEU A O   1 
ATOM   2080  C  CB  . LEU A 1 271 ? 39.260  62.358  87.404  1.00 34.61 ? 271  LEU A CB  1 
ATOM   2081  C  CG  . LEU A 1 271 ? 38.992  61.968  88.859  1.00 34.68 ? 271  LEU A CG  1 
ATOM   2082  C  CD1 . LEU A 1 271 ? 39.565  60.590  89.134  1.00 32.01 ? 271  LEU A CD1 1 
ATOM   2083  C  CD2 . LEU A 1 271 ? 39.582  63.003  89.804  1.00 33.73 ? 271  LEU A CD2 1 
ATOM   2084  N  N   . ILE A 1 272 ? 39.504  64.829  84.993  1.00 35.85 ? 272  ILE A N   1 
ATOM   2085  C  CA  . ILE A 1 272 ? 40.040  65.061  83.654  1.00 36.78 ? 272  ILE A CA  1 
ATOM   2086  C  C   . ILE A 1 272 ? 41.546  64.851  83.787  1.00 35.78 ? 272  ILE A C   1 
ATOM   2087  O  O   . ILE A 1 272 ? 42.198  65.498  84.608  1.00 35.50 ? 272  ILE A O   1 
ATOM   2088  C  CB  . ILE A 1 272 ? 39.715  66.487  83.118  1.00 38.19 ? 272  ILE A CB  1 
ATOM   2089  C  CG1 . ILE A 1 272 ? 40.306  66.671  81.717  1.00 39.18 ? 272  ILE A CG1 1 
ATOM   2090  C  CG2 . ILE A 1 272 ? 40.220  67.559  84.070  1.00 39.86 ? 272  ILE A CG2 1 
ATOM   2091  C  CD1 . ILE A 1 272 ? 40.004  68.015  81.092  1.00 41.98 ? 272  ILE A CD1 1 
ATOM   2092  N  N   . ALA A 1 273 ? 42.095  63.923  83.010  1.00 35.96 ? 273  ALA A N   1 
ATOM   2093  C  CA  . ALA A 1 273 ? 43.518  63.631  83.115  1.00 35.92 ? 273  ALA A CA  1 
ATOM   2094  C  C   . ALA A 1 273 ? 44.302  63.511  81.818  1.00 35.32 ? 273  ALA A C   1 
ATOM   2095  O  O   . ALA A 1 273 ? 43.754  63.208  80.758  1.00 34.56 ? 273  ALA A O   1 
ATOM   2096  C  CB  . ALA A 1 273 ? 43.718  62.375  83.949  1.00 35.09 ? 273  ALA A CB  1 
ATOM   2097  N  N   . GLU A 1 274 ? 45.602  63.766  81.935  1.00 35.91 ? 274  GLU A N   1 
ATOM   2098  C  CA  . GLU A 1 274 ? 46.541  63.667  80.828  1.00 35.48 ? 274  GLU A CA  1 
ATOM   2099  C  C   . GLU A 1 274 ? 47.201  62.297  80.941  1.00 35.06 ? 274  GLU A C   1 
ATOM   2100  O  O   . GLU A 1 274 ? 48.261  62.152  81.552  1.00 35.35 ? 274  GLU A O   1 
ATOM   2101  C  CB  . GLU A 1 274 ? 47.597  64.772  80.923  1.00 36.22 ? 274  GLU A CB  1 
ATOM   2102  C  CG  . GLU A 1 274 ? 47.160  66.113  80.359  1.00 38.00 ? 274  GLU A CG  1 
ATOM   2103  C  CD  . GLU A 1 274 ? 47.208  66.154  78.841  1.00 39.32 ? 274  GLU A CD  1 
ATOM   2104  O  OE1 . GLU A 1 274 ? 46.196  65.808  78.197  1.00 40.22 ? 274  GLU A OE1 1 
ATOM   2105  O  OE2 . GLU A 1 274 ? 48.262  66.537  78.292  1.00 41.77 ? 274  GLU A OE2 1 
ATOM   2106  N  N   . VAL A 1 275 ? 46.528  61.287  80.399  1.00 35.34 ? 275  VAL A N   1 
ATOM   2107  C  CA  . VAL A 1 275 ? 47.017  59.913  80.426  1.00 34.15 ? 275  VAL A CA  1 
ATOM   2108  C  C   . VAL A 1 275 ? 48.145  59.713  79.418  1.00 33.65 ? 275  VAL A C   1 
ATOM   2109  O  O   . VAL A 1 275 ? 47.951  59.874  78.213  1.00 33.33 ? 275  VAL A O   1 
ATOM   2110  C  CB  . VAL A 1 275 ? 45.875  58.917  80.131  1.00 34.59 ? 275  VAL A CB  1 
ATOM   2111  C  CG1 . VAL A 1 275 ? 46.395  57.491  80.141  1.00 35.87 ? 275  VAL A CG1 1 
ATOM   2112  C  CG2 . VAL A 1 275 ? 44.764  59.082  81.155  1.00 33.90 ? 275  VAL A CG2 1 
ATOM   2113  N  N   . PRO A 1 276 ? 49.342  59.348  79.907  1.00 34.33 ? 276  PRO A N   1 
ATOM   2114  C  CA  . PRO A 1 276 ? 50.529  59.116  79.078  1.00 34.45 ? 276  PRO A CA  1 
ATOM   2115  C  C   . PRO A 1 276 ? 50.359  57.960  78.098  1.00 36.34 ? 276  PRO A C   1 
ATOM   2116  O  O   . PRO A 1 276 ? 49.985  56.851  78.484  1.00 36.07 ? 276  PRO A O   1 
ATOM   2117  C  CB  . PRO A 1 276 ? 51.611  58.821  80.117  1.00 33.47 ? 276  PRO A CB  1 
ATOM   2118  C  CG  . PRO A 1 276 ? 50.843  58.176  81.223  1.00 33.39 ? 276  PRO A CG  1 
ATOM   2119  C  CD  . PRO A 1 276 ? 49.634  59.063  81.323  1.00 34.84 ? 276  PRO A CD  1 
ATOM   2120  N  N   . LEU A 1 277 ? 50.618  58.233  76.824  1.00 37.34 ? 277  LEU A N   1 
ATOM   2121  C  CA  . LEU A 1 277 ? 50.499  57.219  75.785  1.00 38.04 ? 277  LEU A CA  1 
ATOM   2122  C  C   . LEU A 1 277 ? 51.736  56.335  75.714  1.00 39.40 ? 277  LEU A C   1 
ATOM   2123  O  O   . LEU A 1 277 ? 52.821  56.724  76.150  1.00 39.27 ? 277  LEU A O   1 
ATOM   2124  C  CB  . LEU A 1 277 ? 50.249  57.870  74.423  1.00 38.30 ? 277  LEU A CB  1 
ATOM   2125  C  CG  . LEU A 1 277 ? 48.899  58.563  74.237  1.00 38.02 ? 277  LEU A CG  1 
ATOM   2126  C  CD1 . LEU A 1 277 ? 48.839  59.223  72.870  1.00 37.75 ? 277  LEU A CD1 1 
ATOM   2127  C  CD2 . LEU A 1 277 ? 47.777  57.552  74.398  1.00 37.56 ? 277  LEU A CD2 1 
ATOM   2128  N  N   . LEU A 1 278 ? 51.554  55.138  75.167  1.00 41.27 ? 278  LEU A N   1 
ATOM   2129  C  CA  . LEU A 1 278 ? 52.633  54.170  75.015  1.00 43.19 ? 278  LEU A CA  1 
ATOM   2130  C  C   . LEU A 1 278 ? 52.322  53.195  73.885  1.00 44.26 ? 278  LEU A C   1 
ATOM   2131  O  O   . LEU A 1 278 ? 51.167  52.817  73.682  1.00 46.04 ? 278  LEU A O   1 
ATOM   2132  C  CB  . LEU A 1 278 ? 52.889  53.432  76.340  1.00 41.65 ? 278  LEU A CB  1 
ATOM   2133  C  CG  . LEU A 1 278 ? 51.718  52.958  77.210  1.00 39.97 ? 278  LEU A CG  1 
ATOM   2134  C  CD1 . LEU A 1 278 ? 51.089  51.693  76.644  1.00 41.45 ? 278  LEU A CD1 1 
ATOM   2135  C  CD2 . LEU A 1 278 ? 52.223  52.696  78.616  1.00 37.07 ? 278  LEU A CD2 1 
ATOM   2136  N  N   . ASP A 1 279 ? 53.352  52.817  73.132  1.00 45.88 ? 279  ASP A N   1 
ATOM   2137  C  CA  . ASP A 1 279 ? 53.198  51.895  72.007  1.00 47.32 ? 279  ASP A CA  1 
ATOM   2138  C  C   . ASP A 1 279 ? 52.879  50.456  72.420  1.00 49.54 ? 279  ASP A C   1 
ATOM   2139  O  O   . ASP A 1 279 ? 52.597  50.181  73.589  1.00 50.04 ? 279  ASP A O   1 
ATOM   2140  C  CB  . ASP A 1 279 ? 54.441  51.939  71.107  1.00 45.97 ? 279  ASP A CB  1 
ATOM   2141  C  CG  . ASP A 1 279 ? 55.740  51.842  71.890  1.00 44.43 ? 279  ASP A CG  1 
ATOM   2142  O  OD1 . ASP A 1 279 ? 56.068  50.741  72.376  1.00 43.98 ? 279  ASP A OD1 1 
ATOM   2143  O  OD2 . ASP A 1 279 ? 56.437  52.871  72.012  1.00 44.00 ? 279  ASP A OD2 1 
ATOM   2144  N  N   . ASN A 1 280 ? 52.918  49.546  71.448  1.00 51.03 ? 280  ASN A N   1 
ATOM   2145  C  CA  . ASN A 1 280 ? 52.628  48.130  71.677  1.00 51.96 ? 280  ASN A CA  1 
ATOM   2146  C  C   . ASN A 1 280 ? 53.603  47.463  72.648  1.00 52.04 ? 280  ASN A C   1 
ATOM   2147  O  O   . ASN A 1 280 ? 53.274  46.453  73.271  1.00 51.41 ? 280  ASN A O   1 
ATOM   2148  C  CB  . ASN A 1 280 ? 52.623  47.370  70.347  1.00 53.37 ? 280  ASN A CB  1 
ATOM   2149  C  CG  . ASN A 1 280 ? 51.577  47.894  69.377  1.00 54.82 ? 280  ASN A CG  1 
ATOM   2150  O  OD1 . ASN A 1 280 ? 51.789  48.902  68.700  1.00 55.49 ? 280  ASN A OD1 1 
ATOM   2151  N  ND2 . ASN A 1 280 ? 50.440  47.210  69.308  1.00 54.99 ? 280  ASN A ND2 1 
ATOM   2152  N  N   . ASN A 1 281 ? 54.803  48.026  72.761  1.00 53.18 ? 281  ASN A N   1 
ATOM   2153  C  CA  . ASN A 1 281 ? 55.827  47.493  73.656  1.00 53.44 ? 281  ASN A CA  1 
ATOM   2154  C  C   . ASN A 1 281 ? 55.795  48.175  75.024  1.00 53.10 ? 281  ASN A C   1 
ATOM   2155  O  O   . ASN A 1 281 ? 56.639  47.907  75.881  1.00 52.98 ? 281  ASN A O   1 
ATOM   2156  C  CB  . ASN A 1 281 ? 57.214  47.637  73.021  1.00 54.32 ? 281  ASN A CB  1 
ATOM   2157  C  CG  . ASN A 1 281 ? 57.338  46.879  71.711  1.00 54.78 ? 281  ASN A CG  1 
ATOM   2158  O  OD1 . ASN A 1 281 ? 57.067  45.678  71.645  1.00 54.67 ? 281  ASN A OD1 1 
ATOM   2159  N  ND2 . ASN A 1 281 ? 57.744  47.581  70.658  1.00 54.22 ? 281  ASN A ND2 1 
ATOM   2160  N  N   . GLY A 1 282 ? 54.821  49.061  75.216  1.00 52.64 ? 282  GLY A N   1 
ATOM   2161  C  CA  . GLY A 1 282 ? 54.675  49.765  76.479  1.00 52.47 ? 282  GLY A CA  1 
ATOM   2162  C  C   . GLY A 1 282 ? 55.693  50.853  76.756  1.00 52.15 ? 282  GLY A C   1 
ATOM   2163  O  O   . GLY A 1 282 ? 55.815  51.312  77.893  1.00 51.16 ? 282  GLY A O   1 
ATOM   2164  N  N   . LYS A 1 283 ? 56.422  51.266  75.724  1.00 53.23 ? 283  LYS A N   1 
ATOM   2165  C  CA  . LYS A 1 283 ? 57.431  52.311  75.861  1.00 53.80 ? 283  LYS A CA  1 
ATOM   2166  C  C   . LYS A 1 283 ? 56.792  53.691  75.729  1.00 52.84 ? 283  LYS A C   1 
ATOM   2167  O  O   . LYS A 1 283 ? 55.999  53.933  74.816  1.00 51.89 ? 283  LYS A O   1 
ATOM   2168  C  CB  . LYS A 1 283 ? 58.529  52.131  74.805  1.00 54.87 ? 283  LYS A CB  1 
ATOM   2169  C  CG  . LYS A 1 283 ? 59.654  53.158  74.881  1.00 55.60 ? 283  LYS A CG  1 
ATOM   2170  C  CD  . LYS A 1 283 ? 60.645  52.977  73.742  1.00 57.03 ? 283  LYS A CD  1 
ATOM   2171  C  CE  . LYS A 1 283 ? 61.709  54.064  73.754  1.00 57.27 ? 283  LYS A CE  1 
ATOM   2172  N  NZ  . LYS A 1 283 ? 62.665  53.921  72.619  1.00 57.53 ? 283  LYS A NZ  1 
ATOM   2173  N  N   . PHE A 1 284 ? 57.130  54.586  76.654  1.00 53.01 ? 284  PHE A N   1 
ATOM   2174  C  CA  . PHE A 1 284 ? 56.600  55.946  76.650  1.00 53.03 ? 284  PHE A CA  1 
ATOM   2175  C  C   . PHE A 1 284 ? 57.188  56.754  75.495  1.00 52.19 ? 284  PHE A C   1 
ATOM   2176  O  O   . PHE A 1 284 ? 58.365  57.120  75.512  1.00 51.69 ? 284  PHE A O   1 
ATOM   2177  C  CB  . PHE A 1 284 ? 56.896  56.634  77.987  1.00 53.41 ? 284  PHE A CB  1 
ATOM   2178  C  CG  . PHE A 1 284 ? 56.347  58.033  78.090  1.00 52.87 ? 284  PHE A CG  1 
ATOM   2179  C  CD1 . PHE A 1 284 ? 54.983  58.273  77.957  1.00 52.65 ? 284  PHE A CD1 1 
ATOM   2180  C  CD2 . PHE A 1 284 ? 57.196  59.110  78.323  1.00 52.67 ? 284  PHE A CD2 1 
ATOM   2181  C  CE1 . PHE A 1 284 ? 54.472  59.564  78.055  1.00 52.39 ? 284  PHE A CE1 1 
ATOM   2182  C  CE2 . PHE A 1 284 ? 56.695  60.405  78.423  1.00 53.14 ? 284  PHE A CE2 1 
ATOM   2183  C  CZ  . PHE A 1 284 ? 55.329  60.632  78.289  1.00 52.94 ? 284  PHE A CZ  1 
ATOM   2184  N  N   . ASN A 1 285 ? 56.354  57.019  74.493  1.00 51.93 ? 285  ASN A N   1 
ATOM   2185  C  CA  . ASN A 1 285 ? 56.762  57.776  73.314  1.00 52.09 ? 285  ASN A CA  1 
ATOM   2186  C  C   . ASN A 1 285 ? 57.000  59.258  73.594  1.00 51.38 ? 285  ASN A C   1 
ATOM   2187  O  O   . ASN A 1 285 ? 57.791  59.903  72.904  1.00 52.40 ? 285  ASN A O   1 
ATOM   2188  C  CB  . ASN A 1 285 ? 55.741  57.597  72.181  1.00 52.80 ? 285  ASN A CB  1 
ATOM   2189  C  CG  . ASN A 1 285 ? 54.300  57.739  72.653  1.00 52.72 ? 285  ASN A CG  1 
ATOM   2190  O  OD1 . ASN A 1 285 ? 54.011  58.454  73.615  1.00 52.45 ? 285  ASN A OD1 1 
ATOM   2191  N  ND2 . ASN A 1 285 ? 53.387  57.051  71.974  1.00 51.97 ? 285  ASN A ND2 1 
ATOM   2192  N  N   . GLY A 1 286 ? 56.310  59.794  74.598  1.00 50.25 ? 286  GLY A N   1 
ATOM   2193  C  CA  . GLY A 1 286 ? 56.478  61.195  74.946  1.00 49.25 ? 286  GLY A CA  1 
ATOM   2194  C  C   . GLY A 1 286 ? 55.211  62.033  74.935  1.00 48.19 ? 286  GLY A C   1 
ATOM   2195  O  O   . GLY A 1 286 ? 55.183  63.121  75.511  1.00 48.13 ? 286  GLY A O   1 
ATOM   2196  N  N   . GLN A 1 287 ? 54.165  61.531  74.286  1.00 48.01 ? 287  GLN A N   1 
ATOM   2197  C  CA  . GLN A 1 287 ? 52.895  62.248  74.194  1.00 47.26 ? 287  GLN A CA  1 
ATOM   2198  C  C   . GLN A 1 287 ? 51.839  61.750  75.181  1.00 45.67 ? 287  GLN A C   1 
ATOM   2199  O  O   . GLN A 1 287 ? 51.924  60.631  75.690  1.00 44.49 ? 287  GLN A O   1 
ATOM   2200  C  CB  . GLN A 1 287 ? 52.366  62.193  72.758  1.00 48.68 ? 287  GLN A CB  1 
ATOM   2201  C  CG  . GLN A 1 287 ? 52.344  60.798  72.161  1.00 50.38 ? 287  GLN A CG  1 
ATOM   2202  C  CD  . GLN A 1 287 ? 52.190  60.810  70.657  1.00 50.80 ? 287  GLN A CD  1 
ATOM   2203  O  OE1 . GLN A 1 287 ? 51.135  60.469  70.127  1.00 53.20 ? 287  GLN A OE1 1 
ATOM   2204  N  NE2 . GLN A 1 287 ? 53.249  61.196  69.957  1.00 51.41 ? 287  GLN A NE2 1 
ATOM   2205  N  N   . TYR A 1 288 ? 50.854  62.603  75.454  1.00 44.38 ? 288  TYR A N   1 
ATOM   2206  C  CA  . TYR A 1 288 ? 49.774  62.286  76.386  1.00 42.14 ? 288  TYR A CA  1 
ATOM   2207  C  C   . TYR A 1 288 ? 48.415  62.163  75.699  1.00 42.96 ? 288  TYR A C   1 
ATOM   2208  O  O   . TYR A 1 288 ? 48.317  62.232  74.471  1.00 43.88 ? 288  TYR A O   1 
ATOM   2209  C  CB  . TYR A 1 288 ? 49.707  63.340  77.495  1.00 38.92 ? 288  TYR A CB  1 
ATOM   2210  C  CG  . TYR A 1 288 ? 50.947  63.400  78.357  1.00 37.17 ? 288  TYR A CG  1 
ATOM   2211  C  CD1 . TYR A 1 288 ? 52.100  64.040  77.909  1.00 36.95 ? 288  TYR A CD1 1 
ATOM   2212  C  CD2 . TYR A 1 288 ? 50.972  62.803  79.616  1.00 37.03 ? 288  TYR A CD2 1 
ATOM   2213  C  CE1 . TYR A 1 288 ? 53.251  64.083  78.691  1.00 38.14 ? 288  TYR A CE1 1 
ATOM   2214  C  CE2 . TYR A 1 288 ? 52.117  62.841  80.408  1.00 37.82 ? 288  TYR A CE2 1 
ATOM   2215  C  CZ  . TYR A 1 288 ? 53.252  63.482  79.938  1.00 37.41 ? 288  TYR A CZ  1 
ATOM   2216  O  OH  . TYR A 1 288 ? 54.390  63.521  80.710  1.00 35.76 ? 288  TYR A OH  1 
ATOM   2217  N  N   . GLU A 1 289 ? 47.368  62.006  76.505  1.00 42.28 ? 289  GLU A N   1 
ATOM   2218  C  CA  . GLU A 1 289 ? 46.008  61.858  75.998  1.00 40.39 ? 289  GLU A CA  1 
ATOM   2219  C  C   . GLU A 1 289 ? 45.007  62.426  77.000  1.00 38.75 ? 289  GLU A C   1 
ATOM   2220  O  O   . GLU A 1 289 ? 44.985  62.023  78.162  1.00 36.64 ? 289  GLU A O   1 
ATOM   2221  C  CB  . GLU A 1 289 ? 45.721  60.377  75.750  1.00 43.16 ? 289  GLU A CB  1 
ATOM   2222  C  CG  . GLU A 1 289 ? 44.383  60.075  75.109  1.00 45.82 ? 289  GLU A CG  1 
ATOM   2223  C  CD  . GLU A 1 289 ? 44.238  58.606  74.761  1.00 47.15 ? 289  GLU A CD  1 
ATOM   2224  O  OE1 . GLU A 1 289 ? 44.226  57.769  75.689  1.00 48.98 ? 289  GLU A OE1 1 
ATOM   2225  O  OE2 . GLU A 1 289 ? 44.148  58.284  73.557  1.00 49.84 ? 289  GLU A OE2 1 
ATOM   2226  N  N   . LEU A 1 290 ? 44.179  63.360  76.538  1.00 38.47 ? 290  LEU A N   1 
ATOM   2227  C  CA  . LEU A 1 290 ? 43.180  63.996  77.392  1.00 37.79 ? 290  LEU A CA  1 
ATOM   2228  C  C   . LEU A 1 290 ? 41.890  63.182  77.475  1.00 36.20 ? 290  LEU A C   1 
ATOM   2229  O  O   . LEU A 1 290 ? 41.210  62.971  76.470  1.00 36.03 ? 290  LEU A O   1 
ATOM   2230  C  CB  . LEU A 1 290 ? 42.881  65.414  76.894  1.00 39.18 ? 290  LEU A CB  1 
ATOM   2231  C  CG  . LEU A 1 290 ? 42.155  66.340  77.873  1.00 40.36 ? 290  LEU A CG  1 
ATOM   2232  C  CD1 . LEU A 1 290 ? 42.968  66.484  79.153  1.00 39.70 ? 290  LEU A CD1 1 
ATOM   2233  C  CD2 . LEU A 1 290 ? 41.932  67.697  77.231  1.00 38.75 ? 290  LEU A CD2 1 
ATOM   2234  N  N   . ARG A 1 291 ? 41.557  62.741  78.686  1.00 35.26 ? 291  ARG A N   1 
ATOM   2235  C  CA  . ARG A 1 291 ? 40.358  61.940  78.922  1.00 33.28 ? 291  ARG A CA  1 
ATOM   2236  C  C   . ARG A 1 291 ? 39.588  62.355  80.169  1.00 30.67 ? 291  ARG A C   1 
ATOM   2237  O  O   . ARG A 1 291 ? 40.162  62.857  81.135  1.00 29.34 ? 291  ARG A O   1 
ATOM   2238  C  CB  . ARG A 1 291 ? 40.718  60.454  79.060  1.00 33.09 ? 291  ARG A CB  1 
ATOM   2239  C  CG  . ARG A 1 291 ? 41.100  59.750  77.772  1.00 33.34 ? 291  ARG A CG  1 
ATOM   2240  C  CD  . ARG A 1 291 ? 41.314  58.262  78.017  1.00 33.68 ? 291  ARG A CD  1 
ATOM   2241  N  NE  . ARG A 1 291 ? 41.567  57.532  76.776  1.00 34.68 ? 291  ARG A NE  1 
ATOM   2242  C  CZ  . ARG A 1 291 ? 40.621  56.997  76.010  1.00 34.06 ? 291  ARG A CZ  1 
ATOM   2243  N  NH1 . ARG A 1 291 ? 39.344  57.099  76.352  1.00 35.39 ? 291  ARG A NH1 1 
ATOM   2244  N  NH2 . ARG A 1 291 ? 40.953  56.372  74.888  1.00 34.17 ? 291  ARG A NH2 1 
ATOM   2245  N  N   . LEU A 1 292 ? 38.278  62.134  80.129  1.00 30.85 ? 292  LEU A N   1 
ATOM   2246  C  CA  . LEU A 1 292 ? 37.392  62.427  81.249  1.00 29.72 ? 292  LEU A CA  1 
ATOM   2247  C  C   . LEU A 1 292 ? 37.002  61.082  81.850  1.00 29.18 ? 292  LEU A C   1 
ATOM   2248  O  O   . LEU A 1 292 ? 36.471  60.216  81.154  1.00 27.93 ? 292  LEU A O   1 
ATOM   2249  C  CB  . LEU A 1 292 ? 36.144  63.172  80.774  1.00 29.36 ? 292  LEU A CB  1 
ATOM   2250  C  CG  . LEU A 1 292 ? 36.274  64.678  80.552  1.00 29.24 ? 292  LEU A CG  1 
ATOM   2251  C  CD1 . LEU A 1 292 ? 35.014  65.216  79.891  1.00 29.03 ? 292  LEU A CD1 1 
ATOM   2252  C  CD2 . LEU A 1 292 ? 36.517  65.368  81.882  1.00 28.49 ? 292  LEU A CD2 1 
HETATM 2253  N  N   . MSE A 1 293 ? 37.287  60.899  83.136  1.00 30.26 ? 293  MSE A N   1 
HETATM 2254  C  CA  . MSE A 1 293 ? 36.986  59.643  83.814  1.00 31.01 ? 293  MSE A CA  1 
HETATM 2255  C  C   . MSE A 1 293 ? 36.349  59.850  85.181  1.00 29.59 ? 293  MSE A C   1 
HETATM 2256  O  O   . MSE A 1 293 ? 36.519  60.897  85.802  1.00 30.88 ? 293  MSE A O   1 
HETATM 2257  C  CB  . MSE A 1 293 ? 38.264  58.815  83.954  1.00 35.06 ? 293  MSE A CB  1 
HETATM 2258  C  CG  . MSE A 1 293 ? 38.943  58.526  82.623  1.00 41.10 ? 293  MSE A CG  1 
HETATM 2259  SE SE  . MSE A 1 293 ? 40.672  57.722  82.805  1.00 51.21 ? 293  MSE A SE  1 
HETATM 2260  C  CE  . MSE A 1 293 ? 41.675  59.297  83.294  1.00 47.79 ? 293  MSE A CE  1 
ATOM   2261  N  N   . VAL A 1 294 ? 35.612  58.843  85.641  1.00 28.31 ? 294  VAL A N   1 
ATOM   2262  C  CA  . VAL A 1 294 ? 34.940  58.902  86.935  1.00 26.28 ? 294  VAL A CA  1 
ATOM   2263  C  C   . VAL A 1 294 ? 35.425  57.777  87.849  1.00 25.95 ? 294  VAL A C   1 
ATOM   2264  O  O   . VAL A 1 294 ? 35.619  56.643  87.405  1.00 25.44 ? 294  VAL A O   1 
ATOM   2265  C  CB  . VAL A 1 294 ? 33.399  58.785  86.782  1.00 25.42 ? 294  VAL A CB  1 
ATOM   2266  C  CG1 . VAL A 1 294 ? 32.718  58.964  88.128  1.00 27.01 ? 294  VAL A CG1 1 
ATOM   2267  C  CG2 . VAL A 1 294 ? 32.880  59.813  85.796  1.00 24.13 ? 294  VAL A CG2 1 
ATOM   2268  N  N   . ALA A 1 295 ? 35.634  58.102  89.122  1.00 24.82 ? 295  ALA A N   1 
ATOM   2269  C  CA  . ALA A 1 295 ? 36.082  57.123  90.108  1.00 23.83 ? 295  ALA A CA  1 
ATOM   2270  C  C   . ALA A 1 295 ? 34.889  56.260  90.516  1.00 23.75 ? 295  ALA A C   1 
ATOM   2271  O  O   . ALA A 1 295 ? 33.985  56.731  91.204  1.00 25.40 ? 295  ALA A O   1 
ATOM   2272  C  CB  . ALA A 1 295 ? 36.665  57.832  91.323  1.00 22.51 ? 295  ALA A CB  1 
ATOM   2273  N  N   . LEU A 1 296 ? 34.885  55.003  90.081  1.00 22.92 ? 296  LEU A N   1 
ATOM   2274  C  CA  . LEU A 1 296 ? 33.783  54.095  90.390  1.00 22.68 ? 296  LEU A CA  1 
ATOM   2275  C  C   . LEU A 1 296 ? 34.224  52.705  90.848  1.00 23.74 ? 296  LEU A C   1 
ATOM   2276  O  O   . LEU A 1 296 ? 33.457  51.745  90.759  1.00 24.56 ? 296  LEU A O   1 
ATOM   2277  C  CB  . LEU A 1 296 ? 32.863  53.961  89.174  1.00 22.17 ? 296  LEU A CB  1 
ATOM   2278  C  CG  . LEU A 1 296 ? 32.121  55.211  88.695  1.00 19.66 ? 296  LEU A CG  1 
ATOM   2279  C  CD1 . LEU A 1 296 ? 31.529  54.954  87.324  1.00 20.25 ? 296  LEU A CD1 1 
ATOM   2280  C  CD2 . LEU A 1 296 ? 31.043  55.606  89.692  1.00 17.75 ? 296  LEU A CD2 1 
ATOM   2281  N  N   . ASP A 1 297 ? 35.449  52.602  91.354  1.00 24.53 ? 297  ASP A N   1 
ATOM   2282  C  CA  . ASP A 1 297 ? 35.974  51.324  91.823  1.00 24.96 ? 297  ASP A CA  1 
ATOM   2283  C  C   . ASP A 1 297 ? 37.129  51.556  92.792  1.00 26.18 ? 297  ASP A C   1 
ATOM   2284  O  O   . ASP A 1 297 ? 37.658  52.665  92.885  1.00 27.60 ? 297  ASP A O   1 
ATOM   2285  C  CB  . ASP A 1 297 ? 36.439  50.476  90.628  1.00 24.61 ? 297  ASP A CB  1 
ATOM   2286  C  CG  . ASP A 1 297 ? 36.622  49.001  90.976  1.00 23.63 ? 297  ASP A CG  1 
ATOM   2287  O  OD1 . ASP A 1 297 ? 36.139  48.551  92.037  1.00 24.36 ? 297  ASP A OD1 1 
ATOM   2288  O  OD2 . ASP A 1 297 ? 37.245  48.281  90.170  1.00 23.97 ? 297  ASP A OD2 1 
ATOM   2289  N  N   . VAL A 1 298 ? 37.491  50.511  93.534  1.00 27.27 ? 298  VAL A N   1 
ATOM   2290  C  CA  . VAL A 1 298 ? 38.584  50.578  94.501  1.00 25.63 ? 298  VAL A CA  1 
ATOM   2291  C  C   . VAL A 1 298 ? 39.587  49.450  94.267  1.00 27.22 ? 298  VAL A C   1 
ATOM   2292  O  O   . VAL A 1 298 ? 39.366  48.568  93.434  1.00 27.13 ? 298  VAL A O   1 
ATOM   2293  C  CB  . VAL A 1 298 ? 38.067  50.488  95.960  1.00 23.59 ? 298  VAL A CB  1 
ATOM   2294  C  CG1 . VAL A 1 298 ? 37.103  51.629  96.258  1.00 21.26 ? 298  VAL A CG1 1 
ATOM   2295  C  CG2 . VAL A 1 298 ? 37.409  49.137  96.209  1.00 22.23 ? 298  VAL A CG2 1 
ATOM   2296  N  N   . GLY A 1 299 ? 40.684  49.483  95.017  1.00 29.11 ? 299  GLY A N   1 
ATOM   2297  C  CA  . GLY A 1 299 ? 41.710  48.465  94.893  1.00 31.91 ? 299  GLY A CA  1 
ATOM   2298  C  C   . GLY A 1 299 ? 42.558  48.379  96.145  1.00 33.85 ? 299  GLY A C   1 
ATOM   2299  O  O   . GLY A 1 299 ? 42.761  49.383  96.832  1.00 35.03 ? 299  GLY A O   1 
ATOM   2300  N  N   . GLY A 1 300 ? 43.050  47.179  96.445  1.00 34.90 ? 300  GLY A N   1 
ATOM   2301  C  CA  . GLY A 1 300 ? 43.876  46.980  97.624  1.00 37.02 ? 300  GLY A CA  1 
ATOM   2302  C  C   . GLY A 1 300 ? 45.217  47.687  97.545  1.00 38.41 ? 300  GLY A C   1 
ATOM   2303  O  O   . GLY A 1 300 ? 45.763  48.111  98.565  1.00 38.27 ? 300  GLY A O   1 
ATOM   2304  N  N   . ALA A 1 301 ? 45.744  47.812  96.330  1.00 39.40 ? 301  ALA A N   1 
ATOM   2305  C  CA  . ALA A 1 301 ? 47.025  48.471  96.099  1.00 40.45 ? 301  ALA A CA  1 
ATOM   2306  C  C   . ALA A 1 301 ? 46.847  49.887  95.553  1.00 41.69 ? 301  ALA A C   1 
ATOM   2307  O  O   . ALA A 1 301 ? 47.810  50.515  95.110  1.00 42.25 ? 301  ALA A O   1 
ATOM   2308  C  CB  . ALA A 1 301 ? 47.876  47.640  95.147  1.00 41.22 ? 301  ALA A CB  1 
ATOM   2309  N  N   . ILE A 1 302 ? 45.611  50.379  95.572  1.00 43.52 ? 302  ILE A N   1 
ATOM   2310  C  CA  . ILE A 1 302 ? 45.312  51.723  95.086  1.00 45.82 ? 302  ILE A CA  1 
ATOM   2311  C  C   . ILE A 1 302 ? 45.070  52.647  96.280  1.00 46.32 ? 302  ILE A C   1 
ATOM   2312  O  O   . ILE A 1 302 ? 43.952  52.742  96.791  1.00 46.42 ? 302  ILE A O   1 
ATOM   2313  C  CB  . ILE A 1 302 ? 44.065  51.733  94.162  1.00 46.73 ? 302  ILE A CB  1 
ATOM   2314  C  CG1 . ILE A 1 302 ? 44.178  50.644  93.088  1.00 47.06 ? 302  ILE A CG1 1 
ATOM   2315  C  CG2 . ILE A 1 302 ? 43.915  53.098  93.498  1.00 46.89 ? 302  ILE A CG2 1 
ATOM   2316  C  CD1 . ILE A 1 302 ? 45.356  50.804  92.151  1.00 46.96 ? 302  ILE A CD1 1 
ATOM   2317  N  N   . LYS A 1 303 ? 46.134  53.302  96.736  1.00 48.31 ? 303  LYS A N   1 
ATOM   2318  C  CA  . LYS A 1 303 ? 46.058  54.215  97.877  1.00 49.69 ? 303  LYS A CA  1 
ATOM   2319  C  C   . LYS A 1 303 ? 46.735  55.548  97.560  1.00 50.64 ? 303  LYS A C   1 
ATOM   2320  O  O   . LYS A 1 303 ? 47.685  55.603  96.776  1.00 50.78 ? 303  LYS A O   1 
ATOM   2321  C  CB  . LYS A 1 303 ? 46.727  53.591  99.110  1.00 49.60 ? 303  LYS A CB  1 
ATOM   2322  C  CG  . LYS A 1 303 ? 46.230  52.199  99.482  1.00 50.03 ? 303  LYS A CG  1 
ATOM   2323  C  CD  . LYS A 1 303 ? 44.745  52.191  99.815  1.00 51.26 ? 303  LYS A CD  1 
ATOM   2324  C  CE  . LYS A 1 303 ? 44.250  50.773  100.061 1.00 51.16 ? 303  LYS A CE  1 
ATOM   2325  N  NZ  . LYS A 1 303 ? 42.785  50.731  100.312 1.00 52.11 ? 303  LYS A NZ  1 
ATOM   2326  N  N   . GLY A 1 304 ? 46.236  56.618  98.176  1.00 51.24 ? 304  GLY A N   1 
ATOM   2327  C  CA  . GLY A 1 304 ? 46.797  57.943  97.969  1.00 51.72 ? 304  GLY A CA  1 
ATOM   2328  C  C   . GLY A 1 304 ? 46.649  58.493  96.562  1.00 52.35 ? 304  GLY A C   1 
ATOM   2329  O  O   . GLY A 1 304 ? 45.621  58.294  95.913  1.00 53.33 ? 304  GLY A O   1 
ATOM   2330  N  N   . GLN A 1 305 ? 47.679  59.201  96.103  1.00 52.63 ? 305  GLN A N   1 
ATOM   2331  C  CA  . GLN A 1 305 ? 47.699  59.800  94.767  1.00 52.16 ? 305  GLN A CA  1 
ATOM   2332  C  C   . GLN A 1 305 ? 48.004  58.721  93.725  1.00 50.71 ? 305  GLN A C   1 
ATOM   2333  O  O   . GLN A 1 305 ? 49.091  58.690  93.142  1.00 51.70 ? 305  GLN A O   1 
ATOM   2334  C  CB  . GLN A 1 305 ? 48.763  60.906  94.699  1.00 53.47 ? 305  GLN A CB  1 
ATOM   2335  C  CG  . GLN A 1 305 ? 48.622  62.016  95.745  1.00 53.99 ? 305  GLN A CG  1 
ATOM   2336  C  CD  . GLN A 1 305 ? 47.484  62.980  95.449  1.00 52.95 ? 305  GLN A CD  1 
ATOM   2337  O  OE1 . GLN A 1 305 ? 47.587  63.824  94.559  1.00 51.46 ? 305  GLN A OE1 1 
ATOM   2338  N  NE2 . GLN A 1 305 ? 46.398  62.869  96.208  1.00 52.70 ? 305  GLN A NE2 1 
ATOM   2339  N  N   . HIS A 1 306 ? 47.029  57.848  93.486  1.00 47.99 ? 306  HIS A N   1 
ATOM   2340  C  CA  . HIS A 1 306 ? 47.188  56.751  92.536  1.00 44.26 ? 306  HIS A CA  1 
ATOM   2341  C  C   . HIS A 1 306 ? 45.843  56.336  91.944  1.00 41.28 ? 306  HIS A C   1 
ATOM   2342  O  O   . HIS A 1 306 ? 44.834  56.275  92.650  1.00 40.21 ? 306  HIS A O   1 
ATOM   2343  C  CB  . HIS A 1 306 ? 47.843  55.558  93.243  1.00 45.27 ? 306  HIS A CB  1 
ATOM   2344  C  CG  . HIS A 1 306 ? 48.078  54.375  92.356  1.00 46.18 ? 306  HIS A CG  1 
ATOM   2345  N  ND1 . HIS A 1 306 ? 48.332  54.492  91.007  1.00 47.04 ? 306  HIS A ND1 1 
ATOM   2346  C  CD2 . HIS A 1 306 ? 48.107  53.049  92.631  1.00 46.81 ? 306  HIS A CD2 1 
ATOM   2347  C  CE1 . HIS A 1 306 ? 48.508  53.290  90.489  1.00 46.73 ? 306  HIS A CE1 1 
ATOM   2348  N  NE2 . HIS A 1 306 ? 48.376  52.397  91.453  1.00 46.42 ? 306  HIS A NE2 1 
ATOM   2349  N  N   . PHE A 1 307 ? 45.840  56.060  90.641  1.00 38.68 ? 307  PHE A N   1 
ATOM   2350  C  CA  . PHE A 1 307 ? 44.632  55.645  89.933  1.00 35.84 ? 307  PHE A CA  1 
ATOM   2351  C  C   . PHE A 1 307 ? 44.864  54.403  89.086  1.00 33.90 ? 307  PHE A C   1 
ATOM   2352  O  O   . PHE A 1 307 ? 45.969  54.166  88.597  1.00 33.12 ? 307  PHE A O   1 
ATOM   2353  C  CB  . PHE A 1 307 ? 44.117  56.768  89.026  1.00 35.14 ? 307  PHE A CB  1 
ATOM   2354  C  CG  . PHE A 1 307 ? 43.569  57.950  89.769  1.00 34.62 ? 307  PHE A CG  1 
ATOM   2355  C  CD1 . PHE A 1 307 ? 42.487  57.808  90.629  1.00 34.91 ? 307  PHE A CD1 1 
ATOM   2356  C  CD2 . PHE A 1 307 ? 44.134  59.209  89.610  1.00 34.82 ? 307  PHE A CD2 1 
ATOM   2357  C  CE1 . PHE A 1 307 ? 41.978  58.903  91.321  1.00 34.46 ? 307  PHE A CE1 1 
ATOM   2358  C  CE2 . PHE A 1 307 ? 43.632  60.308  90.298  1.00 34.57 ? 307  PHE A CE2 1 
ATOM   2359  C  CZ  . PHE A 1 307 ? 42.553  60.154  91.154  1.00 33.25 ? 307  PHE A CZ  1 
ATOM   2360  N  N   . ALA A 1 308 ? 43.808  53.613  88.922  1.00 32.75 ? 308  ALA A N   1 
ATOM   2361  C  CA  . ALA A 1 308 ? 43.857  52.402  88.116  1.00 30.82 ? 308  ALA A CA  1 
ATOM   2362  C  C   . ALA A 1 308 ? 42.852  52.566  86.986  1.00 29.70 ? 308  ALA A C   1 
ATOM   2363  O  O   . ALA A 1 308 ? 41.648  52.414  87.187  1.00 29.43 ? 308  ALA A O   1 
ATOM   2364  C  CB  . ALA A 1 308 ? 43.518  51.183  88.961  1.00 32.39 ? 308  ALA A CB  1 
ATOM   2365  N  N   . ILE A 1 309 ? 43.356  52.914  85.807  1.00 29.78 ? 309  ILE A N   1 
ATOM   2366  C  CA  . ILE A 1 309 ? 42.517  53.124  84.633  1.00 28.72 ? 309  ILE A CA  1 
ATOM   2367  C  C   . ILE A 1 309 ? 41.927  51.823  84.102  1.00 28.90 ? 309  ILE A C   1 
ATOM   2368  O  O   . ILE A 1 309 ? 42.660  50.903  83.732  1.00 30.24 ? 309  ILE A O   1 
ATOM   2369  C  CB  . ILE A 1 309 ? 43.311  53.802  83.492  1.00 27.99 ? 309  ILE A CB  1 
ATOM   2370  C  CG1 . ILE A 1 309 ? 43.985  55.078  84.001  1.00 26.33 ? 309  ILE A CG1 1 
ATOM   2371  C  CG2 . ILE A 1 309 ? 42.384  54.128  82.325  1.00 26.19 ? 309  ILE A CG2 1 
ATOM   2372  C  CD1 . ILE A 1 309 ? 44.926  55.713  83.001  1.00 25.23 ? 309  ILE A CD1 1 
ATOM   2373  N  N   . TYR A 1 310 ? 40.599  51.748  84.086  1.00 28.08 ? 310  TYR A N   1 
ATOM   2374  C  CA  . TYR A 1 310 ? 39.904  50.574  83.577  1.00 27.30 ? 310  TYR A CA  1 
ATOM   2375  C  C   . TYR A 1 310 ? 39.993  50.620  82.057  1.00 27.40 ? 310  TYR A C   1 
ATOM   2376  O  O   . TYR A 1 310 ? 39.361  51.459  81.418  1.00 26.97 ? 310  TYR A O   1 
ATOM   2377  C  CB  . TYR A 1 310 ? 38.439  50.580  84.020  1.00 27.13 ? 310  TYR A CB  1 
ATOM   2378  C  CG  . TYR A 1 310 ? 37.633  49.431  83.459  1.00 25.78 ? 310  TYR A CG  1 
ATOM   2379  C  CD1 . TYR A 1 310 ? 37.898  48.115  83.841  1.00 23.84 ? 310  TYR A CD1 1 
ATOM   2380  C  CD2 . TYR A 1 310 ? 36.620  49.657  82.529  1.00 24.62 ? 310  TYR A CD2 1 
ATOM   2381  C  CE1 . TYR A 1 310 ? 37.174  47.056  83.311  1.00 23.57 ? 310  TYR A CE1 1 
ATOM   2382  C  CE2 . TYR A 1 310 ? 35.890  48.604  81.992  1.00 24.93 ? 310  TYR A CE2 1 
ATOM   2383  C  CZ  . TYR A 1 310 ? 36.173  47.307  82.386  1.00 24.83 ? 310  TYR A CZ  1 
ATOM   2384  O  OH  . TYR A 1 310 ? 35.457  46.264  81.850  1.00 28.37 ? 310  TYR A OH  1 
ATOM   2385  N  N   . GLN A 1 311 ? 40.790  49.721  81.489  1.00 27.97 ? 311  GLN A N   1 
ATOM   2386  C  CA  . GLN A 1 311 ? 40.984  49.670  80.045  1.00 28.38 ? 311  GLN A CA  1 
ATOM   2387  C  C   . GLN A 1 311 ? 39.795  49.132  79.262  1.00 27.25 ? 311  GLN A C   1 
ATOM   2388  O  O   . GLN A 1 311 ? 39.445  49.678  78.216  1.00 28.57 ? 311  GLN A O   1 
ATOM   2389  C  CB  . GLN A 1 311 ? 42.245  48.877  79.710  1.00 31.35 ? 311  GLN A CB  1 
ATOM   2390  C  CG  . GLN A 1 311 ? 43.523  49.496  80.261  1.00 33.27 ? 311  GLN A CG  1 
ATOM   2391  C  CD  . GLN A 1 311 ? 43.801  50.884  79.711  1.00 34.39 ? 311  GLN A CD  1 
ATOM   2392  O  OE1 . GLN A 1 311 ? 43.535  51.169  78.545  1.00 34.81 ? 311  GLN A OE1 1 
ATOM   2393  N  NE2 . GLN A 1 311 ? 44.347  51.754  80.552  1.00 35.87 ? 311  GLN A NE2 1 
ATOM   2394  N  N   . GLY A 1 312 ? 39.189  48.054  79.752  1.00 27.03 ? 312  GLY A N   1 
ATOM   2395  C  CA  . GLY A 1 312 ? 38.042  47.486  79.065  1.00 26.62 ? 312  GLY A CA  1 
ATOM   2396  C  C   . GLY A 1 312 ? 37.881  45.985  79.196  1.00 25.85 ? 312  GLY A C   1 
ATOM   2397  O  O   . GLY A 1 312 ? 38.195  45.401  80.231  1.00 26.71 ? 312  GLY A O   1 
ATOM   2398  N  N   . ILE A 1 313 ? 37.380  45.363  78.133  1.00 27.58 ? 313  ILE A N   1 
ATOM   2399  C  CA  . ILE A 1 313 ? 37.150  43.922  78.098  1.00 27.68 ? 313  ILE A CA  1 
ATOM   2400  C  C   . ILE A 1 313 ? 37.855  43.309  76.890  1.00 29.63 ? 313  ILE A C   1 
ATOM   2401  O  O   . ILE A 1 313 ? 37.767  43.838  75.779  1.00 30.76 ? 313  ILE A O   1 
ATOM   2402  C  CB  . ILE A 1 313 ? 35.640  43.604  77.971  1.00 26.42 ? 313  ILE A CB  1 
ATOM   2403  C  CG1 . ILE A 1 313 ? 34.837  44.381  79.017  1.00 25.41 ? 313  ILE A CG1 1 
ATOM   2404  C  CG2 . ILE A 1 313 ? 35.404  42.107  78.122  1.00 25.30 ? 313  ILE A CG2 1 
ATOM   2405  C  CD1 . ILE A 1 313 ? 33.341  44.374  78.774  1.00 24.33 ? 313  ILE A CD1 1 
ATOM   2406  N  N   . GLY A 1 314 ? 38.554  42.198  77.110  1.00 30.09 ? 314  GLY A N   1 
ATOM   2407  C  CA  . GLY A 1 314 ? 39.239  41.531  76.017  1.00 32.36 ? 314  GLY A CA  1 
ATOM   2408  C  C   . GLY A 1 314 ? 40.756  41.540  76.064  1.00 34.36 ? 314  GLY A C   1 
ATOM   2409  O  O   . GLY A 1 314 ? 41.351  42.112  76.978  1.00 34.97 ? 314  GLY A O   1 
ATOM   2410  N  N   . PRO A 1 315 ? 41.410  40.900  75.076  1.00 35.08 ? 315  PRO A N   1 
ATOM   2411  C  CA  . PRO A 1 315 ? 42.867  40.790  74.940  1.00 35.20 ? 315  PRO A CA  1 
ATOM   2412  C  C   . PRO A 1 315 ? 43.550  42.138  74.728  1.00 34.87 ? 315  PRO A C   1 
ATOM   2413  O  O   . PRO A 1 315 ? 44.529  42.455  75.403  1.00 34.68 ? 315  PRO A O   1 
ATOM   2414  C  CB  . PRO A 1 315 ? 43.026  39.900  73.704  1.00 34.53 ? 315  PRO A CB  1 
ATOM   2415  C  CG  . PRO A 1 315 ? 41.780  39.081  73.709  1.00 34.80 ? 315  PRO A CG  1 
ATOM   2416  C  CD  . PRO A 1 315 ? 40.741  40.115  74.026  1.00 33.91 ? 315  PRO A CD  1 
ATOM   2417  N  N   . GLU A 1 316 ? 43.030  42.917  73.783  1.00 35.70 ? 316  GLU A N   1 
ATOM   2418  C  CA  . GLU A 1 316 ? 43.579  44.233  73.463  1.00 36.35 ? 316  GLU A CA  1 
ATOM   2419  C  C   . GLU A 1 316 ? 43.548  45.165  74.671  1.00 34.01 ? 316  GLU A C   1 
ATOM   2420  O  O   . GLU A 1 316 ? 44.451  45.980  74.860  1.00 33.11 ? 316  GLU A O   1 
ATOM   2421  C  CB  . GLU A 1 316 ? 42.820  44.851  72.287  1.00 40.67 ? 316  GLU A CB  1 
ATOM   2422  C  CG  . GLU A 1 316 ? 42.927  44.043  70.997  1.00 47.21 ? 316  GLU A CG  1 
ATOM   2423  C  CD  . GLU A 1 316 ? 42.123  44.638  69.857  1.00 51.21 ? 316  GLU A CD  1 
ATOM   2424  O  OE1 . GLU A 1 316 ? 42.525  45.699  69.332  1.00 53.65 ? 316  GLU A OE1 1 
ATOM   2425  O  OE2 . GLU A 1 316 ? 41.092  44.039  69.481  1.00 53.13 ? 316  GLU A OE2 1 
ATOM   2426  N  N   . ALA A 1 317 ? 42.509  45.031  75.489  1.00 33.32 ? 317  ALA A N   1 
ATOM   2427  C  CA  . ALA A 1 317 ? 42.365  45.842  76.693  1.00 32.70 ? 317  ALA A CA  1 
ATOM   2428  C  C   . ALA A 1 317 ? 43.369  45.376  77.749  1.00 32.06 ? 317  ALA A C   1 
ATOM   2429  O  O   . ALA A 1 317 ? 43.768  46.144  78.624  1.00 30.36 ? 317  ALA A O   1 
ATOM   2430  C  CB  . ALA A 1 317 ? 40.946  45.736  77.229  1.00 32.35 ? 317  ALA A CB  1 
ATOM   2431  N  N   . GLY A 1 318 ? 43.770  44.110  77.649  1.00 31.87 ? 318  GLY A N   1 
ATOM   2432  C  CA  . GLY A 1 318 ? 44.726  43.540  78.581  1.00 31.93 ? 318  GLY A CA  1 
ATOM   2433  C  C   . GLY A 1 318 ? 46.162  43.893  78.252  1.00 31.87 ? 318  GLY A C   1 
ATOM   2434  O  O   . GLY A 1 318 ? 46.978  44.085  79.153  1.00 32.60 ? 318  GLY A O   1 
ATOM   2435  N  N   . HIS A 1 319 ? 46.472  43.954  76.960  1.00 32.33 ? 319  HIS A N   1 
ATOM   2436  C  CA  . HIS A 1 319 ? 47.812  44.299  76.495  1.00 33.40 ? 319  HIS A CA  1 
ATOM   2437  C  C   . HIS A 1 319 ? 48.094  45.752  76.864  1.00 32.67 ? 319  HIS A C   1 
ATOM   2438  O  O   . HIS A 1 319 ? 49.195  46.101  77.287  1.00 31.69 ? 319  HIS A O   1 
ATOM   2439  C  CB  . HIS A 1 319 ? 47.909  44.141  74.974  1.00 34.94 ? 319  HIS A CB  1 
ATOM   2440  C  CG  . HIS A 1 319 ? 47.580  42.766  74.481  1.00 37.69 ? 319  HIS A CG  1 
ATOM   2441  N  ND1 . HIS A 1 319 ? 47.808  41.630  75.230  1.00 39.44 ? 319  HIS A ND1 1 
ATOM   2442  C  CD2 . HIS A 1 319 ? 47.039  42.345  73.314  1.00 38.98 ? 319  HIS A CD2 1 
ATOM   2443  C  CE1 . HIS A 1 319 ? 47.421  40.570  74.544  1.00 40.63 ? 319  HIS A CE1 1 
ATOM   2444  N  NE2 . HIS A 1 319 ? 46.951  40.975  73.378  1.00 40.45 ? 319  HIS A NE2 1 
ATOM   2445  N  N   . ARG A 1 320 ? 47.069  46.582  76.710  1.00 32.72 ? 320  ARG A N   1 
ATOM   2446  C  CA  . ARG A 1 320 ? 47.142  48.005  77.005  1.00 33.28 ? 320  ARG A CA  1 
ATOM   2447  C  C   . ARG A 1 320 ? 47.251  48.269  78.510  1.00 32.61 ? 320  ARG A C   1 
ATOM   2448  O  O   . ARG A 1 320 ? 47.961  49.179  78.934  1.00 33.56 ? 320  ARG A O   1 
ATOM   2449  C  CB  . ARG A 1 320 ? 45.905  48.693  76.415  1.00 33.71 ? 320  ARG A CB  1 
ATOM   2450  C  CG  . ARG A 1 320 ? 45.899  50.209  76.468  1.00 35.58 ? 320  ARG A CG  1 
ATOM   2451  C  CD  . ARG A 1 320 ? 44.776  50.776  75.600  1.00 35.13 ? 320  ARG A CD  1 
ATOM   2452  N  NE  . ARG A 1 320 ? 43.461  50.249  75.964  1.00 35.48 ? 320  ARG A NE  1 
ATOM   2453  C  CZ  . ARG A 1 320 ? 42.616  49.672  75.112  1.00 34.90 ? 320  ARG A CZ  1 
ATOM   2454  N  NH1 . ARG A 1 320 ? 42.938  49.540  73.832  1.00 36.86 ? 320  ARG A NH1 1 
ATOM   2455  N  NH2 . ARG A 1 320 ? 41.445  49.223  75.540  1.00 35.64 ? 320  ARG A NH2 1 
ATOM   2456  N  N   . ALA A 1 321 ? 46.579  47.441  79.307  1.00 32.87 ? 321  ALA A N   1 
ATOM   2457  C  CA  . ALA A 1 321 ? 46.577  47.570  80.766  1.00 32.20 ? 321  ALA A CA  1 
ATOM   2458  C  C   . ALA A 1 321 ? 47.851  47.066  81.445  1.00 32.87 ? 321  ALA A C   1 
ATOM   2459  O  O   . ALA A 1 321 ? 48.293  47.635  82.445  1.00 32.47 ? 321  ALA A O   1 
ATOM   2460  C  CB  . ALA A 1 321 ? 45.368  46.853  81.349  1.00 31.69 ? 321  ALA A CB  1 
ATOM   2461  N  N   . GLY A 1 322 ? 48.419  45.986  80.912  1.00 32.76 ? 322  GLY A N   1 
ATOM   2462  C  CA  . GLY A 1 322 ? 49.625  45.409  81.481  1.00 33.19 ? 322  GLY A CA  1 
ATOM   2463  C  C   . GLY A 1 322 ? 50.849  46.305  81.457  1.00 34.50 ? 322  GLY A C   1 
ATOM   2464  O  O   . GLY A 1 322 ? 51.732  46.175  82.306  1.00 35.49 ? 322  GLY A O   1 
ATOM   2465  N  N   . TRP A 1 323 ? 50.906  47.213  80.486  1.00 35.50 ? 323  TRP A N   1 
ATOM   2466  C  CA  . TRP A 1 323 ? 52.036  48.129  80.349  1.00 35.80 ? 323  TRP A CA  1 
ATOM   2467  C  C   . TRP A 1 323 ? 51.905  49.397  81.190  1.00 36.58 ? 323  TRP A C   1 
ATOM   2468  O  O   . TRP A 1 323 ? 52.909  50.008  81.556  1.00 36.87 ? 323  TRP A O   1 
ATOM   2469  C  CB  . TRP A 1 323 ? 52.238  48.515  78.877  1.00 34.78 ? 323  TRP A CB  1 
ATOM   2470  C  CG  . TRP A 1 323 ? 52.692  47.384  77.988  1.00 33.99 ? 323  TRP A CG  1 
ATOM   2471  C  CD1 . TRP A 1 323 ? 52.061  46.916  76.870  1.00 33.42 ? 323  TRP A CD1 1 
ATOM   2472  C  CD2 . TRP A 1 323 ? 53.873  46.584  78.146  1.00 34.61 ? 323  TRP A CD2 1 
ATOM   2473  N  NE1 . TRP A 1 323 ? 52.772  45.873  76.324  1.00 33.23 ? 323  TRP A NE1 1 
ATOM   2474  C  CE2 . TRP A 1 323 ? 53.888  45.648  77.086  1.00 34.18 ? 323  TRP A CE2 1 
ATOM   2475  C  CE3 . TRP A 1 323 ? 54.919  46.567  79.079  1.00 32.89 ? 323  TRP A CE3 1 
ATOM   2476  C  CZ2 . TRP A 1 323 ? 54.909  44.703  76.936  1.00 33.74 ? 323  TRP A CZ2 1 
ATOM   2477  C  CZ3 . TRP A 1 323 ? 55.934  45.627  78.929  1.00 31.37 ? 323  TRP A CZ3 1 
ATOM   2478  C  CH2 . TRP A 1 323 ? 55.920  44.708  77.864  1.00 32.77 ? 323  TRP A CH2 1 
ATOM   2479  N  N   . TYR A 1 324 ? 50.670  49.776  81.509  1.00 38.78 ? 324  TYR A N   1 
ATOM   2480  C  CA  . TYR A 1 324 ? 50.402  50.987  82.281  1.00 40.75 ? 324  TYR A CA  1 
ATOM   2481  C  C   . TYR A 1 324 ? 50.885  51.051  83.730  1.00 42.87 ? 324  TYR A C   1 
ATOM   2482  O  O   . TYR A 1 324 ? 50.319  50.421  84.629  1.00 43.87 ? 324  TYR A O   1 
ATOM   2483  C  CB  . TYR A 1 324 ? 48.919  51.361  82.194  1.00 39.75 ? 324  TYR A CB  1 
ATOM   2484  C  CG  . TYR A 1 324 ? 48.612  52.344  81.084  1.00 40.13 ? 324  TYR A CG  1 
ATOM   2485  C  CD1 . TYR A 1 324 ? 49.106  53.648  81.130  1.00 40.20 ? 324  TYR A CD1 1 
ATOM   2486  C  CD2 . TYR A 1 324 ? 47.831  51.975  79.987  1.00 39.26 ? 324  TYR A CD2 1 
ATOM   2487  C  CE1 . TYR A 1 324 ? 48.832  54.559  80.116  1.00 40.02 ? 324  TYR A CE1 1 
ATOM   2488  C  CE2 . TYR A 1 324 ? 47.550  52.882  78.965  1.00 39.79 ? 324  TYR A CE2 1 
ATOM   2489  C  CZ  . TYR A 1 324 ? 48.054  54.172  79.036  1.00 40.58 ? 324  TYR A CZ  1 
ATOM   2490  O  OH  . TYR A 1 324 ? 47.783  55.075  78.032  1.00 39.13 ? 324  TYR A OH  1 
ATOM   2491  N  N   . ASN A 1 325 ? 51.984  51.777  83.917  1.00 44.44 ? 325  ASN A N   1 
ATOM   2492  C  CA  . ASN A 1 325 ? 52.592  52.007  85.225  1.00 45.77 ? 325  ASN A CA  1 
ATOM   2493  C  C   . ASN A 1 325 ? 53.275  53.378  85.172  1.00 46.68 ? 325  ASN A C   1 
ATOM   2494  O  O   . ASN A 1 325 ? 54.342  53.583  85.758  1.00 46.92 ? 325  ASN A O   1 
ATOM   2495  C  CB  . ASN A 1 325 ? 53.613  50.911  85.550  1.00 45.45 ? 325  ASN A CB  1 
ATOM   2496  C  CG  . ASN A 1 325 ? 53.986  50.878  87.024  1.00 45.41 ? 325  ASN A CG  1 
ATOM   2497  O  OD1 . ASN A 1 325 ? 53.644  51.785  87.787  1.00 43.80 ? 325  ASN A OD1 1 
ATOM   2498  N  ND2 . ASN A 1 325 ? 54.683  49.824  87.432  1.00 47.16 ? 325  ASN A ND2 1 
ATOM   2499  N  N   . HIS A 1 326 ? 52.639  54.313  84.466  1.00 46.83 ? 326  HIS A N   1 
ATOM   2500  C  CA  . HIS A 1 326 ? 53.171  55.662  84.280  1.00 45.46 ? 326  HIS A CA  1 
ATOM   2501  C  C   . HIS A 1 326 ? 52.514  56.748  85.134  1.00 43.51 ? 326  HIS A C   1 
ATOM   2502  O  O   . HIS A 1 326 ? 51.719  56.457  86.027  1.00 43.54 ? 326  HIS A O   1 
ATOM   2503  C  CB  . HIS A 1 326 ? 53.091  56.038  82.798  1.00 46.76 ? 326  HIS A CB  1 
ATOM   2504  C  CG  . HIS A 1 326 ? 53.846  55.108  81.899  1.00 46.29 ? 326  HIS A CG  1 
ATOM   2505  N  ND1 . HIS A 1 326 ? 53.795  53.738  82.037  1.00 46.06 ? 326  HIS A ND1 1 
ATOM   2506  C  CD2 . HIS A 1 326 ? 54.687  55.351  80.867  1.00 47.26 ? 326  HIS A CD2 1 
ATOM   2507  C  CE1 . HIS A 1 326 ? 54.576  53.177  81.132  1.00 48.24 ? 326  HIS A CE1 1 
ATOM   2508  N  NE2 . HIS A 1 326 ? 55.129  54.134  80.409  1.00 48.45 ? 326  HIS A NE2 1 
ATOM   2509  N  N   . TYR A 1 327 ? 52.866  58.001  84.848  1.00 41.19 ? 327  TYR A N   1 
ATOM   2510  C  CA  . TYR A 1 327 ? 52.344  59.157  85.573  1.00 39.13 ? 327  TYR A CA  1 
ATOM   2511  C  C   . TYR A 1 327 ? 51.690  60.181  84.652  1.00 38.75 ? 327  TYR A C   1 
ATOM   2512  O  O   . TYR A 1 327 ? 51.970  60.223  83.454  1.00 38.74 ? 327  TYR A O   1 
ATOM   2513  C  CB  . TYR A 1 327 ? 53.471  59.837  86.354  1.00 38.35 ? 327  TYR A CB  1 
ATOM   2514  C  CG  . TYR A 1 327 ? 54.041  58.994  87.467  1.00 38.42 ? 327  TYR A CG  1 
ATOM   2515  C  CD1 . TYR A 1 327 ? 55.008  58.025  87.209  1.00 38.92 ? 327  TYR A CD1 1 
ATOM   2516  C  CD2 . TYR A 1 327 ? 53.603  59.156  88.779  1.00 39.21 ? 327  TYR A CD2 1 
ATOM   2517  C  CE1 . TYR A 1 327 ? 55.522  57.235  88.230  1.00 41.04 ? 327  TYR A CE1 1 
ATOM   2518  C  CE2 . TYR A 1 327 ? 54.109  58.374  89.808  1.00 40.49 ? 327  TYR A CE2 1 
ATOM   2519  C  CZ  . TYR A 1 327 ? 55.068  57.414  89.528  1.00 41.58 ? 327  TYR A CZ  1 
ATOM   2520  O  OH  . TYR A 1 327 ? 55.565  56.632  90.546  1.00 44.12 ? 327  TYR A OH  1 
ATOM   2521  N  N   . GLY A 1 328 ? 50.841  61.026  85.231  1.00 38.24 ? 328  GLY A N   1 
ATOM   2522  C  CA  . GLY A 1 328 ? 50.157  62.050  84.461  1.00 39.23 ? 328  GLY A CA  1 
ATOM   2523  C  C   . GLY A 1 328 ? 49.383  62.999  85.355  1.00 40.62 ? 328  GLY A C   1 
ATOM   2524  O  O   . GLY A 1 328 ? 49.090  62.677  86.506  1.00 41.70 ? 328  GLY A O   1 
ATOM   2525  N  N   . ARG A 1 329 ? 49.045  64.171  84.825  1.00 40.93 ? 329  ARG A N   1 
ATOM   2526  C  CA  . ARG A 1 329 ? 48.302  65.177  85.579  1.00 39.93 ? 329  ARG A CA  1 
ATOM   2527  C  C   . ARG A 1 329 ? 46.797  64.911  85.540  1.00 38.76 ? 329  ARG A C   1 
ATOM   2528  O  O   . ARG A 1 329 ? 46.287  64.338  84.577  1.00 37.45 ? 329  ARG A O   1 
ATOM   2529  C  CB  . ARG A 1 329 ? 48.600  66.570  85.021  1.00 40.72 ? 329  ARG A CB  1 
ATOM   2530  C  CG  . ARG A 1 329 ? 50.083  66.900  84.934  1.00 40.24 ? 329  ARG A CG  1 
ATOM   2531  C  CD  . ARG A 1 329 ? 50.324  68.193  84.173  1.00 41.59 ? 329  ARG A CD  1 
ATOM   2532  N  NE  . ARG A 1 329 ? 49.791  68.150  82.812  1.00 43.10 ? 329  ARG A NE  1 
ATOM   2533  C  CZ  . ARG A 1 329 ? 50.536  68.098  81.710  1.00 43.99 ? 329  ARG A CZ  1 
ATOM   2534  N  NH1 . ARG A 1 329 ? 51.859  68.080  81.792  1.00 43.65 ? 329  ARG A NH1 1 
ATOM   2535  N  NH2 . ARG A 1 329 ? 49.955  68.072  80.519  1.00 43.75 ? 329  ARG A NH2 1 
ATOM   2536  N  N   . VAL A 1 330 ? 46.094  65.330  86.590  1.00 38.41 ? 330  VAL A N   1 
ATOM   2537  C  CA  . VAL A 1 330 ? 44.647  65.145  86.677  1.00 38.23 ? 330  VAL A CA  1 
ATOM   2538  C  C   . VAL A 1 330 ? 43.985  66.244  87.510  1.00 38.77 ? 330  VAL A C   1 
ATOM   2539  O  O   . VAL A 1 330 ? 44.510  66.661  88.545  1.00 39.45 ? 330  VAL A O   1 
ATOM   2540  C  CB  . VAL A 1 330 ? 44.283  63.745  87.248  1.00 38.50 ? 330  VAL A CB  1 
ATOM   2541  C  CG1 . VAL A 1 330 ? 44.849  63.570  88.637  1.00 37.40 ? 330  VAL A CG1 1 
ATOM   2542  C  CG2 . VAL A 1 330 ? 42.775  63.545  87.257  1.00 37.26 ? 330  VAL A CG2 1 
ATOM   2543  N  N   . TRP A 1 331 ? 42.840  66.724  87.030  1.00 38.40 ? 331  TRP A N   1 
ATOM   2544  C  CA  . TRP A 1 331 ? 42.088  67.777  87.706  1.00 36.51 ? 331  TRP A CA  1 
ATOM   2545  C  C   . TRP A 1 331 ? 40.715  67.280  88.147  1.00 35.51 ? 331  TRP A C   1 
ATOM   2546  O  O   . TRP A 1 331 ? 39.989  66.657  87.371  1.00 34.80 ? 331  TRP A O   1 
ATOM   2547  C  CB  . TRP A 1 331 ? 41.916  68.989  86.781  1.00 36.52 ? 331  TRP A CB  1 
ATOM   2548  C  CG  . TRP A 1 331 ? 43.202  69.653  86.378  1.00 37.87 ? 331  TRP A CG  1 
ATOM   2549  C  CD1 . TRP A 1 331 ? 43.752  70.774  86.931  1.00 37.39 ? 331  TRP A CD1 1 
ATOM   2550  C  CD2 . TRP A 1 331 ? 44.098  69.240  85.336  1.00 37.90 ? 331  TRP A CD2 1 
ATOM   2551  N  NE1 . TRP A 1 331 ? 44.934  71.084  86.303  1.00 38.08 ? 331  TRP A NE1 1 
ATOM   2552  C  CE2 . TRP A 1 331 ? 45.172  70.158  85.320  1.00 38.18 ? 331  TRP A CE2 1 
ATOM   2553  C  CE3 . TRP A 1 331 ? 44.098  68.183  84.414  1.00 37.20 ? 331  TRP A CE3 1 
ATOM   2554  C  CZ2 . TRP A 1 331 ? 46.237  70.052  84.418  1.00 36.60 ? 331  TRP A CZ2 1 
ATOM   2555  C  CZ3 . TRP A 1 331 ? 45.157  68.079  83.516  1.00 35.91 ? 331  TRP A CZ3 1 
ATOM   2556  C  CH2 . TRP A 1 331 ? 46.212  69.010  83.526  1.00 36.09 ? 331  TRP A CH2 1 
ATOM   2557  N  N   . VAL A 1 332 ? 40.372  67.550  89.402  1.00 35.39 ? 332  VAL A N   1 
ATOM   2558  C  CA  . VAL A 1 332 ? 39.081  67.152  89.954  1.00 33.61 ? 332  VAL A CA  1 
ATOM   2559  C  C   . VAL A 1 332 ? 38.062  68.245  89.635  1.00 33.31 ? 332  VAL A C   1 
ATOM   2560  O  O   . VAL A 1 332 ? 38.076  69.318  90.239  1.00 31.76 ? 332  VAL A O   1 
ATOM   2561  C  CB  . VAL A 1 332 ? 39.162  66.949  91.483  1.00 32.65 ? 332  VAL A CB  1 
ATOM   2562  C  CG1 . VAL A 1 332 ? 37.809  66.525  92.032  1.00 32.25 ? 332  VAL A CG1 1 
ATOM   2563  C  CG2 . VAL A 1 332 ? 40.223  65.913  91.819  1.00 30.83 ? 332  VAL A CG2 1 
ATOM   2564  N  N   . LEU A 1 333 ? 37.190  67.966  88.670  1.00 33.10 ? 333  LEU A N   1 
ATOM   2565  C  CA  . LEU A 1 333 ? 36.173  68.920  88.245  1.00 32.82 ? 333  LEU A CA  1 
ATOM   2566  C  C   . LEU A 1 333 ? 34.978  68.994  89.192  1.00 35.34 ? 333  LEU A C   1 
ATOM   2567  O  O   . LEU A 1 333 ? 34.306  67.993  89.441  1.00 35.53 ? 333  LEU A O   1 
ATOM   2568  C  CB  . LEU A 1 333 ? 35.702  68.590  86.827  1.00 31.25 ? 333  LEU A CB  1 
ATOM   2569  C  CG  . LEU A 1 333 ? 36.796  68.495  85.757  1.00 29.22 ? 333  LEU A CG  1 
ATOM   2570  C  CD1 . LEU A 1 333 ? 36.173  68.220  84.399  1.00 29.46 ? 333  LEU A CD1 1 
ATOM   2571  C  CD2 . LEU A 1 333 ? 37.609  69.778  85.719  1.00 29.42 ? 333  LEU A CD2 1 
ATOM   2572  N  N   . LYS A 1 334 ? 34.728  70.191  89.718  1.00 37.44 ? 334  LYS A N   1 
ATOM   2573  C  CA  . LYS A 1 334 ? 33.618  70.433  90.639  1.00 38.57 ? 334  LYS A CA  1 
ATOM   2574  C  C   . LYS A 1 334 ? 32.834  71.673  90.212  1.00 39.35 ? 334  LYS A C   1 
ATOM   2575  O  O   . LYS A 1 334 ? 33.245  72.392  89.302  1.00 40.02 ? 334  LYS A O   1 
ATOM   2576  C  CB  . LYS A 1 334 ? 34.134  70.621  92.069  1.00 39.14 ? 334  LYS A CB  1 
ATOM   2577  C  CG  . LYS A 1 334 ? 34.806  69.393  92.664  1.00 39.48 ? 334  LYS A CG  1 
ATOM   2578  C  CD  . LYS A 1 334 ? 35.255  69.635  94.097  1.00 41.82 ? 334  LYS A CD  1 
ATOM   2579  C  CE  . LYS A 1 334 ? 34.076  69.916  95.020  1.00 42.18 ? 334  LYS A CE  1 
ATOM   2580  N  NZ  . LYS A 1 334 ? 34.511  70.144  96.427  1.00 43.00 ? 334  LYS A NZ  1 
ATOM   2581  N  N   . THR A 1 335 ? 31.704  71.915  90.872  1.00 40.45 ? 335  THR A N   1 
ATOM   2582  C  CA  . THR A 1 335 ? 30.863  73.070  90.562  1.00 40.82 ? 335  THR A CA  1 
ATOM   2583  C  C   . THR A 1 335 ? 31.376  74.349  91.213  1.00 41.35 ? 335  THR A C   1 
ATOM   2584  O  O   . THR A 1 335 ? 31.882  74.327  92.338  1.00 40.33 ? 335  THR A O   1 
ATOM   2585  C  CB  . THR A 1 335 ? 29.404  72.847  91.005  1.00 40.41 ? 335  THR A CB  1 
ATOM   2586  O  OG1 . THR A 1 335 ? 29.362  72.560  92.409  1.00 40.29 ? 335  THR A OG1 1 
ATOM   2587  C  CG2 . THR A 1 335 ? 28.786  71.700  90.231  1.00 40.45 ? 335  THR A CG2 1 
ATOM   2588  N  N   . ALA A 1 336 ? 31.242  75.461  90.493  1.00 41.83 ? 336  ALA A N   1 
ATOM   2589  C  CA  . ALA A 1 336 ? 31.684  76.764  90.979  1.00 42.16 ? 336  ALA A CA  1 
ATOM   2590  C  C   . ALA A 1 336 ? 30.703  77.331  92.001  1.00 42.18 ? 336  ALA A C   1 
ATOM   2591  O  O   . ALA A 1 336 ? 29.506  77.440  91.730  1.00 43.51 ? 336  ALA A O   1 
ATOM   2592  C  CB  . ALA A 1 336 ? 31.850  77.729  89.815  1.00 40.51 ? 336  ALA A CB  1 
ATOM   2593  N  N   . PRO A 1 337 ? 31.202  77.692  93.198  1.00 42.45 ? 337  PRO A N   1 
ATOM   2594  C  CA  . PRO A 1 337 ? 30.402  78.254  94.294  1.00 41.81 ? 337  PRO A CA  1 
ATOM   2595  C  C   . PRO A 1 337 ? 29.954  79.705  94.068  1.00 41.04 ? 337  PRO A C   1 
ATOM   2596  O  O   . PRO A 1 337 ? 29.683  80.398  95.071  1.00 41.57 ? 337  PRO A O   1 
ATOM   2597  C  CB  . PRO A 1 337 ? 31.348  78.139  95.488  1.00 41.74 ? 337  PRO A CB  1 
ATOM   2598  C  CG  . PRO A 1 337 ? 32.685  78.359  94.862  1.00 42.18 ? 337  PRO A CG  1 
ATOM   2599  C  CD  . PRO A 1 337 ? 32.600  77.498  93.625  1.00 41.39 ? 337  PRO A CD  1 
ATOM   2600  N  N   . SER B 1 3   ? 24.042  -12.913 57.449  1.00 44.02 ? 3    SER B N   1 
ATOM   2601  C  CA  . SER B 1 3   ? 23.421  -12.496 58.739  1.00 44.19 ? 3    SER B CA  1 
ATOM   2602  C  C   . SER B 1 3   ? 22.990  -11.032 58.703  1.00 44.72 ? 3    SER B C   1 
ATOM   2603  O  O   . SER B 1 3   ? 23.657  -10.193 58.093  1.00 45.13 ? 3    SER B O   1 
ATOM   2604  C  CB  . SER B 1 3   ? 24.398  -12.716 59.897  1.00 43.45 ? 3    SER B CB  1 
ATOM   2605  O  OG  . SER B 1 3   ? 24.761  -14.080 60.010  1.00 43.95 ? 3    SER B OG  1 
ATOM   2606  N  N   . LYS B 1 4   ? 21.866  -10.739 59.354  1.00 45.17 ? 4    LYS B N   1 
ATOM   2607  C  CA  . LYS B 1 4   ? 21.327  -9.383  59.417  1.00 44.52 ? 4    LYS B CA  1 
ATOM   2608  C  C   . LYS B 1 4   ? 22.174  -8.526  60.355  1.00 44.59 ? 4    LYS B C   1 
ATOM   2609  O  O   . LYS B 1 4   ? 22.253  -8.798  61.556  1.00 44.72 ? 4    LYS B O   1 
ATOM   2610  C  CB  . LYS B 1 4   ? 19.881  -9.408  59.919  1.00 45.23 ? 4    LYS B CB  1 
ATOM   2611  C  CG  . LYS B 1 4   ? 18.930  -10.258 59.091  1.00 44.91 ? 4    LYS B CG  1 
ATOM   2612  C  CD  . LYS B 1 4   ? 17.533  -10.240 59.692  1.00 44.26 ? 4    LYS B CD  1 
ATOM   2613  C  CE  . LYS B 1 4   ? 16.585  -11.159 58.940  1.00 46.98 ? 4    LYS B CE  1 
ATOM   2614  N  NZ  . LYS B 1 4   ? 16.994  -12.589 59.033  1.00 49.00 ? 4    LYS B NZ  1 
ATOM   2615  N  N   . PRO B 1 5   ? 22.821  -7.478  59.818  1.00 44.18 ? 5    PRO B N   1 
ATOM   2616  C  CA  . PRO B 1 5   ? 23.665  -6.582  60.615  1.00 43.96 ? 5    PRO B CA  1 
ATOM   2617  C  C   . PRO B 1 5   ? 22.884  -5.751  61.631  1.00 44.29 ? 5    PRO B C   1 
ATOM   2618  O  O   . PRO B 1 5   ? 21.816  -5.220  61.327  1.00 43.70 ? 5    PRO B O   1 
ATOM   2619  C  CB  . PRO B 1 5   ? 24.321  -5.700  59.551  1.00 43.20 ? 5    PRO B CB  1 
ATOM   2620  C  CG  . PRO B 1 5   ? 23.280  -5.635  58.484  1.00 43.13 ? 5    PRO B CG  1 
ATOM   2621  C  CD  . PRO B 1 5   ? 22.819  -7.068  58.402  1.00 43.72 ? 5    PRO B CD  1 
ATOM   2622  N  N   . THR B 1 6   ? 23.419  -5.674  62.846  1.00 45.69 ? 6    THR B N   1 
ATOM   2623  C  CA  . THR B 1 6   ? 22.807  -4.911  63.933  1.00 46.27 ? 6    THR B CA  1 
ATOM   2624  C  C   . THR B 1 6   ? 23.886  -4.215  64.766  1.00 47.28 ? 6    THR B C   1 
ATOM   2625  O  O   . THR B 1 6   ? 23.605  -3.672  65.838  1.00 46.80 ? 6    THR B O   1 
ATOM   2626  C  CB  . THR B 1 6   ? 21.962  -5.815  64.864  1.00 45.36 ? 6    THR B CB  1 
ATOM   2627  O  OG1 . THR B 1 6   ? 22.764  -6.905  65.335  1.00 45.72 ? 6    THR B OG1 1 
ATOM   2628  C  CG2 . THR B 1 6   ? 20.740  -6.358  64.134  1.00 44.65 ? 6    THR B CG2 1 
ATOM   2629  N  N   . ASP B 1 7   ? 25.119  -4.241  64.261  1.00 47.87 ? 7    ASP B N   1 
ATOM   2630  C  CA  . ASP B 1 7   ? 26.261  -3.622  64.931  1.00 47.95 ? 7    ASP B CA  1 
ATOM   2631  C  C   . ASP B 1 7   ? 26.162  -2.101  64.865  1.00 47.34 ? 7    ASP B C   1 
ATOM   2632  O  O   . ASP B 1 7   ? 26.566  -1.400  65.796  1.00 47.45 ? 7    ASP B O   1 
ATOM   2633  C  CB  . ASP B 1 7   ? 27.568  -4.089  64.279  1.00 49.69 ? 7    ASP B CB  1 
ATOM   2634  C  CG  . ASP B 1 7   ? 28.800  -3.560  64.991  1.00 51.98 ? 7    ASP B CG  1 
ATOM   2635  O  OD1 . ASP B 1 7   ? 29.189  -4.146  66.025  1.00 52.74 ? 7    ASP B OD1 1 
ATOM   2636  O  OD2 . ASP B 1 7   ? 29.381  -2.560  64.516  1.00 53.03 ? 7    ASP B OD2 1 
ATOM   2637  N  N   . ARG B 1 8   ? 25.634  -1.605  63.750  1.00 47.04 ? 8    ARG B N   1 
ATOM   2638  C  CA  . ARG B 1 8   ? 25.459  -0.174  63.531  1.00 45.56 ? 8    ARG B CA  1 
ATOM   2639  C  C   . ARG B 1 8   ? 24.245  0.326   64.312  1.00 44.00 ? 8    ARG B C   1 
ATOM   2640  O  O   . ARG B 1 8   ? 24.362  1.219   65.147  1.00 44.21 ? 8    ARG B O   1 
ATOM   2641  C  CB  . ARG B 1 8   ? 25.267  0.109   62.038  1.00 47.43 ? 8    ARG B CB  1 
ATOM   2642  C  CG  . ARG B 1 8   ? 26.431  -0.313  61.144  1.00 47.41 ? 8    ARG B CG  1 
ATOM   2643  C  CD  . ARG B 1 8   ? 27.540  0.731   61.109  1.00 47.16 ? 8    ARG B CD  1 
ATOM   2644  N  NE  . ARG B 1 8   ? 28.187  0.905   62.406  1.00 47.63 ? 8    ARG B NE  1 
ATOM   2645  C  CZ  . ARG B 1 8   ? 29.069  1.861   62.681  1.00 47.38 ? 8    ARG B CZ  1 
ATOM   2646  N  NH1 . ARG B 1 8   ? 29.415  2.741   61.749  1.00 48.14 ? 8    ARG B NH1 1 
ATOM   2647  N  NH2 . ARG B 1 8   ? 29.607  1.937   63.889  1.00 48.14 ? 8    ARG B NH2 1 
ATOM   2648  N  N   . GLY B 1 9   ? 23.084  -0.262  64.037  1.00 43.15 ? 9    GLY B N   1 
ATOM   2649  C  CA  . GLY B 1 9   ? 21.866  0.131   64.723  1.00 41.04 ? 9    GLY B CA  1 
ATOM   2650  C  C   . GLY B 1 9   ? 20.614  -0.220  63.945  1.00 39.81 ? 9    GLY B C   1 
ATOM   2651  O  O   . GLY B 1 9   ? 19.609  0.486   64.024  1.00 40.54 ? 9    GLY B O   1 
ATOM   2652  N  N   . GLN B 1 10  ? 20.674  -1.318  63.197  1.00 39.00 ? 10   GLN B N   1 
ATOM   2653  C  CA  . GLN B 1 10  ? 19.547  -1.770  62.387  1.00 37.88 ? 10   GLN B CA  1 
ATOM   2654  C  C   . GLN B 1 10  ? 18.531  -2.586  63.185  1.00 38.13 ? 10   GLN B C   1 
ATOM   2655  O  O   . GLN B 1 10  ? 18.866  -3.203  64.200  1.00 36.75 ? 10   GLN B O   1 
ATOM   2656  C  CB  . GLN B 1 10  ? 20.041  -2.593  61.191  1.00 37.67 ? 10   GLN B CB  1 
ATOM   2657  C  CG  . GLN B 1 10  ? 21.012  -1.867  60.260  1.00 36.20 ? 10   GLN B CG  1 
ATOM   2658  C  CD  . GLN B 1 10  ? 22.469  -1.977  60.694  1.00 34.48 ? 10   GLN B CD  1 
ATOM   2659  O  OE1 . GLN B 1 10  ? 22.773  -2.179  61.870  1.00 31.97 ? 10   GLN B OE1 1 
ATOM   2660  N  NE2 . GLN B 1 10  ? 23.378  -1.849  59.735  1.00 34.73 ? 10   GLN B NE2 1 
ATOM   2661  N  N   . GLN B 1 11  ? 17.290  -2.586  62.703  1.00 38.27 ? 11   GLN B N   1 
ATOM   2662  C  CA  . GLN B 1 11  ? 16.194  -3.314  63.336  1.00 37.62 ? 11   GLN B CA  1 
ATOM   2663  C  C   . GLN B 1 11  ? 15.261  -3.871  62.260  1.00 37.60 ? 11   GLN B C   1 
ATOM   2664  O  O   . GLN B 1 11  ? 14.823  -3.143  61.366  1.00 37.81 ? 11   GLN B O   1 
ATOM   2665  C  CB  . GLN B 1 11  ? 15.420  -2.388  64.276  1.00 38.90 ? 11   GLN B CB  1 
ATOM   2666  C  CG  . GLN B 1 11  ? 14.316  -3.079  65.056  1.00 42.04 ? 11   GLN B CG  1 
ATOM   2667  C  CD  . GLN B 1 11  ? 13.539  -2.124  65.940  1.00 43.73 ? 11   GLN B CD  1 
ATOM   2668  O  OE1 . GLN B 1 11  ? 12.407  -1.752  65.626  1.00 43.70 ? 11   GLN B OE1 1 
ATOM   2669  N  NE2 . GLN B 1 11  ? 14.143  -1.722  67.053  1.00 43.52 ? 11   GLN B NE2 1 
ATOM   2670  N  N   . TYR B 1 12  ? 14.963  -5.165  62.352  1.00 37.44 ? 12   TYR B N   1 
ATOM   2671  C  CA  . TYR B 1 12  ? 14.097  -5.833  61.382  1.00 35.86 ? 12   TYR B CA  1 
ATOM   2672  C  C   . TYR B 1 12  ? 12.904  -6.491  62.072  1.00 37.03 ? 12   TYR B C   1 
ATOM   2673  O  O   . TYR B 1 12  ? 13.035  -7.563  62.665  1.00 38.06 ? 12   TYR B O   1 
ATOM   2674  C  CB  . TYR B 1 12  ? 14.889  -6.899  60.611  1.00 32.50 ? 12   TYR B CB  1 
ATOM   2675  C  CG  . TYR B 1 12  ? 16.243  -6.437  60.117  1.00 28.69 ? 12   TYR B CG  1 
ATOM   2676  C  CD1 . TYR B 1 12  ? 17.359  -6.474  60.953  1.00 27.14 ? 12   TYR B CD1 1 
ATOM   2677  C  CD2 . TYR B 1 12  ? 16.407  -5.951  58.823  1.00 27.07 ? 12   TYR B CD2 1 
ATOM   2678  C  CE1 . TYR B 1 12  ? 18.603  -6.036  60.513  1.00 26.07 ? 12   TYR B CE1 1 
ATOM   2679  C  CE2 . TYR B 1 12  ? 17.649  -5.511  58.372  1.00 26.77 ? 12   TYR B CE2 1 
ATOM   2680  C  CZ  . TYR B 1 12  ? 18.740  -5.555  59.224  1.00 25.25 ? 12   TYR B CZ  1 
ATOM   2681  O  OH  . TYR B 1 12  ? 19.967  -5.111  58.790  1.00 27.37 ? 12   TYR B OH  1 
ATOM   2682  N  N   . LYS B 1 13  ? 11.742  -5.849  61.989  1.00 37.27 ? 13   LYS B N   1 
ATOM   2683  C  CA  . LYS B 1 13  ? 10.528  -6.381  62.603  1.00 37.53 ? 13   LYS B CA  1 
ATOM   2684  C  C   . LYS B 1 13  ? 9.252   -5.832  61.973  1.00 37.83 ? 13   LYS B C   1 
ATOM   2685  O  O   . LYS B 1 13  ? 8.175   -6.408  62.131  1.00 38.27 ? 13   LYS B O   1 
ATOM   2686  C  CB  . LYS B 1 13  ? 10.522  -6.121  64.113  1.00 36.92 ? 13   LYS B CB  1 
ATOM   2687  C  CG  . LYS B 1 13  ? 10.634  -4.660  64.514  1.00 33.55 ? 13   LYS B CG  1 
ATOM   2688  C  CD  . LYS B 1 13  ? 10.532  -4.505  66.022  1.00 32.80 ? 13   LYS B CD  1 
ATOM   2689  C  CE  . LYS B 1 13  ? 11.625  -5.286  66.738  1.00 31.69 ? 13   LYS B CE  1 
ATOM   2690  N  NZ  . LYS B 1 13  ? 11.526  -5.152  68.217  1.00 31.32 ? 13   LYS B NZ  1 
ATOM   2691  N  N   . ASP B 1 14  ? 9.376   -4.714  61.266  1.00 38.28 ? 14   ASP B N   1 
ATOM   2692  C  CA  . ASP B 1 14  ? 8.231   -4.097  60.609  1.00 38.44 ? 14   ASP B CA  1 
ATOM   2693  C  C   . ASP B 1 14  ? 8.080   -4.616  59.179  1.00 39.07 ? 14   ASP B C   1 
ATOM   2694  O  O   . ASP B 1 14  ? 7.204   -4.168  58.434  1.00 39.99 ? 14   ASP B O   1 
ATOM   2695  C  CB  . ASP B 1 14  ? 8.371   -2.571  60.624  1.00 38.55 ? 14   ASP B CB  1 
ATOM   2696  C  CG  . ASP B 1 14  ? 8.468   -2.002  62.035  1.00 38.21 ? 14   ASP B CG  1 
ATOM   2697  O  OD1 . ASP B 1 14  ? 7.972   -2.646  62.985  1.00 38.60 ? 14   ASP B OD1 1 
ATOM   2698  O  OD2 . ASP B 1 14  ? 9.042   -0.905  62.194  1.00 39.88 ? 14   ASP B OD2 1 
ATOM   2699  N  N   . GLY B 1 15  ? 8.931   -5.575  58.816  1.00 38.38 ? 15   GLY B N   1 
ATOM   2700  C  CA  . GLY B 1 15  ? 8.894   -6.164  57.488  1.00 37.34 ? 15   GLY B CA  1 
ATOM   2701  C  C   . GLY B 1 15  ? 9.663   -5.384  56.440  1.00 38.15 ? 15   GLY B C   1 
ATOM   2702  O  O   . GLY B 1 15  ? 10.429  -4.475  56.767  1.00 37.38 ? 15   GLY B O   1 
ATOM   2703  N  N   . LYS B 1 16  ? 9.479   -5.764  55.178  1.00 38.45 ? 16   LYS B N   1 
ATOM   2704  C  CA  . LYS B 1 16  ? 10.147  -5.095  54.066  1.00 38.76 ? 16   LYS B CA  1 
ATOM   2705  C  C   . LYS B 1 16  ? 9.170   -4.156  53.368  1.00 39.06 ? 16   LYS B C   1 
ATOM   2706  O  O   . LYS B 1 16  ? 8.012   -4.507  53.136  1.00 38.39 ? 16   LYS B O   1 
ATOM   2707  C  CB  . LYS B 1 16  ? 10.704  -6.117  53.071  1.00 39.77 ? 16   LYS B CB  1 
ATOM   2708  C  CG  . LYS B 1 16  ? 11.554  -5.501  51.968  1.00 41.34 ? 16   LYS B CG  1 
ATOM   2709  C  CD  . LYS B 1 16  ? 12.178  -6.562  51.080  1.00 43.75 ? 16   LYS B CD  1 
ATOM   2710  C  CE  . LYS B 1 16  ? 13.111  -5.937  50.053  1.00 45.49 ? 16   LYS B CE  1 
ATOM   2711  N  NZ  . LYS B 1 16  ? 13.795  -6.966  49.220  1.00 46.42 ? 16   LYS B NZ  1 
ATOM   2712  N  N   . PHE B 1 17  ? 9.646   -2.958  53.044  1.00 40.66 ? 17   PHE B N   1 
ATOM   2713  C  CA  . PHE B 1 17  ? 8.823   -1.951  52.387  1.00 41.94 ? 17   PHE B CA  1 
ATOM   2714  C  C   . PHE B 1 17  ? 9.214   -1.767  50.925  1.00 43.96 ? 17   PHE B C   1 
ATOM   2715  O  O   . PHE B 1 17  ? 10.385  -1.549  50.606  1.00 45.58 ? 17   PHE B O   1 
ATOM   2716  C  CB  . PHE B 1 17  ? 8.936   -0.621  53.135  1.00 40.25 ? 17   PHE B CB  1 
ATOM   2717  C  CG  . PHE B 1 17  ? 8.703   -0.743  54.613  1.00 39.72 ? 17   PHE B CG  1 
ATOM   2718  C  CD1 . PHE B 1 17  ? 7.455   -1.105  55.106  1.00 40.76 ? 17   PHE B CD1 1 
ATOM   2719  C  CD2 . PHE B 1 17  ? 9.739   -0.524  55.512  1.00 38.88 ? 17   PHE B CD2 1 
ATOM   2720  C  CE1 . PHE B 1 17  ? 7.242   -1.249  56.473  1.00 39.74 ? 17   PHE B CE1 1 
ATOM   2721  C  CE2 . PHE B 1 17  ? 9.535   -0.667  56.881  1.00 37.31 ? 17   PHE B CE2 1 
ATOM   2722  C  CZ  . PHE B 1 17  ? 8.285   -1.030  57.361  1.00 38.41 ? 17   PHE B CZ  1 
ATOM   2723  N  N   . THR B 1 18  ? 8.224   -1.871  50.044  1.00 45.07 ? 18   THR B N   1 
ATOM   2724  C  CA  . THR B 1 18  ? 8.440   -1.718  48.609  1.00 46.06 ? 18   THR B CA  1 
ATOM   2725  C  C   . THR B 1 18  ? 8.333   -0.257  48.179  1.00 47.03 ? 18   THR B C   1 
ATOM   2726  O  O   . THR B 1 18  ? 9.176   0.243   47.431  1.00 48.56 ? 18   THR B O   1 
ATOM   2727  C  CB  . THR B 1 18  ? 7.440   -2.569  47.798  1.00 46.18 ? 18   THR B CB  1 
ATOM   2728  O  OG1 . THR B 1 18  ? 6.100   -2.244  48.188  1.00 45.09 ? 18   THR B OG1 1 
ATOM   2729  C  CG2 . THR B 1 18  ? 7.689   -4.054  48.036  1.00 46.16 ? 18   THR B CG2 1 
ATOM   2730  N  N   . GLN B 1 19  ? 7.292   0.422   48.656  1.00 47.34 ? 19   GLN B N   1 
ATOM   2731  C  CA  . GLN B 1 19  ? 7.071   1.828   48.333  1.00 47.29 ? 19   GLN B CA  1 
ATOM   2732  C  C   . GLN B 1 19  ? 8.093   2.678   49.084  1.00 46.25 ? 19   GLN B C   1 
ATOM   2733  O  O   . GLN B 1 19  ? 8.467   2.350   50.213  1.00 46.87 ? 19   GLN B O   1 
ATOM   2734  C  CB  . GLN B 1 19  ? 5.662   2.268   48.752  1.00 48.94 ? 19   GLN B CB  1 
ATOM   2735  C  CG  . GLN B 1 19  ? 4.531   1.335   48.337  1.00 53.09 ? 19   GLN B CG  1 
ATOM   2736  C  CD  . GLN B 1 19  ? 4.342   0.164   49.294  1.00 55.24 ? 19   GLN B CD  1 
ATOM   2737  O  OE1 . GLN B 1 19  ? 4.877   0.156   50.405  1.00 55.52 ? 19   GLN B OE1 1 
ATOM   2738  N  NE2 . GLN B 1 19  ? 3.570   -0.828  48.865  1.00 56.43 ? 19   GLN B NE2 1 
ATOM   2739  N  N   . PRO B 1 20  ? 8.558   3.783   48.470  1.00 44.95 ? 20   PRO B N   1 
ATOM   2740  C  CA  . PRO B 1 20  ? 9.539   4.663   49.117  1.00 43.88 ? 20   PRO B CA  1 
ATOM   2741  C  C   . PRO B 1 20  ? 8.994   5.238   50.426  1.00 42.29 ? 20   PRO B C   1 
ATOM   2742  O  O   . PRO B 1 20  ? 9.755   5.627   51.313  1.00 41.98 ? 20   PRO B O   1 
ATOM   2743  C  CB  . PRO B 1 20  ? 9.770   5.749   48.062  1.00 43.88 ? 20   PRO B CB  1 
ATOM   2744  C  CG  . PRO B 1 20  ? 8.479   5.771   47.297  1.00 44.11 ? 20   PRO B CG  1 
ATOM   2745  C  CD  . PRO B 1 20  ? 8.186   4.306   47.144  1.00 44.22 ? 20   PRO B CD  1 
ATOM   2746  N  N   . PHE B 1 21  ? 7.667   5.262   50.530  1.00 40.47 ? 21   PHE B N   1 
ATOM   2747  C  CA  . PHE B 1 21  ? 6.960   5.753   51.708  1.00 38.67 ? 21   PHE B CA  1 
ATOM   2748  C  C   . PHE B 1 21  ? 5.746   4.847   51.938  1.00 38.23 ? 21   PHE B C   1 
ATOM   2749  O  O   . PHE B 1 21  ? 4.760   4.914   51.201  1.00 37.74 ? 21   PHE B O   1 
ATOM   2750  C  CB  . PHE B 1 21  ? 6.498   7.200   51.497  1.00 37.72 ? 21   PHE B CB  1 
ATOM   2751  C  CG  . PHE B 1 21  ? 7.618   8.171   51.237  1.00 36.54 ? 21   PHE B CG  1 
ATOM   2752  C  CD1 . PHE B 1 21  ? 8.576   8.430   52.212  1.00 36.87 ? 21   PHE B CD1 1 
ATOM   2753  C  CD2 . PHE B 1 21  ? 7.713   8.830   50.015  1.00 36.70 ? 21   PHE B CD2 1 
ATOM   2754  C  CE1 . PHE B 1 21  ? 9.613   9.333   51.972  1.00 36.71 ? 21   PHE B CE1 1 
ATOM   2755  C  CE2 . PHE B 1 21  ? 8.746   9.733   49.767  1.00 34.84 ? 21   PHE B CE2 1 
ATOM   2756  C  CZ  . PHE B 1 21  ? 9.696   9.984   50.747  1.00 35.35 ? 21   PHE B CZ  1 
ATOM   2757  N  N   . SER B 1 22  ? 5.839   3.977   52.940  1.00 37.48 ? 22   SER B N   1 
ATOM   2758  C  CA  . SER B 1 22  ? 4.759   3.048   53.269  1.00 36.94 ? 22   SER B CA  1 
ATOM   2759  C  C   . SER B 1 22  ? 3.805   3.629   54.312  1.00 35.93 ? 22   SER B C   1 
ATOM   2760  O  O   . SER B 1 22  ? 4.209   3.932   55.434  1.00 35.45 ? 22   SER B O   1 
ATOM   2761  C  CB  . SER B 1 22  ? 5.339   1.723   53.772  1.00 36.99 ? 22   SER B CB  1 
ATOM   2762  O  OG  . SER B 1 22  ? 6.167   1.123   52.791  1.00 37.39 ? 22   SER B OG  1 
ATOM   2763  N  N   . LEU B 1 23  ? 2.534   3.756   53.940  1.00 35.77 ? 23   LEU B N   1 
ATOM   2764  C  CA  . LEU B 1 23  ? 1.518   4.310   54.831  1.00 35.44 ? 23   LEU B CA  1 
ATOM   2765  C  C   . LEU B 1 23  ? 1.142   3.397   55.998  1.00 36.47 ? 23   LEU B C   1 
ATOM   2766  O  O   . LEU B 1 23  ? 0.237   2.564   55.894  1.00 36.01 ? 23   LEU B O   1 
ATOM   2767  C  CB  . LEU B 1 23  ? 0.265   4.705   54.038  1.00 33.25 ? 23   LEU B CB  1 
ATOM   2768  C  CG  . LEU B 1 23  ? -0.917  5.309   54.807  1.00 30.86 ? 23   LEU B CG  1 
ATOM   2769  C  CD1 . LEU B 1 23  ? -0.480  6.539   55.582  1.00 30.03 ? 23   LEU B CD1 1 
ATOM   2770  C  CD2 . LEU B 1 23  ? -2.034  5.657   53.841  1.00 30.17 ? 23   LEU B CD2 1 
ATOM   2771  N  N   . VAL B 1 24  ? 1.866   3.551   57.103  1.00 36.72 ? 24   VAL B N   1 
ATOM   2772  C  CA  . VAL B 1 24  ? 1.609   2.778   58.310  1.00 36.61 ? 24   VAL B CA  1 
ATOM   2773  C  C   . VAL B 1 24  ? 0.797   3.652   59.261  1.00 38.40 ? 24   VAL B C   1 
ATOM   2774  O  O   . VAL B 1 24  ? 1.181   4.786   59.551  1.00 39.44 ? 24   VAL B O   1 
ATOM   2775  C  CB  . VAL B 1 24  ? 2.921   2.314   58.996  1.00 35.05 ? 24   VAL B CB  1 
ATOM   2776  C  CG1 . VAL B 1 24  ? 3.613   1.260   58.147  1.00 35.54 ? 24   VAL B CG1 1 
ATOM   2777  C  CG2 . VAL B 1 24  ? 3.853   3.492   59.227  1.00 35.34 ? 24   VAL B CG2 1 
ATOM   2778  N  N   . ASN B 1 25  ? -0.347  3.138   59.707  1.00 39.34 ? 25   ASN B N   1 
ATOM   2779  C  CA  . ASN B 1 25  ? -1.227  3.872   60.614  1.00 40.46 ? 25   ASN B CA  1 
ATOM   2780  C  C   . ASN B 1 25  ? -0.490  4.405   61.842  1.00 41.09 ? 25   ASN B C   1 
ATOM   2781  O  O   . ASN B 1 25  ? -0.264  5.612   61.962  1.00 40.24 ? 25   ASN B O   1 
ATOM   2782  C  CB  . ASN B 1 25  ? -2.406  2.991   61.036  1.00 41.20 ? 25   ASN B CB  1 
ATOM   2783  C  CG  . ASN B 1 25  ? -3.371  2.722   59.895  1.00 42.34 ? 25   ASN B CG  1 
ATOM   2784  O  OD1 . ASN B 1 25  ? -2.969  2.334   58.796  1.00 41.50 ? 25   ASN B OD1 1 
ATOM   2785  N  ND2 . ASN B 1 25  ? -4.655  2.934   60.150  1.00 43.95 ? 25   ASN B ND2 1 
ATOM   2786  N  N   . GLN B 1 26  ? -0.122  3.505   62.749  1.00 40.53 ? 26   GLN B N   1 
ATOM   2787  C  CA  . GLN B 1 26  ? 0.604   3.887   63.955  1.00 39.45 ? 26   GLN B CA  1 
ATOM   2788  C  C   . GLN B 1 26  ? 2.078   3.539   63.780  1.00 40.17 ? 26   GLN B C   1 
ATOM   2789  O  O   . GLN B 1 26  ? 2.414   2.409   63.433  1.00 41.31 ? 26   GLN B O   1 
ATOM   2790  C  CB  . GLN B 1 26  ? 0.055   3.148   65.180  1.00 36.38 ? 26   GLN B CB  1 
ATOM   2791  C  CG  . GLN B 1 26  ? -1.388  3.470   65.532  1.00 34.05 ? 26   GLN B CG  1 
ATOM   2792  C  CD  . GLN B 1 26  ? -1.879  2.704   66.752  1.00 32.65 ? 26   GLN B CD  1 
ATOM   2793  O  OE1 . GLN B 1 26  ? -1.166  1.866   67.306  1.00 30.72 ? 26   GLN B OE1 1 
ATOM   2794  N  NE2 . GLN B 1 26  ? -3.102  2.994   67.176  1.00 30.15 ? 26   GLN B NE2 1 
ATOM   2795  N  N   . PRO B 1 27  ? 2.974   4.521   63.961  1.00 40.27 ? 27   PRO B N   1 
ATOM   2796  C  CA  . PRO B 1 27  ? 4.410   4.264   63.817  1.00 39.52 ? 27   PRO B CA  1 
ATOM   2797  C  C   . PRO B 1 27  ? 4.952   3.399   64.959  1.00 39.47 ? 27   PRO B C   1 
ATOM   2798  O  O   . PRO B 1 27  ? 4.378   3.367   66.050  1.00 38.20 ? 27   PRO B O   1 
ATOM   2799  C  CB  . PRO B 1 27  ? 5.008   5.672   63.826  1.00 38.37 ? 27   PRO B CB  1 
ATOM   2800  C  CG  . PRO B 1 27  ? 4.053   6.447   64.664  1.00 39.90 ? 27   PRO B CG  1 
ATOM   2801  C  CD  . PRO B 1 27  ? 2.717   5.956   64.174  1.00 39.89 ? 27   PRO B CD  1 
ATOM   2802  N  N   . ASP B 1 28  ? 6.039   2.677   64.691  1.00 40.72 ? 28   ASP B N   1 
ATOM   2803  C  CA  . ASP B 1 28  ? 6.666   1.805   65.685  1.00 42.27 ? 28   ASP B CA  1 
ATOM   2804  C  C   . ASP B 1 28  ? 7.506   2.634   66.659  1.00 43.20 ? 28   ASP B C   1 
ATOM   2805  O  O   . ASP B 1 28  ? 8.728   2.483   66.741  1.00 43.61 ? 28   ASP B O   1 
ATOM   2806  C  CB  . ASP B 1 28  ? 7.531   0.746   64.986  1.00 42.20 ? 28   ASP B CB  1 
ATOM   2807  C  CG  . ASP B 1 28  ? 7.926   -0.399  65.906  1.00 41.98 ? 28   ASP B CG  1 
ATOM   2808  O  OD1 . ASP B 1 28  ? 7.088   -0.836  66.725  1.00 42.21 ? 28   ASP B OD1 1 
ATOM   2809  O  OD2 . ASP B 1 28  ? 9.075   -0.874  65.798  1.00 42.12 ? 28   ASP B OD2 1 
ATOM   2810  N  N   . ALA B 1 29  ? 6.829   3.515   67.390  1.00 44.32 ? 29   ALA B N   1 
ATOM   2811  C  CA  . ALA B 1 29  ? 7.467   4.397   68.358  1.00 44.81 ? 29   ALA B CA  1 
ATOM   2812  C  C   . ALA B 1 29  ? 7.608   3.742   69.726  1.00 45.73 ? 29   ALA B C   1 
ATOM   2813  O  O   . ALA B 1 29  ? 6.780   2.921   70.122  1.00 45.75 ? 29   ALA B O   1 
ATOM   2814  C  CB  . ALA B 1 29  ? 6.674   5.688   68.478  1.00 44.66 ? 29   ALA B CB  1 
ATOM   2815  N  N   . VAL B 1 30  ? 8.662   4.120   70.445  1.00 47.12 ? 30   VAL B N   1 
ATOM   2816  C  CA  . VAL B 1 30  ? 8.928   3.586   71.777  1.00 48.22 ? 30   VAL B CA  1 
ATOM   2817  C  C   . VAL B 1 30  ? 8.145   4.311   72.871  1.00 48.33 ? 30   VAL B C   1 
ATOM   2818  O  O   . VAL B 1 30  ? 7.984   3.788   73.976  1.00 49.94 ? 30   VAL B O   1 
ATOM   2819  C  CB  . VAL B 1 30  ? 10.439  3.628   72.116  1.00 49.57 ? 30   VAL B CB  1 
ATOM   2820  C  CG1 . VAL B 1 30  ? 11.188  2.589   71.297  1.00 50.21 ? 30   VAL B CG1 1 
ATOM   2821  C  CG2 . VAL B 1 30  ? 11.008  5.024   71.860  1.00 48.80 ? 30   VAL B CG2 1 
ATOM   2822  N  N   . GLY B 1 31  ? 7.653   5.508   72.557  1.00 47.27 ? 31   GLY B N   1 
ATOM   2823  C  CA  . GLY B 1 31  ? 6.895   6.275   73.530  1.00 45.66 ? 31   GLY B CA  1 
ATOM   2824  C  C   . GLY B 1 31  ? 6.275   7.539   72.967  1.00 44.30 ? 31   GLY B C   1 
ATOM   2825  O  O   . GLY B 1 31  ? 5.306   7.477   72.210  1.00 44.57 ? 31   GLY B O   1 
ATOM   2826  N  N   . ALA B 1 32  ? 6.837   8.687   73.338  1.00 43.27 ? 32   ALA B N   1 
ATOM   2827  C  CA  . ALA B 1 32  ? 6.338   9.983   72.881  1.00 41.93 ? 32   ALA B CA  1 
ATOM   2828  C  C   . ALA B 1 32  ? 7.487   10.933  72.528  1.00 40.08 ? 32   ALA B C   1 
ATOM   2829  O  O   . ALA B 1 32  ? 8.615   10.752  72.991  1.00 40.75 ? 32   ALA B O   1 
ATOM   2830  C  CB  . ALA B 1 32  ? 5.448   10.607  73.957  1.00 42.41 ? 32   ALA B CB  1 
ATOM   2831  N  N   . PRO B 1 33  ? 7.216   11.942  71.677  1.00 38.74 ? 33   PRO B N   1 
ATOM   2832  C  CA  . PRO B 1 33  ? 8.215   12.930  71.251  1.00 37.50 ? 33   PRO B CA  1 
ATOM   2833  C  C   . PRO B 1 33  ? 8.862   13.658  72.428  1.00 36.31 ? 33   PRO B C   1 
ATOM   2834  O  O   . PRO B 1 33  ? 8.193   14.380  73.172  1.00 34.52 ? 33   PRO B O   1 
ATOM   2835  C  CB  . PRO B 1 33  ? 7.394   13.884  70.386  1.00 37.16 ? 33   PRO B CB  1 
ATOM   2836  C  CG  . PRO B 1 33  ? 6.386   12.974  69.769  1.00 36.88 ? 33   PRO B CG  1 
ATOM   2837  C  CD  . PRO B 1 33  ? 5.948   12.148  70.953  1.00 37.80 ? 33   PRO B CD  1 
ATOM   2838  N  N   . ILE B 1 34  ? 10.169  13.461  72.585  1.00 35.83 ? 34   ILE B N   1 
ATOM   2839  C  CA  . ILE B 1 34  ? 10.922  14.080  73.673  1.00 34.56 ? 34   ILE B CA  1 
ATOM   2840  C  C   . ILE B 1 34  ? 11.339  15.518  73.368  1.00 33.87 ? 34   ILE B C   1 
ATOM   2841  O  O   . ILE B 1 34  ? 11.933  16.192  74.213  1.00 33.39 ? 34   ILE B O   1 
ATOM   2842  C  CB  . ILE B 1 34  ? 12.195  13.268  74.020  1.00 34.07 ? 34   ILE B CB  1 
ATOM   2843  C  CG1 . ILE B 1 34  ? 13.275  13.486  72.959  1.00 33.95 ? 34   ILE B CG1 1 
ATOM   2844  C  CG2 . ILE B 1 34  ? 11.865  11.782  74.118  1.00 32.98 ? 34   ILE B CG2 1 
ATOM   2845  C  CD1 . ILE B 1 34  ? 14.666  13.220  73.466  1.00 33.58 ? 34   ILE B CD1 1 
ATOM   2846  N  N   . ASN B 1 35  ? 11.046  15.974  72.153  1.00 33.67 ? 35   ASN B N   1 
ATOM   2847  C  CA  . ASN B 1 35  ? 11.396  17.328  71.739  1.00 32.29 ? 35   ASN B CA  1 
ATOM   2848  C  C   . ASN B 1 35  ? 10.172  18.143  71.328  1.00 33.06 ? 35   ASN B C   1 
ATOM   2849  O  O   . ASN B 1 35  ? 10.167  18.792  70.280  1.00 35.35 ? 35   ASN B O   1 
ATOM   2850  C  CB  . ASN B 1 35  ? 12.426  17.289  70.603  1.00 29.34 ? 35   ASN B CB  1 
ATOM   2851  C  CG  . ASN B 1 35  ? 11.887  16.649  69.336  1.00 26.48 ? 35   ASN B CG  1 
ATOM   2852  O  OD1 . ASN B 1 35  ? 10.912  15.897  69.364  1.00 24.16 ? 35   ASN B OD1 1 
ATOM   2853  N  ND2 . ASN B 1 35  ? 12.521  16.953  68.212  1.00 27.90 ? 35   ASN B ND2 1 
ATOM   2854  N  N   . ALA B 1 36  ? 9.137   18.109  72.164  1.00 32.58 ? 36   ALA B N   1 
ATOM   2855  C  CA  . ALA B 1 36  ? 7.907   18.848  71.896  1.00 31.54 ? 36   ALA B CA  1 
ATOM   2856  C  C   . ALA B 1 36  ? 8.195   20.345  71.826  1.00 30.61 ? 36   ALA B C   1 
ATOM   2857  O  O   . ALA B 1 36  ? 7.714   21.036  70.926  1.00 30.50 ? 36   ALA B O   1 
ATOM   2858  C  CB  . ALA B 1 36  ? 6.874   18.556  72.975  1.00 31.36 ? 36   ALA B CB  1 
ATOM   2859  N  N   . GLY B 1 37  ? 9.004   20.827  72.767  1.00 30.54 ? 37   GLY B N   1 
ATOM   2860  C  CA  . GLY B 1 37  ? 9.365   22.233  72.811  1.00 30.17 ? 37   GLY B CA  1 
ATOM   2861  C  C   . GLY B 1 37  ? 10.307  22.639  71.692  1.00 29.31 ? 37   GLY B C   1 
ATOM   2862  O  O   . GLY B 1 37  ? 10.239  23.764  71.197  1.00 29.69 ? 37   GLY B O   1 
ATOM   2863  N  N   . ASP B 1 38  ? 11.193  21.726  71.302  1.00 28.50 ? 38   ASP B N   1 
ATOM   2864  C  CA  . ASP B 1 38  ? 12.151  21.984  70.230  1.00 28.25 ? 38   ASP B CA  1 
ATOM   2865  C  C   . ASP B 1 38  ? 11.461  22.015  68.870  1.00 28.54 ? 38   ASP B C   1 
ATOM   2866  O  O   . ASP B 1 38  ? 11.793  22.837  68.015  1.00 27.45 ? 38   ASP B O   1 
ATOM   2867  C  CB  . ASP B 1 38  ? 13.256  20.920  70.220  1.00 27.97 ? 38   ASP B CB  1 
ATOM   2868  C  CG  . ASP B 1 38  ? 14.129  20.959  71.464  1.00 26.08 ? 38   ASP B CG  1 
ATOM   2869  O  OD1 . ASP B 1 38  ? 14.293  22.046  72.061  1.00 26.59 ? 38   ASP B OD1 1 
ATOM   2870  O  OD2 . ASP B 1 38  ? 14.664  19.895  71.838  1.00 25.92 ? 38   ASP B OD2 1 
ATOM   2871  N  N   . PHE B 1 39  ? 10.505  21.109  68.674  1.00 29.30 ? 39   PHE B N   1 
ATOM   2872  C  CA  . PHE B 1 39  ? 9.761   21.032  67.423  1.00 30.27 ? 39   PHE B CA  1 
ATOM   2873  C  C   . PHE B 1 39  ? 8.850   22.247  67.254  1.00 31.00 ? 39   PHE B C   1 
ATOM   2874  O  O   . PHE B 1 39  ? 8.794   22.841  66.176  1.00 31.95 ? 39   PHE B O   1 
ATOM   2875  C  CB  . PHE B 1 39  ? 8.934   19.746  67.367  1.00 29.38 ? 39   PHE B CB  1 
ATOM   2876  C  CG  . PHE B 1 39  ? 8.229   19.539  66.058  1.00 28.76 ? 39   PHE B CG  1 
ATOM   2877  C  CD1 . PHE B 1 39  ? 8.946   19.233  64.907  1.00 29.01 ? 39   PHE B CD1 1 
ATOM   2878  C  CD2 . PHE B 1 39  ? 6.848   19.657  65.973  1.00 29.79 ? 39   PHE B CD2 1 
ATOM   2879  C  CE1 . PHE B 1 39  ? 8.298   19.047  63.690  1.00 29.31 ? 39   PHE B CE1 1 
ATOM   2880  C  CE2 . PHE B 1 39  ? 6.190   19.474  64.760  1.00 30.76 ? 39   PHE B CE2 1 
ATOM   2881  C  CZ  . PHE B 1 39  ? 6.917   19.169  63.616  1.00 30.29 ? 39   PHE B CZ  1 
ATOM   2882  N  N   . ALA B 1 40  ? 8.141   22.609  68.322  1.00 30.66 ? 40   ALA B N   1 
ATOM   2883  C  CA  . ALA B 1 40  ? 7.241   23.760  68.304  1.00 30.10 ? 40   ALA B CA  1 
ATOM   2884  C  C   . ALA B 1 40  ? 8.029   25.016  67.953  1.00 29.60 ? 40   ALA B C   1 
ATOM   2885  O  O   . ALA B 1 40  ? 7.570   25.855  67.177  1.00 29.12 ? 40   ALA B O   1 
ATOM   2886  C  CB  . ALA B 1 40  ? 6.567   23.923  69.660  1.00 31.06 ? 40   ALA B CB  1 
ATOM   2887  N  N   . GLU B 1 41  ? 9.227   25.119  68.525  1.00 29.06 ? 41   GLU B N   1 
ATOM   2888  C  CA  . GLU B 1 41  ? 10.127  26.244  68.294  1.00 28.57 ? 41   GLU B CA  1 
ATOM   2889  C  C   . GLU B 1 41  ? 10.557  26.264  66.830  1.00 28.00 ? 41   GLU B C   1 
ATOM   2890  O  O   . GLU B 1 41  ? 10.612  27.322  66.204  1.00 28.98 ? 41   GLU B O   1 
ATOM   2891  C  CB  . GLU B 1 41  ? 11.359  26.112  69.192  1.00 29.44 ? 41   GLU B CB  1 
ATOM   2892  C  CG  . GLU B 1 41  ? 12.344  27.270  69.095  1.00 31.60 ? 41   GLU B CG  1 
ATOM   2893  C  CD  . GLU B 1 41  ? 13.669  26.986  69.790  1.00 32.47 ? 41   GLU B CD  1 
ATOM   2894  O  OE1 . GLU B 1 41  ? 13.677  26.280  70.824  1.00 33.55 ? 41   GLU B OE1 1 
ATOM   2895  O  OE2 . GLU B 1 41  ? 14.708  27.475  69.299  1.00 31.83 ? 41   GLU B OE2 1 
ATOM   2896  N  N   . GLN B 1 42  ? 10.850  25.081  66.294  1.00 27.61 ? 42   GLN B N   1 
ATOM   2897  C  CA  . GLN B 1 42  ? 11.273  24.935  64.906  1.00 27.87 ? 42   GLN B CA  1 
ATOM   2898  C  C   . GLN B 1 42  ? 10.179  25.410  63.956  1.00 28.01 ? 42   GLN B C   1 
ATOM   2899  O  O   . GLN B 1 42  ? 10.461  26.060  62.950  1.00 28.58 ? 42   GLN B O   1 
ATOM   2900  C  CB  . GLN B 1 42  ? 11.623  23.473  64.610  1.00 27.48 ? 42   GLN B CB  1 
ATOM   2901  C  CG  . GLN B 1 42  ? 12.161  23.222  63.206  1.00 27.20 ? 42   GLN B CG  1 
ATOM   2902  C  CD  . GLN B 1 42  ? 13.459  23.957  62.936  1.00 26.53 ? 42   GLN B CD  1 
ATOM   2903  O  OE1 . GLN B 1 42  ? 14.544  23.408  63.114  1.00 26.85 ? 42   GLN B OE1 1 
ATOM   2904  N  NE2 . GLN B 1 42  ? 13.352  25.209  62.502  1.00 27.44 ? 42   GLN B NE2 1 
ATOM   2905  N  N   . ILE B 1 43  ? 8.934   25.087  64.289  1.00 28.15 ? 43   ILE B N   1 
ATOM   2906  C  CA  . ILE B 1 43  ? 7.787   25.480  63.476  1.00 28.05 ? 43   ILE B CA  1 
ATOM   2907  C  C   . ILE B 1 43  ? 7.622   26.998  63.494  1.00 27.69 ? 43   ILE B C   1 
ATOM   2908  O  O   . ILE B 1 43  ? 7.337   27.609  62.462  1.00 27.13 ? 43   ILE B O   1 
ATOM   2909  C  CB  . ILE B 1 43  ? 6.484   24.803  63.979  1.00 28.12 ? 43   ILE B CB  1 
ATOM   2910  C  CG1 . ILE B 1 43  ? 6.647   23.281  63.978  1.00 26.32 ? 43   ILE B CG1 1 
ATOM   2911  C  CG2 . ILE B 1 43  ? 5.301   25.205  63.112  1.00 27.33 ? 43   ILE B CG2 1 
ATOM   2912  C  CD1 . ILE B 1 43  ? 7.139   22.713  62.661  1.00 27.36 ? 43   ILE B CD1 1 
ATOM   2913  N  N   . ASN B 1 44  ? 7.819   27.598  64.666  1.00 27.08 ? 44   ASN B N   1 
ATOM   2914  C  CA  . ASN B 1 44  ? 7.705   29.044  64.822  1.00 28.45 ? 44   ASN B CA  1 
ATOM   2915  C  C   . ASN B 1 44  ? 8.807   29.767  64.051  1.00 28.72 ? 44   ASN B C   1 
ATOM   2916  O  O   . ASN B 1 44  ? 8.626   30.907  63.622  1.00 28.63 ? 44   ASN B O   1 
ATOM   2917  C  CB  . ASN B 1 44  ? 7.745   29.431  66.303  1.00 29.87 ? 44   ASN B CB  1 
ATOM   2918  C  CG  . ASN B 1 44  ? 6.539   28.920  67.072  1.00 31.88 ? 44   ASN B CG  1 
ATOM   2919  O  OD1 . ASN B 1 44  ? 5.494   28.623  66.491  1.00 33.05 ? 44   ASN B OD1 1 
ATOM   2920  N  ND2 . ASN B 1 44  ? 6.680   28.815  68.388  1.00 34.84 ? 44   ASN B ND2 1 
ATOM   2921  N  N   . HIS B 1 45  ? 9.943   29.092  63.878  1.00 29.25 ? 45   HIS B N   1 
ATOM   2922  C  CA  . HIS B 1 45  ? 11.076  29.645  63.137  1.00 26.86 ? 45   HIS B CA  1 
ATOM   2923  C  C   . HIS B 1 45  ? 10.786  29.656  61.639  1.00 26.61 ? 45   HIS B C   1 
ATOM   2924  O  O   . HIS B 1 45  ? 11.112  30.618  60.948  1.00 27.05 ? 45   HIS B O   1 
ATOM   2925  C  CB  . HIS B 1 45  ? 12.348  28.839  63.410  1.00 25.97 ? 45   HIS B CB  1 
ATOM   2926  C  CG  . HIS B 1 45  ? 13.053  29.228  64.672  1.00 24.04 ? 45   HIS B CG  1 
ATOM   2927  N  ND1 . HIS B 1 45  ? 13.238  30.541  65.046  1.00 23.17 ? 45   HIS B ND1 1 
ATOM   2928  C  CD2 . HIS B 1 45  ? 13.638  28.476  65.634  1.00 24.34 ? 45   HIS B CD2 1 
ATOM   2929  C  CE1 . HIS B 1 45  ? 13.908  30.582  66.184  1.00 24.15 ? 45   HIS B CE1 1 
ATOM   2930  N  NE2 . HIS B 1 45  ? 14.163  29.343  66.562  1.00 22.46 ? 45   HIS B NE2 1 
ATOM   2931  N  N   . ILE B 1 46  ? 10.183  28.575  61.146  1.00 27.34 ? 46   ILE B N   1 
ATOM   2932  C  CA  . ILE B 1 46  ? 9.828   28.452  59.731  1.00 28.63 ? 46   ILE B CA  1 
ATOM   2933  C  C   . ILE B 1 46  ? 8.695   29.429  59.416  1.00 29.77 ? 46   ILE B C   1 
ATOM   2934  O  O   . ILE B 1 46  ? 8.609   29.970  58.314  1.00 30.18 ? 46   ILE B O   1 
ATOM   2935  C  CB  . ILE B 1 46  ? 9.350   27.016  59.391  1.00 28.51 ? 46   ILE B CB  1 
ATOM   2936  C  CG1 . ILE B 1 46  ? 10.395  25.989  59.830  1.00 27.06 ? 46   ILE B CG1 1 
ATOM   2937  C  CG2 . ILE B 1 46  ? 9.097   26.878  57.890  1.00 28.41 ? 46   ILE B CG2 1 
ATOM   2938  C  CD1 . ILE B 1 46  ? 9.947   24.555  59.671  1.00 26.80 ? 46   ILE B CD1 1 
ATOM   2939  N  N   . ARG B 1 47  ? 7.838   29.651  60.409  1.00 29.84 ? 47   ARG B N   1 
ATOM   2940  C  CA  . ARG B 1 47  ? 6.699   30.550  60.287  1.00 29.13 ? 47   ARG B CA  1 
ATOM   2941  C  C   . ARG B 1 47  ? 7.146   31.994  60.078  1.00 29.09 ? 47   ARG B C   1 
ATOM   2942  O  O   . ARG B 1 47  ? 6.567   32.721  59.268  1.00 29.32 ? 47   ARG B O   1 
ATOM   2943  C  CB  . ARG B 1 47  ? 5.833   30.447  61.547  1.00 30.48 ? 47   ARG B CB  1 
ATOM   2944  C  CG  . ARG B 1 47  ? 4.564   31.283  61.528  1.00 34.05 ? 47   ARG B CG  1 
ATOM   2945  C  CD  . ARG B 1 47  ? 4.560   32.312  62.647  1.00 36.70 ? 47   ARG B CD  1 
ATOM   2946  N  NE  . ARG B 1 47  ? 4.733   31.700  63.962  1.00 38.68 ? 47   ARG B NE  1 
ATOM   2947  C  CZ  . ARG B 1 47  ? 4.829   32.381  65.099  1.00 40.74 ? 47   ARG B CZ  1 
ATOM   2948  N  NH1 . ARG B 1 47  ? 4.768   33.707  65.093  1.00 41.99 ? 47   ARG B NH1 1 
ATOM   2949  N  NH2 . ARG B 1 47  ? 4.993   31.736  66.245  1.00 42.27 ? 47   ARG B NH2 1 
ATOM   2950  N  N   . ASN B 1 48  ? 8.197   32.388  60.792  1.00 27.69 ? 48   ASN B N   1 
ATOM   2951  C  CA  . ASN B 1 48  ? 8.726   33.745  60.717  1.00 26.67 ? 48   ASN B CA  1 
ATOM   2952  C  C   . ASN B 1 48  ? 9.878   33.946  59.731  1.00 27.65 ? 48   ASN B C   1 
ATOM   2953  O  O   . ASN B 1 48  ? 10.148  35.076  59.320  1.00 28.53 ? 48   ASN B O   1 
ATOM   2954  C  CB  . ASN B 1 48  ? 9.159   34.207  62.111  1.00 26.18 ? 48   ASN B CB  1 
ATOM   2955  C  CG  . ASN B 1 48  ? 8.028   34.151  63.123  1.00 24.83 ? 48   ASN B CG  1 
ATOM   2956  O  OD1 . ASN B 1 48  ? 6.890   34.504  62.819  1.00 24.88 ? 48   ASN B OD1 1 
ATOM   2957  N  ND2 . ASN B 1 48  ? 8.341   33.713  64.336  1.00 24.54 ? 48   ASN B ND2 1 
ATOM   2958  N  N   . SER B 1 49  ? 10.553  32.862  59.352  1.00 29.18 ? 49   SER B N   1 
ATOM   2959  C  CA  . SER B 1 49  ? 11.683  32.944  58.424  1.00 29.85 ? 49   SER B CA  1 
ATOM   2960  C  C   . SER B 1 49  ? 11.369  32.514  56.993  1.00 29.93 ? 49   SER B C   1 
ATOM   2961  O  O   . SER B 1 49  ? 12.036  32.943  56.049  1.00 28.85 ? 49   SER B O   1 
ATOM   2962  C  CB  . SER B 1 49  ? 12.869  32.138  58.956  1.00 29.83 ? 49   SER B CB  1 
ATOM   2963  O  OG  . SER B 1 49  ? 13.324  32.666  60.189  1.00 33.87 ? 49   SER B OG  1 
ATOM   2964  N  N   . SER B 1 50  ? 10.367  31.654  56.838  1.00 29.71 ? 50   SER B N   1 
ATOM   2965  C  CA  . SER B 1 50  ? 9.967   31.176  55.520  1.00 29.03 ? 50   SER B CA  1 
ATOM   2966  C  C   . SER B 1 50  ? 8.443   31.166  55.433  1.00 29.79 ? 50   SER B C   1 
ATOM   2967  O  O   . SER B 1 50  ? 7.811   30.115  55.550  1.00 30.55 ? 50   SER B O   1 
ATOM   2968  C  CB  . SER B 1 50  ? 10.529  29.776  55.271  1.00 27.56 ? 50   SER B CB  1 
ATOM   2969  O  OG  . SER B 1 50  ? 10.368  29.403  53.915  1.00 27.64 ? 50   SER B OG  1 
ATOM   2970  N  N   . PRO B 1 51  ? 7.836   32.348  55.221  1.00 29.66 ? 51   PRO B N   1 
ATOM   2971  C  CA  . PRO B 1 51  ? 6.390   32.561  55.111  1.00 30.70 ? 51   PRO B CA  1 
ATOM   2972  C  C   . PRO B 1 51  ? 5.646   31.659  54.126  1.00 32.20 ? 51   PRO B C   1 
ATOM   2973  O  O   . PRO B 1 51  ? 4.565   31.159  54.440  1.00 32.40 ? 51   PRO B O   1 
ATOM   2974  C  CB  . PRO B 1 51  ? 6.299   34.029  54.699  1.00 30.13 ? 51   PRO B CB  1 
ATOM   2975  C  CG  . PRO B 1 51  ? 7.473   34.633  55.386  1.00 28.66 ? 51   PRO B CG  1 
ATOM   2976  C  CD  . PRO B 1 51  ? 8.552   33.629  55.078  1.00 28.14 ? 51   PRO B CD  1 
ATOM   2977  N  N   . ARG B 1 52  ? 6.216   31.451  52.941  1.00 33.17 ? 52   ARG B N   1 
ATOM   2978  C  CA  . ARG B 1 52  ? 5.565   30.616  51.935  1.00 34.90 ? 52   ARG B CA  1 
ATOM   2979  C  C   . ARG B 1 52  ? 5.734   29.116  52.174  1.00 36.11 ? 52   ARG B C   1 
ATOM   2980  O  O   . ARG B 1 52  ? 4.824   28.335  51.889  1.00 37.15 ? 52   ARG B O   1 
ATOM   2981  C  CB  . ARG B 1 52  ? 6.028   30.986  50.525  1.00 35.10 ? 52   ARG B CB  1 
ATOM   2982  C  CG  . ARG B 1 52  ? 5.048   30.539  49.453  1.00 34.67 ? 52   ARG B CG  1 
ATOM   2983  C  CD  . ARG B 1 52  ? 5.485   30.949  48.061  1.00 34.54 ? 52   ARG B CD  1 
ATOM   2984  N  NE  . ARG B 1 52  ? 4.452   30.651  47.070  1.00 32.57 ? 52   ARG B NE  1 
ATOM   2985  C  CZ  . ARG B 1 52  ? 4.135   29.429  46.650  1.00 31.64 ? 52   ARG B CZ  1 
ATOM   2986  N  NH1 . ARG B 1 52  ? 4.771   28.366  47.127  1.00 30.51 ? 52   ARG B NH1 1 
ATOM   2987  N  NH2 . ARG B 1 52  ? 3.176   29.269  45.750  1.00 33.76 ? 52   ARG B NH2 1 
ATOM   2988  N  N   . LEU B 1 53  ? 6.896   28.716  52.687  1.00 36.92 ? 53   LEU B N   1 
ATOM   2989  C  CA  . LEU B 1 53  ? 7.158   27.306  52.974  1.00 36.81 ? 53   LEU B CA  1 
ATOM   2990  C  C   . LEU B 1 53  ? 6.235   26.863  54.106  1.00 37.72 ? 53   LEU B C   1 
ATOM   2991  O  O   . LEU B 1 53  ? 5.707   25.750  54.093  1.00 39.14 ? 53   LEU B O   1 
ATOM   2992  C  CB  . LEU B 1 53  ? 8.619   27.104  53.378  1.00 36.67 ? 53   LEU B CB  1 
ATOM   2993  C  CG  . LEU B 1 53  ? 9.146   25.669  53.462  1.00 36.29 ? 53   LEU B CG  1 
ATOM   2994  C  CD1 . LEU B 1 53  ? 9.142   25.036  52.078  1.00 35.51 ? 53   LEU B CD1 1 
ATOM   2995  C  CD2 . LEU B 1 53  ? 10.552  25.670  54.038  1.00 35.49 ? 53   LEU B CD2 1 
ATOM   2996  N  N   . TYR B 1 54  ? 6.043   27.752  55.077  1.00 38.25 ? 54   TYR B N   1 
ATOM   2997  C  CA  . TYR B 1 54  ? 5.172   27.493  56.218  1.00 38.86 ? 54   TYR B CA  1 
ATOM   2998  C  C   . TYR B 1 54  ? 3.714   27.493  55.771  1.00 39.39 ? 54   TYR B C   1 
ATOM   2999  O  O   . TYR B 1 54  ? 2.911   26.705  56.264  1.00 40.39 ? 54   TYR B O   1 
ATOM   3000  C  CB  . TYR B 1 54  ? 5.384   28.560  57.301  1.00 38.39 ? 54   TYR B CB  1 
ATOM   3001  C  CG  . TYR B 1 54  ? 4.342   28.557  58.405  1.00 39.23 ? 54   TYR B CG  1 
ATOM   3002  C  CD1 . TYR B 1 54  ? 4.447   27.686  59.491  1.00 39.66 ? 54   TYR B CD1 1 
ATOM   3003  C  CD2 . TYR B 1 54  ? 3.250   29.426  58.362  1.00 38.28 ? 54   TYR B CD2 1 
ATOM   3004  C  CE1 . TYR B 1 54  ? 3.489   27.682  60.508  1.00 38.49 ? 54   TYR B CE1 1 
ATOM   3005  C  CE2 . TYR B 1 54  ? 2.288   29.429  59.372  1.00 37.68 ? 54   TYR B CE2 1 
ATOM   3006  C  CZ  . TYR B 1 54  ? 2.413   28.555  60.441  1.00 38.31 ? 54   TYR B CZ  1 
ATOM   3007  O  OH  . TYR B 1 54  ? 1.468   28.560  61.443  1.00 37.26 ? 54   TYR B OH  1 
ATOM   3008  N  N   . GLY B 1 55  ? 3.386   28.379  54.833  1.00 39.58 ? 55   GLY B N   1 
ATOM   3009  C  CA  . GLY B 1 55  ? 2.025   28.486  54.331  1.00 39.24 ? 55   GLY B CA  1 
ATOM   3010  C  C   . GLY B 1 55  ? 1.440   27.206  53.765  1.00 39.34 ? 55   GLY B C   1 
ATOM   3011  O  O   . GLY B 1 55  ? 0.233   26.974  53.869  1.00 40.09 ? 55   GLY B O   1 
ATOM   3012  N  N   . ASN B 1 56  ? 2.291   26.375  53.169  1.00 38.69 ? 56   ASN B N   1 
ATOM   3013  C  CA  . ASN B 1 56  ? 1.853   25.111  52.583  1.00 37.40 ? 56   ASN B CA  1 
ATOM   3014  C  C   . ASN B 1 56  ? 1.778   23.983  53.608  1.00 36.97 ? 56   ASN B C   1 
ATOM   3015  O  O   . ASN B 1 56  ? 0.801   23.232  53.649  1.00 38.10 ? 56   ASN B O   1 
ATOM   3016  C  CB  . ASN B 1 56  ? 2.785   24.702  51.437  1.00 36.44 ? 56   ASN B CB  1 
ATOM   3017  C  CG  . ASN B 1 56  ? 2.705   25.644  50.251  1.00 36.06 ? 56   ASN B CG  1 
ATOM   3018  O  OD1 . ASN B 1 56  ? 1.631   25.866  49.689  1.00 34.58 ? 56   ASN B OD1 1 
ATOM   3019  N  ND2 . ASN B 1 56  ? 3.847   26.196  49.857  1.00 35.80 ? 56   ASN B ND2 1 
ATOM   3020  N  N   . GLN B 1 57  ? 2.809   23.879  54.441  1.00 35.65 ? 57   GLN B N   1 
ATOM   3021  C  CA  . GLN B 1 57  ? 2.881   22.833  55.456  1.00 34.81 ? 57   GLN B CA  1 
ATOM   3022  C  C   . GLN B 1 57  ? 2.225   23.215  56.783  1.00 34.71 ? 57   GLN B C   1 
ATOM   3023  O  O   . GLN B 1 57  ? 2.275   22.446  57.745  1.00 34.17 ? 57   GLN B O   1 
ATOM   3024  C  CB  . GLN B 1 57  ? 4.343   22.442  55.695  1.00 34.18 ? 57   GLN B CB  1 
ATOM   3025  C  CG  . GLN B 1 57  ? 5.146   22.168  54.428  1.00 30.80 ? 57   GLN B CG  1 
ATOM   3026  C  CD  . GLN B 1 57  ? 4.553   21.062  53.577  1.00 30.95 ? 57   GLN B CD  1 
ATOM   3027  O  OE1 . GLN B 1 57  ? 3.885   21.326  52.578  1.00 31.54 ? 57   GLN B OE1 1 
ATOM   3028  N  NE2 . GLN B 1 57  ? 4.801   19.817  53.965  1.00 31.49 ? 57   GLN B NE2 1 
ATOM   3029  N  N   . SER B 1 58  ? 1.589   24.385  56.821  1.00 35.63 ? 58   SER B N   1 
ATOM   3030  C  CA  . SER B 1 58  ? 0.927   24.883  58.029  1.00 36.91 ? 58   SER B CA  1 
ATOM   3031  C  C   . SER B 1 58  ? -0.136  23.928  58.562  1.00 38.27 ? 58   SER B C   1 
ATOM   3032  O  O   . SER B 1 58  ? -0.325  23.813  59.774  1.00 38.14 ? 58   SER B O   1 
ATOM   3033  C  CB  . SER B 1 58  ? 0.300   26.255  57.765  1.00 36.72 ? 58   SER B CB  1 
ATOM   3034  O  OG  . SER B 1 58  ? -0.255  26.804  58.949  1.00 37.84 ? 58   SER B OG  1 
ATOM   3035  N  N   . ASN B 1 59  ? -0.826  23.250  57.651  1.00 39.63 ? 59   ASN B N   1 
ATOM   3036  C  CA  . ASN B 1 59  ? -1.873  22.301  58.015  1.00 40.68 ? 59   ASN B CA  1 
ATOM   3037  C  C   . ASN B 1 59  ? -1.291  21.168  58.853  1.00 40.09 ? 59   ASN B C   1 
ATOM   3038  O  O   . ASN B 1 59  ? -1.819  20.835  59.916  1.00 40.44 ? 59   ASN B O   1 
ATOM   3039  C  CB  . ASN B 1 59  ? -2.530  21.733  56.754  1.00 41.87 ? 59   ASN B CB  1 
ATOM   3040  C  CG  . ASN B 1 59  ? -3.063  22.817  55.837  1.00 43.88 ? 59   ASN B CG  1 
ATOM   3041  O  OD1 . ASN B 1 59  ? -2.476  23.109  54.795  1.00 46.12 ? 59   ASN B OD1 1 
ATOM   3042  N  ND2 . ASN B 1 59  ? -4.175  23.428  56.229  1.00 44.42 ? 59   ASN B ND2 1 
ATOM   3043  N  N   . VAL B 1 60  ? -0.184  20.606  58.374  1.00 38.38 ? 60   VAL B N   1 
ATOM   3044  C  CA  . VAL B 1 60  ? 0.504   19.510  59.051  1.00 36.45 ? 60   VAL B CA  1 
ATOM   3045  C  C   . VAL B 1 60  ? 1.084   19.981  60.381  1.00 36.27 ? 60   VAL B C   1 
ATOM   3046  O  O   . VAL B 1 60  ? 0.960   19.297  61.396  1.00 36.96 ? 60   VAL B O   1 
ATOM   3047  C  CB  . VAL B 1 60  ? 1.655   18.944  58.179  1.00 35.40 ? 60   VAL B CB  1 
ATOM   3048  C  CG1 . VAL B 1 60  ? 2.266   17.714  58.836  1.00 33.87 ? 60   VAL B CG1 1 
ATOM   3049  C  CG2 . VAL B 1 60  ? 1.148   18.608  56.785  1.00 34.97 ? 60   VAL B CG2 1 
ATOM   3050  N  N   . TYR B 1 61  ? 1.699   21.162  60.368  1.00 36.40 ? 61   TYR B N   1 
ATOM   3051  C  CA  . TYR B 1 61  ? 2.309   21.743  61.562  1.00 35.61 ? 61   TYR B CA  1 
ATOM   3052  C  C   . TYR B 1 61  ? 1.310   21.951  62.698  1.00 35.46 ? 61   TYR B C   1 
ATOM   3053  O  O   . TYR B 1 61  ? 1.601   21.639  63.852  1.00 36.55 ? 61   TYR B O   1 
ATOM   3054  C  CB  . TYR B 1 61  ? 2.987   23.073  61.222  1.00 36.16 ? 61   TYR B CB  1 
ATOM   3055  C  CG  . TYR B 1 61  ? 4.165   22.960  60.274  1.00 36.11 ? 61   TYR B CG  1 
ATOM   3056  C  CD1 . TYR B 1 61  ? 4.832   21.747  60.092  1.00 36.35 ? 61   TYR B CD1 1 
ATOM   3057  C  CD2 . TYR B 1 61  ? 4.616   24.071  59.563  1.00 35.73 ? 61   TYR B CD2 1 
ATOM   3058  C  CE1 . TYR B 1 61  ? 5.919   21.646  59.224  1.00 35.89 ? 61   TYR B CE1 1 
ATOM   3059  C  CE2 . TYR B 1 61  ? 5.700   23.981  58.695  1.00 35.04 ? 61   TYR B CE2 1 
ATOM   3060  C  CZ  . TYR B 1 61  ? 6.345   22.767  58.530  1.00 34.99 ? 61   TYR B CZ  1 
ATOM   3061  O  OH  . TYR B 1 61  ? 7.412   22.677  57.669  1.00 33.86 ? 61   TYR B OH  1 
ATOM   3062  N  N   . ASN B 1 62  ? 0.137   22.484  62.367  1.00 34.63 ? 62   ASN B N   1 
ATOM   3063  C  CA  . ASN B 1 62  ? -0.904  22.726  63.360  1.00 33.53 ? 62   ASN B CA  1 
ATOM   3064  C  C   . ASN B 1 62  ? -1.516  21.412  63.843  1.00 32.96 ? 62   ASN B C   1 
ATOM   3065  O  O   . ASN B 1 62  ? -2.024  21.329  64.962  1.00 31.55 ? 62   ASN B O   1 
ATOM   3066  C  CB  . ASN B 1 62  ? -1.999  23.627  62.779  1.00 35.69 ? 62   ASN B CB  1 
ATOM   3067  C  CG  . ASN B 1 62  ? -1.491  25.016  62.422  1.00 36.81 ? 62   ASN B CG  1 
ATOM   3068  O  OD1 . ASN B 1 62  ? -0.289  25.287  62.469  1.00 38.79 ? 62   ASN B OD1 1 
ATOM   3069  N  ND2 . ASN B 1 62  ? -2.409  25.904  62.058  1.00 35.43 ? 62   ASN B ND2 1 
ATOM   3070  N  N   . ALA B 1 63  ? -1.458  20.391  62.990  1.00 33.44 ? 63   ALA B N   1 
ATOM   3071  C  CA  . ALA B 1 63  ? -1.998  19.073  63.309  1.00 33.73 ? 63   ALA B CA  1 
ATOM   3072  C  C   . ALA B 1 63  ? -1.099  18.315  64.281  1.00 34.78 ? 63   ALA B C   1 
ATOM   3073  O  O   . ALA B 1 63  ? -1.575  17.767  65.279  1.00 33.45 ? 63   ALA B O   1 
ATOM   3074  C  CB  . ALA B 1 63  ? -2.196  18.264  62.035  1.00 33.01 ? 63   ALA B CB  1 
ATOM   3075  N  N   . VAL B 1 64  ? 0.200   18.285  63.985  1.00 36.63 ? 64   VAL B N   1 
ATOM   3076  C  CA  . VAL B 1 64  ? 1.171   17.596  64.832  1.00 37.57 ? 64   VAL B CA  1 
ATOM   3077  C  C   . VAL B 1 64  ? 1.369   18.294  66.178  1.00 38.12 ? 64   VAL B C   1 
ATOM   3078  O  O   . VAL B 1 64  ? 1.703   17.649  67.171  1.00 39.53 ? 64   VAL B O   1 
ATOM   3079  C  CB  . VAL B 1 64  ? 2.538   17.425  64.125  1.00 36.88 ? 64   VAL B CB  1 
ATOM   3080  C  CG1 . VAL B 1 64  ? 2.393   16.516  62.914  1.00 35.35 ? 64   VAL B CG1 1 
ATOM   3081  C  CG2 . VAL B 1 64  ? 3.095   18.774  63.710  1.00 37.24 ? 64   VAL B CG2 1 
ATOM   3082  N  N   . GLN B 1 65  ? 1.165   19.610  66.206  1.00 38.20 ? 65   GLN B N   1 
ATOM   3083  C  CA  . GLN B 1 65  ? 1.301   20.376  67.440  1.00 39.12 ? 65   GLN B CA  1 
ATOM   3084  C  C   . GLN B 1 65  ? 0.114   20.132  68.361  1.00 40.77 ? 65   GLN B C   1 
ATOM   3085  O  O   . GLN B 1 65  ? 0.265   20.105  69.585  1.00 40.74 ? 65   GLN B O   1 
ATOM   3086  C  CB  . GLN B 1 65  ? 1.454   21.870  67.146  1.00 38.95 ? 65   GLN B CB  1 
ATOM   3087  C  CG  . GLN B 1 65  ? 2.878   22.280  66.810  1.00 39.98 ? 65   GLN B CG  1 
ATOM   3088  C  CD  . GLN B 1 65  ? 3.863   21.895  67.901  1.00 41.13 ? 65   GLN B CD  1 
ATOM   3089  O  OE1 . GLN B 1 65  ? 4.796   21.129  67.667  1.00 40.93 ? 65   GLN B OE1 1 
ATOM   3090  N  NE2 . GLN B 1 65  ? 3.649   22.415  69.106  1.00 41.96 ? 65   GLN B NE2 1 
ATOM   3091  N  N   . GLU B 1 66  ? -1.066  19.964  67.767  1.00 42.73 ? 66   GLU B N   1 
ATOM   3092  C  CA  . GLU B 1 66  ? -2.279  19.690  68.529  1.00 44.76 ? 66   GLU B CA  1 
ATOM   3093  C  C   . GLU B 1 66  ? -2.205  18.249  69.034  1.00 45.32 ? 66   GLU B C   1 
ATOM   3094  O  O   . GLU B 1 66  ? -2.755  17.916  70.085  1.00 46.11 ? 66   GLU B O   1 
ATOM   3095  C  CB  . GLU B 1 66  ? -3.522  19.898  67.660  1.00 46.17 ? 66   GLU B CB  1 
ATOM   3096  C  CG  . GLU B 1 66  ? -4.844  19.653  68.382  1.00 49.82 ? 66   GLU B CG  1 
ATOM   3097  C  CD  . GLU B 1 66  ? -4.963  20.432  69.683  1.00 51.77 ? 66   GLU B CD  1 
ATOM   3098  O  OE1 . GLU B 1 66  ? -5.054  21.677  69.631  1.00 53.26 ? 66   GLU B OE1 1 
ATOM   3099  O  OE2 . GLU B 1 66  ? -4.968  19.795  70.758  1.00 52.86 ? 66   GLU B OE2 1 
ATOM   3100  N  N   . TRP B 1 67  ? -1.518  17.403  68.269  1.00 44.83 ? 67   TRP B N   1 
ATOM   3101  C  CA  . TRP B 1 67  ? -1.321  16.005  68.634  1.00 45.41 ? 67   TRP B CA  1 
ATOM   3102  C  C   . TRP B 1 67  ? -0.367  15.963  69.825  1.00 45.77 ? 67   TRP B C   1 
ATOM   3103  O  O   . TRP B 1 67  ? -0.591  15.227  70.787  1.00 46.62 ? 67   TRP B O   1 
ATOM   3104  C  CB  . TRP B 1 67  ? -0.734  15.229  67.451  1.00 45.83 ? 67   TRP B CB  1 
ATOM   3105  C  CG  . TRP B 1 67  ? -0.130  13.910  67.827  1.00 47.53 ? 67   TRP B CG  1 
ATOM   3106  C  CD1 . TRP B 1 67  ? -0.690  12.944  68.613  1.00 48.06 ? 67   TRP B CD1 1 
ATOM   3107  C  CD2 . TRP B 1 67  ? 1.170   13.427  67.463  1.00 48.52 ? 67   TRP B CD2 1 
ATOM   3108  N  NE1 . TRP B 1 67  ? 0.181   11.894  68.765  1.00 48.81 ? 67   TRP B NE1 1 
ATOM   3109  C  CE2 . TRP B 1 67  ? 1.330   12.162  68.071  1.00 48.82 ? 67   TRP B CE2 1 
ATOM   3110  C  CE3 . TRP B 1 67  ? 2.216   13.940  66.684  1.00 48.76 ? 67   TRP B CE3 1 
ATOM   3111  C  CZ2 . TRP B 1 67  ? 2.496   11.401  67.924  1.00 48.72 ? 67   TRP B CZ2 1 
ATOM   3112  C  CZ3 . TRP B 1 67  ? 3.377   13.183  66.538  1.00 48.82 ? 67   TRP B CZ3 1 
ATOM   3113  C  CH2 . TRP B 1 67  ? 3.505   11.927  67.157  1.00 49.05 ? 67   TRP B CH2 1 
ATOM   3114  N  N   . LEU B 1 68  ? 0.697   16.761  69.744  1.00 45.82 ? 68   LEU B N   1 
ATOM   3115  C  CA  . LEU B 1 68  ? 1.690   16.857  70.810  1.00 45.61 ? 68   LEU B CA  1 
ATOM   3116  C  C   . LEU B 1 68  ? 1.027   17.383  72.075  1.00 45.46 ? 68   LEU B C   1 
ATOM   3117  O  O   . LEU B 1 68  ? 1.433   17.047  73.189  1.00 46.82 ? 68   LEU B O   1 
ATOM   3118  C  CB  . LEU B 1 68  ? 2.828   17.795  70.395  1.00 45.22 ? 68   LEU B CB  1 
ATOM   3119  C  CG  . LEU B 1 68  ? 4.113   17.157  69.864  1.00 44.68 ? 68   LEU B CG  1 
ATOM   3120  C  CD1 . LEU B 1 68  ? 3.795   16.111  68.817  1.00 44.05 ? 68   LEU B CD1 1 
ATOM   3121  C  CD2 . LEU B 1 68  ? 5.030   18.233  69.303  1.00 42.66 ? 68   LEU B CD2 1 
ATOM   3122  N  N   . ARG B 1 69  ? 0.002   18.212  71.888  1.00 45.18 ? 69   ARG B N   1 
ATOM   3123  C  CA  . ARG B 1 69  ? -0.746  18.788  72.997  1.00 44.54 ? 69   ARG B CA  1 
ATOM   3124  C  C   . ARG B 1 69  ? -1.509  17.676  73.711  1.00 44.04 ? 69   ARG B C   1 
ATOM   3125  O  O   . ARG B 1 69  ? -1.574  17.649  74.939  1.00 44.47 ? 69   ARG B O   1 
ATOM   3126  C  CB  . ARG B 1 69  ? -1.720  19.852  72.482  1.00 43.11 ? 69   ARG B CB  1 
ATOM   3127  C  CG  . ARG B 1 69  ? -2.369  20.694  73.569  1.00 42.16 ? 69   ARG B CG  1 
ATOM   3128  C  CD  . ARG B 1 69  ? -1.321  21.399  74.416  1.00 41.73 ? 69   ARG B CD  1 
ATOM   3129  N  NE  . ARG B 1 69  ? -0.406  22.200  73.607  1.00 40.93 ? 69   ARG B NE  1 
ATOM   3130  C  CZ  . ARG B 1 69  ? 0.853   22.468  73.943  1.00 41.14 ? 69   ARG B CZ  1 
ATOM   3131  N  NH1 . ARG B 1 69  ? 1.356   22.000  75.077  1.00 41.19 ? 69   ARG B NH1 1 
ATOM   3132  N  NH2 . ARG B 1 69  ? 1.613   23.201  73.140  1.00 40.95 ? 69   ARG B NH2 1 
ATOM   3133  N  N   . ALA B 1 70  ? -2.035  16.735  72.930  1.00 43.20 ? 70   ALA B N   1 
ATOM   3134  C  CA  . ALA B 1 70  ? -2.788  15.601  73.460  1.00 43.28 ? 70   ALA B CA  1 
ATOM   3135  C  C   . ALA B 1 70  ? -1.898  14.599  74.200  1.00 42.59 ? 70   ALA B C   1 
ATOM   3136  O  O   . ALA B 1 70  ? -2.292  13.451  74.420  1.00 42.53 ? 70   ALA B O   1 
ATOM   3137  C  CB  . ALA B 1 70  ? -3.539  14.904  72.328  1.00 42.59 ? 70   ALA B CB  1 
ATOM   3138  N  N   . GLY B 1 71  ? -0.708  15.046  74.598  1.00 42.08 ? 71   GLY B N   1 
ATOM   3139  C  CA  . GLY B 1 71  ? 0.224   14.185  75.304  1.00 42.17 ? 71   GLY B CA  1 
ATOM   3140  C  C   . GLY B 1 71  ? 1.183   13.463  74.375  1.00 42.36 ? 71   GLY B C   1 
ATOM   3141  O  O   . GLY B 1 71  ? 1.993   12.651  74.826  1.00 43.14 ? 71   GLY B O   1 
ATOM   3142  N  N   . GLY B 1 72  ? 1.096   13.766  73.080  1.00 42.42 ? 72   GLY B N   1 
ATOM   3143  C  CA  . GLY B 1 72  ? 1.959   13.137  72.094  1.00 41.05 ? 72   GLY B CA  1 
ATOM   3144  C  C   . GLY B 1 72  ? 1.715   11.644  71.988  1.00 41.45 ? 72   GLY B C   1 
ATOM   3145  O  O   . GLY B 1 72  ? 2.660   10.853  71.985  1.00 40.67 ? 72   GLY B O   1 
ATOM   3146  N  N   . ASP B 1 73  ? 0.444   11.262  71.902  1.00 41.76 ? 73   ASP B N   1 
ATOM   3147  C  CA  . ASP B 1 73  ? 0.064   9.856   71.809  1.00 42.97 ? 73   ASP B CA  1 
ATOM   3148  C  C   . ASP B 1 73  ? 0.231   9.334   70.384  1.00 43.20 ? 73   ASP B C   1 
ATOM   3149  O  O   . ASP B 1 73  ? -0.619  9.563   69.520  1.00 43.12 ? 73   ASP B O   1 
ATOM   3150  C  CB  . ASP B 1 73  ? -1.381  9.668   72.282  1.00 42.75 ? 73   ASP B CB  1 
ATOM   3151  C  CG  . ASP B 1 73  ? -1.607  8.323   72.949  1.00 43.37 ? 73   ASP B CG  1 
ATOM   3152  O  OD1 . ASP B 1 73  ? -1.540  7.288   72.254  1.00 43.14 ? 73   ASP B OD1 1 
ATOM   3153  O  OD2 . ASP B 1 73  ? -1.850  8.303   74.174  1.00 43.82 ? 73   ASP B OD2 1 
ATOM   3154  N  N   . THR B 1 74  ? 1.330   8.617   70.158  1.00 43.52 ? 74   THR B N   1 
ATOM   3155  C  CA  . THR B 1 74  ? 1.662   8.049   68.851  1.00 43.46 ? 74   THR B CA  1 
ATOM   3156  C  C   . THR B 1 74  ? 0.582   7.132   68.273  1.00 42.71 ? 74   THR B C   1 
ATOM   3157  O  O   . THR B 1 74  ? 0.626   6.781   67.093  1.00 41.58 ? 74   THR B O   1 
ATOM   3158  C  CB  . THR B 1 74  ? 3.005   7.280   68.910  1.00 44.23 ? 74   THR B CB  1 
ATOM   3159  O  OG1 . THR B 1 74  ? 3.332   6.775   67.611  1.00 44.29 ? 74   THR B OG1 1 
ATOM   3160  C  CG2 . THR B 1 74  ? 2.922   6.119   69.896  1.00 45.23 ? 74   THR B CG2 1 
ATOM   3161  N  N   . ARG B 1 75  ? -0.380  6.748   69.106  1.00 43.42 ? 75   ARG B N   1 
ATOM   3162  C  CA  . ARG B 1 75  ? -1.465  5.876   68.674  1.00 43.60 ? 75   ARG B CA  1 
ATOM   3163  C  C   . ARG B 1 75  ? -2.725  6.666   68.317  1.00 43.47 ? 75   ARG B C   1 
ATOM   3164  O  O   . ARG B 1 75  ? -3.408  6.350   67.341  1.00 42.42 ? 75   ARG B O   1 
ATOM   3165  C  CB  . ARG B 1 75  ? -1.774  4.833   69.756  1.00 44.07 ? 75   ARG B CB  1 
ATOM   3166  C  CG  . ARG B 1 75  ? -0.545  4.072   70.245  1.00 44.12 ? 75   ARG B CG  1 
ATOM   3167  C  CD  . ARG B 1 75  ? -0.870  2.635   70.630  1.00 45.94 ? 75   ARG B CD  1 
ATOM   3168  N  NE  . ARG B 1 75  ? -1.837  2.535   71.720  1.00 47.59 ? 75   ARG B NE  1 
ATOM   3169  C  CZ  . ARG B 1 75  ? -2.345  1.388   72.166  1.00 48.90 ? 75   ARG B CZ  1 
ATOM   3170  N  NH1 . ARG B 1 75  ? -1.980  0.235   71.618  1.00 49.09 ? 75   ARG B NH1 1 
ATOM   3171  N  NH2 . ARG B 1 75  ? -3.225  1.393   73.158  1.00 49.40 ? 75   ARG B NH2 1 
ATOM   3172  N  N   . ASN B 1 76  ? -3.012  7.706   69.100  1.00 43.81 ? 76   ASN B N   1 
ATOM   3173  C  CA  . ASN B 1 76  ? -4.188  8.549   68.884  1.00 44.63 ? 76   ASN B CA  1 
ATOM   3174  C  C   . ASN B 1 76  ? -3.983  9.662   67.855  1.00 46.31 ? 76   ASN B C   1 
ATOM   3175  O  O   . ASN B 1 76  ? -4.873  10.491  67.656  1.00 46.73 ? 76   ASN B O   1 
ATOM   3176  C  CB  . ASN B 1 76  ? -4.658  9.165   70.209  1.00 42.86 ? 76   ASN B CB  1 
ATOM   3177  C  CG  . ASN B 1 76  ? -5.313  8.151   71.131  1.00 41.69 ? 76   ASN B CG  1 
ATOM   3178  O  OD1 . ASN B 1 76  ? -6.539  8.045   71.183  1.00 40.07 ? 76   ASN B OD1 1 
ATOM   3179  N  ND2 . ASN B 1 76  ? -4.498  7.411   71.873  1.00 40.57 ? 76   ASN B ND2 1 
HETATM 3180  N  N   . MSE B 1 77  ? -2.827  9.678   67.196  1.00 48.42 ? 77   MSE B N   1 
HETATM 3181  C  CA  . MSE B 1 77  ? -2.535  10.706  66.197  1.00 50.26 ? 77   MSE B CA  1 
HETATM 3182  C  C   . MSE B 1 77  ? -3.428  10.628  64.959  1.00 49.95 ? 77   MSE B C   1 
HETATM 3183  O  O   . MSE B 1 77  ? -3.523  11.591  64.195  1.00 50.09 ? 77   MSE B O   1 
HETATM 3184  C  CB  . MSE B 1 77  ? -1.058  10.675  65.789  1.00 53.45 ? 77   MSE B CB  1 
HETATM 3185  C  CG  . MSE B 1 77  ? -0.566  9.355   65.223  1.00 56.95 ? 77   MSE B CG  1 
HETATM 3186  SE SE  . MSE B 1 77  ? 1.265   9.491   64.622  1.00 62.97 ? 77   MSE B SE  1 
HETATM 3187  C  CE  . MSE B 1 77  ? 0.950   9.511   62.724  1.00 60.86 ? 77   MSE B CE  1 
ATOM   3188  N  N   . ARG B 1 78  ? -4.089  9.487   64.777  1.00 48.97 ? 78   ARG B N   1 
ATOM   3189  C  CA  . ARG B 1 78  ? -4.985  9.279   63.642  1.00 46.92 ? 78   ARG B CA  1 
ATOM   3190  C  C   . ARG B 1 78  ? -6.245  10.138  63.750  1.00 44.95 ? 78   ARG B C   1 
ATOM   3191  O  O   . ARG B 1 78  ? -6.877  10.449  62.740  1.00 43.60 ? 78   ARG B O   1 
ATOM   3192  C  CB  . ARG B 1 78  ? -5.361  7.798   63.525  1.00 48.13 ? 78   ARG B CB  1 
ATOM   3193  C  CG  . ARG B 1 78  ? -4.181  6.875   63.233  1.00 48.49 ? 78   ARG B CG  1 
ATOM   3194  C  CD  . ARG B 1 78  ? -3.533  7.192   61.889  1.00 49.34 ? 78   ARG B CD  1 
ATOM   3195  N  NE  . ARG B 1 78  ? -4.404  6.874   60.758  1.00 49.74 ? 78   ARG B NE  1 
ATOM   3196  C  CZ  . ARG B 1 78  ? -4.577  7.658   59.696  1.00 48.83 ? 78   ARG B CZ  1 
ATOM   3197  N  NH1 . ARG B 1 78  ? -3.944  8.820   59.610  1.00 49.14 ? 78   ARG B NH1 1 
ATOM   3198  N  NH2 . ARG B 1 78  ? -5.377  7.275   58.711  1.00 47.86 ? 78   ARG B NH2 1 
ATOM   3199  N  N   . GLN B 1 79  ? -6.596  10.519  64.978  1.00 43.87 ? 79   GLN B N   1 
ATOM   3200  C  CA  . GLN B 1 79  ? -7.767  11.356  65.240  1.00 42.56 ? 79   GLN B CA  1 
ATOM   3201  C  C   . GLN B 1 79  ? -7.562  12.750  64.654  1.00 42.90 ? 79   GLN B C   1 
ATOM   3202  O  O   . GLN B 1 79  ? -8.522  13.439  64.301  1.00 42.54 ? 79   GLN B O   1 
ATOM   3203  C  CB  . GLN B 1 79  ? -8.011  11.486  66.747  1.00 41.66 ? 79   GLN B CB  1 
ATOM   3204  C  CG  . GLN B 1 79  ? -8.327  10.185  67.466  1.00 40.78 ? 79   GLN B CG  1 
ATOM   3205  C  CD  . GLN B 1 79  ? -8.547  10.381  68.958  1.00 39.93 ? 79   GLN B CD  1 
ATOM   3206  O  OE1 . GLN B 1 79  ? -8.331  11.470  69.496  1.00 38.40 ? 79   GLN B OE1 1 
ATOM   3207  N  NE2 . GLN B 1 79  ? -8.978  9.323   69.635  1.00 40.44 ? 79   GLN B NE2 1 
ATOM   3208  N  N   . PHE B 1 80  ? -6.300  13.162  64.579  1.00 42.97 ? 80   PHE B N   1 
ATOM   3209  C  CA  . PHE B 1 80  ? -5.931  14.469  64.047  1.00 42.52 ? 80   PHE B CA  1 
ATOM   3210  C  C   . PHE B 1 80  ? -5.704  14.403  62.538  1.00 41.46 ? 80   PHE B C   1 
ATOM   3211  O  O   . PHE B 1 80  ? -5.344  15.401  61.911  1.00 41.37 ? 80   PHE B O   1 
ATOM   3212  C  CB  . PHE B 1 80  ? -4.678  14.982  64.761  1.00 43.07 ? 80   PHE B CB  1 
ATOM   3213  C  CG  . PHE B 1 80  ? -4.795  14.972  66.261  1.00 44.91 ? 80   PHE B CG  1 
ATOM   3214  C  CD1 . PHE B 1 80  ? -4.489  13.825  66.988  1.00 44.36 ? 80   PHE B CD1 1 
ATOM   3215  C  CD2 . PHE B 1 80  ? -5.243  16.098  66.945  1.00 45.31 ? 80   PHE B CD2 1 
ATOM   3216  C  CE1 . PHE B 1 80  ? -4.629  13.798  68.373  1.00 45.42 ? 80   PHE B CE1 1 
ATOM   3217  C  CE2 . PHE B 1 80  ? -5.386  16.081  68.333  1.00 45.58 ? 80   PHE B CE2 1 
ATOM   3218  C  CZ  . PHE B 1 80  ? -5.079  14.928  69.047  1.00 45.65 ? 80   PHE B CZ  1 
ATOM   3219  N  N   . GLY B 1 81  ? -5.932  13.222  61.966  1.00 40.42 ? 81   GLY B N   1 
ATOM   3220  C  CA  . GLY B 1 81  ? -5.764  13.025  60.537  1.00 39.93 ? 81   GLY B CA  1 
ATOM   3221  C  C   . GLY B 1 81  ? -4.320  12.930  60.088  1.00 39.48 ? 81   GLY B C   1 
ATOM   3222  O  O   . GLY B 1 81  ? -4.027  13.064  58.899  1.00 40.22 ? 81   GLY B O   1 
ATOM   3223  N  N   . ILE B 1 82  ? -3.417  12.696  61.036  1.00 38.82 ? 82   ILE B N   1 
ATOM   3224  C  CA  . ILE B 1 82  ? -1.995  12.588  60.733  1.00 37.40 ? 82   ILE B CA  1 
ATOM   3225  C  C   . ILE B 1 82  ? -1.660  11.199  60.200  1.00 35.95 ? 82   ILE B C   1 
ATOM   3226  O  O   . ILE B 1 82  ? -1.722  10.207  60.930  1.00 34.18 ? 82   ILE B O   1 
ATOM   3227  C  CB  . ILE B 1 82  ? -1.124  12.877  61.979  1.00 38.38 ? 82   ILE B CB  1 
ATOM   3228  C  CG1 . ILE B 1 82  ? -1.563  14.187  62.636  1.00 39.37 ? 82   ILE B CG1 1 
ATOM   3229  C  CG2 . ILE B 1 82  ? 0.345   12.976  61.582  1.00 36.57 ? 82   ILE B CG2 1 
ATOM   3230  C  CD1 . ILE B 1 82  ? -0.857  14.482  63.936  1.00 39.89 ? 82   ILE B CD1 1 
ATOM   3231  N  N   . ASP B 1 83  ? -1.334  11.136  58.912  1.00 35.63 ? 83   ASP B N   1 
ATOM   3232  C  CA  . ASP B 1 83  ? -0.982  9.881   58.260  1.00 34.41 ? 83   ASP B CA  1 
ATOM   3233  C  C   . ASP B 1 83  ? 0.532   9.697   58.274  1.00 34.02 ? 83   ASP B C   1 
ATOM   3234  O  O   . ASP B 1 83  ? 1.275   10.574  57.829  1.00 32.94 ? 83   ASP B O   1 
ATOM   3235  C  CB  . ASP B 1 83  ? -1.491  9.869   56.816  1.00 35.39 ? 83   ASP B CB  1 
ATOM   3236  C  CG  . ASP B 1 83  ? -3.004  9.882   56.725  1.00 35.41 ? 83   ASP B CG  1 
ATOM   3237  O  OD1 . ASP B 1 83  ? -3.624  10.888  57.126  1.00 37.23 ? 83   ASP B OD1 1 
ATOM   3238  O  OD2 . ASP B 1 83  ? -3.575  8.885   56.239  1.00 36.31 ? 83   ASP B OD2 1 
ATOM   3239  N  N   . ALA B 1 84  ? 0.980   8.560   58.799  1.00 34.45 ? 84   ALA B N   1 
ATOM   3240  C  CA  . ALA B 1 84  ? 2.405   8.253   58.878  1.00 33.38 ? 84   ALA B CA  1 
ATOM   3241  C  C   . ALA B 1 84  ? 2.876   7.429   57.686  1.00 31.75 ? 84   ALA B C   1 
ATOM   3242  O  O   . ALA B 1 84  ? 2.367   6.338   57.432  1.00 31.03 ? 84   ALA B O   1 
ATOM   3243  C  CB  . ALA B 1 84  ? 2.720   7.524   60.179  1.00 34.28 ? 84   ALA B CB  1 
ATOM   3244  N  N   . TRP B 1 85  ? 3.843   7.971   56.952  1.00 31.77 ? 85   TRP B N   1 
ATOM   3245  C  CA  . TRP B 1 85  ? 4.410   7.304   55.786  1.00 31.17 ? 85   TRP B CA  1 
ATOM   3246  C  C   . TRP B 1 85  ? 5.849   6.879   56.064  1.00 32.31 ? 85   TRP B C   1 
ATOM   3247  O  O   . TRP B 1 85  ? 6.786   7.644   55.825  1.00 34.03 ? 85   TRP B O   1 
ATOM   3248  C  CB  . TRP B 1 85  ? 4.365   8.234   54.570  1.00 29.15 ? 85   TRP B CB  1 
ATOM   3249  C  CG  . TRP B 1 85  ? 3.208   7.992   53.646  1.00 27.50 ? 85   TRP B CG  1 
ATOM   3250  C  CD1 . TRP B 1 85  ? 3.146   7.072   52.641  1.00 27.38 ? 85   TRP B CD1 1 
ATOM   3251  C  CD2 . TRP B 1 85  ? 1.968   8.707   53.611  1.00 28.12 ? 85   TRP B CD2 1 
ATOM   3252  N  NE1 . TRP B 1 85  ? 1.949   7.172   51.977  1.00 28.69 ? 85   TRP B NE1 1 
ATOM   3253  C  CE2 . TRP B 1 85  ? 1.205   8.168   52.550  1.00 29.66 ? 85   TRP B CE2 1 
ATOM   3254  C  CE3 . TRP B 1 85  ? 1.426   9.753   54.368  1.00 28.00 ? 85   TRP B CE3 1 
ATOM   3255  C  CZ2 . TRP B 1 85  ? -0.072  8.642   52.228  1.00 31.40 ? 85   TRP B CZ2 1 
ATOM   3256  C  CZ3 . TRP B 1 85  ? 0.156   10.224  54.046  1.00 29.54 ? 85   TRP B CZ3 1 
ATOM   3257  C  CH2 . TRP B 1 85  ? -0.578  9.667   52.985  1.00 31.31 ? 85   TRP B CH2 1 
ATOM   3258  N  N   . GLN B 1 86  ? 6.022   5.659   56.567  1.00 32.85 ? 86   GLN B N   1 
ATOM   3259  C  CA  . GLN B 1 86  ? 7.351   5.145   56.879  1.00 34.25 ? 86   GLN B CA  1 
ATOM   3260  C  C   . GLN B 1 86  ? 8.223   4.988   55.643  1.00 36.09 ? 86   GLN B C   1 
ATOM   3261  O  O   . GLN B 1 86  ? 7.824   4.368   54.658  1.00 36.79 ? 86   GLN B O   1 
ATOM   3262  C  CB  . GLN B 1 86  ? 7.273   3.811   57.627  1.00 33.33 ? 86   GLN B CB  1 
ATOM   3263  C  CG  . GLN B 1 86  ? 8.642   3.259   58.025  1.00 32.34 ? 86   GLN B CG  1 
ATOM   3264  C  CD  . GLN B 1 86  ? 8.573   2.182   59.090  1.00 31.00 ? 86   GLN B CD  1 
ATOM   3265  O  OE1 . GLN B 1 86  ? 7.556   1.505   59.249  1.00 32.36 ? 86   GLN B OE1 1 
ATOM   3266  N  NE2 . GLN B 1 86  ? 9.663   2.021   59.833  1.00 29.99 ? 86   GLN B NE2 1 
HETATM 3267  N  N   . MSE B 1 87  ? 9.419   5.560   55.714  1.00 37.85 ? 87   MSE B N   1 
HETATM 3268  C  CA  . MSE B 1 87  ? 10.378  5.497   54.621  1.00 37.87 ? 87   MSE B CA  1 
HETATM 3269  C  C   . MSE B 1 87  ? 10.920  4.078   54.492  1.00 36.55 ? 87   MSE B C   1 
HETATM 3270  O  O   . MSE B 1 87  ? 11.141  3.398   55.495  1.00 36.21 ? 87   MSE B O   1 
HETATM 3271  C  CB  . MSE B 1 87  ? 11.518  6.484   54.880  1.00 39.49 ? 87   MSE B CB  1 
HETATM 3272  C  CG  . MSE B 1 87  ? 11.036  7.911   55.094  1.00 41.88 ? 87   MSE B CG  1 
HETATM 3273  SE SE  . MSE B 1 87  ? 12.436  9.180   55.475  1.00 44.30 ? 87   MSE B SE  1 
HETATM 3274  C  CE  . MSE B 1 87  ? 13.209  9.276   53.709  1.00 43.27 ? 87   MSE B CE  1 
ATOM   3275  N  N   . GLU B 1 88  ? 11.109  3.630   53.254  1.00 35.95 ? 88   GLU B N   1 
ATOM   3276  C  CA  . GLU B 1 88  ? 11.619  2.287   52.983  1.00 35.64 ? 88   GLU B CA  1 
ATOM   3277  C  C   . GLU B 1 88  ? 13.006  2.053   53.577  1.00 35.55 ? 88   GLU B C   1 
ATOM   3278  O  O   . GLU B 1 88  ? 13.302  0.965   54.064  1.00 34.72 ? 88   GLU B O   1 
ATOM   3279  C  CB  . GLU B 1 88  ? 11.654  2.025   51.475  1.00 34.81 ? 88   GLU B CB  1 
ATOM   3280  C  CG  . GLU B 1 88  ? 12.488  3.030   50.686  1.00 34.71 ? 88   GLU B CG  1 
ATOM   3281  C  CD  . GLU B 1 88  ? 12.611  2.688   49.210  1.00 34.59 ? 88   GLU B CD  1 
ATOM   3282  O  OE1 . GLU B 1 88  ? 11.838  1.840   48.712  1.00 34.85 ? 88   GLU B OE1 1 
ATOM   3283  O  OE2 . GLU B 1 88  ? 13.488  3.278   48.545  1.00 34.94 ? 88   GLU B OE2 1 
ATOM   3284  N  N   . GLY B 1 89  ? 13.842  3.086   53.552  1.00 36.48 ? 89   GLY B N   1 
ATOM   3285  C  CA  . GLY B 1 89  ? 15.187  2.965   54.080  1.00 36.78 ? 89   GLY B CA  1 
ATOM   3286  C  C   . GLY B 1 89  ? 16.177  2.571   53.002  1.00 37.74 ? 89   GLY B C   1 
ATOM   3287  O  O   . GLY B 1 89  ? 15.785  2.212   51.890  1.00 38.54 ? 89   GLY B O   1 
ATOM   3288  N  N   . ALA B 1 90  ? 17.464  2.645   53.328  1.00 38.49 ? 90   ALA B N   1 
ATOM   3289  C  CA  . ALA B 1 90  ? 18.526  2.296   52.390  1.00 38.22 ? 90   ALA B CA  1 
ATOM   3290  C  C   . ALA B 1 90  ? 18.543  0.797   52.093  1.00 38.04 ? 90   ALA B C   1 
ATOM   3291  O  O   . ALA B 1 90  ? 18.956  0.373   51.011  1.00 38.02 ? 90   ALA B O   1 
ATOM   3292  C  CB  . ALA B 1 90  ? 19.876  2.741   52.941  1.00 38.65 ? 90   ALA B CB  1 
ATOM   3293  N  N   . ASP B 1 91  ? 18.087  0.005   53.060  1.00 38.16 ? 91   ASP B N   1 
ATOM   3294  C  CA  . ASP B 1 91  ? 18.043  -1.447  52.928  1.00 37.14 ? 91   ASP B CA  1 
ATOM   3295  C  C   . ASP B 1 91  ? 16.637  -1.968  52.636  1.00 37.37 ? 91   ASP B C   1 
ATOM   3296  O  O   . ASP B 1 91  ? 16.436  -3.173  52.475  1.00 37.21 ? 91   ASP B O   1 
ATOM   3297  C  CB  . ASP B 1 91  ? 18.599  -2.109  54.198  1.00 37.05 ? 91   ASP B CB  1 
ATOM   3298  C  CG  . ASP B 1 91  ? 17.830  -1.724  55.463  1.00 36.51 ? 91   ASP B CG  1 
ATOM   3299  O  OD1 . ASP B 1 91  ? 16.937  -0.850  55.408  1.00 35.78 ? 91   ASP B OD1 1 
ATOM   3300  O  OD2 . ASP B 1 91  ? 18.128  -2.306  56.527  1.00 36.95 ? 91   ASP B OD2 1 
ATOM   3301  N  N   . ASN B 1 92  ? 15.676  -1.049  52.565  1.00 38.28 ? 92   ASN B N   1 
ATOM   3302  C  CA  . ASN B 1 92  ? 14.272  -1.374  52.305  1.00 41.28 ? 92   ASN B CA  1 
ATOM   3303  C  C   . ASN B 1 92  ? 13.615  -2.124  53.469  1.00 42.63 ? 92   ASN B C   1 
ATOM   3304  O  O   . ASN B 1 92  ? 12.604  -2.804  53.289  1.00 42.77 ? 92   ASN B O   1 
ATOM   3305  C  CB  . ASN B 1 92  ? 14.123  -2.168  51.000  1.00 42.56 ? 92   ASN B CB  1 
ATOM   3306  C  CG  . ASN B 1 92  ? 14.582  -1.384  49.781  1.00 42.97 ? 92   ASN B CG  1 
ATOM   3307  O  OD1 . ASN B 1 92  ? 15.760  -1.399  49.425  1.00 42.30 ? 92   ASN B OD1 1 
ATOM   3308  N  ND2 . ASN B 1 92  ? 13.648  -0.698  49.134  1.00 44.51 ? 92   ASN B ND2 1 
ATOM   3309  N  N   . TYR B 1 93  ? 14.190  -1.977  54.662  1.00 44.16 ? 93   TYR B N   1 
ATOM   3310  C  CA  . TYR B 1 93  ? 13.678  -2.622  55.871  1.00 44.18 ? 93   TYR B CA  1 
ATOM   3311  C  C   . TYR B 1 93  ? 13.241  -1.598  56.920  1.00 45.25 ? 93   TYR B C   1 
ATOM   3312  O  O   . TYR B 1 93  ? 12.921  -1.958  58.056  1.00 45.98 ? 93   TYR B O   1 
ATOM   3313  C  CB  . TYR B 1 93  ? 14.736  -3.550  56.478  1.00 43.51 ? 93   TYR B CB  1 
ATOM   3314  C  CG  . TYR B 1 93  ? 14.980  -4.818  55.692  1.00 42.49 ? 93   TYR B CG  1 
ATOM   3315  C  CD1 . TYR B 1 93  ? 14.068  -5.871  55.732  1.00 43.17 ? 93   TYR B CD1 1 
ATOM   3316  C  CD2 . TYR B 1 93  ? 16.128  -4.971  54.917  1.00 40.92 ? 93   TYR B CD2 1 
ATOM   3317  C  CE1 . TYR B 1 93  ? 14.291  -7.047  55.018  1.00 42.95 ? 93   TYR B CE1 1 
ATOM   3318  C  CE2 . TYR B 1 93  ? 16.362  -6.140  54.198  1.00 41.46 ? 93   TYR B CE2 1 
ATOM   3319  C  CZ  . TYR B 1 93  ? 15.440  -7.174  54.253  1.00 42.55 ? 93   TYR B CZ  1 
ATOM   3320  O  OH  . TYR B 1 93  ? 15.665  -8.333  53.546  1.00 44.30 ? 93   TYR B OH  1 
ATOM   3321  N  N   . GLY B 1 94  ? 13.236  -0.324  56.532  1.00 45.21 ? 94   GLY B N   1 
ATOM   3322  C  CA  . GLY B 1 94  ? 12.838  0.741   57.438  1.00 42.15 ? 94   GLY B CA  1 
ATOM   3323  C  C   . GLY B 1 94  ? 14.001  1.445   58.110  1.00 40.58 ? 94   GLY B C   1 
ATOM   3324  O  O   . GLY B 1 94  ? 13.819  2.488   58.737  1.00 39.66 ? 94   GLY B O   1 
ATOM   3325  N  N   . ASN B 1 95  ? 15.197  0.881   57.969  1.00 40.26 ? 95   ASN B N   1 
ATOM   3326  C  CA  . ASN B 1 95  ? 16.401  1.448   58.569  1.00 40.88 ? 95   ASN B CA  1 
ATOM   3327  C  C   . ASN B 1 95  ? 17.072  2.465   57.649  1.00 41.82 ? 95   ASN B C   1 
ATOM   3328  O  O   . ASN B 1 95  ? 17.401  2.156   56.502  1.00 42.88 ? 95   ASN B O   1 
ATOM   3329  C  CB  . ASN B 1 95  ? 17.381  0.328   58.931  1.00 39.62 ? 95   ASN B CB  1 
ATOM   3330  C  CG  . ASN B 1 95  ? 16.762  -0.711  59.849  1.00 38.63 ? 95   ASN B CG  1 
ATOM   3331  O  OD1 . ASN B 1 95  ? 16.299  -0.391  60.945  1.00 38.65 ? 95   ASN B OD1 1 
ATOM   3332  N  ND2 . ASN B 1 95  ? 16.739  -1.961  59.399  1.00 38.06 ? 95   ASN B ND2 1 
ATOM   3333  N  N   . VAL B 1 96  ? 17.272  3.677   58.163  1.00 41.53 ? 96   VAL B N   1 
ATOM   3334  C  CA  . VAL B 1 96  ? 17.892  4.760   57.401  1.00 40.72 ? 96   VAL B CA  1 
ATOM   3335  C  C   . VAL B 1 96  ? 19.165  5.273   58.074  1.00 39.26 ? 96   VAL B C   1 
ATOM   3336  O  O   . VAL B 1 96  ? 19.235  5.363   59.300  1.00 38.30 ? 96   VAL B O   1 
ATOM   3337  C  CB  . VAL B 1 96  ? 16.911  5.948   57.221  1.00 41.60 ? 96   VAL B CB  1 
ATOM   3338  C  CG1 . VAL B 1 96  ? 17.551  7.053   56.389  1.00 43.70 ? 96   VAL B CG1 1 
ATOM   3339  C  CG2 . VAL B 1 96  ? 15.626  5.476   56.564  1.00 41.82 ? 96   VAL B CG2 1 
ATOM   3340  N  N   . GLN B 1 97  ? 20.165  5.604   57.258  1.00 38.92 ? 97   GLN B N   1 
ATOM   3341  C  CA  . GLN B 1 97  ? 21.442  6.126   57.742  1.00 38.29 ? 97   GLN B CA  1 
ATOM   3342  C  C   . GLN B 1 97  ? 21.268  7.476   58.430  1.00 37.09 ? 97   GLN B C   1 
ATOM   3343  O  O   . GLN B 1 97  ? 20.555  8.354   57.935  1.00 36.54 ? 97   GLN B O   1 
ATOM   3344  C  CB  . GLN B 1 97  ? 22.438  6.273   56.585  1.00 40.72 ? 97   GLN B CB  1 
ATOM   3345  C  CG  . GLN B 1 97  ? 23.399  5.103   56.405  1.00 44.74 ? 97   GLN B CG  1 
ATOM   3346  C  CD  . GLN B 1 97  ? 24.499  5.058   57.461  1.00 48.08 ? 97   GLN B CD  1 
ATOM   3347  O  OE1 . GLN B 1 97  ? 24.402  5.697   58.510  1.00 48.71 ? 97   GLN B OE1 1 
ATOM   3348  N  NE2 . GLN B 1 97  ? 25.555  4.298   57.182  1.00 48.65 ? 97   GLN B NE2 1 
ATOM   3349  N  N   . PHE B 1 98  ? 21.931  7.634   59.571  1.00 34.69 ? 98   PHE B N   1 
ATOM   3350  C  CA  . PHE B 1 98  ? 21.862  8.868   60.341  1.00 31.97 ? 98   PHE B CA  1 
ATOM   3351  C  C   . PHE B 1 98  ? 23.241  9.418   60.671  1.00 29.66 ? 98   PHE B C   1 
ATOM   3352  O  O   . PHE B 1 98  ? 23.985  8.822   61.448  1.00 29.25 ? 98   PHE B O   1 
ATOM   3353  C  CB  . PHE B 1 98  ? 21.089  8.650   61.647  1.00 32.69 ? 98   PHE B CB  1 
ATOM   3354  C  CG  . PHE B 1 98  ? 19.596  8.673   61.487  1.00 33.57 ? 98   PHE B CG  1 
ATOM   3355  C  CD1 . PHE B 1 98  ? 18.968  9.722   60.823  1.00 34.23 ? 98   PHE B CD1 1 
ATOM   3356  C  CD2 . PHE B 1 98  ? 18.812  7.660   62.029  1.00 33.16 ? 98   PHE B CD2 1 
ATOM   3357  C  CE1 . PHE B 1 98  ? 17.582  9.763   60.704  1.00 34.99 ? 98   PHE B CE1 1 
ATOM   3358  C  CE2 . PHE B 1 98  ? 17.425  7.692   61.915  1.00 33.59 ? 98   PHE B CE2 1 
ATOM   3359  C  CZ  . PHE B 1 98  ? 16.809  8.746   61.252  1.00 34.17 ? 98   PHE B CZ  1 
ATOM   3360  N  N   . THR B 1 99  ? 23.587  10.544  60.055  1.00 28.56 ? 99   THR B N   1 
ATOM   3361  C  CA  . THR B 1 99  ? 24.865  11.191  60.318  1.00 27.42 ? 99   THR B CA  1 
ATOM   3362  C  C   . THR B 1 99  ? 24.568  12.476  61.093  1.00 25.07 ? 99   THR B C   1 
ATOM   3363  O  O   . THR B 1 99  ? 23.409  12.759  61.403  1.00 24.44 ? 99   THR B O   1 
ATOM   3364  C  CB  . THR B 1 99  ? 25.647  11.491  59.012  1.00 28.34 ? 99   THR B CB  1 
ATOM   3365  O  OG1 . THR B 1 99  ? 26.996  11.852  59.333  1.00 32.02 ? 99   THR B OG1 1 
ATOM   3366  C  CG2 . THR B 1 99  ? 25.004  12.626  58.235  1.00 28.47 ? 99   THR B CG2 1 
ATOM   3367  N  N   . GLY B 1 100 ? 25.601  13.243  61.424  1.00 23.71 ? 100  GLY B N   1 
ATOM   3368  C  CA  . GLY B 1 100 ? 25.367  14.467  62.166  1.00 22.42 ? 100  GLY B CA  1 
ATOM   3369  C  C   . GLY B 1 100 ? 26.388  15.562  61.954  1.00 22.26 ? 100  GLY B C   1 
ATOM   3370  O  O   . GLY B 1 100 ? 27.538  15.297  61.608  1.00 21.00 ? 100  GLY B O   1 
ATOM   3371  N  N   . TYR B 1 101 ? 25.948  16.801  62.158  1.00 20.17 ? 101  TYR B N   1 
ATOM   3372  C  CA  . TYR B 1 101 ? 26.802  17.973  62.019  1.00 19.65 ? 101  TYR B CA  1 
ATOM   3373  C  C   . TYR B 1 101 ? 26.376  19.022  63.041  1.00 20.02 ? 101  TYR B C   1 
ATOM   3374  O  O   . TYR B 1 101 ? 25.255  18.985  63.548  1.00 22.40 ? 101  TYR B O   1 
ATOM   3375  C  CB  . TYR B 1 101 ? 26.740  18.541  60.593  1.00 17.89 ? 101  TYR B CB  1 
ATOM   3376  C  CG  . TYR B 1 101 ? 25.415  19.155  60.196  1.00 13.65 ? 101  TYR B CG  1 
ATOM   3377  C  CD1 . TYR B 1 101 ? 24.257  18.383  60.122  1.00 13.48 ? 101  TYR B CD1 1 
ATOM   3378  C  CD2 . TYR B 1 101 ? 25.325  20.509  59.875  1.00 12.60 ? 101  TYR B CD2 1 
ATOM   3379  C  CE1 . TYR B 1 101 ? 23.043  18.943  59.737  1.00 12.09 ? 101  TYR B CE1 1 
ATOM   3380  C  CE2 . TYR B 1 101 ? 24.115  21.078  59.488  1.00 12.72 ? 101  TYR B CE2 1 
ATOM   3381  C  CZ  . TYR B 1 101 ? 22.978  20.288  59.421  1.00 12.34 ? 101  TYR B CZ  1 
ATOM   3382  O  OH  . TYR B 1 101 ? 21.779  20.840  59.035  1.00 12.97 ? 101  TYR B OH  1 
ATOM   3383  N  N   . TYR B 1 102 ? 27.273  19.953  63.343  1.00 21.32 ? 102  TYR B N   1 
ATOM   3384  C  CA  . TYR B 1 102 ? 26.978  20.992  64.320  1.00 21.78 ? 102  TYR B CA  1 
ATOM   3385  C  C   . TYR B 1 102 ? 27.584  22.335  63.927  1.00 21.93 ? 102  TYR B C   1 
ATOM   3386  O  O   . TYR B 1 102 ? 28.190  22.471  62.863  1.00 22.49 ? 102  TYR B O   1 
ATOM   3387  C  CB  . TYR B 1 102 ? 27.503  20.576  65.702  1.00 22.52 ? 102  TYR B CB  1 
ATOM   3388  C  CG  . TYR B 1 102 ? 29.013  20.625  65.834  1.00 21.21 ? 102  TYR B CG  1 
ATOM   3389  C  CD1 . TYR B 1 102 ? 29.835  19.866  64.999  1.00 20.67 ? 102  TYR B CD1 1 
ATOM   3390  C  CD2 . TYR B 1 102 ? 29.620  21.450  66.781  1.00 18.51 ? 102  TYR B CD2 1 
ATOM   3391  C  CE1 . TYR B 1 102 ? 31.221  19.929  65.103  1.00 21.09 ? 102  TYR B CE1 1 
ATOM   3392  C  CE2 . TYR B 1 102 ? 31.004  21.519  66.892  1.00 20.27 ? 102  TYR B CE2 1 
ATOM   3393  C  CZ  . TYR B 1 102 ? 31.798  20.757  66.050  1.00 21.66 ? 102  TYR B CZ  1 
ATOM   3394  O  OH  . TYR B 1 102 ? 33.168  20.829  66.150  1.00 23.08 ? 102  TYR B OH  1 
ATOM   3395  N  N   . THR B 1 103 ? 27.417  23.318  64.807  1.00 22.82 ? 103  THR B N   1 
ATOM   3396  C  CA  . THR B 1 103 ? 27.944  24.657  64.597  1.00 23.99 ? 103  THR B CA  1 
ATOM   3397  C  C   . THR B 1 103 ? 29.034  24.918  65.633  1.00 24.13 ? 103  THR B C   1 
ATOM   3398  O  O   . THR B 1 103 ? 28.746  25.181  66.800  1.00 24.57 ? 103  THR B O   1 
ATOM   3399  C  CB  . THR B 1 103 ? 26.840  25.718  64.741  1.00 21.31 ? 103  THR B CB  1 
ATOM   3400  O  OG1 . THR B 1 103 ? 25.758  25.400  63.860  1.00 23.16 ? 103  THR B OG1 1 
ATOM   3401  C  CG2 . THR B 1 103 ? 27.373  27.095  64.389  1.00 23.23 ? 103  THR B CG2 1 
ATOM   3402  N  N   . PRO B 1 104 ? 30.306  24.795  65.224  1.00 25.53 ? 104  PRO B N   1 
ATOM   3403  C  CA  . PRO B 1 104 ? 31.444  25.018  66.120  1.00 26.70 ? 104  PRO B CA  1 
ATOM   3404  C  C   . PRO B 1 104 ? 31.718  26.492  66.413  1.00 28.19 ? 104  PRO B C   1 
ATOM   3405  O  O   . PRO B 1 104 ? 31.510  27.358  65.561  1.00 29.16 ? 104  PRO B O   1 
ATOM   3406  C  CB  . PRO B 1 104 ? 32.601  24.383  65.352  1.00 27.24 ? 104  PRO B CB  1 
ATOM   3407  C  CG  . PRO B 1 104 ? 32.231  24.648  63.926  1.00 25.20 ? 104  PRO B CG  1 
ATOM   3408  C  CD  . PRO B 1 104 ? 30.762  24.315  63.906  1.00 24.54 ? 104  PRO B CD  1 
ATOM   3409  N  N   . VAL B 1 105 ? 32.154  26.768  67.639  1.00 28.53 ? 105  VAL B N   1 
ATOM   3410  C  CA  . VAL B 1 105 ? 32.487  28.125  68.056  1.00 27.52 ? 105  VAL B CA  1 
ATOM   3411  C  C   . VAL B 1 105 ? 34.009  28.227  68.021  1.00 27.17 ? 105  VAL B C   1 
ATOM   3412  O  O   . VAL B 1 105 ? 34.701  27.616  68.837  1.00 29.06 ? 105  VAL B O   1 
ATOM   3413  C  CB  . VAL B 1 105 ? 31.975  28.425  69.483  1.00 27.41 ? 105  VAL B CB  1 
ATOM   3414  C  CG1 . VAL B 1 105 ? 32.353  29.841  69.892  1.00 28.42 ? 105  VAL B CG1 1 
ATOM   3415  C  CG2 . VAL B 1 105 ? 30.466  28.239  69.552  1.00 25.48 ? 105  VAL B CG2 1 
ATOM   3416  N  N   . ILE B 1 106 ? 34.524  28.972  67.050  1.00 26.22 ? 106  ILE B N   1 
ATOM   3417  C  CA  . ILE B 1 106 ? 35.965  29.128  66.886  1.00 24.79 ? 106  ILE B CA  1 
ATOM   3418  C  C   . ILE B 1 106 ? 36.506  30.446  67.429  1.00 24.70 ? 106  ILE B C   1 
ATOM   3419  O  O   . ILE B 1 106 ? 35.957  31.516  67.166  1.00 24.96 ? 106  ILE B O   1 
ATOM   3420  C  CB  . ILE B 1 106 ? 36.370  28.960  65.402  1.00 24.75 ? 106  ILE B CB  1 
ATOM   3421  C  CG1 . ILE B 1 106 ? 36.021  27.546  64.932  1.00 24.95 ? 106  ILE B CG1 1 
ATOM   3422  C  CG2 . ILE B 1 106 ? 37.858  29.227  65.213  1.00 26.37 ? 106  ILE B CG2 1 
ATOM   3423  C  CD1 . ILE B 1 106 ? 36.384  27.272  63.500  1.00 27.74 ? 106  ILE B CD1 1 
ATOM   3424  N  N   . GLN B 1 107 ? 37.586  30.346  68.199  1.00 25.14 ? 107  GLN B N   1 
ATOM   3425  C  CA  . GLN B 1 107 ? 38.240  31.507  68.791  1.00 27.26 ? 107  GLN B CA  1 
ATOM   3426  C  C   . GLN B 1 107 ? 39.148  32.147  67.739  1.00 26.51 ? 107  GLN B C   1 
ATOM   3427  O  O   . GLN B 1 107 ? 39.994  31.475  67.147  1.00 25.42 ? 107  GLN B O   1 
ATOM   3428  C  CB  . GLN B 1 107 ? 39.053  31.076  70.018  1.00 29.11 ? 107  GLN B CB  1 
ATOM   3429  C  CG  . GLN B 1 107 ? 39.585  32.222  70.869  1.00 35.94 ? 107  GLN B CG  1 
ATOM   3430  C  CD  . GLN B 1 107 ? 40.332  31.741  72.104  1.00 37.93 ? 107  GLN B CD  1 
ATOM   3431  O  OE1 . GLN B 1 107 ? 40.086  30.643  72.605  1.00 41.11 ? 107  GLN B OE1 1 
ATOM   3432  N  NE2 . GLN B 1 107 ? 41.247  32.566  72.602  1.00 38.63 ? 107  GLN B NE2 1 
ATOM   3433  N  N   . ALA B 1 108 ? 38.964  33.444  67.506  1.00 27.50 ? 108  ALA B N   1 
ATOM   3434  C  CA  . ALA B 1 108 ? 39.755  34.158  66.511  1.00 27.00 ? 108  ALA B CA  1 
ATOM   3435  C  C   . ALA B 1 108 ? 39.941  35.639  66.825  1.00 27.45 ? 108  ALA B C   1 
ATOM   3436  O  O   . ALA B 1 108 ? 39.354  36.167  67.769  1.00 28.07 ? 108  ALA B O   1 
ATOM   3437  C  CB  . ALA B 1 108 ? 39.119  33.994  65.132  1.00 26.10 ? 108  ALA B CB  1 
ATOM   3438  N  N   . ARG B 1 109 ? 40.779  36.292  66.024  1.00 29.56 ? 109  ARG B N   1 
ATOM   3439  C  CA  . ARG B 1 109 ? 41.071  37.718  66.160  1.00 30.56 ? 109  ARG B CA  1 
ATOM   3440  C  C   . ARG B 1 109 ? 41.028  38.351  64.768  1.00 31.44 ? 109  ARG B C   1 
ATOM   3441  O  O   . ARG B 1 109 ? 41.217  37.663  63.763  1.00 30.42 ? 109  ARG B O   1 
ATOM   3442  C  CB  . ARG B 1 109 ? 42.464  37.930  66.763  1.00 30.17 ? 109  ARG B CB  1 
ATOM   3443  C  CG  . ARG B 1 109 ? 42.692  37.301  68.132  1.00 29.63 ? 109  ARG B CG  1 
ATOM   3444  C  CD  . ARG B 1 109 ? 41.881  37.974  69.227  1.00 29.50 ? 109  ARG B CD  1 
ATOM   3445  N  NE  . ARG B 1 109 ? 42.221  37.456  70.554  1.00 28.24 ? 109  ARG B NE  1 
ATOM   3446  C  CZ  . ARG B 1 109 ? 41.625  36.420  71.138  1.00 25.98 ? 109  ARG B CZ  1 
ATOM   3447  N  NH1 . ARG B 1 109 ? 40.647  35.769  70.523  1.00 27.83 ? 109  ARG B NH1 1 
ATOM   3448  N  NH2 . ARG B 1 109 ? 42.013  36.028  72.343  1.00 25.29 ? 109  ARG B NH2 1 
ATOM   3449  N  N   . HIS B 1 110 ? 40.783  39.657  64.711  1.00 33.98 ? 110  HIS B N   1 
ATOM   3450  C  CA  . HIS B 1 110 ? 40.725  40.376  63.439  1.00 35.49 ? 110  HIS B CA  1 
ATOM   3451  C  C   . HIS B 1 110 ? 42.102  40.477  62.789  1.00 37.84 ? 110  HIS B C   1 
ATOM   3452  O  O   . HIS B 1 110 ? 42.218  40.521  61.563  1.00 39.63 ? 110  HIS B O   1 
ATOM   3453  C  CB  . HIS B 1 110 ? 40.139  41.775  63.638  1.00 34.41 ? 110  HIS B CB  1 
ATOM   3454  C  CG  . HIS B 1 110 ? 38.698  41.774  64.044  1.00 34.12 ? 110  HIS B CG  1 
ATOM   3455  N  ND1 . HIS B 1 110 ? 38.286  42.057  65.329  1.00 34.63 ? 110  HIS B ND1 1 
ATOM   3456  C  CD2 . HIS B 1 110 ? 37.572  41.526  63.334  1.00 34.04 ? 110  HIS B CD2 1 
ATOM   3457  C  CE1 . HIS B 1 110 ? 36.969  41.983  65.393  1.00 34.49 ? 110  HIS B CE1 1 
ATOM   3458  N  NE2 . HIS B 1 110 ? 36.511  41.662  64.196  1.00 33.53 ? 110  HIS B NE2 1 
ATOM   3459  N  N   . THR B 1 111 ? 43.140  40.522  63.621  1.00 39.80 ? 111  THR B N   1 
ATOM   3460  C  CA  . THR B 1 111 ? 44.522  40.608  63.151  1.00 42.41 ? 111  THR B CA  1 
ATOM   3461  C  C   . THR B 1 111 ? 45.339  39.451  63.724  1.00 42.25 ? 111  THR B C   1 
ATOM   3462  O  O   . THR B 1 111 ? 45.111  39.031  64.858  1.00 41.20 ? 111  THR B O   1 
ATOM   3463  C  CB  . THR B 1 111 ? 45.181  41.946  63.563  1.00 43.15 ? 111  THR B CB  1 
ATOM   3464  O  OG1 . THR B 1 111 ? 45.088  42.112  64.984  1.00 45.32 ? 111  THR B OG1 1 
ATOM   3465  C  CG2 . THR B 1 111 ? 44.502  43.121  62.867  1.00 43.03 ? 111  THR B CG2 1 
ATOM   3466  N  N   . ARG B 1 112 ? 46.280  38.933  62.936  1.00 44.24 ? 112  ARG B N   1 
ATOM   3467  C  CA  . ARG B 1 112 ? 47.118  37.821  63.380  1.00 46.35 ? 112  ARG B CA  1 
ATOM   3468  C  C   . ARG B 1 112 ? 48.048  38.207  64.526  1.00 46.86 ? 112  ARG B C   1 
ATOM   3469  O  O   . ARG B 1 112 ? 48.764  39.208  64.455  1.00 46.40 ? 112  ARG B O   1 
ATOM   3470  C  CB  . ARG B 1 112 ? 47.922  37.227  62.217  1.00 46.65 ? 112  ARG B CB  1 
ATOM   3471  C  CG  . ARG B 1 112 ? 48.732  38.226  61.408  1.00 49.73 ? 112  ARG B CG  1 
ATOM   3472  C  CD  . ARG B 1 112 ? 49.680  37.512  60.455  1.00 50.45 ? 112  ARG B CD  1 
ATOM   3473  N  NE  . ARG B 1 112 ? 48.986  36.559  59.593  1.00 53.66 ? 112  ARG B NE  1 
ATOM   3474  C  CZ  . ARG B 1 112 ? 49.564  35.512  59.009  1.00 55.37 ? 112  ARG B CZ  1 
ATOM   3475  N  NH1 . ARG B 1 112 ? 50.857  35.273  59.192  1.00 56.23 ? 112  ARG B NH1 1 
ATOM   3476  N  NH2 . ARG B 1 112 ? 48.848  34.698  58.244  1.00 54.58 ? 112  ARG B NH2 1 
ATOM   3477  N  N   . GLN B 1 113 ? 48.021  37.401  65.584  1.00 46.82 ? 113  GLN B N   1 
ATOM   3478  C  CA  . GLN B 1 113 ? 48.838  37.640  66.767  1.00 47.44 ? 113  GLN B CA  1 
ATOM   3479  C  C   . GLN B 1 113 ? 48.929  36.389  67.634  1.00 47.47 ? 113  GLN B C   1 
ATOM   3480  O  O   . GLN B 1 113 ? 47.918  35.747  67.923  1.00 47.61 ? 113  GLN B O   1 
ATOM   3481  C  CB  . GLN B 1 113 ? 48.256  38.803  67.582  1.00 49.06 ? 113  GLN B CB  1 
ATOM   3482  C  CG  . GLN B 1 113 ? 46.785  38.638  67.959  1.00 50.62 ? 113  GLN B CG  1 
ATOM   3483  C  CD  . GLN B 1 113 ? 46.203  39.878  68.610  1.00 51.57 ? 113  GLN B CD  1 
ATOM   3484  O  OE1 . GLN B 1 113 ? 46.268  40.043  69.828  1.00 53.68 ? 113  GLN B OE1 1 
ATOM   3485  N  NE2 . GLN B 1 113 ? 45.627  40.757  67.798  1.00 51.85 ? 113  GLN B NE2 1 
ATOM   3486  N  N   . GLY B 1 114 ? 50.151  36.044  68.030  1.00 47.52 ? 114  GLY B N   1 
ATOM   3487  C  CA  . GLY B 1 114 ? 50.371  34.876  68.867  1.00 47.91 ? 114  GLY B CA  1 
ATOM   3488  C  C   . GLY B 1 114 ? 49.996  33.555  68.221  1.00 48.13 ? 114  GLY B C   1 
ATOM   3489  O  O   . GLY B 1 114 ? 50.571  33.163  67.202  1.00 48.73 ? 114  GLY B O   1 
ATOM   3490  N  N   . GLU B 1 115 ? 49.028  32.869  68.822  1.00 47.59 ? 115  GLU B N   1 
ATOM   3491  C  CA  . GLU B 1 115 ? 48.558  31.578  68.326  1.00 46.54 ? 115  GLU B CA  1 
ATOM   3492  C  C   . GLU B 1 115 ? 47.595  31.718  67.148  1.00 43.95 ? 115  GLU B C   1 
ATOM   3493  O  O   . GLU B 1 115 ? 47.361  30.758  66.411  1.00 43.09 ? 115  GLU B O   1 
ATOM   3494  C  CB  . GLU B 1 115 ? 47.883  30.795  69.456  1.00 48.33 ? 115  GLU B CB  1 
ATOM   3495  C  CG  . GLU B 1 115 ? 48.780  30.525  70.657  1.00 51.99 ? 115  GLU B CG  1 
ATOM   3496  C  CD  . GLU B 1 115 ? 50.031  29.742  70.296  1.00 54.03 ? 115  GLU B CD  1 
ATOM   3497  O  OE1 . GLU B 1 115 ? 49.909  28.553  69.930  1.00 55.95 ? 115  GLU B OE1 1 
ATOM   3498  O  OE2 . GLU B 1 115 ? 51.137  30.316  70.381  1.00 55.96 ? 115  GLU B OE2 1 
ATOM   3499  N  N   . PHE B 1 116 ? 47.045  32.917  66.977  1.00 42.07 ? 116  PHE B N   1 
ATOM   3500  C  CA  . PHE B 1 116 ? 46.100  33.200  65.902  1.00 40.27 ? 116  PHE B CA  1 
ATOM   3501  C  C   . PHE B 1 116 ? 46.825  33.530  64.601  1.00 40.31 ? 116  PHE B C   1 
ATOM   3502  O  O   . PHE B 1 116 ? 47.137  34.690  64.330  1.00 40.77 ? 116  PHE B O   1 
ATOM   3503  C  CB  . PHE B 1 116 ? 45.180  34.354  66.311  1.00 37.50 ? 116  PHE B CB  1 
ATOM   3504  C  CG  . PHE B 1 116 ? 44.503  34.142  67.635  1.00 35.48 ? 116  PHE B CG  1 
ATOM   3505  C  CD1 . PHE B 1 116 ? 43.397  33.305  67.740  1.00 34.82 ? 116  PHE B CD1 1 
ATOM   3506  C  CD2 . PHE B 1 116 ? 44.992  34.751  68.785  1.00 34.95 ? 116  PHE B CD2 1 
ATOM   3507  C  CE1 . PHE B 1 116 ? 42.789  33.076  68.970  1.00 32.66 ? 116  PHE B CE1 1 
ATOM   3508  C  CE2 . PHE B 1 116 ? 44.391  34.528  70.020  1.00 35.16 ? 116  PHE B CE2 1 
ATOM   3509  C  CZ  . PHE B 1 116 ? 43.287  33.687  70.112  1.00 33.94 ? 116  PHE B CZ  1 
ATOM   3510  N  N   . GLN B 1 117 ? 47.082  32.502  63.795  1.00 40.11 ? 117  GLN B N   1 
ATOM   3511  C  CA  . GLN B 1 117 ? 47.787  32.671  62.524  1.00 39.38 ? 117  GLN B CA  1 
ATOM   3512  C  C   . GLN B 1 117 ? 47.102  31.940  61.365  1.00 37.17 ? 117  GLN B C   1 
ATOM   3513  O  O   . GLN B 1 117 ? 47.681  31.812  60.283  1.00 37.07 ? 117  GLN B O   1 
ATOM   3514  C  CB  . GLN B 1 117 ? 49.228  32.154  62.651  1.00 39.78 ? 117  GLN B CB  1 
ATOM   3515  C  CG  . GLN B 1 117 ? 50.052  32.777  63.773  1.00 40.91 ? 117  GLN B CG  1 
ATOM   3516  C  CD  . GLN B 1 117 ? 50.306  34.257  63.569  1.00 43.04 ? 117  GLN B CD  1 
ATOM   3517  O  OE1 . GLN B 1 117 ? 50.665  34.693  62.473  1.00 44.55 ? 117  GLN B OE1 1 
ATOM   3518  N  NE2 . GLN B 1 117 ? 50.125  35.040  64.628  1.00 44.66 ? 117  GLN B NE2 1 
ATOM   3519  N  N   . TYR B 1 118 ? 45.871  31.482  61.582  1.00 34.97 ? 118  TYR B N   1 
ATOM   3520  C  CA  . TYR B 1 118 ? 45.136  30.740  60.556  1.00 32.33 ? 118  TYR B CA  1 
ATOM   3521  C  C   . TYR B 1 118 ? 43.916  31.496  60.032  1.00 30.61 ? 118  TYR B C   1 
ATOM   3522  O  O   . TYR B 1 118 ? 42.866  31.533  60.674  1.00 30.87 ? 118  TYR B O   1 
ATOM   3523  C  CB  . TYR B 1 118 ? 44.749  29.362  61.102  1.00 31.13 ? 118  TYR B CB  1 
ATOM   3524  C  CG  . TYR B 1 118 ? 45.916  28.671  61.773  1.00 30.96 ? 118  TYR B CG  1 
ATOM   3525  C  CD1 . TYR B 1 118 ? 46.961  28.139  61.020  1.00 31.32 ? 118  TYR B CD1 1 
ATOM   3526  C  CD2 . TYR B 1 118 ? 46.008  28.610  63.163  1.00 32.56 ? 118  TYR B CD2 1 
ATOM   3527  C  CE1 . TYR B 1 118 ? 48.072  27.571  61.635  1.00 33.43 ? 118  TYR B CE1 1 
ATOM   3528  C  CE2 . TYR B 1 118 ? 47.115  28.044  63.787  1.00 33.00 ? 118  TYR B CE2 1 
ATOM   3529  C  CZ  . TYR B 1 118 ? 48.143  27.528  63.018  1.00 33.87 ? 118  TYR B CZ  1 
ATOM   3530  O  OH  . TYR B 1 118 ? 49.245  26.981  63.631  1.00 36.49 ? 118  TYR B OH  1 
ATOM   3531  N  N   . PRO B 1 119 ? 44.042  32.089  58.833  1.00 29.65 ? 119  PRO B N   1 
ATOM   3532  C  CA  . PRO B 1 119 ? 43.018  32.873  58.132  1.00 28.65 ? 119  PRO B CA  1 
ATOM   3533  C  C   . PRO B 1 119 ? 41.741  32.142  57.725  1.00 27.99 ? 119  PRO B C   1 
ATOM   3534  O  O   . PRO B 1 119 ? 41.768  30.987  57.296  1.00 27.87 ? 119  PRO B O   1 
ATOM   3535  C  CB  . PRO B 1 119 ? 43.761  33.374  56.891  1.00 28.98 ? 119  PRO B CB  1 
ATOM   3536  C  CG  . PRO B 1 119 ? 45.193  33.372  57.308  1.00 30.09 ? 119  PRO B CG  1 
ATOM   3537  C  CD  . PRO B 1 119 ? 45.293  32.082  58.058  1.00 28.22 ? 119  PRO B CD  1 
ATOM   3538  N  N   . ILE B 1 120 ? 40.627  32.855  57.854  1.00 27.49 ? 120  ILE B N   1 
ATOM   3539  C  CA  . ILE B 1 120 ? 39.304  32.365  57.483  1.00 26.99 ? 120  ILE B CA  1 
ATOM   3540  C  C   . ILE B 1 120 ? 38.882  33.319  56.369  1.00 27.83 ? 120  ILE B C   1 
ATOM   3541  O  O   . ILE B 1 120 ? 38.737  34.519  56.598  1.00 27.64 ? 120  ILE B O   1 
ATOM   3542  C  CB  . ILE B 1 120 ? 38.315  32.458  58.665  1.00 26.08 ? 120  ILE B CB  1 
ATOM   3543  C  CG1 . ILE B 1 120 ? 38.829  31.624  59.842  1.00 23.84 ? 120  ILE B CG1 1 
ATOM   3544  C  CG2 . ILE B 1 120 ? 36.936  31.974  58.238  1.00 24.55 ? 120  ILE B CG2 1 
ATOM   3545  C  CD1 . ILE B 1 120 ? 37.998  31.748  61.095  1.00 27.24 ? 120  ILE B CD1 1 
ATOM   3546  N  N   . TYR B 1 121 ? 38.712  32.788  55.163  1.00 28.51 ? 121  TYR B N   1 
ATOM   3547  C  CA  . TYR B 1 121 ? 38.369  33.606  54.003  1.00 28.37 ? 121  TYR B CA  1 
ATOM   3548  C  C   . TYR B 1 121 ? 36.893  33.753  53.645  1.00 29.69 ? 121  TYR B C   1 
ATOM   3549  O  O   . TYR B 1 121 ? 36.063  32.907  53.984  1.00 29.06 ? 121  TYR B O   1 
ATOM   3550  C  CB  . TYR B 1 121 ? 39.134  33.103  52.775  1.00 28.01 ? 121  TYR B CB  1 
ATOM   3551  C  CG  . TYR B 1 121 ? 40.638  33.087  52.942  1.00 28.11 ? 121  TYR B CG  1 
ATOM   3552  C  CD1 . TYR B 1 121 ? 41.275  32.039  53.608  1.00 28.82 ? 121  TYR B CD1 1 
ATOM   3553  C  CD2 . TYR B 1 121 ? 41.427  34.119  52.435  1.00 28.25 ? 121  TYR B CD2 1 
ATOM   3554  C  CE1 . TYR B 1 121 ? 42.657  32.018  53.764  1.00 27.75 ? 121  TYR B CE1 1 
ATOM   3555  C  CE2 . TYR B 1 121 ? 42.811  34.106  52.587  1.00 29.03 ? 121  TYR B CE2 1 
ATOM   3556  C  CZ  . TYR B 1 121 ? 43.419  33.054  53.252  1.00 27.90 ? 121  TYR B CZ  1 
ATOM   3557  O  OH  . TYR B 1 121 ? 44.785  33.041  53.411  1.00 28.88 ? 121  TYR B OH  1 
ATOM   3558  N  N   . ARG B 1 122 ? 36.593  34.852  52.952  1.00 29.97 ? 122  ARG B N   1 
ATOM   3559  C  CA  . ARG B 1 122 ? 35.246  35.161  52.477  1.00 31.04 ? 122  ARG B CA  1 
ATOM   3560  C  C   . ARG B 1 122 ? 35.206  34.914  50.969  1.00 32.40 ? 122  ARG B C   1 
ATOM   3561  O  O   . ARG B 1 122 ? 36.212  34.524  50.378  1.00 32.39 ? 122  ARG B O   1 
ATOM   3562  C  CB  . ARG B 1 122 ? 34.882  36.622  52.775  1.00 30.14 ? 122  ARG B CB  1 
ATOM   3563  C  CG  . ARG B 1 122 ? 35.799  37.657  52.135  1.00 27.60 ? 122  ARG B CG  1 
ATOM   3564  C  CD  . ARG B 1 122 ? 35.349  39.072  52.462  1.00 28.07 ? 122  ARG B CD  1 
ATOM   3565  N  NE  . ARG B 1 122 ? 36.313  40.079  52.018  1.00 27.78 ? 122  ARG B NE  1 
ATOM   3566  C  CZ  . ARG B 1 122 ? 36.315  40.646  50.815  1.00 27.27 ? 122  ARG B CZ  1 
ATOM   3567  N  NH1 . ARG B 1 122 ? 35.401  40.313  49.914  1.00 29.45 ? 122  ARG B NH1 1 
ATOM   3568  N  NH2 . ARG B 1 122 ? 37.237  41.548  50.511  1.00 26.35 ? 122  ARG B NH2 1 
HETATM 3569  N  N   . MSE B 1 123 ? 34.052  35.158  50.354  1.00 35.70 ? 123  MSE B N   1 
HETATM 3570  C  CA  . MSE B 1 123 ? 33.872  34.961  48.916  1.00 38.39 ? 123  MSE B CA  1 
HETATM 3571  C  C   . MSE B 1 123 ? 34.706  35.893  48.039  1.00 37.60 ? 123  MSE B C   1 
HETATM 3572  O  O   . MSE B 1 123 ? 34.474  37.102  48.005  1.00 37.51 ? 123  MSE B O   1 
HETATM 3573  C  CB  . MSE B 1 123 ? 32.394  35.106  48.540  1.00 43.03 ? 123  MSE B CB  1 
HETATM 3574  C  CG  . MSE B 1 123 ? 31.594  33.815  48.589  1.00 47.45 ? 123  MSE B CG  1 
HETATM 3575  SE SE  . MSE B 1 123 ? 31.903  32.674  47.061  1.00 52.85 ? 123  MSE B SE  1 
HETATM 3576  C  CE  . MSE B 1 123 ? 30.431  33.249  45.958  1.00 49.64 ? 123  MSE B CE  1 
ATOM   3577  N  N   . PRO B 1 124 ? 35.707  35.336  47.335  1.00 37.51 ? 124  PRO B N   1 
ATOM   3578  C  CA  . PRO B 1 124 ? 36.595  36.086  46.442  1.00 38.76 ? 124  PRO B CA  1 
ATOM   3579  C  C   . PRO B 1 124 ? 35.975  36.138  45.038  1.00 40.22 ? 124  PRO B C   1 
ATOM   3580  O  O   . PRO B 1 124 ? 34.904  35.571  44.809  1.00 40.47 ? 124  PRO B O   1 
ATOM   3581  C  CB  . PRO B 1 124 ? 37.865  35.241  46.470  1.00 37.09 ? 124  PRO B CB  1 
ATOM   3582  C  CG  . PRO B 1 124 ? 37.321  33.864  46.488  1.00 36.87 ? 124  PRO B CG  1 
ATOM   3583  C  CD  . PRO B 1 124 ? 36.176  33.944  47.481  1.00 36.75 ? 124  PRO B CD  1 
ATOM   3584  N  N   . PRO B 1 125 ? 36.630  36.827  44.084  1.00 41.62 ? 125  PRO B N   1 
ATOM   3585  C  CA  . PRO B 1 125 ? 36.086  36.910  42.724  1.00 42.64 ? 125  PRO B CA  1 
ATOM   3586  C  C   . PRO B 1 125 ? 36.041  35.554  42.014  1.00 44.41 ? 125  PRO B C   1 
ATOM   3587  O  O   . PRO B 1 125 ? 36.464  34.537  42.566  1.00 44.63 ? 125  PRO B O   1 
ATOM   3588  C  CB  . PRO B 1 125 ? 37.042  37.886  42.036  1.00 43.29 ? 125  PRO B CB  1 
ATOM   3589  C  CG  . PRO B 1 125 ? 38.335  37.658  42.755  1.00 43.54 ? 125  PRO B CG  1 
ATOM   3590  C  CD  . PRO B 1 125 ? 37.879  37.601  44.188  1.00 43.24 ? 125  PRO B CD  1 
ATOM   3591  N  N   . LYS B 1 126 ? 35.536  35.559  40.783  1.00 45.96 ? 126  LYS B N   1 
ATOM   3592  C  CA  . LYS B 1 126 ? 35.403  34.348  39.974  1.00 46.37 ? 126  LYS B CA  1 
ATOM   3593  C  C   . LYS B 1 126 ? 36.687  33.540  39.810  1.00 46.59 ? 126  LYS B C   1 
ATOM   3594  O  O   . LYS B 1 126 ? 36.699  32.332  40.057  1.00 45.81 ? 126  LYS B O   1 
ATOM   3595  C  CB  . LYS B 1 126 ? 34.827  34.690  38.594  1.00 47.52 ? 126  LYS B CB  1 
ATOM   3596  C  CG  . LYS B 1 126 ? 33.326  34.981  38.584  1.00 49.57 ? 126  LYS B CG  1 
ATOM   3597  C  CD  . LYS B 1 126 ? 32.965  36.197  39.430  1.00 48.94 ? 126  LYS B CD  1 
ATOM   3598  C  CE  . LYS B 1 126 ? 31.461  36.331  39.594  1.00 48.16 ? 126  LYS B CE  1 
ATOM   3599  N  NZ  . LYS B 1 126 ? 31.113  37.409  40.557  1.00 48.38 ? 126  LYS B NZ  1 
ATOM   3600  N  N   . ARG B 1 127 ? 37.764  34.208  39.406  1.00 47.33 ? 127  ARG B N   1 
ATOM   3601  C  CA  . ARG B 1 127 ? 39.043  33.537  39.198  1.00 47.07 ? 127  ARG B CA  1 
ATOM   3602  C  C   . ARG B 1 127 ? 39.819  33.244  40.483  1.00 44.00 ? 127  ARG B C   1 
ATOM   3603  O  O   . ARG B 1 127 ? 40.801  32.498  40.468  1.00 43.46 ? 127  ARG B O   1 
ATOM   3604  C  CB  . ARG B 1 127 ? 39.904  34.317  38.198  1.00 50.99 ? 127  ARG B CB  1 
ATOM   3605  C  CG  . ARG B 1 127 ? 40.386  35.689  38.654  1.00 55.41 ? 127  ARG B CG  1 
ATOM   3606  C  CD  . ARG B 1 127 ? 41.090  36.397  37.499  1.00 58.23 ? 127  ARG B CD  1 
ATOM   3607  N  NE  . ARG B 1 127 ? 41.823  37.589  37.918  1.00 60.16 ? 127  ARG B NE  1 
ATOM   3608  C  CZ  . ARG B 1 127 ? 43.107  37.595  38.264  1.00 61.45 ? 127  ARG B CZ  1 
ATOM   3609  N  NH1 . ARG B 1 127 ? 43.809  36.470  38.249  1.00 63.51 ? 127  ARG B NH1 1 
ATOM   3610  N  NH2 . ARG B 1 127 ? 43.696  38.733  38.607  1.00 61.97 ? 127  ARG B NH2 1 
ATOM   3611  N  N   . GLY B 1 128 ? 39.369  33.825  41.591  1.00 40.55 ? 128  GLY B N   1 
ATOM   3612  C  CA  . GLY B 1 128 ? 40.020  33.596  42.869  1.00 36.98 ? 128  GLY B CA  1 
ATOM   3613  C  C   . GLY B 1 128 ? 39.518  32.319  43.516  1.00 36.10 ? 128  GLY B C   1 
ATOM   3614  O  O   . GLY B 1 128 ? 40.158  31.771  44.414  1.00 35.49 ? 128  GLY B O   1 
ATOM   3615  N  N   . ARG B 1 129 ? 38.367  31.843  43.047  1.00 35.57 ? 129  ARG B N   1 
ATOM   3616  C  CA  . ARG B 1 129 ? 37.741  30.626  43.558  1.00 34.87 ? 129  ARG B CA  1 
ATOM   3617  C  C   . ARG B 1 129 ? 38.268  29.342  42.920  1.00 35.17 ? 129  ARG B C   1 
ATOM   3618  O  O   . ARG B 1 129 ? 37.801  28.247  43.235  1.00 34.20 ? 129  ARG B O   1 
ATOM   3619  C  CB  . ARG B 1 129 ? 36.224  30.706  43.376  1.00 33.65 ? 129  ARG B CB  1 
ATOM   3620  C  CG  . ARG B 1 129 ? 35.533  31.596  44.386  1.00 34.41 ? 129  ARG B CG  1 
ATOM   3621  C  CD  . ARG B 1 129 ? 34.059  31.743  44.078  1.00 36.08 ? 129  ARG B CD  1 
ATOM   3622  N  NE  . ARG B 1 129 ? 33.787  32.921  43.260  1.00 39.72 ? 129  ARG B NE  1 
ATOM   3623  C  CZ  . ARG B 1 129 ? 32.648  33.134  42.610  1.00 40.94 ? 129  ARG B CZ  1 
ATOM   3624  N  NH1 . ARG B 1 129 ? 31.666  32.245  42.670  1.00 42.86 ? 129  ARG B NH1 1 
ATOM   3625  N  NH2 . ARG B 1 129 ? 32.476  34.255  41.925  1.00 42.50 ? 129  ARG B NH2 1 
ATOM   3626  N  N   . LEU B 1 130 ? 39.240  29.480  42.024  1.00 35.26 ? 130  LEU B N   1 
ATOM   3627  C  CA  . LEU B 1 130 ? 39.830  28.334  41.341  1.00 35.07 ? 130  LEU B CA  1 
ATOM   3628  C  C   . LEU B 1 130 ? 40.896  27.643  42.187  1.00 35.25 ? 130  LEU B C   1 
ATOM   3629  O  O   . LEU B 1 130 ? 41.096  26.433  42.077  1.00 36.11 ? 130  LEU B O   1 
ATOM   3630  C  CB  . LEU B 1 130 ? 40.440  28.776  40.009  1.00 34.54 ? 130  LEU B CB  1 
ATOM   3631  C  CG  . LEU B 1 130 ? 39.467  29.329  38.966  1.00 32.68 ? 130  LEU B CG  1 
ATOM   3632  C  CD1 . LEU B 1 130 ? 40.239  29.988  37.842  1.00 31.64 ? 130  LEU B CD1 1 
ATOM   3633  C  CD2 . LEU B 1 130 ? 38.577  28.215  38.439  1.00 33.00 ? 130  LEU B CD2 1 
ATOM   3634  N  N   . SER B 1 131 ? 41.559  28.420  43.041  1.00 35.92 ? 131  SER B N   1 
ATOM   3635  C  CA  . SER B 1 131 ? 42.624  27.923  43.910  1.00 35.69 ? 131  SER B CA  1 
ATOM   3636  C  C   . SER B 1 131 ? 42.202  26.822  44.881  1.00 36.33 ? 131  SER B C   1 
ATOM   3637  O  O   . SER B 1 131 ? 41.128  26.884  45.482  1.00 37.41 ? 131  SER B O   1 
ATOM   3638  C  CB  . SER B 1 131 ? 43.244  29.084  44.692  1.00 34.29 ? 131  SER B CB  1 
ATOM   3639  O  OG  . SER B 1 131 ? 43.796  30.052  43.817  1.00 36.91 ? 131  SER B OG  1 
ATOM   3640  N  N   . SER B 1 132 ? 43.063  25.817  45.023  1.00 36.66 ? 132  SER B N   1 
ATOM   3641  C  CA  . SER B 1 132 ? 42.814  24.694  45.922  1.00 37.34 ? 132  SER B CA  1 
ATOM   3642  C  C   . SER B 1 132 ? 43.238  25.041  47.349  1.00 36.89 ? 132  SER B C   1 
ATOM   3643  O  O   . SER B 1 132 ? 43.910  26.047  47.577  1.00 37.41 ? 132  SER B O   1 
ATOM   3644  C  CB  . SER B 1 132 ? 43.564  23.446  45.441  1.00 37.01 ? 132  SER B CB  1 
ATOM   3645  O  OG  . SER B 1 132 ? 44.964  23.659  45.420  1.00 37.61 ? 132  SER B OG  1 
ATOM   3646  N  N   . ARG B 1 133 ? 42.855  24.192  48.299  1.00 35.91 ? 133  ARG B N   1 
ATOM   3647  C  CA  . ARG B 1 133 ? 43.180  24.398  49.708  1.00 35.31 ? 133  ARG B CA  1 
ATOM   3648  C  C   . ARG B 1 133 ? 44.680  24.560  49.963  1.00 35.23 ? 133  ARG B C   1 
ATOM   3649  O  O   . ARG B 1 133 ? 45.096  25.480  50.665  1.00 35.94 ? 133  ARG B O   1 
ATOM   3650  C  CB  . ARG B 1 133 ? 42.629  23.243  50.548  1.00 33.48 ? 133  ARG B CB  1 
ATOM   3651  C  CG  . ARG B 1 133 ? 42.945  23.345  52.028  1.00 33.94 ? 133  ARG B CG  1 
ATOM   3652  C  CD  . ARG B 1 133 ? 42.366  22.176  52.805  1.00 32.79 ? 133  ARG B CD  1 
ATOM   3653  N  NE  . ARG B 1 133 ? 40.906  22.186  52.809  1.00 31.56 ? 133  ARG B NE  1 
ATOM   3654  C  CZ  . ARG B 1 133 ? 40.164  22.889  53.658  1.00 29.09 ? 133  ARG B CZ  1 
ATOM   3655  N  NH1 . ARG B 1 133 ? 40.737  23.645  54.584  1.00 29.47 ? 133  ARG B NH1 1 
ATOM   3656  N  NH2 . ARG B 1 133 ? 38.844  22.836  53.580  1.00 31.54 ? 133  ARG B NH2 1 
ATOM   3657  N  N   . ALA B 1 134 ? 45.479  23.671  49.377  1.00 35.81 ? 134  ALA B N   1 
ATOM   3658  C  CA  . ALA B 1 134 ? 46.934  23.696  49.534  1.00 35.17 ? 134  ALA B CA  1 
ATOM   3659  C  C   . ALA B 1 134 ? 47.548  25.014  49.080  1.00 33.84 ? 134  ALA B C   1 
ATOM   3660  O  O   . ALA B 1 134 ? 48.476  25.527  49.707  1.00 34.47 ? 134  ALA B O   1 
ATOM   3661  C  CB  . ALA B 1 134 ? 47.562  22.539  48.769  1.00 35.73 ? 134  ALA B CB  1 
ATOM   3662  N  N   . GLU B 1 135 ? 47.024  25.549  47.983  1.00 33.21 ? 135  GLU B N   1 
ATOM   3663  C  CA  . GLU B 1 135 ? 47.504  26.806  47.423  1.00 31.72 ? 135  GLU B CA  1 
ATOM   3664  C  C   . GLU B 1 135 ? 47.072  27.992  48.274  1.00 31.93 ? 135  GLU B C   1 
ATOM   3665  O  O   . GLU B 1 135 ? 47.815  28.963  48.417  1.00 32.12 ? 135  GLU B O   1 
ATOM   3666  C  CB  . GLU B 1 135 ? 46.983  26.967  46.000  1.00 31.61 ? 135  GLU B CB  1 
ATOM   3667  C  CG  . GLU B 1 135 ? 47.411  25.845  45.068  1.00 31.61 ? 135  GLU B CG  1 
ATOM   3668  C  CD  . GLU B 1 135 ? 46.704  25.890  43.731  1.00 32.29 ? 135  GLU B CD  1 
ATOM   3669  O  OE1 . GLU B 1 135 ? 46.124  26.944  43.393  1.00 34.69 ? 135  GLU B OE1 1 
ATOM   3670  O  OE2 . GLU B 1 135 ? 46.726  24.866  43.018  1.00 33.46 ? 135  GLU B OE2 1 
ATOM   3671  N  N   . ILE B 1 136 ? 45.864  27.909  48.829  1.00 31.98 ? 136  ILE B N   1 
ATOM   3672  C  CA  . ILE B 1 136 ? 45.326  28.967  49.681  1.00 30.21 ? 136  ILE B CA  1 
ATOM   3673  C  C   . ILE B 1 136 ? 46.120  29.021  50.985  1.00 29.60 ? 136  ILE B C   1 
ATOM   3674  O  O   . ILE B 1 136 ? 46.326  30.095  51.553  1.00 30.63 ? 136  ILE B O   1 
ATOM   3675  C  CB  . ILE B 1 136 ? 43.819  28.748  49.960  1.00 28.61 ? 136  ILE B CB  1 
ATOM   3676  C  CG1 . ILE B 1 136 ? 43.035  28.847  48.648  1.00 28.02 ? 136  ILE B CG1 1 
ATOM   3677  C  CG2 . ILE B 1 136 ? 43.302  29.781  50.949  1.00 27.84 ? 136  ILE B CG2 1 
ATOM   3678  C  CD1 . ILE B 1 136 ? 41.561  28.526  48.772  1.00 30.09 ? 136  ILE B CD1 1 
ATOM   3679  N  N   . TYR B 1 137 ? 46.584  27.857  51.437  1.00 28.96 ? 137  TYR B N   1 
ATOM   3680  C  CA  . TYR B 1 137 ? 47.387  27.759  52.652  1.00 29.81 ? 137  TYR B CA  1 
ATOM   3681  C  C   . TYR B 1 137 ? 48.729  28.447  52.419  1.00 30.97 ? 137  TYR B C   1 
ATOM   3682  O  O   . TYR B 1 137 ? 49.297  29.054  53.330  1.00 31.05 ? 137  TYR B O   1 
ATOM   3683  C  CB  . TYR B 1 137 ? 47.631  26.292  53.017  1.00 29.10 ? 137  TYR B CB  1 
ATOM   3684  C  CG  . TYR B 1 137 ? 46.483  25.597  53.716  1.00 29.52 ? 137  TYR B CG  1 
ATOM   3685  C  CD1 . TYR B 1 137 ? 45.324  26.287  54.071  1.00 30.08 ? 137  TYR B CD1 1 
ATOM   3686  C  CD2 . TYR B 1 137 ? 46.569  24.246  54.048  1.00 29.21 ? 137  TYR B CD2 1 
ATOM   3687  C  CE1 . TYR B 1 137 ? 44.280  25.647  54.740  1.00 31.08 ? 137  TYR B CE1 1 
ATOM   3688  C  CE2 . TYR B 1 137 ? 45.536  23.598  54.717  1.00 30.73 ? 137  TYR B CE2 1 
ATOM   3689  C  CZ  . TYR B 1 137 ? 44.395  24.303  55.061  1.00 32.19 ? 137  TYR B CZ  1 
ATOM   3690  O  OH  . TYR B 1 137 ? 43.374  23.663  55.728  1.00 33.62 ? 137  TYR B OH  1 
ATOM   3691  N  N   . ALA B 1 138 ? 49.227  28.337  51.189  1.00 31.83 ? 138  ALA B N   1 
ATOM   3692  C  CA  . ALA B 1 138 ? 50.495  28.940  50.797  1.00 32.39 ? 138  ALA B CA  1 
ATOM   3693  C  C   . ALA B 1 138 ? 50.350  30.422  50.447  1.00 34.09 ? 138  ALA B C   1 
ATOM   3694  O  O   . ALA B 1 138 ? 51.349  31.123  50.281  1.00 35.95 ? 138  ALA B O   1 
ATOM   3695  C  CB  . ALA B 1 138 ? 51.102  28.173  49.634  1.00 31.11 ? 138  ALA B CB  1 
ATOM   3696  N  N   . GLY B 1 139 ? 49.107  30.884  50.312  1.00 35.52 ? 139  GLY B N   1 
ATOM   3697  C  CA  . GLY B 1 139 ? 48.858  32.285  50.010  1.00 36.33 ? 139  GLY B CA  1 
ATOM   3698  C  C   . GLY B 1 139 ? 48.341  32.636  48.626  1.00 37.35 ? 139  GLY B C   1 
ATOM   3699  O  O   . GLY B 1 139 ? 48.680  33.693  48.100  1.00 37.54 ? 139  GLY B O   1 
ATOM   3700  N  N   . ALA B 1 140 ? 47.488  31.791  48.052  1.00 38.63 ? 140  ALA B N   1 
ATOM   3701  C  CA  . ALA B 1 140 ? 46.937  32.046  46.720  1.00 38.49 ? 140  ALA B CA  1 
ATOM   3702  C  C   . ALA B 1 140 ? 45.952  33.214  46.690  1.00 38.30 ? 140  ALA B C   1 
ATOM   3703  O  O   . ALA B 1 140 ? 45.793  33.870  45.659  1.00 38.21 ? 140  ALA B O   1 
ATOM   3704  C  CB  . ALA B 1 140 ? 46.275  30.791  46.173  1.00 38.20 ? 140  ALA B CB  1 
ATOM   3705  N  N   . LEU B 1 141 ? 45.288  33.461  47.818  1.00 38.25 ? 141  LEU B N   1 
ATOM   3706  C  CA  . LEU B 1 141 ? 44.316  34.547  47.927  1.00 37.57 ? 141  LEU B CA  1 
ATOM   3707  C  C   . LEU B 1 141 ? 44.895  35.780  48.610  1.00 37.21 ? 141  LEU B C   1 
ATOM   3708  O  O   . LEU B 1 141 ? 45.766  35.672  49.474  1.00 36.69 ? 141  LEU B O   1 
ATOM   3709  C  CB  . LEU B 1 141 ? 43.076  34.080  48.693  1.00 37.35 ? 141  LEU B CB  1 
ATOM   3710  C  CG  . LEU B 1 141 ? 42.196  33.022  48.030  1.00 37.40 ? 141  LEU B CG  1 
ATOM   3711  C  CD1 . LEU B 1 141 ? 41.066  32.643  48.967  1.00 38.11 ? 141  LEU B CD1 1 
ATOM   3712  C  CD2 . LEU B 1 141 ? 41.644  33.555  46.719  1.00 39.68 ? 141  LEU B CD2 1 
ATOM   3713  N  N   . SER B 1 142 ? 44.391  36.949  48.220  1.00 38.00 ? 142  SER B N   1 
ATOM   3714  C  CA  . SER B 1 142 ? 44.835  38.217  48.789  1.00 38.20 ? 142  SER B CA  1 
ATOM   3715  C  C   . SER B 1 142 ? 44.382  38.335  50.241  1.00 39.35 ? 142  SER B C   1 
ATOM   3716  O  O   . SER B 1 142 ? 43.365  37.759  50.633  1.00 39.23 ? 142  SER B O   1 
ATOM   3717  C  CB  . SER B 1 142 ? 44.286  39.389  47.971  1.00 37.48 ? 142  SER B CB  1 
ATOM   3718  O  OG  . SER B 1 142 ? 44.711  40.634  48.501  1.00 35.40 ? 142  SER B OG  1 
ATOM   3719  N  N   . ASP B 1 143 ? 45.142  39.087  51.030  1.00 40.61 ? 143  ASP B N   1 
ATOM   3720  C  CA  . ASP B 1 143 ? 44.842  39.284  52.445  1.00 42.48 ? 143  ASP B CA  1 
ATOM   3721  C  C   . ASP B 1 143 ? 43.574  40.087  52.715  1.00 42.33 ? 143  ASP B C   1 
ATOM   3722  O  O   . ASP B 1 143 ? 43.084  40.109  53.845  1.00 42.97 ? 143  ASP B O   1 
ATOM   3723  C  CB  . ASP B 1 143 ? 46.030  39.942  53.154  1.00 45.95 ? 143  ASP B CB  1 
ATOM   3724  C  CG  . ASP B 1 143 ? 47.213  39.001  53.317  1.00 48.91 ? 143  ASP B CG  1 
ATOM   3725  O  OD1 . ASP B 1 143 ? 47.427  38.135  52.440  1.00 51.51 ? 143  ASP B OD1 1 
ATOM   3726  O  OD2 . ASP B 1 143 ? 47.933  39.132  54.330  1.00 50.00 ? 143  ASP B OD2 1 
ATOM   3727  N  N   . LYS B 1 144 ? 43.046  40.749  51.688  1.00 41.99 ? 144  LYS B N   1 
ATOM   3728  C  CA  . LYS B 1 144 ? 41.833  41.545  51.847  1.00 40.56 ? 144  LYS B CA  1 
ATOM   3729  C  C   . LYS B 1 144 ? 40.567  40.690  51.868  1.00 39.51 ? 144  LYS B C   1 
ATOM   3730  O  O   . LYS B 1 144 ? 39.474  41.193  52.127  1.00 40.43 ? 144  LYS B O   1 
ATOM   3731  C  CB  . LYS B 1 144 ? 41.739  42.627  50.766  1.00 40.99 ? 144  LYS B CB  1 
ATOM   3732  C  CG  . LYS B 1 144 ? 41.629  42.117  49.341  1.00 42.43 ? 144  LYS B CG  1 
ATOM   3733  C  CD  . LYS B 1 144 ? 41.496  43.284  48.375  1.00 44.48 ? 144  LYS B CD  1 
ATOM   3734  C  CE  . LYS B 1 144 ? 41.385  42.817  46.935  1.00 45.82 ? 144  LYS B CE  1 
ATOM   3735  N  NZ  . LYS B 1 144 ? 41.280  43.969  45.996  1.00 45.98 ? 144  LYS B NZ  1 
ATOM   3736  N  N   . TYR B 1 145 ? 40.727  39.395  51.602  1.00 38.17 ? 145  TYR B N   1 
ATOM   3737  C  CA  . TYR B 1 145 ? 39.608  38.457  51.607  1.00 35.90 ? 145  TYR B CA  1 
ATOM   3738  C  C   . TYR B 1 145 ? 39.556  37.663  52.911  1.00 34.60 ? 145  TYR B C   1 
ATOM   3739  O  O   . TYR B 1 145 ? 38.735  36.758  53.068  1.00 33.49 ? 145  TYR B O   1 
ATOM   3740  C  CB  . TYR B 1 145 ? 39.694  37.514  50.403  1.00 35.66 ? 145  TYR B CB  1 
ATOM   3741  C  CG  . TYR B 1 145 ? 39.547  38.232  49.084  1.00 35.60 ? 145  TYR B CG  1 
ATOM   3742  C  CD1 . TYR B 1 145 ? 38.309  38.730  48.675  1.00 35.14 ? 145  TYR B CD1 1 
ATOM   3743  C  CD2 . TYR B 1 145 ? 40.652  38.463  48.267  1.00 36.12 ? 145  TYR B CD2 1 
ATOM   3744  C  CE1 . TYR B 1 145 ? 38.178  39.446  47.489  1.00 33.94 ? 145  TYR B CE1 1 
ATOM   3745  C  CE2 . TYR B 1 145 ? 40.532  39.178  47.080  1.00 34.80 ? 145  TYR B CE2 1 
ATOM   3746  C  CZ  . TYR B 1 145 ? 39.294  39.668  46.698  1.00 34.77 ? 145  TYR B CZ  1 
ATOM   3747  O  OH  . TYR B 1 145 ? 39.177  40.392  45.534  1.00 36.42 ? 145  TYR B OH  1 
ATOM   3748  N  N   . ILE B 1 146 ? 40.443  38.010  53.841  1.00 32.77 ? 146  ILE B N   1 
ATOM   3749  C  CA  . ILE B 1 146 ? 40.503  37.352  55.140  1.00 30.90 ? 146  ILE B CA  1 
ATOM   3750  C  C   . ILE B 1 146 ? 39.510  38.023  56.085  1.00 29.75 ? 146  ILE B C   1 
ATOM   3751  O  O   . ILE B 1 146 ? 39.380  39.249  56.093  1.00 30.53 ? 146  ILE B O   1 
ATOM   3752  C  CB  . ILE B 1 146 ? 41.923  37.427  55.748  1.00 30.50 ? 146  ILE B CB  1 
ATOM   3753  C  CG1 . ILE B 1 146 ? 42.933  36.779  54.797  1.00 30.18 ? 146  ILE B CG1 1 
ATOM   3754  C  CG2 . ILE B 1 146 ? 41.958  36.727  57.101  1.00 31.83 ? 146  ILE B CG2 1 
ATOM   3755  C  CD1 . ILE B 1 146 ? 44.364  36.811  55.288  1.00 30.02 ? 146  ILE B CD1 1 
ATOM   3756  N  N   . LEU B 1 147 ? 38.797  37.208  56.856  1.00 27.73 ? 147  LEU B N   1 
ATOM   3757  C  CA  . LEU B 1 147 ? 37.804  37.699  57.807  1.00 26.30 ? 147  LEU B CA  1 
ATOM   3758  C  C   . LEU B 1 147 ? 38.329  37.680  59.239  1.00 26.01 ? 147  LEU B C   1 
ATOM   3759  O  O   . LEU B 1 147 ? 38.043  38.585  60.025  1.00 26.19 ? 147  LEU B O   1 
ATOM   3760  C  CB  . LEU B 1 147 ? 36.530  36.857  57.713  1.00 23.92 ? 147  LEU B CB  1 
ATOM   3761  C  CG  . LEU B 1 147 ? 35.785  36.899  56.379  1.00 18.99 ? 147  LEU B CG  1 
ATOM   3762  C  CD1 . LEU B 1 147 ? 34.738  35.804  56.334  1.00 20.75 ? 147  LEU B CD1 1 
ATOM   3763  C  CD2 . LEU B 1 147 ? 35.153  38.265  56.188  1.00 21.47 ? 147  LEU B CD2 1 
ATOM   3764  N  N   . ALA B 1 148 ? 39.098  36.644  59.567  1.00 25.82 ? 148  ALA B N   1 
ATOM   3765  C  CA  . ALA B 1 148 ? 39.666  36.488  60.901  1.00 26.22 ? 148  ALA B CA  1 
ATOM   3766  C  C   . ALA B 1 148 ? 40.789  35.456  60.922  1.00 26.23 ? 148  ALA B C   1 
ATOM   3767  O  O   . ALA B 1 148 ? 40.993  34.724  59.953  1.00 26.66 ? 148  ALA B O   1 
ATOM   3768  C  CB  . ALA B 1 148 ? 38.576  36.093  61.890  1.00 26.09 ? 148  ALA B CB  1 
ATOM   3769  N  N   . TYR B 1 149 ? 41.522  35.417  62.032  1.00 27.31 ? 149  TYR B N   1 
ATOM   3770  C  CA  . TYR B 1 149 ? 42.626  34.478  62.214  1.00 27.51 ? 149  TYR B CA  1 
ATOM   3771  C  C   . TYR B 1 149 ? 42.358  33.625  63.450  1.00 28.48 ? 149  TYR B C   1 
ATOM   3772  O  O   . TYR B 1 149 ? 42.294  34.144  64.564  1.00 28.73 ? 149  TYR B O   1 
ATOM   3773  C  CB  . TYR B 1 149 ? 43.951  35.230  62.397  1.00 26.84 ? 149  TYR B CB  1 
ATOM   3774  C  CG  . TYR B 1 149 ? 44.382  36.068  61.213  1.00 24.79 ? 149  TYR B CG  1 
ATOM   3775  C  CD1 . TYR B 1 149 ? 43.950  37.385  61.072  1.00 25.64 ? 149  TYR B CD1 1 
ATOM   3776  C  CD2 . TYR B 1 149 ? 45.245  35.554  60.247  1.00 26.03 ? 149  TYR B CD2 1 
ATOM   3777  C  CE1 . TYR B 1 149 ? 44.367  38.172  59.999  1.00 25.66 ? 149  TYR B CE1 1 
ATOM   3778  C  CE2 . TYR B 1 149 ? 45.668  36.332  59.171  1.00 26.90 ? 149  TYR B CE2 1 
ATOM   3779  C  CZ  . TYR B 1 149 ? 45.226  37.640  59.053  1.00 25.42 ? 149  TYR B CZ  1 
ATOM   3780  O  OH  . TYR B 1 149 ? 45.645  38.415  57.996  1.00 24.11 ? 149  TYR B OH  1 
ATOM   3781  N  N   . SER B 1 150 ? 42.196  32.319  63.252  1.00 29.38 ? 150  SER B N   1 
ATOM   3782  C  CA  . SER B 1 150 ? 41.932  31.404  64.359  1.00 30.11 ? 150  SER B CA  1 
ATOM   3783  C  C   . SER B 1 150 ? 43.215  30.847  64.971  1.00 30.16 ? 150  SER B C   1 
ATOM   3784  O  O   . SER B 1 150 ? 44.308  31.045  64.437  1.00 28.88 ? 150  SER B O   1 
ATOM   3785  C  CB  . SER B 1 150 ? 41.042  30.249  63.897  1.00 30.37 ? 150  SER B CB  1 
ATOM   3786  O  OG  . SER B 1 150 ? 41.725  29.420  62.976  1.00 32.13 ? 150  SER B OG  1 
ATOM   3787  N  N   . ASN B 1 151 ? 43.064  30.136  66.086  1.00 29.96 ? 151  ASN B N   1 
ATOM   3788  C  CA  . ASN B 1 151 ? 44.194  29.539  66.791  1.00 29.33 ? 151  ASN B CA  1 
ATOM   3789  C  C   . ASN B 1 151 ? 44.372  28.052  66.489  1.00 28.76 ? 151  ASN B C   1 
ATOM   3790  O  O   . ASN B 1 151 ? 45.142  27.364  67.162  1.00 30.01 ? 151  ASN B O   1 
ATOM   3791  C  CB  . ASN B 1 151 ? 44.045  29.751  68.301  1.00 30.28 ? 151  ASN B CB  1 
ATOM   3792  C  CG  . ASN B 1 151 ? 42.739  29.197  68.848  1.00 32.46 ? 151  ASN B CG  1 
ATOM   3793  O  OD1 . ASN B 1 151 ? 41.955  28.579  68.125  1.00 33.47 ? 151  ASN B OD1 1 
ATOM   3794  N  ND2 . ASN B 1 151 ? 42.500  29.421  70.135  1.00 33.63 ? 151  ASN B ND2 1 
ATOM   3795  N  N   . SER B 1 152 ? 43.669  27.561  65.473  1.00 28.02 ? 152  SER B N   1 
ATOM   3796  C  CA  . SER B 1 152 ? 43.757  26.155  65.095  1.00 26.99 ? 152  SER B CA  1 
ATOM   3797  C  C   . SER B 1 152 ? 43.379  25.933  63.635  1.00 25.88 ? 152  SER B C   1 
ATOM   3798  O  O   . SER B 1 152 ? 42.336  26.400  63.176  1.00 24.08 ? 152  SER B O   1 
ATOM   3799  C  CB  . SER B 1 152 ? 42.858  25.308  66.000  1.00 26.53 ? 152  SER B CB  1 
ATOM   3800  O  OG  . SER B 1 152 ? 42.920  23.934  65.656  1.00 27.47 ? 152  SER B OG  1 
ATOM   3801  N  N   . LEU B 1 153 ? 44.245  25.226  62.913  1.00 26.02 ? 153  LEU B N   1 
ATOM   3802  C  CA  . LEU B 1 153 ? 44.012  24.918  61.505  1.00 26.89 ? 153  LEU B CA  1 
ATOM   3803  C  C   . LEU B 1 153 ? 42.979  23.798  61.400  1.00 27.41 ? 153  LEU B C   1 
ATOM   3804  O  O   . LEU B 1 153 ? 42.248  23.702  60.412  1.00 29.45 ? 153  LEU B O   1 
ATOM   3805  C  CB  . LEU B 1 153 ? 45.319  24.491  60.829  1.00 25.92 ? 153  LEU B CB  1 
ATOM   3806  C  CG  . LEU B 1 153 ? 45.301  24.362  59.302  1.00 24.72 ? 153  LEU B CG  1 
ATOM   3807  C  CD1 . LEU B 1 153 ? 45.074  25.726  58.668  1.00 24.59 ? 153  LEU B CD1 1 
ATOM   3808  C  CD2 . LEU B 1 153 ? 46.608  23.768  58.815  1.00 22.15 ? 153  LEU B CD2 1 
HETATM 3809  N  N   . MSE B 1 154 ? 42.927  22.960  62.432  1.00 27.82 ? 154  MSE B N   1 
HETATM 3810  C  CA  . MSE B 1 154 ? 41.989  21.844  62.492  1.00 28.46 ? 154  MSE B CA  1 
HETATM 3811  C  C   . MSE B 1 154 ? 40.564  22.355  62.690  1.00 27.19 ? 154  MSE B C   1 
HETATM 3812  O  O   . MSE B 1 154 ? 39.623  21.827  62.097  1.00 27.05 ? 154  MSE B O   1 
HETATM 3813  C  CB  . MSE B 1 154 ? 42.374  20.890  63.627  1.00 31.32 ? 154  MSE B CB  1 
HETATM 3814  C  CG  . MSE B 1 154 ? 41.504  19.647  63.730  1.00 33.45 ? 154  MSE B CG  1 
HETATM 3815  SE SE  . MSE B 1 154 ? 41.446  18.639  62.085  1.00 39.70 ? 154  MSE B SE  1 
HETATM 3816  C  CE  . MSE B 1 154 ? 43.120  17.692  62.257  1.00 36.21 ? 154  MSE B CE  1 
ATOM   3817  N  N   . ASP B 1 155 ? 40.414  23.385  63.520  1.00 27.74 ? 155  ASP B N   1 
ATOM   3818  C  CA  . ASP B 1 155 ? 39.107  23.981  63.785  1.00 28.08 ? 155  ASP B CA  1 
ATOM   3819  C  C   . ASP B 1 155 ? 38.530  24.582  62.509  1.00 28.28 ? 155  ASP B C   1 
ATOM   3820  O  O   . ASP B 1 155 ? 37.339  24.440  62.233  1.00 29.53 ? 155  ASP B O   1 
ATOM   3821  C  CB  . ASP B 1 155 ? 39.209  25.062  64.866  1.00 28.60 ? 155  ASP B CB  1 
ATOM   3822  C  CG  . ASP B 1 155 ? 39.471  24.494  66.251  1.00 29.38 ? 155  ASP B CG  1 
ATOM   3823  O  OD1 . ASP B 1 155 ? 39.478  23.255  66.412  1.00 31.03 ? 155  ASP B OD1 1 
ATOM   3824  O  OD2 . ASP B 1 155 ? 39.669  25.296  67.186  1.00 31.73 ? 155  ASP B OD2 1 
ATOM   3825  N  N   . ASN B 1 156 ? 39.382  25.258  61.742  1.00 27.45 ? 156  ASN B N   1 
ATOM   3826  C  CA  . ASN B 1 156 ? 38.976  25.873  60.482  1.00 26.60 ? 156  ASN B CA  1 
ATOM   3827  C  C   . ASN B 1 156 ? 38.557  24.800  59.490  1.00 26.63 ? 156  ASN B C   1 
ATOM   3828  O  O   . ASN B 1 156 ? 37.641  25.001  58.693  1.00 27.65 ? 156  ASN B O   1 
ATOM   3829  C  CB  . ASN B 1 156 ? 40.124  26.691  59.885  1.00 26.55 ? 156  ASN B CB  1 
ATOM   3830  C  CG  . ASN B 1 156 ? 40.416  27.949  60.671  1.00 24.99 ? 156  ASN B CG  1 
ATOM   3831  O  OD1 . ASN B 1 156 ? 39.761  28.234  61.673  1.00 26.68 ? 156  ASN B OD1 1 
ATOM   3832  N  ND2 . ASN B 1 156 ? 41.400  28.715  60.216  1.00 22.00 ? 156  ASN B ND2 1 
ATOM   3833  N  N   . PHE B 1 157 ? 39.238  23.659  59.547  1.00 26.61 ? 157  PHE B N   1 
ATOM   3834  C  CA  . PHE B 1 157 ? 38.944  22.543  58.662  1.00 26.80 ? 157  PHE B CA  1 
ATOM   3835  C  C   . PHE B 1 157 ? 37.618  21.889  59.039  1.00 27.43 ? 157  PHE B C   1 
ATOM   3836  O  O   . PHE B 1 157 ? 36.826  21.539  58.166  1.00 27.40 ? 157  PHE B O   1 
ATOM   3837  C  CB  . PHE B 1 157 ? 40.073  21.513  58.708  1.00 26.15 ? 157  PHE B CB  1 
ATOM   3838  C  CG  . PHE B 1 157 ? 39.964  20.453  57.653  1.00 25.33 ? 157  PHE B CG  1 
ATOM   3839  C  CD1 . PHE B 1 157 ? 40.509  20.656  56.391  1.00 25.47 ? 157  PHE B CD1 1 
ATOM   3840  C  CD2 . PHE B 1 157 ? 39.305  19.255  57.914  1.00 26.62 ? 157  PHE B CD2 1 
ATOM   3841  C  CE1 . PHE B 1 157 ? 40.399  19.683  55.401  1.00 24.64 ? 157  PHE B CE1 1 
ATOM   3842  C  CE2 . PHE B 1 157 ? 39.189  18.277  56.930  1.00 26.31 ? 157  PHE B CE2 1 
ATOM   3843  C  CZ  . PHE B 1 157 ? 39.737  18.494  55.671  1.00 24.47 ? 157  PHE B CZ  1 
ATOM   3844  N  N   . ILE B 1 158 ? 37.388  21.717  60.339  1.00 29.25 ? 158  ILE B N   1 
ATOM   3845  C  CA  . ILE B 1 158 ? 36.149  21.113  60.825  1.00 31.00 ? 158  ILE B CA  1 
ATOM   3846  C  C   . ILE B 1 158 ? 34.967  22.020  60.498  1.00 31.34 ? 158  ILE B C   1 
ATOM   3847  O  O   . ILE B 1 158 ? 33.930  21.550  60.032  1.00 32.27 ? 158  ILE B O   1 
ATOM   3848  C  CB  . ILE B 1 158 ? 36.208  20.833  62.346  1.00 31.54 ? 158  ILE B CB  1 
ATOM   3849  C  CG1 . ILE B 1 158 ? 37.279  19.777  62.635  1.00 32.45 ? 158  ILE B CG1 1 
ATOM   3850  C  CG2 . ILE B 1 158 ? 34.851  20.358  62.856  1.00 32.08 ? 158  ILE B CG2 1 
ATOM   3851  C  CD1 . ILE B 1 158 ? 37.432  19.428  64.100  1.00 33.86 ? 158  ILE B CD1 1 
HETATM 3852  N  N   . MSE B 1 159 ? 35.143  23.320  60.722  1.00 31.51 ? 159  MSE B N   1 
HETATM 3853  C  CA  . MSE B 1 159 ? 34.112  24.313  60.431  1.00 32.44 ? 159  MSE B CA  1 
HETATM 3854  C  C   . MSE B 1 159 ? 33.834  24.300  58.930  1.00 33.22 ? 159  MSE B C   1 
HETATM 3855  O  O   . MSE B 1 159 ? 32.696  24.475  58.491  1.00 33.52 ? 159  MSE B O   1 
HETATM 3856  C  CB  . MSE B 1 159 ? 34.590  25.701  60.858  1.00 33.63 ? 159  MSE B CB  1 
HETATM 3857  C  CG  . MSE B 1 159 ? 33.679  26.845  60.441  1.00 35.72 ? 159  MSE B CG  1 
HETATM 3858  SE SE  . MSE B 1 159 ? 34.390  28.569  60.931  1.00 40.80 ? 159  MSE B SE  1 
HETATM 3859  C  CE  . MSE B 1 159 ? 35.967  28.571  59.825  1.00 38.06 ? 159  MSE B CE  1 
ATOM   3860  N  N   . ASP B 1 160 ? 34.893  24.075  58.158  1.00 34.61 ? 160  ASP B N   1 
ATOM   3861  C  CA  . ASP B 1 160 ? 34.823  24.013  56.703  1.00 34.75 ? 160  ASP B CA  1 
ATOM   3862  C  C   . ASP B 1 160 ? 33.909  22.858  56.300  1.00 33.18 ? 160  ASP B C   1 
ATOM   3863  O  O   . ASP B 1 160 ? 33.073  22.997  55.406  1.00 35.59 ? 160  ASP B O   1 
ATOM   3864  C  CB  . ASP B 1 160 ? 36.231  23.791  56.143  1.00 37.67 ? 160  ASP B CB  1 
ATOM   3865  C  CG  . ASP B 1 160 ? 36.324  24.058  54.660  1.00 40.11 ? 160  ASP B CG  1 
ATOM   3866  O  OD1 . ASP B 1 160 ? 35.936  23.176  53.866  1.00 42.27 ? 160  ASP B OD1 1 
ATOM   3867  O  OD2 . ASP B 1 160 ? 36.811  25.147  54.289  1.00 43.85 ? 160  ASP B OD2 1 
ATOM   3868  N  N   . VAL B 1 161 ? 34.063  21.729  56.988  1.00 31.42 ? 161  VAL B N   1 
ATOM   3869  C  CA  . VAL B 1 161 ? 33.266  20.533  56.731  1.00 29.58 ? 161  VAL B CA  1 
ATOM   3870  C  C   . VAL B 1 161 ? 31.820  20.710  57.188  1.00 29.27 ? 161  VAL B C   1 
ATOM   3871  O  O   . VAL B 1 161 ? 30.898  20.251  56.519  1.00 31.33 ? 161  VAL B O   1 
ATOM   3872  C  CB  . VAL B 1 161 ? 33.873  19.293  57.438  1.00 29.68 ? 161  VAL B CB  1 
ATOM   3873  C  CG1 . VAL B 1 161 ? 33.003  18.062  57.207  1.00 28.86 ? 161  VAL B CG1 1 
ATOM   3874  C  CG2 . VAL B 1 161 ? 35.286  19.041  56.932  1.00 27.74 ? 161  VAL B CG2 1 
ATOM   3875  N  N   . GLN B 1 162 ? 31.626  21.386  58.318  1.00 28.24 ? 162  GLN B N   1 
ATOM   3876  C  CA  . GLN B 1 162 ? 30.286  21.613  58.857  1.00 26.82 ? 162  GLN B CA  1 
ATOM   3877  C  C   . GLN B 1 162 ? 29.459  22.551  57.985  1.00 25.96 ? 162  GLN B C   1 
ATOM   3878  O  O   . GLN B 1 162 ? 28.230  22.477  57.975  1.00 25.57 ? 162  GLN B O   1 
ATOM   3879  C  CB  . GLN B 1 162 ? 30.360  22.172  60.283  1.00 27.68 ? 162  GLN B CB  1 
ATOM   3880  C  CG  . GLN B 1 162 ? 31.194  21.344  61.250  1.00 25.60 ? 162  GLN B CG  1 
ATOM   3881  C  CD  . GLN B 1 162 ? 30.890  19.863  61.173  1.00 25.93 ? 162  GLN B CD  1 
ATOM   3882  O  OE1 . GLN B 1 162 ? 29.758  19.434  61.396  1.00 25.17 ? 162  GLN B OE1 1 
ATOM   3883  N  NE2 . GLN B 1 162 ? 31.904  19.071  60.849  1.00 28.13 ? 162  GLN B NE2 1 
ATOM   3884  N  N   . GLY B 1 163 ? 30.139  23.435  57.262  1.00 26.52 ? 163  GLY B N   1 
ATOM   3885  C  CA  . GLY B 1 163 ? 29.452  24.376  56.395  1.00 25.77 ? 163  GLY B CA  1 
ATOM   3886  C  C   . GLY B 1 163 ? 29.398  25.780  56.964  1.00 25.65 ? 163  GLY B C   1 
ATOM   3887  O  O   . GLY B 1 163 ? 29.271  26.749  56.217  1.00 25.76 ? 163  GLY B O   1 
ATOM   3888  N  N   . SER B 1 164 ? 29.495  25.891  58.286  1.00 26.10 ? 164  SER B N   1 
ATOM   3889  C  CA  . SER B 1 164 ? 29.453  27.185  58.961  1.00 25.05 ? 164  SER B CA  1 
ATOM   3890  C  C   . SER B 1 164 ? 29.915  27.079  60.411  1.00 25.06 ? 164  SER B C   1 
ATOM   3891  O  O   . SER B 1 164 ? 30.304  26.005  60.876  1.00 24.90 ? 164  SER B O   1 
ATOM   3892  C  CB  . SER B 1 164 ? 28.035  27.762  58.915  1.00 24.90 ? 164  SER B CB  1 
ATOM   3893  O  OG  . SER B 1 164 ? 27.117  26.919  59.588  1.00 26.57 ? 164  SER B OG  1 
ATOM   3894  N  N   . GLY B 1 165 ? 29.873  28.204  61.117  1.00 25.49 ? 165  GLY B N   1 
ATOM   3895  C  CA  . GLY B 1 165 ? 30.282  28.224  62.508  1.00 25.25 ? 165  GLY B CA  1 
ATOM   3896  C  C   . GLY B 1 165 ? 30.328  29.618  63.102  1.00 25.42 ? 165  GLY B C   1 
ATOM   3897  O  O   . GLY B 1 165 ? 30.471  30.606  62.379  1.00 24.47 ? 165  GLY B O   1 
ATOM   3898  N  N   . TYR B 1 166 ? 30.174  29.696  64.421  1.00 25.72 ? 166  TYR B N   1 
ATOM   3899  C  CA  . TYR B 1 166 ? 30.218  30.968  65.135  1.00 24.86 ? 166  TYR B CA  1 
ATOM   3900  C  C   . TYR B 1 166 ? 31.661  31.352  65.425  1.00 25.99 ? 166  TYR B C   1 
ATOM   3901  O  O   . TYR B 1 166 ? 32.483  30.499  65.768  1.00 25.99 ? 166  TYR B O   1 
ATOM   3902  C  CB  . TYR B 1 166 ? 29.452  30.879  66.455  1.00 23.43 ? 166  TYR B CB  1 
ATOM   3903  C  CG  . TYR B 1 166 ? 27.957  31.022  66.322  1.00 23.37 ? 166  TYR B CG  1 
ATOM   3904  C  CD1 . TYR B 1 166 ? 27.381  32.255  66.016  1.00 22.44 ? 166  TYR B CD1 1 
ATOM   3905  C  CD2 . TYR B 1 166 ? 27.114  29.932  66.521  1.00 23.71 ? 166  TYR B CD2 1 
ATOM   3906  C  CE1 . TYR B 1 166 ? 25.999  32.398  65.915  1.00 22.75 ? 166  TYR B CE1 1 
ATOM   3907  C  CE2 . TYR B 1 166 ? 25.733  30.064  66.421  1.00 23.39 ? 166  TYR B CE2 1 
ATOM   3908  C  CZ  . TYR B 1 166 ? 25.182  31.298  66.118  1.00 22.16 ? 166  TYR B CZ  1 
ATOM   3909  O  OH  . TYR B 1 166 ? 23.817  31.428  66.020  1.00 24.46 ? 166  TYR B OH  1 
ATOM   3910  N  N   . ILE B 1 167 ? 31.964  32.637  65.278  1.00 26.12 ? 167  ILE B N   1 
ATOM   3911  C  CA  . ILE B 1 167 ? 33.307  33.136  65.535  1.00 24.16 ? 167  ILE B CA  1 
ATOM   3912  C  C   . ILE B 1 167 ? 33.313  34.007  66.783  1.00 24.57 ? 167  ILE B C   1 
ATOM   3913  O  O   . ILE B 1 167 ? 32.654  35.045  66.838  1.00 24.46 ? 167  ILE B O   1 
ATOM   3914  C  CB  . ILE B 1 167 ? 33.862  33.925  64.326  1.00 22.76 ? 167  ILE B CB  1 
ATOM   3915  C  CG1 . ILE B 1 167 ? 33.947  33.012  63.097  1.00 20.87 ? 167  ILE B CG1 1 
ATOM   3916  C  CG2 . ILE B 1 167 ? 35.234  34.506  64.648  1.00 20.96 ? 167  ILE B CG2 1 
ATOM   3917  C  CD1 . ILE B 1 167 ? 34.847  31.804  63.269  1.00 15.68 ? 167  ILE B CD1 1 
ATOM   3918  N  N   . ASP B 1 168 ? 34.030  33.542  67.800  1.00 27.25 ? 168  ASP B N   1 
ATOM   3919  C  CA  . ASP B 1 168 ? 34.150  34.254  69.064  1.00 29.23 ? 168  ASP B CA  1 
ATOM   3920  C  C   . ASP B 1 168 ? 35.462  35.032  69.076  1.00 29.89 ? 168  ASP B C   1 
ATOM   3921  O  O   . ASP B 1 168 ? 36.542  34.439  69.061  1.00 30.21 ? 168  ASP B O   1 
ATOM   3922  C  CB  . ASP B 1 168 ? 34.112  33.255  70.227  1.00 32.74 ? 168  ASP B CB  1 
ATOM   3923  C  CG  . ASP B 1 168 ? 34.243  33.925  71.583  1.00 35.32 ? 168  ASP B CG  1 
ATOM   3924  O  OD1 . ASP B 1 168 ? 33.345  34.709  71.955  1.00 39.64 ? 168  ASP B OD1 1 
ATOM   3925  O  OD2 . ASP B 1 168 ? 35.244  33.659  72.280  1.00 41.24 ? 168  ASP B OD2 1 
ATOM   3926  N  N   . PHE B 1 169 ? 35.363  36.360  69.086  1.00 28.99 ? 169  PHE B N   1 
ATOM   3927  C  CA  . PHE B 1 169 ? 36.545  37.218  69.095  1.00 28.80 ? 169  PHE B CA  1 
ATOM   3928  C  C   . PHE B 1 169 ? 37.136  37.438  70.488  1.00 29.39 ? 169  PHE B C   1 
ATOM   3929  O  O   . PHE B 1 169 ? 38.177  38.084  70.632  1.00 28.72 ? 169  PHE B O   1 
ATOM   3930  C  CB  . PHE B 1 169 ? 36.240  38.554  68.414  1.00 27.65 ? 169  PHE B CB  1 
ATOM   3931  C  CG  . PHE B 1 169 ? 36.065  38.444  66.926  1.00 28.05 ? 169  PHE B CG  1 
ATOM   3932  C  CD1 . PHE B 1 169 ? 37.170  38.292  66.093  1.00 26.24 ? 169  PHE B CD1 1 
ATOM   3933  C  CD2 . PHE B 1 169 ? 34.797  38.476  66.355  1.00 29.38 ? 169  PHE B CD2 1 
ATOM   3934  C  CE1 . PHE B 1 169 ? 37.017  38.171  64.714  1.00 24.59 ? 169  PHE B CE1 1 
ATOM   3935  C  CE2 . PHE B 1 169 ? 34.633  38.356  64.974  1.00 28.91 ? 169  PHE B CE2 1 
ATOM   3936  C  CZ  . PHE B 1 169 ? 35.747  38.203  64.154  1.00 26.36 ? 169  PHE B CZ  1 
ATOM   3937  N  N   . GLY B 1 170 ? 36.462  36.897  71.503  1.00 29.78 ? 170  GLY B N   1 
ATOM   3938  C  CA  . GLY B 1 170 ? 36.918  37.008  72.880  1.00 29.76 ? 170  GLY B CA  1 
ATOM   3939  C  C   . GLY B 1 170 ? 37.200  38.407  73.393  1.00 31.31 ? 170  GLY B C   1 
ATOM   3940  O  O   . GLY B 1 170 ? 38.099  38.595  74.212  1.00 31.47 ? 170  GLY B O   1 
ATOM   3941  N  N   . ASP B 1 171 ? 36.425  39.384  72.929  1.00 32.81 ? 171  ASP B N   1 
ATOM   3942  C  CA  . ASP B 1 171 ? 36.596  40.773  73.344  1.00 32.47 ? 171  ASP B CA  1 
ATOM   3943  C  C   . ASP B 1 171 ? 35.328  41.366  73.953  1.00 32.91 ? 171  ASP B C   1 
ATOM   3944  O  O   . ASP B 1 171 ? 35.305  42.533  74.351  1.00 33.06 ? 171  ASP B O   1 
ATOM   3945  C  CB  . ASP B 1 171 ? 37.071  41.631  72.160  1.00 33.23 ? 171  ASP B CB  1 
ATOM   3946  C  CG  . ASP B 1 171 ? 36.136  41.561  70.953  1.00 32.60 ? 171  ASP B CG  1 
ATOM   3947  O  OD1 . ASP B 1 171 ? 35.081  40.897  71.025  1.00 30.26 ? 171  ASP B OD1 1 
ATOM   3948  O  OD2 . ASP B 1 171 ? 36.468  42.177  69.918  1.00 33.55 ? 171  ASP B OD2 1 
ATOM   3949  N  N   . GLY B 1 172 ? 34.277  40.553  74.023  1.00 33.00 ? 172  GLY B N   1 
ATOM   3950  C  CA  . GLY B 1 172 ? 33.016  41.007  74.577  1.00 33.57 ? 172  GLY B CA  1 
ATOM   3951  C  C   . GLY B 1 172 ? 31.904  41.034  73.546  1.00 33.80 ? 172  GLY B C   1 
ATOM   3952  O  O   . GLY B 1 172 ? 30.742  40.795  73.878  1.00 33.71 ? 172  GLY B O   1 
ATOM   3953  N  N   . SER B 1 173 ? 32.260  41.319  72.295  1.00 34.77 ? 173  SER B N   1 
ATOM   3954  C  CA  . SER B 1 173 ? 31.289  41.379  71.206  1.00 35.99 ? 173  SER B CA  1 
ATOM   3955  C  C   . SER B 1 173 ? 30.635  40.018  70.967  1.00 36.21 ? 173  SER B C   1 
ATOM   3956  O  O   . SER B 1 173 ? 31.252  38.974  71.194  1.00 37.40 ? 173  SER B O   1 
ATOM   3957  C  CB  . SER B 1 173 ? 31.955  41.876  69.917  1.00 36.62 ? 173  SER B CB  1 
ATOM   3958  O  OG  . SER B 1 173 ? 32.903  40.945  69.425  1.00 38.63 ? 173  SER B OG  1 
ATOM   3959  N  N   . PRO B 1 174 ? 29.366  40.017  70.523  1.00 35.67 ? 174  PRO B N   1 
ATOM   3960  C  CA  . PRO B 1 174 ? 28.602  38.797  70.245  1.00 34.37 ? 174  PRO B CA  1 
ATOM   3961  C  C   . PRO B 1 174 ? 29.262  37.915  69.190  1.00 33.43 ? 174  PRO B C   1 
ATOM   3962  O  O   . PRO B 1 174 ? 30.057  38.390  68.377  1.00 34.99 ? 174  PRO B O   1 
ATOM   3963  C  CB  . PRO B 1 174 ? 27.268  39.346  69.743  1.00 35.98 ? 174  PRO B CB  1 
ATOM   3964  C  CG  . PRO B 1 174 ? 27.137  40.638  70.477  1.00 36.12 ? 174  PRO B CG  1 
ATOM   3965  C  CD  . PRO B 1 174 ? 28.521  41.209  70.331  1.00 36.49 ? 174  PRO B CD  1 
ATOM   3966  N  N   . LEU B 1 175 ? 28.929  36.628  69.215  1.00 32.85 ? 175  LEU B N   1 
ATOM   3967  C  CA  . LEU B 1 175 ? 29.475  35.665  68.264  1.00 31.39 ? 175  LEU B CA  1 
ATOM   3968  C  C   . LEU B 1 175 ? 28.941  35.942  66.863  1.00 29.39 ? 175  LEU B C   1 
ATOM   3969  O  O   . LEU B 1 175 ? 27.735  36.060  66.667  1.00 29.92 ? 175  LEU B O   1 
ATOM   3970  C  CB  . LEU B 1 175 ? 29.117  34.236  68.683  1.00 32.32 ? 175  LEU B CB  1 
ATOM   3971  C  CG  . LEU B 1 175 ? 29.827  33.614  69.891  1.00 32.35 ? 175  LEU B CG  1 
ATOM   3972  C  CD1 . LEU B 1 175 ? 29.592  34.427  71.153  1.00 35.08 ? 175  LEU B CD1 1 
ATOM   3973  C  CD2 . LEU B 1 175 ? 29.325  32.193  70.082  1.00 35.04 ? 175  LEU B CD2 1 
ATOM   3974  N  N   . ASN B 1 176 ? 29.849  36.064  65.900  1.00 27.64 ? 176  ASN B N   1 
ATOM   3975  C  CA  . ASN B 1 176 ? 29.478  36.335  64.514  1.00 24.12 ? 176  ASN B CA  1 
ATOM   3976  C  C   . ASN B 1 176 ? 29.312  35.025  63.748  1.00 22.49 ? 176  ASN B C   1 
ATOM   3977  O  O   . ASN B 1 176 ? 30.237  34.215  63.683  1.00 24.71 ? 176  ASN B O   1 
ATOM   3978  C  CB  . ASN B 1 176 ? 30.551  37.203  63.849  1.00 24.09 ? 176  ASN B CB  1 
ATOM   3979  C  CG  . ASN B 1 176 ? 30.081  37.825  62.545  1.00 23.23 ? 176  ASN B CG  1 
ATOM   3980  O  OD1 . ASN B 1 176 ? 29.455  37.167  61.716  1.00 21.91 ? 176  ASN B OD1 1 
ATOM   3981  N  ND2 . ASN B 1 176 ? 30.384  39.105  62.361  1.00 21.50 ? 176  ASN B ND2 1 
ATOM   3982  N  N   . PHE B 1 177 ? 28.133  34.824  63.168  1.00 21.16 ? 177  PHE B N   1 
ATOM   3983  C  CA  . PHE B 1 177 ? 27.851  33.608  62.412  1.00 19.58 ? 177  PHE B CA  1 
ATOM   3984  C  C   . PHE B 1 177 ? 28.375  33.661  60.978  1.00 20.12 ? 177  PHE B C   1 
ATOM   3985  O  O   . PHE B 1 177 ? 27.877  34.425  60.152  1.00 20.44 ? 177  PHE B O   1 
ATOM   3986  C  CB  . PHE B 1 177 ? 26.347  33.318  62.404  1.00 18.69 ? 177  PHE B CB  1 
ATOM   3987  C  CG  . PHE B 1 177 ? 25.977  32.054  61.675  1.00 18.06 ? 177  PHE B CG  1 
ATOM   3988  C  CD1 . PHE B 1 177 ? 26.428  30.817  62.126  1.00 16.39 ? 177  PHE B CD1 1 
ATOM   3989  C  CD2 . PHE B 1 177 ? 25.189  32.103  60.530  1.00 16.87 ? 177  PHE B CD2 1 
ATOM   3990  C  CE1 . PHE B 1 177 ? 26.101  29.646  61.446  1.00 16.82 ? 177  PHE B CE1 1 
ATOM   3991  C  CE2 . PHE B 1 177 ? 24.856  30.937  59.841  1.00 17.44 ? 177  PHE B CE2 1 
ATOM   3992  C  CZ  . PHE B 1 177 ? 25.313  29.707  60.301  1.00 16.64 ? 177  PHE B CZ  1 
ATOM   3993  N  N   . PHE B 1 178 ? 29.382  32.840  60.694  1.00 21.37 ? 178  PHE B N   1 
ATOM   3994  C  CA  . PHE B 1 178 ? 29.974  32.765  59.362  1.00 21.20 ? 178  PHE B CA  1 
ATOM   3995  C  C   . PHE B 1 178 ? 29.232  31.717  58.537  1.00 21.47 ? 178  PHE B C   1 
ATOM   3996  O  O   . PHE B 1 178 ? 29.584  30.537  58.554  1.00 22.54 ? 178  PHE B O   1 
ATOM   3997  C  CB  . PHE B 1 178 ? 31.462  32.402  59.452  1.00 21.28 ? 178  PHE B CB  1 
ATOM   3998  C  CG  . PHE B 1 178 ? 32.357  33.552  59.837  1.00 22.12 ? 178  PHE B CG  1 
ATOM   3999  C  CD1 . PHE B 1 178 ? 31.861  34.645  60.544  1.00 21.97 ? 178  PHE B CD1 1 
ATOM   4000  C  CD2 . PHE B 1 178 ? 33.706  33.536  59.494  1.00 22.43 ? 178  PHE B CD2 1 
ATOM   4001  C  CE1 . PHE B 1 178 ? 32.695  35.704  60.903  1.00 20.94 ? 178  PHE B CE1 1 
ATOM   4002  C  CE2 . PHE B 1 178 ? 34.548  34.590  59.849  1.00 21.70 ? 178  PHE B CE2 1 
ATOM   4003  C  CZ  . PHE B 1 178 ? 34.041  35.675  60.554  1.00 21.07 ? 178  PHE B CZ  1 
ATOM   4004  N  N   . SER B 1 179 ? 28.203  32.158  57.819  1.00 22.62 ? 179  SER B N   1 
ATOM   4005  C  CA  . SER B 1 179 ? 27.390  31.271  56.990  1.00 22.92 ? 179  SER B CA  1 
ATOM   4006  C  C   . SER B 1 179 ? 28.100  30.791  55.728  1.00 23.85 ? 179  SER B C   1 
ATOM   4007  O  O   . SER B 1 179 ? 29.068  31.401  55.274  1.00 25.34 ? 179  SER B O   1 
ATOM   4008  C  CB  . SER B 1 179 ? 26.083  31.966  56.601  1.00 23.01 ? 179  SER B CB  1 
ATOM   4009  O  OG  . SER B 1 179 ? 26.327  33.107  55.796  1.00 21.65 ? 179  SER B OG  1 
ATOM   4010  N  N   . TYR B 1 180 ? 27.599  29.694  55.167  1.00 23.51 ? 180  TYR B N   1 
ATOM   4011  C  CA  . TYR B 1 180 ? 28.146  29.109  53.948  1.00 22.52 ? 180  TYR B CA  1 
ATOM   4012  C  C   . TYR B 1 180 ? 27.883  30.076  52.794  1.00 23.95 ? 180  TYR B C   1 
ATOM   4013  O  O   . TYR B 1 180 ? 26.740  30.252  52.372  1.00 26.64 ? 180  TYR B O   1 
ATOM   4014  C  CB  . TYR B 1 180 ? 27.464  27.761  53.680  1.00 21.78 ? 180  TYR B CB  1 
ATOM   4015  C  CG  . TYR B 1 180 ? 28.034  26.962  52.527  1.00 19.26 ? 180  TYR B CG  1 
ATOM   4016  C  CD1 . TYR B 1 180 ? 27.646  27.220  51.213  1.00 19.97 ? 180  TYR B CD1 1 
ATOM   4017  C  CD2 . TYR B 1 180 ? 28.941  25.928  52.753  1.00 20.54 ? 180  TYR B CD2 1 
ATOM   4018  C  CE1 . TYR B 1 180 ? 28.146  26.471  50.153  1.00 18.29 ? 180  TYR B CE1 1 
ATOM   4019  C  CE2 . TYR B 1 180 ? 29.446  25.170  51.700  1.00 19.47 ? 180  TYR B CE2 1 
ATOM   4020  C  CZ  . TYR B 1 180 ? 29.045  25.447  50.403  1.00 19.54 ? 180  TYR B CZ  1 
ATOM   4021  O  OH  . TYR B 1 180 ? 29.540  24.702  49.356  1.00 18.67 ? 180  TYR B OH  1 
ATOM   4022  N  N   . ALA B 1 181 ? 28.940  30.720  52.308  1.00 24.11 ? 181  ALA B N   1 
ATOM   4023  C  CA  . ALA B 1 181 ? 28.819  31.676  51.211  1.00 24.24 ? 181  ALA B CA  1 
ATOM   4024  C  C   . ALA B 1 181 ? 29.159  31.059  49.858  1.00 23.92 ? 181  ALA B C   1 
ATOM   4025  O  O   . ALA B 1 181 ? 28.622  31.467  48.826  1.00 25.84 ? 181  ALA B O   1 
ATOM   4026  C  CB  . ALA B 1 181 ? 29.701  32.884  51.472  1.00 23.64 ? 181  ALA B CB  1 
ATOM   4027  N  N   . GLY B 1 182 ? 30.062  30.085  49.868  1.00 22.87 ? 182  GLY B N   1 
ATOM   4028  C  CA  . GLY B 1 182 ? 30.461  29.432  48.636  1.00 21.69 ? 182  GLY B CA  1 
ATOM   4029  C  C   . GLY B 1 182 ? 31.583  28.438  48.850  1.00 21.59 ? 182  GLY B C   1 
ATOM   4030  O  O   . GLY B 1 182 ? 31.966  28.159  49.986  1.00 20.55 ? 182  GLY B O   1 
ATOM   4031  N  N   . LYS B 1 183 ? 32.125  27.923  47.752  1.00 22.32 ? 183  LYS B N   1 
ATOM   4032  C  CA  . LYS B 1 183 ? 33.208  26.948  47.805  1.00 23.32 ? 183  LYS B CA  1 
ATOM   4033  C  C   . LYS B 1 183 ? 34.130  27.147  46.603  1.00 24.50 ? 183  LYS B C   1 
ATOM   4034  O  O   . LYS B 1 183 ? 33.817  27.922  45.697  1.00 24.51 ? 183  LYS B O   1 
ATOM   4035  C  CB  . LYS B 1 183 ? 32.618  25.535  47.785  1.00 23.76 ? 183  LYS B CB  1 
ATOM   4036  C  CG  . LYS B 1 183 ? 33.573  24.436  48.213  1.00 25.27 ? 183  LYS B CG  1 
ATOM   4037  C  CD  . LYS B 1 183 ? 32.910  23.070  48.129  1.00 24.77 ? 183  LYS B CD  1 
ATOM   4038  C  CE  . LYS B 1 183 ? 32.672  22.652  46.691  1.00 23.54 ? 183  LYS B CE  1 
ATOM   4039  N  NZ  . LYS B 1 183 ? 33.956  22.519  45.952  1.00 24.79 ? 183  LYS B NZ  1 
ATOM   4040  N  N   . ASN B 1 184 ? 35.274  26.467  46.606  1.00 26.05 ? 184  ASN B N   1 
ATOM   4041  C  CA  . ASN B 1 184 ? 36.224  26.570  45.500  1.00 28.23 ? 184  ASN B CA  1 
ATOM   4042  C  C   . ASN B 1 184 ? 35.890  25.580  44.380  1.00 28.70 ? 184  ASN B C   1 
ATOM   4043  O  O   . ASN B 1 184 ? 34.947  24.794  44.499  1.00 29.71 ? 184  ASN B O   1 
ATOM   4044  C  CB  . ASN B 1 184 ? 37.664  26.372  45.997  1.00 27.81 ? 184  ASN B CB  1 
ATOM   4045  C  CG  . ASN B 1 184 ? 37.923  24.974  46.525  1.00 26.30 ? 184  ASN B CG  1 
ATOM   4046  O  OD1 . ASN B 1 184 ? 36.999  24.189  46.740  1.00 27.69 ? 184  ASN B OD1 1 
ATOM   4047  N  ND2 . ASN B 1 184 ? 39.194  24.658  46.742  1.00 26.19 ? 184  ASN B ND2 1 
ATOM   4048  N  N   . GLY B 1 185 ? 36.669  25.618  43.301  1.00 29.33 ? 185  GLY B N   1 
ATOM   4049  C  CA  . GLY B 1 185 ? 36.430  24.731  42.173  1.00 28.44 ? 185  GLY B CA  1 
ATOM   4050  C  C   . GLY B 1 185 ? 37.075  23.360  42.261  1.00 28.58 ? 185  GLY B C   1 
ATOM   4051  O  O   . GLY B 1 185 ? 37.515  22.817  41.246  1.00 29.39 ? 185  GLY B O   1 
ATOM   4052  N  N   . HIS B 1 186 ? 37.121  22.791  43.463  1.00 28.13 ? 186  HIS B N   1 
ATOM   4053  C  CA  . HIS B 1 186 ? 37.716  21.474  43.673  1.00 26.33 ? 186  HIS B CA  1 
ATOM   4054  C  C   . HIS B 1 186 ? 36.792  20.556  44.462  1.00 28.01 ? 186  HIS B C   1 
ATOM   4055  O  O   . HIS B 1 186 ? 36.185  20.971  45.450  1.00 29.08 ? 186  HIS B O   1 
ATOM   4056  C  CB  . HIS B 1 186 ? 39.059  21.600  44.392  1.00 24.41 ? 186  HIS B CB  1 
ATOM   4057  C  CG  . HIS B 1 186 ? 40.137  22.215  43.556  1.00 23.58 ? 186  HIS B CG  1 
ATOM   4058  N  ND1 . HIS B 1 186 ? 41.000  21.466  42.785  1.00 22.10 ? 186  HIS B ND1 1 
ATOM   4059  C  CD2 . HIS B 1 186 ? 40.493  23.508  43.370  1.00 24.18 ? 186  HIS B CD2 1 
ATOM   4060  C  CE1 . HIS B 1 186 ? 41.840  22.271  42.160  1.00 21.21 ? 186  HIS B CE1 1 
ATOM   4061  N  NE2 . HIS B 1 186 ? 41.554  23.515  42.498  1.00 23.43 ? 186  HIS B NE2 1 
ATOM   4062  N  N   . ALA B 1 187 ? 36.709  19.302  44.023  1.00 29.88 ? 187  ALA B N   1 
ATOM   4063  C  CA  . ALA B 1 187 ? 35.862  18.297  44.662  1.00 31.25 ? 187  ALA B CA  1 
ATOM   4064  C  C   . ALA B 1 187 ? 36.356  17.885  46.046  1.00 32.32 ? 187  ALA B C   1 
ATOM   4065  O  O   . ALA B 1 187 ? 37.560  17.777  46.285  1.00 32.47 ? 187  ALA B O   1 
ATOM   4066  C  CB  . ALA B 1 187 ? 35.735  17.073  43.764  1.00 31.99 ? 187  ALA B CB  1 
ATOM   4067  N  N   . TYR B 1 188 ? 35.407  17.639  46.945  1.00 33.87 ? 188  TYR B N   1 
ATOM   4068  C  CA  . TYR B 1 188 ? 35.706  17.237  48.315  1.00 34.77 ? 188  TYR B CA  1 
ATOM   4069  C  C   . TYR B 1 188 ? 36.218  15.801  48.413  1.00 36.22 ? 188  TYR B C   1 
ATOM   4070  O  O   . TYR B 1 188 ? 35.731  14.905  47.719  1.00 36.70 ? 188  TYR B O   1 
ATOM   4071  C  CB  . TYR B 1 188 ? 34.461  17.405  49.199  1.00 34.01 ? 188  TYR B CB  1 
ATOM   4072  C  CG  . TYR B 1 188 ? 34.641  16.925  50.626  1.00 33.74 ? 188  TYR B CG  1 
ATOM   4073  C  CD1 . TYR B 1 188 ? 35.273  17.725  51.578  1.00 32.87 ? 188  TYR B CD1 1 
ATOM   4074  C  CD2 . TYR B 1 188 ? 34.197  15.661  51.019  1.00 34.03 ? 188  TYR B CD2 1 
ATOM   4075  C  CE1 . TYR B 1 188 ? 35.463  17.278  52.885  1.00 32.27 ? 188  TYR B CE1 1 
ATOM   4076  C  CE2 . TYR B 1 188 ? 34.382  15.205  52.324  1.00 33.92 ? 188  TYR B CE2 1 
ATOM   4077  C  CZ  . TYR B 1 188 ? 35.016  16.019  53.251  1.00 32.56 ? 188  TYR B CZ  1 
ATOM   4078  O  OH  . TYR B 1 188 ? 35.208  15.570  54.537  1.00 32.77 ? 188  TYR B OH  1 
ATOM   4079  N  N   . ARG B 1 189 ? 37.202  15.600  49.285  1.00 37.81 ? 189  ARG B N   1 
ATOM   4080  C  CA  . ARG B 1 189 ? 37.791  14.287  49.520  1.00 39.78 ? 189  ARG B CA  1 
ATOM   4081  C  C   . ARG B 1 189 ? 37.974  14.103  51.023  1.00 40.53 ? 189  ARG B C   1 
ATOM   4082  O  O   . ARG B 1 189 ? 38.689  14.869  51.672  1.00 39.98 ? 189  ARG B O   1 
ATOM   4083  C  CB  . ARG B 1 189 ? 39.131  14.150  48.790  1.00 41.54 ? 189  ARG B CB  1 
ATOM   4084  C  CG  . ARG B 1 189 ? 39.013  14.304  47.280  1.00 44.45 ? 189  ARG B CG  1 
ATOM   4085  C  CD  . ARG B 1 189 ? 40.303  13.955  46.557  1.00 45.15 ? 189  ARG B CD  1 
ATOM   4086  N  NE  . ARG B 1 189 ? 40.200  14.201  45.119  1.00 47.97 ? 189  ARG B NE  1 
ATOM   4087  C  CZ  . ARG B 1 189 ? 39.382  13.552  44.293  1.00 49.96 ? 189  ARG B CZ  1 
ATOM   4088  N  NH1 . ARG B 1 189 ? 38.577  12.601  44.749  1.00 50.48 ? 189  ARG B NH1 1 
ATOM   4089  N  NH2 . ARG B 1 189 ? 39.367  13.857  43.003  1.00 51.48 ? 189  ARG B NH2 1 
ATOM   4090  N  N   . SER B 1 190 ? 37.302  13.093  51.568  1.00 41.51 ? 190  SER B N   1 
ATOM   4091  C  CA  . SER B 1 190 ? 37.346  12.794  52.996  1.00 42.80 ? 190  SER B CA  1 
ATOM   4092  C  C   . SER B 1 190 ? 38.752  12.502  53.520  1.00 43.23 ? 190  SER B C   1 
ATOM   4093  O  O   . SER B 1 190 ? 39.531  11.785  52.888  1.00 42.60 ? 190  SER B O   1 
ATOM   4094  C  CB  . SER B 1 190 ? 36.409  11.625  53.317  1.00 42.75 ? 190  SER B CB  1 
ATOM   4095  O  OG  . SER B 1 190 ? 36.242  11.464  54.716  1.00 43.59 ? 190  SER B OG  1 
ATOM   4096  N  N   . ILE B 1 191 ? 39.063  13.084  54.677  1.00 43.74 ? 191  ILE B N   1 
ATOM   4097  C  CA  . ILE B 1 191 ? 40.358  12.916  55.331  1.00 42.05 ? 191  ILE B CA  1 
ATOM   4098  C  C   . ILE B 1 191 ? 40.396  11.627  56.151  1.00 41.84 ? 191  ILE B C   1 
ATOM   4099  O  O   . ILE B 1 191 ? 41.468  11.071  56.398  1.00 41.60 ? 191  ILE B O   1 
ATOM   4100  C  CB  . ILE B 1 191 ? 40.680  14.135  56.233  1.00 41.59 ? 191  ILE B CB  1 
ATOM   4101  C  CG1 . ILE B 1 191 ? 40.877  15.382  55.369  1.00 41.34 ? 191  ILE B CG1 1 
ATOM   4102  C  CG2 . ILE B 1 191 ? 41.919  13.883  57.078  1.00 43.65 ? 191  ILE B CG2 1 
ATOM   4103  C  CD1 . ILE B 1 191 ? 41.974  15.255  54.333  1.00 37.25 ? 191  ILE B CD1 1 
ATOM   4104  N  N   . GLY B 1 192 ? 39.220  11.154  56.559  1.00 41.94 ? 192  GLY B N   1 
ATOM   4105  C  CA  . GLY B 1 192 ? 39.134  9.925   57.330  1.00 42.73 ? 192  GLY B CA  1 
ATOM   4106  C  C   . GLY B 1 192 ? 39.702  8.752   56.554  1.00 43.15 ? 192  GLY B C   1 
ATOM   4107  O  O   . GLY B 1 192 ? 40.364  7.881   57.122  1.00 43.33 ? 192  GLY B O   1 
ATOM   4108  N  N   . LYS B 1 193 ? 39.449  8.742   55.246  1.00 43.01 ? 193  LYS B N   1 
ATOM   4109  C  CA  . LYS B 1 193 ? 39.937  7.695   54.354  1.00 43.28 ? 193  LYS B CA  1 
ATOM   4110  C  C   . LYS B 1 193 ? 41.460  7.752   54.249  1.00 42.69 ? 193  LYS B C   1 
ATOM   4111  O  O   . LYS B 1 193 ? 42.134  6.724   54.318  1.00 42.25 ? 193  LYS B O   1 
ATOM   4112  C  CB  . LYS B 1 193 ? 39.316  7.858   52.963  1.00 43.98 ? 193  LYS B CB  1 
ATOM   4113  C  CG  . LYS B 1 193 ? 39.940  6.974   51.891  1.00 45.77 ? 193  LYS B CG  1 
ATOM   4114  C  CD  . LYS B 1 193 ? 39.360  7.263   50.516  1.00 46.73 ? 193  LYS B CD  1 
ATOM   4115  C  CE  . LYS B 1 193 ? 40.166  6.568   49.425  1.00 47.24 ? 193  LYS B CE  1 
ATOM   4116  N  NZ  . LYS B 1 193 ? 40.240  5.094   49.621  1.00 47.19 ? 193  LYS B NZ  1 
ATOM   4117  N  N   . VAL B 1 194 ? 41.986  8.965   54.095  1.00 42.30 ? 194  VAL B N   1 
ATOM   4118  C  CA  . VAL B 1 194 ? 43.423  9.196   53.975  1.00 42.08 ? 194  VAL B CA  1 
ATOM   4119  C  C   . VAL B 1 194 ? 44.191  8.668   55.188  1.00 42.51 ? 194  VAL B C   1 
ATOM   4120  O  O   . VAL B 1 194 ? 45.283  8.122   55.044  1.00 43.64 ? 194  VAL B O   1 
ATOM   4121  C  CB  . VAL B 1 194 ? 43.731  10.705  53.795  1.00 41.53 ? 194  VAL B CB  1 
ATOM   4122  C  CG1 . VAL B 1 194 ? 45.218  10.923  53.563  1.00 40.41 ? 194  VAL B CG1 1 
ATOM   4123  C  CG2 . VAL B 1 194 ? 42.924  11.273  52.637  1.00 41.16 ? 194  VAL B CG2 1 
ATOM   4124  N  N   . LEU B 1 195 ? 43.606  8.822   56.374  1.00 42.50 ? 195  LEU B N   1 
ATOM   4125  C  CA  . LEU B 1 195 ? 44.220  8.366   57.621  1.00 42.11 ? 195  LEU B CA  1 
ATOM   4126  C  C   . LEU B 1 195 ? 44.313  6.844   57.714  1.00 42.43 ? 195  LEU B C   1 
ATOM   4127  O  O   . LEU B 1 195 ? 45.323  6.300   58.167  1.00 41.87 ? 195  LEU B O   1 
ATOM   4128  C  CB  . LEU B 1 195 ? 43.443  8.917   58.818  1.00 41.21 ? 195  LEU B CB  1 
ATOM   4129  C  CG  . LEU B 1 195 ? 43.606  10.414  59.085  1.00 40.99 ? 195  LEU B CG  1 
ATOM   4130  C  CD1 . LEU B 1 195 ? 42.589  10.889  60.111  1.00 40.58 ? 195  LEU B CD1 1 
ATOM   4131  C  CD2 . LEU B 1 195 ? 45.025  10.688  59.559  1.00 41.25 ? 195  LEU B CD2 1 
ATOM   4132  N  N   . ILE B 1 196 ? 43.249  6.166   57.294  1.00 43.25 ? 196  ILE B N   1 
ATOM   4133  C  CA  . ILE B 1 196 ? 43.198  4.707   57.310  1.00 44.08 ? 196  ILE B CA  1 
ATOM   4134  C  C   . ILE B 1 196 ? 44.181  4.151   56.279  1.00 45.57 ? 196  ILE B C   1 
ATOM   4135  O  O   . ILE B 1 196 ? 44.949  3.231   56.570  1.00 46.34 ? 196  ILE B O   1 
ATOM   4136  C  CB  . ILE B 1 196 ? 41.777  4.198   56.977  1.00 43.69 ? 196  ILE B CB  1 
ATOM   4137  C  CG1 . ILE B 1 196 ? 40.766  4.768   57.974  1.00 42.24 ? 196  ILE B CG1 1 
ATOM   4138  C  CG2 . ILE B 1 196 ? 41.742  2.676   56.997  1.00 44.32 ? 196  ILE B CG2 1 
ATOM   4139  C  CD1 . ILE B 1 196 ? 39.327  4.444   57.641  1.00 40.71 ? 196  ILE B CD1 1 
ATOM   4140  N  N   . ASP B 1 197 ? 44.159  4.737   55.083  1.00 46.27 ? 197  ASP B N   1 
ATOM   4141  C  CA  . ASP B 1 197 ? 45.032  4.329   53.985  1.00 47.05 ? 197  ASP B CA  1 
ATOM   4142  C  C   . ASP B 1 197 ? 46.499  4.650   54.263  1.00 48.29 ? 197  ASP B C   1 
ATOM   4143  O  O   . ASP B 1 197 ? 47.393  3.951   53.786  1.00 50.30 ? 197  ASP B O   1 
ATOM   4144  C  CB  . ASP B 1 197 ? 44.596  5.008   52.680  1.00 46.41 ? 197  ASP B CB  1 
ATOM   4145  C  CG  . ASP B 1 197 ? 43.224  4.551   52.203  1.00 45.88 ? 197  ASP B CG  1 
ATOM   4146  O  OD1 . ASP B 1 197 ? 42.390  4.136   53.036  1.00 46.93 ? 197  ASP B OD1 1 
ATOM   4147  O  OD2 . ASP B 1 197 ? 42.976  4.617   50.981  1.00 46.59 ? 197  ASP B OD2 1 
ATOM   4148  N  N   . ARG B 1 198 ? 46.737  5.712   55.029  1.00 49.08 ? 198  ARG B N   1 
ATOM   4149  C  CA  . ARG B 1 198 ? 48.092  6.132   55.379  1.00 49.68 ? 198  ARG B CA  1 
ATOM   4150  C  C   . ARG B 1 198 ? 48.735  5.116   56.321  1.00 50.63 ? 198  ARG B C   1 
ATOM   4151  O  O   . ARG B 1 198 ? 49.955  4.941   56.319  1.00 50.94 ? 198  ARG B O   1 
ATOM   4152  C  CB  . ARG B 1 198 ? 48.064  7.517   56.037  1.00 49.67 ? 198  ARG B CB  1 
ATOM   4153  C  CG  . ARG B 1 198 ? 49.418  8.208   56.125  1.00 48.55 ? 198  ARG B CG  1 
ATOM   4154  C  CD  . ARG B 1 198 ? 49.379  9.577   55.456  1.00 46.81 ? 198  ARG B CD  1 
ATOM   4155  N  NE  . ARG B 1 198 ? 49.067  9.479   54.031  1.00 44.73 ? 198  ARG B NE  1 
ATOM   4156  C  CZ  . ARG B 1 198 ? 48.860  10.521  53.230  1.00 43.40 ? 198  ARG B CZ  1 
ATOM   4157  N  NH1 . ARG B 1 198 ? 48.928  11.759  53.705  1.00 41.02 ? 198  ARG B NH1 1 
ATOM   4158  N  NH2 . ARG B 1 198 ? 48.580  10.324  51.948  1.00 42.37 ? 198  ARG B NH2 1 
ATOM   4159  N  N   . GLY B 1 199 ? 47.903  4.446   57.115  1.00 51.53 ? 199  GLY B N   1 
ATOM   4160  C  CA  . GLY B 1 199 ? 48.396  3.445   58.044  1.00 52.48 ? 199  GLY B CA  1 
ATOM   4161  C  C   . GLY B 1 199 ? 48.441  3.892   59.493  1.00 53.42 ? 199  GLY B C   1 
ATOM   4162  O  O   . GLY B 1 199 ? 48.724  3.087   60.382  1.00 54.04 ? 199  GLY B O   1 
ATOM   4163  N  N   . GLU B 1 200 ? 48.165  5.171   59.735  1.00 53.56 ? 200  GLU B N   1 
ATOM   4164  C  CA  . GLU B 1 200 ? 48.179  5.718   61.090  1.00 52.87 ? 200  GLU B CA  1 
ATOM   4165  C  C   . GLU B 1 200 ? 46.926  5.341   61.875  1.00 52.76 ? 200  GLU B C   1 
ATOM   4166  O  O   . GLU B 1 200 ? 47.013  4.707   62.929  1.00 53.07 ? 200  GLU B O   1 
ATOM   4167  C  CB  . GLU B 1 200 ? 48.346  7.240   61.051  1.00 52.01 ? 200  GLU B CB  1 
ATOM   4168  C  CG  . GLU B 1 200 ? 49.662  7.694   60.438  1.00 50.58 ? 200  GLU B CG  1 
ATOM   4169  C  CD  . GLU B 1 200 ? 49.850  9.194   60.498  1.00 49.55 ? 200  GLU B CD  1 
ATOM   4170  O  OE1 . GLU B 1 200 ? 50.329  9.693   61.537  1.00 47.84 ? 200  GLU B OE1 1 
ATOM   4171  O  OE2 . GLU B 1 200 ? 49.524  9.874   59.502  1.00 50.09 ? 200  GLU B OE2 1 
ATOM   4172  N  N   . VAL B 1 201 ? 45.765  5.736   61.358  1.00 52.48 ? 201  VAL B N   1 
ATOM   4173  C  CA  . VAL B 1 201 ? 44.488  5.437   62.001  1.00 51.69 ? 201  VAL B CA  1 
ATOM   4174  C  C   . VAL B 1 201 ? 43.947  4.101   61.491  1.00 52.12 ? 201  VAL B C   1 
ATOM   4175  O  O   . VAL B 1 201 ? 44.194  3.719   60.344  1.00 51.97 ? 201  VAL B O   1 
ATOM   4176  C  CB  . VAL B 1 201 ? 43.452  6.564   61.744  1.00 50.09 ? 201  VAL B CB  1 
ATOM   4177  C  CG1 . VAL B 1 201 ? 42.122  6.236   62.407  1.00 49.53 ? 201  VAL B CG1 1 
ATOM   4178  C  CG2 . VAL B 1 201 ? 43.982  7.888   62.272  1.00 49.45 ? 201  VAL B CG2 1 
ATOM   4179  N  N   . LYS B 1 202 ? 43.232  3.387   62.358  1.00 52.54 ? 202  LYS B N   1 
ATOM   4180  C  CA  . LYS B 1 202 ? 42.654  2.091   62.012  1.00 53.02 ? 202  LYS B CA  1 
ATOM   4181  C  C   . LYS B 1 202 ? 41.357  2.225   61.213  1.00 53.08 ? 202  LYS B C   1 
ATOM   4182  O  O   . LYS B 1 202 ? 40.746  3.295   61.176  1.00 54.49 ? 202  LYS B O   1 
ATOM   4183  C  CB  . LYS B 1 202 ? 42.409  1.264   63.278  1.00 53.23 ? 202  LYS B CB  1 
ATOM   4184  C  CG  . LYS B 1 202 ? 43.670  0.952   64.075  1.00 53.80 ? 202  LYS B CG  1 
ATOM   4185  C  CD  . LYS B 1 202 ? 43.366  0.048   65.263  1.00 51.75 ? 202  LYS B CD  1 
ATOM   4186  C  CE  . LYS B 1 202 ? 44.633  -0.339  66.009  1.00 49.72 ? 202  LYS B CE  1 
ATOM   4187  N  NZ  . LYS B 1 202 ? 44.347  -1.267  67.137  1.00 47.08 ? 202  LYS B NZ  1 
ATOM   4188  N  N   . LYS B 1 203 ? 40.942  1.127   60.585  1.00 52.74 ? 203  LYS B N   1 
ATOM   4189  C  CA  . LYS B 1 203 ? 39.729  1.085   59.767  1.00 51.63 ? 203  LYS B CA  1 
ATOM   4190  C  C   . LYS B 1 203 ? 38.457  1.464   60.520  1.00 50.65 ? 203  LYS B C   1 
ATOM   4191  O  O   . LYS B 1 203 ? 37.919  2.557   60.336  1.00 51.00 ? 203  LYS B O   1 
ATOM   4192  C  CB  . LYS B 1 203 ? 39.554  -0.307  59.151  1.00 52.85 ? 203  LYS B CB  1 
ATOM   4193  C  CG  . LYS B 1 203 ? 40.585  -0.679  58.093  1.00 52.39 ? 203  LYS B CG  1 
ATOM   4194  C  CD  . LYS B 1 203 ? 40.480  -2.153  57.707  1.00 52.30 ? 203  LYS B CD  1 
ATOM   4195  C  CE  . LYS B 1 203 ? 39.076  -2.533  57.244  1.00 52.15 ? 203  LYS B CE  1 
ATOM   4196  N  NZ  . LYS B 1 203 ? 38.649  -1.790  56.027  1.00 52.26 ? 203  LYS B NZ  1 
ATOM   4197  N  N   . GLU B 1 204 ? 37.977  0.550   61.359  1.00 50.20 ? 204  GLU B N   1 
ATOM   4198  C  CA  . GLU B 1 204 ? 36.759  0.764   62.135  1.00 49.95 ? 204  GLU B CA  1 
ATOM   4199  C  C   . GLU B 1 204 ? 36.955  1.808   63.233  1.00 48.95 ? 204  GLU B C   1 
ATOM   4200  O  O   . GLU B 1 204 ? 35.988  2.382   63.736  1.00 49.54 ? 204  GLU B O   1 
ATOM   4201  C  CB  . GLU B 1 204 ? 36.295  -0.558  62.754  1.00 50.14 ? 204  GLU B CB  1 
ATOM   4202  C  CG  . GLU B 1 204 ? 34.787  -0.674  62.934  1.00 49.49 ? 204  GLU B CG  1 
ATOM   4203  C  CD  . GLU B 1 204 ? 34.047  -0.791  61.612  1.00 49.89 ? 204  GLU B CD  1 
ATOM   4204  O  OE1 . GLU B 1 204 ? 34.220  -1.818  60.921  1.00 49.14 ? 204  GLU B OE1 1 
ATOM   4205  O  OE2 . GLU B 1 204 ? 33.290  0.141   61.264  1.00 50.74 ? 204  GLU B OE2 1 
ATOM   4206  N  N   . ASP B 1 205 ? 38.211  2.050   63.597  1.00 47.95 ? 205  ASP B N   1 
ATOM   4207  C  CA  . ASP B 1 205 ? 38.543  3.020   64.635  1.00 47.72 ? 205  ASP B CA  1 
ATOM   4208  C  C   . ASP B 1 205 ? 38.693  4.430   64.069  1.00 46.86 ? 205  ASP B C   1 
ATOM   4209  O  O   . ASP B 1 205 ? 39.714  5.091   64.272  1.00 46.15 ? 205  ASP B O   1 
ATOM   4210  C  CB  . ASP B 1 205 ? 39.822  2.599   65.364  1.00 48.19 ? 205  ASP B CB  1 
ATOM   4211  C  CG  . ASP B 1 205 ? 39.702  1.233   66.009  1.00 47.66 ? 205  ASP B CG  1 
ATOM   4212  O  OD1 . ASP B 1 205 ? 39.914  0.223   65.306  1.00 47.01 ? 205  ASP B OD1 1 
ATOM   4213  O  OD2 . ASP B 1 205 ? 39.392  1.169   67.217  1.00 48.01 ? 205  ASP B OD2 1 
HETATM 4214  N  N   . MSE B 1 206 ? 37.669  4.880   63.351  1.00 46.32 ? 206  MSE B N   1 
HETATM 4215  C  CA  . MSE B 1 206 ? 37.666  6.211   62.758  1.00 45.43 ? 206  MSE B CA  1 
HETATM 4216  C  C   . MSE B 1 206 ? 36.516  7.032   63.329  1.00 44.85 ? 206  MSE B C   1 
HETATM 4217  O  O   . MSE B 1 206 ? 35.413  6.520   63.529  1.00 44.81 ? 206  MSE B O   1 
HETATM 4218  C  CB  . MSE B 1 206 ? 37.535  6.123   61.233  1.00 45.74 ? 206  MSE B CB  1 
HETATM 4219  C  CG  . MSE B 1 206 ? 37.562  7.475   60.511  1.00 46.65 ? 206  MSE B CG  1 
HETATM 4220  SE SE  . MSE B 1 206 ? 39.316  8.291   60.360  1.00 46.96 ? 206  MSE B SE  1 
HETATM 4221  C  CE  . MSE B 1 206 ? 39.393  9.238   62.031  1.00 43.53 ? 206  MSE B CE  1 
ATOM   4222  N  N   . SER B 1 207 ? 36.792  8.305   63.596  1.00 45.09 ? 207  SER B N   1 
ATOM   4223  C  CA  . SER B 1 207 ? 35.803  9.231   64.137  1.00 45.90 ? 207  SER B CA  1 
ATOM   4224  C  C   . SER B 1 207 ? 36.315  10.658  63.994  1.00 46.64 ? 207  SER B C   1 
ATOM   4225  O  O   . SER B 1 207 ? 37.513  10.878  63.814  1.00 45.86 ? 207  SER B O   1 
ATOM   4226  C  CB  . SER B 1 207 ? 35.523  8.921   65.611  1.00 44.86 ? 207  SER B CB  1 
ATOM   4227  O  OG  . SER B 1 207 ? 36.704  8.982   66.392  1.00 43.63 ? 207  SER B OG  1 
HETATM 4228  N  N   . MSE B 1 208 ? 35.405  11.625  64.071  1.00 49.02 ? 208  MSE B N   1 
HETATM 4229  C  CA  . MSE B 1 208 ? 35.776  13.033  63.956  1.00 52.20 ? 208  MSE B CA  1 
HETATM 4230  C  C   . MSE B 1 208 ? 36.576  13.453  65.189  1.00 52.01 ? 208  MSE B C   1 
HETATM 4231  O  O   . MSE B 1 208 ? 37.246  14.487  65.188  1.00 53.46 ? 208  MSE B O   1 
HETATM 4232  C  CB  . MSE B 1 208 ? 34.526  13.902  63.797  1.00 55.01 ? 208  MSE B CB  1 
HETATM 4233  C  CG  . MSE B 1 208 ? 34.763  15.219  63.062  1.00 59.01 ? 208  MSE B CG  1 
HETATM 4234  SE SE  . MSE B 1 208 ? 35.512  14.982  61.283  1.00 64.37 ? 208  MSE B SE  1 
HETATM 4235  C  CE  . MSE B 1 208 ? 34.086  13.964  60.472  1.00 62.56 ? 208  MSE B CE  1 
ATOM   4236  N  N   . GLN B 1 209 ? 36.493  12.635  66.235  1.00 52.06 ? 209  GLN B N   1 
ATOM   4237  C  CA  . GLN B 1 209 ? 37.211  12.870  67.482  1.00 52.51 ? 209  GLN B CA  1 
ATOM   4238  C  C   . GLN B 1 209 ? 38.669  12.457  67.299  1.00 52.60 ? 209  GLN B C   1 
ATOM   4239  O  O   . GLN B 1 209 ? 39.584  13.156  67.735  1.00 53.18 ? 209  GLN B O   1 
ATOM   4240  C  CB  . GLN B 1 209 ? 36.589  12.045  68.611  1.00 52.37 ? 209  GLN B CB  1 
ATOM   4241  C  CG  . GLN B 1 209 ? 37.327  12.158  69.937  1.00 52.09 ? 209  GLN B CG  1 
ATOM   4242  C  CD  . GLN B 1 209 ? 36.951  11.063  70.914  1.00 51.87 ? 209  GLN B CD  1 
ATOM   4243  O  OE1 . GLN B 1 209 ? 36.429  10.020  70.524  1.00 50.68 ? 209  GLN B OE1 1 
ATOM   4244  N  NE2 . GLN B 1 209 ? 37.233  11.289  72.193  1.00 51.95 ? 209  GLN B NE2 1 
ATOM   4245  N  N   . ALA B 1 210 ? 38.869  11.307  66.658  1.00 53.20 ? 210  ALA B N   1 
ATOM   4246  C  CA  . ALA B 1 210 ? 40.202  10.776  66.398  1.00 52.78 ? 210  ALA B CA  1 
ATOM   4247  C  C   . ALA B 1 210 ? 40.998  11.734  65.519  1.00 52.98 ? 210  ALA B C   1 
ATOM   4248  O  O   . ALA B 1 210 ? 42.219  11.824  65.638  1.00 53.97 ? 210  ALA B O   1 
ATOM   4249  C  CB  . ALA B 1 210 ? 40.103  9.408   65.736  1.00 52.29 ? 210  ALA B CB  1 
ATOM   4250  N  N   . ILE B 1 211 ? 40.294  12.446  64.640  1.00 53.53 ? 211  ILE B N   1 
ATOM   4251  C  CA  . ILE B 1 211 ? 40.917  13.415  63.743  1.00 53.33 ? 211  ILE B CA  1 
ATOM   4252  C  C   . ILE B 1 211 ? 41.438  14.604  64.548  1.00 54.17 ? 211  ILE B C   1 
ATOM   4253  O  O   . ILE B 1 211 ? 42.571  15.046  64.353  1.00 54.50 ? 211  ILE B O   1 
ATOM   4254  C  CB  . ILE B 1 211 ? 39.917  13.911  62.666  1.00 51.30 ? 211  ILE B CB  1 
ATOM   4255  C  CG1 . ILE B 1 211 ? 39.466  12.737  61.792  1.00 50.51 ? 211  ILE B CG1 1 
ATOM   4256  C  CG2 . ILE B 1 211 ? 40.556  14.989  61.800  1.00 50.96 ? 211  ILE B CG2 1 
ATOM   4257  C  CD1 . ILE B 1 211 ? 38.496  13.113  60.690  1.00 49.93 ? 211  ILE B CD1 1 
ATOM   4258  N  N   . ARG B 1 212 ? 40.612  15.101  65.467  1.00 55.97 ? 212  ARG B N   1 
ATOM   4259  C  CA  . ARG B 1 212 ? 40.982  16.228  66.318  1.00 58.57 ? 212  ARG B CA  1 
ATOM   4260  C  C   . ARG B 1 212 ? 42.141  15.851  67.241  1.00 58.59 ? 212  ARG B C   1 
ATOM   4261  O  O   . ARG B 1 212 ? 43.046  16.654  67.473  1.00 58.37 ? 212  ARG B O   1 
ATOM   4262  C  CB  . ARG B 1 212 ? 39.774  16.696  67.136  1.00 60.98 ? 212  ARG B CB  1 
ATOM   4263  C  CG  . ARG B 1 212 ? 40.089  17.779  68.159  1.00 64.95 ? 212  ARG B CG  1 
ATOM   4264  C  CD  . ARG B 1 212 ? 38.824  18.306  68.823  1.00 69.18 ? 212  ARG B CD  1 
ATOM   4265  N  NE  . ARG B 1 212 ? 38.028  19.136  67.920  1.00 71.91 ? 212  ARG B NE  1 
ATOM   4266  C  CZ  . ARG B 1 212 ? 38.260  20.426  67.686  1.00 73.76 ? 212  ARG B CZ  1 
ATOM   4267  N  NH1 . ARG B 1 212 ? 39.269  21.044  68.287  1.00 74.58 ? 212  ARG B NH1 1 
ATOM   4268  N  NH2 . ARG B 1 212 ? 37.479  21.101  66.852  1.00 74.44 ? 212  ARG B NH2 1 
ATOM   4269  N  N   . HIS B 1 213 ? 42.107  14.624  67.756  1.00 58.90 ? 213  HIS B N   1 
ATOM   4270  C  CA  . HIS B 1 213 ? 43.156  14.120  68.638  1.00 59.03 ? 213  HIS B CA  1 
ATOM   4271  C  C   . HIS B 1 213 ? 44.452  13.944  67.848  1.00 59.19 ? 213  HIS B C   1 
ATOM   4272  O  O   . HIS B 1 213 ? 45.537  14.244  68.347  1.00 59.68 ? 213  HIS B O   1 
ATOM   4273  C  CB  . HIS B 1 213 ? 42.735  12.783  69.260  1.00 59.20 ? 213  HIS B CB  1 
ATOM   4274  C  CG  . HIS B 1 213 ? 43.783  12.163  70.133  1.00 59.09 ? 213  HIS B CG  1 
ATOM   4275  N  ND1 . HIS B 1 213 ? 44.281  12.785  71.257  1.00 59.94 ? 213  HIS B ND1 1 
ATOM   4276  C  CD2 . HIS B 1 213 ? 44.430  10.976  70.043  1.00 58.85 ? 213  HIS B CD2 1 
ATOM   4277  C  CE1 . HIS B 1 213 ? 45.189  12.009  71.822  1.00 58.60 ? 213  HIS B CE1 1 
ATOM   4278  N  NE2 . HIS B 1 213 ? 45.298  10.905  71.105  1.00 57.81 ? 213  HIS B NE2 1 
ATOM   4279  N  N   . TRP B 1 214 ? 44.321  13.460  66.614  1.00 58.75 ? 214  TRP B N   1 
ATOM   4280  C  CA  . TRP B 1 214 ? 45.460  13.243  65.726  1.00 58.56 ? 214  TRP B CA  1 
ATOM   4281  C  C   . TRP B 1 214 ? 46.164  14.572  65.465  1.00 58.60 ? 214  TRP B C   1 
ATOM   4282  O  O   . TRP B 1 214 ? 47.394  14.643  65.465  1.00 58.54 ? 214  TRP B O   1 
ATOM   4283  C  CB  . TRP B 1 214 ? 44.980  12.637  64.401  1.00 58.68 ? 214  TRP B CB  1 
ATOM   4284  C  CG  . TRP B 1 214 ? 46.077  12.223  63.457  1.00 59.02 ? 214  TRP B CG  1 
ATOM   4285  C  CD1 . TRP B 1 214 ? 46.564  10.960  63.271  1.00 59.33 ? 214  TRP B CD1 1 
ATOM   4286  C  CD2 . TRP B 1 214 ? 46.808  13.070  62.557  1.00 58.56 ? 214  TRP B CD2 1 
ATOM   4287  N  NE1 . TRP B 1 214 ? 47.550  10.967  62.313  1.00 58.64 ? 214  TRP B NE1 1 
ATOM   4288  C  CE2 . TRP B 1 214 ? 47.720  12.248  61.859  1.00 59.03 ? 214  TRP B CE2 1 
ATOM   4289  C  CE3 . TRP B 1 214 ? 46.781  14.443  62.275  1.00 58.17 ? 214  TRP B CE3 1 
ATOM   4290  C  CZ2 . TRP B 1 214 ? 48.599  12.755  60.895  1.00 59.79 ? 214  TRP B CZ2 1 
ATOM   4291  C  CZ3 . TRP B 1 214 ? 47.655  14.946  61.317  1.00 58.97 ? 214  TRP B CZ3 1 
ATOM   4292  C  CH2 . TRP B 1 214 ? 48.552  14.102  60.639  1.00 60.09 ? 214  TRP B CH2 1 
ATOM   4293  N  N   . GLY B 1 215 ? 45.369  15.620  65.248  1.00 58.44 ? 215  GLY B N   1 
ATOM   4294  C  CA  . GLY B 1 215 ? 45.911  16.943  64.988  1.00 59.36 ? 215  GLY B CA  1 
ATOM   4295  C  C   . GLY B 1 215 ? 46.692  17.521  66.154  1.00 59.93 ? 215  GLY B C   1 
ATOM   4296  O  O   . GLY B 1 215 ? 47.605  18.326  65.961  1.00 60.69 ? 215  GLY B O   1 
ATOM   4297  N  N   . GLU B 1 216 ? 46.324  17.113  67.367  1.00 59.38 ? 216  GLU B N   1 
ATOM   4298  C  CA  . GLU B 1 216 ? 46.990  17.576  68.581  1.00 57.54 ? 216  GLU B CA  1 
ATOM   4299  C  C   . GLU B 1 216 ? 48.240  16.748  68.869  1.00 55.98 ? 216  GLU B C   1 
ATOM   4300  O  O   . GLU B 1 216 ? 49.162  17.215  69.540  1.00 56.48 ? 216  GLU B O   1 
ATOM   4301  C  CB  . GLU B 1 216 ? 46.025  17.505  69.765  1.00 57.81 ? 216  GLU B CB  1 
ATOM   4302  C  CG  . GLU B 1 216 ? 44.798  18.391  69.603  1.00 58.94 ? 216  GLU B CG  1 
ATOM   4303  C  CD  . GLU B 1 216 ? 43.753  18.154  70.674  1.00 59.10 ? 216  GLU B CD  1 
ATOM   4304  O  OE1 . GLU B 1 216 ? 43.231  17.021  70.754  1.00 60.48 ? 216  GLU B OE1 1 
ATOM   4305  O  OE2 . GLU B 1 216 ? 43.447  19.102  71.427  1.00 58.58 ? 216  GLU B OE2 1 
ATOM   4306  N  N   . THR B 1 217 ? 48.263  15.522  68.352  1.00 54.91 ? 217  THR B N   1 
ATOM   4307  C  CA  . THR B 1 217 ? 49.392  14.613  68.537  1.00 53.68 ? 217  THR B CA  1 
ATOM   4308  C  C   . THR B 1 217 ? 50.530  14.943  67.569  1.00 52.09 ? 217  THR B C   1 
ATOM   4309  O  O   . THR B 1 217 ? 51.706  14.789  67.905  1.00 52.83 ? 217  THR B O   1 
ATOM   4310  C  CB  . THR B 1 217 ? 48.964  13.136  68.323  1.00 53.30 ? 217  THR B CB  1 
ATOM   4311  O  OG1 . THR B 1 217 ? 47.874  12.818  69.196  1.00 52.96 ? 217  THR B OG1 1 
ATOM   4312  C  CG2 . THR B 1 217 ? 50.121  12.189  68.617  1.00 53.42 ? 217  THR B CG2 1 
ATOM   4313  N  N   . HIS B 1 218 ? 50.172  15.405  66.374  1.00 50.79 ? 218  HIS B N   1 
ATOM   4314  C  CA  . HIS B 1 218 ? 51.156  15.746  65.351  1.00 49.35 ? 218  HIS B CA  1 
ATOM   4315  C  C   . HIS B 1 218 ? 51.404  17.247  65.216  1.00 48.71 ? 218  HIS B C   1 
ATOM   4316  O  O   . HIS B 1 218 ? 50.608  18.065  65.680  1.00 49.07 ? 218  HIS B O   1 
ATOM   4317  C  CB  . HIS B 1 218 ? 50.741  15.144  64.008  1.00 48.86 ? 218  HIS B CB  1 
ATOM   4318  C  CG  . HIS B 1 218 ? 50.642  13.650  64.026  1.00 49.16 ? 218  HIS B CG  1 
ATOM   4319  N  ND1 . HIS B 1 218 ? 49.829  12.970  64.907  1.00 48.89 ? 218  HIS B ND1 1 
ATOM   4320  C  CD2 . HIS B 1 218 ? 51.263  12.705  63.281  1.00 49.31 ? 218  HIS B CD2 1 
ATOM   4321  C  CE1 . HIS B 1 218 ? 49.954  11.670  64.705  1.00 49.33 ? 218  HIS B CE1 1 
ATOM   4322  N  NE2 . HIS B 1 218 ? 50.818  11.483  63.724  1.00 49.76 ? 218  HIS B NE2 1 
ATOM   4323  N  N   . SER B 1 219 ? 52.516  17.596  64.573  1.00 47.96 ? 219  SER B N   1 
ATOM   4324  C  CA  . SER B 1 219 ? 52.910  18.989  64.374  1.00 46.46 ? 219  SER B CA  1 
ATOM   4325  C  C   . SER B 1 219 ? 52.101  19.720  63.306  1.00 45.50 ? 219  SER B C   1 
ATOM   4326  O  O   . SER B 1 219 ? 51.362  19.104  62.539  1.00 46.53 ? 219  SER B O   1 
ATOM   4327  C  CB  . SER B 1 219 ? 54.400  19.070  64.029  1.00 45.56 ? 219  SER B CB  1 
ATOM   4328  O  OG  . SER B 1 219 ? 54.671  18.435  62.790  1.00 46.26 ? 219  SER B OG  1 
ATOM   4329  N  N   . GLU B 1 220 ? 52.279  21.038  63.256  1.00 44.37 ? 220  GLU B N   1 
ATOM   4330  C  CA  . GLU B 1 220 ? 51.597  21.909  62.302  1.00 43.24 ? 220  GLU B CA  1 
ATOM   4331  C  C   . GLU B 1 220 ? 51.847  21.495  60.852  1.00 42.10 ? 220  GLU B C   1 
ATOM   4332  O  O   . GLU B 1 220 ? 50.927  21.492  60.035  1.00 41.83 ? 220  GLU B O   1 
ATOM   4333  C  CB  . GLU B 1 220 ? 52.048  23.359  62.518  1.00 44.91 ? 220  GLU B CB  1 
ATOM   4334  C  CG  . GLU B 1 220 ? 51.456  24.381  61.550  1.00 46.31 ? 220  GLU B CG  1 
ATOM   4335  C  CD  . GLU B 1 220 ? 49.944  24.479  61.631  1.00 47.39 ? 220  GLU B CD  1 
ATOM   4336  O  OE1 . GLU B 1 220 ? 49.385  24.372  62.744  1.00 48.31 ? 220  GLU B OE1 1 
ATOM   4337  O  OE2 . GLU B 1 220 ? 49.313  24.671  60.572  1.00 49.94 ? 220  GLU B OE2 1 
ATOM   4338  N  N   . ALA B 1 221 ? 53.095  21.144  60.546  1.00 41.11 ? 221  ALA B N   1 
ATOM   4339  C  CA  . ALA B 1 221 ? 53.484  20.724  59.202  1.00 39.99 ? 221  ALA B CA  1 
ATOM   4340  C  C   . ALA B 1 221 ? 52.824  19.406  58.806  1.00 39.46 ? 221  ALA B C   1 
ATOM   4341  O  O   . ALA B 1 221 ? 52.505  19.189  57.636  1.00 37.70 ? 221  ALA B O   1 
ATOM   4342  C  CB  . ALA B 1 221 ? 54.997  20.599  59.112  1.00 39.42 ? 221  ALA B CB  1 
ATOM   4343  N  N   . GLU B 1 222 ? 52.629  18.531  59.788  1.00 40.87 ? 222  GLU B N   1 
ATOM   4344  C  CA  . GLU B 1 222 ? 52.006  17.232  59.559  1.00 42.59 ? 222  GLU B CA  1 
ATOM   4345  C  C   . GLU B 1 222 ? 50.488  17.352  59.445  1.00 41.62 ? 222  GLU B C   1 
ATOM   4346  O  O   . GLU B 1 222 ? 49.852  16.593  58.710  1.00 41.55 ? 222  GLU B O   1 
ATOM   4347  C  CB  . GLU B 1 222 ? 52.381  16.259  60.678  1.00 46.24 ? 222  GLU B CB  1 
ATOM   4348  C  CG  . GLU B 1 222 ? 53.874  15.972  60.767  1.00 51.17 ? 222  GLU B CG  1 
ATOM   4349  C  CD  . GLU B 1 222 ? 54.217  14.963  61.846  1.00 54.45 ? 222  GLU B CD  1 
ATOM   4350  O  OE1 . GLU B 1 222 ? 54.392  15.375  63.012  1.00 56.74 ? 222  GLU B OE1 1 
ATOM   4351  O  OE2 . GLU B 1 222 ? 54.317  13.759  61.527  1.00 56.43 ? 222  GLU B OE2 1 
ATOM   4352  N  N   . VAL B 1 223 ? 49.916  18.305  60.179  1.00 39.88 ? 223  VAL B N   1 
ATOM   4353  C  CA  . VAL B 1 223 ? 48.474  18.542  60.157  1.00 38.04 ? 223  VAL B CA  1 
ATOM   4354  C  C   . VAL B 1 223 ? 48.086  19.198  58.834  1.00 36.36 ? 223  VAL B C   1 
ATOM   4355  O  O   . VAL B 1 223 ? 47.159  18.749  58.160  1.00 35.70 ? 223  VAL B O   1 
ATOM   4356  C  CB  . VAL B 1 223 ? 48.028  19.449  61.331  1.00 37.29 ? 223  VAL B CB  1 
ATOM   4357  C  CG1 . VAL B 1 223 ? 46.531  19.718  61.260  1.00 37.26 ? 223  VAL B CG1 1 
ATOM   4358  C  CG2 . VAL B 1 223 ? 48.372  18.796  62.656  1.00 37.61 ? 223  VAL B CG2 1 
ATOM   4359  N  N   . ARG B 1 224 ? 48.824  20.243  58.463  1.00 35.28 ? 224  ARG B N   1 
ATOM   4360  C  CA  . ARG B 1 224 ? 48.587  20.975  57.222  1.00 33.66 ? 224  ARG B CA  1 
ATOM   4361  C  C   . ARG B 1 224 ? 48.656  20.047  56.015  1.00 34.45 ? 224  ARG B C   1 
ATOM   4362  O  O   . ARG B 1 224 ? 47.792  20.097  55.141  1.00 35.95 ? 224  ARG B O   1 
ATOM   4363  C  CB  . ARG B 1 224 ? 49.609  22.107  57.072  1.00 33.26 ? 224  ARG B CB  1 
ATOM   4364  C  CG  . ARG B 1 224 ? 49.476  22.908  55.786  1.00 30.93 ? 224  ARG B CG  1 
ATOM   4365  C  CD  . ARG B 1 224 ? 50.485  24.040  55.730  1.00 29.42 ? 224  ARG B CD  1 
ATOM   4366  N  NE  . ARG B 1 224 ? 50.461  24.728  54.442  1.00 30.07 ? 224  ARG B NE  1 
ATOM   4367  C  CZ  . ARG B 1 224 ? 51.186  25.804  54.150  1.00 32.02 ? 224  ARG B CZ  1 
ATOM   4368  N  NH1 . ARG B 1 224 ? 51.999  26.331  55.055  1.00 31.75 ? 224  ARG B NH1 1 
ATOM   4369  N  NH2 . ARG B 1 224 ? 51.105  26.349  52.944  1.00 33.79 ? 224  ARG B NH2 1 
ATOM   4370  N  N   . GLU B 1 225 ? 49.673  19.189  55.989  1.00 34.92 ? 225  GLU B N   1 
ATOM   4371  C  CA  . GLU B 1 225 ? 49.869  18.234  54.901  1.00 35.84 ? 225  GLU B CA  1 
ATOM   4372  C  C   . GLU B 1 225 ? 48.652  17.322  54.750  1.00 35.10 ? 225  GLU B C   1 
ATOM   4373  O  O   . GLU B 1 225 ? 48.196  17.065  53.635  1.00 34.83 ? 225  GLU B O   1 
ATOM   4374  C  CB  . GLU B 1 225 ? 51.138  17.406  55.156  1.00 38.12 ? 225  GLU B CB  1 
ATOM   4375  C  CG  . GLU B 1 225 ? 51.498  16.384  54.070  1.00 40.40 ? 225  GLU B CG  1 
ATOM   4376  C  CD  . GLU B 1 225 ? 50.725  15.075  54.186  1.00 41.60 ? 225  GLU B CD  1 
ATOM   4377  O  OE1 . GLU B 1 225 ? 50.552  14.571  55.318  1.00 42.51 ? 225  GLU B OE1 1 
ATOM   4378  O  OE2 . GLU B 1 225 ? 50.292  14.548  53.140  1.00 43.57 ? 225  GLU B OE2 1 
ATOM   4379  N  N   . LEU B 1 226 ? 48.130  16.846  55.878  1.00 34.20 ? 226  LEU B N   1 
ATOM   4380  C  CA  . LEU B 1 226 ? 46.966  15.966  55.880  1.00 33.85 ? 226  LEU B CA  1 
ATOM   4381  C  C   . LEU B 1 226 ? 45.714  16.686  55.393  1.00 33.16 ? 226  LEU B C   1 
ATOM   4382  O  O   . LEU B 1 226 ? 44.971  16.161  54.564  1.00 33.41 ? 226  LEU B O   1 
ATOM   4383  C  CB  . LEU B 1 226 ? 46.718  15.410  57.286  1.00 34.43 ? 226  LEU B CB  1 
ATOM   4384  C  CG  . LEU B 1 226 ? 45.502  14.490  57.436  1.00 32.59 ? 226  LEU B CG  1 
ATOM   4385  C  CD1 . LEU B 1 226 ? 45.747  13.180  56.702  1.00 32.64 ? 226  LEU B CD1 1 
ATOM   4386  C  CD2 . LEU B 1 226 ? 45.217  14.237  58.903  1.00 32.05 ? 226  LEU B CD2 1 
ATOM   4387  N  N   . LEU B 1 227 ? 45.485  17.888  55.915  1.00 32.27 ? 227  LEU B N   1 
ATOM   4388  C  CA  . LEU B 1 227 ? 44.318  18.678  55.541  1.00 30.31 ? 227  LEU B CA  1 
ATOM   4389  C  C   . LEU B 1 227 ? 44.339  19.095  54.073  1.00 29.63 ? 227  LEU B C   1 
ATOM   4390  O  O   . LEU B 1 227 ? 43.289  19.339  53.480  1.00 30.35 ? 227  LEU B O   1 
ATOM   4391  C  CB  . LEU B 1 227 ? 44.194  19.910  56.443  1.00 28.01 ? 227  LEU B CB  1 
ATOM   4392  C  CG  . LEU B 1 227 ? 44.118  19.652  57.951  1.00 24.82 ? 227  LEU B CG  1 
ATOM   4393  C  CD1 . LEU B 1 227 ? 43.831  20.957  58.674  1.00 23.77 ? 227  LEU B CD1 1 
ATOM   4394  C  CD2 . LEU B 1 227 ? 43.045  18.623  58.269  1.00 22.25 ? 227  LEU B CD2 1 
ATOM   4395  N  N   . GLU B 1 228 ? 45.534  19.159  53.488  1.00 30.64 ? 228  GLU B N   1 
ATOM   4396  C  CA  . GLU B 1 228 ? 45.685  19.535  52.084  1.00 30.99 ? 228  GLU B CA  1 
ATOM   4397  C  C   . GLU B 1 228 ? 45.240  18.425  51.138  1.00 31.24 ? 228  GLU B C   1 
ATOM   4398  O  O   . GLU B 1 228 ? 45.106  18.646  49.933  1.00 32.18 ? 228  GLU B O   1 
ATOM   4399  C  CB  . GLU B 1 228 ? 47.131  19.929  51.778  1.00 30.97 ? 228  GLU B CB  1 
ATOM   4400  C  CG  . GLU B 1 228 ? 47.550  21.260  52.382  1.00 32.12 ? 228  GLU B CG  1 
ATOM   4401  C  CD  . GLU B 1 228 ? 48.963  21.670  52.004  1.00 33.37 ? 228  GLU B CD  1 
ATOM   4402  O  OE1 . GLU B 1 228 ? 49.816  20.782  51.789  1.00 34.38 ? 228  GLU B OE1 1 
ATOM   4403  O  OE2 . GLU B 1 228 ? 49.221  22.890  51.926  1.00 36.19 ? 228  GLU B OE2 1 
ATOM   4404  N  N   . GLN B 1 229 ? 45.016  17.232  51.686  1.00 32.69 ? 229  GLN B N   1 
ATOM   4405  C  CA  . GLN B 1 229 ? 44.567  16.091  50.890  1.00 33.76 ? 229  GLN B CA  1 
ATOM   4406  C  C   . GLN B 1 229 ? 43.126  16.307  50.431  1.00 32.90 ? 229  GLN B C   1 
ATOM   4407  O  O   . GLN B 1 229 ? 42.591  15.538  49.631  1.00 33.02 ? 229  GLN B O   1 
ATOM   4408  C  CB  . GLN B 1 229 ? 44.693  14.791  51.688  1.00 34.70 ? 229  GLN B CB  1 
ATOM   4409  C  CG  . GLN B 1 229 ? 46.119  14.465  52.120  1.00 36.31 ? 229  GLN B CG  1 
ATOM   4410  C  CD  . GLN B 1 229 ? 47.098  14.459  50.959  1.00 36.98 ? 229  GLN B CD  1 
ATOM   4411  O  OE1 . GLN B 1 229 ? 47.003  13.630  50.054  1.00 39.05 ? 229  GLN B OE1 1 
ATOM   4412  N  NE2 . GLN B 1 229 ? 48.044  15.391  50.980  1.00 37.18 ? 229  GLN B NE2 1 
ATOM   4413  N  N   . ASN B 1 230 ? 42.508  17.353  50.970  1.00 32.76 ? 230  ASN B N   1 
ATOM   4414  C  CA  . ASN B 1 230 ? 41.149  17.742  50.626  1.00 32.18 ? 230  ASN B CA  1 
ATOM   4415  C  C   . ASN B 1 230 ? 41.295  19.075  49.895  1.00 32.11 ? 230  ASN B C   1 
ATOM   4416  O  O   . ASN B 1 230 ? 41.401  20.129  50.523  1.00 32.68 ? 230  ASN B O   1 
ATOM   4417  C  CB  . ASN B 1 230 ? 40.307  17.917  51.896  1.00 32.18 ? 230  ASN B CB  1 
ATOM   4418  C  CG  . ASN B 1 230 ? 38.881  18.351  51.601  1.00 32.50 ? 230  ASN B CG  1 
ATOM   4419  O  OD1 . ASN B 1 230 ? 38.305  17.981  50.578  1.00 34.03 ? 230  ASN B OD1 1 
ATOM   4420  N  ND2 . ASN B 1 230 ? 38.307  19.142  52.499  1.00 31.68 ? 230  ASN B ND2 1 
ATOM   4421  N  N   . PRO B 1 231 ? 41.337  19.038  48.552  1.00 32.15 ? 231  PRO B N   1 
ATOM   4422  C  CA  . PRO B 1 231 ? 41.480  20.229  47.709  1.00 31.10 ? 231  PRO B CA  1 
ATOM   4423  C  C   . PRO B 1 231 ? 40.336  21.238  47.802  1.00 29.98 ? 231  PRO B C   1 
ATOM   4424  O  O   . PRO B 1 231 ? 40.476  22.378  47.356  1.00 30.30 ? 231  PRO B O   1 
ATOM   4425  C  CB  . PRO B 1 231 ? 41.595  19.635  46.305  1.00 32.20 ? 231  PRO B CB  1 
ATOM   4426  C  CG  . PRO B 1 231 ? 40.760  18.400  46.395  1.00 32.07 ? 231  PRO B CG  1 
ATOM   4427  C  CD  . PRO B 1 231 ? 41.197  17.828  47.721  1.00 33.12 ? 231  PRO B CD  1 
ATOM   4428  N  N   . SER B 1 232 ? 39.216  20.819  48.385  1.00 27.84 ? 232  SER B N   1 
ATOM   4429  C  CA  . SER B 1 232 ? 38.051  21.687  48.533  1.00 25.82 ? 232  SER B CA  1 
ATOM   4430  C  C   . SER B 1 232 ? 38.229  22.690  49.676  1.00 23.98 ? 232  SER B C   1 
ATOM   4431  O  O   . SER B 1 232 ? 38.819  22.371  50.708  1.00 22.96 ? 232  SER B O   1 
ATOM   4432  C  CB  . SER B 1 232 ? 36.795  20.846  48.757  1.00 25.04 ? 232  SER B CB  1 
ATOM   4433  O  OG  . SER B 1 232 ? 35.633  21.650  48.703  1.00 31.40 ? 232  SER B OG  1 
ATOM   4434  N  N   . PHE B 1 233 ? 37.704  23.898  49.481  1.00 22.60 ? 233  PHE B N   1 
ATOM   4435  C  CA  . PHE B 1 233 ? 37.801  24.965  50.476  1.00 21.96 ? 233  PHE B CA  1 
ATOM   4436  C  C   . PHE B 1 233 ? 36.520  25.804  50.474  1.00 21.62 ? 233  PHE B C   1 
ATOM   4437  O  O   . PHE B 1 233 ? 36.078  26.279  49.426  1.00 20.93 ? 233  PHE B O   1 
ATOM   4438  C  CB  . PHE B 1 233 ? 39.012  25.853  50.164  1.00 20.83 ? 233  PHE B CB  1 
ATOM   4439  C  CG  . PHE B 1 233 ? 39.403  26.776  51.286  1.00 19.80 ? 233  PHE B CG  1 
ATOM   4440  C  CD1 . PHE B 1 233 ? 40.279  26.349  52.278  1.00 20.00 ? 233  PHE B CD1 1 
ATOM   4441  C  CD2 . PHE B 1 233 ? 38.914  28.076  51.340  1.00 18.29 ? 233  PHE B CD2 1 
ATOM   4442  C  CE1 . PHE B 1 233 ? 40.662  27.203  53.307  1.00 19.74 ? 233  PHE B CE1 1 
ATOM   4443  C  CE2 . PHE B 1 233 ? 39.291  28.937  52.365  1.00 18.56 ? 233  PHE B CE2 1 
ATOM   4444  C  CZ  . PHE B 1 233 ? 40.167  28.499  53.350  1.00 19.46 ? 233  PHE B CZ  1 
ATOM   4445  N  N   . VAL B 1 234 ? 35.940  25.991  51.657  1.00 21.87 ? 234  VAL B N   1 
ATOM   4446  C  CA  . VAL B 1 234 ? 34.705  26.758  51.808  1.00 20.39 ? 234  VAL B CA  1 
ATOM   4447  C  C   . VAL B 1 234 ? 34.934  28.211  52.222  1.00 20.66 ? 234  VAL B C   1 
ATOM   4448  O  O   . VAL B 1 234 ? 35.802  28.510  53.042  1.00 19.82 ? 234  VAL B O   1 
ATOM   4449  C  CB  . VAL B 1 234 ? 33.747  26.077  52.824  1.00 19.96 ? 234  VAL B CB  1 
ATOM   4450  C  CG1 . VAL B 1 234 ? 32.518  26.940  53.079  1.00 19.48 ? 234  VAL B CG1 1 
ATOM   4451  C  CG2 . VAL B 1 234 ? 33.325  24.714  52.305  1.00 20.43 ? 234  VAL B CG2 1 
ATOM   4452  N  N   . PHE B 1 235 ? 34.145  29.103  51.627  1.00 22.48 ? 235  PHE B N   1 
ATOM   4453  C  CA  . PHE B 1 235 ? 34.204  30.534  51.907  1.00 22.83 ? 235  PHE B CA  1 
ATOM   4454  C  C   . PHE B 1 235 ? 32.968  30.916  52.714  1.00 22.74 ? 235  PHE B C   1 
ATOM   4455  O  O   . PHE B 1 235 ? 31.872  30.414  52.458  1.00 25.25 ? 235  PHE B O   1 
ATOM   4456  C  CB  . PHE B 1 235 ? 34.264  31.322  50.599  1.00 22.70 ? 235  PHE B CB  1 
ATOM   4457  C  CG  . PHE B 1 235 ? 35.448  30.973  49.746  1.00 22.27 ? 235  PHE B CG  1 
ATOM   4458  C  CD1 . PHE B 1 235 ? 36.740  31.264  50.176  1.00 22.20 ? 235  PHE B CD1 1 
ATOM   4459  C  CD2 . PHE B 1 235 ? 35.279  30.325  48.528  1.00 23.03 ? 235  PHE B CD2 1 
ATOM   4460  C  CE1 . PHE B 1 235 ? 37.845  30.913  49.407  1.00 21.80 ? 235  PHE B CE1 1 
ATOM   4461  C  CE2 . PHE B 1 235 ? 36.378  29.970  47.750  1.00 22.54 ? 235  PHE B CE2 1 
ATOM   4462  C  CZ  . PHE B 1 235 ? 37.663  30.264  48.191  1.00 22.30 ? 235  PHE B CZ  1 
ATOM   4463  N  N   . PHE B 1 236 ? 33.144  31.810  53.683  1.00 23.83 ? 236  PHE B N   1 
ATOM   4464  C  CA  . PHE B 1 236 ? 32.042  32.218  54.551  1.00 23.16 ? 236  PHE B CA  1 
ATOM   4465  C  C   . PHE B 1 236 ? 31.611  33.676  54.420  1.00 23.35 ? 236  PHE B C   1 
ATOM   4466  O  O   . PHE B 1 236 ? 32.295  34.493  53.805  1.00 24.75 ? 236  PHE B O   1 
ATOM   4467  C  CB  . PHE B 1 236 ? 32.403  31.931  56.012  1.00 21.36 ? 236  PHE B CB  1 
ATOM   4468  C  CG  . PHE B 1 236 ? 32.885  30.528  56.257  1.00 20.63 ? 236  PHE B CG  1 
ATOM   4469  C  CD1 . PHE B 1 236 ? 31.981  29.497  56.487  1.00 19.73 ? 236  PHE B CD1 1 
ATOM   4470  C  CD2 . PHE B 1 236 ? 34.246  30.237  56.256  1.00 20.42 ? 236  PHE B CD2 1 
ATOM   4471  C  CE1 . PHE B 1 236 ? 32.424  28.196  56.711  1.00 19.93 ? 236  PHE B CE1 1 
ATOM   4472  C  CE2 . PHE B 1 236 ? 34.700  28.939  56.478  1.00 21.73 ? 236  PHE B CE2 1 
ATOM   4473  C  CZ  . PHE B 1 236 ? 33.787  27.916  56.707  1.00 20.20 ? 236  PHE B CZ  1 
ATOM   4474  N  N   . LYS B 1 237 ? 30.457  33.980  55.004  1.00 24.10 ? 237  LYS B N   1 
ATOM   4475  C  CA  . LYS B 1 237 ? 29.902  35.327  55.006  1.00 23.97 ? 237  LYS B CA  1 
ATOM   4476  C  C   . LYS B 1 237 ? 29.351  35.618  56.395  1.00 24.90 ? 237  LYS B C   1 
ATOM   4477  O  O   . LYS B 1 237 ? 28.380  34.996  56.829  1.00 26.84 ? 237  LYS B O   1 
ATOM   4478  C  CB  . LYS B 1 237 ? 28.783  35.470  53.971  1.00 24.14 ? 237  LYS B CB  1 
ATOM   4479  C  CG  . LYS B 1 237 ? 28.177  36.867  53.929  1.00 22.62 ? 237  LYS B CG  1 
ATOM   4480  C  CD  . LYS B 1 237 ? 27.075  36.983  52.894  1.00 24.51 ? 237  LYS B CD  1 
ATOM   4481  C  CE  . LYS B 1 237 ? 26.505  38.390  52.867  1.00 25.60 ? 237  LYS B CE  1 
ATOM   4482  N  NZ  . LYS B 1 237 ? 25.413  38.531  51.867  1.00 29.23 ? 237  LYS B NZ  1 
ATOM   4483  N  N   . PRO B 1 238 ? 29.984  36.553  57.120  1.00 25.72 ? 238  PRO B N   1 
ATOM   4484  C  CA  . PRO B 1 238 ? 29.569  36.941  58.472  1.00 25.63 ? 238  PRO B CA  1 
ATOM   4485  C  C   . PRO B 1 238 ? 28.160  37.527  58.525  1.00 25.77 ? 238  PRO B C   1 
ATOM   4486  O  O   . PRO B 1 238 ? 27.831  38.450  57.780  1.00 29.65 ? 238  PRO B O   1 
ATOM   4487  C  CB  . PRO B 1 238 ? 30.636  37.962  58.879  1.00 25.63 ? 238  PRO B CB  1 
ATOM   4488  C  CG  . PRO B 1 238 ? 31.121  38.508  57.579  1.00 26.35 ? 238  PRO B CG  1 
ATOM   4489  C  CD  . PRO B 1 238 ? 31.188  37.294  56.709  1.00 26.15 ? 238  PRO B CD  1 
ATOM   4490  N  N   . GLN B 1 239 ? 27.323  36.950  59.384  1.00 25.48 ? 239  GLN B N   1 
ATOM   4491  C  CA  . GLN B 1 239 ? 25.945  37.400  59.549  1.00 24.74 ? 239  GLN B CA  1 
ATOM   4492  C  C   . GLN B 1 239 ? 25.787  38.291  60.774  1.00 25.90 ? 239  GLN B C   1 
ATOM   4493  O  O   . GLN B 1 239 ? 24.700  38.802  61.046  1.00 27.31 ? 239  GLN B O   1 
ATOM   4494  C  CB  . GLN B 1 239 ? 24.990  36.207  59.636  1.00 22.48 ? 239  GLN B CB  1 
ATOM   4495  C  CG  . GLN B 1 239 ? 24.930  35.352  58.378  1.00 19.38 ? 239  GLN B CG  1 
ATOM   4496  C  CD  . GLN B 1 239 ? 24.555  36.142  57.134  1.00 19.54 ? 239  GLN B CD  1 
ATOM   4497  O  OE1 . GLN B 1 239 ? 23.670  36.996  57.165  1.00 20.40 ? 239  GLN B OE1 1 
ATOM   4498  N  NE2 . GLN B 1 239 ? 25.230  35.855  56.028  1.00 17.87 ? 239  GLN B NE2 1 
ATOM   4499  N  N   . SER B 1 240 ? 26.878  38.451  61.518  1.00 27.58 ? 240  SER B N   1 
ATOM   4500  C  CA  . SER B 1 240 ? 26.900  39.292  62.707  1.00 29.19 ? 240  SER B CA  1 
ATOM   4501  C  C   . SER B 1 240 ? 25.858  38.911  63.758  1.00 29.72 ? 240  SER B C   1 
ATOM   4502  O  O   . SER B 1 240 ? 24.827  39.572  63.895  1.00 33.87 ? 240  SER B O   1 
ATOM   4503  C  CB  . SER B 1 240 ? 26.749  40.760  62.305  1.00 29.06 ? 240  SER B CB  1 
ATOM   4504  O  OG  . SER B 1 240 ? 26.895  41.610  63.426  1.00 33.85 ? 240  SER B OG  1 
ATOM   4505  N  N   . PHE B 1 241 ? 26.136  37.831  64.480  1.00 28.73 ? 241  PHE B N   1 
ATOM   4506  C  CA  . PHE B 1 241 ? 25.259  37.317  65.531  1.00 29.06 ? 241  PHE B CA  1 
ATOM   4507  C  C   . PHE B 1 241 ? 23.846  37.009  65.053  1.00 29.09 ? 241  PHE B C   1 
ATOM   4508  O  O   . PHE B 1 241 ? 22.867  37.592  65.527  1.00 27.55 ? 241  PHE B O   1 
ATOM   4509  C  CB  . PHE B 1 241 ? 25.222  38.257  66.741  1.00 27.41 ? 241  PHE B CB  1 
ATOM   4510  C  CG  . PHE B 1 241 ? 24.673  37.614  67.988  1.00 27.26 ? 241  PHE B CG  1 
ATOM   4511  C  CD1 . PHE B 1 241 ? 25.224  36.435  68.476  1.00 27.81 ? 241  PHE B CD1 1 
ATOM   4512  C  CD2 . PHE B 1 241 ? 23.609  38.188  68.676  1.00 29.45 ? 241  PHE B CD2 1 
ATOM   4513  C  CE1 . PHE B 1 241 ? 24.726  35.836  69.630  1.00 28.38 ? 241  PHE B CE1 1 
ATOM   4514  C  CE2 . PHE B 1 241 ? 23.104  37.597  69.833  1.00 28.49 ? 241  PHE B CE2 1 
ATOM   4515  C  CZ  . PHE B 1 241 ? 23.665  36.418  70.310  1.00 30.13 ? 241  PHE B CZ  1 
ATOM   4516  N  N   . ALA B 1 242 ? 23.757  36.082  64.108  1.00 29.73 ? 242  ALA B N   1 
ATOM   4517  C  CA  . ALA B 1 242 ? 22.483  35.659  63.552  1.00 28.39 ? 242  ALA B CA  1 
ATOM   4518  C  C   . ALA B 1 242 ? 22.288  34.184  63.886  1.00 28.78 ? 242  ALA B C   1 
ATOM   4519  O  O   . ALA B 1 242 ? 23.259  33.466  64.134  1.00 30.34 ? 242  ALA B O   1 
ATOM   4520  C  CB  . ALA B 1 242 ? 22.487  35.859  62.045  1.00 27.04 ? 242  ALA B CB  1 
ATOM   4521  N  N   . PRO B 1 243 ? 21.029  33.718  63.940  1.00 28.38 ? 243  PRO B N   1 
ATOM   4522  C  CA  . PRO B 1 243 ? 20.783  32.307  64.250  1.00 27.48 ? 243  PRO B CA  1 
ATOM   4523  C  C   . PRO B 1 243 ? 21.335  31.400  63.149  1.00 26.89 ? 243  PRO B C   1 
ATOM   4524  O  O   . PRO B 1 243 ? 21.453  31.817  61.995  1.00 28.20 ? 243  PRO B O   1 
ATOM   4525  C  CB  . PRO B 1 243 ? 19.257  32.241  64.335  1.00 26.37 ? 243  PRO B CB  1 
ATOM   4526  C  CG  . PRO B 1 243 ? 18.815  33.328  63.400  1.00 28.06 ? 243  PRO B CG  1 
ATOM   4527  C  CD  . PRO B 1 243 ? 19.760  34.441  63.749  1.00 27.94 ? 243  PRO B CD  1 
ATOM   4528  N  N   . VAL B 1 244 ? 21.702  30.175  63.517  1.00 25.18 ? 244  VAL B N   1 
ATOM   4529  C  CA  . VAL B 1 244 ? 22.247  29.218  62.559  1.00 23.00 ? 244  VAL B CA  1 
ATOM   4530  C  C   . VAL B 1 244 ? 21.213  28.852  61.504  1.00 21.95 ? 244  VAL B C   1 
ATOM   4531  O  O   . VAL B 1 244 ? 20.210  28.210  61.805  1.00 23.95 ? 244  VAL B O   1 
ATOM   4532  C  CB  . VAL B 1 244 ? 22.720  27.926  63.254  1.00 23.30 ? 244  VAL B CB  1 
ATOM   4533  C  CG1 . VAL B 1 244 ? 23.349  26.980  62.237  1.00 22.91 ? 244  VAL B CG1 1 
ATOM   4534  C  CG2 . VAL B 1 244 ? 23.705  28.254  64.359  1.00 22.30 ? 244  VAL B CG2 1 
ATOM   4535  N  N   . LYS B 1 245 ? 21.460  29.273  60.268  1.00 20.44 ? 245  LYS B N   1 
ATOM   4536  C  CA  . LYS B 1 245 ? 20.553  28.987  59.165  1.00 19.46 ? 245  LYS B CA  1 
ATOM   4537  C  C   . LYS B 1 245 ? 21.205  28.064  58.147  1.00 20.76 ? 245  LYS B C   1 
ATOM   4538  O  O   . LYS B 1 245 ? 22.421  28.101  57.951  1.00 22.54 ? 245  LYS B O   1 
ATOM   4539  C  CB  . LYS B 1 245 ? 20.111  30.285  58.485  1.00 17.92 ? 245  LYS B CB  1 
ATOM   4540  C  CG  . LYS B 1 245 ? 19.299  31.205  59.376  1.00 17.36 ? 245  LYS B CG  1 
ATOM   4541  C  CD  . LYS B 1 245 ? 18.849  32.447  58.629  1.00 18.33 ? 245  LYS B CD  1 
ATOM   4542  C  CE  . LYS B 1 245 ? 18.043  33.362  59.534  1.00 21.46 ? 245  LYS B CE  1 
ATOM   4543  N  NZ  . LYS B 1 245 ? 17.569  34.576  58.817  1.00 25.49 ? 245  LYS B NZ  1 
ATOM   4544  N  N   . GLY B 1 246 ? 20.390  27.223  57.520  1.00 20.79 ? 246  GLY B N   1 
ATOM   4545  C  CA  . GLY B 1 246 ? 20.894  26.300  56.521  1.00 21.18 ? 246  GLY B CA  1 
ATOM   4546  C  C   . GLY B 1 246 ? 20.549  26.754  55.117  1.00 22.47 ? 246  GLY B C   1 
ATOM   4547  O  O   . GLY B 1 246 ? 20.482  27.955  54.843  1.00 22.16 ? 246  GLY B O   1 
ATOM   4548  N  N   . ALA B 1 247 ? 20.310  25.792  54.231  1.00 22.85 ? 247  ALA B N   1 
ATOM   4549  C  CA  . ALA B 1 247 ? 19.968  26.076  52.840  1.00 23.72 ? 247  ALA B CA  1 
ATOM   4550  C  C   . ALA B 1 247 ? 18.592  26.725  52.690  1.00 25.88 ? 247  ALA B C   1 
ATOM   4551  O  O   . ALA B 1 247 ? 18.387  27.553  51.801  1.00 26.72 ? 247  ALA B O   1 
ATOM   4552  C  CB  . ALA B 1 247 ? 20.039  24.804  52.017  1.00 23.25 ? 247  ALA B CB  1 
ATOM   4553  N  N   . SER B 1 248 ? 17.659  26.346  53.561  1.00 26.43 ? 248  SER B N   1 
ATOM   4554  C  CA  . SER B 1 248 ? 16.298  26.885  53.531  1.00 24.96 ? 248  SER B CA  1 
ATOM   4555  C  C   . SER B 1 248 ? 16.193  28.281  54.136  1.00 23.23 ? 248  SER B C   1 
ATOM   4556  O  O   . SER B 1 248 ? 15.120  28.884  54.123  1.00 23.99 ? 248  SER B O   1 
ATOM   4557  C  CB  . SER B 1 248 ? 15.335  25.942  54.255  1.00 24.75 ? 248  SER B CB  1 
ATOM   4558  O  OG  . SER B 1 248 ? 15.280  24.679  53.617  1.00 26.86 ? 248  SER B OG  1 
ATOM   4559  N  N   . ALA B 1 249 ? 17.308  28.784  54.660  1.00 23.85 ? 249  ALA B N   1 
ATOM   4560  C  CA  . ALA B 1 249 ? 17.371  30.108  55.281  1.00 24.12 ? 249  ALA B CA  1 
ATOM   4561  C  C   . ALA B 1 249 ? 16.467  30.211  56.507  1.00 23.49 ? 249  ALA B C   1 
ATOM   4562  O  O   . ALA B 1 249 ? 15.890  31.265  56.784  1.00 22.92 ? 249  ALA B O   1 
ATOM   4563  C  CB  . ALA B 1 249 ? 17.025  31.198  54.261  1.00 25.90 ? 249  ALA B CB  1 
ATOM   4564  N  N   . VAL B 1 250 ? 16.350  29.103  57.232  1.00 23.88 ? 250  VAL B N   1 
ATOM   4565  C  CA  . VAL B 1 250 ? 15.529  29.036  58.437  1.00 23.72 ? 250  VAL B CA  1 
ATOM   4566  C  C   . VAL B 1 250 ? 16.408  28.609  59.608  1.00 22.66 ? 250  VAL B C   1 
ATOM   4567  O  O   . VAL B 1 250 ? 17.136  27.622  59.512  1.00 24.30 ? 250  VAL B O   1 
ATOM   4568  C  CB  . VAL B 1 250 ? 14.378  28.009  58.278  1.00 22.52 ? 250  VAL B CB  1 
ATOM   4569  C  CG1 . VAL B 1 250 ? 13.542  27.950  59.545  1.00 22.31 ? 250  VAL B CG1 1 
ATOM   4570  C  CG2 . VAL B 1 250 ? 13.505  28.366  57.086  1.00 22.53 ? 250  VAL B CG2 1 
ATOM   4571  N  N   . PRO B 1 251 ? 16.367  29.361  60.723  1.00 22.95 ? 251  PRO B N   1 
ATOM   4572  C  CA  . PRO B 1 251 ? 17.167  29.045  61.912  1.00 23.02 ? 251  PRO B CA  1 
ATOM   4573  C  C   . PRO B 1 251 ? 16.968  27.612  62.406  1.00 22.51 ? 251  PRO B C   1 
ATOM   4574  O  O   . PRO B 1 251 ? 15.864  27.208  62.771  1.00 24.05 ? 251  PRO B O   1 
ATOM   4575  C  CB  . PRO B 1 251 ? 16.700  30.090  62.933  1.00 22.16 ? 251  PRO B CB  1 
ATOM   4576  C  CG  . PRO B 1 251 ? 15.362  30.534  62.421  1.00 23.07 ? 251  PRO B CG  1 
ATOM   4577  C  CD  . PRO B 1 251 ? 15.572  30.578  60.944  1.00 22.50 ? 251  PRO B CD  1 
ATOM   4578  N  N   . LEU B 1 252 ? 18.058  26.851  62.380  1.00 22.32 ? 252  LEU B N   1 
ATOM   4579  C  CA  . LEU B 1 252 ? 18.071  25.453  62.790  1.00 22.36 ? 252  LEU B CA  1 
ATOM   4580  C  C   . LEU B 1 252 ? 18.059  25.258  64.303  1.00 24.35 ? 252  LEU B C   1 
ATOM   4581  O  O   . LEU B 1 252 ? 18.812  25.909  65.030  1.00 24.78 ? 252  LEU B O   1 
ATOM   4582  C  CB  . LEU B 1 252 ? 19.298  24.757  62.196  1.00 20.87 ? 252  LEU B CB  1 
ATOM   4583  C  CG  . LEU B 1 252 ? 19.455  24.807  60.674  1.00 19.40 ? 252  LEU B CG  1 
ATOM   4584  C  CD1 . LEU B 1 252 ? 20.826  24.294  60.272  1.00 17.38 ? 252  LEU B CD1 1 
ATOM   4585  C  CD2 . LEU B 1 252 ? 18.355  23.997  60.007  1.00 19.70 ? 252  LEU B CD2 1 
ATOM   4586  N  N   . VAL B 1 253 ? 17.200  24.350  64.761  1.00 26.60 ? 253  VAL B N   1 
ATOM   4587  C  CA  . VAL B 1 253 ? 17.074  24.029  66.179  1.00 26.87 ? 253  VAL B CA  1 
ATOM   4588  C  C   . VAL B 1 253 ? 17.779  22.701  66.454  1.00 28.20 ? 253  VAL B C   1 
ATOM   4589  O  O   . VAL B 1 253 ? 17.653  21.750  65.678  1.00 29.25 ? 253  VAL B O   1 
ATOM   4590  C  CB  . VAL B 1 253 ? 15.589  23.925  66.608  1.00 26.86 ? 253  VAL B CB  1 
ATOM   4591  C  CG1 . VAL B 1 253 ? 15.484  23.584  68.089  1.00 27.59 ? 253  VAL B CG1 1 
ATOM   4592  C  CG2 . VAL B 1 253 ? 14.869  25.230  66.322  1.00 25.01 ? 253  VAL B CG2 1 
ATOM   4593  N  N   . GLY B 1 254 ? 18.515  22.650  67.561  1.00 28.80 ? 254  GLY B N   1 
ATOM   4594  C  CA  . GLY B 1 254 ? 19.250  21.453  67.934  1.00 28.72 ? 254  GLY B CA  1 
ATOM   4595  C  C   . GLY B 1 254 ? 18.434  20.178  68.010  1.00 29.19 ? 254  GLY B C   1 
ATOM   4596  O  O   . GLY B 1 254 ? 17.507  20.070  68.814  1.00 30.47 ? 254  GLY B O   1 
ATOM   4597  N  N   . ARG B 1 255 ? 18.786  19.219  67.154  1.00 29.66 ? 255  ARG B N   1 
ATOM   4598  C  CA  . ARG B 1 255 ? 18.131  17.913  67.079  1.00 28.24 ? 255  ARG B CA  1 
ATOM   4599  C  C   . ARG B 1 255 ? 16.640  17.948  66.747  1.00 28.73 ? 255  ARG B C   1 
ATOM   4600  O  O   . ARG B 1 255 ? 15.909  16.989  67.012  1.00 27.92 ? 255  ARG B O   1 
ATOM   4601  C  CB  . ARG B 1 255 ? 18.389  17.116  68.360  1.00 29.74 ? 255  ARG B CB  1 
ATOM   4602  C  CG  . ARG B 1 255 ? 19.826  16.632  68.488  1.00 29.76 ? 255  ARG B CG  1 
ATOM   4603  C  CD  . ARG B 1 255 ? 20.088  15.976  69.828  1.00 30.91 ? 255  ARG B CD  1 
ATOM   4604  N  NE  . ARG B 1 255 ? 20.097  16.945  70.920  1.00 32.78 ? 255  ARG B NE  1 
ATOM   4605  C  CZ  . ARG B 1 255 ? 20.313  16.635  72.194  1.00 33.80 ? 255  ARG B CZ  1 
ATOM   4606  N  NH1 . ARG B 1 255 ? 20.537  15.376  72.547  1.00 34.57 ? 255  ARG B NH1 1 
ATOM   4607  N  NH2 . ARG B 1 255 ? 20.315  17.587  73.118  1.00 33.39 ? 255  ARG B NH2 1 
ATOM   4608  N  N   . ALA B 1 256 ? 16.204  19.053  66.149  1.00 28.76 ? 256  ALA B N   1 
ATOM   4609  C  CA  . ALA B 1 256 ? 14.811  19.231  65.749  1.00 27.66 ? 256  ALA B CA  1 
ATOM   4610  C  C   . ALA B 1 256 ? 14.756  19.528  64.253  1.00 27.95 ? 256  ALA B C   1 
ATOM   4611  O  O   . ALA B 1 256 ? 13.695  19.827  63.703  1.00 29.14 ? 256  ALA B O   1 
ATOM   4612  C  CB  . ALA B 1 256 ? 14.176  20.364  66.538  1.00 26.53 ? 256  ALA B CB  1 
ATOM   4613  N  N   . SER B 1 257 ? 15.912  19.425  63.604  1.00 28.05 ? 257  SER B N   1 
ATOM   4614  C  CA  . SER B 1 257 ? 16.045  19.671  62.173  1.00 29.73 ? 257  SER B CA  1 
ATOM   4615  C  C   . SER B 1 257 ? 17.138  18.780  61.591  1.00 30.13 ? 257  SER B C   1 
ATOM   4616  O  O   . SER B 1 257 ? 18.065  18.380  62.299  1.00 30.47 ? 257  SER B O   1 
ATOM   4617  C  CB  . SER B 1 257 ? 16.381  21.144  61.913  1.00 30.39 ? 257  SER B CB  1 
ATOM   4618  O  OG  . SER B 1 257 ? 17.558  21.536  62.599  1.00 28.32 ? 257  SER B OG  1 
ATOM   4619  N  N   . VAL B 1 258 ? 17.018  18.461  60.306  1.00 30.03 ? 258  VAL B N   1 
ATOM   4620  C  CA  . VAL B 1 258 ? 17.997  17.613  59.627  1.00 29.28 ? 258  VAL B CA  1 
ATOM   4621  C  C   . VAL B 1 258 ? 18.285  18.086  58.205  1.00 28.57 ? 258  VAL B C   1 
ATOM   4622  O  O   . VAL B 1 258 ? 17.530  18.872  57.632  1.00 29.71 ? 258  VAL B O   1 
ATOM   4623  C  CB  . VAL B 1 258 ? 17.523  16.132  59.545  1.00 27.83 ? 258  VAL B CB  1 
ATOM   4624  C  CG1 . VAL B 1 258 ? 17.388  15.529  60.931  1.00 27.88 ? 258  VAL B CG1 1 
ATOM   4625  C  CG2 . VAL B 1 258 ? 16.207  16.033  58.788  1.00 28.21 ? 258  VAL B CG2 1 
ATOM   4626  N  N   . ALA B 1 259 ? 19.404  17.624  57.659  1.00 28.35 ? 259  ALA B N   1 
ATOM   4627  C  CA  . ALA B 1 259 ? 19.791  17.951  56.295  1.00 29.32 ? 259  ALA B CA  1 
ATOM   4628  C  C   . ALA B 1 259 ? 19.349  16.764  55.445  1.00 32.09 ? 259  ALA B C   1 
ATOM   4629  O  O   . ALA B 1 259 ? 19.516  15.611  55.850  1.00 32.01 ? 259  ALA B O   1 
ATOM   4630  C  CB  . ALA B 1 259 ? 21.292  18.145  56.199  1.00 27.03 ? 259  ALA B CB  1 
ATOM   4631  N  N   . SER B 1 260 ? 18.782  17.039  54.274  1.00 35.12 ? 260  SER B N   1 
ATOM   4632  C  CA  . SER B 1 260 ? 18.302  15.968  53.408  1.00 38.30 ? 260  SER B CA  1 
ATOM   4633  C  C   . SER B 1 260 ? 18.496  16.237  51.924  1.00 41.05 ? 260  SER B C   1 
ATOM   4634  O  O   . SER B 1 260 ? 18.948  17.308  51.521  1.00 41.70 ? 260  SER B O   1 
ATOM   4635  C  CB  . SER B 1 260 ? 16.816  15.721  53.667  1.00 37.29 ? 260  SER B CB  1 
ATOM   4636  O  OG  . SER B 1 260 ? 16.043  16.847  53.286  1.00 37.45 ? 260  SER B OG  1 
ATOM   4637  N  N   . ASP B 1 261 ? 18.153  15.234  51.121  1.00 44.47 ? 261  ASP B N   1 
ATOM   4638  C  CA  . ASP B 1 261 ? 18.239  15.327  49.671  1.00 46.61 ? 261  ASP B CA  1 
ATOM   4639  C  C   . ASP B 1 261 ? 16.930  15.982  49.241  1.00 47.60 ? 261  ASP B C   1 
ATOM   4640  O  O   . ASP B 1 261 ? 15.869  15.364  49.320  1.00 48.03 ? 261  ASP B O   1 
ATOM   4641  C  CB  . ASP B 1 261 ? 18.365  13.923  49.066  1.00 47.70 ? 261  ASP B CB  1 
ATOM   4642  C  CG  . ASP B 1 261 ? 18.728  13.941  47.586  1.00 49.59 ? 261  ASP B CG  1 
ATOM   4643  O  OD1 . ASP B 1 261 ? 19.101  15.011  47.056  1.00 52.14 ? 261  ASP B OD1 1 
ATOM   4644  O  OD2 . ASP B 1 261 ? 18.651  12.868  46.951  1.00 49.26 ? 261  ASP B OD2 1 
ATOM   4645  N  N   . ARG B 1 262 ? 17.007  17.242  48.820  1.00 49.01 ? 262  ARG B N   1 
ATOM   4646  C  CA  . ARG B 1 262 ? 15.827  17.999  48.403  1.00 50.16 ? 262  ARG B CA  1 
ATOM   4647  C  C   . ARG B 1 262 ? 15.006  17.338  47.297  1.00 50.73 ? 262  ARG B C   1 
ATOM   4648  O  O   . ARG B 1 262 ? 13.812  17.613  47.158  1.00 51.06 ? 262  ARG B O   1 
ATOM   4649  C  CB  . ARG B 1 262 ? 16.221  19.418  47.984  1.00 50.52 ? 262  ARG B CB  1 
ATOM   4650  C  CG  . ARG B 1 262 ? 17.094  19.494  46.743  1.00 53.35 ? 262  ARG B CG  1 
ATOM   4651  C  CD  . ARG B 1 262 ? 17.367  20.939  46.358  1.00 55.77 ? 262  ARG B CD  1 
ATOM   4652  N  NE  . ARG B 1 262 ? 16.130  21.700  46.196  1.00 57.99 ? 262  ARG B NE  1 
ATOM   4653  C  CZ  . ARG B 1 262 ? 16.075  23.005  45.945  1.00 59.67 ? 262  ARG B CZ  1 
ATOM   4654  N  NH1 . ARG B 1 262 ? 17.191  23.714  45.820  1.00 60.14 ? 262  ARG B NH1 1 
ATOM   4655  N  NH2 . ARG B 1 262 ? 14.899  23.606  45.828  1.00 60.28 ? 262  ARG B NH2 1 
ATOM   4656  N  N   . SER B 1 263 ? 15.644  16.471  46.514  1.00 51.34 ? 263  SER B N   1 
ATOM   4657  C  CA  . SER B 1 263 ? 14.966  15.771  45.428  1.00 52.25 ? 263  SER B CA  1 
ATOM   4658  C  C   . SER B 1 263 ? 14.024  14.686  45.955  1.00 52.11 ? 263  SER B C   1 
ATOM   4659  O  O   . SER B 1 263 ? 12.928  14.496  45.425  1.00 52.37 ? 263  SER B O   1 
ATOM   4660  C  CB  . SER B 1 263 ? 15.989  15.164  44.461  1.00 53.14 ? 263  SER B CB  1 
ATOM   4661  O  OG  . SER B 1 263 ? 16.852  14.251  45.119  1.00 52.51 ? 263  SER B OG  1 
ATOM   4662  N  N   . ILE B 1 264 ? 14.456  13.984  47.001  1.00 51.49 ? 264  ILE B N   1 
ATOM   4663  C  CA  . ILE B 1 264 ? 13.657  12.923  47.610  1.00 50.20 ? 264  ILE B CA  1 
ATOM   4664  C  C   . ILE B 1 264 ? 12.812  13.482  48.756  1.00 49.15 ? 264  ILE B C   1 
ATOM   4665  O  O   . ILE B 1 264 ? 11.593  13.300  48.785  1.00 49.40 ? 264  ILE B O   1 
ATOM   4666  C  CB  . ILE B 1 264 ? 14.550  11.776  48.141  1.00 50.50 ? 264  ILE B CB  1 
ATOM   4667  C  CG1 . ILE B 1 264 ? 15.492  11.278  47.038  1.00 51.10 ? 264  ILE B CG1 1 
ATOM   4668  C  CG2 . ILE B 1 264 ? 13.689  10.626  48.657  1.00 50.10 ? 264  ILE B CG2 1 
ATOM   4669  C  CD1 . ILE B 1 264 ? 14.787  10.756  45.798  1.00 52.10 ? 264  ILE B CD1 1 
ATOM   4670  N  N   . ILE B 1 265 ? 13.469  14.147  49.704  1.00 47.22 ? 265  ILE B N   1 
ATOM   4671  C  CA  . ILE B 1 265 ? 12.788  14.751  50.848  1.00 45.59 ? 265  ILE B CA  1 
ATOM   4672  C  C   . ILE B 1 265 ? 12.959  16.271  50.777  1.00 43.66 ? 265  ILE B C   1 
ATOM   4673  O  O   . ILE B 1 265 ? 13.987  16.810  51.195  1.00 43.97 ? 265  ILE B O   1 
ATOM   4674  C  CB  . ILE B 1 265 ? 13.355  14.250  52.206  1.00 46.66 ? 265  ILE B CB  1 
ATOM   4675  C  CG1 . ILE B 1 265 ? 13.435  12.723  52.236  1.00 47.14 ? 265  ILE B CG1 1 
ATOM   4676  C  CG2 . ILE B 1 265 ? 12.483  14.736  53.355  1.00 46.51 ? 265  ILE B CG2 1 
ATOM   4677  C  CD1 . ILE B 1 265 ? 14.768  12.173  51.768  1.00 48.85 ? 265  ILE B CD1 1 
ATOM   4678  N  N   . PRO B 1 266 ? 11.952  16.979  50.238  1.00 41.62 ? 266  PRO B N   1 
ATOM   4679  C  CA  . PRO B 1 266 ? 11.968  18.439  50.099  1.00 40.31 ? 266  PRO B CA  1 
ATOM   4680  C  C   . PRO B 1 266 ? 11.943  19.177  51.439  1.00 38.68 ? 266  PRO B C   1 
ATOM   4681  O  O   . PRO B 1 266 ? 11.523  18.622  52.455  1.00 39.82 ? 266  PRO B O   1 
ATOM   4682  C  CB  . PRO B 1 266 ? 10.703  18.709  49.283  1.00 39.87 ? 266  PRO B CB  1 
ATOM   4683  C  CG  . PRO B 1 266 ? 9.783   17.628  49.734  1.00 40.54 ? 266  PRO B CG  1 
ATOM   4684  C  CD  . PRO B 1 266 ? 10.688  16.424  49.722  1.00 41.93 ? 266  PRO B CD  1 
ATOM   4685  N  N   . PRO B 1 267 ? 12.416  20.436  51.458  1.00 36.91 ? 267  PRO B N   1 
ATOM   4686  C  CA  . PRO B 1 267 ? 12.445  21.250  52.678  1.00 37.08 ? 267  PRO B CA  1 
ATOM   4687  C  C   . PRO B 1 267 ? 11.055  21.538  53.244  1.00 36.45 ? 267  PRO B C   1 
ATOM   4688  O  O   . PRO B 1 267 ? 10.099  21.754  52.496  1.00 37.23 ? 267  PRO B O   1 
ATOM   4689  C  CB  . PRO B 1 267 ? 13.150  22.528  52.217  1.00 37.39 ? 267  PRO B CB  1 
ATOM   4690  C  CG  . PRO B 1 267 ? 12.812  22.602  50.761  1.00 36.71 ? 267  PRO B CG  1 
ATOM   4691  C  CD  . PRO B 1 267 ? 12.998  21.177  50.327  1.00 36.84 ? 267  PRO B CD  1 
ATOM   4692  N  N   . GLY B 1 268 ? 10.957  21.534  54.570  1.00 35.00 ? 268  GLY B N   1 
ATOM   4693  C  CA  . GLY B 1 268 ? 9.688   21.782  55.230  1.00 34.53 ? 268  GLY B CA  1 
ATOM   4694  C  C   . GLY B 1 268 ? 8.957   20.502  55.588  1.00 33.37 ? 268  GLY B C   1 
ATOM   4695  O  O   . GLY B 1 268 ? 7.884   20.540  56.190  1.00 33.62 ? 268  GLY B O   1 
ATOM   4696  N  N   . THR B 1 269 ? 9.544   19.365  55.225  1.00 33.45 ? 269  THR B N   1 
ATOM   4697  C  CA  . THR B 1 269 ? 8.951   18.061  55.500  1.00 33.62 ? 269  THR B CA  1 
ATOM   4698  C  C   . THR B 1 269 ? 9.126   17.639  56.957  1.00 33.20 ? 269  THR B C   1 
ATOM   4699  O  O   . THR B 1 269 ? 10.240  17.636  57.486  1.00 32.29 ? 269  THR B O   1 
ATOM   4700  C  CB  . THR B 1 269 ? 9.551   16.973  54.581  1.00 32.64 ? 269  THR B CB  1 
ATOM   4701  O  OG1 . THR B 1 269 ? 9.289   17.306  53.213  1.00 32.44 ? 269  THR B OG1 1 
ATOM   4702  C  CG2 . THR B 1 269 ? 8.943   15.612  54.886  1.00 33.06 ? 269  THR B CG2 1 
ATOM   4703  N  N   . THR B 1 270 ? 8.012   17.300  57.602  1.00 33.80 ? 270  THR B N   1 
ATOM   4704  C  CA  . THR B 1 270 ? 8.021   16.857  58.993  1.00 34.28 ? 270  THR B CA  1 
ATOM   4705  C  C   . THR B 1 270 ? 8.433   15.386  59.029  1.00 34.47 ? 270  THR B C   1 
ATOM   4706  O  O   . THR B 1 270 ? 7.896   14.561  58.286  1.00 33.49 ? 270  THR B O   1 
ATOM   4707  C  CB  . THR B 1 270 ? 6.630   17.023  59.649  1.00 35.22 ? 270  THR B CB  1 
ATOM   4708  O  OG1 . THR B 1 270 ? 6.218   18.393  59.561  1.00 34.83 ? 270  THR B OG1 1 
ATOM   4709  C  CG2 . THR B 1 270 ? 6.675   16.613  61.114  1.00 34.85 ? 270  THR B CG2 1 
ATOM   4710  N  N   . LEU B 1 271 ? 9.388   15.065  59.898  1.00 36.16 ? 271  LEU B N   1 
ATOM   4711  C  CA  . LEU B 1 271 ? 9.895   13.703  60.016  1.00 37.06 ? 271  LEU B CA  1 
ATOM   4712  C  C   . LEU B 1 271 ? 9.998   13.221  61.458  1.00 37.35 ? 271  LEU B C   1 
ATOM   4713  O  O   . LEU B 1 271 ? 10.721  13.807  62.262  1.00 39.01 ? 271  LEU B O   1 
ATOM   4714  C  CB  . LEU B 1 271 ? 11.290  13.613  59.386  1.00 37.29 ? 271  LEU B CB  1 
ATOM   4715  C  CG  . LEU B 1 271 ? 11.524  14.088  57.950  1.00 37.90 ? 271  LEU B CG  1 
ATOM   4716  C  CD1 . LEU B 1 271 ? 13.014  14.238  57.704  1.00 35.18 ? 271  LEU B CD1 1 
ATOM   4717  C  CD2 . LEU B 1 271 ? 10.902  13.119  56.959  1.00 38.47 ? 271  LEU B CD2 1 
ATOM   4718  N  N   . ILE B 1 272 ? 9.260   12.165  61.788  1.00 37.51 ? 272  ILE B N   1 
ATOM   4719  C  CA  . ILE B 1 272 ? 9.330   11.580  63.124  1.00 37.94 ? 272  ILE B CA  1 
ATOM   4720  C  C   . ILE B 1 272 ? 10.264  10.382  62.962  1.00 37.04 ? 272  ILE B C   1 
ATOM   4721  O  O   . ILE B 1 272 ? 10.045  9.531   62.099  1.00 37.62 ? 272  ILE B O   1 
ATOM   4722  C  CB  . ILE B 1 272 ? 7.935   11.141  63.658  1.00 39.09 ? 272  ILE B CB  1 
ATOM   4723  C  CG1 . ILE B 1 272 ? 8.072   10.536  65.058  1.00 40.54 ? 272  ILE B CG1 1 
ATOM   4724  C  CG2 . ILE B 1 272 ? 7.267   10.165  62.710  1.00 40.98 ? 272  ILE B CG2 1 
ATOM   4725  C  CD1 . ILE B 1 272 ? 6.757   10.101  65.674  1.00 43.50 ? 272  ILE B CD1 1 
ATOM   4726  N  N   . ALA B 1 273 ? 11.330  10.337  63.754  1.00 36.45 ? 273  ALA B N   1 
ATOM   4727  C  CA  . ALA B 1 273 ? 12.289  9.248   63.625  1.00 36.11 ? 273  ALA B CA  1 
ATOM   4728  C  C   . ALA B 1 273 ? 12.797  8.627   64.916  1.00 35.81 ? 273  ALA B C   1 
ATOM   4729  O  O   . ALA B 1 273 ? 12.753  9.236   65.986  1.00 35.24 ? 273  ALA B O   1 
ATOM   4730  C  CB  . ALA B 1 273 ? 13.468  9.706   62.777  1.00 34.90 ? 273  ALA B CB  1 
ATOM   4731  N  N   . GLU B 1 274 ? 13.269  7.391   64.784  1.00 35.65 ? 274  GLU B N   1 
ATOM   4732  C  CA  . GLU B 1 274 ? 13.838  6.632   65.886  1.00 35.40 ? 274  GLU B CA  1 
ATOM   4733  C  C   . GLU B 1 274 ? 15.353  6.756   65.777  1.00 34.26 ? 274  GLU B C   1 
ATOM   4734  O  O   . GLU B 1 274 ? 16.016  5.927   65.151  1.00 34.11 ? 274  GLU B O   1 
ATOM   4735  C  CB  . GLU B 1 274 ? 13.418  5.163   65.795  1.00 37.21 ? 274  GLU B CB  1 
ATOM   4736  C  CG  . GLU B 1 274 ? 12.046  4.870   66.375  1.00 41.20 ? 274  GLU B CG  1 
ATOM   4737  C  CD  . GLU B 1 274 ? 12.049  4.844   67.891  1.00 43.76 ? 274  GLU B CD  1 
ATOM   4738  O  OE1 . GLU B 1 274 ? 11.791  5.897   68.511  1.00 46.09 ? 274  GLU B OE1 1 
ATOM   4739  O  OE2 . GLU B 1 274 ? 12.313  3.768   68.465  1.00 46.89 ? 274  GLU B OE2 1 
ATOM   4740  N  N   . VAL B 1 275 ? 15.882  7.835   66.346  1.00 34.12 ? 275  VAL B N   1 
ATOM   4741  C  CA  . VAL B 1 275 ? 17.313  8.108   66.328  1.00 32.48 ? 275  VAL B CA  1 
ATOM   4742  C  C   . VAL B 1 275 ? 18.053  7.218   67.322  1.00 31.42 ? 275  VAL B C   1 
ATOM   4743  O  O   . VAL B 1 275 ? 17.796  7.266   68.526  1.00 29.29 ? 275  VAL B O   1 
ATOM   4744  C  CB  . VAL B 1 275 ? 17.599  9.593   66.652  1.00 33.04 ? 275  VAL B CB  1 
ATOM   4745  C  CG1 . VAL B 1 275 ? 19.094  9.869   66.615  1.00 33.05 ? 275  VAL B CG1 1 
ATOM   4746  C  CG2 . VAL B 1 275 ? 16.871  10.491  65.666  1.00 32.71 ? 275  VAL B CG2 1 
ATOM   4747  N  N   . PRO B 1 276 ? 18.986  6.392   66.822  1.00 31.82 ? 276  PRO B N   1 
ATOM   4748  C  CA  . PRO B 1 276 ? 19.785  5.474   67.638  1.00 32.25 ? 276  PRO B CA  1 
ATOM   4749  C  C   . PRO B 1 276 ? 20.688  6.202   68.629  1.00 33.74 ? 276  PRO B C   1 
ATOM   4750  O  O   . PRO B 1 276 ? 21.446  7.098   68.255  1.00 34.12 ? 276  PRO B O   1 
ATOM   4751  C  CB  . PRO B 1 276 ? 20.600  4.715   66.591  1.00 31.07 ? 276  PRO B CB  1 
ATOM   4752  C  CG  . PRO B 1 276 ? 20.769  5.727   65.503  1.00 31.10 ? 276  PRO B CG  1 
ATOM   4753  C  CD  . PRO B 1 276 ? 19.383  6.307   65.406  1.00 31.56 ? 276  PRO B CD  1 
ATOM   4754  N  N   . LEU B 1 277 ? 20.585  5.822   69.897  1.00 34.73 ? 277  LEU B N   1 
ATOM   4755  C  CA  . LEU B 1 277 ? 21.391  6.430   70.945  1.00 34.86 ? 277  LEU B CA  1 
ATOM   4756  C  C   . LEU B 1 277 ? 22.780  5.815   71.009  1.00 35.97 ? 277  LEU B C   1 
ATOM   4757  O  O   . LEU B 1 277 ? 23.000  4.693   70.551  1.00 36.81 ? 277  LEU B O   1 
ATOM   4758  C  CB  . LEU B 1 277 ? 20.701  6.290   72.302  1.00 34.12 ? 277  LEU B CB  1 
ATOM   4759  C  CG  . LEU B 1 277 ? 19.400  7.068   72.481  1.00 33.92 ? 277  LEU B CG  1 
ATOM   4760  C  CD1 . LEU B 1 277 ? 18.783  6.726   73.822  1.00 33.77 ? 277  LEU B CD1 1 
ATOM   4761  C  CD2 . LEU B 1 277 ? 19.670  8.560   72.373  1.00 34.43 ? 277  LEU B CD2 1 
ATOM   4762  N  N   . LEU B 1 278 ? 23.714  6.569   71.575  1.00 37.91 ? 278  LEU B N   1 
ATOM   4763  C  CA  . LEU B 1 278 ? 25.094  6.127   71.722  1.00 40.12 ? 278  LEU B CA  1 
ATOM   4764  C  C   . LEU B 1 278 ? 25.780  6.880   72.857  1.00 40.73 ? 278  LEU B C   1 
ATOM   4765  O  O   . LEU B 1 278 ? 25.537  8.071   73.058  1.00 41.48 ? 278  LEU B O   1 
ATOM   4766  C  CB  . LEU B 1 278 ? 25.859  6.287   70.397  1.00 40.19 ? 278  LEU B CB  1 
ATOM   4767  C  CG  . LEU B 1 278 ? 25.657  7.528   69.517  1.00 40.24 ? 278  LEU B CG  1 
ATOM   4768  C  CD1 . LEU B 1 278 ? 26.381  8.738   70.091  1.00 42.02 ? 278  LEU B CD1 1 
ATOM   4769  C  CD2 . LEU B 1 278 ? 26.173  7.231   68.120  1.00 37.72 ? 278  LEU B CD2 1 
ATOM   4770  N  N   . ASP B 1 279 ? 26.609  6.169   73.617  1.00 42.14 ? 279  ASP B N   1 
ATOM   4771  C  CA  . ASP B 1 279 ? 27.325  6.759   74.745  1.00 44.01 ? 279  ASP B CA  1 
ATOM   4772  C  C   . ASP B 1 279 ? 28.411  7.756   74.338  1.00 45.55 ? 279  ASP B C   1 
ATOM   4773  O  O   . ASP B 1 279 ? 28.514  8.136   73.169  1.00 45.44 ? 279  ASP B O   1 
ATOM   4774  C  CB  . ASP B 1 279 ? 27.904  5.660   75.650  1.00 43.30 ? 279  ASP B CB  1 
ATOM   4775  C  CG  . ASP B 1 279 ? 28.626  4.575   74.872  1.00 42.72 ? 279  ASP B CG  1 
ATOM   4776  O  OD1 . ASP B 1 279 ? 29.729  4.839   74.351  1.00 43.89 ? 279  ASP B OD1 1 
ATOM   4777  O  OD2 . ASP B 1 279 ? 28.088  3.451   74.787  1.00 42.86 ? 279  ASP B OD2 1 
ATOM   4778  N  N   . ASN B 1 280 ? 29.209  8.184   75.315  1.00 47.30 ? 280  ASN B N   1 
ATOM   4779  C  CA  . ASN B 1 280 ? 30.290  9.144   75.090  1.00 48.81 ? 280  ASN B CA  1 
ATOM   4780  C  C   . ASN B 1 280 ? 31.343  8.633   74.108  1.00 48.77 ? 280  ASN B C   1 
ATOM   4781  O  O   . ASN B 1 280 ? 32.031  9.422   73.457  1.00 48.44 ? 280  ASN B O   1 
ATOM   4782  C  CB  . ASN B 1 280 ? 30.953  9.514   76.420  1.00 50.29 ? 280  ASN B CB  1 
ATOM   4783  C  CG  . ASN B 1 280 ? 29.982  10.148  77.400  1.00 52.51 ? 280  ASN B CG  1 
ATOM   4784  O  OD1 . ASN B 1 280 ? 29.189  9.457   78.043  1.00 53.50 ? 280  ASN B OD1 1 
ATOM   4785  N  ND2 . ASN B 1 280 ? 30.039  11.469  77.518  1.00 53.74 ? 280  ASN B ND2 1 
ATOM   4786  N  N   . ASN B 1 281 ? 31.463  7.311   74.013  1.00 49.63 ? 281  ASN B N   1 
ATOM   4787  C  CA  . ASN B 1 281 ? 32.423  6.682   73.112  1.00 50.39 ? 281  ASN B CA  1 
ATOM   4788  C  C   . ASN B 1 281 ? 31.801  6.373   71.750  1.00 50.57 ? 281  ASN B C   1 
ATOM   4789  O  O   . ASN B 1 281 ? 32.423  5.726   70.905  1.00 50.89 ? 281  ASN B O   1 
ATOM   4790  C  CB  . ASN B 1 281 ? 32.988  5.406   73.745  1.00 50.83 ? 281  ASN B CB  1 
ATOM   4791  C  CG  . ASN B 1 281 ? 33.736  5.679   75.039  1.00 51.47 ? 281  ASN B CG  1 
ATOM   4792  O  OD1 . ASN B 1 281 ? 34.699  6.448   75.065  1.00 51.34 ? 281  ASN B OD1 1 
ATOM   4793  N  ND2 . ASN B 1 281 ? 33.292  5.051   76.122  1.00 51.40 ? 281  ASN B ND2 1 
ATOM   4794  N  N   . GLY B 1 282 ? 30.570  6.839   71.549  1.00 50.35 ? 282  GLY B N   1 
ATOM   4795  C  CA  . GLY B 1 282 ? 29.871  6.632   70.291  1.00 50.88 ? 282  GLY B CA  1 
ATOM   4796  C  C   . GLY B 1 282 ? 29.471  5.205   69.974  1.00 51.86 ? 282  GLY B C   1 
ATOM   4797  O  O   . GLY B 1 282 ? 29.181  4.883   68.820  1.00 51.30 ? 282  GLY B O   1 
ATOM   4798  N  N   . LYS B 1 283 ? 29.461  4.351   70.994  1.00 53.52 ? 283  LYS B N   1 
ATOM   4799  C  CA  . LYS B 1 283 ? 29.091  2.949   70.833  1.00 54.37 ? 283  LYS B CA  1 
ATOM   4800  C  C   . LYS B 1 283 ? 27.578  2.788   70.956  1.00 53.00 ? 283  LYS B C   1 
ATOM   4801  O  O   . LYS B 1 283 ? 26.958  3.336   71.871  1.00 52.27 ? 283  LYS B O   1 
ATOM   4802  C  CB  . LYS B 1 283 ? 29.801  2.088   71.886  1.00 56.79 ? 283  LYS B CB  1 
ATOM   4803  C  CG  . LYS B 1 283 ? 29.473  0.600   71.812  1.00 59.35 ? 283  LYS B CG  1 
ATOM   4804  C  CD  . LYS B 1 283 ? 30.207  -0.191  72.883  1.00 61.77 ? 283  LYS B CD  1 
ATOM   4805  C  CE  . LYS B 1 283 ? 29.788  -1.650  72.874  1.00 62.82 ? 283  LYS B CE  1 
ATOM   4806  N  NZ  . LYS B 1 283 ? 30.523  -2.432  73.906  1.00 64.20 ? 283  LYS B NZ  1 
ATOM   4807  N  N   . PHE B 1 284 ? 26.990  2.048   70.019  1.00 52.10 ? 284  PHE B N   1 
ATOM   4808  C  CA  . PHE B 1 284 ? 25.552  1.804   70.012  1.00 50.97 ? 284  PHE B CA  1 
ATOM   4809  C  C   . PHE B 1 284 ? 25.153  0.887   71.169  1.00 50.73 ? 284  PHE B C   1 
ATOM   4810  O  O   . PHE B 1 284 ? 25.433  -0.314  71.153  1.00 50.28 ? 284  PHE B O   1 
ATOM   4811  C  CB  . PHE B 1 284 ? 25.126  1.190   68.673  1.00 49.47 ? 284  PHE B CB  1 
ATOM   4812  C  CG  . PHE B 1 284 ? 23.643  0.968   68.550  1.00 49.20 ? 284  PHE B CG  1 
ATOM   4813  C  CD1 . PHE B 1 284 ? 22.753  2.029   68.691  1.00 48.31 ? 284  PHE B CD1 1 
ATOM   4814  C  CD2 . PHE B 1 284 ? 23.136  -0.302  68.296  1.00 48.99 ? 284  PHE B CD2 1 
ATOM   4815  C  CE1 . PHE B 1 284 ? 21.380  1.828   68.582  1.00 47.49 ? 284  PHE B CE1 1 
ATOM   4816  C  CE2 . PHE B 1 284 ? 21.763  -0.513  68.185  1.00 48.54 ? 284  PHE B CE2 1 
ATOM   4817  C  CZ  . PHE B 1 284 ? 20.885  0.555   68.328  1.00 48.23 ? 284  PHE B CZ  1 
ATOM   4818  N  N   . ASN B 1 285 ? 24.507  1.471   72.173  1.00 50.42 ? 285  ASN B N   1 
ATOM   4819  C  CA  . ASN B 1 285 ? 24.063  0.731   73.349  1.00 51.03 ? 285  ASN B CA  1 
ATOM   4820  C  C   . ASN B 1 285 ? 22.918  -0.237  73.055  1.00 50.33 ? 285  ASN B C   1 
ATOM   4821  O  O   . ASN B 1 285 ? 22.813  -1.287  73.690  1.00 50.85 ? 285  ASN B O   1 
ATOM   4822  C  CB  . ASN B 1 285 ? 23.680  1.698   74.478  1.00 52.69 ? 285  ASN B CB  1 
ATOM   4823  C  CG  . ASN B 1 285 ? 22.827  2.864   73.995  1.00 53.21 ? 285  ASN B CG  1 
ATOM   4824  O  OD1 . ASN B 1 285 ? 22.070  2.742   73.030  1.00 52.24 ? 285  ASN B OD1 1 
ATOM   4825  N  ND2 . ASN B 1 285 ? 22.953  4.004   74.667  1.00 51.76 ? 285  ASN B ND2 1 
ATOM   4826  N  N   . GLY B 1 286 ? 22.067  0.118   72.095  1.00 49.46 ? 286  GLY B N   1 
ATOM   4827  C  CA  . GLY B 1 286 ? 20.954  -0.746  71.739  1.00 49.33 ? 286  GLY B CA  1 
ATOM   4828  C  C   . GLY B 1 286 ? 19.588  -0.087  71.753  1.00 48.91 ? 286  GLY B C   1 
ATOM   4829  O  O   . GLY B 1 286 ? 18.634  -0.621  71.184  1.00 49.11 ? 286  GLY B O   1 
ATOM   4830  N  N   . GLN B 1 287 ? 19.490  1.071   72.400  1.00 49.04 ? 287  GLN B N   1 
ATOM   4831  C  CA  . GLN B 1 287 ? 18.228  1.800   72.493  1.00 48.21 ? 287  GLN B CA  1 
ATOM   4832  C  C   . GLN B 1 287 ? 18.124  2.968   71.512  1.00 47.05 ? 287  GLN B C   1 
ATOM   4833  O  O   . GLN B 1 287 ? 19.132  3.453   70.995  1.00 46.60 ? 287  GLN B O   1 
ATOM   4834  C  CB  . GLN B 1 287 ? 18.000  2.274   73.931  1.00 49.21 ? 287  GLN B CB  1 
ATOM   4835  C  CG  . GLN B 1 287 ? 19.185  2.990   74.550  1.00 50.77 ? 287  GLN B CG  1 
ATOM   4836  C  CD  . GLN B 1 287 ? 19.053  3.140   76.051  1.00 51.84 ? 287  GLN B CD  1 
ATOM   4837  O  OE1 . GLN B 1 287 ? 18.661  4.193   76.550  1.00 54.05 ? 287  GLN B OE1 1 
ATOM   4838  N  NE2 . GLN B 1 287 ? 19.382  2.081   76.782  1.00 52.75 ? 287  GLN B NE2 1 
ATOM   4839  N  N   . TYR B 1 288 ? 16.891  3.400   71.253  1.00 46.48 ? 288  TYR B N   1 
ATOM   4840  C  CA  . TYR B 1 288 ? 16.623  4.498   70.327  1.00 44.68 ? 288  TYR B CA  1 
ATOM   4841  C  C   . TYR B 1 288 ? 16.033  5.725   71.018  1.00 44.65 ? 288  TYR B C   1 
ATOM   4842  O  O   . TYR B 1 288 ? 15.910  5.765   72.245  1.00 44.98 ? 288  TYR B O   1 
ATOM   4843  C  CB  . TYR B 1 288 ? 15.687  4.031   69.207  1.00 43.05 ? 288  TYR B CB  1 
ATOM   4844  C  CG  . TYR B 1 288 ? 16.266  2.936   68.341  1.00 42.65 ? 288  TYR B CG  1 
ATOM   4845  C  CD1 . TYR B 1 288 ? 16.298  1.615   68.785  1.00 43.02 ? 288  TYR B CD1 1 
ATOM   4846  C  CD2 . TYR B 1 288 ? 16.798  3.221   67.085  1.00 42.87 ? 288  TYR B CD2 1 
ATOM   4847  C  CE1 . TYR B 1 288 ? 16.846  0.604   68.002  1.00 44.62 ? 288  TYR B CE1 1 
ATOM   4848  C  CE2 . TYR B 1 288 ? 17.347  2.217   66.292  1.00 44.75 ? 288  TYR B CE2 1 
ATOM   4849  C  CZ  . TYR B 1 288 ? 17.368  0.912   66.758  1.00 44.54 ? 288  TYR B CZ  1 
ATOM   4850  O  OH  . TYR B 1 288 ? 17.912  -0.087  65.986  1.00 45.52 ? 288  TYR B OH  1 
ATOM   4851  N  N   . GLU B 1 289 ? 15.644  6.713   70.215  1.00 43.60 ? 289  GLU B N   1 
ATOM   4852  C  CA  . GLU B 1 289 ? 15.080  7.958   70.723  1.00 41.46 ? 289  GLU B CA  1 
ATOM   4853  C  C   . GLU B 1 289 ? 14.091  8.538   69.716  1.00 40.32 ? 289  GLU B C   1 
ATOM   4854  O  O   . GLU B 1 289 ? 14.433  8.756   68.554  1.00 39.49 ? 289  GLU B O   1 
ATOM   4855  C  CB  . GLU B 1 289 ? 16.212  8.953   70.982  1.00 41.67 ? 289  GLU B CB  1 
ATOM   4856  C  CG  . GLU B 1 289 ? 15.797  10.263  71.616  1.00 39.49 ? 289  GLU B CG  1 
ATOM   4857  C  CD  . GLU B 1 289 ? 16.991  11.131  71.965  1.00 38.07 ? 289  GLU B CD  1 
ATOM   4858  O  OE1 . GLU B 1 289 ? 17.699  11.577  71.038  1.00 39.31 ? 289  GLU B OE1 1 
ATOM   4859  O  OE2 . GLU B 1 289 ? 17.230  11.359  73.169  1.00 39.59 ? 289  GLU B OE2 1 
ATOM   4860  N  N   . LEU B 1 290 ? 12.864  8.785   70.168  1.00 40.53 ? 290  LEU B N   1 
ATOM   4861  C  CA  . LEU B 1 290 ? 11.823  9.332   69.303  1.00 40.23 ? 290  LEU B CA  1 
ATOM   4862  C  C   . LEU B 1 290 ? 11.886  10.858  69.227  1.00 38.86 ? 290  LEU B C   1 
ATOM   4863  O  O   . LEU B 1 290 ? 11.727  11.548  70.236  1.00 38.33 ? 290  LEU B O   1 
ATOM   4864  C  CB  . LEU B 1 290 ? 10.441  8.885   69.788  1.00 41.25 ? 290  LEU B CB  1 
ATOM   4865  C  CG  . LEU B 1 290 ? 9.289   9.099   68.803  1.00 42.20 ? 290  LEU B CG  1 
ATOM   4866  C  CD1 . LEU B 1 290 ? 9.519   8.264   67.548  1.00 40.69 ? 290  LEU B CD1 1 
ATOM   4867  C  CD2 . LEU B 1 290 ? 7.972   8.724   69.461  1.00 40.61 ? 290  LEU B CD2 1 
ATOM   4868  N  N   . ARG B 1 291 ? 12.104  11.374  68.020  1.00 37.98 ? 291  ARG B N   1 
ATOM   4869  C  CA  . ARG B 1 291 ? 12.200  12.814  67.798  1.00 35.57 ? 291  ARG B CA  1 
ATOM   4870  C  C   . ARG B 1 291 ? 11.469  13.296  66.553  1.00 33.54 ? 291  ARG B C   1 
ATOM   4871  O  O   . ARG B 1 291 ? 11.395  12.591  65.546  1.00 33.78 ? 291  ARG B O   1 
ATOM   4872  C  CB  . ARG B 1 291 ? 13.666  13.248  67.685  1.00 34.90 ? 291  ARG B CB  1 
ATOM   4873  C  CG  . ARG B 1 291 ? 14.428  13.307  68.991  1.00 34.85 ? 291  ARG B CG  1 
ATOM   4874  C  CD  . ARG B 1 291 ? 15.832  13.843  68.762  1.00 35.06 ? 291  ARG B CD  1 
ATOM   4875  N  NE  . ARG B 1 291 ? 16.575  13.981  70.012  1.00 36.08 ? 291  ARG B NE  1 
ATOM   4876  C  CZ  . ARG B 1 291 ? 16.495  15.030  70.824  1.00 35.63 ? 291  ARG B CZ  1 
ATOM   4877  N  NH1 . ARG B 1 291 ? 15.704  16.053  70.522  1.00 36.04 ? 291  ARG B NH1 1 
ATOM   4878  N  NH2 . ARG B 1 291 ? 17.198  15.051  71.948  1.00 36.28 ? 291  ARG B NH2 1 
ATOM   4879  N  N   . LEU B 1 292 ? 10.940  14.513  66.639  1.00 32.83 ? 292  LEU B N   1 
ATOM   4880  C  CA  . LEU B 1 292 ? 10.245  15.153  65.529  1.00 30.30 ? 292  LEU B CA  1 
ATOM   4881  C  C   . LEU B 1 292 ? 11.208  16.177  64.944  1.00 28.19 ? 292  LEU B C   1 
ATOM   4882  O  O   . LEU B 1 292 ? 11.673  17.074  65.647  1.00 26.12 ? 292  LEU B O   1 
ATOM   4883  C  CB  . LEU B 1 292 ? 8.972   15.845  66.015  1.00 29.68 ? 292  LEU B CB  1 
ATOM   4884  C  CG  . LEU B 1 292 ? 7.738   14.964  66.194  1.00 28.83 ? 292  LEU B CG  1 
ATOM   4885  C  CD1 . LEU B 1 292 ? 6.639   15.755  66.869  1.00 28.97 ? 292  LEU B CD1 1 
ATOM   4886  C  CD2 . LEU B 1 292 ? 7.273   14.459  64.841  1.00 27.32 ? 292  LEU B CD2 1 
HETATM 4887  N  N   . MSE B 1 293 ? 11.522  16.027  63.662  1.00 28.32 ? 293  MSE B N   1 
HETATM 4888  C  CA  . MSE B 1 293 ? 12.456  16.927  62.995  1.00 28.93 ? 293  MSE B CA  1 
HETATM 4889  C  C   . MSE B 1 293 ? 11.938  17.397  61.642  1.00 28.39 ? 293  MSE B C   1 
HETATM 4890  O  O   . MSE B 1 293 ? 11.076  16.758  61.043  1.00 30.40 ? 293  MSE B O   1 
HETATM 4891  C  CB  . MSE B 1 293 ? 13.809  16.230  62.833  1.00 30.74 ? 293  MSE B CB  1 
HETATM 4892  C  CG  . MSE B 1 293 ? 14.402  15.753  64.153  1.00 33.34 ? 293  MSE B CG  1 
HETATM 4893  SE SE  . MSE B 1 293 ? 15.916  14.591  63.964  1.00 39.89 ? 293  MSE B SE  1 
HETATM 4894  C  CE  . MSE B 1 293 ? 14.993  12.985  63.438  1.00 36.53 ? 293  MSE B CE  1 
ATOM   4895  N  N   . VAL B 1 294 ? 12.458  18.529  61.177  1.00 27.05 ? 294  VAL B N   1 
ATOM   4896  C  CA  . VAL B 1 294 ? 12.056  19.095  59.894  1.00 24.80 ? 294  VAL B CA  1 
ATOM   4897  C  C   . VAL B 1 294 ? 13.268  19.265  58.980  1.00 24.26 ? 294  VAL B C   1 
ATOM   4898  O  O   . VAL B 1 294 ? 14.335  19.697  59.421  1.00 23.58 ? 294  VAL B O   1 
ATOM   4899  C  CB  . VAL B 1 294 ? 11.368  20.475  60.070  1.00 24.85 ? 294  VAL B CB  1 
ATOM   4900  C  CG1 . VAL B 1 294 ? 10.865  20.992  58.732  1.00 24.43 ? 294  VAL B CG1 1 
ATOM   4901  C  CG2 . VAL B 1 294 ? 10.220  20.379  61.058  1.00 24.06 ? 294  VAL B CG2 1 
ATOM   4902  N  N   . ALA B 1 295 ? 13.104  18.900  57.712  1.00 23.23 ? 295  ALA B N   1 
ATOM   4903  C  CA  . ALA B 1 295 ? 14.175  19.027  56.730  1.00 22.97 ? 295  ALA B CA  1 
ATOM   4904  C  C   . ALA B 1 295 ? 14.294  20.498  56.343  1.00 22.97 ? 295  ALA B C   1 
ATOM   4905  O  O   . ALA B 1 295 ? 13.389  21.055  55.725  1.00 23.29 ? 295  ALA B O   1 
ATOM   4906  C  CB  . ALA B 1 295 ? 13.868  18.177  55.505  1.00 21.70 ? 295  ALA B CB  1 
ATOM   4907  N  N   . LEU B 1 296 ? 15.403  21.129  56.722  1.00 23.34 ? 296  LEU B N   1 
ATOM   4908  C  CA  . LEU B 1 296 ? 15.612  22.546  56.426  1.00 23.09 ? 296  LEU B CA  1 
ATOM   4909  C  C   . LEU B 1 296 ? 17.024  22.884  55.953  1.00 24.24 ? 296  LEU B C   1 
ATOM   4910  O  O   . LEU B 1 296 ? 17.429  24.048  55.971  1.00 24.82 ? 296  LEU B O   1 
ATOM   4911  C  CB  . LEU B 1 296 ? 15.278  23.388  57.659  1.00 22.19 ? 296  LEU B CB  1 
ATOM   4912  C  CG  . LEU B 1 296 ? 13.831  23.387  58.150  1.00 19.92 ? 296  LEU B CG  1 
ATOM   4913  C  CD1 . LEU B 1 296 ? 13.767  23.995  59.532  1.00 21.68 ? 296  LEU B CD1 1 
ATOM   4914  C  CD2 . LEU B 1 296 ? 12.941  24.144  57.176  1.00 19.95 ? 296  LEU B CD2 1 
ATOM   4915  N  N   . ASP B 1 297 ? 17.763  21.874  55.506  1.00 25.03 ? 297  ASP B N   1 
ATOM   4916  C  CA  . ASP B 1 297 ? 19.129  22.084  55.039  1.00 25.51 ? 297  ASP B CA  1 
ATOM   4917  C  C   . ASP B 1 297 ? 19.525  20.979  54.065  1.00 26.19 ? 297  ASP B C   1 
ATOM   4918  O  O   . ASP B 1 297 ? 18.856  19.949  53.978  1.00 28.15 ? 297  ASP B O   1 
ATOM   4919  C  CB  . ASP B 1 297 ? 20.087  22.110  56.240  1.00 24.41 ? 297  ASP B CB  1 
ATOM   4920  C  CG  . ASP B 1 297 ? 21.441  22.731  55.913  1.00 23.27 ? 297  ASP B CG  1 
ATOM   4921  O  OD1 . ASP B 1 297 ? 21.590  23.371  54.849  1.00 22.53 ? 297  ASP B OD1 1 
ATOM   4922  O  OD2 . ASP B 1 297 ? 22.362  22.586  56.740  1.00 25.40 ? 297  ASP B OD2 1 
ATOM   4923  N  N   . VAL B 1 298 ? 20.596  21.216  53.313  1.00 28.29 ? 298  VAL B N   1 
ATOM   4924  C  CA  . VAL B 1 298 ? 21.097  20.248  52.341  1.00 28.50 ? 298  VAL B CA  1 
ATOM   4925  C  C   . VAL B 1 298 ? 22.580  19.961  52.571  1.00 29.12 ? 298  VAL B C   1 
ATOM   4926  O  O   . VAL B 1 298 ? 23.223  20.591  53.411  1.00 29.35 ? 298  VAL B O   1 
ATOM   4927  C  CB  . VAL B 1 298 ? 20.909  20.746  50.885  1.00 26.79 ? 298  VAL B CB  1 
ATOM   4928  C  CG1 . VAL B 1 298 ? 19.436  20.994  50.592  1.00 26.43 ? 298  VAL B CG1 1 
ATOM   4929  C  CG2 . VAL B 1 298 ? 21.732  22.004  50.641  1.00 25.66 ? 298  VAL B CG2 1 
ATOM   4930  N  N   . GLY B 1 299 ? 23.114  19.014  51.808  1.00 30.92 ? 299  GLY B N   1 
ATOM   4931  C  CA  . GLY B 1 299 ? 24.515  18.657  51.927  1.00 33.17 ? 299  GLY B CA  1 
ATOM   4932  C  C   . GLY B 1 299 ? 25.021  18.002  50.658  1.00 35.44 ? 299  GLY B C   1 
ATOM   4933  O  O   . GLY B 1 299 ? 24.252  17.374  49.928  1.00 37.19 ? 299  GLY B O   1 
ATOM   4934  N  N   . GLY B 1 300 ? 26.315  18.156  50.390  1.00 36.07 ? 300  GLY B N   1 
ATOM   4935  C  CA  . GLY B 1 300 ? 26.906  17.569  49.199  1.00 36.72 ? 300  GLY B CA  1 
ATOM   4936  C  C   . GLY B 1 300 ? 26.976  16.054  49.256  1.00 37.17 ? 300  GLY B C   1 
ATOM   4937  O  O   . GLY B 1 300 ? 26.894  15.385  48.226  1.00 36.83 ? 300  GLY B O   1 
ATOM   4938  N  N   . ALA B 1 301 ? 27.130  15.518  50.464  1.00 38.18 ? 301  ALA B N   1 
ATOM   4939  C  CA  . ALA B 1 301 ? 27.211  14.076  50.672  1.00 38.82 ? 301  ALA B CA  1 
ATOM   4940  C  C   . ALA B 1 301 ? 25.896  13.490  51.188  1.00 39.63 ? 301  ALA B C   1 
ATOM   4941  O  O   . ALA B 1 301 ? 25.837  12.317  51.558  1.00 40.17 ? 301  ALA B O   1 
ATOM   4942  C  CB  . ALA B 1 301 ? 28.346  13.749  51.635  1.00 39.74 ? 301  ALA B CB  1 
ATOM   4943  N  N   . ILE B 1 302 ? 24.851  14.314  51.223  1.00 40.66 ? 302  ILE B N   1 
ATOM   4944  C  CA  . ILE B 1 302 ? 23.539  13.872  51.689  1.00 42.15 ? 302  ILE B CA  1 
ATOM   4945  C  C   . ILE B 1 302 ? 22.628  13.626  50.484  1.00 42.99 ? 302  ILE B C   1 
ATOM   4946  O  O   . ILE B 1 302 ? 21.988  14.549  49.974  1.00 42.78 ? 302  ILE B O   1 
ATOM   4947  C  CB  . ILE B 1 302 ? 22.879  14.916  52.629  1.00 42.47 ? 302  ILE B CB  1 
ATOM   4948  C  CG1 . ILE B 1 302 ? 23.867  15.373  53.709  1.00 42.51 ? 302  ILE B CG1 1 
ATOM   4949  C  CG2 . ILE B 1 302 ? 21.636  14.323  53.281  1.00 42.97 ? 302  ILE B CG2 1 
ATOM   4950  C  CD1 . ILE B 1 302 ? 24.360  14.271  54.622  1.00 43.66 ? 302  ILE B CD1 1 
ATOM   4951  N  N   . LYS B 1 303 ? 22.598  12.380  50.019  1.00 44.88 ? 303  LYS B N   1 
ATOM   4952  C  CA  . LYS B 1 303 ? 21.781  11.998  48.870  1.00 46.92 ? 303  LYS B CA  1 
ATOM   4953  C  C   . LYS B 1 303 ? 20.957  10.749  49.176  1.00 48.65 ? 303  LYS B C   1 
ATOM   4954  O  O   . LYS B 1 303 ? 21.376  9.894   49.958  1.00 49.76 ? 303  LYS B O   1 
ATOM   4955  C  CB  . LYS B 1 303 ? 22.669  11.728  47.648  1.00 47.20 ? 303  LYS B CB  1 
ATOM   4956  C  CG  . LYS B 1 303 ? 23.627  12.857  47.282  1.00 49.46 ? 303  LYS B CG  1 
ATOM   4957  C  CD  . LYS B 1 303 ? 22.888  14.144  46.937  1.00 52.81 ? 303  LYS B CD  1 
ATOM   4958  C  CE  . LYS B 1 303 ? 23.861  15.292  46.705  1.00 52.09 ? 303  LYS B CE  1 
ATOM   4959  N  NZ  . LYS B 1 303 ? 23.158  16.583  46.476  1.00 52.74 ? 303  LYS B NZ  1 
ATOM   4960  N  N   . GLY B 1 304 ? 19.785  10.655  48.553  1.00 49.44 ? 304  GLY B N   1 
ATOM   4961  C  CA  . GLY B 1 304 ? 18.915  9.508   48.751  1.00 50.83 ? 304  GLY B CA  1 
ATOM   4962  C  C   . GLY B 1 304 ? 18.409  9.325   50.171  1.00 52.17 ? 304  GLY B C   1 
ATOM   4963  O  O   . GLY B 1 304 ? 18.122  10.299  50.869  1.00 52.40 ? 304  GLY B O   1 
ATOM   4964  N  N   . GLN B 1 305 ? 18.295  8.066   50.589  1.00 53.61 ? 305  GLN B N   1 
ATOM   4965  C  CA  . GLN B 1 305 ? 17.821  7.718   51.928  1.00 55.24 ? 305  GLN B CA  1 
ATOM   4966  C  C   . GLN B 1 305 ? 18.917  7.987   52.960  1.00 55.23 ? 305  GLN B C   1 
ATOM   4967  O  O   . GLN B 1 305 ? 19.546  7.059   53.474  1.00 56.49 ? 305  GLN B O   1 
ATOM   4968  C  CB  . GLN B 1 305 ? 17.410  6.240   51.974  1.00 56.41 ? 305  GLN B CB  1 
ATOM   4969  C  CG  . GLN B 1 305 ? 16.346  5.831   50.956  1.00 57.66 ? 305  GLN B CG  1 
ATOM   4970  C  CD  . GLN B 1 305 ? 14.964  6.373   51.284  1.00 58.19 ? 305  GLN B CD  1 
ATOM   4971  O  OE1 . GLN B 1 305 ? 14.278  5.862   52.171  1.00 56.98 ? 305  GLN B OE1 1 
ATOM   4972  N  NE2 . GLN B 1 305 ? 14.544  7.405   50.559  1.00 58.64 ? 305  GLN B NE2 1 
ATOM   4973  N  N   . HIS B 1 306 ? 19.130  9.264   53.268  1.00 54.12 ? 306  HIS B N   1 
ATOM   4974  C  CA  . HIS B 1 306 ? 20.157  9.666   54.221  1.00 52.02 ? 306  HIS B CA  1 
ATOM   4975  C  C   . HIS B 1 306 ? 19.833  11.024  54.840  1.00 50.58 ? 306  HIS B C   1 
ATOM   4976  O  O   . HIS B 1 306 ? 19.394  11.944  54.145  1.00 51.48 ? 306  HIS B O   1 
ATOM   4977  C  CB  . HIS B 1 306 ? 21.515  9.725   53.514  1.00 54.09 ? 306  HIS B CB  1 
ATOM   4978  C  CG  . HIS B 1 306 ? 22.655  10.090  54.412  1.00 55.56 ? 306  HIS B CG  1 
ATOM   4979  N  ND1 . HIS B 1 306 ? 22.729  9.680   55.726  1.00 56.04 ? 306  HIS B ND1 1 
ATOM   4980  C  CD2 . HIS B 1 306 ? 23.770  10.822  54.183  1.00 56.11 ? 306  HIS B CD2 1 
ATOM   4981  C  CE1 . HIS B 1 306 ? 23.841  10.144  56.267  1.00 55.90 ? 306  HIS B CE1 1 
ATOM   4982  N  NE2 . HIS B 1 306 ? 24.491  10.841  55.352  1.00 56.00 ? 306  HIS B NE2 1 
ATOM   4983  N  N   . PHE B 1 307 ? 20.051  11.138  56.148  1.00 47.70 ? 307  PHE B N   1 
ATOM   4984  C  CA  . PHE B 1 307 ? 19.790  12.377  56.877  1.00 44.27 ? 307  PHE B CA  1 
ATOM   4985  C  C   . PHE B 1 307 ? 20.966  12.801  57.745  1.00 41.30 ? 307  PHE B C   1 
ATOM   4986  O  O   . PHE B 1 307 ? 21.696  11.963  58.276  1.00 41.12 ? 307  PHE B O   1 
ATOM   4987  C  CB  . PHE B 1 307 ? 18.549  12.236  57.765  1.00 44.96 ? 307  PHE B CB  1 
ATOM   4988  C  CG  . PHE B 1 307 ? 17.265  12.120  57.001  1.00 46.61 ? 307  PHE B CG  1 
ATOM   4989  C  CD1 . PHE B 1 307 ? 16.847  13.143  56.158  1.00 46.94 ? 307  PHE B CD1 1 
ATOM   4990  C  CD2 . PHE B 1 307 ? 16.472  10.985  57.121  1.00 47.29 ? 307  PHE B CD2 1 
ATOM   4991  C  CE1 . PHE B 1 307 ? 15.658  13.038  55.445  1.00 47.12 ? 307  PHE B CE1 1 
ATOM   4992  C  CE2 . PHE B 1 307 ? 15.281  10.871  56.412  1.00 47.72 ? 307  PHE B CE2 1 
ATOM   4993  C  CZ  . PHE B 1 307 ? 14.874  11.900  55.572  1.00 46.11 ? 307  PHE B CZ  1 
ATOM   4994  N  N   . ALA B 1 308 ? 21.137  14.112  57.879  1.00 37.70 ? 308  ALA B N   1 
ATOM   4995  C  CA  . ALA B 1 308 ? 22.200  14.680  58.695  1.00 34.51 ? 308  ALA B CA  1 
ATOM   4996  C  C   . ALA B 1 308 ? 21.544  15.463  59.822  1.00 32.51 ? 308  ALA B C   1 
ATOM   4997  O  O   . ALA B 1 308 ? 21.047  16.570  59.616  1.00 32.89 ? 308  ALA B O   1 
ATOM   4998  C  CB  . ALA B 1 308 ? 23.089  15.591  57.858  1.00 35.15 ? 308  ALA B CB  1 
ATOM   4999  N  N   . ILE B 1 309 ? 21.519  14.866  61.008  1.00 30.82 ? 309  ILE B N   1 
ATOM   5000  C  CA  . ILE B 1 309 ? 20.908  15.488  62.177  1.00 29.04 ? 309  ILE B CA  1 
ATOM   5001  C  C   . ILE B 1 309 ? 21.731  16.649  62.724  1.00 27.78 ? 309  ILE B C   1 
ATOM   5002  O  O   . ILE B 1 309 ? 22.897  16.482  63.088  1.00 28.38 ? 309  ILE B O   1 
ATOM   5003  C  CB  . ILE B 1 309 ? 20.684  14.455  63.306  1.00 29.19 ? 309  ILE B CB  1 
ATOM   5004  C  CG1 . ILE B 1 309 ? 19.896  13.254  62.771  1.00 28.84 ? 309  ILE B CG1 1 
ATOM   5005  C  CG2 . ILE B 1 309 ? 19.938  15.100  64.472  1.00 26.36 ? 309  ILE B CG2 1 
ATOM   5006  C  CD1 . ILE B 1 309 ? 19.792  12.102  63.747  1.00 27.74 ? 309  ILE B CD1 1 
ATOM   5007  N  N   . TYR B 1 310 ? 21.118  17.829  62.756  1.00 26.14 ? 310  TYR B N   1 
ATOM   5008  C  CA  . TYR B 1 310 ? 21.770  19.023  63.278  1.00 24.71 ? 310  TYR B CA  1 
ATOM   5009  C  C   . TYR B 1 310 ? 21.767  18.927  64.800  1.00 24.54 ? 310  TYR B C   1 
ATOM   5010  O  O   . TYR B 1 310 ? 20.727  19.088  65.439  1.00 23.88 ? 310  TYR B O   1 
ATOM   5011  C  CB  . TYR B 1 310 ? 21.028  20.281  62.822  1.00 23.36 ? 310  TYR B CB  1 
ATOM   5012  C  CG  . TYR B 1 310 ? 21.590  21.559  63.399  1.00 21.28 ? 310  TYR B CG  1 
ATOM   5013  C  CD1 . TYR B 1 310 ? 22.849  22.025  63.017  1.00 18.80 ? 310  TYR B CD1 1 
ATOM   5014  C  CD2 . TYR B 1 310 ? 20.875  22.288  64.347  1.00 20.07 ? 310  TYR B CD2 1 
ATOM   5015  C  CE1 . TYR B 1 310 ? 23.381  23.184  63.570  1.00 18.23 ? 310  TYR B CE1 1 
ATOM   5016  C  CE2 . TYR B 1 310 ? 21.399  23.448  64.906  1.00 20.69 ? 310  TYR B CE2 1 
ATOM   5017  C  CZ  . TYR B 1 310 ? 22.651  23.888  64.514  1.00 18.88 ? 310  TYR B CZ  1 
ATOM   5018  O  OH  . TYR B 1 310 ? 23.169  25.029  65.074  1.00 20.32 ? 310  TYR B OH  1 
ATOM   5019  N  N   . GLN B 1 311 ? 22.936  18.653  65.370  1.00 24.01 ? 311  GLN B N   1 
ATOM   5020  C  CA  . GLN B 1 311 ? 23.078  18.504  66.814  1.00 24.14 ? 311  GLN B CA  1 
ATOM   5021  C  C   . GLN B 1 311 ? 22.936  19.797  67.607  1.00 23.63 ? 311  GLN B C   1 
ATOM   5022  O  O   . GLN B 1 311 ? 22.280  19.815  68.650  1.00 24.94 ? 311  GLN B O   1 
ATOM   5023  C  CB  . GLN B 1 311 ? 24.406  17.823  67.144  1.00 25.01 ? 311  GLN B CB  1 
ATOM   5024  C  CG  . GLN B 1 311 ? 24.536  16.418  66.573  1.00 25.27 ? 311  GLN B CG  1 
ATOM   5025  C  CD  . GLN B 1 311 ? 23.500  15.453  67.120  1.00 25.82 ? 311  GLN B CD  1 
ATOM   5026  O  OE1 . GLN B 1 311 ? 23.122  15.525  68.288  1.00 25.29 ? 311  GLN B OE1 1 
ATOM   5027  N  NE2 . GLN B 1 311 ? 23.041  14.538  66.274  1.00 27.49 ? 311  GLN B NE2 1 
ATOM   5028  N  N   . GLY B 1 312 ? 23.563  20.868  67.128  1.00 23.43 ? 312  GLY B N   1 
ATOM   5029  C  CA  . GLY B 1 312 ? 23.472  22.140  67.823  1.00 23.84 ? 312  GLY B CA  1 
ATOM   5030  C  C   . GLY B 1 312 ? 24.697  23.027  67.716  1.00 23.95 ? 312  GLY B C   1 
ATOM   5031  O  O   . GLY B 1 312 ? 25.404  23.013  66.711  1.00 24.93 ? 312  GLY B O   1 
ATOM   5032  N  N   . ILE B 1 313 ? 24.945  23.801  68.769  1.00 25.15 ? 313  ILE B N   1 
ATOM   5033  C  CA  . ILE B 1 313 ? 26.078  24.721  68.820  1.00 23.99 ? 313  ILE B CA  1 
ATOM   5034  C  C   . ILE B 1 313 ? 26.967  24.404  70.022  1.00 25.65 ? 313  ILE B C   1 
ATOM   5035  O  O   . ILE B 1 313 ? 26.470  24.219  71.135  1.00 26.48 ? 313  ILE B O   1 
ATOM   5036  C  CB  . ILE B 1 313 ? 25.595  26.187  68.963  1.00 21.62 ? 313  ILE B CB  1 
ATOM   5037  C  CG1 . ILE B 1 313 ? 24.524  26.501  67.915  1.00 18.65 ? 313  ILE B CG1 1 
ATOM   5038  C  CG2 . ILE B 1 313 ? 26.773  27.145  68.824  1.00 18.80 ? 313  ILE B CG2 1 
ATOM   5039  C  CD1 . ILE B 1 313 ? 23.779  27.794  68.169  1.00 17.23 ? 313  ILE B CD1 1 
ATOM   5040  N  N   . GLY B 1 314 ? 28.277  24.342  69.794  1.00 26.79 ? 314  GLY B N   1 
ATOM   5041  C  CA  . GLY B 1 314 ? 29.201  24.070  70.881  1.00 28.84 ? 314  GLY B CA  1 
ATOM   5042  C  C   . GLY B 1 314 ? 29.954  22.752  70.820  1.00 30.68 ? 314  GLY B C   1 
ATOM   5043  O  O   . GLY B 1 314 ? 29.737  21.946  69.915  1.00 29.97 ? 314  GLY B O   1 
ATOM   5044  N  N   . PRO B 1 315 ? 30.855  22.510  71.789  1.00 31.42 ? 315  PRO B N   1 
ATOM   5045  C  CA  . PRO B 1 315 ? 31.685  21.306  71.914  1.00 32.78 ? 315  PRO B CA  1 
ATOM   5046  C  C   . PRO B 1 315 ? 30.867  20.039  72.134  1.00 33.22 ? 315  PRO B C   1 
ATOM   5047  O  O   . PRO B 1 315 ? 31.081  19.033  71.459  1.00 33.18 ? 315  PRO B O   1 
ATOM   5048  C  CB  . PRO B 1 315 ? 32.547  21.616  73.141  1.00 32.78 ? 315  PRO B CB  1 
ATOM   5049  C  CG  . PRO B 1 315 ? 32.629  23.100  73.134  1.00 32.58 ? 315  PRO B CG  1 
ATOM   5050  C  CD  . PRO B 1 315 ? 31.210  23.481  72.836  1.00 30.96 ? 315  PRO B CD  1 
ATOM   5051  N  N   . GLU B 1 316 ? 29.942  20.095  73.090  1.00 35.21 ? 316  GLU B N   1 
ATOM   5052  C  CA  . GLU B 1 316 ? 29.082  18.959  73.416  1.00 36.67 ? 316  GLU B CA  1 
ATOM   5053  C  C   . GLU B 1 316 ? 28.257  18.527  72.208  1.00 34.70 ? 316  GLU B C   1 
ATOM   5054  O  O   . GLU B 1 316 ? 27.994  17.339  72.019  1.00 33.66 ? 316  GLU B O   1 
ATOM   5055  C  CB  . GLU B 1 316 ? 28.166  19.307  74.593  1.00 40.84 ? 316  GLU B CB  1 
ATOM   5056  C  CG  . GLU B 1 316 ? 28.915  19.629  75.882  1.00 46.89 ? 316  GLU B CG  1 
ATOM   5057  C  CD  . GLU B 1 316 ? 27.992  20.018  77.023  1.00 50.01 ? 316  GLU B CD  1 
ATOM   5058  O  OE1 . GLU B 1 316 ? 27.230  19.149  77.500  1.00 51.11 ? 316  GLU B OE1 1 
ATOM   5059  O  OE2 . GLU B 1 316 ? 28.035  21.192  77.447  1.00 51.51 ? 316  GLU B OE2 1 
ATOM   5060  N  N   . ALA B 1 317 ? 27.861  19.500  71.392  1.00 33.40 ? 317  ALA B N   1 
ATOM   5061  C  CA  . ALA B 1 317 ? 27.087  19.234  70.185  1.00 31.75 ? 317  ALA B CA  1 
ATOM   5062  C  C   . ALA B 1 317 ? 27.998  18.607  69.130  1.00 30.33 ? 317  ALA B C   1 
ATOM   5063  O  O   . ALA B 1 317 ? 27.541  17.863  68.262  1.00 28.58 ? 317  ALA B O   1 
ATOM   5064  C  CB  . ALA B 1 317 ? 26.479  20.526  69.658  1.00 30.99 ? 317  ALA B CB  1 
ATOM   5065  N  N   . GLY B 1 318 ? 29.289  18.918  69.223  1.00 29.42 ? 318  GLY B N   1 
ATOM   5066  C  CA  . GLY B 1 318 ? 30.267  18.386  68.292  1.00 30.33 ? 318  GLY B CA  1 
ATOM   5067  C  C   . GLY B 1 318 ? 30.654  16.955  68.599  1.00 30.30 ? 318  GLY B C   1 
ATOM   5068  O  O   . GLY B 1 318 ? 30.858  16.154  67.687  1.00 30.50 ? 318  GLY B O   1 
ATOM   5069  N  N   . HIS B 1 319 ? 30.772  16.642  69.888  1.00 30.90 ? 319  HIS B N   1 
ATOM   5070  C  CA  . HIS B 1 319 ? 31.125  15.298  70.337  1.00 31.81 ? 319  HIS B CA  1 
ATOM   5071  C  C   . HIS B 1 319 ? 30.002  14.343  69.950  1.00 30.51 ? 319  HIS B C   1 
ATOM   5072  O  O   . HIS B 1 319 ? 30.244  13.238  69.472  1.00 30.86 ? 319  HIS B O   1 
ATOM   5073  C  CB  . HIS B 1 319 ? 31.309  15.272  71.859  1.00 33.32 ? 319  HIS B CB  1 
ATOM   5074  C  CG  . HIS B 1 319 ? 32.318  16.254  72.367  1.00 37.05 ? 319  HIS B CG  1 
ATOM   5075  N  ND1 . HIS B 1 319 ? 33.404  16.662  71.622  1.00 38.81 ? 319  HIS B ND1 1 
ATOM   5076  C  CD2 . HIS B 1 319 ? 32.403  16.913  73.547  1.00 38.77 ? 319  HIS B CD2 1 
ATOM   5077  C  CE1 . HIS B 1 319 ? 34.113  17.532  72.320  1.00 39.95 ? 319  HIS B CE1 1 
ATOM   5078  N  NE2 . HIS B 1 319 ? 33.527  17.701  73.492  1.00 40.68 ? 319  HIS B NE2 1 
ATOM   5079  N  N   . ARG B 1 320 ? 28.772  14.803  70.147  1.00 29.16 ? 320  ARG B N   1 
ATOM   5080  C  CA  . ARG B 1 320 ? 27.575  14.035  69.838  1.00 29.16 ? 320  ARG B CA  1 
ATOM   5081  C  C   . ARG B 1 320 ? 27.404  13.855  68.327  1.00 29.22 ? 320  ARG B C   1 
ATOM   5082  O  O   . ARG B 1 320 ? 26.890  12.834  67.872  1.00 30.01 ? 320  ARG B O   1 
ATOM   5083  C  CB  . ARG B 1 320 ? 26.361  14.749  70.441  1.00 28.93 ? 320  ARG B CB  1 
ATOM   5084  C  CG  . ARG B 1 320 ? 25.046  13.989  70.388  1.00 30.52 ? 320  ARG B CG  1 
ATOM   5085  C  CD  . ARG B 1 320 ? 23.990  14.672  71.260  1.00 28.51 ? 320  ARG B CD  1 
ATOM   5086  N  NE  . ARG B 1 320 ? 23.786  16.077  70.900  1.00 27.51 ? 320  ARG B NE  1 
ATOM   5087  C  CZ  . ARG B 1 320 ? 23.932  17.102  71.738  1.00 25.13 ? 320  ARG B CZ  1 
ATOM   5088  N  NH1 . ARG B 1 320 ? 24.285  16.896  72.999  1.00 25.02 ? 320  ARG B NH1 1 
ATOM   5089  N  NH2 . ARG B 1 320 ? 23.731  18.340  71.311  1.00 24.86 ? 320  ARG B NH2 1 
ATOM   5090  N  N   . ALA B 1 321 ? 27.872  14.836  67.558  1.00 30.37 ? 321  ALA B N   1 
ATOM   5091  C  CA  . ALA B 1 321 ? 27.770  14.804  66.099  1.00 30.60 ? 321  ALA B CA  1 
ATOM   5092  C  C   . ALA B 1 321 ? 28.826  13.925  65.434  1.00 31.92 ? 321  ALA B C   1 
ATOM   5093  O  O   . ALA B 1 321 ? 28.531  13.204  64.478  1.00 31.97 ? 321  ALA B O   1 
ATOM   5094  C  CB  . ALA B 1 321 ? 27.839  16.216  65.541  1.00 28.81 ? 321  ALA B CB  1 
ATOM   5095  N  N   . GLY B 1 322 ? 30.056  14.006  65.935  1.00 32.16 ? 322  GLY B N   1 
ATOM   5096  C  CA  . GLY B 1 322 ? 31.150  13.221  65.388  1.00 33.09 ? 322  GLY B CA  1 
ATOM   5097  C  C   . GLY B 1 322 ? 31.173  11.756  65.785  1.00 33.55 ? 322  GLY B C   1 
ATOM   5098  O  O   . GLY B 1 322 ? 32.203  11.250  66.237  1.00 33.96 ? 322  GLY B O   1 
ATOM   5099  N  N   . TRP B 1 323 ? 30.032  11.087  65.655  1.00 34.07 ? 323  TRP B N   1 
ATOM   5100  C  CA  . TRP B 1 323 ? 29.914  9.669   65.975  1.00 34.74 ? 323  TRP B CA  1 
ATOM   5101  C  C   . TRP B 1 323 ? 28.931  9.009   65.027  1.00 35.41 ? 323  TRP B C   1 
ATOM   5102  O  O   . TRP B 1 323 ? 29.174  7.910   64.535  1.00 35.73 ? 323  TRP B O   1 
ATOM   5103  C  CB  . TRP B 1 323 ? 29.409  9.463   67.401  1.00 34.14 ? 323  TRP B CB  1 
ATOM   5104  C  CG  . TRP B 1 323 ? 30.431  9.628   68.470  1.00 34.83 ? 323  TRP B CG  1 
ATOM   5105  C  CD1 . TRP B 1 323 ? 30.310  10.387  69.591  1.00 34.17 ? 323  TRP B CD1 1 
ATOM   5106  C  CD2 . TRP B 1 323 ? 31.708  8.977   68.559  1.00 35.76 ? 323  TRP B CD2 1 
ATOM   5107  N  NE1 . TRP B 1 323 ? 31.423  10.251  70.382  1.00 35.48 ? 323  TRP B NE1 1 
ATOM   5108  C  CE2 . TRP B 1 323 ? 32.299  9.391   69.773  1.00 35.65 ? 323  TRP B CE2 1 
ATOM   5109  C  CE3 . TRP B 1 323 ? 32.407  8.081   67.737  1.00 35.31 ? 323  TRP B CE3 1 
ATOM   5110  C  CZ2 . TRP B 1 323 ? 33.556  8.943   70.187  1.00 35.51 ? 323  TRP B CZ2 1 
ATOM   5111  C  CZ3 . TRP B 1 323 ? 33.660  7.634   68.152  1.00 35.35 ? 323  TRP B CZ3 1 
ATOM   5112  C  CH2 . TRP B 1 323 ? 34.219  8.067   69.367  1.00 34.14 ? 323  TRP B CH2 1 
ATOM   5113  N  N   . TYR B 1 324 ? 27.837  9.714   64.754  1.00 36.96 ? 324  TYR B N   1 
ATOM   5114  C  CA  . TYR B 1 324 ? 26.759  9.225   63.902  1.00 38.70 ? 324  TYR B CA  1 
ATOM   5115  C  C   . TYR B 1 324 ? 27.021  8.709   62.484  1.00 40.07 ? 324  TYR B C   1 
ATOM   5116  O  O   . TYR B 1 324 ? 27.220  9.477   61.537  1.00 38.94 ? 324  TYR B O   1 
ATOM   5117  C  CB  . TYR B 1 324 ? 25.606  10.234  63.886  1.00 38.44 ? 324  TYR B CB  1 
ATOM   5118  C  CG  . TYR B 1 324 ? 24.700  10.140  65.096  1.00 39.05 ? 324  TYR B CG  1 
ATOM   5119  C  CD1 . TYR B 1 324 ? 23.658  9.213   65.139  1.00 39.14 ? 324  TYR B CD1 1 
ATOM   5120  C  CD2 . TYR B 1 324 ? 24.885  10.974  66.199  1.00 38.79 ? 324  TYR B CD2 1 
ATOM   5121  C  CE1 . TYR B 1 324 ? 22.819  9.118   66.252  1.00 39.23 ? 324  TYR B CE1 1 
ATOM   5122  C  CE2 . TYR B 1 324 ? 24.053  10.888  67.318  1.00 38.66 ? 324  TYR B CE2 1 
ATOM   5123  C  CZ  . TYR B 1 324 ? 23.022  9.959   67.339  1.00 39.97 ? 324  TYR B CZ  1 
ATOM   5124  O  OH  . TYR B 1 324 ? 22.199  9.877   68.442  1.00 39.62 ? 324  TYR B OH  1 
ATOM   5125  N  N   . ASN B 1 325 ? 27.041  7.383   62.381  1.00 41.19 ? 325  ASN B N   1 
ATOM   5126  C  CA  . ASN B 1 325 ? 27.193  6.653   61.127  1.00 41.34 ? 325  ASN B CA  1 
ATOM   5127  C  C   . ASN B 1 325 ? 26.299  5.422   61.315  1.00 41.58 ? 325  ASN B C   1 
ATOM   5128  O  O   . ASN B 1 325 ? 26.530  4.363   60.729  1.00 42.29 ? 325  ASN B O   1 
ATOM   5129  C  CB  . ASN B 1 325 ? 28.646  6.225   60.901  1.00 42.62 ? 325  ASN B CB  1 
ATOM   5130  C  CG  . ASN B 1 325 ? 28.904  5.771   59.471  1.00 43.01 ? 325  ASN B CG  1 
ATOM   5131  O  OD1 . ASN B 1 325 ? 28.005  5.791   58.628  1.00 43.22 ? 325  ASN B OD1 1 
ATOM   5132  N  ND2 . ASN B 1 325 ? 30.139  5.371   59.191  1.00 41.58 ? 325  ASN B ND2 1 
ATOM   5133  N  N   . HIS B 1 326 ? 25.268  5.590   62.144  1.00 42.18 ? 326  HIS B N   1 
ATOM   5134  C  CA  . HIS B 1 326 ? 24.326  4.523   62.480  1.00 41.20 ? 326  HIS B CA  1 
ATOM   5135  C  C   . HIS B 1 326 ? 23.006  4.556   61.701  1.00 40.70 ? 326  HIS B C   1 
ATOM   5136  O  O   . HIS B 1 326 ? 22.822  5.377   60.803  1.00 40.23 ? 326  HIS B O   1 
ATOM   5137  C  CB  . HIS B 1 326 ? 24.049  4.545   63.988  1.00 40.62 ? 326  HIS B CB  1 
ATOM   5138  C  CG  . HIS B 1 326 ? 25.287  4.489   64.832  1.00 39.65 ? 326  HIS B CG  1 
ATOM   5139  N  ND1 . HIS B 1 326 ? 26.419  5.222   64.545  1.00 39.01 ? 326  HIS B ND1 1 
ATOM   5140  C  CD2 . HIS B 1 326 ? 25.573  3.780   65.948  1.00 39.55 ? 326  HIS B CD2 1 
ATOM   5141  C  CE1 . HIS B 1 326 ? 27.349  4.964   65.446  1.00 38.61 ? 326  HIS B CE1 1 
ATOM   5142  N  NE2 . HIS B 1 326 ? 26.861  4.092   66.309  1.00 40.07 ? 326  HIS B NE2 1 
ATOM   5143  N  N   . TYR B 1 327 ? 22.092  3.653   62.055  1.00 40.47 ? 327  TYR B N   1 
ATOM   5144  C  CA  . TYR B 1 327 ? 20.791  3.553   61.392  1.00 40.37 ? 327  TYR B CA  1 
ATOM   5145  C  C   . TYR B 1 327 ? 19.618  3.676   62.361  1.00 40.81 ? 327  TYR B C   1 
ATOM   5146  O  O   . TYR B 1 327 ? 19.787  3.582   63.577  1.00 40.95 ? 327  TYR B O   1 
ATOM   5147  C  CB  . TYR B 1 327 ? 20.671  2.221   60.648  1.00 40.80 ? 327  TYR B CB  1 
ATOM   5148  C  CG  . TYR B 1 327 ? 21.702  2.003   59.564  1.00 42.98 ? 327  TYR B CG  1 
ATOM   5149  C  CD1 . TYR B 1 327 ? 23.025  1.699   59.883  1.00 42.55 ? 327  TYR B CD1 1 
ATOM   5150  C  CD2 . TYR B 1 327 ? 21.350  2.080   58.218  1.00 44.20 ? 327  TYR B CD2 1 
ATOM   5151  C  CE1 . TYR B 1 327 ? 23.974  1.475   58.890  1.00 44.30 ? 327  TYR B CE1 1 
ATOM   5152  C  CE2 . TYR B 1 327 ? 22.291  1.855   57.215  1.00 46.58 ? 327  TYR B CE2 1 
ATOM   5153  C  CZ  . TYR B 1 327 ? 23.601  1.553   57.560  1.00 46.88 ? 327  TYR B CZ  1 
ATOM   5154  O  OH  . TYR B 1 327 ? 24.538  1.331   56.575  1.00 51.11 ? 327  TYR B OH  1 
ATOM   5155  N  N   . GLY B 1 328 ? 18.425  3.857   61.800  1.00 40.07 ? 328  GLY B N   1 
ATOM   5156  C  CA  . GLY B 1 328 ? 17.219  3.985   62.599  1.00 39.99 ? 328  GLY B CA  1 
ATOM   5157  C  C   . GLY B 1 328 ? 16.006  4.165   61.708  1.00 40.65 ? 328  GLY B C   1 
ATOM   5158  O  O   . GLY B 1 328 ? 16.145  4.466   60.521  1.00 42.63 ? 328  GLY B O   1 
ATOM   5159  N  N   . ARG B 1 329 ? 14.815  3.970   62.269  1.00 40.23 ? 329  ARG B N   1 
ATOM   5160  C  CA  . ARG B 1 329 ? 13.578  4.120   61.507  1.00 39.04 ? 329  ARG B CA  1 
ATOM   5161  C  C   . ARG B 1 329 ? 13.130  5.578   61.434  1.00 37.53 ? 329  ARG B C   1 
ATOM   5162  O  O   . ARG B 1 329 ? 13.472  6.386   62.298  1.00 36.84 ? 329  ARG B O   1 
ATOM   5163  C  CB  . ARG B 1 329 ? 12.455  3.264   62.106  1.00 39.66 ? 329  ARG B CB  1 
ATOM   5164  C  CG  . ARG B 1 329 ? 12.733  1.767   62.130  1.00 39.61 ? 329  ARG B CG  1 
ATOM   5165  C  CD  . ARG B 1 329 ? 13.315  1.333   63.462  1.00 40.26 ? 329  ARG B CD  1 
ATOM   5166  N  NE  . ARG B 1 329 ? 12.376  1.551   64.559  1.00 42.78 ? 329  ARG B NE  1 
ATOM   5167  C  CZ  . ARG B 1 329 ? 12.670  1.377   65.844  1.00 42.67 ? 329  ARG B CZ  1 
ATOM   5168  N  NH1 . ARG B 1 329 ? 13.882  0.981   66.203  1.00 42.66 ? 329  ARG B NH1 1 
ATOM   5169  N  NH2 . ARG B 1 329 ? 11.749  1.594   66.772  1.00 43.11 ? 329  ARG B NH2 1 
ATOM   5170  N  N   . VAL B 1 330 ? 12.358  5.904   60.401  1.00 36.71 ? 330  VAL B N   1 
ATOM   5171  C  CA  . VAL B 1 330 ? 11.858  7.262   60.205  1.00 35.19 ? 330  VAL B CA  1 
ATOM   5172  C  C   . VAL B 1 330 ? 10.545  7.272   59.422  1.00 34.75 ? 330  VAL B C   1 
ATOM   5173  O  O   . VAL B 1 330 ? 10.380  6.533   58.449  1.00 34.32 ? 330  VAL B O   1 
ATOM   5174  C  CB  . VAL B 1 330 ? 12.912  8.154   59.494  1.00 34.37 ? 330  VAL B CB  1 
ATOM   5175  C  CG1 . VAL B 1 330 ? 13.340  7.525   58.183  1.00 35.16 ? 330  VAL B CG1 1 
ATOM   5176  C  CG2 . VAL B 1 330 ? 12.365  9.559   59.270  1.00 33.18 ? 330  VAL B CG2 1 
ATOM   5177  N  N   . TRP B 1 331 ? 9.609   8.101   59.876  1.00 34.52 ? 331  TRP B N   1 
ATOM   5178  C  CA  . TRP B 1 331 ? 8.301   8.226   59.244  1.00 33.94 ? 331  TRP B CA  1 
ATOM   5179  C  C   . TRP B 1 331 ? 8.073   9.648   58.744  1.00 33.06 ? 331  TRP B C   1 
ATOM   5180  O  O   . TRP B 1 331 ? 8.309   10.616  59.467  1.00 31.47 ? 331  TRP B O   1 
ATOM   5181  C  CB  . TRP B 1 331 ? 7.190   7.863   60.237  1.00 35.08 ? 331  TRP B CB  1 
ATOM   5182  C  CG  . TRP B 1 331 ? 7.260   6.468   60.786  1.00 36.55 ? 331  TRP B CG  1 
ATOM   5183  C  CD1 . TRP B 1 331 ? 6.528   5.392   60.377  1.00 37.45 ? 331  TRP B CD1 1 
ATOM   5184  C  CD2 . TRP B 1 331 ? 8.098   6.000   61.852  1.00 36.30 ? 331  TRP B CD2 1 
ATOM   5185  N  NE1 . TRP B 1 331 ? 6.858   4.282   61.117  1.00 38.24 ? 331  TRP B NE1 1 
ATOM   5186  C  CE2 . TRP B 1 331 ? 7.819   4.626   62.030  1.00 36.94 ? 331  TRP B CE2 1 
ATOM   5187  C  CE3 . TRP B 1 331 ? 9.057   6.607   62.675  1.00 35.30 ? 331  TRP B CE3 1 
ATOM   5188  C  CZ2 . TRP B 1 331 ? 8.465   3.849   62.997  1.00 36.24 ? 331  TRP B CZ2 1 
ATOM   5189  C  CZ3 . TRP B 1 331 ? 9.698   5.834   63.636  1.00 34.83 ? 331  TRP B CZ3 1 
ATOM   5190  C  CH2 . TRP B 1 331 ? 9.398   4.469   63.788  1.00 34.97 ? 331  TRP B CH2 1 
ATOM   5191  N  N   . VAL B 1 332 ? 7.622   9.766   57.500  1.00 34.35 ? 332  VAL B N   1 
ATOM   5192  C  CA  . VAL B 1 332 ? 7.338   11.066  56.901  1.00 34.52 ? 332  VAL B CA  1 
ATOM   5193  C  C   . VAL B 1 332 ? 5.880   11.419  57.176  1.00 35.76 ? 332  VAL B C   1 
ATOM   5194  O  O   . VAL B 1 332 ? 4.966   10.841  56.584  1.00 36.17 ? 332  VAL B O   1 
ATOM   5195  C  CB  . VAL B 1 332 ? 7.587   11.050  55.381  1.00 33.35 ? 332  VAL B CB  1 
ATOM   5196  C  CG1 . VAL B 1 332 ? 7.251   12.403  54.775  1.00 34.60 ? 332  VAL B CG1 1 
ATOM   5197  C  CG2 . VAL B 1 332 ? 9.030   10.694  55.097  1.00 32.36 ? 332  VAL B CG2 1 
ATOM   5198  N  N   . LEU B 1 333 ? 5.672   12.360  58.090  1.00 36.50 ? 333  LEU B N   1 
ATOM   5199  C  CA  . LEU B 1 333 ? 4.330   12.787  58.468  1.00 37.37 ? 333  LEU B CA  1 
ATOM   5200  C  C   . LEU B 1 333 ? 3.666   13.674  57.420  1.00 40.08 ? 333  LEU B C   1 
ATOM   5201  O  O   . LEU B 1 333 ? 4.194   14.726  57.052  1.00 39.86 ? 333  LEU B O   1 
ATOM   5202  C  CB  . LEU B 1 333 ? 4.364   13.495  59.823  1.00 35.69 ? 333  LEU B CB  1 
ATOM   5203  C  CG  . LEU B 1 333 ? 4.962   12.674  60.970  1.00 35.01 ? 333  LEU B CG  1 
ATOM   5204  C  CD1 . LEU B 1 333 ? 4.889   13.459  62.267  1.00 35.43 ? 333  LEU B CD1 1 
ATOM   5205  C  CD2 . LEU B 1 333 ? 4.223   11.352  61.108  1.00 34.95 ? 333  LEU B CD2 1 
ATOM   5206  N  N   . LYS B 1 334 ? 2.502   13.234  56.947  1.00 43.39 ? 334  LYS B N   1 
ATOM   5207  C  CA  . LYS B 1 334 ? 1.736   13.959  55.934  1.00 44.45 ? 334  LYS B CA  1 
ATOM   5208  C  C   . LYS B 1 334 ? 0.256   14.058  56.308  1.00 44.40 ? 334  LYS B C   1 
ATOM   5209  O  O   . LYS B 1 334 ? -0.124  13.837  57.460  1.00 44.14 ? 334  LYS B O   1 
ATOM   5210  C  CB  . LYS B 1 334 ? 1.860   13.263  54.574  1.00 44.74 ? 334  LYS B CB  1 
ATOM   5211  C  CG  . LYS B 1 334 ? 3.257   13.239  53.980  1.00 46.10 ? 334  LYS B CG  1 
ATOM   5212  C  CD  . LYS B 1 334 ? 3.280   12.459  52.671  1.00 49.24 ? 334  LYS B CD  1 
ATOM   5213  C  CE  . LYS B 1 334 ? 2.345   13.070  51.636  1.00 51.75 ? 334  LYS B CE  1 
ATOM   5214  N  NZ  . LYS B 1 334 ? 2.322   12.284  50.371  1.00 53.39 ? 334  LYS B NZ  1 
ATOM   5215  N  N   . THR B 1 335 ? -0.570  14.384  55.316  1.00 45.30 ? 335  THR B N   1 
ATOM   5216  C  CA  . THR B 1 335 ? -2.012  14.517  55.500  1.00 45.49 ? 335  THR B CA  1 
ATOM   5217  C  C   . THR B 1 335 ? -2.773  13.352  54.861  1.00 46.22 ? 335  THR B C   1 
ATOM   5218  O  O   . THR B 1 335 ? -2.173  12.357  54.452  1.00 46.68 ? 335  THR B O   1 
ATOM   5219  C  CB  . THR B 1 335 ? -2.534  15.843  54.902  1.00 44.17 ? 335  THR B CB  1 
ATOM   5220  O  OG1 . THR B 1 335 ? -2.188  15.917  53.513  1.00 42.80 ? 335  THR B OG1 1 
ATOM   5221  C  CG2 . THR B 1 335 ? -1.934  17.033  55.637  1.00 43.90 ? 335  THR B CG2 1 
ATOM   5222  N  N   . ALA B 1 336 ? -4.093  13.496  54.771  1.00 47.68 ? 336  ALA B N   1 
ATOM   5223  C  CA  . ALA B 1 336 ? -4.968  12.476  54.196  1.00 48.11 ? 336  ALA B CA  1 
ATOM   5224  C  C   . ALA B 1 336 ? -4.605  12.116  52.754  1.00 49.30 ? 336  ALA B C   1 
ATOM   5225  O  O   . ALA B 1 336 ? -4.167  12.972  51.983  1.00 49.65 ? 336  ALA B O   1 
ATOM   5226  C  CB  . ALA B 1 336 ? -6.419  12.937  54.271  1.00 47.90 ? 336  ALA B CB  1 
ATOM   5227  N  N   . PRO B 1 337 ? -4.772  10.833  52.380  1.00 50.71 ? 337  PRO B N   1 
ATOM   5228  C  CA  . PRO B 1 337 ? -4.475  10.313  51.039  1.00 50.72 ? 337  PRO B CA  1 
ATOM   5229  C  C   . PRO B 1 337 ? -5.519  10.700  49.980  1.00 51.24 ? 337  PRO B C   1 
ATOM   5230  O  O   . PRO B 1 337 ? -5.991  9.807   49.241  1.00 50.44 ? 337  PRO B O   1 
ATOM   5231  C  CB  . PRO B 1 337 ? -4.429  8.802   51.275  1.00 50.94 ? 337  PRO B CB  1 
ATOM   5232  C  CG  . PRO B 1 337 ? -5.473  8.608   52.324  1.00 50.04 ? 337  PRO B CG  1 
ATOM   5233  C  CD  . PRO B 1 337 ? -5.167  9.736   53.285  1.00 50.73 ? 337  PRO B CD  1 
ATOM   5234  N  N   . SER C 1 3   ? 21.932  91.007  51.747  1.00 40.95 ? 3    SER C N   1 
ATOM   5235  C  CA  . SER C 1 3   ? 21.192  89.809  51.248  1.00 41.45 ? 3    SER C CA  1 
ATOM   5236  C  C   . SER C 1 3   ? 21.827  88.506  51.732  1.00 41.10 ? 3    SER C C   1 
ATOM   5237  O  O   . SER C 1 3   ? 21.391  87.417  51.355  1.00 40.18 ? 3    SER C O   1 
ATOM   5238  C  CB  . SER C 1 3   ? 21.132  89.822  49.716  1.00 41.69 ? 3    SER C CB  1 
ATOM   5239  O  OG  . SER C 1 3   ? 22.430  89.771  49.147  1.00 40.69 ? 3    SER C OG  1 
ATOM   5240  N  N   . LYS C 1 4   ? 22.860  88.627  52.562  1.00 41.61 ? 4    LYS C N   1 
ATOM   5241  C  CA  . LYS C 1 4   ? 23.569  87.470  53.105  1.00 41.51 ? 4    LYS C CA  1 
ATOM   5242  C  C   . LYS C 1 4   ? 22.934  86.973  54.405  1.00 40.98 ? 4    LYS C C   1 
ATOM   5243  O  O   . LYS C 1 4   ? 23.035  87.624  55.447  1.00 40.14 ? 4    LYS C O   1 
ATOM   5244  C  CB  . LYS C 1 4   ? 25.043  87.817  53.337  1.00 41.35 ? 4    LYS C CB  1 
ATOM   5245  C  CG  . LYS C 1 4   ? 25.822  88.097  52.057  1.00 40.64 ? 4    LYS C CG  1 
ATOM   5246  C  CD  . LYS C 1 4   ? 27.133  88.818  52.337  1.00 38.35 ? 4    LYS C CD  1 
ATOM   5247  C  CE  . LYS C 1 4   ? 26.887  90.233  52.845  1.00 38.65 ? 4    LYS C CE  1 
ATOM   5248  N  NZ  . LYS C 1 4   ? 28.154  90.979  53.070  1.00 36.80 ? 4    LYS C NZ  1 
ATOM   5249  N  N   . PRO C 1 5   ? 22.260  85.812  54.351  1.00 40.94 ? 5    PRO C N   1 
ATOM   5250  C  CA  . PRO C 1 5   ? 21.596  85.202  55.508  1.00 41.41 ? 5    PRO C CA  1 
ATOM   5251  C  C   . PRO C 1 5   ? 22.578  84.594  56.513  1.00 41.32 ? 5    PRO C C   1 
ATOM   5252  O  O   . PRO C 1 5   ? 23.645  84.106  56.136  1.00 41.93 ? 5    PRO C O   1 
ATOM   5253  C  CB  . PRO C 1 5   ? 20.719  84.133  54.862  1.00 41.46 ? 5    PRO C CB  1 
ATOM   5254  C  CG  . PRO C 1 5   ? 21.544  83.699  53.696  1.00 41.59 ? 5    PRO C CG  1 
ATOM   5255  C  CD  . PRO C 1 5   ? 22.034  85.009  53.135  1.00 40.65 ? 5    PRO C CD  1 
ATOM   5256  N  N   . THR C 1 6   ? 22.210  84.639  57.791  1.00 41.69 ? 6    THR C N   1 
ATOM   5257  C  CA  . THR C 1 6   ? 23.039  84.100  58.870  1.00 41.75 ? 6    THR C CA  1 
ATOM   5258  C  C   . THR C 1 6   ? 22.183  83.332  59.876  1.00 42.00 ? 6    THR C C   1 
ATOM   5259  O  O   . THR C 1 6   ? 22.702  82.714  60.808  1.00 41.00 ? 6    THR C O   1 
ATOM   5260  C  CB  . THR C 1 6   ? 23.781  85.227  59.629  1.00 41.55 ? 6    THR C CB  1 
ATOM   5261  O  OG1 . THR C 1 6   ? 22.838  86.209  60.077  1.00 41.32 ? 6    THR C OG1 1 
ATOM   5262  C  CG2 . THR C 1 6   ? 24.824  85.891  58.737  1.00 39.85 ? 6    THR C CG2 1 
ATOM   5263  N  N   . ASP C 1 7   ? 20.870  83.375  59.666  1.00 43.64 ? 7    ASP C N   1 
ATOM   5264  C  CA  . ASP C 1 7   ? 19.892  82.713  60.526  1.00 45.63 ? 7    ASP C CA  1 
ATOM   5265  C  C   . ASP C 1 7   ? 20.041  81.192  60.583  1.00 46.60 ? 7    ASP C C   1 
ATOM   5266  O  O   . ASP C 1 7   ? 19.726  80.570  61.601  1.00 46.43 ? 7    ASP C O   1 
ATOM   5267  C  CB  . ASP C 1 7   ? 18.475  83.083  60.061  1.00 45.89 ? 7    ASP C CB  1 
ATOM   5268  C  CG  . ASP C 1 7   ? 17.389  82.321  60.805  1.00 46.38 ? 7    ASP C CG  1 
ATOM   5269  O  OD1 . ASP C 1 7   ? 17.227  82.541  62.025  1.00 47.27 ? 7    ASP C OD1 1 
ATOM   5270  O  OD2 . ASP C 1 7   ? 16.694  81.504  60.163  1.00 45.02 ? 7    ASP C OD2 1 
ATOM   5271  N  N   . ARG C 1 8   ? 20.536  80.601  59.499  1.00 47.10 ? 8    ARG C N   1 
ATOM   5272  C  CA  . ARG C 1 8   ? 20.694  79.153  59.427  1.00 46.48 ? 8    ARG C CA  1 
ATOM   5273  C  C   . ARG C 1 8   ? 22.128  78.647  59.596  1.00 45.72 ? 8    ARG C C   1 
ATOM   5274  O  O   . ARG C 1 8   ? 22.436  77.512  59.234  1.00 45.69 ? 8    ARG C O   1 
ATOM   5275  C  CB  . ARG C 1 8   ? 20.086  78.633  58.123  1.00 46.14 ? 8    ARG C CB  1 
ATOM   5276  C  CG  . ARG C 1 8   ? 18.637  79.060  57.925  1.00 48.90 ? 8    ARG C CG  1 
ATOM   5277  C  CD  . ARG C 1 8   ? 18.036  78.488  56.652  1.00 51.01 ? 8    ARG C CD  1 
ATOM   5278  N  NE  . ARG C 1 8   ? 16.680  78.985  56.416  1.00 51.87 ? 8    ARG C NE  1 
ATOM   5279  C  CZ  . ARG C 1 8   ? 15.606  78.616  57.111  1.00 52.22 ? 8    ARG C CZ  1 
ATOM   5280  N  NH1 . ARG C 1 8   ? 15.712  77.737  58.099  1.00 53.26 ? 8    ARG C NH1 1 
ATOM   5281  N  NH2 . ARG C 1 8   ? 14.419  79.130  56.816  1.00 52.85 ? 8    ARG C NH2 1 
ATOM   5282  N  N   . GLY C 1 9   ? 22.994  79.478  60.170  1.00 44.29 ? 9    GLY C N   1 
ATOM   5283  C  CA  . GLY C 1 9   ? 24.375  79.077  60.385  1.00 42.34 ? 9    GLY C CA  1 
ATOM   5284  C  C   . GLY C 1 9   ? 25.355  79.500  59.307  1.00 40.97 ? 9    GLY C C   1 
ATOM   5285  O  O   . GLY C 1 9   ? 26.532  79.142  59.362  1.00 39.34 ? 9    GLY C O   1 
ATOM   5286  N  N   . GLN C 1 10  ? 24.873  80.261  58.328  1.00 39.70 ? 10   GLN C N   1 
ATOM   5287  C  CA  . GLN C 1 10  ? 25.712  80.740  57.232  1.00 38.06 ? 10   GLN C CA  1 
ATOM   5288  C  C   . GLN C 1 10  ? 26.659  81.849  57.695  1.00 39.10 ? 10   GLN C C   1 
ATOM   5289  O  O   . GLN C 1 10  ? 26.383  82.548  58.674  1.00 38.40 ? 10   GLN C O   1 
ATOM   5290  C  CB  . GLN C 1 10  ? 24.836  81.216  56.073  1.00 35.67 ? 10   GLN C CB  1 
ATOM   5291  C  CG  . GLN C 1 10  ? 24.044  80.094  55.421  1.00 31.09 ? 10   GLN C CG  1 
ATOM   5292  C  CD  . GLN C 1 10  ? 22.596  80.459  55.169  1.00 28.32 ? 10   GLN C CD  1 
ATOM   5293  O  OE1 . GLN C 1 10  ? 21.861  80.812  56.092  1.00 27.43 ? 10   GLN C OE1 1 
ATOM   5294  N  NE2 . GLN C 1 10  ? 22.172  80.362  53.915  1.00 27.70 ? 10   GLN C NE2 1 
ATOM   5295  N  N   . GLN C 1 11  ? 27.779  81.996  56.990  1.00 40.85 ? 11   GLN C N   1 
ATOM   5296  C  CA  . GLN C 1 11  ? 28.791  82.996  57.332  1.00 42.98 ? 11   GLN C CA  1 
ATOM   5297  C  C   . GLN C 1 11  ? 29.321  83.744  56.105  1.00 44.16 ? 11   GLN C C   1 
ATOM   5298  O  O   . GLN C 1 11  ? 28.845  83.539  54.989  1.00 44.84 ? 11   GLN C O   1 
ATOM   5299  C  CB  . GLN C 1 11  ? 29.948  82.314  58.071  1.00 42.73 ? 11   GLN C CB  1 
ATOM   5300  C  CG  . GLN C 1 11  ? 29.535  81.641  59.373  1.00 40.52 ? 11   GLN C CG  1 
ATOM   5301  C  CD  . GLN C 1 11  ? 30.442  80.491  59.759  1.00 39.14 ? 11   GLN C CD  1 
ATOM   5302  O  OE1 . GLN C 1 11  ? 30.822  79.677  58.919  1.00 38.79 ? 11   GLN C OE1 1 
ATOM   5303  N  NE2 . GLN C 1 11  ? 30.778  80.408  61.040  1.00 38.01 ? 11   GLN C NE2 1 
ATOM   5304  N  N   . TYR C 1 12  ? 30.275  84.645  56.332  1.00 45.32 ? 12   TYR C N   1 
ATOM   5305  C  CA  . TYR C 1 12  ? 30.883  85.430  55.258  1.00 46.91 ? 12   TYR C CA  1 
ATOM   5306  C  C   . TYR C 1 12  ? 32.380  85.650  55.501  1.00 46.92 ? 12   TYR C C   1 
ATOM   5307  O  O   . TYR C 1 12  ? 33.121  86.009  54.583  1.00 47.54 ? 12   TYR C O   1 
ATOM   5308  C  CB  . TYR C 1 12  ? 30.153  86.775  55.111  1.00 49.55 ? 12   TYR C CB  1 
ATOM   5309  C  CG  . TYR C 1 12  ? 30.663  87.675  53.996  1.00 51.73 ? 12   TYR C CG  1 
ATOM   5310  C  CD1 . TYR C 1 12  ? 31.067  87.148  52.768  1.00 52.92 ? 12   TYR C CD1 1 
ATOM   5311  C  CD2 . TYR C 1 12  ? 30.744  89.056  54.176  1.00 52.24 ? 12   TYR C CD2 1 
ATOM   5312  C  CE1 . TYR C 1 12  ? 31.540  87.974  51.749  1.00 53.30 ? 12   TYR C CE1 1 
ATOM   5313  C  CE2 . TYR C 1 12  ? 31.215  89.889  53.162  1.00 53.16 ? 12   TYR C CE2 1 
ATOM   5314  C  CZ  . TYR C 1 12  ? 31.612  89.341  51.953  1.00 53.63 ? 12   TYR C CZ  1 
ATOM   5315  O  OH  . TYR C 1 12  ? 32.084  90.158  50.950  1.00 55.12 ? 12   TYR C OH  1 
ATOM   5316  N  N   . LYS C 1 13  ? 32.823  85.410  56.733  1.00 46.24 ? 13   LYS C N   1 
ATOM   5317  C  CA  . LYS C 1 13  ? 34.226  85.584  57.116  1.00 44.52 ? 13   LYS C CA  1 
ATOM   5318  C  C   . LYS C 1 13  ? 35.173  84.556  56.486  1.00 43.63 ? 13   LYS C C   1 
ATOM   5319  O  O   . LYS C 1 13  ? 36.261  84.295  57.006  1.00 42.65 ? 13   LYS C O   1 
ATOM   5320  C  CB  . LYS C 1 13  ? 34.357  85.549  58.643  1.00 44.06 ? 13   LYS C CB  1 
ATOM   5321  C  CG  . LYS C 1 13  ? 33.707  84.337  59.291  1.00 42.63 ? 13   LYS C CG  1 
ATOM   5322  C  CD  . LYS C 1 13  ? 33.878  84.355  60.798  1.00 42.13 ? 13   LYS C CD  1 
ATOM   5323  C  CE  . LYS C 1 13  ? 33.074  83.247  61.457  1.00 40.88 ? 13   LYS C CE  1 
ATOM   5324  N  NZ  . LYS C 1 13  ? 31.610  83.407  61.232  1.00 40.87 ? 13   LYS C NZ  1 
ATOM   5325  N  N   . ASP C 1 14  ? 34.759  84.004  55.348  1.00 43.14 ? 14   ASP C N   1 
ATOM   5326  C  CA  . ASP C 1 14  ? 35.538  83.004  54.622  1.00 42.89 ? 14   ASP C CA  1 
ATOM   5327  C  C   . ASP C 1 14  ? 35.771  83.454  53.178  1.00 42.55 ? 14   ASP C C   1 
ATOM   5328  O  O   . ASP C 1 14  ? 36.712  83.001  52.521  1.00 41.73 ? 14   ASP C O   1 
ATOM   5329  C  CB  . ASP C 1 14  ? 34.794  81.663  54.620  1.00 43.43 ? 14   ASP C CB  1 
ATOM   5330  C  CG  . ASP C 1 14  ? 34.338  81.242  56.008  1.00 43.61 ? 14   ASP C CG  1 
ATOM   5331  O  OD1 . ASP C 1 14  ? 33.168  81.511  56.357  1.00 42.61 ? 14   ASP C OD1 1 
ATOM   5332  O  OD2 . ASP C 1 14  ? 35.146  80.640  56.747  1.00 42.89 ? 14   ASP C OD2 1 
ATOM   5333  N  N   . GLY C 1 15  ? 34.905  84.343  52.696  1.00 42.35 ? 15   GLY C N   1 
ATOM   5334  C  CA  . GLY C 1 15  ? 35.010  84.842  51.335  1.00 39.71 ? 15   GLY C CA  1 
ATOM   5335  C  C   . GLY C 1 15  ? 34.253  83.972  50.350  1.00 38.34 ? 15   GLY C C   1 
ATOM   5336  O  O   . GLY C 1 15  ? 34.041  82.784  50.601  1.00 38.09 ? 15   GLY C O   1 
ATOM   5337  N  N   . LYS C 1 16  ? 33.836  84.560  49.231  1.00 37.22 ? 16   LYS C N   1 
ATOM   5338  C  CA  . LYS C 1 16  ? 33.098  83.824  48.209  1.00 35.61 ? 16   LYS C CA  1 
ATOM   5339  C  C   . LYS C 1 16  ? 34.021  82.883  47.435  1.00 35.36 ? 16   LYS C C   1 
ATOM   5340  O  O   . LYS C 1 16  ? 35.162  83.231  47.123  1.00 33.96 ? 16   LYS C O   1 
ATOM   5341  C  CB  . LYS C 1 16  ? 32.380  84.788  47.256  1.00 35.32 ? 16   LYS C CB  1 
ATOM   5342  C  CG  . LYS C 1 16  ? 31.463  84.103  46.246  1.00 34.54 ? 16   LYS C CG  1 
ATOM   5343  C  CD  . LYS C 1 16  ? 30.637  85.102  45.452  1.00 34.56 ? 16   LYS C CD  1 
ATOM   5344  C  CE  . LYS C 1 16  ? 29.641  85.831  46.343  1.00 37.31 ? 16   LYS C CE  1 
ATOM   5345  N  NZ  . LYS C 1 16  ? 28.773  86.776  45.582  1.00 35.34 ? 16   LYS C NZ  1 
ATOM   5346  N  N   . PHE C 1 17  ? 33.522  81.682  47.157  1.00 36.20 ? 17   PHE C N   1 
ATOM   5347  C  CA  . PHE C 1 17  ? 34.277  80.662  46.435  1.00 36.68 ? 17   PHE C CA  1 
ATOM   5348  C  C   . PHE C 1 17  ? 34.062  80.686  44.929  1.00 37.12 ? 17   PHE C C   1 
ATOM   5349  O  O   . PHE C 1 17  ? 33.038  81.163  44.438  1.00 36.76 ? 17   PHE C O   1 
ATOM   5350  C  CB  . PHE C 1 17  ? 33.935  79.268  46.969  1.00 36.09 ? 17   PHE C CB  1 
ATOM   5351  C  CG  . PHE C 1 17  ? 34.590  78.941  48.280  1.00 35.46 ? 17   PHE C CG  1 
ATOM   5352  C  CD1 . PHE C 1 17  ? 34.130  79.505  49.465  1.00 35.24 ? 17   PHE C CD1 1 
ATOM   5353  C  CD2 . PHE C 1 17  ? 35.668  78.065  48.330  1.00 33.99 ? 17   PHE C CD2 1 
ATOM   5354  C  CE1 . PHE C 1 17  ? 34.735  79.202  50.680  1.00 34.88 ? 17   PHE C CE1 1 
ATOM   5355  C  CE2 . PHE C 1 17  ? 36.278  77.756  49.539  1.00 33.08 ? 17   PHE C CE2 1 
ATOM   5356  C  CZ  . PHE C 1 17  ? 35.810  78.327  50.716  1.00 33.60 ? 17   PHE C CZ  1 
ATOM   5357  N  N   . THR C 1 18  ? 35.044  80.153  44.207  1.00 38.94 ? 18   THR C N   1 
ATOM   5358  C  CA  . THR C 1 18  ? 35.003  80.075  42.750  1.00 41.36 ? 18   THR C CA  1 
ATOM   5359  C  C   . THR C 1 18  ? 35.050  78.610  42.311  1.00 42.11 ? 18   THR C C   1 
ATOM   5360  O  O   . THR C 1 18  ? 34.915  78.297  41.126  1.00 41.91 ? 18   THR C O   1 
ATOM   5361  C  CB  . THR C 1 18  ? 36.195  80.827  42.113  1.00 42.08 ? 18   THR C CB  1 
ATOM   5362  O  OG1 . THR C 1 18  ? 37.428  80.267  42.585  1.00 42.52 ? 18   THR C OG1 1 
ATOM   5363  C  CG2 . THR C 1 18  ? 36.144  82.309  42.468  1.00 43.88 ? 18   THR C CG2 1 
ATOM   5364  N  N   . GLN C 1 19  ? 35.245  77.723  43.284  1.00 43.53 ? 19   GLN C N   1 
ATOM   5365  C  CA  . GLN C 1 19  ? 35.327  76.284  43.047  1.00 44.30 ? 19   GLN C CA  1 
ATOM   5366  C  C   . GLN C 1 19  ? 34.659  75.538  44.204  1.00 44.59 ? 19   GLN C C   1 
ATOM   5367  O  O   . GLN C 1 19  ? 34.464  76.101  45.285  1.00 45.27 ? 19   GLN C O   1 
ATOM   5368  C  CB  . GLN C 1 19  ? 36.795  75.849  42.965  1.00 44.98 ? 19   GLN C CB  1 
ATOM   5369  C  CG  . GLN C 1 19  ? 37.622  76.559  41.903  1.00 45.70 ? 19   GLN C CG  1 
ATOM   5370  C  CD  . GLN C 1 19  ? 39.099  76.215  41.976  1.00 46.18 ? 19   GLN C CD  1 
ATOM   5371  O  OE1 . GLN C 1 19  ? 39.470  75.374  42.937  1.00 46.54 ? 19   GLN C OE1 1 
ATOM   5372  N  NE2 . GLN C 1 19  ? 39.898  76.703  41.176  1.00 47.52 ? 19   GLN C NE2 1 
ATOM   5373  N  N   . PRO C 1 20  ? 34.276  74.267  43.985  1.00 44.88 ? 20   PRO C N   1 
ATOM   5374  C  CA  . PRO C 1 20  ? 33.634  73.457  45.027  1.00 44.59 ? 20   PRO C CA  1 
ATOM   5375  C  C   . PRO C 1 20  ? 34.584  73.223  46.203  1.00 44.36 ? 20   PRO C C   1 
ATOM   5376  O  O   . PRO C 1 20  ? 34.199  73.360  47.366  1.00 44.15 ? 20   PRO C O   1 
ATOM   5377  C  CB  . PRO C 1 20  ? 33.331  72.149  44.295  1.00 44.82 ? 20   PRO C CB  1 
ATOM   5378  C  CG  . PRO C 1 20  ? 33.112  72.595  42.886  1.00 44.47 ? 20   PRO C CG  1 
ATOM   5379  C  CD  . PRO C 1 20  ? 34.249  73.560  42.692  1.00 44.78 ? 20   PRO C CD  1 
ATOM   5380  N  N   . PHE C 1 21  ? 35.829  72.876  45.880  1.00 43.46 ? 21   PHE C N   1 
ATOM   5381  C  CA  . PHE C 1 21  ? 36.864  72.622  46.878  1.00 41.92 ? 21   PHE C CA  1 
ATOM   5382  C  C   . PHE C 1 21  ? 38.031  73.574  46.644  1.00 41.68 ? 21   PHE C C   1 
ATOM   5383  O  O   . PHE C 1 21  ? 38.381  73.865  45.499  1.00 41.91 ? 21   PHE C O   1 
ATOM   5384  C  CB  . PHE C 1 21  ? 37.371  71.182  46.769  1.00 41.68 ? 21   PHE C CB  1 
ATOM   5385  C  CG  . PHE C 1 21  ? 36.285  70.148  46.806  1.00 40.00 ? 21   PHE C CG  1 
ATOM   5386  C  CD1 . PHE C 1 21  ? 35.724  69.754  48.015  1.00 39.56 ? 21   PHE C CD1 1 
ATOM   5387  C  CD2 . PHE C 1 21  ? 35.828  69.563  45.631  1.00 38.57 ? 21   PHE C CD2 1 
ATOM   5388  C  CE1 . PHE C 1 21  ? 34.722  68.790  48.053  1.00 39.61 ? 21   PHE C CE1 1 
ATOM   5389  C  CE2 . PHE C 1 21  ? 34.828  68.599  45.658  1.00 38.51 ? 21   PHE C CE2 1 
ATOM   5390  C  CZ  . PHE C 1 21  ? 34.274  68.212  46.873  1.00 39.03 ? 21   PHE C CZ  1 
ATOM   5391  N  N   . SER C 1 22  ? 38.641  74.040  47.731  1.00 41.47 ? 22   SER C N   1 
ATOM   5392  C  CA  . SER C 1 22  ? 39.777  74.955  47.643  1.00 40.53 ? 22   SER C CA  1 
ATOM   5393  C  C   . SER C 1 22  ? 40.821  74.661  48.714  1.00 39.46 ? 22   SER C C   1 
ATOM   5394  O  O   . SER C 1 22  ? 40.493  74.531  49.894  1.00 38.72 ? 22   SER C O   1 
ATOM   5395  C  CB  . SER C 1 22  ? 39.310  76.409  47.759  1.00 40.20 ? 22   SER C CB  1 
ATOM   5396  O  OG  . SER C 1 22  ? 38.473  76.769  46.673  1.00 38.75 ? 22   SER C OG  1 
ATOM   5397  N  N   . LEU C 1 23  ? 42.077  74.556  48.288  1.00 39.59 ? 23   LEU C N   1 
ATOM   5398  C  CA  . LEU C 1 23  ? 43.192  74.280  49.192  1.00 39.23 ? 23   LEU C CA  1 
ATOM   5399  C  C   . LEU C 1 23  ? 43.434  75.430  50.168  1.00 38.84 ? 23   LEU C C   1 
ATOM   5400  O  O   . LEU C 1 23  ? 43.853  76.521  49.777  1.00 38.80 ? 23   LEU C O   1 
ATOM   5401  C  CB  . LEU C 1 23  ? 44.472  73.970  48.399  1.00 38.89 ? 23   LEU C CB  1 
ATOM   5402  C  CG  . LEU C 1 23  ? 45.028  74.978  47.383  1.00 39.86 ? 23   LEU C CG  1 
ATOM   5403  C  CD1 . LEU C 1 23  ? 46.440  74.573  46.999  1.00 41.46 ? 23   LEU C CD1 1 
ATOM   5404  C  CD2 . LEU C 1 23  ? 44.142  75.069  46.145  1.00 39.45 ? 23   LEU C CD2 1 
ATOM   5405  N  N   . VAL C 1 24  ? 43.142  75.180  51.440  1.00 39.09 ? 24   VAL C N   1 
ATOM   5406  C  CA  . VAL C 1 24  ? 43.317  76.180  52.486  1.00 40.02 ? 24   VAL C CA  1 
ATOM   5407  C  C   . VAL C 1 24  ? 44.476  75.801  53.403  1.00 39.89 ? 24   VAL C C   1 
ATOM   5408  O  O   . VAL C 1 24  ? 44.456  74.748  54.046  1.00 40.85 ? 24   VAL C O   1 
ATOM   5409  C  CB  . VAL C 1 24  ? 42.029  76.340  53.326  1.00 40.81 ? 24   VAL C CB  1 
ATOM   5410  C  CG1 . VAL C 1 24  ? 42.180  77.481  54.314  1.00 43.17 ? 24   VAL C CG1 1 
ATOM   5411  C  CG2 . VAL C 1 24  ? 40.840  76.593  52.418  1.00 41.09 ? 24   VAL C CG2 1 
ATOM   5412  N  N   . ASN C 1 25  ? 45.481  76.670  53.460  1.00 39.52 ? 25   ASN C N   1 
ATOM   5413  C  CA  . ASN C 1 25  ? 46.665  76.448  54.288  1.00 39.11 ? 25   ASN C CA  1 
ATOM   5414  C  C   . ASN C 1 25  ? 46.292  76.345  55.767  1.00 37.40 ? 25   ASN C C   1 
ATOM   5415  O  O   . ASN C 1 25  ? 46.817  75.500  56.494  1.00 37.07 ? 25   ASN C O   1 
ATOM   5416  C  CB  . ASN C 1 25  ? 47.669  77.586  54.077  1.00 39.87 ? 25   ASN C CB  1 
ATOM   5417  C  CG  . ASN C 1 25  ? 49.060  77.240  54.572  1.00 39.24 ? 25   ASN C CG  1 
ATOM   5418  O  OD1 . ASN C 1 25  ? 49.901  76.761  53.808  1.00 40.19 ? 25   ASN C OD1 1 
ATOM   5419  N  ND2 . ASN C 1 25  ? 49.314  77.488  55.852  1.00 39.03 ? 25   ASN C ND2 1 
ATOM   5420  N  N   . GLN C 1 26  ? 45.372  77.202  56.198  1.00 36.70 ? 26   GLN C N   1 
ATOM   5421  C  CA  . GLN C 1 26  ? 44.920  77.221  57.584  1.00 35.59 ? 26   GLN C CA  1 
ATOM   5422  C  C   . GLN C 1 26  ? 43.398  77.330  57.624  1.00 35.49 ? 26   GLN C C   1 
ATOM   5423  O  O   . GLN C 1 26  ? 42.826  78.312  57.149  1.00 35.65 ? 26   GLN C O   1 
ATOM   5424  C  CB  . GLN C 1 26  ? 45.545  78.408  58.322  1.00 34.59 ? 26   GLN C CB  1 
ATOM   5425  C  CG  . GLN C 1 26  ? 45.362  78.390  59.834  1.00 32.53 ? 26   GLN C CG  1 
ATOM   5426  C  CD  . GLN C 1 26  ? 46.230  77.352  60.516  1.00 30.06 ? 26   GLN C CD  1 
ATOM   5427  O  OE1 . GLN C 1 26  ? 45.774  76.255  60.836  1.00 29.63 ? 26   GLN C OE1 1 
ATOM   5428  N  NE2 . GLN C 1 26  ? 47.492  77.697  60.744  1.00 28.47 ? 26   GLN C NE2 1 
ATOM   5429  N  N   . PRO C 1 27  ? 42.723  76.316  58.192  1.00 34.97 ? 27   PRO C N   1 
ATOM   5430  C  CA  . PRO C 1 27  ? 41.261  76.288  58.300  1.00 35.85 ? 27   PRO C CA  1 
ATOM   5431  C  C   . PRO C 1 27  ? 40.696  77.441  59.128  1.00 36.74 ? 27   PRO C C   1 
ATOM   5432  O  O   . PRO C 1 27  ? 41.220  77.766  60.194  1.00 37.33 ? 27   PRO C O   1 
ATOM   5433  C  CB  . PRO C 1 27  ? 40.996  74.933  58.961  1.00 36.47 ? 27   PRO C CB  1 
ATOM   5434  C  CG  . PRO C 1 27  ? 42.236  74.695  59.769  1.00 34.78 ? 27   PRO C CG  1 
ATOM   5435  C  CD  . PRO C 1 27  ? 43.311  75.113  58.806  1.00 34.95 ? 27   PRO C CD  1 
ATOM   5436  N  N   . ASP C 1 28  ? 39.637  78.064  58.619  1.00 38.31 ? 28   ASP C N   1 
ATOM   5437  C  CA  . ASP C 1 28  ? 38.994  79.179  59.307  1.00 40.62 ? 28   ASP C CA  1 
ATOM   5438  C  C   . ASP C 1 28  ? 38.011  78.649  60.351  1.00 41.89 ? 28   ASP C C   1 
ATOM   5439  O  O   . ASP C 1 28  ? 36.793  78.694  60.159  1.00 42.33 ? 28   ASP C O   1 
ATOM   5440  C  CB  . ASP C 1 28  ? 38.275  80.082  58.297  1.00 41.90 ? 28   ASP C CB  1 
ATOM   5441  C  CG  . ASP C 1 28  ? 37.892  81.433  58.884  1.00 42.48 ? 28   ASP C CG  1 
ATOM   5442  O  OD1 . ASP C 1 28  ? 36.928  81.497  59.677  1.00 43.18 ? 28   ASP C OD1 1 
ATOM   5443  O  OD2 . ASP C 1 28  ? 38.553  82.435  58.543  1.00 42.99 ? 28   ASP C OD2 1 
ATOM   5444  N  N   . ALA C 1 29  ? 38.556  78.134  61.449  1.00 43.27 ? 29   ALA C N   1 
ATOM   5445  C  CA  . ALA C 1 29  ? 37.757  77.583  62.540  1.00 43.99 ? 29   ALA C CA  1 
ATOM   5446  C  C   . ALA C 1 29  ? 38.641  77.290  63.746  1.00 43.75 ? 29   ALA C C   1 
ATOM   5447  O  O   . ALA C 1 29  ? 39.664  76.611  63.628  1.00 44.24 ? 29   ALA C O   1 
ATOM   5448  C  CB  . ALA C 1 29  ? 37.056  76.310  62.091  1.00 43.60 ? 29   ALA C CB  1 
ATOM   5449  N  N   . VAL C 1 30  ? 38.240  77.805  64.904  1.00 43.05 ? 30   VAL C N   1 
ATOM   5450  C  CA  . VAL C 1 30  ? 38.993  77.598  66.137  1.00 41.83 ? 30   VAL C CA  1 
ATOM   5451  C  C   . VAL C 1 30  ? 38.429  76.448  66.968  1.00 39.75 ? 30   VAL C C   1 
ATOM   5452  O  O   . VAL C 1 30  ? 37.212  76.307  67.115  1.00 39.93 ? 30   VAL C O   1 
ATOM   5453  C  CB  . VAL C 1 30  ? 39.047  78.887  66.994  1.00 42.21 ? 30   VAL C CB  1 
ATOM   5454  C  CG1 . VAL C 1 30  ? 39.840  79.961  66.265  1.00 41.98 ? 30   VAL C CG1 1 
ATOM   5455  C  CG2 . VAL C 1 30  ? 37.641  79.387  67.303  1.00 42.74 ? 30   VAL C CG2 1 
ATOM   5456  N  N   . GLY C 1 31  ? 39.326  75.611  67.482  1.00 37.56 ? 31   GLY C N   1 
ATOM   5457  C  CA  . GLY C 1 31  ? 38.911  74.481  68.293  1.00 33.86 ? 31   GLY C CA  1 
ATOM   5458  C  C   . GLY C 1 31  ? 39.685  73.209  68.004  1.00 31.86 ? 31   GLY C C   1 
ATOM   5459  O  O   . GLY C 1 31  ? 40.707  73.229  67.314  1.00 30.57 ? 31   GLY C O   1 
ATOM   5460  N  N   . ALA C 1 32  ? 39.184  72.098  68.536  1.00 31.08 ? 32   ALA C N   1 
ATOM   5461  C  CA  . ALA C 1 32  ? 39.805  70.790  68.353  1.00 29.87 ? 32   ALA C CA  1 
ATOM   5462  C  C   . ALA C 1 32  ? 38.718  69.728  68.202  1.00 28.88 ? 32   ALA C C   1 
ATOM   5463  O  O   . ALA C 1 32  ? 37.630  69.864  68.763  1.00 29.75 ? 32   ALA C O   1 
ATOM   5464  C  CB  . ALA C 1 32  ? 40.703  70.466  69.542  1.00 30.57 ? 32   ALA C CB  1 
ATOM   5465  N  N   . PRO C 1 33  ? 38.986  68.675  67.408  1.00 28.83 ? 33   PRO C N   1 
ATOM   5466  C  CA  . PRO C 1 33  ? 38.033  67.581  67.175  1.00 28.80 ? 33   PRO C CA  1 
ATOM   5467  C  C   . PRO C 1 33  ? 37.584  66.932  68.482  1.00 27.87 ? 33   PRO C C   1 
ATOM   5468  O  O   . PRO C 1 33  ? 38.334  66.175  69.103  1.00 27.29 ? 33   PRO C O   1 
ATOM   5469  C  CB  . PRO C 1 33  ? 38.842  66.609  66.318  1.00 29.23 ? 33   PRO C CB  1 
ATOM   5470  C  CG  . PRO C 1 33  ? 39.732  67.521  65.541  1.00 29.99 ? 33   PRO C CG  1 
ATOM   5471  C  CD  . PRO C 1 33  ? 40.207  68.476  66.607  1.00 27.70 ? 33   PRO C CD  1 
ATOM   5472  N  N   . ILE C 1 34  ? 36.358  67.239  68.893  1.00 27.80 ? 34   ILE C N   1 
ATOM   5473  C  CA  . ILE C 1 34  ? 35.808  66.705  70.135  1.00 28.60 ? 34   ILE C CA  1 
ATOM   5474  C  C   . ILE C 1 34  ? 35.243  65.286  70.041  1.00 28.21 ? 34   ILE C C   1 
ATOM   5475  O  O   . ILE C 1 34  ? 34.671  64.775  71.006  1.00 27.68 ? 34   ILE C O   1 
ATOM   5476  C  CB  . ILE C 1 34  ? 34.763  67.675  70.753  1.00 29.11 ? 34   ILE C CB  1 
ATOM   5477  C  CG1 . ILE C 1 34  ? 33.749  68.146  69.703  1.00 28.05 ? 34   ILE C CG1 1 
ATOM   5478  C  CG2 . ILE C 1 34  ? 35.467  68.873  71.357  1.00 28.85 ? 34   ILE C CG2 1 
ATOM   5479  C  CD1 . ILE C 1 34  ? 32.697  67.124  69.337  1.00 29.21 ? 34   ILE C CD1 1 
ATOM   5480  N  N   . ASN C 1 35  ? 35.424  64.648  68.887  1.00 28.10 ? 35   ASN C N   1 
ATOM   5481  C  CA  . ASN C 1 35  ? 34.940  63.286  68.679  1.00 28.00 ? 35   ASN C CA  1 
ATOM   5482  C  C   . ASN C 1 35  ? 36.072  62.366  68.216  1.00 26.96 ? 35   ASN C C   1 
ATOM   5483  O  O   . ASN C 1 35  ? 35.845  61.409  67.476  1.00 28.59 ? 35   ASN C O   1 
ATOM   5484  C  CB  . ASN C 1 35  ? 33.799  63.274  67.656  1.00 27.99 ? 35   ASN C CB  1 
ATOM   5485  C  CG  . ASN C 1 35  ? 34.265  63.601  66.247  1.00 29.72 ? 35   ASN C CG  1 
ATOM   5486  O  OD1 . ASN C 1 35  ? 35.207  64.369  66.051  1.00 29.87 ? 35   ASN C OD1 1 
ATOM   5487  N  ND2 . ASN C 1 35  ? 33.605  63.009  65.257  1.00 29.44 ? 35   ASN C ND2 1 
ATOM   5488  N  N   . ALA C 1 36  ? 37.285  62.655  68.682  1.00 25.78 ? 36   ALA C N   1 
ATOM   5489  C  CA  . ALA C 1 36  ? 38.474  61.885  68.328  1.00 24.26 ? 36   ALA C CA  1 
ATOM   5490  C  C   . ALA C 1 36  ? 38.350  60.391  68.619  1.00 24.10 ? 36   ALA C C   1 
ATOM   5491  O  O   . ALA C 1 36  ? 38.895  59.565  67.887  1.00 24.48 ? 36   ALA C O   1 
ATOM   5492  C  CB  . ALA C 1 36  ? 39.689  62.458  69.031  1.00 25.64 ? 36   ALA C CB  1 
ATOM   5493  N  N   . GLY C 1 37  ? 37.645  60.052  69.695  1.00 26.15 ? 37   GLY C N   1 
ATOM   5494  C  CA  . GLY C 1 37  ? 37.456  58.656  70.052  1.00 25.23 ? 37   GLY C CA  1 
ATOM   5495  C  C   . GLY C 1 37  ? 36.510  57.964  69.089  1.00 23.84 ? 37   GLY C C   1 
ATOM   5496  O  O   . GLY C 1 37  ? 36.747  56.827  68.678  1.00 22.87 ? 37   GLY C O   1 
ATOM   5497  N  N   . ASP C 1 38  ? 35.436  58.663  68.728  1.00 24.70 ? 38   ASP C N   1 
ATOM   5498  C  CA  . ASP C 1 38  ? 34.435  58.142  67.801  1.00 24.77 ? 38   ASP C CA  1 
ATOM   5499  C  C   . ASP C 1 38  ? 35.009  58.008  66.395  1.00 25.95 ? 38   ASP C C   1 
ATOM   5500  O  O   . ASP C 1 38  ? 34.609  57.126  65.635  1.00 27.80 ? 38   ASP C O   1 
ATOM   5501  C  CB  . ASP C 1 38  ? 33.202  59.053  67.776  1.00 23.17 ? 38   ASP C CB  1 
ATOM   5502  C  CG  . ASP C 1 38  ? 32.445  59.063  69.097  1.00 21.40 ? 38   ASP C CG  1 
ATOM   5503  O  OD1 . ASP C 1 38  ? 32.668  58.164  69.939  1.00 20.08 ? 38   ASP C OD1 1 
ATOM   5504  O  OD2 . ASP C 1 38  ? 31.614  59.974  69.289  1.00 22.61 ? 38   ASP C OD2 1 
ATOM   5505  N  N   . PHE C 1 39  ? 35.939  58.896  66.053  1.00 26.26 ? 39   PHE C N   1 
ATOM   5506  C  CA  . PHE C 1 39  ? 36.585  58.874  64.745  1.00 26.35 ? 39   PHE C CA  1 
ATOM   5507  C  C   . PHE C 1 39  ? 37.528  57.677  64.637  1.00 26.05 ? 39   PHE C C   1 
ATOM   5508  O  O   . PHE C 1 39  ? 37.566  56.999  63.608  1.00 26.69 ? 39   PHE C O   1 
ATOM   5509  C  CB  . PHE C 1 39  ? 37.357  60.175  64.507  1.00 26.74 ? 39   PHE C CB  1 
ATOM   5510  C  CG  . PHE C 1 39  ? 38.092  60.212  63.196  1.00 29.14 ? 39   PHE C CG  1 
ATOM   5511  C  CD1 . PHE C 1 39  ? 37.395  60.261  61.991  1.00 29.96 ? 39   PHE C CD1 1 
ATOM   5512  C  CD2 . PHE C 1 39  ? 39.483  60.181  63.163  1.00 27.98 ? 39   PHE C CD2 1 
ATOM   5513  C  CE1 . PHE C 1 39  ? 38.071  60.277  60.774  1.00 29.43 ? 39   PHE C CE1 1 
ATOM   5514  C  CE2 . PHE C 1 39  ? 40.167  60.196  61.952  1.00 28.40 ? 39   PHE C CE2 1 
ATOM   5515  C  CZ  . PHE C 1 39  ? 39.459  60.244  60.755  1.00 28.85 ? 39   PHE C CZ  1 
ATOM   5516  N  N   . ALA C 1 40  ? 38.288  57.429  65.703  1.00 25.81 ? 40   ALA C N   1 
ATOM   5517  C  CA  . ALA C 1 40  ? 39.229  56.312  65.750  1.00 25.84 ? 40   ALA C CA  1 
ATOM   5518  C  C   . ALA C 1 40  ? 38.484  54.982  65.679  1.00 26.11 ? 40   ALA C C   1 
ATOM   5519  O  O   . ALA C 1 40  ? 39.016  53.985  65.188  1.00 25.89 ? 40   ALA C O   1 
ATOM   5520  C  CB  . ALA C 1 40  ? 40.061  56.381  67.021  1.00 25.41 ? 40   ALA C CB  1 
ATOM   5521  N  N   . GLU C 1 41  ? 37.252  54.982  66.180  1.00 28.48 ? 41   GLU C N   1 
ATOM   5522  C  CA  . GLU C 1 41  ? 36.402  53.797  66.174  1.00 28.85 ? 41   GLU C CA  1 
ATOM   5523  C  C   . GLU C 1 41  ? 35.958  53.479  64.746  1.00 28.01 ? 41   GLU C C   1 
ATOM   5524  O  O   . GLU C 1 41  ? 35.880  52.312  64.360  1.00 29.36 ? 41   GLU C O   1 
ATOM   5525  C  CB  . GLU C 1 41  ? 35.185  54.023  67.074  1.00 30.37 ? 41   GLU C CB  1 
ATOM   5526  C  CG  . GLU C 1 41  ? 34.273  52.816  67.219  1.00 32.23 ? 41   GLU C CG  1 
ATOM   5527  C  CD  . GLU C 1 41  ? 33.117  53.064  68.170  1.00 33.61 ? 41   GLU C CD  1 
ATOM   5528  O  OE1 . GLU C 1 41  ? 32.451  54.115  68.046  1.00 32.73 ? 41   GLU C OE1 1 
ATOM   5529  O  OE2 . GLU C 1 41  ? 32.873  52.204  69.042  1.00 35.91 ? 41   GLU C OE2 1 
ATOM   5530  N  N   . GLN C 1 42  ? 35.678  54.525  63.968  1.00 27.48 ? 42   GLN C N   1 
ATOM   5531  C  CA  . GLN C 1 42  ? 35.258  54.378  62.575  1.00 25.79 ? 42   GLN C CA  1 
ATOM   5532  C  C   . GLN C 1 42  ? 36.351  53.757  61.719  1.00 25.32 ? 42   GLN C C   1 
ATOM   5533  O  O   . GLN C 1 42  ? 36.079  52.905  60.876  1.00 26.67 ? 42   GLN C O   1 
ATOM   5534  C  CB  . GLN C 1 42  ? 34.867  55.732  61.977  1.00 24.48 ? 42   GLN C CB  1 
ATOM   5535  C  CG  . GLN C 1 42  ? 33.400  56.093  62.123  1.00 24.24 ? 42   GLN C CG  1 
ATOM   5536  C  CD  . GLN C 1 42  ? 32.476  55.199  61.304  1.00 22.73 ? 42   GLN C CD  1 
ATOM   5537  O  OE1 . GLN C 1 42  ? 31.250  55.659  61.100  1.00 22.40 ? 42   GLN C OE1 1 
ATOM   5538  N  NE2 . GLN C 1 42  ? 32.855  54.111  60.870  1.00 21.03 ? 42   GLN C NE2 1 
ATOM   5539  N  N   . ILE C 1 43  ? 37.585  54.204  61.934  1.00 25.20 ? 43   ILE C N   1 
ATOM   5540  C  CA  . ILE C 1 43  ? 38.738  53.702  61.193  1.00 25.15 ? 43   ILE C CA  1 
ATOM   5541  C  C   . ILE C 1 43  ? 38.944  52.209  61.448  1.00 24.37 ? 43   ILE C C   1 
ATOM   5542  O  O   . ILE C 1 43  ? 39.348  51.470  60.551  1.00 23.67 ? 43   ILE C O   1 
ATOM   5543  C  CB  . ILE C 1 43  ? 40.014  54.489  61.564  1.00 26.39 ? 43   ILE C CB  1 
ATOM   5544  C  CG1 . ILE C 1 43  ? 39.846  55.958  61.169  1.00 26.48 ? 43   ILE C CG1 1 
ATOM   5545  C  CG2 . ILE C 1 43  ? 41.235  53.893  60.875  1.00 26.55 ? 43   ILE C CG2 1 
ATOM   5546  C  CD1 . ILE C 1 43  ? 41.033  56.825  61.515  1.00 28.62 ? 43   ILE C CD1 1 
ATOM   5547  N  N   . ASN C 1 44  ? 38.651  51.771  62.670  1.00 24.85 ? 44   ASN C N   1 
ATOM   5548  C  CA  . ASN C 1 44  ? 38.786  50.365  63.036  1.00 25.72 ? 44   ASN C CA  1 
ATOM   5549  C  C   . ASN C 1 44  ? 37.706  49.558  62.317  1.00 26.78 ? 44   ASN C C   1 
ATOM   5550  O  O   . ASN C 1 44  ? 37.930  48.414  61.923  1.00 26.36 ? 44   ASN C O   1 
ATOM   5551  C  CB  . ASN C 1 44  ? 38.657  50.196  64.553  1.00 25.96 ? 44   ASN C CB  1 
ATOM   5552  C  CG  . ASN C 1 44  ? 38.911  48.768  65.007  1.00 25.89 ? 44   ASN C CG  1 
ATOM   5553  O  OD1 . ASN C 1 44  ? 40.032  48.265  64.918  1.00 26.34 ? 44   ASN C OD1 1 
ATOM   5554  N  ND2 . ASN C 1 44  ? 37.868  48.111  65.502  1.00 25.02 ? 44   ASN C ND2 1 
ATOM   5555  N  N   . HIS C 1 45  ? 36.537  50.173  62.146  1.00 27.73 ? 45   HIS C N   1 
ATOM   5556  C  CA  . HIS C 1 45  ? 35.411  49.542  61.465  1.00 28.39 ? 45   HIS C CA  1 
ATOM   5557  C  C   . HIS C 1 45  ? 35.685  49.434  59.970  1.00 29.64 ? 45   HIS C C   1 
ATOM   5558  O  O   . HIS C 1 45  ? 35.297  48.456  59.331  1.00 31.53 ? 45   HIS C O   1 
ATOM   5559  C  CB  . HIS C 1 45  ? 34.126  50.337  61.706  1.00 31.20 ? 45   HIS C CB  1 
ATOM   5560  C  CG  . HIS C 1 45  ? 33.576  50.197  63.093  1.00 33.02 ? 45   HIS C CG  1 
ATOM   5561  N  ND1 . HIS C 1 45  ? 32.499  50.931  63.542  1.00 33.40 ? 45   HIS C ND1 1 
ATOM   5562  C  CD2 . HIS C 1 45  ? 33.942  49.398  64.122  1.00 33.18 ? 45   HIS C CD2 1 
ATOM   5563  C  CE1 . HIS C 1 45  ? 32.224  50.588  64.788  1.00 32.01 ? 45   HIS C CE1 1 
ATOM   5564  N  NE2 . HIS C 1 45  ? 33.085  49.660  65.164  1.00 32.93 ? 45   HIS C NE2 1 
ATOM   5565  N  N   . ILE C 1 46  ? 36.346  50.450  59.419  1.00 28.87 ? 46   ILE C N   1 
ATOM   5566  C  CA  . ILE C 1 46  ? 36.700  50.477  58.001  1.00 27.18 ? 46   ILE C CA  1 
ATOM   5567  C  C   . ILE C 1 46  ? 37.845  49.493  57.765  1.00 27.15 ? 46   ILE C C   1 
ATOM   5568  O  O   . ILE C 1 46  ? 37.993  48.943  56.677  1.00 29.01 ? 46   ILE C O   1 
ATOM   5569  C  CB  . ILE C 1 46  ? 37.142  51.899  57.561  1.00 25.96 ? 46   ILE C CB  1 
ATOM   5570  C  CG1 . ILE C 1 46  ? 36.010  52.900  57.804  1.00 24.76 ? 46   ILE C CG1 1 
ATOM   5571  C  CG2 . ILE C 1 46  ? 37.523  51.912  56.084  1.00 26.60 ? 46   ILE C CG2 1 
ATOM   5572  C  CD1 . ILE C 1 46  ? 36.386  54.338  57.531  1.00 24.99 ? 46   ILE C CD1 1 
ATOM   5573  N  N   . ARG C 1 47  ? 38.631  49.262  58.812  1.00 28.56 ? 47   ARG C N   1 
ATOM   5574  C  CA  . ARG C 1 47  ? 39.773  48.354  58.767  1.00 28.78 ? 47   ARG C CA  1 
ATOM   5575  C  C   . ARG C 1 47  ? 39.352  46.885  58.846  1.00 28.59 ? 47   ARG C C   1 
ATOM   5576  O  O   . ARG C 1 47  ? 40.044  46.002  58.333  1.00 28.52 ? 47   ARG C O   1 
ATOM   5577  C  CB  . ARG C 1 47  ? 40.736  48.704  59.908  1.00 29.99 ? 47   ARG C CB  1 
ATOM   5578  C  CG  . ARG C 1 47  ? 41.928  47.776  60.081  1.00 31.99 ? 47   ARG C CG  1 
ATOM   5579  C  CD  . ARG C 1 47  ? 42.942  48.377  61.045  1.00 32.15 ? 47   ARG C CD  1 
ATOM   5580  N  NE  . ARG C 1 47  ? 42.333  48.802  62.304  1.00 34.62 ? 47   ARG C NE  1 
ATOM   5581  C  CZ  . ARG C 1 47  ? 42.605  49.950  62.922  1.00 37.13 ? 47   ARG C CZ  1 
ATOM   5582  N  NH1 . ARG C 1 47  ? 43.480  50.802  62.402  1.00 38.76 ? 47   ARG C NH1 1 
ATOM   5583  N  NH2 . ARG C 1 47  ? 42.006  50.247  64.066  1.00 38.11 ? 47   ARG C NH2 1 
ATOM   5584  N  N   . ASN C 1 48  ? 38.207  46.631  59.472  1.00 27.78 ? 48   ASN C N   1 
ATOM   5585  C  CA  . ASN C 1 48  ? 37.700  45.270  59.620  1.00 27.26 ? 48   ASN C CA  1 
ATOM   5586  C  C   . ASN C 1 48  ? 36.623  44.915  58.599  1.00 26.66 ? 48   ASN C C   1 
ATOM   5587  O  O   . ASN C 1 48  ? 36.690  43.867  57.957  1.00 27.61 ? 48   ASN C O   1 
ATOM   5588  C  CB  . ASN C 1 48  ? 37.157  45.053  61.038  1.00 24.55 ? 48   ASN C CB  1 
ATOM   5589  C  CG  . ASN C 1 48  ? 38.228  45.193  62.106  1.00 24.05 ? 48   ASN C CG  1 
ATOM   5590  O  OD1 . ASN C 1 48  ? 39.414  44.987  61.849  1.00 23.96 ? 48   ASN C OD1 1 
ATOM   5591  N  ND2 . ASN C 1 48  ? 37.809  45.541  63.317  1.00 23.35 ? 48   ASN C ND2 1 
ATOM   5592  N  N   . SER C 1 49  ? 35.638  45.796  58.448  1.00 27.63 ? 49   SER C N   1 
ATOM   5593  C  CA  . SER C 1 49  ? 34.531  45.565  57.524  1.00 28.66 ? 49   SER C CA  1 
ATOM   5594  C  C   . SER C 1 49  ? 34.828  45.827  56.049  1.00 29.20 ? 49   SER C C   1 
ATOM   5595  O  O   . SER C 1 49  ? 34.160  45.269  55.176  1.00 30.15 ? 49   SER C O   1 
ATOM   5596  C  CB  . SER C 1 49  ? 33.302  46.365  57.964  1.00 29.15 ? 49   SER C CB  1 
ATOM   5597  O  OG  . SER C 1 49  ? 32.849  45.942  59.239  1.00 28.44 ? 49   SER C OG  1 
ATOM   5598  N  N   . SER C 1 50  ? 35.816  46.672  55.766  1.00 29.91 ? 50   SER C N   1 
ATOM   5599  C  CA  . SER C 1 50  ? 36.170  46.979  54.381  1.00 30.53 ? 50   SER C CA  1 
ATOM   5600  C  C   . SER C 1 50  ? 37.658  47.268  54.196  1.00 31.36 ? 50   SER C C   1 
ATOM   5601  O  O   . SER C 1 50  ? 38.051  48.406  53.937  1.00 31.16 ? 50   SER C O   1 
ATOM   5602  C  CB  . SER C 1 50  ? 35.338  48.157  53.864  1.00 30.46 ? 50   SER C CB  1 
ATOM   5603  O  OG  . SER C 1 50  ? 35.593  48.398  52.490  1.00 29.61 ? 50   SER C OG  1 
ATOM   5604  N  N   . PRO C 1 51  ? 38.506  46.229  54.308  1.00 33.52 ? 51   PRO C N   1 
ATOM   5605  C  CA  . PRO C 1 51  ? 39.961  46.356  54.155  1.00 34.16 ? 51   PRO C CA  1 
ATOM   5606  C  C   . PRO C 1 51  ? 40.386  46.788  52.749  1.00 34.19 ? 51   PRO C C   1 
ATOM   5607  O  O   . PRO C 1 51  ? 41.541  47.155  52.523  1.00 32.59 ? 51   PRO C O   1 
ATOM   5608  C  CB  . PRO C 1 51  ? 40.459  44.950  54.494  1.00 35.28 ? 51   PRO C CB  1 
ATOM   5609  C  CG  . PRO C 1 51  ? 39.321  44.073  54.066  1.00 34.06 ? 51   PRO C CG  1 
ATOM   5610  C  CD  . PRO C 1 51  ? 38.133  44.831  54.590  1.00 33.23 ? 51   PRO C CD  1 
ATOM   5611  N  N   . ARG C 1 52  ? 39.445  46.729  51.810  1.00 35.32 ? 52   ARG C N   1 
ATOM   5612  C  CA  . ARG C 1 52  ? 39.692  47.121  50.427  1.00 37.24 ? 52   ARG C CA  1 
ATOM   5613  C  C   . ARG C 1 52  ? 39.737  48.642  50.294  1.00 37.61 ? 52   ARG C C   1 
ATOM   5614  O  O   . ARG C 1 52  ? 40.659  49.192  49.690  1.00 38.19 ? 52   ARG C O   1 
ATOM   5615  C  CB  . ARG C 1 52  ? 38.625  46.532  49.492  1.00 38.75 ? 52   ARG C CB  1 
ATOM   5616  C  CG  . ARG C 1 52  ? 37.206  46.497  50.059  1.00 41.78 ? 52   ARG C CG  1 
ATOM   5617  C  CD  . ARG C 1 52  ? 36.975  45.245  50.903  1.00 42.11 ? 52   ARG C CD  1 
ATOM   5618  N  NE  . ARG C 1 52  ? 35.666  45.239  51.554  1.00 43.96 ? 52   ARG C NE  1 
ATOM   5619  C  CZ  . ARG C 1 52  ? 34.523  44.920  50.953  1.00 44.30 ? 52   ARG C CZ  1 
ATOM   5620  N  NH1 . ARG C 1 52  ? 34.510  44.576  49.671  1.00 44.46 ? 52   ARG C NH1 1 
ATOM   5621  N  NH2 . ARG C 1 52  ? 33.387  44.940  51.639  1.00 43.84 ? 52   ARG C NH2 1 
ATOM   5622  N  N   . LEU C 1 53  ? 38.741  49.313  50.867  1.00 38.14 ? 53   LEU C N   1 
ATOM   5623  C  CA  . LEU C 1 53  ? 38.670  50.770  50.831  1.00 37.70 ? 53   LEU C CA  1 
ATOM   5624  C  C   . LEU C 1 53  ? 39.720  51.351  51.777  1.00 37.24 ? 53   LEU C C   1 
ATOM   5625  O  O   . LEU C 1 53  ? 40.376  52.343  51.459  1.00 38.14 ? 53   LEU C O   1 
ATOM   5626  C  CB  . LEU C 1 53  ? 37.273  51.244  51.238  1.00 38.06 ? 53   LEU C CB  1 
ATOM   5627  C  CG  . LEU C 1 53  ? 36.980  52.743  51.135  1.00 38.62 ? 53   LEU C CG  1 
ATOM   5628  C  CD1 . LEU C 1 53  ? 37.163  53.214  49.699  1.00 40.30 ? 53   LEU C CD1 1 
ATOM   5629  C  CD2 . LEU C 1 53  ? 35.563  53.025  51.613  1.00 39.41 ? 53   LEU C CD2 1 
ATOM   5630  N  N   . TYR C 1 54  ? 39.882  50.707  52.931  1.00 35.88 ? 54   TYR C N   1 
ATOM   5631  C  CA  . TYR C 1 54  ? 40.856  51.125  53.934  1.00 34.70 ? 54   TYR C CA  1 
ATOM   5632  C  C   . TYR C 1 54  ? 42.271  51.011  53.372  1.00 34.82 ? 54   TYR C C   1 
ATOM   5633  O  O   . TYR C 1 54  ? 43.108  51.883  53.600  1.00 34.91 ? 54   TYR C O   1 
ATOM   5634  C  CB  . TYR C 1 54  ? 40.721  50.252  55.187  1.00 34.08 ? 54   TYR C CB  1 
ATOM   5635  C  CG  . TYR C 1 54  ? 41.663  50.618  56.314  1.00 34.30 ? 54   TYR C CG  1 
ATOM   5636  C  CD1 . TYR C 1 54  ? 41.455  51.766  57.076  1.00 34.17 ? 54   TYR C CD1 1 
ATOM   5637  C  CD2 . TYR C 1 54  ? 42.766  49.818  56.616  1.00 33.88 ? 54   TYR C CD2 1 
ATOM   5638  C  CE1 . TYR C 1 54  ? 42.322  52.111  58.111  1.00 34.85 ? 54   TYR C CE1 1 
ATOM   5639  C  CE2 . TYR C 1 54  ? 43.639  50.155  57.649  1.00 35.75 ? 54   TYR C CE2 1 
ATOM   5640  C  CZ  . TYR C 1 54  ? 43.411  51.305  58.392  1.00 35.23 ? 54   TYR C CZ  1 
ATOM   5641  O  OH  . TYR C 1 54  ? 44.274  51.653  59.409  1.00 34.12 ? 54   TYR C OH  1 
ATOM   5642  N  N   . GLY C 1 55  ? 42.516  49.943  52.614  1.00 35.13 ? 55   GLY C N   1 
ATOM   5643  C  CA  . GLY C 1 55  ? 43.823  49.716  52.022  1.00 35.05 ? 55   GLY C CA  1 
ATOM   5644  C  C   . GLY C 1 55  ? 44.323  50.843  51.137  1.00 35.62 ? 55   GLY C C   1 
ATOM   5645  O  O   . GLY C 1 55  ? 45.530  50.981  50.929  1.00 36.45 ? 55   GLY C O   1 
ATOM   5646  N  N   . ASN C 1 56  ? 43.401  51.652  50.620  1.00 36.00 ? 56   ASN C N   1 
ATOM   5647  C  CA  . ASN C 1 56  ? 43.752  52.774  49.754  1.00 35.56 ? 56   ASN C CA  1 
ATOM   5648  C  C   . ASN C 1 56  ? 43.428  54.134  50.370  1.00 33.78 ? 56   ASN C C   1 
ATOM   5649  O  O   . ASN C 1 56  ? 43.677  55.172  49.757  1.00 33.26 ? 56   ASN C O   1 
ATOM   5650  C  CB  . ASN C 1 56  ? 43.063  52.635  48.392  1.00 37.96 ? 56   ASN C CB  1 
ATOM   5651  C  CG  . ASN C 1 56  ? 43.592  51.462  47.585  1.00 38.10 ? 56   ASN C CG  1 
ATOM   5652  O  OD1 . ASN C 1 56  ? 42.883  50.483  47.352  1.00 40.01 ? 56   ASN C OD1 1 
ATOM   5653  N  ND2 . ASN C 1 56  ? 44.847  51.554  47.158  1.00 36.87 ? 56   ASN C ND2 1 
ATOM   5654  N  N   . GLN C 1 57  ? 42.871  54.123  51.578  1.00 31.62 ? 57   GLN C N   1 
ATOM   5655  C  CA  . GLN C 1 57  ? 42.524  55.359  52.278  1.00 30.24 ? 57   GLN C CA  1 
ATOM   5656  C  C   . GLN C 1 57  ? 43.339  55.529  53.557  1.00 28.96 ? 57   GLN C C   1 
ATOM   5657  O  O   . GLN C 1 57  ? 43.257  56.566  54.216  1.00 28.08 ? 57   GLN C O   1 
ATOM   5658  C  CB  . GLN C 1 57  ? 41.030  55.389  52.616  1.00 31.25 ? 57   GLN C CB  1 
ATOM   5659  C  CG  . GLN C 1 57  ? 40.101  55.445  51.412  1.00 31.16 ? 57   GLN C CG  1 
ATOM   5660  C  CD  . GLN C 1 57  ? 40.276  56.706  50.588  1.00 32.96 ? 57   GLN C CD  1 
ATOM   5661  O  OE1 . GLN C 1 57  ? 40.374  57.808  51.129  1.00 33.74 ? 57   GLN C OE1 1 
ATOM   5662  N  NE2 . GLN C 1 57  ? 40.309  56.550  49.269  1.00 34.68 ? 57   GLN C NE2 1 
ATOM   5663  N  N   . SER C 1 58  ? 44.128  54.509  53.894  1.00 29.50 ? 58   SER C N   1 
ATOM   5664  C  CA  . SER C 1 58  ? 44.968  54.515  55.092  1.00 28.62 ? 58   SER C CA  1 
ATOM   5665  C  C   . SER C 1 58  ? 45.903  55.713  55.168  1.00 29.43 ? 58   SER C C   1 
ATOM   5666  O  O   . SER C 1 58  ? 46.145  56.244  56.251  1.00 30.53 ? 58   SER C O   1 
ATOM   5667  C  CB  . SER C 1 58  ? 45.796  53.232  55.176  1.00 26.52 ? 58   SER C CB  1 
ATOM   5668  O  OG  . SER C 1 58  ? 44.982  52.115  55.467  1.00 27.45 ? 58   SER C OG  1 
ATOM   5669  N  N   . ASN C 1 59  ? 46.428  56.125  54.018  1.00 29.54 ? 59   ASN C N   1 
ATOM   5670  C  CA  . ASN C 1 59  ? 47.342  57.262  53.943  1.00 29.39 ? 59   ASN C CA  1 
ATOM   5671  C  C   . ASN C 1 59  ? 46.781  58.507  54.628  1.00 28.18 ? 59   ASN C C   1 
ATOM   5672  O  O   . ASN C 1 59  ? 47.506  59.220  55.324  1.00 28.40 ? 59   ASN C O   1 
ATOM   5673  C  CB  . ASN C 1 59  ? 47.705  57.565  52.481  1.00 32.00 ? 59   ASN C CB  1 
ATOM   5674  C  CG  . ASN C 1 59  ? 46.486  57.817  51.603  1.00 33.22 ? 59   ASN C CG  1 
ATOM   5675  O  OD1 . ASN C 1 59  ? 45.543  57.024  51.579  1.00 32.49 ? 59   ASN C OD1 1 
ATOM   5676  N  ND2 . ASN C 1 59  ? 46.510  58.921  50.863  1.00 33.86 ? 59   ASN C ND2 1 
ATOM   5677  N  N   . VAL C 1 60  ? 45.483  58.740  54.452  1.00 27.37 ? 60   VAL C N   1 
ATOM   5678  C  CA  . VAL C 1 60  ? 44.814  59.890  55.051  1.00 26.90 ? 60   VAL C CA  1 
ATOM   5679  C  C   . VAL C 1 60  ? 44.552  59.655  56.537  1.00 28.79 ? 60   VAL C C   1 
ATOM   5680  O  O   . VAL C 1 60  ? 44.715  60.565  57.350  1.00 29.94 ? 60   VAL C O   1 
ATOM   5681  C  CB  . VAL C 1 60  ? 43.477  60.199  54.335  1.00 25.59 ? 60   VAL C CB  1 
ATOM   5682  C  CG1 . VAL C 1 60  ? 42.832  61.440  54.932  1.00 24.15 ? 60   VAL C CG1 1 
ATOM   5683  C  CG2 . VAL C 1 60  ? 43.711  60.393  52.845  1.00 24.07 ? 60   VAL C CG2 1 
ATOM   5684  N  N   . TYR C 1 61  ? 44.159  58.430  56.884  1.00 30.61 ? 61   TYR C N   1 
ATOM   5685  C  CA  . TYR C 1 61  ? 43.875  58.066  58.272  1.00 29.04 ? 61   TYR C CA  1 
ATOM   5686  C  C   . TYR C 1 61  ? 45.134  58.118  59.122  1.00 29.07 ? 61   TYR C C   1 
ATOM   5687  O  O   . TYR C 1 61  ? 45.127  58.688  60.209  1.00 29.40 ? 61   TYR C O   1 
ATOM   5688  C  CB  . TYR C 1 61  ? 43.258  56.668  58.358  1.00 28.19 ? 61   TYR C CB  1 
ATOM   5689  C  CG  . TYR C 1 61  ? 41.975  56.507  57.576  1.00 28.28 ? 61   TYR C CG  1 
ATOM   5690  C  CD1 . TYR C 1 61  ? 41.032  57.533  57.523  1.00 27.92 ? 61   TYR C CD1 1 
ATOM   5691  C  CD2 . TYR C 1 61  ? 41.708  55.331  56.881  1.00 28.99 ? 61   TYR C CD2 1 
ATOM   5692  C  CE1 . TYR C 1 61  ? 39.855  57.390  56.794  1.00 28.06 ? 61   TYR C CE1 1 
ATOM   5693  C  CE2 . TYR C 1 61  ? 40.535  55.177  56.151  1.00 28.92 ? 61   TYR C CE2 1 
ATOM   5694  C  CZ  . TYR C 1 61  ? 39.615  56.209  56.111  1.00 28.46 ? 61   TYR C CZ  1 
ATOM   5695  O  OH  . TYR C 1 61  ? 38.460  56.060  55.382  1.00 32.42 ? 61   TYR C OH  1 
ATOM   5696  N  N   . ASN C 1 62  ? 46.215  57.532  58.613  1.00 29.71 ? 62   ASN C N   1 
ATOM   5697  C  CA  . ASN C 1 62  ? 47.494  57.511  59.318  1.00 29.69 ? 62   ASN C CA  1 
ATOM   5698  C  C   . ASN C 1 62  ? 47.981  58.928  59.609  1.00 30.52 ? 62   ASN C C   1 
ATOM   5699  O  O   . ASN C 1 62  ? 48.638  59.170  60.621  1.00 32.88 ? 62   ASN C O   1 
ATOM   5700  C  CB  . ASN C 1 62  ? 48.547  56.760  58.497  1.00 30.33 ? 62   ASN C CB  1 
ATOM   5701  C  CG  . ASN C 1 62  ? 48.189  55.302  58.273  1.00 28.21 ? 62   ASN C CG  1 
ATOM   5702  O  OD1 . ASN C 1 62  ? 47.448  54.703  59.052  1.00 27.80 ? 62   ASN C OD1 1 
ATOM   5703  N  ND2 . ASN C 1 62  ? 48.719  54.722  57.202  1.00 29.20 ? 62   ASN C ND2 1 
ATOM   5704  N  N   . ALA C 1 63  ? 47.647  59.859  58.717  1.00 31.39 ? 63   ALA C N   1 
ATOM   5705  C  CA  . ALA C 1 63  ? 48.035  61.257  58.864  1.00 30.04 ? 63   ALA C CA  1 
ATOM   5706  C  C   . ALA C 1 63  ? 47.167  61.970  59.897  1.00 30.17 ? 63   ALA C C   1 
ATOM   5707  O  O   . ALA C 1 63  ? 47.675  62.734  60.717  1.00 30.25 ? 63   ALA C O   1 
ATOM   5708  C  CB  . ALA C 1 63  ? 47.950  61.970  57.522  1.00 30.60 ? 63   ALA C CB  1 
ATOM   5709  N  N   . VAL C 1 64  ? 45.859  61.721  59.851  1.00 31.55 ? 64   VAL C N   1 
ATOM   5710  C  CA  . VAL C 1 64  ? 44.925  62.340  60.791  1.00 32.63 ? 64   VAL C CA  1 
ATOM   5711  C  C   . VAL C 1 64  ? 44.973  61.673  62.166  1.00 33.48 ? 64   VAL C C   1 
ATOM   5712  O  O   . VAL C 1 64  ? 44.453  62.214  63.142  1.00 33.91 ? 64   VAL C O   1 
ATOM   5713  C  CB  . VAL C 1 64  ? 43.470  62.338  60.256  1.00 32.04 ? 64   VAL C CB  1 
ATOM   5714  C  CG1 . VAL C 1 64  ? 43.388  63.107  58.948  1.00 30.76 ? 64   VAL C CG1 1 
ATOM   5715  C  CG2 . VAL C 1 64  ? 42.971  60.924  60.074  1.00 32.89 ? 64   VAL C CG2 1 
ATOM   5716  N  N   . GLN C 1 65  ? 45.578  60.487  62.227  1.00 34.45 ? 65   GLN C N   1 
ATOM   5717  C  CA  . GLN C 1 65  ? 45.725  59.751  63.479  1.00 34.07 ? 65   GLN C CA  1 
ATOM   5718  C  C   . GLN C 1 65  ? 46.998  60.208  64.174  1.00 33.40 ? 65   GLN C C   1 
ATOM   5719  O  O   . GLN C 1 65  ? 47.012  60.417  65.385  1.00 34.51 ? 65   GLN C O   1 
ATOM   5720  C  CB  . GLN C 1 65  ? 45.792  58.242  63.226  1.00 36.14 ? 65   GLN C CB  1 
ATOM   5721  C  CG  . GLN C 1 65  ? 44.444  57.576  62.992  1.00 37.72 ? 65   GLN C CG  1 
ATOM   5722  C  CD  . GLN C 1 65  ? 43.596  57.509  64.247  1.00 37.31 ? 65   GLN C CD  1 
ATOM   5723  O  OE1 . GLN C 1 65  ? 43.135  58.531  64.757  1.00 37.50 ? 65   GLN C OE1 1 
ATOM   5724  N  NE2 . GLN C 1 65  ? 43.381  56.299  64.750  1.00 36.29 ? 65   GLN C NE2 1 
ATOM   5725  N  N   . GLU C 1 66  ? 48.064  60.367  63.393  1.00 31.95 ? 66   GLU C N   1 
ATOM   5726  C  CA  . GLU C 1 66  ? 49.354  60.811  63.914  1.00 31.28 ? 66   GLU C CA  1 
ATOM   5727  C  C   . GLU C 1 66  ? 49.208  62.233  64.454  1.00 29.54 ? 66   GLU C C   1 
ATOM   5728  O  O   . GLU C 1 66  ? 49.852  62.607  65.434  1.00 30.11 ? 66   GLU C O   1 
ATOM   5729  C  CB  . GLU C 1 66  ? 50.409  60.770  62.803  1.00 32.75 ? 66   GLU C CB  1 
ATOM   5730  C  CG  . GLU C 1 66  ? 51.855  60.878  63.283  1.00 34.84 ? 66   GLU C CG  1 
ATOM   5731  C  CD  . GLU C 1 66  ? 52.335  59.649  64.046  1.00 34.37 ? 66   GLU C CD  1 
ATOM   5732  O  OE1 . GLU C 1 66  ? 51.809  58.539  63.809  1.00 32.99 ? 66   GLU C OE1 1 
ATOM   5733  O  OE2 . GLU C 1 66  ? 53.257  59.795  64.877  1.00 34.77 ? 66   GLU C OE2 1 
ATOM   5734  N  N   . TRP C 1 67  ? 48.348  63.011  63.802  1.00 28.88 ? 67   TRP C N   1 
ATOM   5735  C  CA  . TRP C 1 67  ? 48.069  64.389  64.194  1.00 28.38 ? 67   TRP C CA  1 
ATOM   5736  C  C   . TRP C 1 67  ? 47.255  64.397  65.485  1.00 29.49 ? 67   TRP C C   1 
ATOM   5737  O  O   . TRP C 1 67  ? 47.511  65.194  66.389  1.00 31.01 ? 67   TRP C O   1 
ATOM   5738  C  CB  . TRP C 1 67  ? 47.299  65.098  63.072  1.00 26.61 ? 67   TRP C CB  1 
ATOM   5739  C  CG  . TRP C 1 67  ? 46.702  66.421  63.458  1.00 25.48 ? 67   TRP C CG  1 
ATOM   5740  C  CD1 . TRP C 1 67  ? 47.374  67.555  63.813  1.00 24.62 ? 67   TRP C CD1 1 
ATOM   5741  C  CD2 . TRP C 1 67  ? 45.307  66.740  63.535  1.00 24.48 ? 67   TRP C CD2 1 
ATOM   5742  N  NE1 . TRP C 1 67  ? 46.484  68.559  64.109  1.00 22.27 ? 67   TRP C NE1 1 
ATOM   5743  C  CE2 . TRP C 1 67  ? 45.209  68.086  63.947  1.00 22.39 ? 67   TRP C CE2 1 
ATOM   5744  C  CE3 . TRP C 1 67  ? 44.130  66.017  63.296  1.00 23.90 ? 67   TRP C CE3 1 
ATOM   5745  C  CZ2 . TRP C 1 67  ? 43.979  68.727  64.126  1.00 22.15 ? 67   TRP C CZ2 1 
ATOM   5746  C  CZ3 . TRP C 1 67  ? 42.907  66.655  63.475  1.00 23.62 ? 67   TRP C CZ3 1 
ATOM   5747  C  CH2 . TRP C 1 67  ? 42.843  67.998  63.886  1.00 22.35 ? 67   TRP C CH2 1 
ATOM   5748  N  N   . LEU C 1 68  ? 46.283  63.492  65.559  1.00 31.08 ? 68   LEU C N   1 
ATOM   5749  C  CA  . LEU C 1 68  ? 45.410  63.356  66.721  1.00 31.39 ? 68   LEU C CA  1 
ATOM   5750  C  C   . LEU C 1 68  ? 46.230  62.935  67.937  1.00 30.79 ? 68   LEU C C   1 
ATOM   5751  O  O   . LEU C 1 68  ? 46.124  63.541  69.004  1.00 32.15 ? 68   LEU C O   1 
ATOM   5752  C  CB  . LEU C 1 68  ? 44.325  62.313  66.425  1.00 32.69 ? 68   LEU C CB  1 
ATOM   5753  C  CG  . LEU C 1 68  ? 43.073  62.193  67.301  1.00 34.12 ? 68   LEU C CG  1 
ATOM   5754  C  CD1 . LEU C 1 68  ? 42.065  61.309  66.584  1.00 35.10 ? 68   LEU C CD1 1 
ATOM   5755  C  CD2 . LEU C 1 68  ? 43.394  61.631  68.681  1.00 35.51 ? 68   LEU C CD2 1 
ATOM   5756  N  N   . ARG C 1 69  ? 47.044  61.896  67.763  1.00 31.05 ? 69   ARG C N   1 
ATOM   5757  C  CA  . ARG C 1 69  ? 47.894  61.379  68.833  1.00 31.78 ? 69   ARG C CA  1 
ATOM   5758  C  C   . ARG C 1 69  ? 48.858  62.444  69.343  1.00 33.09 ? 69   ARG C C   1 
ATOM   5759  O  O   . ARG C 1 69  ? 49.117  62.537  70.544  1.00 32.99 ? 69   ARG C O   1 
ATOM   5760  C  CB  . ARG C 1 69  ? 48.663  60.141  68.353  1.00 31.94 ? 69   ARG C CB  1 
ATOM   5761  C  CG  . ARG C 1 69  ? 47.923  58.821  68.550  1.00 31.95 ? 69   ARG C CG  1 
ATOM   5762  C  CD  . ARG C 1 69  ? 46.570  58.818  67.856  1.00 33.32 ? 69   ARG C CD  1 
ATOM   5763  N  NE  . ARG C 1 69  ? 45.771  57.643  68.192  1.00 33.60 ? 69   ARG C NE  1 
ATOM   5764  C  CZ  . ARG C 1 69  ? 44.457  57.551  68.002  1.00 32.45 ? 69   ARG C CZ  1 
ATOM   5765  N  NH1 . ARG C 1 69  ? 43.785  58.566  67.475  1.00 30.35 ? 69   ARG C NH1 1 
ATOM   5766  N  NH2 . ARG C 1 69  ? 43.812  56.446  68.349  1.00 32.06 ? 69   ARG C NH2 1 
ATOM   5767  N  N   . ALA C 1 70  ? 49.377  63.251  68.422  1.00 35.56 ? 70   ALA C N   1 
ATOM   5768  C  CA  . ALA C 1 70  ? 50.299  64.324  68.770  1.00 37.89 ? 70   ALA C CA  1 
ATOM   5769  C  C   . ALA C 1 70  ? 49.509  65.590  69.102  1.00 38.77 ? 70   ALA C C   1 
ATOM   5770  O  O   . ALA C 1 70  ? 49.568  66.585  68.376  1.00 39.58 ? 70   ALA C O   1 
ATOM   5771  C  CB  . ALA C 1 70  ? 51.267  64.580  67.622  1.00 37.93 ? 70   ALA C CB  1 
ATOM   5772  N  N   . GLY C 1 71  ? 48.759  65.532  70.198  1.00 39.50 ? 71   GLY C N   1 
ATOM   5773  C  CA  . GLY C 1 71  ? 47.960  66.667  70.621  1.00 39.69 ? 71   GLY C CA  1 
ATOM   5774  C  C   . GLY C 1 71  ? 46.605  66.730  69.944  1.00 40.21 ? 71   GLY C C   1 
ATOM   5775  O  O   . GLY C 1 71  ? 45.598  66.303  70.513  1.00 40.24 ? 71   GLY C O   1 
ATOM   5776  N  N   . GLY C 1 72  ? 46.585  67.264  68.726  1.00 41.51 ? 72   GLY C N   1 
ATOM   5777  C  CA  . GLY C 1 72  ? 45.347  67.385  67.976  1.00 41.35 ? 72   GLY C CA  1 
ATOM   5778  C  C   . GLY C 1 72  ? 45.003  68.832  67.677  1.00 42.12 ? 72   GLY C C   1 
ATOM   5779  O  O   . GLY C 1 72  ? 43.834  69.171  67.485  1.00 42.60 ? 72   GLY C O   1 
ATOM   5780  N  N   . ASP C 1 73  ? 46.027  69.682  67.634  1.00 42.27 ? 73   ASP C N   1 
ATOM   5781  C  CA  . ASP C 1 73  ? 45.859  71.108  67.364  1.00 41.47 ? 73   ASP C CA  1 
ATOM   5782  C  C   . ASP C 1 73  ? 45.818  71.383  65.863  1.00 42.31 ? 73   ASP C C   1 
ATOM   5783  O  O   . ASP C 1 73  ? 46.747  71.033  65.135  1.00 41.44 ? 73   ASP C O   1 
ATOM   5784  C  CB  . ASP C 1 73  ? 46.997  71.901  68.020  1.00 40.39 ? 73   ASP C CB  1 
ATOM   5785  C  CG  . ASP C 1 73  ? 46.796  73.410  67.941  1.00 39.16 ? 73   ASP C CG  1 
ATOM   5786  O  OD1 . ASP C 1 73  ? 45.649  73.872  67.760  1.00 39.35 ? 73   ASP C OD1 1 
ATOM   5787  O  OD2 . ASP C 1 73  ? 47.799  74.141  68.076  1.00 39.78 ? 73   ASP C OD2 1 
ATOM   5788  N  N   . THR C 1 74  ? 44.746  72.037  65.418  1.00 43.68 ? 74   THR C N   1 
ATOM   5789  C  CA  . THR C 1 74  ? 44.547  72.375  64.007  1.00 44.57 ? 74   THR C CA  1 
ATOM   5790  C  C   . THR C 1 74  ? 45.641  73.283  63.438  1.00 46.26 ? 74   THR C C   1 
ATOM   5791  O  O   . THR C 1 74  ? 45.662  73.573  62.239  1.00 46.13 ? 74   THR C O   1 
ATOM   5792  C  CB  . THR C 1 74  ? 43.171  73.047  63.781  1.00 44.02 ? 74   THR C CB  1 
ATOM   5793  O  OG1 . THR C 1 74  ? 43.079  74.240  64.571  1.00 45.22 ? 74   THR C OG1 1 
ATOM   5794  C  CG2 . THR C 1 74  ? 42.044  72.101  64.165  1.00 42.58 ? 74   THR C CG2 1 
ATOM   5795  N  N   . ARG C 1 75  ? 46.547  73.723  64.305  1.00 47.35 ? 75   ARG C N   1 
ATOM   5796  C  CA  . ARG C 1 75  ? 47.647  74.593  63.911  1.00 48.06 ? 75   ARG C CA  1 
ATOM   5797  C  C   . ARG C 1 75  ? 48.880  73.828  63.428  1.00 48.44 ? 75   ARG C C   1 
ATOM   5798  O  O   . ARG C 1 75  ? 49.860  74.438  62.993  1.00 50.34 ? 75   ARG C O   1 
ATOM   5799  C  CB  . ARG C 1 75  ? 48.048  75.491  65.081  1.00 48.45 ? 75   ARG C CB  1 
ATOM   5800  C  CG  . ARG C 1 75  ? 47.007  76.525  65.474  1.00 48.77 ? 75   ARG C CG  1 
ATOM   5801  C  CD  . ARG C 1 75  ? 47.657  77.666  66.247  1.00 49.71 ? 75   ARG C CD  1 
ATOM   5802  N  NE  . ARG C 1 75  ? 48.870  78.156  65.587  1.00 51.10 ? 75   ARG C NE  1 
ATOM   5803  C  CZ  . ARG C 1 75  ? 48.936  78.573  64.323  1.00 51.83 ? 75   ARG C CZ  1 
ATOM   5804  N  NH1 . ARG C 1 75  ? 47.854  78.574  63.554  1.00 51.97 ? 75   ARG C NH1 1 
ATOM   5805  N  NH2 . ARG C 1 75  ? 50.095  78.959  63.813  1.00 51.32 ? 75   ARG C NH2 1 
ATOM   5806  N  N   . ASN C 1 76  ? 48.833  72.499  63.502  1.00 46.97 ? 76   ASN C N   1 
ATOM   5807  C  CA  . ASN C 1 76  ? 49.968  71.677  63.090  1.00 44.46 ? 76   ASN C CA  1 
ATOM   5808  C  C   . ASN C 1 76  ? 49.609  70.571  62.102  1.00 42.41 ? 76   ASN C C   1 
ATOM   5809  O  O   . ASN C 1 76  ? 50.397  69.650  61.895  1.00 43.69 ? 76   ASN C O   1 
ATOM   5810  C  CB  . ASN C 1 76  ? 50.636  71.053  64.322  1.00 45.54 ? 76   ASN C CB  1 
ATOM   5811  C  CG  . ASN C 1 76  ? 51.097  72.091  65.327  1.00 46.08 ? 76   ASN C CG  1 
ATOM   5812  O  OD1 . ASN C 1 76  ? 50.322  72.536  66.175  1.00 47.44 ? 76   ASN C OD1 1 
ATOM   5813  N  ND2 . ASN C 1 76  ? 52.364  72.480  65.239  1.00 47.09 ? 76   ASN C ND2 1 
HETATM 5814  N  N   . MSE C 1 77  ? 48.439  70.671  61.476  1.00 39.48 ? 77   MSE C N   1 
HETATM 5815  C  CA  . MSE C 1 77  ? 47.993  69.659  60.517  1.00 36.57 ? 77   MSE C CA  1 
HETATM 5816  C  C   . MSE C 1 77  ? 48.954  69.444  59.350  1.00 34.15 ? 77   MSE C C   1 
HETATM 5817  O  O   . MSE C 1 77  ? 49.153  68.313  58.906  1.00 33.35 ? 77   MSE C O   1 
HETATM 5818  C  CB  . MSE C 1 77  ? 46.605  70.000  59.976  1.00 37.60 ? 77   MSE C CB  1 
HETATM 5819  C  CG  . MSE C 1 77  ? 45.514  70.002  61.023  1.00 37.70 ? 77   MSE C CG  1 
HETATM 5820  SE SE  . MSE C 1 77  ? 43.759  70.091  60.243  1.00 43.85 ? 77   MSE C SE  1 
HETATM 5821  C  CE  . MSE C 1 77  ? 43.361  68.207  60.205  1.00 37.83 ? 77   MSE C CE  1 
ATOM   5822  N  N   . ARG C 1 78  ? 49.551  70.530  58.863  1.00 32.05 ? 78   ARG C N   1 
ATOM   5823  C  CA  . ARG C 1 78  ? 50.490  70.464  57.745  1.00 28.78 ? 78   ARG C CA  1 
ATOM   5824  C  C   . ARG C 1 78  ? 51.803  69.774  58.116  1.00 27.08 ? 78   ARG C C   1 
ATOM   5825  O  O   . ARG C 1 78  ? 52.573  69.378  57.239  1.00 26.59 ? 78   ARG C O   1 
ATOM   5826  C  CB  . ARG C 1 78  ? 50.765  71.865  57.196  1.00 28.78 ? 78   ARG C CB  1 
ATOM   5827  C  CG  . ARG C 1 78  ? 49.517  72.607  56.742  1.00 28.03 ? 78   ARG C CG  1 
ATOM   5828  C  CD  . ARG C 1 78  ? 49.863  73.792  55.853  1.00 27.49 ? 78   ARG C CD  1 
ATOM   5829  N  NE  . ARG C 1 78  ? 50.520  73.378  54.613  1.00 26.25 ? 78   ARG C NE  1 
ATOM   5830  C  CZ  . ARG C 1 78  ? 49.907  72.782  53.593  1.00 26.64 ? 78   ARG C CZ  1 
ATOM   5831  N  NH1 . ARG C 1 78  ? 48.606  72.522  53.644  1.00 28.81 ? 78   ARG C NH1 1 
ATOM   5832  N  NH2 . ARG C 1 78  ? 50.602  72.433  52.520  1.00 28.02 ? 78   ARG C NH2 1 
ATOM   5833  N  N   . GLN C 1 79  ? 52.048  69.636  59.417  1.00 25.41 ? 79   GLN C N   1 
ATOM   5834  C  CA  . GLN C 1 79  ? 53.252  68.986  59.930  1.00 25.52 ? 79   GLN C CA  1 
ATOM   5835  C  C   . GLN C 1 79  ? 53.129  67.463  59.822  1.00 25.70 ? 79   GLN C C   1 
ATOM   5836  O  O   . GLN C 1 79  ? 54.108  66.736  60.001  1.00 26.66 ? 79   GLN C O   1 
ATOM   5837  C  CB  . GLN C 1 79  ? 53.472  69.382  61.394  1.00 24.79 ? 79   GLN C CB  1 
ATOM   5838  C  CG  . GLN C 1 79  ? 54.712  68.782  62.044  1.00 23.68 ? 79   GLN C CG  1 
ATOM   5839  C  CD  . GLN C 1 79  ? 54.781  69.044  63.539  1.00 23.89 ? 79   GLN C CD  1 
ATOM   5840  O  OE1 . GLN C 1 79  ? 53.945  69.751  64.101  1.00 23.18 ? 79   GLN C OE1 1 
ATOM   5841  N  NE2 . GLN C 1 79  ? 55.785  68.468  64.191  1.00 24.50 ? 79   GLN C NE2 1 
ATOM   5842  N  N   . PHE C 1 80  ? 51.920  66.991  59.527  1.00 25.60 ? 80   PHE C N   1 
ATOM   5843  C  CA  . PHE C 1 80  ? 51.651  65.562  59.403  1.00 23.33 ? 80   PHE C CA  1 
ATOM   5844  C  C   . PHE C 1 80  ? 51.217  65.174  57.989  1.00 24.39 ? 80   PHE C C   1 
ATOM   5845  O  O   . PHE C 1 80  ? 50.968  64.000  57.707  1.00 24.73 ? 80   PHE C O   1 
ATOM   5846  C  CB  . PHE C 1 80  ? 50.585  65.142  60.420  1.00 19.71 ? 80   PHE C CB  1 
ATOM   5847  C  CG  . PHE C 1 80  ? 50.930  65.504  61.837  1.00 15.13 ? 80   PHE C CG  1 
ATOM   5848  C  CD1 . PHE C 1 80  ? 51.653  64.629  62.637  1.00 15.26 ? 80   PHE C CD1 1 
ATOM   5849  C  CD2 . PHE C 1 80  ? 50.550  66.732  62.365  1.00 13.86 ? 80   PHE C CD2 1 
ATOM   5850  C  CE1 . PHE C 1 80  ? 51.993  64.974  63.943  1.00 14.47 ? 80   PHE C CE1 1 
ATOM   5851  C  CE2 . PHE C 1 80  ? 50.885  67.085  63.669  1.00 10.86 ? 80   PHE C CE2 1 
ATOM   5852  C  CZ  . PHE C 1 80  ? 51.607  66.205  64.457  1.00 11.69 ? 80   PHE C CZ  1 
ATOM   5853  N  N   . GLY C 1 81  ? 51.144  66.166  57.105  1.00 25.94 ? 81   GLY C N   1 
ATOM   5854  C  CA  . GLY C 1 81  ? 50.746  65.920  55.730  1.00 28.38 ? 81   GLY C CA  1 
ATOM   5855  C  C   . GLY C 1 81  ? 49.245  65.829  55.552  1.00 29.53 ? 81   GLY C C   1 
ATOM   5856  O  O   . GLY C 1 81  ? 48.736  64.845  55.013  1.00 30.94 ? 81   GLY C O   1 
ATOM   5857  N  N   . ILE C 1 82  ? 48.535  66.856  56.008  1.00 31.52 ? 82   ILE C N   1 
ATOM   5858  C  CA  . ILE C 1 82  ? 47.082  66.890  55.901  1.00 33.64 ? 82   ILE C CA  1 
ATOM   5859  C  C   . ILE C 1 82  ? 46.616  68.103  55.104  1.00 34.71 ? 82   ILE C C   1 
ATOM   5860  O  O   . ILE C 1 82  ? 46.703  69.239  55.575  1.00 35.34 ? 82   ILE C O   1 
ATOM   5861  C  CB  . ILE C 1 82  ? 46.408  66.922  57.291  1.00 34.62 ? 82   ILE C CB  1 
ATOM   5862  C  CG1 . ILE C 1 82  ? 46.881  65.739  58.140  1.00 36.77 ? 82   ILE C CG1 1 
ATOM   5863  C  CG2 . ILE C 1 82  ? 44.894  66.875  57.138  1.00 34.04 ? 82   ILE C CG2 1 
ATOM   5864  C  CD1 . ILE C 1 82  ? 46.347  65.747  59.558  1.00 37.19 ? 82   ILE C CD1 1 
ATOM   5865  N  N   . ASP C 1 83  ? 46.127  67.848  53.893  1.00 34.90 ? 83   ASP C N   1 
ATOM   5866  C  CA  . ASP C 1 83  ? 45.629  68.902  53.018  1.00 34.51 ? 83   ASP C CA  1 
ATOM   5867  C  C   . ASP C 1 83  ? 44.175  69.237  53.323  1.00 35.12 ? 83   ASP C C   1 
ATOM   5868  O  O   . ASP C 1 83  ? 43.303  68.368  53.265  1.00 35.13 ? 83   ASP C O   1 
ATOM   5869  C  CB  . ASP C 1 83  ? 45.760  68.489  51.546  1.00 33.06 ? 83   ASP C CB  1 
ATOM   5870  C  CG  . ASP C 1 83  ? 47.184  68.589  51.027  1.00 32.51 ? 83   ASP C CG  1 
ATOM   5871  O  OD1 . ASP C 1 83  ? 48.083  69.028  51.778  1.00 33.18 ? 83   ASP C OD1 1 
ATOM   5872  O  OD2 . ASP C 1 83  ? 47.401  68.234  49.850  1.00 31.85 ? 83   ASP C OD2 1 
ATOM   5873  N  N   . ALA C 1 84  ? 43.925  70.498  53.661  1.00 35.90 ? 84   ALA C N   1 
ATOM   5874  C  CA  . ALA C 1 84  ? 42.578  70.966  53.964  1.00 35.95 ? 84   ALA C CA  1 
ATOM   5875  C  C   . ALA C 1 84  ? 41.941  71.537  52.699  1.00 36.49 ? 84   ALA C C   1 
ATOM   5876  O  O   . ALA C 1 84  ? 42.594  72.247  51.933  1.00 36.40 ? 84   ALA C O   1 
ATOM   5877  C  CB  . ALA C 1 84  ? 42.623  72.023  55.058  1.00 35.95 ? 84   ALA C CB  1 
ATOM   5878  N  N   . TRP C 1 85  ? 40.674  71.199  52.473  1.00 37.18 ? 85   TRP C N   1 
ATOM   5879  C  CA  . TRP C 1 85  ? 39.944  71.675  51.301  1.00 38.13 ? 85   TRP C CA  1 
ATOM   5880  C  C   . TRP C 1 85  ? 38.583  72.238  51.700  1.00 38.93 ? 85   TRP C C   1 
ATOM   5881  O  O   . TRP C 1 85  ? 37.648  71.488  51.987  1.00 39.89 ? 85   TRP C O   1 
ATOM   5882  C  CB  . TRP C 1 85  ? 39.758  70.543  50.283  1.00 37.78 ? 85   TRP C CB  1 
ATOM   5883  C  CG  . TRP C 1 85  ? 41.037  70.038  49.675  1.00 37.51 ? 85   TRP C CG  1 
ATOM   5884  C  CD1 . TRP C 1 85  ? 41.872  69.089  50.191  1.00 36.81 ? 85   TRP C CD1 1 
ATOM   5885  C  CD2 . TRP C 1 85  ? 41.617  70.448  48.430  1.00 37.65 ? 85   TRP C CD2 1 
ATOM   5886  N  NE1 . TRP C 1 85  ? 42.935  68.882  49.346  1.00 36.61 ? 85   TRP C NE1 1 
ATOM   5887  C  CE2 . TRP C 1 85  ? 42.804  69.703  48.257  1.00 36.99 ? 85   TRP C CE2 1 
ATOM   5888  C  CE3 . TRP C 1 85  ? 41.248  71.372  47.443  1.00 38.30 ? 85   TRP C CE3 1 
ATOM   5889  C  CZ2 . TRP C 1 85  ? 43.627  69.854  47.135  1.00 38.55 ? 85   TRP C CZ2 1 
ATOM   5890  C  CZ3 . TRP C 1 85  ? 42.068  71.521  46.326  1.00 38.42 ? 85   TRP C CZ3 1 
ATOM   5891  C  CH2 . TRP C 1 85  ? 43.243  70.765  46.184  1.00 38.57 ? 85   TRP C CH2 1 
ATOM   5892  N  N   . GLN C 1 86  ? 38.479  73.564  51.715  1.00 40.27 ? 86   GLN C N   1 
ATOM   5893  C  CA  . GLN C 1 86  ? 37.237  74.237  52.078  1.00 42.07 ? 86   GLN C CA  1 
ATOM   5894  C  C   . GLN C 1 86  ? 36.127  74.013  51.058  1.00 43.72 ? 86   GLN C C   1 
ATOM   5895  O  O   . GLN C 1 86  ? 36.322  74.203  49.855  1.00 43.69 ? 86   GLN C O   1 
ATOM   5896  C  CB  . GLN C 1 86  ? 37.470  75.740  52.249  1.00 40.54 ? 86   GLN C CB  1 
ATOM   5897  C  CG  . GLN C 1 86  ? 37.355  76.250  53.680  1.00 39.08 ? 86   GLN C CG  1 
ATOM   5898  C  CD  . GLN C 1 86  ? 35.941  76.182  54.235  1.00 38.11 ? 86   GLN C CD  1 
ATOM   5899  O  OE1 . GLN C 1 86  ? 35.380  75.099  54.418  1.00 37.39 ? 86   GLN C OE1 1 
ATOM   5900  N  NE2 . GLN C 1 86  ? 35.365  77.344  54.524  1.00 36.52 ? 86   GLN C NE2 1 
HETATM 5901  N  N   . MSE C 1 87  ? 34.964  73.601  51.555  1.00 44.46 ? 87   MSE C N   1 
HETATM 5902  C  CA  . MSE C 1 87  ? 33.801  73.357  50.710  1.00 44.23 ? 87   MSE C CA  1 
HETATM 5903  C  C   . MSE C 1 87  ? 32.863  74.553  50.780  1.00 43.24 ? 87   MSE C C   1 
HETATM 5904  O  O   . MSE C 1 87  ? 32.636  75.106  51.855  1.00 43.18 ? 87   MSE C O   1 
HETATM 5905  C  CB  . MSE C 1 87  ? 33.059  72.106  51.172  1.00 45.42 ? 87   MSE C CB  1 
HETATM 5906  C  CG  . MSE C 1 87  ? 33.843  70.820  51.030  1.00 45.90 ? 87   MSE C CG  1 
HETATM 5907  SE SE  . MSE C 1 87  ? 32.797  69.317  51.614  1.00 48.65 ? 87   MSE C SE  1 
HETATM 5908  C  CE  . MSE C 1 87  ? 31.480  69.312  50.202  1.00 45.49 ? 87   MSE C CE  1 
ATOM   5909  N  N   . GLU C 1 88  ? 32.306  74.935  49.635  1.00 43.07 ? 88   GLU C N   1 
ATOM   5910  C  CA  . GLU C 1 88  ? 31.391  76.068  49.566  1.00 43.41 ? 88   GLU C CA  1 
ATOM   5911  C  C   . GLU C 1 88  ? 30.016  75.782  50.171  1.00 42.85 ? 88   GLU C C   1 
ATOM   5912  O  O   . GLU C 1 88  ? 29.551  76.519  51.040  1.00 41.50 ? 88   GLU C O   1 
ATOM   5913  C  CB  . GLU C 1 88  ? 31.235  76.545  48.118  1.00 44.67 ? 88   GLU C CB  1 
ATOM   5914  C  CG  . GLU C 1 88  ? 30.799  75.463  47.140  1.00 46.15 ? 88   GLU C CG  1 
ATOM   5915  C  CD  . GLU C 1 88  ? 30.365  76.022  45.800  1.00 47.49 ? 88   GLU C CD  1 
ATOM   5916  O  OE1 . GLU C 1 88  ? 31.234  76.503  45.040  1.00 47.70 ? 88   GLU C OE1 1 
ATOM   5917  O  OE2 . GLU C 1 88  ? 29.151  75.979  45.508  1.00 46.84 ? 88   GLU C OE2 1 
ATOM   5918  N  N   . GLY C 1 89  ? 29.386  74.696  49.733  1.00 43.42 ? 89   GLY C N   1 
ATOM   5919  C  CA  . GLY C 1 89  ? 28.065  74.350  50.227  1.00 45.11 ? 89   GLY C CA  1 
ATOM   5920  C  C   . GLY C 1 89  ? 27.009  75.025  49.376  1.00 46.38 ? 89   GLY C C   1 
ATOM   5921  O  O   . GLY C 1 89  ? 27.207  75.200  48.171  1.00 45.49 ? 89   GLY C O   1 
ATOM   5922  N  N   . ALA C 1 90  ? 25.883  75.387  49.987  1.00 48.27 ? 90   ALA C N   1 
ATOM   5923  C  CA  . ALA C 1 90  ? 24.810  76.070  49.265  1.00 50.76 ? 90   ALA C CA  1 
ATOM   5924  C  C   . ALA C 1 90  ? 25.304  77.472  48.913  1.00 51.44 ? 90   ALA C C   1 
ATOM   5925  O  O   . ALA C 1 90  ? 25.313  77.867  47.744  1.00 52.58 ? 90   ALA C O   1 
ATOM   5926  C  CB  . ALA C 1 90  ? 23.554  76.145  50.122  1.00 51.29 ? 90   ALA C CB  1 
ATOM   5927  N  N   . ASP C 1 91  ? 25.713  78.215  49.937  1.00 51.01 ? 91   ASP C N   1 
ATOM   5928  C  CA  . ASP C 1 91  ? 26.249  79.559  49.761  1.00 49.44 ? 91   ASP C CA  1 
ATOM   5929  C  C   . ASP C 1 91  ? 27.760  79.422  49.590  1.00 48.15 ? 91   ASP C C   1 
ATOM   5930  O  O   . ASP C 1 91  ? 28.410  78.698  50.344  1.00 48.20 ? 91   ASP C O   1 
ATOM   5931  C  CB  . ASP C 1 91  ? 25.919  80.439  50.976  1.00 49.69 ? 91   ASP C CB  1 
ATOM   5932  C  CG  . ASP C 1 91  ? 26.417  79.848  52.288  1.00 51.06 ? 91   ASP C CG  1 
ATOM   5933  O  OD1 . ASP C 1 91  ? 25.892  78.795  52.711  1.00 53.12 ? 91   ASP C OD1 1 
ATOM   5934  O  OD2 . ASP C 1 91  ? 27.330  80.440  52.901  1.00 51.41 ? 91   ASP C OD2 1 
ATOM   5935  N  N   . ASN C 1 92  ? 28.313  80.101  48.590  1.00 46.15 ? 92   ASN C N   1 
ATOM   5936  C  CA  . ASN C 1 92  ? 29.747  80.036  48.317  1.00 44.16 ? 92   ASN C CA  1 
ATOM   5937  C  C   . ASN C 1 92  ? 30.618  80.696  49.385  1.00 42.76 ? 92   ASN C C   1 
ATOM   5938  O  O   . ASN C 1 92  ? 31.660  81.267  49.074  1.00 43.15 ? 92   ASN C O   1 
ATOM   5939  C  CB  . ASN C 1 92  ? 30.052  80.647  46.944  1.00 44.44 ? 92   ASN C CB  1 
ATOM   5940  C  CG  . ASN C 1 92  ? 29.544  79.794  45.797  1.00 43.68 ? 92   ASN C CG  1 
ATOM   5941  O  OD1 . ASN C 1 92  ? 28.367  79.435  45.744  1.00 42.17 ? 92   ASN C OD1 1 
ATOM   5942  N  ND2 . ASN C 1 92  ? 30.434  79.466  44.867  1.00 42.46 ? 92   ASN C ND2 1 
ATOM   5943  N  N   . TYR C 1 93  ? 30.205  80.598  50.644  1.00 41.73 ? 93   TYR C N   1 
ATOM   5944  C  CA  . TYR C 1 93  ? 30.962  81.191  51.741  1.00 43.43 ? 93   TYR C CA  1 
ATOM   5945  C  C   . TYR C 1 93  ? 31.548  80.146  52.688  1.00 43.02 ? 93   TYR C C   1 
ATOM   5946  O  O   . TYR C 1 93  ? 31.906  80.458  53.825  1.00 43.08 ? 93   TYR C O   1 
ATOM   5947  C  CB  . TYR C 1 93  ? 30.091  82.183  52.517  1.00 45.50 ? 93   TYR C CB  1 
ATOM   5948  C  CG  . TYR C 1 93  ? 29.684  83.412  51.728  1.00 46.25 ? 93   TYR C CG  1 
ATOM   5949  C  CD1 . TYR C 1 93  ? 30.566  84.016  50.832  1.00 46.71 ? 93   TYR C CD1 1 
ATOM   5950  C  CD2 . TYR C 1 93  ? 28.419  83.976  51.886  1.00 47.29 ? 93   TYR C CD2 1 
ATOM   5951  C  CE1 . TYR C 1 93  ? 30.200  85.152  50.114  1.00 47.80 ? 93   TYR C CE1 1 
ATOM   5952  C  CE2 . TYR C 1 93  ? 28.042  85.113  51.173  1.00 49.24 ? 93   TYR C CE2 1 
ATOM   5953  C  CZ  . TYR C 1 93  ? 28.938  85.696  50.289  1.00 48.58 ? 93   TYR C CZ  1 
ATOM   5954  O  OH  . TYR C 1 93  ? 28.575  86.825  49.590  1.00 48.82 ? 93   TYR C OH  1 
ATOM   5955  N  N   . GLY C 1 94  ? 31.642  78.907  52.212  1.00 43.76 ? 94   GLY C N   1 
ATOM   5956  C  CA  . GLY C 1 94  ? 32.196  77.834  53.019  1.00 42.26 ? 94   GLY C CA  1 
ATOM   5957  C  C   . GLY C 1 94  ? 31.202  77.040  53.845  1.00 42.55 ? 94   GLY C C   1 
ATOM   5958  O  O   . GLY C 1 94  ? 31.543  75.976  54.363  1.00 41.60 ? 94   GLY C O   1 
ATOM   5959  N  N   . ASN C 1 95  ? 29.974  77.539  53.960  1.00 44.11 ? 95   ASN C N   1 
ATOM   5960  C  CA  . ASN C 1 95  ? 28.938  76.867  54.743  1.00 44.10 ? 95   ASN C CA  1 
ATOM   5961  C  C   . ASN C 1 95  ? 28.134  75.838  53.952  1.00 44.64 ? 95   ASN C C   1 
ATOM   5962  O  O   . ASN C 1 95  ? 27.461  76.169  52.973  1.00 45.30 ? 95   ASN C O   1 
ATOM   5963  C  CB  . ASN C 1 95  ? 28.014  77.897  55.390  1.00 41.84 ? 95   ASN C CB  1 
ATOM   5964  C  CG  . ASN C 1 95  ? 28.742  78.781  56.380  1.00 40.96 ? 95   ASN C CG  1 
ATOM   5965  O  OD1 . ASN C 1 95  ? 29.467  79.698  55.993  1.00 40.14 ? 95   ASN C OD1 1 
ATOM   5966  N  ND2 . ASN C 1 95  ? 28.573  78.495  57.666  1.00 38.40 ? 95   ASN C ND2 1 
ATOM   5967  N  N   . VAL C 1 96  ? 28.206  74.590  54.406  1.00 44.19 ? 96   VAL C N   1 
ATOM   5968  C  CA  . VAL C 1 96  ? 27.521  73.469  53.770  1.00 43.69 ? 96   VAL C CA  1 
ATOM   5969  C  C   . VAL C 1 96  ? 26.242  73.065  54.501  1.00 43.02 ? 96   VAL C C   1 
ATOM   5970  O  O   . VAL C 1 96  ? 26.195  73.053  55.732  1.00 41.37 ? 96   VAL C O   1 
ATOM   5971  C  CB  . VAL C 1 96  ? 28.459  72.239  53.678  1.00 43.99 ? 96   VAL C CB  1 
ATOM   5972  C  CG1 . VAL C 1 96  ? 27.753  71.067  53.011  1.00 45.02 ? 96   VAL C CG1 1 
ATOM   5973  C  CG2 . VAL C 1 96  ? 29.718  72.604  52.911  1.00 44.81 ? 96   VAL C CG2 1 
ATOM   5974  N  N   . GLN C 1 97  ? 25.216  72.726  53.722  1.00 43.21 ? 97   GLN C N   1 
ATOM   5975  C  CA  . GLN C 1 97  ? 23.922  72.297  54.250  1.00 43.84 ? 97   GLN C CA  1 
ATOM   5976  C  C   . GLN C 1 97  ? 24.061  70.987  55.028  1.00 42.68 ? 97   GLN C C   1 
ATOM   5977  O  O   . GLN C 1 97  ? 24.397  69.946  54.462  1.00 42.49 ? 97   GLN C O   1 
ATOM   5978  C  CB  . GLN C 1 97  ? 22.918  72.138  53.098  1.00 44.13 ? 97   GLN C CB  1 
ATOM   5979  C  CG  . GLN C 1 97  ? 21.597  71.453  53.456  1.00 46.72 ? 97   GLN C CG  1 
ATOM   5980  C  CD  . GLN C 1 97  ? 20.767  72.218  54.471  1.00 47.35 ? 97   GLN C CD  1 
ATOM   5981  O  OE1 . GLN C 1 97  ? 20.427  71.557  55.572  1.00 48.36 ? 97   GLN C OE1 1 
ATOM   5982  N  NE2 . GLN C 1 97  ? 20.418  73.379  54.259  1.00 48.98 ? 97   GLN C NE2 1 
ATOM   5983  N  N   . PHE C 1 98  ? 23.829  71.062  56.335  1.00 41.69 ? 98   PHE C N   1 
ATOM   5984  C  CA  . PHE C 1 98  ? 23.921  69.898  57.209  1.00 39.78 ? 98   PHE C CA  1 
ATOM   5985  C  C   . PHE C 1 98  ? 22.558  69.366  57.631  1.00 38.98 ? 98   PHE C C   1 
ATOM   5986  O  O   . PHE C 1 98  ? 21.794  70.056  58.308  1.00 38.56 ? 98   PHE C O   1 
ATOM   5987  C  CB  . PHE C 1 98  ? 24.737  70.228  58.465  1.00 39.54 ? 98   PHE C CB  1 
ATOM   5988  C  CG  . PHE C 1 98  ? 26.218  70.024  58.306  1.00 39.39 ? 98   PHE C CG  1 
ATOM   5989  C  CD1 . PHE C 1 98  ? 26.718  68.864  57.722  1.00 37.64 ? 98   PHE C CD1 1 
ATOM   5990  C  CD2 . PHE C 1 98  ? 27.116  70.985  58.761  1.00 38.11 ? 98   PHE C CD2 1 
ATOM   5991  C  CE1 . PHE C 1 98  ? 28.090  68.663  57.594  1.00 36.86 ? 98   PHE C CE1 1 
ATOM   5992  C  CE2 . PHE C 1 98  ? 28.489  70.793  58.638  1.00 37.78 ? 98   PHE C CE2 1 
ATOM   5993  C  CZ  . PHE C 1 98  ? 28.976  69.628  58.053  1.00 37.16 ? 98   PHE C CZ  1 
ATOM   5994  N  N   . THR C 1 99  ? 22.251  68.145  57.205  1.00 38.02 ? 99   THR C N   1 
ATOM   5995  C  CA  . THR C 1 99  ? 20.997  67.501  57.572  1.00 36.27 ? 99   THR C CA  1 
ATOM   5996  C  C   . THR C 1 99  ? 21.358  66.290  58.432  1.00 35.53 ? 99   THR C C   1 
ATOM   5997  O  O   . THR C 1 99  ? 22.540  66.028  58.669  1.00 34.99 ? 99   THR C O   1 
ATOM   5998  C  CB  . THR C 1 99  ? 20.178  67.068  56.329  1.00 35.95 ? 99   THR C CB  1 
ATOM   5999  O  OG1 . THR C 1 99  ? 18.852  66.707  56.734  1.00 39.03 ? 99   THR C OG1 1 
ATOM   6000  C  CG2 . THR C 1 99  ? 20.820  65.881  55.632  1.00 36.42 ? 99   THR C CG2 1 
ATOM   6001  N  N   . GLY C 1 100 ? 20.356  65.557  58.906  1.00 34.58 ? 100  GLY C N   1 
ATOM   6002  C  CA  . GLY C 1 100 ? 20.647  64.405  59.738  1.00 32.76 ? 100  GLY C CA  1 
ATOM   6003  C  C   . GLY C 1 100 ? 19.647  63.271  59.673  1.00 32.22 ? 100  GLY C C   1 
ATOM   6004  O  O   . GLY C 1 100 ? 18.490  63.457  59.294  1.00 30.12 ? 100  GLY C O   1 
ATOM   6005  N  N   . TYR C 1 101 ? 20.117  62.084  60.044  1.00 32.44 ? 101  TYR C N   1 
ATOM   6006  C  CA  . TYR C 1 101 ? 19.297  60.879  60.063  1.00 32.28 ? 101  TYR C CA  1 
ATOM   6007  C  C   . TYR C 1 101 ? 19.817  59.945  61.150  1.00 31.28 ? 101  TYR C C   1 
ATOM   6008  O  O   . TYR C 1 101 ? 20.974  60.043  61.559  1.00 32.60 ? 101  TYR C O   1 
ATOM   6009  C  CB  . TYR C 1 101 ? 19.309  60.181  58.694  1.00 32.70 ? 101  TYR C CB  1 
ATOM   6010  C  CG  . TYR C 1 101 ? 20.631  59.559  58.297  1.00 31.10 ? 101  TYR C CG  1 
ATOM   6011  C  CD1 . TYR C 1 101 ? 21.729  60.351  57.967  1.00 29.80 ? 101  TYR C CD1 1 
ATOM   6012  C  CD2 . TYR C 1 101 ? 20.777  58.172  58.236  1.00 30.89 ? 101  TYR C CD2 1 
ATOM   6013  C  CE1 . TYR C 1 101 ? 22.939  59.778  57.584  1.00 29.74 ? 101  TYR C CE1 1 
ATOM   6014  C  CE2 . TYR C 1 101 ? 21.983  57.590  57.853  1.00 29.29 ? 101  TYR C CE2 1 
ATOM   6015  C  CZ  . TYR C 1 101 ? 23.059  58.400  57.529  1.00 29.50 ? 101  TYR C CZ  1 
ATOM   6016  O  OH  . TYR C 1 101 ? 24.251  57.834  57.143  1.00 30.96 ? 101  TYR C OH  1 
ATOM   6017  N  N   . TYR C 1 102 ? 18.959  59.048  61.622  1.00 31.44 ? 102  TYR C N   1 
ATOM   6018  C  CA  . TYR C 1 102 ? 19.342  58.112  62.673  1.00 32.37 ? 102  TYR C CA  1 
ATOM   6019  C  C   . TYR C 1 102 ? 18.753  56.724  62.441  1.00 33.48 ? 102  TYR C C   1 
ATOM   6020  O  O   . TYR C 1 102 ? 18.102  56.472  61.426  1.00 35.49 ? 102  TYR C O   1 
ATOM   6021  C  CB  . TYR C 1 102 ? 18.889  58.638  64.041  1.00 31.18 ? 102  TYR C CB  1 
ATOM   6022  C  CG  . TYR C 1 102 ? 17.390  58.587  64.260  1.00 29.61 ? 102  TYR C CG  1 
ATOM   6023  C  CD1 . TYR C 1 102 ? 16.514  59.266  63.410  1.00 29.79 ? 102  TYR C CD1 1 
ATOM   6024  C  CD2 . TYR C 1 102 ? 16.846  57.852  65.312  1.00 26.93 ? 102  TYR C CD2 1 
ATOM   6025  C  CE1 . TYR C 1 102 ? 15.136  59.210  63.600  1.00 27.36 ? 102  TYR C CE1 1 
ATOM   6026  C  CE2 . TYR C 1 102 ? 15.470  57.791  65.511  1.00 25.97 ? 102  TYR C CE2 1 
ATOM   6027  C  CZ  . TYR C 1 102 ? 14.623  58.471  64.652  1.00 26.08 ? 102  TYR C CZ  1 
ATOM   6028  O  OH  . TYR C 1 102 ? 13.263  58.414  64.845  1.00 26.92 ? 102  TYR C OH  1 
ATOM   6029  N  N   . THR C 1 103 ? 18.988  55.829  63.396  1.00 33.21 ? 103  THR C N   1 
ATOM   6030  C  CA  . THR C 1 103 ? 18.484  54.466  63.325  1.00 32.35 ? 103  THR C CA  1 
ATOM   6031  C  C   . THR C 1 103 ? 17.462  54.262  64.439  1.00 32.90 ? 103  THR C C   1 
ATOM   6032  O  O   . THR C 1 103 ? 17.823  54.015  65.590  1.00 34.05 ? 103  THR C O   1 
ATOM   6033  C  CB  . THR C 1 103 ? 19.625  53.444  63.475  1.00 32.28 ? 103  THR C CB  1 
ATOM   6034  O  OG1 . THR C 1 103 ? 20.594  53.662  62.443  1.00 33.46 ? 103  THR C OG1 1 
ATOM   6035  C  CG2 . THR C 1 103 ? 19.094  52.026  63.363  1.00 32.65 ? 103  THR C CG2 1 
ATOM   6036  N  N   . PRO C 1 104 ? 16.167  54.397  64.110  1.00 32.95 ? 104  PRO C N   1 
ATOM   6037  C  CA  . PRO C 1 104 ? 15.078  54.232  65.077  1.00 32.42 ? 104  PRO C CA  1 
ATOM   6038  C  C   . PRO C 1 104 ? 14.847  52.790  65.514  1.00 31.28 ? 104  PRO C C   1 
ATOM   6039  O  O   . PRO C 1 104 ? 14.961  51.860  64.715  1.00 31.65 ? 104  PRO C O   1 
ATOM   6040  C  CB  . PRO C 1 104 ? 13.872  54.781  64.317  1.00 33.32 ? 104  PRO C CB  1 
ATOM   6041  C  CG  . PRO C 1 104 ? 14.180  54.414  62.904  1.00 33.47 ? 104  PRO C CG  1 
ATOM   6042  C  CD  . PRO C 1 104 ? 15.639  54.780  62.788  1.00 32.89 ? 104  PRO C CD  1 
ATOM   6043  N  N   . VAL C 1 105 ? 14.555  52.612  66.798  1.00 30.42 ? 105  VAL C N   1 
ATOM   6044  C  CA  . VAL C 1 105 ? 14.276  51.290  67.344  1.00 30.13 ? 105  VAL C CA  1 
ATOM   6045  C  C   . VAL C 1 105 ? 12.757  51.169  67.442  1.00 31.43 ? 105  VAL C C   1 
ATOM   6046  O  O   . VAL C 1 105 ? 12.111  51.898  68.199  1.00 33.09 ? 105  VAL C O   1 
ATOM   6047  C  CB  . VAL C 1 105 ? 14.912  51.095  68.740  1.00 29.11 ? 105  VAL C CB  1 
ATOM   6048  C  CG1 . VAL C 1 105 ? 14.634  49.688  69.253  1.00 27.03 ? 105  VAL C CG1 1 
ATOM   6049  C  CG2 . VAL C 1 105 ? 16.411  51.346  68.678  1.00 28.04 ? 105  VAL C CG2 1 
ATOM   6050  N  N   . ILE C 1 106 ? 12.191  50.279  66.633  1.00 31.09 ? 106  ILE C N   1 
ATOM   6051  C  CA  . ILE C 1 106 ? 10.750  50.068  66.605  1.00 30.72 ? 106  ILE C CA  1 
ATOM   6052  C  C   . ILE C 1 106 ? 10.365  48.739  67.237  1.00 30.40 ? 106  ILE C C   1 
ATOM   6053  O  O   . ILE C 1 106 ? 11.021  47.723  67.012  1.00 30.33 ? 106  ILE C O   1 
ATOM   6054  C  CB  . ILE C 1 106 ? 10.214  50.108  65.152  1.00 31.84 ? 106  ILE C CB  1 
ATOM   6055  C  CG1 . ILE C 1 106 ? 10.545  51.457  64.509  1.00 31.64 ? 106  ILE C CG1 1 
ATOM   6056  C  CG2 . ILE C 1 106 ? 8.707   49.869  65.126  1.00 31.61 ? 106  ILE C CG2 1 
ATOM   6057  C  CD1 . ILE C 1 106 ? 10.080  51.579  63.083  1.00 33.33 ? 106  ILE C CD1 1 
ATOM   6058  N  N   . GLN C 1 107 ? 9.309   48.760  68.046  1.00 30.71 ? 107  GLN C N   1 
ATOM   6059  C  CA  . GLN C 1 107 ? 8.821   47.551  68.695  1.00 30.19 ? 107  GLN C CA  1 
ATOM   6060  C  C   . GLN C 1 107 ? 7.742   46.940  67.806  1.00 29.42 ? 107  GLN C C   1 
ATOM   6061  O  O   . GLN C 1 107 ? 6.793   47.621  67.409  1.00 28.03 ? 107  GLN C O   1 
ATOM   6062  C  CB  . GLN C 1 107 ? 8.264   47.865  70.087  1.00 31.59 ? 107  GLN C CB  1 
ATOM   6063  C  CG  . GLN C 1 107 ? 7.924   46.625  70.904  1.00 32.85 ? 107  GLN C CG  1 
ATOM   6064  C  CD  . GLN C 1 107 ? 7.583   46.940  72.345  1.00 31.16 ? 107  GLN C CD  1 
ATOM   6065  O  OE1 . GLN C 1 107 ? 6.472   47.369  72.654  1.00 33.40 ? 107  GLN C OE1 1 
ATOM   6066  N  NE2 . GLN C 1 107 ? 8.539   46.718  73.240  1.00 32.38 ? 107  GLN C NE2 1 
ATOM   6067  N  N   . ALA C 1 108 ? 7.903   45.661  67.480  1.00 28.69 ? 108  ALA C N   1 
ATOM   6068  C  CA  . ALA C 1 108 ? 6.953   44.969  66.618  1.00 27.91 ? 108  ALA C CA  1 
ATOM   6069  C  C   . ALA C 1 108 ? 6.833   43.486  66.948  1.00 27.37 ? 108  ALA C C   1 
ATOM   6070  O  O   . ALA C 1 108 ? 7.628   42.944  67.711  1.00 28.81 ? 108  ALA C O   1 
ATOM   6071  C  CB  . ALA C 1 108 ? 7.360   45.147  65.161  1.00 28.08 ? 108  ALA C CB  1 
ATOM   6072  N  N   . ARG C 1 109 ? 5.821   42.842  66.372  1.00 27.30 ? 109  ARG C N   1 
ATOM   6073  C  CA  . ARG C 1 109 ? 5.581   41.417  66.578  1.00 27.24 ? 109  ARG C CA  1 
ATOM   6074  C  C   . ARG C 1 109 ? 5.520   40.696  65.235  1.00 27.66 ? 109  ARG C C   1 
ATOM   6075  O  O   . ARG C 1 109 ? 5.209   41.306  64.212  1.00 25.29 ? 109  ARG C O   1 
ATOM   6076  C  CB  . ARG C 1 109 ? 4.273   41.195  67.341  1.00 26.87 ? 109  ARG C CB  1 
ATOM   6077  C  CG  . ARG C 1 109 ? 4.243   41.809  68.731  1.00 28.38 ? 109  ARG C CG  1 
ATOM   6078  C  CD  . ARG C 1 109 ? 5.341   41.249  69.625  1.00 27.97 ? 109  ARG C CD  1 
ATOM   6079  N  NE  . ARG C 1 109 ? 5.341   41.871  70.948  1.00 26.45 ? 109  ARG C NE  1 
ATOM   6080  C  CZ  . ARG C 1 109 ? 5.884   43.053  71.226  1.00 25.13 ? 109  ARG C CZ  1 
ATOM   6081  N  NH1 . ARG C 1 109 ? 6.483   43.758  70.275  1.00 23.50 ? 109  ARG C NH1 1 
ATOM   6082  N  NH2 . ARG C 1 109 ? 5.823   43.538  72.460  1.00 25.31 ? 109  ARG C NH2 1 
ATOM   6083  N  N   . HIS C 1 110 ? 5.818   39.398  65.246  1.00 29.03 ? 110  HIS C N   1 
ATOM   6084  C  CA  . HIS C 1 110 ? 5.801   38.581  64.034  1.00 31.49 ? 110  HIS C CA  1 
ATOM   6085  C  C   . HIS C 1 110 ? 4.393   38.419  63.466  1.00 34.32 ? 110  HIS C C   1 
ATOM   6086  O  O   . HIS C 1 110 ? 4.216   38.264  62.256  1.00 35.11 ? 110  HIS C O   1 
ATOM   6087  C  CB  . HIS C 1 110 ? 6.403   37.203  64.312  1.00 29.27 ? 110  HIS C CB  1 
ATOM   6088  C  CG  . HIS C 1 110 ? 7.866   37.232  64.628  1.00 27.08 ? 110  HIS C CG  1 
ATOM   6089  N  ND1 . HIS C 1 110 ? 8.362   36.947  65.882  1.00 25.96 ? 110  HIS C ND1 1 
ATOM   6090  C  CD2 . HIS C 1 110 ? 8.940   37.502  63.850  1.00 25.56 ? 110  HIS C CD2 1 
ATOM   6091  C  CE1 . HIS C 1 110 ? 9.680   37.039  65.862  1.00 25.68 ? 110  HIS C CE1 1 
ATOM   6092  N  NE2 . HIS C 1 110 ? 10.056  37.374  64.642  1.00 24.52 ? 110  HIS C NE2 1 
ATOM   6093  N  N   . THR C 1 111 ? 3.402   38.437  64.354  1.00 37.65 ? 111  THR C N   1 
ATOM   6094  C  CA  . THR C 1 111 ? 1.997   38.304  63.978  1.00 39.23 ? 111  THR C CA  1 
ATOM   6095  C  C   . THR C 1 111 ? 1.208   39.484  64.541  1.00 40.08 ? 111  THR C C   1 
ATOM   6096  O  O   . THR C 1 111 ? 1.501   39.963  65.639  1.00 40.81 ? 111  THR C O   1 
ATOM   6097  C  CB  . THR C 1 111 ? 1.390   36.986  64.516  1.00 39.41 ? 111  THR C CB  1 
ATOM   6098  O  OG1 . THR C 1 111 ? 1.605   36.896  65.930  1.00 38.46 ? 111  THR C OG1 1 
ATOM   6099  C  CG2 . THR C 1 111 ? 2.024   35.782  63.830  1.00 38.48 ? 111  THR C CG2 1 
ATOM   6100  N  N   . ARG C 1 112 ? 0.220   39.958  63.786  1.00 41.06 ? 112  ARG C N   1 
ATOM   6101  C  CA  . ARG C 1 112 ? -0.594  41.090  64.224  1.00 42.79 ? 112  ARG C CA  1 
ATOM   6102  C  C   . ARG C 1 112 ? -1.433  40.768  65.456  1.00 42.79 ? 112  ARG C C   1 
ATOM   6103  O  O   . ARG C 1 112 ? -2.132  39.753  65.503  1.00 42.84 ? 112  ARG C O   1 
ATOM   6104  C  CB  . ARG C 1 112 ? -1.486  41.606  63.089  1.00 43.94 ? 112  ARG C CB  1 
ATOM   6105  C  CG  . ARG C 1 112 ? -2.341  40.554  62.402  1.00 45.81 ? 112  ARG C CG  1 
ATOM   6106  C  CD  . ARG C 1 112 ? -3.357  41.205  61.478  1.00 48.31 ? 112  ARG C CD  1 
ATOM   6107  N  NE  . ARG C 1 112 ? -2.729  42.107  60.515  1.00 51.18 ? 112  ARG C NE  1 
ATOM   6108  C  CZ  . ARG C 1 112 ? -3.359  43.105  59.900  1.00 52.36 ? 112  ARG C CZ  1 
ATOM   6109  N  NH1 . ARG C 1 112 ? -4.643  43.334  60.145  1.00 54.07 ? 112  ARG C NH1 1 
ATOM   6110  N  NH2 . ARG C 1 112 ? -2.705  43.877  59.042  1.00 51.74 ? 112  ARG C NH2 1 
ATOM   6111  N  N   . GLN C 1 113 ? -1.348  41.643  66.453  1.00 42.75 ? 113  GLN C N   1 
ATOM   6112  C  CA  . GLN C 1 113 ? -2.077  41.472  67.704  1.00 43.08 ? 113  GLN C CA  1 
ATOM   6113  C  C   . GLN C 1 113 ? -2.157  42.777  68.486  1.00 42.28 ? 113  GLN C C   1 
ATOM   6114  O  O   . GLN C 1 113 ? -1.142  43.434  68.723  1.00 44.34 ? 113  GLN C O   1 
ATOM   6115  C  CB  . GLN C 1 113 ? -1.407  40.390  68.559  1.00 44.86 ? 113  GLN C CB  1 
ATOM   6116  C  CG  . GLN C 1 113 ? 0.075   40.628  68.830  1.00 46.08 ? 113  GLN C CG  1 
ATOM   6117  C  CD  . GLN C 1 113 ? 0.735   39.463  69.542  1.00 47.89 ? 113  GLN C CD  1 
ATOM   6118  O  OE1 . GLN C 1 113 ? 0.669   39.349  70.767  1.00 49.16 ? 113  GLN C OE1 1 
ATOM   6119  N  NE2 . GLN C 1 113 ? 1.379   38.590  68.774  1.00 48.44 ? 113  GLN C NE2 1 
ATOM   6120  N  N   . GLY C 1 114 ? -3.373  43.149  68.873  1.00 41.17 ? 114  GLY C N   1 
ATOM   6121  C  CA  . GLY C 1 114 ? -3.577  44.370  69.633  1.00 39.95 ? 114  GLY C CA  1 
ATOM   6122  C  C   . GLY C 1 114 ? -3.202  45.635  68.886  1.00 39.55 ? 114  GLY C C   1 
ATOM   6123  O  O   . GLY C 1 114 ? -3.774  45.942  67.841  1.00 38.28 ? 114  GLY C O   1 
ATOM   6124  N  N   . GLU C 1 115 ? -2.229  46.363  69.427  1.00 40.15 ? 115  GLU C N   1 
ATOM   6125  C  CA  . GLU C 1 115 ? -1.765  47.613  68.831  1.00 40.41 ? 115  GLU C CA  1 
ATOM   6126  C  C   . GLU C 1 115 ? -0.854  47.400  67.621  1.00 39.22 ? 115  GLU C C   1 
ATOM   6127  O  O   . GLU C 1 115 ? -0.625  48.323  66.837  1.00 38.59 ? 115  GLU C O   1 
ATOM   6128  C  CB  . GLU C 1 115 ? -1.039  48.457  69.884  1.00 41.72 ? 115  GLU C CB  1 
ATOM   6129  C  CG  . GLU C 1 115 ? -1.875  48.784  71.120  1.00 46.88 ? 115  GLU C CG  1 
ATOM   6130  C  CD  . GLU C 1 115 ? -3.129  49.582  70.798  1.00 49.64 ? 115  GLU C CD  1 
ATOM   6131  O  OE1 . GLU C 1 115 ? -3.003  50.746  70.360  1.00 51.90 ? 115  GLU C OE1 1 
ATOM   6132  O  OE2 . GLU C 1 115 ? -4.242  49.046  70.991  1.00 51.16 ? 115  GLU C OE2 1 
ATOM   6133  N  N   . PHE C 1 116 ? -0.344  46.180  67.474  1.00 38.85 ? 116  PHE C N   1 
ATOM   6134  C  CA  . PHE C 1 116 ? 0.547   45.832  66.370  1.00 37.88 ? 116  PHE C CA  1 
ATOM   6135  C  C   . PHE C 1 116 ? -0.242  45.426  65.128  1.00 37.17 ? 116  PHE C C   1 
ATOM   6136  O  O   . PHE C 1 116 ? -0.529  44.246  64.922  1.00 36.87 ? 116  PHE C O   1 
ATOM   6137  C  CB  . PHE C 1 116 ? 1.488   44.701  66.797  1.00 37.10 ? 116  PHE C CB  1 
ATOM   6138  C  CG  . PHE C 1 116 ? 2.233   44.986  68.070  1.00 37.64 ? 116  PHE C CG  1 
ATOM   6139  C  CD1 . PHE C 1 116 ? 3.309   45.867  68.080  1.00 36.86 ? 116  PHE C CD1 1 
ATOM   6140  C  CD2 . PHE C 1 116 ? 1.841   44.394  69.267  1.00 37.09 ? 116  PHE C CD2 1 
ATOM   6141  C  CE1 . PHE C 1 116 ? 3.983   46.157  69.263  1.00 36.33 ? 116  PHE C CE1 1 
ATOM   6142  C  CE2 . PHE C 1 116 ? 2.509   44.678  70.455  1.00 36.55 ? 116  PHE C CE2 1 
ATOM   6143  C  CZ  . PHE C 1 116 ? 3.582   45.562  70.453  1.00 36.57 ? 116  PHE C CZ  1 
ATOM   6144  N  N   . GLN C 1 117 ? -0.584  46.412  64.301  1.00 36.22 ? 117  GLN C N   1 
ATOM   6145  C  CA  . GLN C 1 117 ? -1.354  46.164  63.083  1.00 37.13 ? 117  GLN C CA  1 
ATOM   6146  C  C   . GLN C 1 117 ? -0.753  46.853  61.854  1.00 36.29 ? 117  GLN C C   1 
ATOM   6147  O  O   . GLN C 1 117 ? -1.421  46.978  60.825  1.00 37.17 ? 117  GLN C O   1 
ATOM   6148  C  CB  . GLN C 1 117 ? -2.800  46.650  63.265  1.00 37.68 ? 117  GLN C CB  1 
ATOM   6149  C  CG  . GLN C 1 117 ? -3.545  46.067  64.463  1.00 41.16 ? 117  GLN C CG  1 
ATOM   6150  C  CD  . GLN C 1 117 ? -3.792  44.573  64.348  1.00 44.43 ? 117  GLN C CD  1 
ATOM   6151  O  OE1 . GLN C 1 117 ? -4.168  44.071  63.289  1.00 46.84 ? 117  GLN C OE1 1 
ATOM   6152  N  NE2 . GLN C 1 117 ? -3.590  43.856  65.449  1.00 45.84 ? 117  GLN C NE2 1 
ATOM   6153  N  N   . TYR C 1 118 ? 0.501   47.290  61.954  1.00 34.57 ? 118  TYR C N   1 
ATOM   6154  C  CA  . TYR C 1 118 ? 1.162   47.983  60.846  1.00 32.33 ? 118  TYR C CA  1 
ATOM   6155  C  C   . TYR C 1 118 ? 2.358   47.203  60.310  1.00 29.58 ? 118  TYR C C   1 
ATOM   6156  O  O   . TYR C 1 118 ? 3.443   47.225  60.889  1.00 28.00 ? 118  TYR C O   1 
ATOM   6157  C  CB  . TYR C 1 118 ? 1.570   49.392  61.284  1.00 33.70 ? 118  TYR C CB  1 
ATOM   6158  C  CG  . TYR C 1 118 ? 0.439   50.125  61.966  1.00 35.54 ? 118  TYR C CG  1 
ATOM   6159  C  CD1 . TYR C 1 118 ? -0.689  50.523  61.250  1.00 35.33 ? 118  TYR C CD1 1 
ATOM   6160  C  CD2 . TYR C 1 118 ? 0.459   50.350  63.342  1.00 36.64 ? 118  TYR C CD2 1 
ATOM   6161  C  CE1 . TYR C 1 118 ? -1.771  51.118  61.887  1.00 36.12 ? 118  TYR C CE1 1 
ATOM   6162  C  CE2 . TYR C 1 118 ? -0.618  50.945  63.990  1.00 37.38 ? 118  TYR C CE2 1 
ATOM   6163  C  CZ  . TYR C 1 118 ? -1.730  51.323  63.257  1.00 38.17 ? 118  TYR C CZ  1 
ATOM   6164  O  OH  . TYR C 1 118 ? -2.809  51.889  63.896  1.00 40.65 ? 118  TYR C OH  1 
ATOM   6165  N  N   . PRO C 1 119 ? 2.168   46.519  59.169  1.00 29.01 ? 119  PRO C N   1 
ATOM   6166  C  CA  . PRO C 1 119 ? 3.158   45.694  58.467  1.00 28.22 ? 119  PRO C CA  1 
ATOM   6167  C  C   . PRO C 1 119 ? 4.425   46.393  57.980  1.00 27.47 ? 119  PRO C C   1 
ATOM   6168  O  O   . PRO C 1 119 ? 4.398   47.550  57.557  1.00 28.82 ? 119  PRO C O   1 
ATOM   6169  C  CB  . PRO C 1 119 ? 2.362   45.147  57.280  1.00 27.36 ? 119  PRO C CB  1 
ATOM   6170  C  CG  . PRO C 1 119 ? 0.957   45.144  57.770  1.00 27.11 ? 119  PRO C CG  1 
ATOM   6171  C  CD  . PRO C 1 119 ? 0.875   46.467  58.467  1.00 28.48 ? 119  PRO C CD  1 
ATOM   6172  N  N   . ILE C 1 120 ? 5.531   45.658  58.049  1.00 25.43 ? 120  ILE C N   1 
ATOM   6173  C  CA  . ILE C 1 120 ? 6.835   46.120  57.590  1.00 23.80 ? 120  ILE C CA  1 
ATOM   6174  C  C   . ILE C 1 120 ? 7.207   45.101  56.519  1.00 21.95 ? 120  ILE C C   1 
ATOM   6175  O  O   . ILE C 1 120 ? 7.393   43.924  56.816  1.00 20.36 ? 120  ILE C O   1 
ATOM   6176  C  CB  . ILE C 1 120 ? 7.882   46.099  58.722  1.00 23.89 ? 120  ILE C CB  1 
ATOM   6177  C  CG1 . ILE C 1 120 ? 7.441   47.023  59.861  1.00 22.85 ? 120  ILE C CG1 1 
ATOM   6178  C  CG2 . ILE C 1 120 ? 9.242   46.528  58.184  1.00 24.43 ? 120  ILE C CG2 1 
ATOM   6179  C  CD1 . ILE C 1 120 ? 8.373   47.024  61.054  1.00 23.22 ? 120  ILE C CD1 1 
ATOM   6180  N  N   . TYR C 1 121 ? 7.289   45.554  55.273  1.00 23.86 ? 121  TYR C N   1 
ATOM   6181  C  CA  . TYR C 1 121 ? 7.575   44.668  54.148  1.00 24.09 ? 121  TYR C CA  1 
ATOM   6182  C  C   . TYR C 1 121 ? 9.032   44.494  53.730  1.00 25.15 ? 121  TYR C C   1 
ATOM   6183  O  O   . TYR C 1 121 ? 9.886   45.338  54.008  1.00 24.37 ? 121  TYR C O   1 
ATOM   6184  C  CB  . TYR C 1 121 ? 6.752   45.102  52.929  1.00 21.77 ? 121  TYR C CB  1 
ATOM   6185  C  CG  . TYR C 1 121 ? 5.255   45.133  53.162  1.00 19.87 ? 121  TYR C CG  1 
ATOM   6186  C  CD1 . TYR C 1 121 ? 4.647   46.227  53.777  1.00 18.53 ? 121  TYR C CD1 1 
ATOM   6187  C  CD2 . TYR C 1 121 ? 4.446   44.073  52.756  1.00 19.38 ? 121  TYR C CD2 1 
ATOM   6188  C  CE1 . TYR C 1 121 ? 3.270   46.265  53.981  1.00 18.57 ? 121  TYR C CE1 1 
ATOM   6189  C  CE2 . TYR C 1 121 ? 3.068   44.102  52.954  1.00 19.49 ? 121  TYR C CE2 1 
ATOM   6190  C  CZ  . TYR C 1 121 ? 2.488   45.200  53.566  1.00 19.19 ? 121  TYR C CZ  1 
ATOM   6191  O  OH  . TYR C 1 121 ? 1.126   45.234  53.753  1.00 21.28 ? 121  TYR C OH  1 
ATOM   6192  N  N   . ARG C 1 122 ? 9.292   43.374  53.059  1.00 26.77 ? 122  ARG C N   1 
ATOM   6193  C  CA  . ARG C 1 122 ? 10.614  43.043  52.540  1.00 29.01 ? 122  ARG C CA  1 
ATOM   6194  C  C   . ARG C 1 122 ? 10.569  43.194  51.020  1.00 30.00 ? 122  ARG C C   1 
ATOM   6195  O  O   . ARG C 1 122 ? 9.536   43.563  50.463  1.00 30.76 ? 122  ARG C O   1 
ATOM   6196  C  CB  . ARG C 1 122 ? 11.009  41.608  52.917  1.00 28.30 ? 122  ARG C CB  1 
ATOM   6197  C  CG  . ARG C 1 122 ? 10.078  40.523  52.391  1.00 27.36 ? 122  ARG C CG  1 
ATOM   6198  C  CD  . ARG C 1 122 ? 10.548  39.142  52.819  1.00 25.87 ? 122  ARG C CD  1 
ATOM   6199  N  NE  . ARG C 1 122 ? 9.586   38.096  52.476  1.00 27.58 ? 122  ARG C NE  1 
ATOM   6200  C  CZ  . ARG C 1 122 ? 9.532   37.474  51.300  1.00 27.83 ? 122  ARG C CZ  1 
ATOM   6201  N  NH1 . ARG C 1 122 ? 10.388  37.787  50.335  1.00 27.25 ? 122  ARG C NH1 1 
ATOM   6202  N  NH2 . ARG C 1 122 ? 8.613   36.540  51.087  1.00 25.59 ? 122  ARG C NH2 1 
HETATM 6203  N  N   . MSE C 1 123 ? 11.683  42.896  50.358  1.00 32.70 ? 123  MSE C N   1 
HETATM 6204  C  CA  . MSE C 1 123 ? 11.783  43.003  48.903  1.00 35.01 ? 123  MSE C CA  1 
HETATM 6205  C  C   . MSE C 1 123 ? 10.896  42.034  48.125  1.00 34.81 ? 123  MSE C C   1 
HETATM 6206  O  O   . MSE C 1 123 ? 11.119  40.822  48.142  1.00 36.79 ? 123  MSE C O   1 
HETATM 6207  C  CB  . MSE C 1 123 ? 13.236  42.830  48.461  1.00 38.33 ? 123  MSE C CB  1 
HETATM 6208  C  CG  . MSE C 1 123 ? 14.013  44.126  48.372  1.00 40.86 ? 123  MSE C CG  1 
HETATM 6209  SE SE  . MSE C 1 123 ? 13.463  45.182  46.861  1.00 44.45 ? 123  MSE C SE  1 
HETATM 6210  C  CE  . MSE C 1 123 ? 14.827  44.620  45.618  1.00 40.44 ? 123  MSE C CE  1 
ATOM   6211  N  N   . PRO C 1 124 ? 9.863   42.564  47.445  1.00 34.02 ? 124  PRO C N   1 
ATOM   6212  C  CA  . PRO C 1 124 ? 8.923   41.776  46.644  1.00 33.31 ? 124  PRO C CA  1 
ATOM   6213  C  C   . PRO C 1 124 ? 9.454   41.639  45.213  1.00 33.21 ? 124  PRO C C   1 
ATOM   6214  O  O   . PRO C 1 124 ? 10.492  42.214  44.877  1.00 32.21 ? 124  PRO C O   1 
ATOM   6215  C  CB  . PRO C 1 124 ? 7.661   42.632  46.697  1.00 30.75 ? 124  PRO C CB  1 
ATOM   6216  C  CG  . PRO C 1 124 ? 8.214   44.003  46.603  1.00 30.46 ? 124  PRO C CG  1 
ATOM   6217  C  CD  . PRO C 1 124 ? 9.419   43.969  47.530  1.00 32.16 ? 124  PRO C CD  1 
ATOM   6218  N  N   . PRO C 1 125 ? 8.756   40.873  44.352  1.00 33.95 ? 125  PRO C N   1 
ATOM   6219  C  CA  . PRO C 1 125 ? 9.205   40.701  42.966  1.00 34.76 ? 125  PRO C CA  1 
ATOM   6220  C  C   . PRO C 1 125 ? 9.216   42.008  42.170  1.00 35.68 ? 125  PRO C C   1 
ATOM   6221  O  O   . PRO C 1 125 ? 8.868   43.069  42.691  1.00 35.16 ? 125  PRO C O   1 
ATOM   6222  C  CB  . PRO C 1 125 ? 8.193   39.700  42.404  1.00 34.20 ? 125  PRO C CB  1 
ATOM   6223  C  CG  . PRO C 1 125 ? 6.958   39.981  43.203  1.00 34.46 ? 125  PRO C CG  1 
ATOM   6224  C  CD  . PRO C 1 125 ? 7.522   40.106  44.592  1.00 33.58 ? 125  PRO C CD  1 
ATOM   6225  N  N   . LYS C 1 126 ? 9.604   41.911  40.902  1.00 37.68 ? 126  LYS C N   1 
ATOM   6226  C  CA  . LYS C 1 126 ? 9.689   43.065  40.008  1.00 38.48 ? 126  LYS C CA  1 
ATOM   6227  C  C   . LYS C 1 126 ? 8.402   43.876  39.866  1.00 37.31 ? 126  LYS C C   1 
ATOM   6228  O  O   . LYS C 1 126 ? 8.399   45.084  40.108  1.00 36.93 ? 126  LYS C O   1 
ATOM   6229  C  CB  . LYS C 1 126 ? 10.194  42.631  38.626  1.00 41.17 ? 126  LYS C CB  1 
ATOM   6230  C  CG  . LYS C 1 126 ? 11.687  42.302  38.566  1.00 45.89 ? 126  LYS C CG  1 
ATOM   6231  C  CD  . LYS C 1 126 ? 12.060  41.136  39.473  1.00 46.91 ? 126  LYS C CD  1 
ATOM   6232  C  CE  . LYS C 1 126 ? 13.567  40.967  39.572  1.00 48.18 ? 126  LYS C CE  1 
ATOM   6233  N  NZ  . LYS C 1 126 ? 13.929  39.939  40.585  1.00 48.19 ? 126  LYS C NZ  1 
ATOM   6234  N  N   . ARG C 1 127 ? 7.311   43.215  39.487  1.00 36.88 ? 127  ARG C N   1 
ATOM   6235  C  CA  . ARG C 1 127 ? 6.035   43.904  39.307  1.00 36.17 ? 127  ARG C CA  1 
ATOM   6236  C  C   . ARG C 1 127 ? 5.332   44.271  40.614  1.00 34.48 ? 127  ARG C C   1 
ATOM   6237  O  O   . ARG C 1 127 ? 4.369   45.039  40.614  1.00 34.16 ? 127  ARG C O   1 
ATOM   6238  C  CB  . ARG C 1 127 ? 5.103   43.100  38.390  1.00 39.39 ? 127  ARG C CB  1 
ATOM   6239  C  CG  . ARG C 1 127 ? 4.597   41.776  38.944  1.00 42.61 ? 127  ARG C CG  1 
ATOM   6240  C  CD  . ARG C 1 127 ? 3.776   41.048  37.884  1.00 43.72 ? 127  ARG C CD  1 
ATOM   6241  N  NE  . ARG C 1 127 ? 3.101   39.859  38.400  1.00 45.35 ? 127  ARG C NE  1 
ATOM   6242  C  CZ  . ARG C 1 127 ? 1.834   39.834  38.808  1.00 45.64 ? 127  ARG C CZ  1 
ATOM   6243  N  NH1 . ARG C 1 127 ? 1.098   40.937  38.764  1.00 45.43 ? 127  ARG C NH1 1 
ATOM   6244  N  NH2 . ARG C 1 127 ? 1.298   38.704  39.249  1.00 44.29 ? 127  ARG C NH2 1 
ATOM   6245  N  N   . GLY C 1 128 ? 5.824   43.728  41.724  1.00 33.19 ? 128  GLY C N   1 
ATOM   6246  C  CA  . GLY C 1 128 ? 5.241   44.028  43.019  1.00 29.98 ? 128  GLY C CA  1 
ATOM   6247  C  C   . GLY C 1 128 ? 5.776   45.336  43.573  1.00 29.04 ? 128  GLY C C   1 
ATOM   6248  O  O   . GLY C 1 128 ? 5.163   45.951  44.445  1.00 29.17 ? 128  GLY C O   1 
ATOM   6249  N  N   . ARG C 1 129 ? 6.924   45.759  43.052  1.00 28.57 ? 129  ARG C N   1 
ATOM   6250  C  CA  . ARG C 1 129 ? 7.573   46.996  43.476  1.00 26.77 ? 129  ARG C CA  1 
ATOM   6251  C  C   . ARG C 1 129 ? 7.002   48.240  42.800  1.00 26.64 ? 129  ARG C C   1 
ATOM   6252  O  O   . ARG C 1 129 ? 7.448   49.355  43.064  1.00 27.97 ? 129  ARG C O   1 
ATOM   6253  C  CB  . ARG C 1 129 ? 9.081   46.907  43.223  1.00 25.22 ? 129  ARG C CB  1 
ATOM   6254  C  CG  . ARG C 1 129 ? 9.827   46.065  44.244  1.00 23.85 ? 129  ARG C CG  1 
ATOM   6255  C  CD  . ARG C 1 129 ? 11.290  45.892  43.876  1.00 25.75 ? 129  ARG C CD  1 
ATOM   6256  N  NE  . ARG C 1 129 ? 11.528  44.680  43.096  1.00 26.02 ? 129  ARG C NE  1 
ATOM   6257  C  CZ  . ARG C 1 129 ? 12.631  44.443  42.392  1.00 26.71 ? 129  ARG C CZ  1 
ATOM   6258  N  NH1 . ARG C 1 129 ? 13.610  45.336  42.353  1.00 28.84 ? 129  ARG C NH1 1 
ATOM   6259  N  NH2 . ARG C 1 129 ? 12.772  43.291  41.752  1.00 27.15 ? 129  ARG C NH2 1 
ATOM   6260  N  N   . LEU C 1 130 ? 6.011   48.044  41.934  1.00 27.26 ? 130  LEU C N   1 
ATOM   6261  C  CA  . LEU C 1 130 ? 5.377   49.146  41.215  1.00 26.51 ? 130  LEU C CA  1 
ATOM   6262  C  C   . LEU C 1 130 ? 4.359   49.900  42.067  1.00 25.97 ? 130  LEU C C   1 
ATOM   6263  O  O   . LEU C 1 130 ? 4.168   51.103  41.892  1.00 26.72 ? 130  LEU C O   1 
ATOM   6264  C  CB  . LEU C 1 130 ? 4.696   48.624  39.948  1.00 26.14 ? 130  LEU C CB  1 
ATOM   6265  C  CG  . LEU C 1 130 ? 5.613   48.055  38.865  1.00 26.78 ? 130  LEU C CG  1 
ATOM   6266  C  CD1 . LEU C 1 130 ? 4.785   47.378  37.791  1.00 27.16 ? 130  LEU C CD1 1 
ATOM   6267  C  CD2 . LEU C 1 130 ? 6.467   49.163  38.270  1.00 25.26 ? 130  LEU C CD2 1 
ATOM   6268  N  N   . SER C 1 131 ? 3.723   49.185  42.991  1.00 26.06 ? 131  SER C N   1 
ATOM   6269  C  CA  . SER C 1 131 ? 2.706   49.754  43.875  1.00 28.14 ? 131  SER C CA  1 
ATOM   6270  C  C   . SER C 1 131 ? 3.194   50.907  44.753  1.00 28.50 ? 131  SER C C   1 
ATOM   6271  O  O   . SER C 1 131 ? 4.319   50.885  45.256  1.00 31.34 ? 131  SER C O   1 
ATOM   6272  C  CB  . SER C 1 131 ? 2.114   48.653  44.754  1.00 28.92 ? 131  SER C CB  1 
ATOM   6273  O  OG  . SER C 1 131 ? 1.539   47.630  43.962  1.00 35.02 ? 131  SER C OG  1 
ATOM   6274  N  N   . SER C 1 132 ? 2.335   51.908  44.933  1.00 27.37 ? 132  SER C N   1 
ATOM   6275  C  CA  . SER C 1 132 ? 2.658   53.073  45.756  1.00 26.17 ? 132  SER C CA  1 
ATOM   6276  C  C   . SER C 1 132 ? 2.356   52.801  47.225  1.00 25.18 ? 132  SER C C   1 
ATOM   6277  O  O   . SER C 1 132 ? 1.752   51.784  47.564  1.00 27.57 ? 132  SER C O   1 
ATOM   6278  C  CB  . SER C 1 132 ? 1.869   54.301  45.288  1.00 25.32 ? 132  SER C CB  1 
ATOM   6279  O  OG  . SER C 1 132 ? 0.479   54.145  45.517  1.00 27.14 ? 132  SER C OG  1 
ATOM   6280  N  N   . ARG C 1 133 ? 2.766   53.724  48.090  1.00 23.76 ? 133  ARG C N   1 
ATOM   6281  C  CA  . ARG C 1 133 ? 2.545   53.595  49.527  1.00 22.71 ? 133  ARG C CA  1 
ATOM   6282  C  C   . ARG C 1 133 ? 1.064   53.447  49.880  1.00 21.85 ? 133  ARG C C   1 
ATOM   6283  O  O   . ARG C 1 133 ? 0.693   52.569  50.659  1.00 22.95 ? 133  ARG C O   1 
ATOM   6284  C  CB  . ARG C 1 133 ? 3.142   54.799  50.260  1.00 21.44 ? 133  ARG C CB  1 
ATOM   6285  C  CG  . ARG C 1 133 ? 2.897   54.798  51.758  1.00 23.61 ? 133  ARG C CG  1 
ATOM   6286  C  CD  . ARG C 1 133 ? 3.523   56.008  52.429  1.00 24.24 ? 133  ARG C CD  1 
ATOM   6287  N  NE  . ARG C 1 133 ? 4.981   55.976  52.362  1.00 25.01 ? 133  ARG C NE  1 
ATOM   6288  C  CZ  . ARG C 1 133 ? 5.762   55.353  53.240  1.00 24.03 ? 133  ARG C CZ  1 
ATOM   6289  N  NH1 . ARG C 1 133 ? 5.234   54.703  54.269  1.00 23.78 ? 133  ARG C NH1 1 
ATOM   6290  N  NH2 . ARG C 1 133 ? 7.076   55.380  53.087  1.00 25.65 ? 133  ARG C NH2 1 
ATOM   6291  N  N   . ALA C 1 134 ? 0.227   54.298  49.292  1.00 22.19 ? 134  ALA C N   1 
ATOM   6292  C  CA  . ALA C 1 134 ? -1.215  54.279  49.535  1.00 21.22 ? 134  ALA C CA  1 
ATOM   6293  C  C   . ALA C 1 134 ? -1.840  52.935  49.179  1.00 22.32 ? 134  ALA C C   1 
ATOM   6294  O  O   . ALA C 1 134 ? -2.725  52.447  49.883  1.00 23.65 ? 134  ALA C O   1 
ATOM   6295  C  CB  . ALA C 1 134 ? -1.890  55.391  48.748  1.00 22.77 ? 134  ALA C CB  1 
ATOM   6296  N  N   . GLU C 1 135 ? -1.374  52.348  48.080  1.00 22.23 ? 135  GLU C N   1 
ATOM   6297  C  CA  . GLU C 1 135 ? -1.872  51.061  47.613  1.00 21.82 ? 135  GLU C CA  1 
ATOM   6298  C  C   . GLU C 1 135 ? -1.403  49.930  48.517  1.00 21.58 ? 135  GLU C C   1 
ATOM   6299  O  O   . GLU C 1 135 ? -2.143  48.981  48.769  1.00 22.63 ? 135  GLU C O   1 
ATOM   6300  C  CB  . GLU C 1 135 ? -1.403  50.809  46.183  1.00 23.05 ? 135  GLU C CB  1 
ATOM   6301  C  CG  . GLU C 1 135 ? -1.889  51.849  45.185  1.00 26.12 ? 135  GLU C CG  1 
ATOM   6302  C  CD  . GLU C 1 135 ? -1.258  51.693  43.814  1.00 28.75 ? 135  GLU C CD  1 
ATOM   6303  O  OE1 . GLU C 1 135 ? -0.706  50.611  43.523  1.00 30.60 ? 135  GLU C OE1 1 
ATOM   6304  O  OE2 . GLU C 1 135 ? -1.314  52.656  43.023  1.00 30.43 ? 135  GLU C OE2 1 
ATOM   6305  N  N   . ILE C 1 136 ? -0.165  50.034  48.993  1.00 22.42 ? 136  ILE C N   1 
ATOM   6306  C  CA  . ILE C 1 136 ? 0.412   49.030  49.881  1.00 22.19 ? 136  ILE C CA  1 
ATOM   6307  C  C   . ILE C 1 136 ? -0.325  49.037  51.219  1.00 23.96 ? 136  ILE C C   1 
ATOM   6308  O  O   . ILE C 1 136 ? -0.498  47.989  51.845  1.00 27.57 ? 136  ILE C O   1 
ATOM   6309  C  CB  . ILE C 1 136 ? 1.928   49.271  50.083  1.00 19.65 ? 136  ILE C CB  1 
ATOM   6310  C  CG1 . ILE C 1 136 ? 2.651   49.124  48.741  1.00 15.49 ? 136  ILE C CG1 1 
ATOM   6311  C  CG2 . ILE C 1 136 ? 2.500   48.285  51.093  1.00 18.40 ? 136  ILE C CG2 1 
ATOM   6312  C  CD1 . ILE C 1 136 ? 4.118   49.455  48.783  1.00 13.42 ? 136  ILE C CD1 1 
ATOM   6313  N  N   . TYR C 1 137 ? -0.773  50.219  51.640  1.00 25.05 ? 137  TYR C N   1 
ATOM   6314  C  CA  . TYR C 1 137 ? -1.525  50.366  52.885  1.00 25.75 ? 137  TYR C CA  1 
ATOM   6315  C  C   . TYR C 1 137 ? -2.869  49.658  52.729  1.00 27.50 ? 137  TYR C C   1 
ATOM   6316  O  O   . TYR C 1 137 ? -3.388  49.069  53.678  1.00 28.24 ? 137  TYR C O   1 
ATOM   6317  C  CB  . TYR C 1 137 ? -1.774  51.846  53.197  1.00 24.34 ? 137  TYR C CB  1 
ATOM   6318  C  CG  . TYR C 1 137 ? -0.605  52.597  53.808  1.00 23.52 ? 137  TYR C CG  1 
ATOM   6319  C  CD1 . TYR C 1 137 ? 0.584   51.947  54.136  1.00 21.72 ? 137  TYR C CD1 1 
ATOM   6320  C  CD2 . TYR C 1 137 ? -0.701  53.964  54.073  1.00 22.63 ? 137  TYR C CD2 1 
ATOM   6321  C  CE1 . TYR C 1 137 ? 1.648   52.640  54.716  1.00 22.10 ? 137  TYR C CE1 1 
ATOM   6322  C  CE2 . TYR C 1 137 ? 0.354   54.666  54.651  1.00 22.30 ? 137  TYR C CE2 1 
ATOM   6323  C  CZ  . TYR C 1 137 ? 1.525   53.999  54.970  1.00 23.32 ? 137  TYR C CZ  1 
ATOM   6324  O  OH  . TYR C 1 137 ? 2.569   54.691  55.542  1.00 22.04 ? 137  TYR C OH  1 
ATOM   6325  N  N   . ALA C 1 138 ? -3.419  49.723  51.518  1.00 30.32 ? 138  ALA C N   1 
ATOM   6326  C  CA  . ALA C 1 138 ? -4.701  49.102  51.198  1.00 31.90 ? 138  ALA C CA  1 
ATOM   6327  C  C   . ALA C 1 138 ? -4.588  47.598  50.938  1.00 32.65 ? 138  ALA C C   1 
ATOM   6328  O  O   . ALA C 1 138 ? -5.602  46.910  50.811  1.00 34.25 ? 138  ALA C O   1 
ATOM   6329  C  CB  . ALA C 1 138 ? -5.337  49.800  50.004  1.00 31.15 ? 138  ALA C CB  1 
ATOM   6330  N  N   . GLY C 1 139 ? -3.357  47.100  50.837  1.00 33.12 ? 139  GLY C N   1 
ATOM   6331  C  CA  . GLY C 1 139 ? -3.143  45.680  50.612  1.00 32.19 ? 139  GLY C CA  1 
ATOM   6332  C  C   . GLY C 1 139 ? -2.751  45.265  49.205  1.00 31.96 ? 139  GLY C C   1 
ATOM   6333  O  O   . GLY C 1 139 ? -3.239  44.251  48.701  1.00 32.55 ? 139  GLY C O   1 
ATOM   6334  N  N   . ALA C 1 140 ? -1.856  46.025  48.580  1.00 31.56 ? 140  ALA C N   1 
ATOM   6335  C  CA  . ALA C 1 140 ? -1.396  45.722  47.226  1.00 30.60 ? 140  ALA C CA  1 
ATOM   6336  C  C   . ALA C 1 140 ? -0.424  44.545  47.217  1.00 30.79 ? 140  ALA C C   1 
ATOM   6337  O  O   . ALA C 1 140 ? -0.378  43.774  46.258  1.00 30.45 ? 140  ALA C O   1 
ATOM   6338  C  CB  . ALA C 1 140 ? -0.741  46.945  46.609  1.00 30.96 ? 140  ALA C CB  1 
ATOM   6339  N  N   . LEU C 1 141 ? 0.354   44.422  48.289  1.00 31.51 ? 141  LEU C N   1 
ATOM   6340  C  CA  . LEU C 1 141 ? 1.331   43.347  48.426  1.00 30.34 ? 141  LEU C CA  1 
ATOM   6341  C  C   . LEU C 1 141 ? 0.786   42.173  49.233  1.00 29.14 ? 141  LEU C C   1 
ATOM   6342  O  O   . LEU C 1 141 ? -0.029  42.355  50.140  1.00 28.47 ? 141  LEU C O   1 
ATOM   6343  C  CB  . LEU C 1 141 ? 2.605   43.872  49.093  1.00 30.09 ? 141  LEU C CB  1 
ATOM   6344  C  CG  . LEU C 1 141 ? 3.414   44.919  48.329  1.00 29.04 ? 141  LEU C CG  1 
ATOM   6345  C  CD1 . LEU C 1 141 ? 4.581   45.383  49.181  1.00 27.47 ? 141  LEU C CD1 1 
ATOM   6346  C  CD2 . LEU C 1 141 ? 3.906   44.333  47.017  1.00 29.56 ? 141  LEU C CD2 1 
ATOM   6347  N  N   . SER C 1 142 ? 1.255   40.972  48.903  1.00 29.35 ? 142  SER C N   1 
ATOM   6348  C  CA  . SER C 1 142 ? 0.835   39.757  49.595  1.00 29.19 ? 142  SER C CA  1 
ATOM   6349  C  C   . SER C 1 142 ? 1.387   39.744  51.018  1.00 29.95 ? 142  SER C C   1 
ATOM   6350  O  O   . SER C 1 142 ? 2.430   40.337  51.295  1.00 31.25 ? 142  SER C O   1 
ATOM   6351  C  CB  . SER C 1 142 ? 1.316   38.518  48.835  1.00 26.73 ? 142  SER C CB  1 
ATOM   6352  O  OG  . SER C 1 142 ? 0.871   37.328  49.461  1.00 25.64 ? 142  SER C OG  1 
ATOM   6353  N  N   . ASP C 1 143 ? 0.682   39.060  51.914  1.00 30.45 ? 143  ASP C N   1 
ATOM   6354  C  CA  . ASP C 1 143 ? 1.082   38.972  53.315  1.00 29.75 ? 143  ASP C CA  1 
ATOM   6355  C  C   . ASP C 1 143 ? 2.365   38.181  53.559  1.00 30.11 ? 143  ASP C C   1 
ATOM   6356  O  O   . ASP C 1 143 ? 2.953   38.273  54.637  1.00 32.07 ? 143  ASP C O   1 
ATOM   6357  C  CB  . ASP C 1 143 ? -0.057  38.387  54.157  1.00 31.48 ? 143  ASP C CB  1 
ATOM   6358  C  CG  . ASP C 1 143 ? -1.221  39.351  54.321  1.00 31.28 ? 143  ASP C CG  1 
ATOM   6359  O  OD1 . ASP C 1 143 ? -1.562  40.061  53.352  1.00 34.55 ? 143  ASP C OD1 1 
ATOM   6360  O  OD2 . ASP C 1 143 ? -1.800  39.396  55.427  1.00 31.91 ? 143  ASP C OD2 1 
ATOM   6361  N  N   . LYS C 1 144 ? 2.801   37.411  52.564  1.00 28.85 ? 144  LYS C N   1 
ATOM   6362  C  CA  . LYS C 1 144 ? 4.019   36.617  52.704  1.00 28.00 ? 144  LYS C CA  1 
ATOM   6363  C  C   . LYS C 1 144 ? 5.284   37.469  52.604  1.00 27.42 ? 144  LYS C C   1 
ATOM   6364  O  O   . LYS C 1 144 ? 6.390   36.978  52.830  1.00 28.06 ? 144  LYS C O   1 
ATOM   6365  C  CB  . LYS C 1 144 ? 4.053   35.476  51.682  1.00 28.28 ? 144  LYS C CB  1 
ATOM   6366  C  CG  . LYS C 1 144 ? 4.125   35.907  50.228  1.00 28.97 ? 144  LYS C CG  1 
ATOM   6367  C  CD  . LYS C 1 144 ? 4.216   34.693  49.317  1.00 31.02 ? 144  LYS C CD  1 
ATOM   6368  C  CE  . LYS C 1 144 ? 4.316   35.095  47.856  1.00 31.14 ? 144  LYS C CE  1 
ATOM   6369  N  NZ  . LYS C 1 144 ? 4.443   33.910  46.964  1.00 31.38 ? 144  LYS C NZ  1 
ATOM   6370  N  N   . TYR C 1 145 ? 5.110   38.744  52.266  1.00 26.68 ? 145  TYR C N   1 
ATOM   6371  C  CA  . TYR C 1 145 ? 6.229   39.673  52.149  1.00 26.29 ? 145  TYR C CA  1 
ATOM   6372  C  C   . TYR C 1 145 ? 6.362   40.543  53.397  1.00 25.62 ? 145  TYR C C   1 
ATOM   6373  O  O   . TYR C 1 145 ? 7.216   41.427  53.464  1.00 24.90 ? 145  TYR C O   1 
ATOM   6374  C  CB  . TYR C 1 145 ? 6.076   40.541  50.897  1.00 27.91 ? 145  TYR C CB  1 
ATOM   6375  C  CG  . TYR C 1 145 ? 6.160   39.747  49.614  1.00 29.48 ? 145  TYR C CG  1 
ATOM   6376  C  CD1 . TYR C 1 145 ? 7.374   39.211  49.184  1.00 28.93 ? 145  TYR C CD1 1 
ATOM   6377  C  CD2 . TYR C 1 145 ? 5.023   39.497  48.847  1.00 32.15 ? 145  TYR C CD2 1 
ATOM   6378  C  CE1 . TYR C 1 145 ? 7.454   38.443  48.028  1.00 29.18 ? 145  TYR C CE1 1 
ATOM   6379  C  CE2 . TYR C 1 145 ? 5.091   38.729  47.686  1.00 31.24 ? 145  TYR C CE2 1 
ATOM   6380  C  CZ  . TYR C 1 145 ? 6.310   38.205  47.285  1.00 30.41 ? 145  TYR C CZ  1 
ATOM   6381  O  OH  . TYR C 1 145 ? 6.383   37.433  46.150  1.00 33.29 ? 145  TYR C OH  1 
ATOM   6382  N  N   . ILE C 1 146 ? 5.516   40.276  54.389  1.00 25.52 ? 146  ILE C N   1 
ATOM   6383  C  CA  . ILE C 1 146 ? 5.535   41.019  55.643  1.00 24.52 ? 146  ILE C CA  1 
ATOM   6384  C  C   . ILE C 1 146 ? 6.563   40.407  56.591  1.00 24.96 ? 146  ILE C C   1 
ATOM   6385  O  O   . ILE C 1 146 ? 6.638   39.186  56.737  1.00 26.48 ? 146  ILE C O   1 
ATOM   6386  C  CB  . ILE C 1 146 ? 4.148   41.016  56.320  1.00 23.29 ? 146  ILE C CB  1 
ATOM   6387  C  CG1 . ILE C 1 146 ? 3.101   41.605  55.370  1.00 22.72 ? 146  ILE C CG1 1 
ATOM   6388  C  CG2 . ILE C 1 146 ? 4.193   41.816  57.617  1.00 23.59 ? 146  ILE C CG2 1 
ATOM   6389  C  CD1 . ILE C 1 146 ? 1.689   41.609  55.917  1.00 21.11 ? 146  ILE C CD1 1 
ATOM   6390  N  N   . LEU C 1 147 ? 7.364   41.267  57.214  1.00 24.14 ? 147  LEU C N   1 
ATOM   6391  C  CA  . LEU C 1 147 ? 8.397   40.840  58.151  1.00 21.78 ? 147  LEU C CA  1 
ATOM   6392  C  C   . LEU C 1 147 ? 7.935   40.972  59.599  1.00 23.63 ? 147  LEU C C   1 
ATOM   6393  O  O   . LEU C 1 147 ? 8.275   40.141  60.444  1.00 25.80 ? 147  LEU C O   1 
ATOM   6394  C  CB  . LEU C 1 147 ? 9.671   41.661  57.938  1.00 17.71 ? 147  LEU C CB  1 
ATOM   6395  C  CG  . LEU C 1 147 ? 10.362  41.516  56.582  1.00 12.26 ? 147  LEU C CG  1 
ATOM   6396  C  CD1 . LEU C 1 147 ? 11.423  42.586  56.426  1.00 14.00 ? 147  LEU C CD1 1 
ATOM   6397  C  CD2 . LEU C 1 147 ? 10.966  40.128  56.451  1.00 11.99 ? 147  LEU C CD2 1 
ATOM   6398  N  N   . ALA C 1 148 ? 7.156   42.017  59.875  1.00 24.92 ? 148  ALA C N   1 
ATOM   6399  C  CA  . ALA C 1 148 ? 6.645   42.273  61.219  1.00 26.14 ? 148  ALA C CA  1 
ATOM   6400  C  C   . ALA C 1 148 ? 5.529   43.318  61.224  1.00 26.99 ? 148  ALA C C   1 
ATOM   6401  O  O   . ALA C 1 148 ? 5.305   44.008  60.230  1.00 27.45 ? 148  ALA C O   1 
ATOM   6402  C  CB  . ALA C 1 148 ? 7.782   42.722  62.133  1.00 26.74 ? 148  ALA C CB  1 
ATOM   6403  N  N   . TYR C 1 149 ? 4.830   43.416  62.353  1.00 28.32 ? 149  TYR C N   1 
ATOM   6404  C  CA  . TYR C 1 149 ? 3.739   44.371  62.529  1.00 27.72 ? 149  TYR C CA  1 
ATOM   6405  C  C   . TYR C 1 149 ? 4.068   45.291  63.702  1.00 30.20 ? 149  TYR C C   1 
ATOM   6406  O  O   . TYR C 1 149 ? 4.158   44.838  64.844  1.00 30.23 ? 149  TYR C O   1 
ATOM   6407  C  CB  . TYR C 1 149 ? 2.424   43.644  62.828  1.00 26.19 ? 149  TYR C CB  1 
ATOM   6408  C  CG  . TYR C 1 149 ? 1.935   42.721  61.737  1.00 24.39 ? 149  TYR C CG  1 
ATOM   6409  C  CD1 . TYR C 1 149 ? 2.360   41.394  61.676  1.00 25.13 ? 149  TYR C CD1 1 
ATOM   6410  C  CD2 . TYR C 1 149 ? 1.022   43.163  60.782  1.00 24.96 ? 149  TYR C CD2 1 
ATOM   6411  C  CE1 . TYR C 1 149 ? 1.885   40.528  60.691  1.00 24.55 ? 149  TYR C CE1 1 
ATOM   6412  C  CE2 . TYR C 1 149 ? 0.540   42.305  59.793  1.00 24.67 ? 149  TYR C CE2 1 
ATOM   6413  C  CZ  . TYR C 1 149 ? 0.976   40.991  59.754  1.00 23.81 ? 149  TYR C CZ  1 
ATOM   6414  O  OH  . TYR C 1 149 ? 0.502   40.143  58.779  1.00 23.69 ? 149  TYR C OH  1 
ATOM   6415  N  N   . SER C 1 150 ? 4.240   46.580  63.420  1.00 32.02 ? 150  SER C N   1 
ATOM   6416  C  CA  . SER C 1 150 ? 4.561   47.558  64.457  1.00 32.77 ? 150  SER C CA  1 
ATOM   6417  C  C   . SER C 1 150 ? 3.318   48.150  65.115  1.00 33.64 ? 150  SER C C   1 
ATOM   6418  O  O   . SER C 1 150 ? 2.194   47.931  64.661  1.00 33.82 ? 150  SER C O   1 
ATOM   6419  C  CB  . SER C 1 150 ? 5.415   48.685  63.878  1.00 33.12 ? 150  SER C CB  1 
ATOM   6420  O  OG  . SER C 1 150 ? 4.664   49.474  62.975  1.00 34.41 ? 150  SER C OG  1 
ATOM   6421  N  N   . ASN C 1 151 ? 3.540   48.914  66.181  1.00 34.82 ? 151  ASN C N   1 
ATOM   6422  C  CA  . ASN C 1 151 ? 2.460   49.555  66.924  1.00 35.39 ? 151  ASN C CA  1 
ATOM   6423  C  C   . ASN C 1 151 ? 2.247   51.014  66.524  1.00 35.42 ? 151  ASN C C   1 
ATOM   6424  O  O   . ASN C 1 151 ? 1.463   51.728  67.152  1.00 35.63 ? 151  ASN C O   1 
ATOM   6425  C  CB  . ASN C 1 151 ? 2.724   49.458  68.434  1.00 35.13 ? 151  ASN C CB  1 
ATOM   6426  C  CG  . ASN C 1 151 ? 4.097   49.987  68.833  1.00 34.78 ? 151  ASN C CG  1 
ATOM   6427  O  OD1 . ASN C 1 151 ? 4.787   50.640  68.047  1.00 34.63 ? 151  ASN C OD1 1 
ATOM   6428  N  ND2 . ASN C 1 151 ? 4.497   49.704  70.068  1.00 33.79 ? 151  ASN C ND2 1 
ATOM   6429  N  N   . SER C 1 152 ? 2.933   51.448  65.470  1.00 35.65 ? 152  SER C N   1 
ATOM   6430  C  CA  . SER C 1 152 ? 2.817   52.824  65.003  1.00 36.26 ? 152  SER C CA  1 
ATOM   6431  C  C   . SER C 1 152 ? 3.129   52.970  63.520  1.00 35.80 ? 152  SER C C   1 
ATOM   6432  O  O   . SER C 1 152 ? 4.203   52.582  63.059  1.00 37.18 ? 152  SER C O   1 
ATOM   6433  C  CB  . SER C 1 152 ? 3.741   53.735  65.816  1.00 36.05 ? 152  SER C CB  1 
ATOM   6434  O  OG  . SER C 1 152 ? 3.691   55.072  65.348  1.00 36.78 ? 152  SER C OG  1 
ATOM   6435  N  N   . LEU C 1 153 ? 2.179   53.539  62.782  1.00 36.21 ? 153  LEU C N   1 
ATOM   6436  C  CA  . LEU C 1 153 ? 2.335   53.766  61.350  1.00 36.05 ? 153  LEU C CA  1 
ATOM   6437  C  C   . LEU C 1 153 ? 3.337   54.899  61.132  1.00 36.31 ? 153  LEU C C   1 
ATOM   6438  O  O   . LEU C 1 153 ? 3.992   54.974  60.090  1.00 36.21 ? 153  LEU C O   1 
ATOM   6439  C  CB  . LEU C 1 153 ? 0.986   54.135  60.723  1.00 35.74 ? 153  LEU C CB  1 
ATOM   6440  C  CG  . LEU C 1 153 ? 0.928   54.208  59.194  1.00 35.72 ? 153  LEU C CG  1 
ATOM   6441  C  CD1 . LEU C 1 153 ? 1.124   52.821  58.604  1.00 35.55 ? 153  LEU C CD1 1 
ATOM   6442  C  CD2 . LEU C 1 153 ? -0.400  54.789  58.748  1.00 34.07 ? 153  LEU C CD2 1 
HETATM 6443  N  N   . MSE C 1 154 ? 3.446   55.775  62.129  1.00 36.97 ? 154  MSE C N   1 
HETATM 6444  C  CA  . MSE C 1 154 ? 4.361   56.910  62.083  1.00 37.58 ? 154  MSE C CA  1 
HETATM 6445  C  C   . MSE C 1 154 ? 5.807   56.440  62.225  1.00 37.05 ? 154  MSE C C   1 
HETATM 6446  O  O   . MSE C 1 154 ? 6.695   56.927  61.524  1.00 38.19 ? 154  MSE C O   1 
HETATM 6447  C  CB  . MSE C 1 154 ? 4.016   57.914  63.188  1.00 38.57 ? 154  MSE C CB  1 
HETATM 6448  C  CG  . MSE C 1 154 ? 4.844   59.188  63.158  1.00 41.17 ? 154  MSE C CG  1 
HETATM 6449  SE SE  . MSE C 1 154 ? 4.738   60.099  61.459  1.00 46.65 ? 154  MSE C SE  1 
HETATM 6450  C  CE  . MSE C 1 154 ? 3.064   61.023  61.722  1.00 44.36 ? 154  MSE C CE  1 
ATOM   6451  N  N   . ASP C 1 155 ? 6.034   55.491  63.131  1.00 36.03 ? 155  ASP C N   1 
ATOM   6452  C  CA  . ASP C 1 155 ? 7.369   54.942  63.353  1.00 33.95 ? 155  ASP C CA  1 
ATOM   6453  C  C   . ASP C 1 155 ? 7.865   54.257  62.088  1.00 32.04 ? 155  ASP C C   1 
ATOM   6454  O  O   . ASP C 1 155 ? 9.038   54.362  61.737  1.00 32.30 ? 155  ASP C O   1 
ATOM   6455  C  CB  . ASP C 1 155 ? 7.362   53.943  64.515  1.00 35.72 ? 155  ASP C CB  1 
ATOM   6456  C  CG  . ASP C 1 155 ? 7.200   54.612  65.873  1.00 37.31 ? 155  ASP C CG  1 
ATOM   6457  O  OD1 . ASP C 1 155 ? 7.199   55.859  65.944  1.00 38.58 ? 155  ASP C OD1 1 
ATOM   6458  O  OD2 . ASP C 1 155 ? 7.076   53.881  66.878  1.00 39.02 ? 155  ASP C OD2 1 
ATOM   6459  N  N   . ASN C 1 156 ? 6.961   53.553  61.411  1.00 31.10 ? 156  ASN C N   1 
ATOM   6460  C  CA  . ASN C 1 156 ? 7.293   52.859  60.172  1.00 30.21 ? 156  ASN C CA  1 
ATOM   6461  C  C   . ASN C 1 156 ? 7.677   53.868  59.103  1.00 29.60 ? 156  ASN C C   1 
ATOM   6462  O  O   . ASN C 1 156 ? 8.625   53.653  58.350  1.00 31.84 ? 156  ASN C O   1 
ATOM   6463  C  CB  . ASN C 1 156 ? 6.104   52.029  59.682  1.00 29.84 ? 156  ASN C CB  1 
ATOM   6464  C  CG  . ASN C 1 156 ? 5.850   50.813  60.541  1.00 28.29 ? 156  ASN C CG  1 
ATOM   6465  O  OD1 . ASN C 1 156 ? 6.574   50.555  61.501  1.00 29.58 ? 156  ASN C OD1 1 
ATOM   6466  N  ND2 . ASN C 1 156 ? 4.820   50.049  60.195  1.00 29.32 ? 156  ASN C ND2 1 
ATOM   6467  N  N   . PHE C 1 157 ? 6.942   54.975  59.061  1.00 28.66 ? 157  PHE C N   1 
ATOM   6468  C  CA  . PHE C 1 157 ? 7.189   56.033  58.092  1.00 29.34 ? 157  PHE C CA  1 
ATOM   6469  C  C   . PHE C 1 157 ? 8.542   56.693  58.332  1.00 29.93 ? 157  PHE C C   1 
ATOM   6470  O  O   . PHE C 1 157 ? 9.290   56.941  57.388  1.00 31.24 ? 157  PHE C O   1 
ATOM   6471  C  CB  . PHE C 1 157 ? 6.077   57.084  58.153  1.00 29.07 ? 157  PHE C CB  1 
ATOM   6472  C  CG  . PHE C 1 157 ? 6.129   58.080  57.033  1.00 28.78 ? 157  PHE C CG  1 
ATOM   6473  C  CD1 . PHE C 1 157 ? 5.510   57.806  55.818  1.00 29.23 ? 157  PHE C CD1 1 
ATOM   6474  C  CD2 . PHE C 1 157 ? 6.813   59.281  57.181  1.00 27.86 ? 157  PHE C CD2 1 
ATOM   6475  C  CE1 . PHE C 1 157 ? 5.574   58.711  54.765  1.00 28.49 ? 157  PHE C CE1 1 
ATOM   6476  C  CE2 . PHE C 1 157 ? 6.884   60.193  56.134  1.00 28.39 ? 157  PHE C CE2 1 
ATOM   6477  C  CZ  . PHE C 1 157 ? 6.263   59.906  54.923  1.00 29.04 ? 157  PHE C CZ  1 
ATOM   6478  N  N   . ILE C 1 158 ? 8.847   56.981  59.594  1.00 30.08 ? 158  ILE C N   1 
ATOM   6479  C  CA  . ILE C 1 158 ? 10.115  57.610  59.949  1.00 31.86 ? 158  ILE C CA  1 
ATOM   6480  C  C   . ILE C 1 158 ? 11.278  56.675  59.634  1.00 31.11 ? 158  ILE C C   1 
ATOM   6481  O  O   . ILE C 1 158 ? 12.288  57.105  59.080  1.00 31.42 ? 158  ILE C O   1 
ATOM   6482  C  CB  . ILE C 1 158 ? 10.142  58.033  61.437  1.00 33.81 ? 158  ILE C CB  1 
ATOM   6483  C  CG1 . ILE C 1 158 ? 9.074   59.103  61.681  1.00 35.35 ? 158  ILE C CG1 1 
ATOM   6484  C  CG2 . ILE C 1 158 ? 11.521  58.570  61.817  1.00 32.11 ? 158  ILE C CG2 1 
ATOM   6485  C  CD1 . ILE C 1 158 ? 9.010   59.612  63.099  1.00 37.79 ? 158  ILE C CD1 1 
HETATM 6486  N  N   . MSE C 1 159 ? 11.115  55.395  59.961  1.00 30.52 ? 159  MSE C N   1 
HETATM 6487  C  CA  . MSE C 1 159 ? 12.139  54.389  59.693  1.00 30.16 ? 159  MSE C CA  1 
HETATM 6488  C  C   . MSE C 1 159 ? 12.342  54.284  58.187  1.00 28.60 ? 159  MSE C C   1 
HETATM 6489  O  O   . MSE C 1 159 ? 13.450  54.047  57.709  1.00 27.77 ? 159  MSE C O   1 
HETATM 6490  C  CB  . MSE C 1 159 ? 11.707  53.031  60.251  1.00 32.81 ? 159  MSE C CB  1 
HETATM 6491  C  CG  . MSE C 1 159 ? 12.619  51.875  59.866  1.00 34.29 ? 159  MSE C CG  1 
HETATM 6492  SE SE  . MSE C 1 159 ? 11.993  50.169  60.503  1.00 38.60 ? 159  MSE C SE  1 
HETATM 6493  C  CE  . MSE C 1 159 ? 10.342  50.059  59.505  1.00 36.19 ? 159  MSE C CE  1 
ATOM   6494  N  N   . ASP C 1 160 ? 11.250  54.478  57.455  1.00 30.14 ? 160  ASP C N   1 
ATOM   6495  C  CA  . ASP C 1 160 ? 11.243  54.428  55.998  1.00 30.66 ? 160  ASP C CA  1 
ATOM   6496  C  C   . ASP C 1 160 ? 12.114  55.557  55.444  1.00 29.49 ? 160  ASP C C   1 
ATOM   6497  O  O   . ASP C 1 160 ? 12.870  55.362  54.491  1.00 29.17 ? 160  ASP C O   1 
ATOM   6498  C  CB  . ASP C 1 160 ? 9.803   54.578  55.501  1.00 32.65 ? 160  ASP C CB  1 
ATOM   6499  C  CG  . ASP C 1 160 ? 9.643   54.227  54.040  1.00 34.69 ? 160  ASP C CG  1 
ATOM   6500  O  OD1 . ASP C 1 160 ? 10.026  55.048  53.181  1.00 34.85 ? 160  ASP C OD1 1 
ATOM   6501  O  OD2 . ASP C 1 160 ? 9.108   53.136  53.753  1.00 37.76 ? 160  ASP C OD2 1 
ATOM   6502  N  N   . VAL C 1 161 ? 12.005  56.732  56.061  1.00 28.57 ? 161  VAL C N   1 
ATOM   6503  C  CA  . VAL C 1 161 ? 12.771  57.907  55.654  1.00 26.92 ? 161  VAL C CA  1 
ATOM   6504  C  C   . VAL C 1 161 ? 14.244  57.780  56.044  1.00 26.05 ? 161  VAL C C   1 
ATOM   6505  O  O   . VAL C 1 161 ? 15.125  58.227  55.311  1.00 25.60 ? 161  VAL C O   1 
ATOM   6506  C  CB  . VAL C 1 161 ? 12.189  59.201  56.279  1.00 27.15 ? 161  VAL C CB  1 
ATOM   6507  C  CG1 . VAL C 1 161 ? 12.998  60.417  55.847  1.00 26.57 ? 161  VAL C CG1 1 
ATOM   6508  C  CG2 . VAL C 1 161 ? 10.737  59.370  55.873  1.00 24.58 ? 161  VAL C CG2 1 
ATOM   6509  N  N   . GLN C 1 162 ? 14.505  57.160  57.191  1.00 26.25 ? 162  GLN C N   1 
ATOM   6510  C  CA  . GLN C 1 162 ? 15.874  56.983  57.670  1.00 26.32 ? 162  GLN C CA  1 
ATOM   6511  C  C   . GLN C 1 162 ? 16.665  56.008  56.804  1.00 25.11 ? 162  GLN C C   1 
ATOM   6512  O  O   . GLN C 1 162 ? 17.875  56.160  56.635  1.00 24.93 ? 162  GLN C O   1 
ATOM   6513  C  CB  . GLN C 1 162 ? 15.879  56.504  59.125  1.00 26.73 ? 162  GLN C CB  1 
ATOM   6514  C  CG  . GLN C 1 162 ? 15.074  57.370  60.083  1.00 28.80 ? 162  GLN C CG  1 
ATOM   6515  C  CD  . GLN C 1 162 ? 15.363  58.849  59.931  1.00 29.62 ? 162  GLN C CD  1 
ATOM   6516  O  OE1 . GLN C 1 162 ? 16.505  59.288  60.052  1.00 31.34 ? 162  GLN C OE1 1 
ATOM   6517  N  NE2 . GLN C 1 162 ? 14.322  59.626  59.662  1.00 31.10 ? 162  GLN C NE2 1 
ATOM   6518  N  N   . GLY C 1 163 ? 15.971  55.015  56.255  1.00 25.40 ? 163  GLY C N   1 
ATOM   6519  C  CA  . GLY C 1 163 ? 16.619  54.025  55.413  1.00 24.41 ? 163  GLY C CA  1 
ATOM   6520  C  C   . GLY C 1 163 ? 16.731  52.667  56.080  1.00 24.46 ? 163  GLY C C   1 
ATOM   6521  O  O   . GLY C 1 163 ? 16.862  51.648  55.402  1.00 25.20 ? 163  GLY C O   1 
ATOM   6522  N  N   . SER C 1 164 ? 16.672  52.653  57.409  1.00 25.15 ? 164  SER C N   1 
ATOM   6523  C  CA  . SER C 1 164 ? 16.769  51.417  58.181  1.00 25.20 ? 164  SER C CA  1 
ATOM   6524  C  C   . SER C 1 164 ? 16.338  51.620  59.633  1.00 26.22 ? 164  SER C C   1 
ATOM   6525  O  O   . SER C 1 164 ? 15.889  52.704  60.015  1.00 25.93 ? 164  SER C O   1 
ATOM   6526  C  CB  . SER C 1 164 ? 18.203  50.875  58.137  1.00 26.87 ? 164  SER C CB  1 
ATOM   6527  O  OG  . SER C 1 164 ? 19.128  51.807  58.672  1.00 28.19 ? 164  SER C OG  1 
ATOM   6528  N  N   . GLY C 1 165 ? 16.475  50.566  60.434  1.00 25.97 ? 165  GLY C N   1 
ATOM   6529  C  CA  . GLY C 1 165 ? 16.101  50.639  61.835  1.00 23.46 ? 165  GLY C CA  1 
ATOM   6530  C  C   . GLY C 1 165 ? 16.092  49.290  62.529  1.00 23.21 ? 165  GLY C C   1 
ATOM   6531  O  O   . GLY C 1 165 ? 15.903  48.253  61.893  1.00 22.25 ? 165  GLY C O   1 
ATOM   6532  N  N   . TYR C 1 166 ? 16.317  49.307  63.840  1.00 25.08 ? 166  TYR C N   1 
ATOM   6533  C  CA  . TYR C 1 166 ? 16.325  48.086  64.639  1.00 26.00 ? 166  TYR C CA  1 
ATOM   6534  C  C   . TYR C 1 166 ? 14.913  47.694  65.042  1.00 27.17 ? 166  TYR C C   1 
ATOM   6535  O  O   . TYR C 1 166 ? 14.112  48.544  65.431  1.00 28.68 ? 166  TYR C O   1 
ATOM   6536  C  CB  . TYR C 1 166 ? 17.165  48.270  65.903  1.00 25.14 ? 166  TYR C CB  1 
ATOM   6537  C  CG  . TYR C 1 166 ? 18.653  48.125  65.699  1.00 26.08 ? 166  TYR C CG  1 
ATOM   6538  C  CD1 . TYR C 1 166 ? 19.227  46.875  65.464  1.00 26.52 ? 166  TYR C CD1 1 
ATOM   6539  C  CD2 . TYR C 1 166 ? 19.493  49.232  65.767  1.00 27.86 ? 166  TYR C CD2 1 
ATOM   6540  C  CE1 . TYR C 1 166 ? 20.603  46.733  65.306  1.00 28.79 ? 166  TYR C CE1 1 
ATOM   6541  C  CE2 . TYR C 1 166 ? 20.868  49.102  65.611  1.00 30.17 ? 166  TYR C CE2 1 
ATOM   6542  C  CZ  . TYR C 1 166 ? 21.418  47.852  65.382  1.00 29.41 ? 166  TYR C CZ  1 
ATOM   6543  O  OH  . TYR C 1 166 ? 22.781  47.730  65.234  1.00 31.23 ? 166  TYR C OH  1 
ATOM   6544  N  N   . ILE C 1 167 ? 14.611  46.404  64.942  1.00 27.81 ? 167  ILE C N   1 
ATOM   6545  C  CA  . ILE C 1 167 ? 13.296  45.902  65.313  1.00 27.04 ? 167  ILE C CA  1 
ATOM   6546  C  C   . ILE C 1 167 ? 13.377  45.110  66.612  1.00 27.88 ? 167  ILE C C   1 
ATOM   6547  O  O   . ILE C 1 167 ? 14.077  44.100  66.704  1.00 26.83 ? 167  ILE C O   1 
ATOM   6548  C  CB  . ILE C 1 167 ? 12.674  45.040  64.195  1.00 25.89 ? 167  ILE C CB  1 
ATOM   6549  C  CG1 . ILE C 1 167 ? 12.496  45.883  62.928  1.00 26.96 ? 167  ILE C CG1 1 
ATOM   6550  C  CG2 . ILE C 1 167 ? 11.326  44.478  64.641  1.00 23.84 ? 167  ILE C CG2 1 
ATOM   6551  C  CD1 . ILE C 1 167 ? 11.594  47.093  63.098  1.00 25.79 ? 167  ILE C CD1 1 
ATOM   6552  N  N   . ASP C 1 168 ? 12.680  45.613  67.623  1.00 29.90 ? 168  ASP C N   1 
ATOM   6553  C  CA  . ASP C 1 168 ? 12.636  44.994  68.939  1.00 31.68 ? 168  ASP C CA  1 
ATOM   6554  C  C   . ASP C 1 168 ? 11.334  44.210  69.089  1.00 30.90 ? 168  ASP C C   1 
ATOM   6555  O  O   . ASP C 1 168 ? 10.255  44.797  69.171  1.00 30.24 ? 168  ASP C O   1 
ATOM   6556  C  CB  . ASP C 1 168 ? 12.735  46.081  70.014  1.00 33.66 ? 168  ASP C CB  1 
ATOM   6557  C  CG  . ASP C 1 168 ? 12.625  45.529  71.417  1.00 35.69 ? 168  ASP C CG  1 
ATOM   6558  O  OD1 . ASP C 1 168 ? 13.580  44.868  71.878  1.00 39.55 ? 168  ASP C OD1 1 
ATOM   6559  O  OD2 . ASP C 1 168 ? 11.581  45.762  72.059  1.00 37.34 ? 168  ASP C OD2 1 
ATOM   6560  N  N   . PHE C 1 169 ? 11.438  42.884  69.114  1.00 31.78 ? 169  PHE C N   1 
ATOM   6561  C  CA  . PHE C 1 169 ? 10.260  42.030  69.248  1.00 32.96 ? 169  PHE C CA  1 
ATOM   6562  C  C   . PHE C 1 169 ? 9.761   41.884  70.683  1.00 33.82 ? 169  PHE C C   1 
ATOM   6563  O  O   . PHE C 1 169 ? 8.743   41.233  70.925  1.00 34.70 ? 169  PHE C O   1 
ATOM   6564  C  CB  . PHE C 1 169 ? 10.520  40.656  68.629  1.00 32.80 ? 169  PHE C CB  1 
ATOM   6565  C  CG  . PHE C 1 169 ? 10.624  40.682  67.133  1.00 33.86 ? 169  PHE C CG  1 
ATOM   6566  C  CD1 . PHE C 1 169 ? 9.483   40.806  66.348  1.00 33.92 ? 169  PHE C CD1 1 
ATOM   6567  C  CD2 . PHE C 1 169 ? 11.863  40.600  66.506  1.00 35.28 ? 169  PHE C CD2 1 
ATOM   6568  C  CE1 . PHE C 1 169 ? 9.570   40.850  64.959  1.00 33.10 ? 169  PHE C CE1 1 
ATOM   6569  C  CE2 . PHE C 1 169 ? 11.963  40.642  65.116  1.00 35.06 ? 169  PHE C CE2 1 
ATOM   6570  C  CZ  . PHE C 1 169 ? 10.813  40.768  64.341  1.00 34.69 ? 169  PHE C CZ  1 
ATOM   6571  N  N   . GLY C 1 170 ? 10.482  42.495  71.623  1.00 34.38 ? 170  GLY C N   1 
ATOM   6572  C  CA  . GLY C 1 170 ? 10.109  42.450  73.029  1.00 35.03 ? 170  GLY C CA  1 
ATOM   6573  C  C   . GLY C 1 170 ? 9.801   41.069  73.573  1.00 35.09 ? 170  GLY C C   1 
ATOM   6574  O  O   . GLY C 1 170 ? 8.808   40.883  74.278  1.00 36.04 ? 170  GLY C O   1 
ATOM   6575  N  N   . ASP C 1 171 ? 10.656  40.103  73.252  1.00 35.37 ? 171  ASP C N   1 
ATOM   6576  C  CA  . ASP C 1 171 ? 10.472  38.725  73.701  1.00 35.72 ? 171  ASP C CA  1 
ATOM   6577  C  C   . ASP C 1 171 ? 11.765  38.105  74.221  1.00 35.95 ? 171  ASP C C   1 
ATOM   6578  O  O   . ASP C 1 171 ? 11.781  36.948  74.646  1.00 36.13 ? 171  ASP C O   1 
ATOM   6579  C  CB  . ASP C 1 171 ? 9.894   37.866  72.565  1.00 35.27 ? 171  ASP C CB  1 
ATOM   6580  C  CG  . ASP C 1 171 ? 10.768  37.863  71.312  1.00 34.59 ? 171  ASP C CG  1 
ATOM   6581  O  OD1 . ASP C 1 171 ? 11.771  38.606  71.254  1.00 33.74 ? 171  ASP C OD1 1 
ATOM   6582  O  OD2 . ASP C 1 171 ? 10.441  37.110  70.371  1.00 35.31 ? 171  ASP C OD2 1 
ATOM   6583  N  N   . GLY C 1 172 ? 12.845  38.881  74.179  1.00 36.61 ? 172  GLY C N   1 
ATOM   6584  C  CA  . GLY C 1 172 ? 14.131  38.395  74.644  1.00 37.86 ? 172  GLY C CA  1 
ATOM   6585  C  C   . GLY C 1 172 ? 15.177  38.377  73.549  1.00 38.07 ? 172  GLY C C   1 
ATOM   6586  O  O   . GLY C 1 172 ? 16.347  38.681  73.792  1.00 37.63 ? 172  GLY C O   1 
ATOM   6587  N  N   . SER C 1 173 ? 14.748  38.024  72.340  1.00 38.36 ? 173  SER C N   1 
ATOM   6588  C  CA  . SER C 1 173 ? 15.637  37.955  71.186  1.00 38.11 ? 173  SER C CA  1 
ATOM   6589  C  C   . SER C 1 173 ? 16.261  39.315  70.877  1.00 38.66 ? 173  SER C C   1 
ATOM   6590  O  O   . SER C 1 173 ? 15.644  40.358  71.106  1.00 40.35 ? 173  SER C O   1 
ATOM   6591  C  CB  . SER C 1 173 ? 14.879  37.433  69.961  1.00 37.59 ? 173  SER C CB  1 
ATOM   6592  O  OG  . SER C 1 173 ? 13.850  38.324  69.570  1.00 35.28 ? 173  SER C OG  1 
ATOM   6593  N  N   . PRO C 1 174 ? 17.508  39.316  70.374  1.00 38.37 ? 174  PRO C N   1 
ATOM   6594  C  CA  . PRO C 1 174 ? 18.246  40.534  70.025  1.00 38.49 ? 174  PRO C CA  1 
ATOM   6595  C  C   . PRO C 1 174 ? 17.535  41.374  68.968  1.00 37.91 ? 174  PRO C C   1 
ATOM   6596  O  O   . PRO C 1 174 ? 16.688  40.871  68.227  1.00 39.31 ? 174  PRO C O   1 
ATOM   6597  C  CB  . PRO C 1 174 ? 19.567  39.984  69.492  1.00 38.16 ? 174  PRO C CB  1 
ATOM   6598  C  CG  . PRO C 1 174 ? 19.740  38.719  70.266  1.00 38.82 ? 174  PRO C CG  1 
ATOM   6599  C  CD  . PRO C 1 174 ? 18.360  38.127  70.193  1.00 38.29 ? 174  PRO C CD  1 
ATOM   6600  N  N   . LEU C 1 175 ? 17.879  42.657  68.914  1.00 36.56 ? 175  LEU C N   1 
ATOM   6601  C  CA  . LEU C 1 175 ? 17.283  43.575  67.949  1.00 33.71 ? 175  LEU C CA  1 
ATOM   6602  C  C   . LEU C 1 175 ? 17.713  43.229  66.532  1.00 31.18 ? 175  LEU C C   1 
ATOM   6603  O  O   . LEU C 1 175 ? 18.902  43.152  66.243  1.00 30.41 ? 175  LEU C O   1 
ATOM   6604  C  CB  . LEU C 1 175 ? 17.680  45.018  68.263  1.00 34.62 ? 175  LEU C CB  1 
ATOM   6605  C  CG  . LEU C 1 175 ? 16.977  45.727  69.422  1.00 36.05 ? 175  LEU C CG  1 
ATOM   6606  C  CD1 . LEU C 1 175 ? 17.249  45.027  70.748  1.00 36.87 ? 175  LEU C CD1 1 
ATOM   6607  C  CD2 . LEU C 1 175 ? 17.449  47.168  69.465  1.00 35.90 ? 175  LEU C CD2 1 
ATOM   6608  N  N   . ASN C 1 176 ? 16.737  43.020  65.654  1.00 29.50 ? 176  ASN C N   1 
ATOM   6609  C  CA  . ASN C 1 176 ? 17.012  42.681  64.264  1.00 26.50 ? 176  ASN C CA  1 
ATOM   6610  C  C   . ASN C 1 176 ? 17.141  43.953  63.428  1.00 24.77 ? 176  ASN C C   1 
ATOM   6611  O  O   . ASN C 1 176 ? 16.211  44.756  63.357  1.00 26.35 ? 176  ASN C O   1 
ATOM   6612  C  CB  . ASN C 1 176 ? 15.890  41.794  63.711  1.00 26.50 ? 176  ASN C CB  1 
ATOM   6613  C  CG  . ASN C 1 176 ? 16.274  41.096  62.417  1.00 26.05 ? 176  ASN C CG  1 
ATOM   6614  O  OD1 . ASN C 1 176 ? 16.879  41.693  61.524  1.00 25.69 ? 176  ASN C OD1 1 
ATOM   6615  N  ND2 . ASN C 1 176 ? 15.923  39.820  62.312  1.00 27.52 ? 176  ASN C ND2 1 
ATOM   6616  N  N   . PHE C 1 177 ? 18.300  44.132  62.801  1.00 22.92 ? 177  PHE C N   1 
ATOM   6617  C  CA  . PHE C 1 177 ? 18.547  45.304  61.971  1.00 21.84 ? 177  PHE C CA  1 
ATOM   6618  C  C   . PHE C 1 177 ? 17.959  45.153  60.570  1.00 22.39 ? 177  PHE C C   1 
ATOM   6619  O  O   . PHE C 1 177 ? 18.441  44.354  59.767  1.00 23.40 ? 177  PHE C O   1 
ATOM   6620  C  CB  . PHE C 1 177 ? 20.050  45.589  61.876  1.00 19.80 ? 177  PHE C CB  1 
ATOM   6621  C  CG  . PHE C 1 177 ? 20.389  46.783  61.026  1.00 17.41 ? 177  PHE C CG  1 
ATOM   6622  C  CD1 . PHE C 1 177 ? 19.918  48.048  61.361  1.00 15.89 ? 177  PHE C CD1 1 
ATOM   6623  C  CD2 . PHE C 1 177 ? 21.165  46.640  59.880  1.00 16.37 ? 177  PHE C CD2 1 
ATOM   6624  C  CE1 . PHE C 1 177 ? 20.213  49.153  60.568  1.00 15.32 ? 177  PHE C CE1 1 
ATOM   6625  C  CE2 . PHE C 1 177 ? 21.465  47.740  59.080  1.00 14.11 ? 177  PHE C CE2 1 
ATOM   6626  C  CZ  . PHE C 1 177 ? 20.988  48.998  59.424  1.00 14.21 ? 177  PHE C CZ  1 
ATOM   6627  N  N   . PHE C 1 178 ? 16.909  45.919  60.291  1.00 22.42 ? 178  PHE C N   1 
ATOM   6628  C  CA  . PHE C 1 178 ? 16.259  45.894  58.986  1.00 20.41 ? 178  PHE C CA  1 
ATOM   6629  C  C   . PHE C 1 178 ? 16.965  46.885  58.066  1.00 18.85 ? 178  PHE C C   1 
ATOM   6630  O  O   . PHE C 1 178 ? 16.674  48.080  58.085  1.00 17.76 ? 178  PHE C O   1 
ATOM   6631  C  CB  . PHE C 1 178 ? 14.774  46.256  59.115  1.00 19.91 ? 178  PHE C CB  1 
ATOM   6632  C  CG  . PHE C 1 178 ? 13.909  45.137  59.638  1.00 20.04 ? 178  PHE C CG  1 
ATOM   6633  C  CD1 . PHE C 1 178 ? 14.449  44.107  60.406  1.00 19.72 ? 178  PHE C CD1 1 
ATOM   6634  C  CD2 . PHE C 1 178 ? 12.544  45.118  59.364  1.00 20.12 ? 178  PHE C CD2 1 
ATOM   6635  C  CE1 . PHE C 1 178 ? 13.644  43.076  60.892  1.00 18.63 ? 178  PHE C CE1 1 
ATOM   6636  C  CE2 . PHE C 1 178 ? 11.731  44.091  59.845  1.00 20.43 ? 178  PHE C CE2 1 
ATOM   6637  C  CZ  . PHE C 1 178 ? 12.282  43.069  60.611  1.00 18.62 ? 178  PHE C CZ  1 
ATOM   6638  N  N   . SER C 1 179 ? 17.903  46.376  57.274  1.00 21.17 ? 179  SER C N   1 
ATOM   6639  C  CA  . SER C 1 179 ? 18.678  47.196  56.347  1.00 21.99 ? 179  SER C CA  1 
ATOM   6640  C  C   . SER C 1 179 ? 17.905  47.600  55.097  1.00 22.46 ? 179  SER C C   1 
ATOM   6641  O  O   . SER C 1 179 ? 16.906  46.976  54.742  1.00 21.90 ? 179  SER C O   1 
ATOM   6642  C  CB  . SER C 1 179 ? 19.959  46.463  55.940  1.00 22.92 ? 179  SER C CB  1 
ATOM   6643  O  OG  . SER C 1 179 ? 19.664  45.256  55.257  1.00 24.05 ? 179  SER C OG  1 
ATOM   6644  N  N   . TYR C 1 180 ? 18.388  48.648  54.435  1.00 24.46 ? 180  TYR C N   1 
ATOM   6645  C  CA  . TYR C 1 180 ? 17.782  49.163  53.210  1.00 23.98 ? 180  TYR C CA  1 
ATOM   6646  C  C   . TYR C 1 180 ? 17.985  48.143  52.091  1.00 24.33 ? 180  TYR C C   1 
ATOM   6647  O  O   . TYR C 1 180 ? 19.096  47.982  51.585  1.00 25.58 ? 180  TYR C O   1 
ATOM   6648  C  CB  . TYR C 1 180 ? 18.440  50.498  52.834  1.00 24.33 ? 180  TYR C CB  1 
ATOM   6649  C  CG  . TYR C 1 180 ? 17.812  51.213  51.656  1.00 24.83 ? 180  TYR C CG  1 
ATOM   6650  C  CD1 . TYR C 1 180 ? 18.165  50.887  50.345  1.00 25.36 ? 180  TYR C CD1 1 
ATOM   6651  C  CD2 . TYR C 1 180 ? 16.868  52.221  51.852  1.00 25.03 ? 180  TYR C CD2 1 
ATOM   6652  C  CE1 . TYR C 1 180 ? 17.591  51.544  49.259  1.00 25.57 ? 180  TYR C CE1 1 
ATOM   6653  C  CE2 . TYR C 1 180 ? 16.289  52.886  50.772  1.00 25.41 ? 180  TYR C CE2 1 
ATOM   6654  C  CZ  . TYR C 1 180 ? 16.655  52.541  49.480  1.00 25.62 ? 180  TYR C CZ  1 
ATOM   6655  O  OH  . TYR C 1 180 ? 16.079  53.187  48.409  1.00 27.26 ? 180  TYR C OH  1 
ATOM   6656  N  N   . ALA C 1 181 ? 16.914  47.444  51.725  1.00 23.90 ? 181  ALA C N   1 
ATOM   6657  C  CA  . ALA C 1 181 ? 16.979  46.433  50.672  1.00 24.10 ? 181  ALA C CA  1 
ATOM   6658  C  C   . ALA C 1 181 ? 16.568  46.975  49.305  1.00 24.12 ? 181  ALA C C   1 
ATOM   6659  O  O   . ALA C 1 181 ? 17.067  46.521  48.275  1.00 23.16 ? 181  ALA C O   1 
ATOM   6660  C  CB  . ALA C 1 181 ? 16.120  45.236  51.042  1.00 23.60 ? 181  ALA C CB  1 
ATOM   6661  N  N   . GLY C 1 182 ? 15.651  47.939  49.302  1.00 24.50 ? 182  GLY C N   1 
ATOM   6662  C  CA  . GLY C 1 182 ? 15.189  48.522  48.056  1.00 24.16 ? 182  GLY C CA  1 
ATOM   6663  C  C   . GLY C 1 182 ? 14.071  49.525  48.257  1.00 24.64 ? 182  GLY C C   1 
ATOM   6664  O  O   . GLY C 1 182 ? 13.761  49.903  49.386  1.00 25.95 ? 182  GLY C O   1 
ATOM   6665  N  N   . LYS C 1 183 ? 13.447  49.937  47.159  1.00 26.09 ? 183  LYS C N   1 
ATOM   6666  C  CA  . LYS C 1 183 ? 12.359  50.910  47.205  1.00 28.76 ? 183  LYS C CA  1 
ATOM   6667  C  C   . LYS C 1 183 ? 11.362  50.634  46.079  1.00 28.70 ? 183  LYS C C   1 
ATOM   6668  O  O   . LYS C 1 183 ? 11.602  49.780  45.225  1.00 28.14 ? 183  LYS C O   1 
ATOM   6669  C  CB  . LYS C 1 183 ? 12.933  52.325  47.066  1.00 30.62 ? 183  LYS C CB  1 
ATOM   6670  C  CG  . LYS C 1 183 ? 11.990  53.446  47.476  1.00 33.81 ? 183  LYS C CG  1 
ATOM   6671  C  CD  . LYS C 1 183 ? 12.641  54.808  47.297  1.00 36.61 ? 183  LYS C CD  1 
ATOM   6672  C  CE  . LYS C 1 183 ? 12.860  55.138  45.830  1.00 37.25 ? 183  LYS C CE  1 
ATOM   6673  N  NZ  . LYS C 1 183 ? 11.569  55.239  45.095  1.00 40.44 ? 183  LYS C NZ  1 
ATOM   6674  N  N   . ASN C 1 184 ? 10.235  51.341  46.094  1.00 29.86 ? 184  ASN C N   1 
ATOM   6675  C  CA  . ASN C 1 184 ? 9.213   51.173  45.065  1.00 30.33 ? 184  ASN C CA  1 
ATOM   6676  C  C   . ASN C 1 184 ? 9.468   52.081  43.860  1.00 30.86 ? 184  ASN C C   1 
ATOM   6677  O  O   . ASN C 1 184 ? 10.414  52.873  43.859  1.00 31.89 ? 184  ASN C O   1 
ATOM   6678  C  CB  . ASN C 1 184 ? 7.811   51.415  45.645  1.00 29.17 ? 184  ASN C CB  1 
ATOM   6679  C  CG  . ASN C 1 184 ? 7.602   52.841  46.123  1.00 26.95 ? 184  ASN C CG  1 
ATOM   6680  O  OD1 . ASN C 1 184 ? 8.541   53.633  46.204  1.00 27.67 ? 184  ASN C OD1 1 
ATOM   6681  N  ND2 . ASN C 1 184 ? 6.358   53.173  46.445  1.00 23.88 ? 184  ASN C ND2 1 
ATOM   6682  N  N   . GLY C 1 185 ? 8.625   51.962  42.838  1.00 29.96 ? 185  GLY C N   1 
ATOM   6683  C  CA  . GLY C 1 185 ? 8.785   52.770  41.642  1.00 30.05 ? 185  GLY C CA  1 
ATOM   6684  C  C   . GLY C 1 185 ? 8.108   54.126  41.702  1.00 31.34 ? 185  GLY C C   1 
ATOM   6685  O  O   . GLY C 1 185 ? 7.492   54.555  40.726  1.00 32.40 ? 185  GLY C O   1 
ATOM   6686  N  N   . HIS C 1 186 ? 8.227   54.805  42.841  1.00 32.50 ? 186  HIS C N   1 
ATOM   6687  C  CA  . HIS C 1 186 ? 7.622   56.123  43.026  1.00 31.98 ? 186  HIS C CA  1 
ATOM   6688  C  C   . HIS C 1 186 ? 8.579   57.114  43.684  1.00 33.20 ? 186  HIS C C   1 
ATOM   6689  O  O   . HIS C 1 186 ? 9.289   56.774  44.632  1.00 31.10 ? 186  HIS C O   1 
ATOM   6690  C  CB  . HIS C 1 186 ? 6.336   56.014  43.849  1.00 30.06 ? 186  HIS C CB  1 
ATOM   6691  C  CG  . HIS C 1 186 ? 5.211   55.339  43.126  1.00 27.91 ? 186  HIS C CG  1 
ATOM   6692  N  ND1 . HIS C 1 186 ? 4.303   56.030  42.352  1.00 27.39 ? 186  HIS C ND1 1 
ATOM   6693  C  CD2 . HIS C 1 186 ? 4.852   54.036  43.053  1.00 25.82 ? 186  HIS C CD2 1 
ATOM   6694  C  CE1 . HIS C 1 186 ? 3.435   55.182  41.832  1.00 25.52 ? 186  HIS C CE1 1 
ATOM   6695  N  NE2 . HIS C 1 186 ? 3.745   53.966  42.242  1.00 24.40 ? 186  HIS C NE2 1 
ATOM   6696  N  N   . ALA C 1 187 ? 8.574   58.346  43.176  1.00 35.73 ? 187  ALA C N   1 
ATOM   6697  C  CA  . ALA C 1 187 ? 9.435   59.416  43.680  1.00 35.64 ? 187  ALA C CA  1 
ATOM   6698  C  C   . ALA C 1 187 ? 9.031   59.908  45.069  1.00 35.33 ? 187  ALA C C   1 
ATOM   6699  O  O   . ALA C 1 187 ? 7.845   59.985  45.393  1.00 35.52 ? 187  ALA C O   1 
ATOM   6700  C  CB  . ALA C 1 187 ? 9.453   60.577  42.695  1.00 36.23 ? 187  ALA C CB  1 
ATOM   6701  N  N   . TYR C 1 188 ? 10.031  60.264  45.871  1.00 35.34 ? 188  TYR C N   1 
ATOM   6702  C  CA  . TYR C 1 188 ? 9.812   60.743  47.232  1.00 35.42 ? 188  TYR C CA  1 
ATOM   6703  C  C   . TYR C 1 188 ? 9.249   62.162  47.322  1.00 36.05 ? 188  TYR C C   1 
ATOM   6704  O  O   . TYR C 1 188 ? 9.756   63.091  46.690  1.00 37.46 ? 188  TYR C O   1 
ATOM   6705  C  CB  . TYR C 1 188 ? 11.114  60.653  48.039  1.00 34.49 ? 188  TYR C CB  1 
ATOM   6706  C  CG  . TYR C 1 188 ? 11.011  61.203  49.448  1.00 34.60 ? 188  TYR C CG  1 
ATOM   6707  C  CD1 . TYR C 1 188 ? 10.448  60.446  50.475  1.00 34.96 ? 188  TYR C CD1 1 
ATOM   6708  C  CD2 . TYR C 1 188 ? 11.457  62.488  49.750  1.00 33.57 ? 188  TYR C CD2 1 
ATOM   6709  C  CE1 . TYR C 1 188 ? 10.330  60.956  51.767  1.00 35.43 ? 188  TYR C CE1 1 
ATOM   6710  C  CE2 . TYR C 1 188 ? 11.342  63.008  51.037  1.00 34.55 ? 188  TYR C CE2 1 
ATOM   6711  C  CZ  . TYR C 1 188 ? 10.777  62.238  52.040  1.00 34.80 ? 188  TYR C CZ  1 
ATOM   6712  O  OH  . TYR C 1 188 ? 10.648  62.753  53.309  1.00 35.39 ? 188  TYR C OH  1 
ATOM   6713  N  N   . ARG C 1 189 ? 8.193   62.306  48.118  1.00 36.29 ? 189  ARG C N   1 
ATOM   6714  C  CA  . ARG C 1 189 ? 7.542   63.589  48.362  1.00 35.35 ? 189  ARG C CA  1 
ATOM   6715  C  C   . ARG C 1 189 ? 7.547   63.784  49.874  1.00 34.48 ? 189  ARG C C   1 
ATOM   6716  O  O   . ARG C 1 189 ? 6.983   62.975  50.608  1.00 33.11 ? 189  ARG C O   1 
ATOM   6717  C  CB  . ARG C 1 189 ? 6.093   63.582  47.867  1.00 36.87 ? 189  ARG C CB  1 
ATOM   6718  C  CG  . ARG C 1 189 ? 5.909   63.492  46.362  1.00 39.17 ? 189  ARG C CG  1 
ATOM   6719  C  CD  . ARG C 1 189 ? 4.428   63.593  46.018  1.00 40.76 ? 189  ARG C CD  1 
ATOM   6720  N  NE  . ARG C 1 189 ? 4.150   63.354  44.604  1.00 41.52 ? 189  ARG C NE  1 
ATOM   6721  C  CZ  . ARG C 1 189 ? 2.988   62.903  44.136  1.00 41.99 ? 189  ARG C CZ  1 
ATOM   6722  N  NH1 . ARG C 1 189 ? 1.988   62.638  44.969  1.00 41.42 ? 189  ARG C NH1 1 
ATOM   6723  N  NH2 . ARG C 1 189 ? 2.825   62.718  42.834  1.00 42.05 ? 189  ARG C NH2 1 
ATOM   6724  N  N   . SER C 1 190 ? 8.195   64.846  50.337  1.00 35.98 ? 190  SER C N   1 
ATOM   6725  C  CA  . SER C 1 190 ? 8.276   65.121  51.768  1.00 36.65 ? 190  SER C CA  1 
ATOM   6726  C  C   . SER C 1 190 ? 6.950   65.587  52.361  1.00 36.76 ? 190  SER C C   1 
ATOM   6727  O  O   . SER C 1 190 ? 6.270   66.446  51.797  1.00 35.53 ? 190  SER C O   1 
ATOM   6728  C  CB  . SER C 1 190 ? 9.365   66.159  52.050  1.00 37.41 ? 190  SER C CB  1 
ATOM   6729  O  OG  . SER C 1 190 ? 9.533   66.357  53.443  1.00 37.45 ? 190  SER C OG  1 
ATOM   6730  N  N   . ILE C 1 191 ? 6.591   65.002  53.502  1.00 37.82 ? 191  ILE C N   1 
ATOM   6731  C  CA  . ILE C 1 191 ? 5.361   65.355  54.206  1.00 39.44 ? 191  ILE C CA  1 
ATOM   6732  C  C   . ILE C 1 191 ? 5.528   66.750  54.808  1.00 41.62 ? 191  ILE C C   1 
ATOM   6733  O  O   . ILE C 1 191 ? 4.547   67.421  55.139  1.00 41.76 ? 191  ILE C O   1 
ATOM   6734  C  CB  . ILE C 1 191 ? 5.044   64.334  55.327  1.00 39.40 ? 191  ILE C CB  1 
ATOM   6735  C  CG1 . ILE C 1 191 ? 4.883   62.936  54.730  1.00 39.51 ? 191  ILE C CG1 1 
ATOM   6736  C  CG2 . ILE C 1 191 ? 3.775   64.724  56.071  1.00 39.51 ? 191  ILE C CG2 1 
ATOM   6737  C  CD1 . ILE C 1 191 ? 3.799   62.827  53.676  1.00 39.90 ? 191  ILE C CD1 1 
ATOM   6738  N  N   . GLY C 1 192 ? 6.783   67.176  54.936  1.00 43.22 ? 192  GLY C N   1 
ATOM   6739  C  CA  . GLY C 1 192 ? 7.082   68.490  55.471  1.00 44.85 ? 192  GLY C CA  1 
ATOM   6740  C  C   . GLY C 1 192 ? 6.518   69.564  54.563  1.00 45.86 ? 192  GLY C C   1 
ATOM   6741  O  O   . GLY C 1 192 ? 5.854   70.487  55.031  1.00 46.75 ? 192  GLY C O   1 
ATOM   6742  N  N   . LYS C 1 193 ? 6.757   69.419  53.260  1.00 46.94 ? 193  LYS C N   1 
ATOM   6743  C  CA  . LYS C 1 193 ? 6.265   70.367  52.262  1.00 47.29 ? 193  LYS C CA  1 
ATOM   6744  C  C   . LYS C 1 193 ? 4.739   70.396  52.262  1.00 47.05 ? 193  LYS C C   1 
ATOM   6745  O  O   . LYS C 1 193 ? 4.129   71.428  51.984  1.00 48.31 ? 193  LYS C O   1 
ATOM   6746  C  CB  . LYS C 1 193 ? 6.771   69.989  50.866  1.00 48.28 ? 193  LYS C CB  1 
ATOM   6747  C  CG  . LYS C 1 193 ? 6.288   70.921  49.761  1.00 49.03 ? 193  LYS C CG  1 
ATOM   6748  C  CD  . LYS C 1 193 ? 6.716   70.440  48.386  1.00 49.34 ? 193  LYS C CD  1 
ATOM   6749  C  CE  . LYS C 1 193 ? 6.208   71.378  47.303  1.00 49.46 ? 193  LYS C CE  1 
ATOM   6750  N  NZ  . LYS C 1 193 ? 6.629   70.939  45.944  1.00 50.19 ? 193  LYS C NZ  1 
ATOM   6751  N  N   . VAL C 1 194 ? 4.131   69.255  52.577  1.00 46.13 ? 194  VAL C N   1 
ATOM   6752  C  CA  . VAL C 1 194 ? 2.678   69.138  52.624  1.00 44.82 ? 194  VAL C CA  1 
ATOM   6753  C  C   . VAL C 1 194 ? 2.104   70.009  53.740  1.00 43.91 ? 194  VAL C C   1 
ATOM   6754  O  O   . VAL C 1 194 ? 1.223   70.831  53.495  1.00 43.44 ? 194  VAL C O   1 
ATOM   6755  C  CB  . VAL C 1 194 ? 2.241   67.670  52.838  1.00 44.89 ? 194  VAL C CB  1 
ATOM   6756  C  CG1 . VAL C 1 194 ? 0.722   67.558  52.832  1.00 44.55 ? 194  VAL C CG1 1 
ATOM   6757  C  CG2 . VAL C 1 194 ? 2.842   66.784  51.757  1.00 44.85 ? 194  VAL C CG2 1 
ATOM   6758  N  N   . LEU C 1 195 ? 2.629   69.845  54.953  1.00 43.52 ? 195  LEU C N   1 
ATOM   6759  C  CA  . LEU C 1 195 ? 2.168   70.616  56.107  1.00 43.05 ? 195  LEU C CA  1 
ATOM   6760  C  C   . LEU C 1 195 ? 2.567   72.090  56.058  1.00 43.78 ? 195  LEU C C   1 
ATOM   6761  O  O   . LEU C 1 195 ? 1.930   72.930  56.697  1.00 44.23 ? 195  LEU C O   1 
ATOM   6762  C  CB  . LEU C 1 195 ? 2.650   69.976  57.411  1.00 43.09 ? 195  LEU C CB  1 
ATOM   6763  C  CG  . LEU C 1 195 ? 1.985   68.647  57.783  1.00 42.92 ? 195  LEU C CG  1 
ATOM   6764  C  CD1 . LEU C 1 195 ? 2.587   68.106  59.069  1.00 42.73 ? 195  LEU C CD1 1 
ATOM   6765  C  CD2 . LEU C 1 195 ? 0.483   68.840  57.939  1.00 42.21 ? 195  LEU C CD2 1 
ATOM   6766  N  N   . ILE C 1 196 ? 3.630   72.397  55.317  1.00 43.75 ? 196  ILE C N   1 
ATOM   6767  C  CA  . ILE C 1 196 ? 4.092   73.775  55.168  1.00 43.55 ? 196  ILE C CA  1 
ATOM   6768  C  C   . ILE C 1 196 ? 3.091   74.532  54.296  1.00 43.10 ? 196  ILE C C   1 
ATOM   6769  O  O   . ILE C 1 196 ? 2.701   75.657  54.613  1.00 43.67 ? 196  ILE C O   1 
ATOM   6770  C  CB  . ILE C 1 196 ? 5.502   73.839  54.520  1.00 44.06 ? 196  ILE C CB  1 
ATOM   6771  C  CG1 . ILE C 1 196 ? 6.557   73.339  55.511  1.00 44.81 ? 196  ILE C CG1 1 
ATOM   6772  C  CG2 . ILE C 1 196 ? 5.830   75.262  54.073  1.00 44.14 ? 196  ILE C CG2 1 
ATOM   6773  C  CD1 . ILE C 1 196 ? 7.963   73.294  54.944  1.00 44.91 ? 196  ILE C CD1 1 
ATOM   6774  N  N   . ASP C 1 197 ? 2.663   73.889  53.212  1.00 42.18 ? 197  ASP C N   1 
ATOM   6775  C  CA  . ASP C 1 197 ? 1.704   74.476  52.285  1.00 41.50 ? 197  ASP C CA  1 
ATOM   6776  C  C   . ASP C 1 197 ? 0.287   74.485  52.857  1.00 40.85 ? 197  ASP C C   1 
ATOM   6777  O  O   . ASP C 1 197 ? -0.507  75.370  52.537  1.00 41.44 ? 197  ASP C O   1 
ATOM   6778  C  CB  . ASP C 1 197 ? 1.737   73.736  50.943  1.00 42.55 ? 197  ASP C CB  1 
ATOM   6779  C  CG  . ASP C 1 197 ? 3.023   73.988  50.164  1.00 42.96 ? 197  ASP C CG  1 
ATOM   6780  O  OD1 . ASP C 1 197 ? 4.122   73.871  50.748  1.00 42.43 ? 197  ASP C OD1 1 
ATOM   6781  O  OD2 . ASP C 1 197 ? 2.932   74.304  48.959  1.00 43.95 ? 197  ASP C OD2 1 
ATOM   6782  N  N   . ARG C 1 198 ? -0.023  73.502  53.701  1.00 40.89 ? 198  ARG C N   1 
ATOM   6783  C  CA  . ARG C 1 198 ? -1.341  73.407  54.330  1.00 41.21 ? 198  ARG C CA  1 
ATOM   6784  C  C   . ARG C 1 198 ? -1.542  74.508  55.371  1.00 42.18 ? 198  ARG C C   1 
ATOM   6785  O  O   . ARG C 1 198 ? -2.675  74.891  55.670  1.00 42.03 ? 198  ARG C O   1 
ATOM   6786  C  CB  . ARG C 1 198 ? -1.532  72.041  54.998  1.00 40.42 ? 198  ARG C CB  1 
ATOM   6787  C  CG  . ARG C 1 198 ? -1.804  70.888  54.044  1.00 40.85 ? 198  ARG C CG  1 
ATOM   6788  C  CD  . ARG C 1 198 ? -2.067  69.602  54.818  1.00 40.86 ? 198  ARG C CD  1 
ATOM   6789  N  NE  . ARG C 1 198 ? -2.388  68.476  53.944  1.00 42.15 ? 198  ARG C NE  1 
ATOM   6790  C  CZ  . ARG C 1 198 ? -3.027  67.377  54.338  1.00 41.89 ? 198  ARG C CZ  1 
ATOM   6791  N  NH1 . ARG C 1 198 ? -3.421  67.245  55.598  1.00 41.03 ? 198  ARG C NH1 1 
ATOM   6792  N  NH2 . ARG C 1 198 ? -3.275  66.407  53.468  1.00 41.51 ? 198  ARG C NH2 1 
ATOM   6793  N  N   . GLY C 1 199 ? -0.436  75.004  55.919  1.00 43.30 ? 199  GLY C N   1 
ATOM   6794  C  CA  . GLY C 1 199 ? -0.498  76.053  56.920  1.00 44.26 ? 199  GLY C CA  1 
ATOM   6795  C  C   . GLY C 1 199 ? -0.676  75.517  58.328  1.00 45.74 ? 199  GLY C C   1 
ATOM   6796  O  O   . GLY C 1 199 ? -1.546  75.982  59.067  1.00 45.96 ? 199  GLY C O   1 
ATOM   6797  N  N   . GLU C 1 200 ? 0.146   74.538  58.698  1.00 46.90 ? 200  GLU C N   1 
ATOM   6798  C  CA  . GLU C 1 200 ? 0.081   73.935  60.028  1.00 48.14 ? 200  GLU C CA  1 
ATOM   6799  C  C   . GLU C 1 200 ? 1.464   73.786  60.667  1.00 48.93 ? 200  GLU C C   1 
ATOM   6800  O  O   . GLU C 1 200 ? 1.677   72.913  61.512  1.00 48.56 ? 200  GLU C O   1 
ATOM   6801  C  CB  . GLU C 1 200 ? -0.623  72.573  59.968  1.00 48.08 ? 200  GLU C CB  1 
ATOM   6802  C  CG  . GLU C 1 200 ? -2.098  72.644  59.592  1.00 48.18 ? 200  GLU C CG  1 
ATOM   6803  C  CD  . GLU C 1 200 ? -2.798  71.303  59.695  1.00 48.34 ? 200  GLU C CD  1 
ATOM   6804  O  OE1 . GLU C 1 200 ? -2.680  70.491  58.752  1.00 49.05 ? 200  GLU C OE1 1 
ATOM   6805  O  OE2 . GLU C 1 200 ? -3.473  71.063  60.719  1.00 48.56 ? 200  GLU C OE2 1 
ATOM   6806  N  N   . VAL C 1 201 ? 2.393   74.651  60.267  1.00 50.49 ? 201  VAL C N   1 
ATOM   6807  C  CA  . VAL C 1 201 ? 3.758   74.631  60.794  1.00 51.79 ? 201  VAL C CA  1 
ATOM   6808  C  C   . VAL C 1 201 ? 4.066   75.926  61.547  1.00 52.31 ? 201  VAL C C   1 
ATOM   6809  O  O   . VAL C 1 201 ? 3.660   77.012  61.124  1.00 52.16 ? 201  VAL C O   1 
ATOM   6810  C  CB  . VAL C 1 201 ? 4.798   74.443  59.656  1.00 52.22 ? 201  VAL C CB  1 
ATOM   6811  C  CG1 . VAL C 1 201 ? 6.214   74.425  60.220  1.00 53.28 ? 201  VAL C CG1 1 
ATOM   6812  C  CG2 . VAL C 1 201 ? 4.521   73.156  58.899  1.00 52.85 ? 201  VAL C CG2 1 
ATOM   6813  N  N   . LYS C 1 202 ? 4.780   75.802  62.664  1.00 52.48 ? 202  LYS C N   1 
ATOM   6814  C  CA  . LYS C 1 202 ? 5.153   76.954  63.480  1.00 52.77 ? 202  LYS C CA  1 
ATOM   6815  C  C   . LYS C 1 202 ? 6.103   77.874  62.714  1.00 52.91 ? 202  LYS C C   1 
ATOM   6816  O  O   . LYS C 1 202 ? 7.020   77.412  62.033  1.00 52.62 ? 202  LYS C O   1 
ATOM   6817  C  CB  . LYS C 1 202 ? 5.821   76.492  64.778  1.00 52.59 ? 202  LYS C CB  1 
ATOM   6818  C  CG  . LYS C 1 202 ? 6.162   77.625  65.739  1.00 54.10 ? 202  LYS C CG  1 
ATOM   6819  C  CD  . LYS C 1 202 ? 7.083   77.159  66.858  1.00 54.14 ? 202  LYS C CD  1 
ATOM   6820  C  CE  . LYS C 1 202 ? 8.440   76.736  66.315  1.00 54.77 ? 202  LYS C CE  1 
ATOM   6821  N  NZ  . LYS C 1 202 ? 9.360   76.280  67.392  1.00 55.03 ? 202  LYS C NZ  1 
HETATM 6822  N  N   . MSE C 1 206 ? 10.505  71.358  57.009  1.00 67.26 ? 206  MSE C N   1 
HETATM 6823  C  CA  . MSE C 1 206 ? 10.074  71.666  58.369  1.00 67.40 ? 206  MSE C CA  1 
HETATM 6824  C  C   . MSE C 1 206 ? 10.751  70.738  59.377  1.00 66.65 ? 206  MSE C C   1 
HETATM 6825  O  O   . MSE C 1 206 ? 11.766  70.107  59.077  1.00 66.98 ? 206  MSE C O   1 
HETATM 6826  C  CB  . MSE C 1 206 ? 8.552   71.519  58.490  1.00 68.79 ? 206  MSE C CB  1 
HETATM 6827  C  CG  . MSE C 1 206 ? 8.063   70.076  58.417  1.00 70.38 ? 206  MSE C CG  1 
HETATM 6828  SE SE  . MSE C 1 206 ? 6.212   69.861  58.914  1.00 73.57 ? 206  MSE C SE  1 
HETATM 6829  C  CE  . MSE C 1 206 ? 6.376   70.073  60.822  1.00 72.71 ? 206  MSE C CE  1 
ATOM   6830  N  N   . SER C 1 207 ? 10.179  70.671  60.577  1.00 65.27 ? 207  SER C N   1 
ATOM   6831  C  CA  . SER C 1 207 ? 10.691  69.816  61.639  1.00 63.34 ? 207  SER C CA  1 
ATOM   6832  C  C   . SER C 1 207 ? 10.113  68.418  61.453  1.00 62.21 ? 207  SER C C   1 
ATOM   6833  O  O   . SER C 1 207 ? 8.902   68.221  61.557  1.00 61.55 ? 207  SER C O   1 
ATOM   6834  C  CB  . SER C 1 207 ? 10.282  70.372  63.004  1.00 63.54 ? 207  SER C CB  1 
ATOM   6835  O  OG  . SER C 1 207 ? 10.753  71.698  63.175  1.00 63.83 ? 207  SER C OG  1 
HETATM 6836  N  N   . MSE C 1 208 ? 10.982  67.453  61.165  1.00 61.99 ? 208  MSE C N   1 
HETATM 6837  C  CA  . MSE C 1 208 ? 10.555  66.074  60.952  1.00 61.97 ? 208  MSE C CA  1 
HETATM 6838  C  C   . MSE C 1 208 ? 10.066  65.383  62.228  1.00 60.46 ? 208  MSE C C   1 
HETATM 6839  O  O   . MSE C 1 208 ? 9.493   64.291  62.166  1.00 60.54 ? 208  MSE C O   1 
HETATM 6840  C  CB  . MSE C 1 208 ? 11.674  65.266  60.290  1.00 64.76 ? 208  MSE C CB  1 
HETATM 6841  C  CG  . MSE C 1 208 ? 11.323  64.725  58.901  1.00 69.00 ? 208  MSE C CG  1 
HETATM 6842  SE SE  . MSE C 1 208 ? 10.740  66.069  57.622  1.00 74.29 ? 208  MSE C SE  1 
HETATM 6843  C  CE  . MSE C 1 208 ? 9.360   65.058  56.726  1.00 72.67 ? 208  MSE C CE  1 
ATOM   6844  N  N   . GLN C 1 209 ? 10.300  66.013  63.379  1.00 57.90 ? 209  GLN C N   1 
ATOM   6845  C  CA  . GLN C 1 209 ? 9.852   65.461  64.656  1.00 55.78 ? 209  GLN C CA  1 
ATOM   6846  C  C   . GLN C 1 209 ? 8.525   66.089  65.073  1.00 55.61 ? 209  GLN C C   1 
ATOM   6847  O  O   . GLN C 1 209 ? 7.791   65.524  65.886  1.00 56.42 ? 209  GLN C O   1 
ATOM   6848  C  CB  . GLN C 1 209 ? 10.894  65.672  65.761  1.00 55.05 ? 209  GLN C CB  1 
ATOM   6849  C  CG  . GLN C 1 209 ? 11.197  67.126  66.092  1.00 52.54 ? 209  GLN C CG  1 
ATOM   6850  C  CD  . GLN C 1 209 ? 12.468  67.612  65.438  1.00 50.93 ? 209  GLN C CD  1 
ATOM   6851  O  OE1 . GLN C 1 209 ? 12.335  68.524  64.485  1.00 49.66 ? 209  GLN C OE1 1 
ATOM   6852  N  NE2 . GLN C 1 209 ? 13.562  67.170  65.785  1.00 50.73 ? 209  GLN C NE2 1 
ATOM   6853  N  N   . ALA C 1 210 ? 8.233   67.269  64.528  1.00 54.22 ? 210  ALA C N   1 
ATOM   6854  C  CA  . ALA C 1 210 ? 6.989   67.971  64.828  1.00 53.08 ? 210  ALA C CA  1 
ATOM   6855  C  C   . ALA C 1 210 ? 5.817   67.184  64.253  1.00 52.25 ? 210  ALA C C   1 
ATOM   6856  O  O   . ALA C 1 210 ? 4.704   67.234  64.781  1.00 52.58 ? 210  ALA C O   1 
ATOM   6857  C  CB  . ALA C 1 210 ? 7.020   69.375  64.246  1.00 53.05 ? 210  ALA C CB  1 
ATOM   6858  N  N   . ILE C 1 211 ? 6.086   66.454  63.172  1.00 51.25 ? 211  ILE C N   1 
ATOM   6859  C  CA  . ILE C 1 211 ? 5.080   65.629  62.513  1.00 50.20 ? 211  ILE C CA  1 
ATOM   6860  C  C   . ILE C 1 211 ? 4.756   64.434  63.408  1.00 50.29 ? 211  ILE C C   1 
ATOM   6861  O  O   . ILE C 1 211 ? 3.644   63.904  63.371  1.00 49.72 ? 211  ILE C O   1 
ATOM   6862  C  CB  . ILE C 1 211 ? 5.576   65.132  61.134  1.00 49.74 ? 211  ILE C CB  1 
ATOM   6863  C  CG1 . ILE C 1 211 ? 6.047   66.318  60.289  1.00 49.05 ? 211  ILE C CG1 1 
ATOM   6864  C  CG2 . ILE C 1 211 ? 4.460   64.393  60.403  1.00 49.30 ? 211  ILE C CG2 1 
ATOM   6865  C  CD1 . ILE C 1 211 ? 6.600   65.933  58.935  1.00 47.77 ? 211  ILE C CD1 1 
ATOM   6866  N  N   . ARG C 1 212 ? 5.734   64.021  64.215  1.00 50.85 ? 212  ARG C N   1 
ATOM   6867  C  CA  . ARG C 1 212 ? 5.557   62.907  65.143  1.00 51.62 ? 212  ARG C CA  1 
ATOM   6868  C  C   . ARG C 1 212 ? 4.519   63.297  66.194  1.00 52.00 ? 212  ARG C C   1 
ATOM   6869  O  O   . ARG C 1 212 ? 3.684   62.480  66.587  1.00 52.46 ? 212  ARG C O   1 
ATOM   6870  C  CB  . ARG C 1 212 ? 6.889   62.538  65.810  1.00 51.53 ? 212  ARG C CB  1 
ATOM   6871  C  CG  . ARG C 1 212 ? 6.767   61.504  66.924  1.00 51.82 ? 212  ARG C CG  1 
ATOM   6872  C  CD  . ARG C 1 212 ? 8.129   61.093  67.469  1.00 51.88 ? 212  ARG C CD  1 
ATOM   6873  N  NE  . ARG C 1 212 ? 8.821   60.154  66.588  1.00 50.29 ? 212  ARG C NE  1 
ATOM   6874  C  CZ  . ARG C 1 212 ? 8.587   58.844  66.555  1.00 50.09 ? 212  ARG C CZ  1 
ATOM   6875  N  NH1 . ARG C 1 212 ? 7.673   58.305  67.353  1.00 49.68 ? 212  ARG C NH1 1 
ATOM   6876  N  NH2 . ARG C 1 212 ? 9.271   58.068  65.726  1.00 49.40 ? 212  ARG C NH2 1 
ATOM   6877  N  N   . HIS C 1 213 ? 4.573   64.555  66.630  1.00 52.17 ? 213  HIS C N   1 
ATOM   6878  C  CA  . HIS C 1 213 ? 3.628   65.075  67.614  1.00 53.30 ? 213  HIS C CA  1 
ATOM   6879  C  C   . HIS C 1 213 ? 2.246   65.196  66.971  1.00 52.70 ? 213  HIS C C   1 
ATOM   6880  O  O   . HIS C 1 213 ? 1.227   64.951  67.619  1.00 53.15 ? 213  HIS C O   1 
ATOM   6881  C  CB  . HIS C 1 213 ? 4.088   66.442  68.130  1.00 55.88 ? 213  HIS C CB  1 
ATOM   6882  C  CG  . HIS C 1 213 ? 3.134   67.076  69.095  1.00 59.34 ? 213  HIS C CG  1 
ATOM   6883  N  ND1 . HIS C 1 213 ? 2.794   66.495  70.298  1.00 60.71 ? 213  HIS C ND1 1 
ATOM   6884  C  CD2 . HIS C 1 213 ? 2.437   68.236  69.028  1.00 60.22 ? 213  HIS C CD2 1 
ATOM   6885  C  CE1 . HIS C 1 213 ? 1.928   67.268  70.930  1.00 61.13 ? 213  HIS C CE1 1 
ATOM   6886  N  NE2 . HIS C 1 213 ? 1.695   68.331  70.181  1.00 60.99 ? 213  HIS C NE2 1 
ATOM   6887  N  N   . TRP C 1 214 ? 2.228   65.568  65.692  1.00 51.23 ? 214  TRP C N   1 
ATOM   6888  C  CA  . TRP C 1 214 ? 0.991   65.718  64.929  1.00 48.75 ? 214  TRP C CA  1 
ATOM   6889  C  C   . TRP C 1 214 ? 0.288   64.365  64.816  1.00 47.83 ? 214  TRP C C   1 
ATOM   6890  O  O   . TRP C 1 214 ? -0.927  64.270  64.991  1.00 46.19 ? 214  TRP C O   1 
ATOM   6891  C  CB  . TRP C 1 214 ? 1.306   66.264  63.530  1.00 49.20 ? 214  TRP C CB  1 
ATOM   6892  C  CG  . TRP C 1 214 ? 0.097   66.603  62.694  1.00 49.74 ? 214  TRP C CG  1 
ATOM   6893  C  CD1 . TRP C 1 214 ? -0.467  67.836  62.533  1.00 49.05 ? 214  TRP C CD1 1 
ATOM   6894  C  CD2 . TRP C 1 214 ? -0.683  65.699  61.897  1.00 50.00 ? 214  TRP C CD2 1 
ATOM   6895  N  NE1 . TRP C 1 214 ? -1.550  67.758  61.689  1.00 48.58 ? 214  TRP C NE1 1 
ATOM   6896  C  CE2 . TRP C 1 214 ? -1.705  66.459  61.284  1.00 50.05 ? 214  TRP C CE2 1 
ATOM   6897  C  CE3 . TRP C 1 214 ? -0.620  64.321  61.643  1.00 50.50 ? 214  TRP C CE3 1 
ATOM   6898  C  CZ2 . TRP C 1 214 ? -2.657  65.887  60.431  1.00 50.75 ? 214  TRP C CZ2 1 
ATOM   6899  C  CZ3 . TRP C 1 214 ? -1.568  63.752  60.796  1.00 51.67 ? 214  TRP C CZ3 1 
ATOM   6900  C  CH2 . TRP C 1 214 ? -2.573  64.536  60.201  1.00 51.29 ? 214  TRP C CH2 1 
ATOM   6901  N  N   . GLY C 1 215 ? 1.068   63.324  64.529  1.00 48.06 ? 215  GLY C N   1 
ATOM   6902  C  CA  . GLY C 1 215 ? 0.523   61.984  64.392  1.00 48.58 ? 215  GLY C CA  1 
ATOM   6903  C  C   . GLY C 1 215 ? -0.116  61.452  65.661  1.00 49.21 ? 215  GLY C C   1 
ATOM   6904  O  O   . GLY C 1 215 ? -1.072  60.676  65.604  1.00 50.16 ? 215  GLY C O   1 
ATOM   6905  N  N   . GLU C 1 216 ? 0.419   61.863  66.807  1.00 48.81 ? 216  GLU C N   1 
ATOM   6906  C  CA  . GLU C 1 216 ? -0.101  61.435  68.101  1.00 48.26 ? 216  GLU C CA  1 
ATOM   6907  C  C   . GLU C 1 216 ? -1.349  62.234  68.475  1.00 47.94 ? 216  GLU C C   1 
ATOM   6908  O  O   . GLU C 1 216 ? -2.186  61.768  69.250  1.00 46.69 ? 216  GLU C O   1 
ATOM   6909  C  CB  . GLU C 1 216 ? 0.976   61.593  69.176  1.00 48.18 ? 216  GLU C CB  1 
ATOM   6910  C  CG  . GLU C 1 216 ? 2.234   60.778  68.905  1.00 48.13 ? 216  GLU C CG  1 
ATOM   6911  C  CD  . GLU C 1 216 ? 3.353   61.070  69.886  1.00 47.72 ? 216  GLU C CD  1 
ATOM   6912  O  OE1 . GLU C 1 216 ? 3.781   62.241  69.974  1.00 48.54 ? 216  GLU C OE1 1 
ATOM   6913  O  OE2 . GLU C 1 216 ? 3.811   60.127  70.564  1.00 47.70 ? 216  GLU C OE2 1 
ATOM   6914  N  N   . THR C 1 217 ? -1.468  63.433  67.907  1.00 48.06 ? 217  THR C N   1 
ATOM   6915  C  CA  . THR C 1 217 ? -2.606  64.313  68.163  1.00 48.74 ? 217  THR C CA  1 
ATOM   6916  C  C   . THR C 1 217 ? -3.827  63.886  67.349  1.00 47.63 ? 217  THR C C   1 
ATOM   6917  O  O   . THR C 1 217 ? -4.957  63.940  67.835  1.00 49.06 ? 217  THR C O   1 
ATOM   6918  C  CB  . THR C 1 217 ? -2.265  65.787  67.817  1.00 49.53 ? 217  THR C CB  1 
ATOM   6919  O  OG1 . THR C 1 217 ? -1.126  66.210  68.577  1.00 50.99 ? 217  THR C OG1 1 
ATOM   6920  C  CG2 . THR C 1 217 ? -3.440  66.704  68.136  1.00 49.63 ? 217  THR C CG2 1 
ATOM   6921  N  N   . HIS C 1 218 ? -3.589  63.453  66.114  1.00 46.78 ? 218  HIS C N   1 
ATOM   6922  C  CA  . HIS C 1 218 ? -4.662  63.026  65.221  1.00 44.57 ? 218  HIS C CA  1 
ATOM   6923  C  C   . HIS C 1 218 ? -4.855  61.511  65.193  1.00 45.10 ? 218  HIS C C   1 
ATOM   6924  O  O   . HIS C 1 218 ? -3.979  60.754  65.616  1.00 45.53 ? 218  HIS C O   1 
ATOM   6925  C  CB  . HIS C 1 218 ? -4.408  63.564  63.812  1.00 43.03 ? 218  HIS C CB  1 
ATOM   6926  C  CG  . HIS C 1 218 ? -4.341  65.059  63.743  1.00 41.75 ? 218  HIS C CG  1 
ATOM   6927  N  ND1 . HIS C 1 218 ? -3.444  65.799  64.484  1.00 41.02 ? 218  HIS C ND1 1 
ATOM   6928  C  CD2 . HIS C 1 218 ? -5.070  65.953  63.034  1.00 41.68 ? 218  HIS C CD2 1 
ATOM   6929  C  CE1 . HIS C 1 218 ? -3.624  67.083  64.235  1.00 41.55 ? 218  HIS C CE1 1 
ATOM   6930  N  NE2 . HIS C 1 218 ? -4.604  67.204  63.358  1.00 42.27 ? 218  HIS C NE2 1 
ATOM   6931  N  N   . SER C 1 219 ? -6.009  61.080  64.688  1.00 45.69 ? 219  SER C N   1 
ATOM   6932  C  CA  . SER C 1 219 ? -6.351  59.661  64.607  1.00 45.73 ? 219  SER C CA  1 
ATOM   6933  C  C   . SER C 1 219 ? -5.610  58.913  63.504  1.00 45.30 ? 219  SER C C   1 
ATOM   6934  O  O   . SER C 1 219 ? -4.973  59.519  62.643  1.00 45.49 ? 219  SER C O   1 
ATOM   6935  C  CB  . SER C 1 219 ? -7.860  59.489  64.411  1.00 46.56 ? 219  SER C CB  1 
ATOM   6936  O  OG  . SER C 1 219 ? -8.276  59.991  63.151  1.00 47.59 ? 219  SER C OG  1 
ATOM   6937  N  N   . GLU C 1 220 ? -5.735  57.588  63.530  1.00 45.30 ? 220  GLU C N   1 
ATOM   6938  C  CA  . GLU C 1 220 ? -5.098  56.707  62.556  1.00 45.75 ? 220  GLU C CA  1 
ATOM   6939  C  C   . GLU C 1 220 ? -5.486  57.043  61.115  1.00 45.58 ? 220  GLU C C   1 
ATOM   6940  O  O   . GLU C 1 220 ? -4.627  57.102  60.234  1.00 46.10 ? 220  GLU C O   1 
ATOM   6941  C  CB  . GLU C 1 220 ? -5.450  55.248  62.877  1.00 46.93 ? 220  GLU C CB  1 
ATOM   6942  C  CG  . GLU C 1 220 ? -4.865  54.210  61.924  1.00 48.00 ? 220  GLU C CG  1 
ATOM   6943  C  CD  . GLU C 1 220 ? -3.348  54.259  61.836  1.00 49.42 ? 220  GLU C CD  1 
ATOM   6944  O  OE1 . GLU C 1 220 ? -2.681  54.470  62.873  1.00 49.77 ? 220  GLU C OE1 1 
ATOM   6945  O  OE2 . GLU C 1 220 ? -2.820  54.078  60.721  1.00 50.81 ? 220  GLU C OE2 1 
ATOM   6946  N  N   . ALA C 1 221 ? -6.777  57.276  60.889  1.00 45.27 ? 221  ALA C N   1 
ATOM   6947  C  CA  . ALA C 1 221 ? -7.288  57.608  59.560  1.00 44.15 ? 221  ALA C CA  1 
ATOM   6948  C  C   . ALA C 1 221 ? -6.713  58.926  59.049  1.00 43.40 ? 221  ALA C C   1 
ATOM   6949  O  O   . ALA C 1 221 ? -6.459  59.078  57.854  1.00 42.43 ? 221  ALA C O   1 
ATOM   6950  C  CB  . ALA C 1 221 ? -8.810  57.668  59.582  1.00 43.95 ? 221  ALA C CB  1 
ATOM   6951  N  N   . GLU C 1 222 ? -6.505  59.870  59.962  1.00 44.09 ? 222  GLU C N   1 
ATOM   6952  C  CA  . GLU C 1 222 ? -5.954  61.176  59.617  1.00 45.71 ? 222  GLU C CA  1 
ATOM   6953  C  C   . GLU C 1 222 ? -4.450  61.100  59.366  1.00 45.29 ? 222  GLU C C   1 
ATOM   6954  O  O   . GLU C 1 222 ? -3.910  61.857  58.557  1.00 44.84 ? 222  GLU C O   1 
ATOM   6955  C  CB  . GLU C 1 222 ? -6.251  62.189  60.725  1.00 47.91 ? 222  GLU C CB  1 
ATOM   6956  C  CG  . GLU C 1 222 ? -7.734  62.435  60.955  1.00 50.01 ? 222  GLU C CG  1 
ATOM   6957  C  CD  . GLU C 1 222 ? -7.994  63.466  62.034  1.00 50.98 ? 222  GLU C CD  1 
ATOM   6958  O  OE1 . GLU C 1 222 ? -8.030  63.088  63.223  1.00 50.46 ? 222  GLU C OE1 1 
ATOM   6959  O  OE2 . GLU C 1 222 ? -8.163  64.656  61.692  1.00 53.73 ? 222  GLU C OE2 1 
ATOM   6960  N  N   . VAL C 1 223 ? -3.779  60.195  60.075  1.00 44.90 ? 223  VAL C N   1 
ATOM   6961  C  CA  . VAL C 1 223 ? -2.338  60.010  59.922  1.00 44.08 ? 223  VAL C CA  1 
ATOM   6962  C  C   . VAL C 1 223 ? -2.063  59.297  58.602  1.00 43.21 ? 223  VAL C C   1 
ATOM   6963  O  O   . VAL C 1 223 ? -1.217  59.731  57.819  1.00 43.16 ? 223  VAL C O   1 
ATOM   6964  C  CB  . VAL C 1 223 ? -1.735  59.187  61.090  1.00 44.12 ? 223  VAL C CB  1 
ATOM   6965  C  CG1 . VAL C 1 223 ? -0.243  58.966  60.872  1.00 43.97 ? 223  VAL C CG1 1 
ATOM   6966  C  CG2 . VAL C 1 223 ? -1.963  59.904  62.412  1.00 42.87 ? 223  VAL C CG2 1 
ATOM   6967  N  N   . ARG C 1 224 ? -2.805  58.221  58.352  1.00 41.88 ? 224  ARG C N   1 
ATOM   6968  C  CA  . ARG C 1 224 ? -2.660  57.442  57.127  1.00 41.51 ? 224  ARG C CA  1 
ATOM   6969  C  C   . ARG C 1 224 ? -2.866  58.318  55.895  1.00 42.41 ? 224  ARG C C   1 
ATOM   6970  O  O   . ARG C 1 224 ? -2.081  58.263  54.949  1.00 43.13 ? 224  ARG C O   1 
ATOM   6971  C  CB  . ARG C 1 224 ? -3.655  56.278  57.117  1.00 40.74 ? 224  ARG C CB  1 
ATOM   6972  C  CG  . ARG C 1 224 ? -3.613  55.426  55.855  1.00 40.63 ? 224  ARG C CG  1 
ATOM   6973  C  CD  . ARG C 1 224 ? -4.552  54.235  55.957  1.00 40.47 ? 224  ARG C CD  1 
ATOM   6974  N  NE  . ARG C 1 224 ? -4.629  53.483  54.706  1.00 39.39 ? 224  ARG C NE  1 
ATOM   6975  C  CZ  . ARG C 1 224 ? -5.266  52.324  54.565  1.00 39.28 ? 224  ARG C CZ  1 
ATOM   6976  N  NH1 . ARG C 1 224 ? -5.884  51.769  55.599  1.00 39.08 ? 224  ARG C NH1 1 
ATOM   6977  N  NH2 . ARG C 1 224 ? -5.302  51.728  53.381  1.00 39.53 ? 224  ARG C NH2 1 
ATOM   6978  N  N   . GLU C 1 225 ? -3.904  59.150  55.934  1.00 43.11 ? 225  GLU C N   1 
ATOM   6979  C  CA  . GLU C 1 225 ? -4.228  60.053  54.832  1.00 43.83 ? 225  GLU C CA  1 
ATOM   6980  C  C   . GLU C 1 225 ? -3.061  60.990  54.520  1.00 42.83 ? 225  GLU C C   1 
ATOM   6981  O  O   . GLU C 1 225 ? -2.737  61.219  53.353  1.00 42.47 ? 225  GLU C O   1 
ATOM   6982  C  CB  . GLU C 1 225 ? -5.491  60.856  55.174  1.00 46.63 ? 225  GLU C CB  1 
ATOM   6983  C  CG  . GLU C 1 225 ? -6.002  61.791  54.075  1.00 50.93 ? 225  GLU C CG  1 
ATOM   6984  C  CD  . GLU C 1 225 ? -5.275  63.129  54.031  1.00 52.81 ? 225  GLU C CD  1 
ATOM   6985  O  OE1 . GLU C 1 225 ? -5.073  63.740  55.104  1.00 53.67 ? 225  GLU C OE1 1 
ATOM   6986  O  OE2 . GLU C 1 225 ? -4.909  63.568  52.920  1.00 53.44 ? 225  GLU C OE2 1 
ATOM   6987  N  N   . LEU C 1 226 ? -2.435  61.522  55.568  1.00 41.36 ? 226  LEU C N   1 
ATOM   6988  C  CA  . LEU C 1 226 ? -1.304  62.433  55.413  1.00 38.54 ? 226  LEU C CA  1 
ATOM   6989  C  C   . LEU C 1 226 ? -0.067  61.720  54.878  1.00 37.06 ? 226  LEU C C   1 
ATOM   6990  O  O   . LEU C 1 226 ? 0.637   62.250  54.019  1.00 36.38 ? 226  LEU C O   1 
ATOM   6991  C  CB  . LEU C 1 226 ? -0.966  63.103  56.749  1.00 38.28 ? 226  LEU C CB  1 
ATOM   6992  C  CG  . LEU C 1 226 ? 0.220   64.075  56.729  1.00 38.09 ? 226  LEU C CG  1 
ATOM   6993  C  CD1 . LEU C 1 226 ? -0.127  65.306  55.906  1.00 38.08 ? 226  LEU C CD1 1 
ATOM   6994  C  CD2 . LEU C 1 226 ? 0.603   64.471  58.141  1.00 36.60 ? 226  LEU C CD2 1 
ATOM   6995  N  N   . LEU C 1 227 ? 0.198   60.523  55.392  1.00 35.69 ? 227  LEU C N   1 
ATOM   6996  C  CA  . LEU C 1 227 ? 1.360   59.748  54.969  1.00 35.31 ? 227  LEU C CA  1 
ATOM   6997  C  C   . LEU C 1 227 ? 1.252   59.263  53.527  1.00 35.16 ? 227  LEU C C   1 
ATOM   6998  O  O   . LEU C 1 227 ? 2.266   59.047  52.863  1.00 33.51 ? 227  LEU C O   1 
ATOM   6999  C  CB  . LEU C 1 227 ? 1.592   58.565  55.912  1.00 34.48 ? 227  LEU C CB  1 
ATOM   7000  C  CG  . LEU C 1 227 ? 1.797   58.894  57.395  1.00 34.11 ? 227  LEU C CG  1 
ATOM   7001  C  CD1 . LEU C 1 227 ? 2.200   57.634  58.144  1.00 33.39 ? 227  LEU C CD1 1 
ATOM   7002  C  CD2 . LEU C 1 227 ? 2.857   59.974  57.567  1.00 33.73 ? 227  LEU C CD2 1 
ATOM   7003  N  N   . GLU C 1 228 ? 0.021   59.117  53.040  1.00 37.10 ? 228  GLU C N   1 
ATOM   7004  C  CA  . GLU C 1 228 ? -0.223  58.668  51.672  1.00 37.93 ? 228  GLU C CA  1 
ATOM   7005  C  C   . GLU C 1 228 ? 0.164   59.721  50.633  1.00 39.88 ? 228  GLU C C   1 
ATOM   7006  O  O   . GLU C 1 228 ? 0.040   59.490  49.429  1.00 41.28 ? 228  GLU C O   1 
ATOM   7007  C  CB  . GLU C 1 228 ? -1.686  58.250  51.492  1.00 37.46 ? 228  GLU C CB  1 
ATOM   7008  C  CG  . GLU C 1 228 ? -2.049  56.964  52.223  1.00 38.08 ? 228  GLU C CG  1 
ATOM   7009  C  CD  . GLU C 1 228 ? -3.499  56.550  52.034  1.00 38.87 ? 228  GLU C CD  1 
ATOM   7010  O  OE1 . GLU C 1 228 ? -4.381  57.435  52.003  1.00 39.87 ? 228  GLU C OE1 1 
ATOM   7011  O  OE2 . GLU C 1 228 ? -3.758  55.332  51.929  1.00 39.90 ? 228  GLU C OE2 1 
ATOM   7012  N  N   . GLN C 1 229 ? 0.637   60.873  51.106  1.00 40.69 ? 229  GLN C N   1 
ATOM   7013  C  CA  . GLN C 1 229 ? 1.067   61.951  50.221  1.00 40.95 ? 229  GLN C CA  1 
ATOM   7014  C  C   . GLN C 1 229 ? 2.470   61.661  49.690  1.00 40.40 ? 229  GLN C C   1 
ATOM   7015  O  O   . GLN C 1 229 ? 2.918   62.271  48.719  1.00 40.94 ? 229  GLN C O   1 
ATOM   7016  C  CB  . GLN C 1 229 ? 1.029   63.299  50.946  1.00 42.03 ? 229  GLN C CB  1 
ATOM   7017  C  CG  . GLN C 1 229 ? -0.355  63.689  51.455  1.00 43.99 ? 229  GLN C CG  1 
ATOM   7018  C  CD  . GLN C 1 229 ? -1.417  63.647  50.370  1.00 44.89 ? 229  GLN C CD  1 
ATOM   7019  O  OE1 . GLN C 1 229 ? -1.366  64.410  49.405  1.00 46.37 ? 229  GLN C OE1 1 
ATOM   7020  N  NE2 . GLN C 1 229 ? -2.385  62.751  50.525  1.00 44.62 ? 229  GLN C NE2 1 
ATOM   7021  N  N   . ASN C 1 230 ? 3.163   60.740  50.357  1.00 38.75 ? 230  ASN C N   1 
ATOM   7022  C  CA  . ASN C 1 230 ? 4.500   60.317  49.957  1.00 36.93 ? 230  ASN C CA  1 
ATOM   7023  C  C   . ASN C 1 230 ? 4.326   58.945  49.308  1.00 36.80 ? 230  ASN C C   1 
ATOM   7024  O  O   . ASN C 1 230 ? 4.233   57.931  49.999  1.00 38.13 ? 230  ASN C O   1 
ATOM   7025  C  CB  . ASN C 1 230 ? 5.419   60.210  51.179  1.00 35.07 ? 230  ASN C CB  1 
ATOM   7026  C  CG  . ASN C 1 230 ? 6.821   59.745  50.820  1.00 33.31 ? 230  ASN C CG  1 
ATOM   7027  O  OD1 . ASN C 1 230 ? 7.336   60.056  49.748  1.00 34.03 ? 230  ASN C OD1 1 
ATOM   7028  N  ND2 . ASN C 1 230 ? 7.444   58.993  51.720  1.00 32.83 ? 230  ASN C ND2 1 
ATOM   7029  N  N   . PRO C 1 231 ? 4.261   58.903  47.967  1.00 36.19 ? 231  PRO C N   1 
ATOM   7030  C  CA  . PRO C 1 231 ? 4.088   57.659  47.207  1.00 35.42 ? 231  PRO C CA  1 
ATOM   7031  C  C   . PRO C 1 231 ? 5.238   56.657  47.318  1.00 33.55 ? 231  PRO C C   1 
ATOM   7032  O  O   . PRO C 1 231 ? 5.070   55.479  46.997  1.00 32.96 ? 231  PRO C O   1 
ATOM   7033  C  CB  . PRO C 1 231 ? 3.909   58.163  45.775  1.00 36.74 ? 231  PRO C CB  1 
ATOM   7034  C  CG  . PRO C 1 231 ? 4.746   59.399  45.751  1.00 36.76 ? 231  PRO C CG  1 
ATOM   7035  C  CD  . PRO C 1 231 ? 4.380   60.056  47.057  1.00 36.12 ? 231  PRO C CD  1 
ATOM   7036  N  N   . SER C 1 232 ? 6.396   57.125  47.778  1.00 32.26 ? 232  SER C N   1 
ATOM   7037  C  CA  . SER C 1 232 ? 7.572   56.273  47.930  1.00 29.15 ? 232  SER C CA  1 
ATOM   7038  C  C   . SER C 1 232 ? 7.447   55.338  49.134  1.00 27.24 ? 232  SER C C   1 
ATOM   7039  O  O   . SER C 1 232 ? 6.910   55.719  50.175  1.00 26.40 ? 232  SER C O   1 
ATOM   7040  C  CB  . SER C 1 232 ? 8.832   57.131  48.055  1.00 27.54 ? 232  SER C CB  1 
ATOM   7041  O  OG  . SER C 1 232 ? 9.998   56.331  48.023  1.00 28.26 ? 232  SER C OG  1 
ATOM   7042  N  N   . PHE C 1 233 ? 7.956   54.118  48.980  1.00 25.81 ? 233  PHE C N   1 
ATOM   7043  C  CA  . PHE C 1 233 ? 7.905   53.107  50.033  1.00 24.37 ? 233  PHE C CA  1 
ATOM   7044  C  C   . PHE C 1 233 ? 9.202   52.295  50.009  1.00 24.47 ? 233  PHE C C   1 
ATOM   7045  O  O   . PHE C 1 233 ? 9.639   51.841  48.950  1.00 23.22 ? 233  PHE C O   1 
ATOM   7046  C  CB  . PHE C 1 233 ? 6.700   52.185  49.808  1.00 22.40 ? 233  PHE C CB  1 
ATOM   7047  C  CG  . PHE C 1 233 ? 6.341   51.341  50.999  1.00 20.32 ? 233  PHE C CG  1 
ATOM   7048  C  CD1 . PHE C 1 233 ? 5.461   51.819  51.963  1.00 19.21 ? 233  PHE C CD1 1 
ATOM   7049  C  CD2 . PHE C 1 233 ? 6.864   50.061  51.146  1.00 20.46 ? 233  PHE C CD2 1 
ATOM   7050  C  CE1 . PHE C 1 233 ? 5.107   51.035  53.057  1.00 20.02 ? 233  PHE C CE1 1 
ATOM   7051  C  CE2 . PHE C 1 233 ? 6.516   49.269  52.237  1.00 21.14 ? 233  PHE C CE2 1 
ATOM   7052  C  CZ  . PHE C 1 233 ? 5.635   49.758  53.194  1.00 20.79 ? 233  PHE C CZ  1 
ATOM   7053  N  N   . VAL C 1 234 ? 9.806   52.116  51.181  1.00 24.31 ? 234  VAL C N   1 
ATOM   7054  C  CA  . VAL C 1 234 ? 11.060  51.375  51.310  1.00 24.21 ? 234  VAL C CA  1 
ATOM   7055  C  C   . VAL C 1 234 ? 10.882  49.946  51.831  1.00 22.64 ? 234  VAL C C   1 
ATOM   7056  O  O   . VAL C 1 234 ? 10.063  49.688  52.717  1.00 22.37 ? 234  VAL C O   1 
ATOM   7057  C  CB  . VAL C 1 234 ? 12.067  52.140  52.217  1.00 24.91 ? 234  VAL C CB  1 
ATOM   7058  C  CG1 . VAL C 1 234 ? 13.301  51.291  52.500  1.00 25.11 ? 234  VAL C CG1 1 
ATOM   7059  C  CG2 . VAL C 1 234 ? 12.479  53.446  51.552  1.00 23.86 ? 234  VAL C CG2 1 
ATOM   7060  N  N   . PHE C 1 235 ? 11.654  49.027  51.255  1.00 21.40 ? 235  PHE C N   1 
ATOM   7061  C  CA  . PHE C 1 235 ? 11.631  47.616  51.633  1.00 20.85 ? 235  PHE C CA  1 
ATOM   7062  C  C   . PHE C 1 235 ? 12.922  47.288  52.376  1.00 20.33 ? 235  PHE C C   1 
ATOM   7063  O  O   . PHE C 1 235 ? 14.000  47.747  51.995  1.00 24.12 ? 235  PHE C O   1 
ATOM   7064  C  CB  . PHE C 1 235 ? 11.484  46.738  50.389  1.00 18.46 ? 235  PHE C CB  1 
ATOM   7065  C  CG  . PHE C 1 235 ? 10.252  47.035  49.589  1.00 18.61 ? 235  PHE C CG  1 
ATOM   7066  C  CD1 . PHE C 1 235 ? 8.995   46.691  50.073  1.00 19.21 ? 235  PHE C CD1 1 
ATOM   7067  C  CD2 . PHE C 1 235 ? 10.342  47.692  48.368  1.00 18.75 ? 235  PHE C CD2 1 
ATOM   7068  C  CE1 . PHE C 1 235 ? 7.846   46.998  49.354  1.00 20.07 ? 235  PHE C CE1 1 
ATOM   7069  C  CE2 . PHE C 1 235 ? 9.198   48.005  47.641  1.00 19.62 ? 235  PHE C CE2 1 
ATOM   7070  C  CZ  . PHE C 1 235 ? 7.948   47.659  48.134  1.00 20.88 ? 235  PHE C CZ  1 
ATOM   7071  N  N   . PHE C 1 236 ? 12.812  46.482  53.427  1.00 19.31 ? 236  PHE C N   1 
ATOM   7072  C  CA  . PHE C 1 236 ? 13.969  46.133  54.245  1.00 17.91 ? 236  PHE C CA  1 
ATOM   7073  C  C   . PHE C 1 236 ? 14.409  44.676  54.168  1.00 17.49 ? 236  PHE C C   1 
ATOM   7074  O  O   . PHE C 1 236 ? 13.716  43.828  53.606  1.00 16.07 ? 236  PHE C O   1 
ATOM   7075  C  CB  . PHE C 1 236 ? 13.695  46.503  55.706  1.00 16.48 ? 236  PHE C CB  1 
ATOM   7076  C  CG  . PHE C 1 236 ? 13.212  47.914  55.895  1.00 15.85 ? 236  PHE C CG  1 
ATOM   7077  C  CD1 . PHE C 1 236 ? 14.116  48.964  56.013  1.00 14.47 ? 236  PHE C CD1 1 
ATOM   7078  C  CD2 . PHE C 1 236 ? 11.849  48.195  55.944  1.00 15.73 ? 236  PHE C CD2 1 
ATOM   7079  C  CE1 . PHE C 1 236 ? 13.670  50.275  56.175  1.00 18.40 ? 236  PHE C CE1 1 
ATOM   7080  C  CE2 . PHE C 1 236 ? 11.393  49.501  56.105  1.00 19.12 ? 236  PHE C CE2 1 
ATOM   7081  C  CZ  . PHE C 1 236 ? 12.306  50.543  56.221  1.00 16.91 ? 236  PHE C CZ  1 
ATOM   7082  N  N   . LYS C 1 237 ? 15.585  44.408  54.732  1.00 18.93 ? 237  LYS C N   1 
ATOM   7083  C  CA  . LYS C 1 237 ? 16.157  43.067  54.778  1.00 19.13 ? 237  LYS C CA  1 
ATOM   7084  C  C   . LYS C 1 237 ? 16.777  42.839  56.152  1.00 20.27 ? 237  LYS C C   1 
ATOM   7085  O  O   . LYS C 1 237 ? 17.736  43.514  56.531  1.00 21.13 ? 237  LYS C O   1 
ATOM   7086  C  CB  . LYS C 1 237 ? 17.227  42.879  53.696  1.00 18.46 ? 237  LYS C CB  1 
ATOM   7087  C  CG  . LYS C 1 237 ? 17.828  41.475  53.684  1.00 17.24 ? 237  LYS C CG  1 
ATOM   7088  C  CD  . LYS C 1 237 ? 18.903  41.305  52.624  1.00 16.95 ? 237  LYS C CD  1 
ATOM   7089  C  CE  . LYS C 1 237 ? 19.451  39.884  52.638  1.00 18.53 ? 237  LYS C CE  1 
ATOM   7090  N  NZ  . LYS C 1 237 ? 20.513  39.668  51.619  1.00 21.84 ? 237  LYS C NZ  1 
ATOM   7091  N  N   . PRO C 1 238 ? 16.220  41.890  56.923  1.00 22.14 ? 238  PRO C N   1 
ATOM   7092  C  CA  . PRO C 1 238 ? 16.683  41.536  58.269  1.00 23.48 ? 238  PRO C CA  1 
ATOM   7093  C  C   . PRO C 1 238 ? 18.124  41.037  58.294  1.00 24.57 ? 238  PRO C C   1 
ATOM   7094  O  O   . PRO C 1 238 ? 18.520  40.208  57.471  1.00 25.56 ? 238  PRO C O   1 
ATOM   7095  C  CB  . PRO C 1 238 ? 15.713  40.428  58.679  1.00 23.57 ? 238  PRO C CB  1 
ATOM   7096  C  CG  . PRO C 1 238 ? 14.478  40.761  57.930  1.00 21.90 ? 238  PRO C CG  1 
ATOM   7097  C  CD  . PRO C 1 238 ? 15.014  41.121  56.575  1.00 21.93 ? 238  PRO C CD  1 
ATOM   7098  N  N   . GLN C 1 239 ? 18.902  41.559  59.238  1.00 26.39 ? 239  GLN C N   1 
ATOM   7099  C  CA  . GLN C 1 239 ? 20.304  41.176  59.402  1.00 28.53 ? 239  GLN C CA  1 
ATOM   7100  C  C   . GLN C 1 239 ? 20.529  40.501  60.760  1.00 30.68 ? 239  GLN C C   1 
ATOM   7101  O  O   . GLN C 1 239 ? 21.595  39.940  61.015  1.00 31.21 ? 239  GLN C O   1 
ATOM   7102  C  CB  . GLN C 1 239 ? 21.214  42.405  59.273  1.00 27.35 ? 239  GLN C CB  1 
ATOM   7103  C  CG  . GLN C 1 239 ? 21.127  43.136  57.933  1.00 24.50 ? 239  GLN C CG  1 
ATOM   7104  C  CD  . GLN C 1 239 ? 21.501  42.261  56.748  1.00 22.18 ? 239  GLN C CD  1 
ATOM   7105  O  OE1 . GLN C 1 239 ? 22.350  41.376  56.853  1.00 21.98 ? 239  GLN C OE1 1 
ATOM   7106  N  NE2 . GLN C 1 239 ? 20.866  42.511  55.610  1.00 21.51 ? 239  GLN C NE2 1 
ATOM   7107  N  N   . SER C 1 240 ? 19.508  40.573  61.617  1.00 33.07 ? 240  SER C N   1 
ATOM   7108  C  CA  . SER C 1 240 ? 19.498  39.994  62.966  1.00 34.21 ? 240  SER C CA  1 
ATOM   7109  C  C   . SER C 1 240 ? 20.669  40.360  63.880  1.00 35.24 ? 240  SER C C   1 
ATOM   7110  O  O   . SER C 1 240 ? 21.652  39.627  64.001  1.00 38.54 ? 240  SER C O   1 
ATOM   7111  C  CB  . SER C 1 240 ? 19.275  38.481  62.924  1.00 34.35 ? 240  SER C CB  1 
ATOM   7112  O  OG  . SER C 1 240 ? 20.415  37.792  62.470  1.00 35.93 ? 240  SER C OG  1 
ATOM   7113  N  N   . PHE C 1 241 ? 20.542  41.528  64.498  1.00 34.66 ? 241  PHE C N   1 
ATOM   7114  C  CA  . PHE C 1 241 ? 21.527  42.090  65.420  1.00 34.34 ? 241  PHE C CA  1 
ATOM   7115  C  C   . PHE C 1 241 ? 22.894  42.340  64.808  1.00 32.18 ? 241  PHE C C   1 
ATOM   7116  O  O   . PHE C 1 241 ? 23.913  41.838  65.284  1.00 31.57 ? 241  PHE C O   1 
ATOM   7117  C  CB  . PHE C 1 241 ? 21.652  41.261  66.703  1.00 36.09 ? 241  PHE C CB  1 
ATOM   7118  C  CG  . PHE C 1 241 ? 22.227  42.035  67.863  1.00 37.37 ? 241  PHE C CG  1 
ATOM   7119  C  CD1 . PHE C 1 241 ? 21.703  43.280  68.210  1.00 39.44 ? 241  PHE C CD1 1 
ATOM   7120  C  CD2 . PHE C 1 241 ? 23.291  41.531  68.601  1.00 37.88 ? 241  PHE C CD2 1 
ATOM   7121  C  CE1 . PHE C 1 241 ? 22.232  44.010  69.273  1.00 40.94 ? 241  PHE C CE1 1 
ATOM   7122  C  CE2 . PHE C 1 241 ? 23.827  42.255  69.667  1.00 39.60 ? 241  PHE C CE2 1 
ATOM   7123  C  CZ  . PHE C 1 241 ? 23.297  43.495  70.003  1.00 40.33 ? 241  PHE C CZ  1 
ATOM   7124  N  N   . ALA C 1 242 ? 22.897  43.131  63.745  1.00 30.82 ? 242  ALA C N   1 
ATOM   7125  C  CA  . ALA C 1 242 ? 24.118  43.501  63.052  1.00 28.59 ? 242  ALA C CA  1 
ATOM   7126  C  C   . ALA C 1 242 ? 24.255  45.011  63.207  1.00 29.03 ? 242  ALA C C   1 
ATOM   7127  O  O   . ALA C 1 242 ? 23.255  45.717  63.337  1.00 29.63 ? 242  ALA C O   1 
ATOM   7128  C  CB  . ALA C 1 242 ? 24.025  43.121  61.583  1.00 27.93 ? 242  ALA C CB  1 
ATOM   7129  N  N   . PRO C 1 243 ? 25.496  45.525  63.227  1.00 29.12 ? 243  PRO C N   1 
ATOM   7130  C  CA  . PRO C 1 243 ? 25.702  46.970  63.372  1.00 29.48 ? 243  PRO C CA  1 
ATOM   7131  C  C   . PRO C 1 243 ? 25.088  47.758  62.215  1.00 29.91 ? 243  PRO C C   1 
ATOM   7132  O  O   . PRO C 1 243 ? 24.948  47.240  61.104  1.00 30.87 ? 243  PRO C O   1 
ATOM   7133  C  CB  . PRO C 1 243 ? 27.226  47.092  63.401  1.00 28.78 ? 243  PRO C CB  1 
ATOM   7134  C  CG  . PRO C 1 243 ? 27.678  45.927  62.578  1.00 29.29 ? 243  PRO C CG  1 
ATOM   7135  C  CD  . PRO C 1 243 ? 26.783  44.827  63.077  1.00 29.31 ? 243  PRO C CD  1 
ATOM   7136  N  N   . VAL C 1 244 ? 24.694  48.998  62.493  1.00 28.46 ? 244  VAL C N   1 
ATOM   7137  C  CA  . VAL C 1 244 ? 24.091  49.857  61.481  1.00 26.39 ? 244  VAL C CA  1 
ATOM   7138  C  C   . VAL C 1 244 ? 25.082  50.129  60.359  1.00 26.94 ? 244  VAL C C   1 
ATOM   7139  O  O   . VAL C 1 244 ? 26.099  50.788  60.566  1.00 29.76 ? 244  VAL C O   1 
ATOM   7140  C  CB  . VAL C 1 244 ? 23.629  51.200  62.081  1.00 25.00 ? 244  VAL C CB  1 
ATOM   7141  C  CG1 . VAL C 1 244 ? 22.991  52.070  61.005  1.00 23.46 ? 244  VAL C CG1 1 
ATOM   7142  C  CG2 . VAL C 1 244 ? 22.651  50.955  63.211  1.00 24.62 ? 244  VAL C CG2 1 
ATOM   7143  N  N   . LYS C 1 245 ? 24.783  49.598  59.178  1.00 26.11 ? 245  LYS C N   1 
ATOM   7144  C  CA  . LYS C 1 245 ? 25.638  49.774  58.012  1.00 24.06 ? 245  LYS C CA  1 
ATOM   7145  C  C   . LYS C 1 245 ? 24.928  50.575  56.925  1.00 24.00 ? 245  LYS C C   1 
ATOM   7146  O  O   . LYS C 1 245 ? 23.710  50.479  56.762  1.00 22.44 ? 245  LYS C O   1 
ATOM   7147  C  CB  . LYS C 1 245 ? 26.074  48.413  57.463  1.00 22.49 ? 245  LYS C CB  1 
ATOM   7148  C  CG  . LYS C 1 245 ? 26.885  47.583  58.446  1.00 20.52 ? 245  LYS C CG  1 
ATOM   7149  C  CD  . LYS C 1 245 ? 27.332  46.268  57.837  1.00 19.25 ? 245  LYS C CD  1 
ATOM   7150  C  CE  . LYS C 1 245 ? 28.185  45.480  58.816  1.00 19.23 ? 245  LYS C CE  1 
ATOM   7151  N  NZ  . LYS C 1 245 ? 28.744  44.243  58.210  1.00 21.71 ? 245  LYS C NZ  1 
ATOM   7152  N  N   . GLY C 1 246 ? 25.698  51.383  56.201  1.00 24.44 ? 246  GLY C N   1 
ATOM   7153  C  CA  . GLY C 1 246 ? 25.137  52.190  55.134  1.00 25.75 ? 246  GLY C CA  1 
ATOM   7154  C  C   . GLY C 1 246 ? 25.426  51.597  53.770  1.00 26.26 ? 246  GLY C C   1 
ATOM   7155  O  O   . GLY C 1 246 ? 25.498  50.377  53.619  1.00 26.47 ? 246  GLY C O   1 
ATOM   7156  N  N   . ALA C 1 247 ? 25.606  52.463  52.778  1.00 26.51 ? 247  ALA C N   1 
ATOM   7157  C  CA  . ALA C 1 247 ? 25.893  52.029  51.415  1.00 28.10 ? 247  ALA C CA  1 
ATOM   7158  C  C   . ALA C 1 247 ? 27.275  51.389  51.296  1.00 28.87 ? 247  ALA C C   1 
ATOM   7159  O  O   . ALA C 1 247 ? 27.471  50.463  50.507  1.00 29.32 ? 247  ALA C O   1 
ATOM   7160  C  CB  . ALA C 1 247 ? 25.774  53.203  50.459  1.00 29.15 ? 247  ALA C CB  1 
ATOM   7161  N  N   . SER C 1 248 ? 28.225  51.883  52.087  1.00 29.03 ? 248  SER C N   1 
ATOM   7162  C  CA  . SER C 1 248 ? 29.592  51.370  52.075  1.00 29.25 ? 248  SER C CA  1 
ATOM   7163  C  C   . SER C 1 248 ? 29.742  50.044  52.820  1.00 29.31 ? 248  SER C C   1 
ATOM   7164  O  O   . SER C 1 248 ? 30.829  49.460  52.840  1.00 30.36 ? 248  SER C O   1 
ATOM   7165  C  CB  . SER C 1 248 ? 30.553  52.405  52.667  1.00 29.32 ? 248  SER C CB  1 
ATOM   7166  O  OG  . SER C 1 248 ? 30.571  53.590  51.893  1.00 29.57 ? 248  SER C OG  1 
ATOM   7167  N  N   . ALA C 1 249 ? 28.651  49.577  53.426  1.00 27.99 ? 249  ALA C N   1 
ATOM   7168  C  CA  . ALA C 1 249 ? 28.635  48.322  54.181  1.00 26.73 ? 249  ALA C CA  1 
ATOM   7169  C  C   . ALA C 1 249 ? 29.601  48.357  55.366  1.00 26.50 ? 249  ALA C C   1 
ATOM   7170  O  O   . ALA C 1 249 ? 30.190  47.341  55.739  1.00 27.08 ? 249  ALA C O   1 
ATOM   7171  C  CB  . ALA C 1 249 ? 28.950  47.141  53.263  1.00 25.96 ? 249  ALA C CB  1 
ATOM   7172  N  N   . VAL C 1 250 ? 29.759  49.543  55.945  1.00 27.21 ? 250  VAL C N   1 
ATOM   7173  C  CA  . VAL C 1 250 ? 30.639  49.748  57.090  1.00 26.49 ? 250  VAL C CA  1 
ATOM   7174  C  C   . VAL C 1 250 ? 29.801  50.268  58.256  1.00 25.65 ? 250  VAL C C   1 
ATOM   7175  O  O   . VAL C 1 250 ? 29.010  51.198  58.091  1.00 25.92 ? 250  VAL C O   1 
ATOM   7176  C  CB  . VAL C 1 250 ? 31.757  50.778  56.763  1.00 25.31 ? 250  VAL C CB  1 
ATOM   7177  C  CG1 . VAL C 1 250 ? 32.653  50.998  57.972  1.00 24.99 ? 250  VAL C CG1 1 
ATOM   7178  C  CG2 . VAL C 1 250 ? 32.583  50.307  55.580  1.00 24.36 ? 250  VAL C CG2 1 
ATOM   7179  N  N   . PRO C 1 251 ? 29.933  49.646  59.441  1.00 24.55 ? 251  PRO C N   1 
ATOM   7180  C  CA  . PRO C 1 251 ? 29.176  50.069  60.624  1.00 25.18 ? 251  PRO C CA  1 
ATOM   7181  C  C   . PRO C 1 251 ? 29.370  51.549  60.954  1.00 24.92 ? 251  PRO C C   1 
ATOM   7182  O  O   . PRO C 1 251 ? 30.485  52.011  61.202  1.00 25.16 ? 251  PRO C O   1 
ATOM   7183  C  CB  . PRO C 1 251 ? 29.702  49.143  61.728  1.00 24.17 ? 251  PRO C CB  1 
ATOM   7184  C  CG  . PRO C 1 251 ? 31.026  48.657  61.204  1.00 25.25 ? 251  PRO C CG  1 
ATOM   7185  C  CD  . PRO C 1 251 ? 30.759  48.468  59.746  1.00 24.26 ? 251  PRO C CD  1 
ATOM   7186  N  N   . LEU C 1 252 ? 28.262  52.284  60.916  1.00 24.33 ? 252  LEU C N   1 
ATOM   7187  C  CA  . LEU C 1 252 ? 28.239  53.718  61.176  1.00 23.66 ? 252  LEU C CA  1 
ATOM   7188  C  C   . LEU C 1 252 ? 28.335  54.072  62.657  1.00 24.52 ? 252  LEU C C   1 
ATOM   7189  O  O   . LEU C 1 252 ? 27.691  53.445  63.498  1.00 26.25 ? 252  LEU C O   1 
ATOM   7190  C  CB  . LEU C 1 252 ? 26.960  54.322  60.586  1.00 21.00 ? 252  LEU C CB  1 
ATOM   7191  C  CG  . LEU C 1 252 ? 26.715  54.120  59.087  1.00 17.51 ? 252  LEU C CG  1 
ATOM   7192  C  CD1 . LEU C 1 252 ? 25.303  54.540  58.726  1.00 13.98 ? 252  LEU C CD1 1 
ATOM   7193  C  CD2 . LEU C 1 252 ? 27.736  54.901  58.278  1.00 19.54 ? 252  LEU C CD2 1 
ATOM   7194  N  N   . VAL C 1 253 ? 29.147  55.081  62.963  1.00 26.27 ? 253  VAL C N   1 
ATOM   7195  C  CA  . VAL C 1 253 ? 29.330  55.549  64.334  1.00 26.74 ? 253  VAL C CA  1 
ATOM   7196  C  C   . VAL C 1 253 ? 28.605  56.881  64.518  1.00 27.64 ? 253  VAL C C   1 
ATOM   7197  O  O   . VAL C 1 253 ? 28.606  57.728  63.621  1.00 28.96 ? 253  VAL C O   1 
ATOM   7198  C  CB  . VAL C 1 253 ? 30.830  55.715  64.686  1.00 25.97 ? 253  VAL C CB  1 
ATOM   7199  C  CG1 . VAL C 1 253 ? 30.990  56.294  66.085  1.00 27.09 ? 253  VAL C CG1 1 
ATOM   7200  C  CG2 . VAL C 1 253 ? 31.540  54.373  64.602  1.00 26.99 ? 253  VAL C CG2 1 
ATOM   7201  N  N   . GLY C 1 254 ? 27.982  57.050  65.683  1.00 27.82 ? 254  GLY C N   1 
ATOM   7202  C  CA  . GLY C 1 254 ? 27.245  58.265  65.982  1.00 28.68 ? 254  GLY C CA  1 
ATOM   7203  C  C   . GLY C 1 254 ? 28.039  59.552  65.860  1.00 30.21 ? 254  GLY C C   1 
ATOM   7204  O  O   . GLY C 1 254 ? 28.996  59.778  66.602  1.00 29.49 ? 254  GLY C O   1 
ATOM   7205  N  N   . ARG C 1 255 ? 27.629  60.389  64.908  1.00 30.97 ? 255  ARG C N   1 
ATOM   7206  C  CA  . ARG C 1 255 ? 28.257  61.684  64.638  1.00 30.32 ? 255  ARG C CA  1 
ATOM   7207  C  C   . ARG C 1 255 ? 29.735  61.628  64.255  1.00 29.68 ? 255  ARG C C   1 
ATOM   7208  O  O   . ARG C 1 255 ? 30.470  62.603  64.419  1.00 29.65 ? 255  ARG C O   1 
ATOM   7209  C  CB  . ARG C 1 255 ? 28.027  62.644  65.808  1.00 29.44 ? 255  ARG C CB  1 
ATOM   7210  C  CG  . ARG C 1 255 ? 26.602  63.165  65.891  1.00 27.29 ? 255  ARG C CG  1 
ATOM   7211  C  CD  . ARG C 1 255 ? 26.361  63.919  67.182  1.00 27.18 ? 255  ARG C CD  1 
ATOM   7212  N  NE  . ARG C 1 255 ? 26.394  63.029  68.338  1.00 28.25 ? 255  ARG C NE  1 
ATOM   7213  C  CZ  . ARG C 1 255 ? 26.330  63.438  69.601  1.00 30.18 ? 255  ARG C CZ  1 
ATOM   7214  N  NH1 . ARG C 1 255 ? 26.231  64.731  69.882  1.00 31.08 ? 255  ARG C NH1 1 
ATOM   7215  N  NH2 . ARG C 1 255 ? 26.357  62.549  70.586  1.00 31.42 ? 255  ARG C NH2 1 
ATOM   7216  N  N   . ALA C 1 256 ? 30.153  60.484  63.726  1.00 29.67 ? 256  ALA C N   1 
ATOM   7217  C  CA  . ALA C 1 256 ? 31.527  60.284  63.285  1.00 29.21 ? 256  ALA C CA  1 
ATOM   7218  C  C   . ALA C 1 256 ? 31.503  59.836  61.826  1.00 29.10 ? 256  ALA C C   1 
ATOM   7219  O  O   . ALA C 1 256 ? 32.532  59.471  61.255  1.00 30.16 ? 256  ALA C O   1 
ATOM   7220  C  CB  . ALA C 1 256 ? 32.214  59.241  64.152  1.00 28.18 ? 256  ALA C CB  1 
ATOM   7221  N  N   . SER C 1 257 ? 30.313  59.889  61.233  1.00 29.00 ? 257  SER C N   1 
ATOM   7222  C  CA  . SER C 1 257 ? 30.100  59.500  59.844  1.00 30.40 ? 257  SER C CA  1 
ATOM   7223  C  C   . SER C 1 257 ? 28.949  60.297  59.237  1.00 31.47 ? 257  SER C C   1 
ATOM   7224  O  O   . SER C 1 257 ? 28.043  60.738  59.949  1.00 30.45 ? 257  SER C O   1 
ATOM   7225  C  CB  . SER C 1 257 ? 29.804  58.001  59.752  1.00 30.42 ? 257  SER C CB  1 
ATOM   7226  O  OG  . SER C 1 257 ? 28.748  57.630  60.623  1.00 31.85 ? 257  SER C OG  1 
ATOM   7227  N  N   . VAL C 1 258 ? 28.997  60.486  57.921  1.00 32.58 ? 258  VAL C N   1 
ATOM   7228  C  CA  . VAL C 1 258 ? 27.966  61.233  57.204  1.00 32.57 ? 258  VAL C CA  1 
ATOM   7229  C  C   . VAL C 1 258 ? 27.644  60.603  55.855  1.00 33.82 ? 258  VAL C C   1 
ATOM   7230  O  O   . VAL C 1 258 ? 28.422  59.808  55.325  1.00 35.47 ? 258  VAL C O   1 
ATOM   7231  C  CB  . VAL C 1 258 ? 28.393  62.705  56.940  1.00 32.11 ? 258  VAL C CB  1 
ATOM   7232  C  CG1 . VAL C 1 258 ? 28.578  63.454  58.243  1.00 31.34 ? 258  VAL C CG1 1 
ATOM   7233  C  CG2 . VAL C 1 258 ? 29.671  62.750  56.116  1.00 31.90 ? 258  VAL C CG2 1 
ATOM   7234  N  N   . ALA C 1 259 ? 26.477  60.948  55.321  1.00 34.05 ? 259  ALA C N   1 
ATOM   7235  C  CA  . ALA C 1 259 ? 26.048  60.462  54.016  1.00 34.01 ? 259  ALA C CA  1 
ATOM   7236  C  C   . ALA C 1 259 ? 26.410  61.560  53.025  1.00 34.68 ? 259  ALA C C   1 
ATOM   7237  O  O   . ALA C 1 259 ? 26.249  62.744  53.323  1.00 34.86 ? 259  ALA C O   1 
ATOM   7238  C  CB  . ALA C 1 259 ? 24.555  60.213  54.009  1.00 34.36 ? 259  ALA C CB  1 
ATOM   7239  N  N   . SER C 1 260 ? 26.896  61.174  51.850  1.00 34.83 ? 260  SER C N   1 
ATOM   7240  C  CA  . SER C 1 260 ? 27.298  62.157  50.853  1.00 36.30 ? 260  SER C CA  1 
ATOM   7241  C  C   . SER C 1 260 ? 27.020  61.748  49.414  1.00 37.21 ? 260  SER C C   1 
ATOM   7242  O  O   . SER C 1 260 ? 26.493  60.666  49.146  1.00 35.50 ? 260  SER C O   1 
ATOM   7243  C  CB  . SER C 1 260 ? 28.791  62.458  51.006  1.00 36.10 ? 260  SER C CB  1 
ATOM   7244  O  OG  . SER C 1 260 ? 29.567  61.286  50.815  1.00 36.48 ? 260  SER C OG  1 
ATOM   7245  N  N   . ASP C 1 261 ? 27.356  62.650  48.496  1.00 39.08 ? 261  ASP C N   1 
ATOM   7246  C  CA  . ASP C 1 261 ? 27.195  62.412  47.069  1.00 41.20 ? 261  ASP C CA  1 
ATOM   7247  C  C   . ASP C 1 261 ? 28.501  61.759  46.629  1.00 42.24 ? 261  ASP C C   1 
ATOM   7248  O  O   . ASP C 1 261 ? 29.539  62.417  46.570  1.00 42.59 ? 261  ASP C O   1 
ATOM   7249  C  CB  . ASP C 1 261 ? 26.982  63.741  46.333  1.00 41.57 ? 261  ASP C CB  1 
ATOM   7250  C  CG  . ASP C 1 261 ? 26.617  63.557  44.865  1.00 41.25 ? 261  ASP C CG  1 
ATOM   7251  O  OD1 . ASP C 1 261 ? 26.316  62.419  44.444  1.00 42.88 ? 261  ASP C OD1 1 
ATOM   7252  O  OD2 . ASP C 1 261 ? 26.625  64.566  44.129  1.00 39.48 ? 261  ASP C OD2 1 
ATOM   7253  N  N   . ARG C 1 262 ? 28.443  60.460  46.349  1.00 44.12 ? 262  ARG C N   1 
ATOM   7254  C  CA  . ARG C 1 262 ? 29.620  59.694  45.946  1.00 46.54 ? 262  ARG C CA  1 
ATOM   7255  C  C   . ARG C 1 262 ? 30.365  60.229  44.722  1.00 46.43 ? 262  ARG C C   1 
ATOM   7256  O  O   . ARG C 1 262 ? 31.553  59.949  44.544  1.00 46.17 ? 262  ARG C O   1 
ATOM   7257  C  CB  . ARG C 1 262 ? 29.254  58.220  45.742  1.00 49.83 ? 262  ARG C CB  1 
ATOM   7258  C  CG  . ARG C 1 262 ? 28.253  57.957  44.626  1.00 54.39 ? 262  ARG C CG  1 
ATOM   7259  C  CD  . ARG C 1 262 ? 28.006  56.465  44.460  1.00 58.61 ? 262  ARG C CD  1 
ATOM   7260  N  NE  . ARG C 1 262 ? 29.250  55.729  44.234  1.00 61.44 ? 262  ARG C NE  1 
ATOM   7261  C  CZ  . ARG C 1 262 ? 29.332  54.406  44.117  1.00 63.55 ? 262  ARG C CZ  1 
ATOM   7262  N  NH1 . ARG C 1 262 ? 28.240  53.655  44.201  1.00 64.63 ? 262  ARG C NH1 1 
ATOM   7263  N  NH2 . ARG C 1 262 ? 30.512  53.832  43.924  1.00 63.85 ? 262  ARG C NH2 1 
ATOM   7264  N  N   . SER C 1 263 ? 29.673  60.995  43.883  1.00 46.13 ? 263  SER C N   1 
ATOM   7265  C  CA  . SER C 1 263 ? 30.293  61.564  42.690  1.00 46.49 ? 263  SER C CA  1 
ATOM   7266  C  C   . SER C 1 263 ? 31.228  62.715  43.058  1.00 46.85 ? 263  SER C C   1 
ATOM   7267  O  O   . SER C 1 263 ? 32.290  62.879  42.455  1.00 47.92 ? 263  SER C O   1 
ATOM   7268  C  CB  . SER C 1 263 ? 29.225  62.040  41.698  1.00 46.25 ? 263  SER C CB  1 
ATOM   7269  O  OG  . SER C 1 263 ? 28.399  63.043  42.261  1.00 48.29 ? 263  SER C OG  1 
ATOM   7270  N  N   . ILE C 1 264 ? 30.832  63.498  44.059  1.00 45.84 ? 264  ILE C N   1 
ATOM   7271  C  CA  . ILE C 1 264 ? 31.627  64.634  44.518  1.00 43.50 ? 264  ILE C CA  1 
ATOM   7272  C  C   . ILE C 1 264 ? 32.539  64.215  45.672  1.00 41.87 ? 264  ILE C C   1 
ATOM   7273  O  O   . ILE C 1 264 ? 33.757  64.386  45.600  1.00 41.58 ? 264  ILE C O   1 
ATOM   7274  C  CB  . ILE C 1 264 ? 30.720  65.810  44.958  1.00 44.37 ? 264  ILE C CB  1 
ATOM   7275  C  CG1 . ILE C 1 264 ? 29.727  66.161  43.843  1.00 45.66 ? 264  ILE C CG1 1 
ATOM   7276  C  CG2 . ILE C 1 264 ? 31.558  67.031  45.292  1.00 43.83 ? 264  ILE C CG2 1 
ATOM   7277  C  CD1 . ILE C 1 264 ? 30.376  66.540  42.518  1.00 44.38 ? 264  ILE C CD1 1 
ATOM   7278  N  N   . ILE C 1 265 ? 31.942  63.668  46.731  1.00 40.22 ? 265  ILE C N   1 
ATOM   7279  C  CA  . ILE C 1 265 ? 32.694  63.202  47.897  1.00 38.42 ? 265  ILE C CA  1 
ATOM   7280  C  C   . ILE C 1 265 ? 32.563  61.679  48.006  1.00 36.28 ? 265  ILE C C   1 
ATOM   7281  O  O   . ILE C 1 265 ? 31.575  61.168  48.539  1.00 34.87 ? 265  ILE C O   1 
ATOM   7282  C  CB  . ILE C 1 265 ? 32.185  63.840  49.226  1.00 38.53 ? 265  ILE C CB  1 
ATOM   7283  C  CG1 . ILE C 1 265 ? 32.154  65.368  49.127  1.00 37.25 ? 265  ILE C CG1 1 
ATOM   7284  C  CG2 . ILE C 1 265 ? 33.079  63.425  50.387  1.00 38.74 ? 265  ILE C CG2 1 
ATOM   7285  C  CD1 . ILE C 1 265 ? 30.827  65.924  48.650  1.00 38.48 ? 265  ILE C CD1 1 
ATOM   7286  N  N   . PRO C 1 266 ? 33.561  60.935  47.496  1.00 34.77 ? 266  PRO C N   1 
ATOM   7287  C  CA  . PRO C 1 266 ? 33.571  59.467  47.526  1.00 35.13 ? 266  PRO C CA  1 
ATOM   7288  C  C   . PRO C 1 266 ? 33.670  58.880  48.938  1.00 36.06 ? 266  PRO C C   1 
ATOM   7289  O  O   . PRO C 1 266 ? 34.122  59.549  49.868  1.00 36.90 ? 266  PRO C O   1 
ATOM   7290  C  CB  . PRO C 1 266 ? 34.800  59.124  46.681  1.00 34.35 ? 266  PRO C CB  1 
ATOM   7291  C  CG  . PRO C 1 266 ? 35.711  60.276  46.930  1.00 34.81 ? 266  PRO C CG  1 
ATOM   7292  C  CD  . PRO C 1 266 ? 34.772  61.449  46.832  1.00 34.96 ? 266  PRO C CD  1 
ATOM   7293  N  N   . PRO C 1 267 ? 33.224  57.623  49.115  1.00 35.67 ? 267  PRO C N   1 
ATOM   7294  C  CA  . PRO C 1 267 ? 33.265  56.947  50.417  1.00 35.13 ? 267  PRO C CA  1 
ATOM   7295  C  C   . PRO C 1 267 ? 34.687  56.733  50.938  1.00 34.62 ? 267  PRO C C   1 
ATOM   7296  O  O   . PRO C 1 267 ? 35.600  56.414  50.173  1.00 34.99 ? 267  PRO C O   1 
ATOM   7297  C  CB  . PRO C 1 267 ? 32.554  55.623  50.135  1.00 35.42 ? 267  PRO C CB  1 
ATOM   7298  C  CG  . PRO C 1 267 ? 32.844  55.382  48.682  1.00 36.77 ? 267  PRO C CG  1 
ATOM   7299  C  CD  . PRO C 1 267 ? 32.619  56.749  48.095  1.00 35.76 ? 267  PRO C CD  1 
ATOM   7300  N  N   . GLY C 1 268 ? 34.859  56.910  52.245  1.00 32.89 ? 268  GLY C N   1 
ATOM   7301  C  CA  . GLY C 1 268 ? 36.166  56.750  52.859  1.00 31.91 ? 268  GLY C CA  1 
ATOM   7302  C  C   . GLY C 1 268 ? 36.893  58.075  53.013  1.00 31.55 ? 268  GLY C C   1 
ATOM   7303  O  O   . GLY C 1 268 ? 38.019  58.119  53.509  1.00 30.87 ? 268  GLY C O   1 
ATOM   7304  N  N   . THR C 1 269 ? 36.242  59.156  52.588  1.00 32.51 ? 269  THR C N   1 
ATOM   7305  C  CA  . THR C 1 269 ? 36.812  60.498  52.667  1.00 32.16 ? 269  THR C CA  1 
ATOM   7306  C  C   . THR C 1 269 ? 36.726  61.071  54.081  1.00 32.57 ? 269  THR C C   1 
ATOM   7307  O  O   . THR C 1 269 ? 35.649  61.116  54.678  1.00 31.70 ? 269  THR C O   1 
ATOM   7308  C  CB  . THR C 1 269 ? 36.097  61.469  51.692  1.00 30.61 ? 269  THR C CB  1 
ATOM   7309  O  OG1 . THR C 1 269 ? 36.263  61.009  50.347  1.00 30.99 ? 269  THR C OG1 1 
ATOM   7310  C  CG2 . THR C 1 269 ? 36.674  62.869  51.806  1.00 29.60 ? 269  THR C CG2 1 
ATOM   7311  N  N   . THR C 1 270 ? 37.872  61.499  54.607  1.00 31.69 ? 270  THR C N   1 
ATOM   7312  C  CA  . THR C 1 270 ? 37.941  62.088  55.940  1.00 31.96 ? 270  THR C CA  1 
ATOM   7313  C  C   . THR C 1 270 ? 37.489  63.546  55.854  1.00 32.11 ? 270  THR C C   1 
ATOM   7314  O  O   . THR C 1 270 ? 37.976  64.309  55.017  1.00 31.06 ? 270  THR C O   1 
ATOM   7315  C  CB  . THR C 1 270 ? 39.373  62.025  56.506  1.00 32.55 ? 270  THR C CB  1 
ATOM   7316  O  OG1 . THR C 1 270 ? 39.843  60.673  56.463  1.00 32.89 ? 270  THR C OG1 1 
ATOM   7317  C  CG2 . THR C 1 270 ? 39.398  62.514  57.947  1.00 33.51 ? 270  THR C CG2 1 
ATOM   7318  N  N   . LEU C 1 271 ? 36.561  63.926  56.727  1.00 32.82 ? 271  LEU C N   1 
ATOM   7319  C  CA  . LEU C 1 271 ? 36.019  65.281  56.738  1.00 32.89 ? 271  LEU C CA  1 
ATOM   7320  C  C   . LEU C 1 271 ? 35.999  65.915  58.123  1.00 33.32 ? 271  LEU C C   1 
ATOM   7321  O  O   . LEU C 1 271 ? 35.405  65.370  59.053  1.00 33.78 ? 271  LEU C O   1 
ATOM   7322  C  CB  . LEU C 1 271 ? 34.583  65.274  56.200  1.00 30.73 ? 271  LEU C CB  1 
ATOM   7323  C  CG  . LEU C 1 271 ? 34.285  64.677  54.824  1.00 30.17 ? 271  LEU C CG  1 
ATOM   7324  C  CD1 . LEU C 1 271 ? 32.792  64.461  54.680  1.00 27.35 ? 271  LEU C CD1 1 
ATOM   7325  C  CD2 . LEU C 1 271 ? 34.811  65.583  53.728  1.00 30.52 ? 271  LEU C CD2 1 
ATOM   7326  N  N   . ILE C 1 272 ? 36.663  67.058  58.260  1.00 34.09 ? 272  ILE C N   1 
ATOM   7327  C  CA  . ILE C 1 272 ? 36.663  67.788  59.522  1.00 35.35 ? 272  ILE C CA  1 
ATOM   7328  C  C   . ILE C 1 272 ? 35.679  68.933  59.289  1.00 34.92 ? 272  ILE C C   1 
ATOM   7329  O  O   . ILE C 1 272 ? 35.804  69.675  58.313  1.00 34.88 ? 272  ILE C O   1 
ATOM   7330  C  CB  . ILE C 1 272 ? 38.075  68.316  59.901  1.00 36.11 ? 272  ILE C CB  1 
ATOM   7331  C  CG1 . ILE C 1 272 ? 38.027  69.010  61.265  1.00 36.97 ? 272  ILE C CG1 1 
ATOM   7332  C  CG2 . ILE C 1 272 ? 38.617  69.247  58.831  1.00 36.27 ? 272  ILE C CG2 1 
ATOM   7333  C  CD1 . ILE C 1 272 ? 39.373  69.491  61.761  1.00 38.74 ? 272  ILE C CD1 1 
ATOM   7334  N  N   . ALA C 1 273 ? 34.677  69.055  60.153  1.00 34.61 ? 273  ALA C N   1 
ATOM   7335  C  CA  . ALA C 1 273 ? 33.675  70.094  59.963  1.00 35.67 ? 273  ALA C CA  1 
ATOM   7336  C  C   . ALA C 1 273 ? 33.206  70.837  61.202  1.00 36.77 ? 273  ALA C C   1 
ATOM   7337  O  O   . ALA C 1 273 ? 33.293  70.340  62.325  1.00 35.99 ? 273  ALA C O   1 
ATOM   7338  C  CB  . ALA C 1 273 ? 32.473  69.513  59.237  1.00 35.40 ? 273  ALA C CB  1 
ATOM   7339  N  N   . GLU C 1 274 ? 32.701  72.043  60.962  1.00 38.13 ? 274  GLU C N   1 
ATOM   7340  C  CA  . GLU C 1 274 ? 32.163  72.903  62.004  1.00 41.34 ? 274  GLU C CA  1 
ATOM   7341  C  C   . GLU C 1 274 ? 30.652  72.725  61.997  1.00 41.12 ? 274  GLU C C   1 
ATOM   7342  O  O   . GLU C 1 274 ? 29.927  73.468  61.332  1.00 41.48 ? 274  GLU C O   1 
ATOM   7343  C  CB  . GLU C 1 274 ? 32.524  74.366  61.733  1.00 44.88 ? 274  GLU C CB  1 
ATOM   7344  C  CG  . GLU C 1 274 ? 33.899  74.775  62.230  1.00 49.48 ? 274  GLU C CG  1 
ATOM   7345  C  CD  . GLU C 1 274 ? 33.941  74.981  63.735  1.00 53.45 ? 274  GLU C CD  1 
ATOM   7346  O  OE1 . GLU C 1 274 ? 34.249  74.016  64.466  1.00 56.74 ? 274  GLU C OE1 1 
ATOM   7347  O  OE2 . GLU C 1 274 ? 33.668  76.113  64.186  1.00 55.48 ? 274  GLU C OE2 1 
ATOM   7348  N  N   . VAL C 1 275 ? 30.193  71.697  62.702  1.00 42.12 ? 275  VAL C N   1 
ATOM   7349  C  CA  . VAL C 1 275 ? 28.774  71.383  62.799  1.00 42.40 ? 275  VAL C CA  1 
ATOM   7350  C  C   . VAL C 1 275 ? 28.064  72.370  63.727  1.00 43.03 ? 275  VAL C C   1 
ATOM   7351  O  O   . VAL C 1 275 ? 28.367  72.446  64.919  1.00 43.02 ? 275  VAL C O   1 
ATOM   7352  C  CB  . VAL C 1 275 ? 28.564  69.942  63.317  1.00 41.52 ? 275  VAL C CB  1 
ATOM   7353  C  CG1 . VAL C 1 275 ? 27.084  69.597  63.350  1.00 43.23 ? 275  VAL C CG1 1 
ATOM   7354  C  CG2 . VAL C 1 275 ? 29.321  68.956  62.444  1.00 40.58 ? 275  VAL C CG2 1 
ATOM   7355  N  N   . PRO C 1 276 ? 27.110  73.145  63.184  1.00 44.11 ? 276  PRO C N   1 
ATOM   7356  C  CA  . PRO C 1 276 ? 26.344  74.136  63.948  1.00 44.33 ? 276  PRO C CA  1 
ATOM   7357  C  C   . PRO C 1 276 ? 25.505  73.514  65.066  1.00 44.46 ? 276  PRO C C   1 
ATOM   7358  O  O   . PRO C 1 276 ? 24.733  72.581  64.833  1.00 45.00 ? 276  PRO C O   1 
ATOM   7359  C  CB  . PRO C 1 276 ? 25.465  74.782  62.875  1.00 44.05 ? 276  PRO C CB  1 
ATOM   7360  C  CG  . PRO C 1 276 ? 25.270  73.672  61.883  1.00 43.59 ? 276  PRO C CG  1 
ATOM   7361  C  CD  . PRO C 1 276 ? 26.660  73.109  61.781  1.00 43.65 ? 276  PRO C CD  1 
ATOM   7362  N  N   . LEU C 1 277 ? 25.676  74.026  66.280  1.00 44.54 ? 277  LEU C N   1 
ATOM   7363  C  CA  . LEU C 1 277 ? 24.936  73.525  67.433  1.00 45.64 ? 277  LEU C CA  1 
ATOM   7364  C  C   . LEU C 1 277 ? 23.536  74.116  67.524  1.00 47.15 ? 277  LEU C C   1 
ATOM   7365  O  O   . LEU C 1 277 ? 23.280  75.219  67.040  1.00 48.03 ? 277  LEU C O   1 
ATOM   7366  C  CB  . LEU C 1 277 ? 25.702  73.804  68.727  1.00 44.16 ? 277  LEU C CB  1 
ATOM   7367  C  CG  . LEU C 1 277 ? 27.002  73.027  68.940  1.00 42.82 ? 277  LEU C CG  1 
ATOM   7368  C  CD1 . LEU C 1 277 ? 27.666  73.493  70.218  1.00 42.35 ? 277  LEU C CD1 1 
ATOM   7369  C  CD2 . LEU C 1 277 ? 26.717  71.534  68.998  1.00 42.03 ? 277  LEU C CD2 1 
ATOM   7370  N  N   . LEU C 1 278 ? 22.636  73.369  68.157  1.00 49.44 ? 278  LEU C N   1 
ATOM   7371  C  CA  . LEU C 1 278 ? 21.251  73.791  68.332  1.00 52.17 ? 278  LEU C CA  1 
ATOM   7372  C  C   . LEU C 1 278 ? 20.637  73.158  69.580  1.00 54.28 ? 278  LEU C C   1 
ATOM   7373  O  O   . LEU C 1 278 ? 20.933  72.009  69.915  1.00 55.79 ? 278  LEU C O   1 
ATOM   7374  C  CB  . LEU C 1 278 ? 20.428  73.462  67.075  1.00 51.14 ? 278  LEU C CB  1 
ATOM   7375  C  CG  . LEU C 1 278 ? 20.607  72.116  66.359  1.00 49.89 ? 278  LEU C CG  1 
ATOM   7376  C  CD1 . LEU C 1 278 ? 19.904  70.992  67.108  1.00 51.64 ? 278  LEU C CD1 1 
ATOM   7377  C  CD2 . LEU C 1 278 ? 20.048  72.222  64.953  1.00 49.76 ? 278  LEU C CD2 1 
ATOM   7378  N  N   . ASP C 1 279 ? 19.803  73.926  70.276  1.00 56.32 ? 279  ASP C N   1 
ATOM   7379  C  CA  . ASP C 1 279 ? 19.148  73.460  71.497  1.00 58.52 ? 279  ASP C CA  1 
ATOM   7380  C  C   . ASP C 1 279 ? 18.056  72.416  71.254  1.00 59.73 ? 279  ASP C C   1 
ATOM   7381  O  O   . ASP C 1 279 ? 17.868  71.949  70.129  1.00 60.36 ? 279  ASP C O   1 
ATOM   7382  C  CB  . ASP C 1 279 ? 18.586  74.651  72.284  1.00 59.64 ? 279  ASP C CB  1 
ATOM   7383  C  CG  . ASP C 1 279 ? 17.775  75.599  71.417  1.00 59.99 ? 279  ASP C CG  1 
ATOM   7384  O  OD1 . ASP C 1 279 ? 16.633  75.251  71.055  1.00 60.25 ? 279  ASP C OD1 1 
ATOM   7385  O  OD2 . ASP C 1 279 ? 18.281  76.697  71.102  1.00 60.99 ? 279  ASP C OD2 1 
ATOM   7386  N  N   . ASN C 1 280 ? 17.339  72.061  72.320  1.00 60.30 ? 280  ASN C N   1 
ATOM   7387  C  CA  . ASN C 1 280 ? 16.267  71.069  72.253  1.00 61.07 ? 280  ASN C CA  1 
ATOM   7388  C  C   . ASN C 1 280 ? 15.146  71.458  71.291  1.00 60.59 ? 280  ASN C C   1 
ATOM   7389  O  O   . ASN C 1 280 ? 14.431  70.593  70.782  1.00 61.54 ? 280  ASN C O   1 
ATOM   7390  C  CB  . ASN C 1 280 ? 15.689  70.817  73.648  1.00 62.37 ? 280  ASN C CB  1 
ATOM   7391  C  CG  . ASN C 1 280 ? 16.720  70.271  74.614  1.00 63.84 ? 280  ASN C CG  1 
ATOM   7392  O  OD1 . ASN C 1 280 ? 17.514  71.023  75.182  1.00 65.93 ? 280  ASN C OD1 1 
ATOM   7393  N  ND2 . ASN C 1 280 ? 16.716  68.956  74.804  1.00 64.32 ? 280  ASN C ND2 1 
ATOM   7394  N  N   . ASN C 1 281 ? 14.992  72.758  71.054  1.00 59.41 ? 281  ASN C N   1 
ATOM   7395  C  CA  . ASN C 1 281 ? 13.966  73.258  70.144  1.00 58.86 ? 281  ASN C CA  1 
ATOM   7396  C  C   . ASN C 1 281 ? 14.522  73.464  68.734  1.00 58.53 ? 281  ASN C C   1 
ATOM   7397  O  O   . ASN C 1 281 ? 13.860  74.050  67.874  1.00 58.19 ? 281  ASN C O   1 
ATOM   7398  C  CB  . ASN C 1 281 ? 13.366  74.562  70.677  1.00 59.26 ? 281  ASN C CB  1 
ATOM   7399  C  CG  . ASN C 1 281 ? 12.673  74.379  72.014  1.00 58.79 ? 281  ASN C CG  1 
ATOM   7400  O  OD1 . ASN C 1 281 ? 11.744  73.581  72.142  1.00 57.78 ? 281  ASN C OD1 1 
ATOM   7401  N  ND2 . ASN C 1 281 ? 13.128  75.116  73.021  1.00 59.61 ? 281  ASN C ND2 1 
ATOM   7402  N  N   . GLY C 1 282 ? 15.743  72.980  68.513  1.00 57.56 ? 282  GLY C N   1 
ATOM   7403  C  CA  . GLY C 1 282 ? 16.385  73.090  67.213  1.00 56.60 ? 282  GLY C CA  1 
ATOM   7404  C  C   . GLY C 1 282 ? 16.734  74.488  66.751  1.00 56.96 ? 282  GLY C C   1 
ATOM   7405  O  O   . GLY C 1 282 ? 16.990  74.704  65.565  1.00 57.21 ? 282  GLY C O   1 
ATOM   7406  N  N   . LYS C 1 283 ? 16.739  75.438  67.679  1.00 57.83 ? 283  LYS C N   1 
ATOM   7407  C  CA  . LYS C 1 283 ? 17.068  76.821  67.359  1.00 58.01 ? 283  LYS C CA  1 
ATOM   7408  C  C   . LYS C 1 283 ? 18.582  77.013  67.371  1.00 58.23 ? 283  LYS C C   1 
ATOM   7409  O  O   . LYS C 1 283 ? 19.266  76.563  68.293  1.00 58.73 ? 283  LYS C O   1 
ATOM   7410  C  CB  . LYS C 1 283 ? 16.406  77.768  68.365  1.00 58.22 ? 283  LYS C CB  1 
ATOM   7411  C  CG  . LYS C 1 283 ? 16.672  79.242  68.108  1.00 58.78 ? 283  LYS C CG  1 
ATOM   7412  C  CD  . LYS C 1 283 ? 16.004  80.116  69.155  1.00 58.66 ? 283  LYS C CD  1 
ATOM   7413  C  CE  . LYS C 1 283 ? 16.309  81.584  68.914  1.00 59.07 ? 283  LYS C CE  1 
ATOM   7414  N  NZ  . LYS C 1 283 ? 15.636  82.460  69.912  1.00 59.93 ? 283  LYS C NZ  1 
ATOM   7415  N  N   . PHE C 1 284 ? 19.100  77.662  66.331  1.00 57.84 ? 284  PHE C N   1 
ATOM   7416  C  CA  . PHE C 1 284 ? 20.532  77.922  66.219  1.00 57.10 ? 284  PHE C CA  1 
ATOM   7417  C  C   . PHE C 1 284 ? 20.962  78.957  67.255  1.00 57.42 ? 284  PHE C C   1 
ATOM   7418  O  O   . PHE C 1 284 ? 20.636  80.141  67.137  1.00 58.48 ? 284  PHE C O   1 
ATOM   7419  C  CB  . PHE C 1 284 ? 20.879  78.412  64.809  1.00 55.75 ? 284  PHE C CB  1 
ATOM   7420  C  CG  . PHE C 1 284 ? 22.351  78.640  64.587  1.00 55.13 ? 284  PHE C CG  1 
ATOM   7421  C  CD1 . PHE C 1 284 ? 23.274  77.632  64.850  1.00 54.01 ? 284  PHE C CD1 1 
ATOM   7422  C  CD2 . PHE C 1 284 ? 22.814  79.863  64.113  1.00 55.16 ? 284  PHE C CD2 1 
ATOM   7423  C  CE1 . PHE C 1 284 ? 24.635  77.839  64.644  1.00 53.89 ? 284  PHE C CE1 1 
ATOM   7424  C  CE2 . PHE C 1 284 ? 24.175  80.080  63.904  1.00 54.88 ? 284  PHE C CE2 1 
ATOM   7425  C  CZ  . PHE C 1 284 ? 25.087  79.064  64.170  1.00 54.10 ? 284  PHE C CZ  1 
ATOM   7426  N  N   . ASN C 1 285 ? 21.684  78.497  68.273  1.00 56.86 ? 285  ASN C N   1 
ATOM   7427  C  CA  . ASN C 1 285 ? 22.166  79.369  69.341  1.00 55.23 ? 285  ASN C CA  1 
ATOM   7428  C  C   . ASN C 1 285 ? 23.281  80.321  68.900  1.00 53.98 ? 285  ASN C C   1 
ATOM   7429  O  O   . ASN C 1 285 ? 23.404  81.425  69.433  1.00 52.85 ? 285  ASN C O   1 
ATOM   7430  C  CB  . ASN C 1 285 ? 22.603  78.539  70.560  1.00 55.59 ? 285  ASN C CB  1 
ATOM   7431  C  CG  . ASN C 1 285 ? 23.412  77.304  70.182  1.00 53.75 ? 285  ASN C CG  1 
ATOM   7432  O  OD1 . ASN C 1 285 ? 24.128  77.291  69.179  1.00 53.64 ? 285  ASN C OD1 1 
ATOM   7433  N  ND2 . ASN C 1 285 ? 23.299  76.259  70.992  1.00 51.51 ? 285  ASN C ND2 1 
ATOM   7434  N  N   . GLY C 1 286 ? 24.082  79.896  67.925  1.00 53.45 ? 286  GLY C N   1 
ATOM   7435  C  CA  . GLY C 1 286 ? 25.162  80.735  67.433  1.00 52.90 ? 286  GLY C CA  1 
ATOM   7436  C  C   . GLY C 1 286 ? 26.542  80.099  67.454  1.00 52.70 ? 286  GLY C C   1 
ATOM   7437  O  O   . GLY C 1 286 ? 27.463  80.594  66.801  1.00 52.89 ? 286  GLY C O   1 
ATOM   7438  N  N   . GLN C 1 287 ? 26.690  79.009  68.201  1.00 52.28 ? 287  GLN C N   1 
ATOM   7439  C  CA  . GLN C 1 287 ? 27.970  78.315  68.307  1.00 51.26 ? 287  GLN C CA  1 
ATOM   7440  C  C   . GLN C 1 287 ? 28.053  77.064  67.435  1.00 50.59 ? 287  GLN C C   1 
ATOM   7441  O  O   . GLN C 1 287 ? 27.033  76.536  66.986  1.00 49.61 ? 287  GLN C O   1 
ATOM   7442  C  CB  . GLN C 1 287 ? 28.267  77.977  69.772  1.00 52.34 ? 287  GLN C CB  1 
ATOM   7443  C  CG  . GLN C 1 287 ? 27.125  77.283  70.500  1.00 53.85 ? 287  GLN C CG  1 
ATOM   7444  C  CD  . GLN C 1 287 ? 27.320  77.256  72.003  1.00 54.45 ? 287  GLN C CD  1 
ATOM   7445  O  OE1 . GLN C 1 287 ? 27.666  76.224  72.577  1.00 54.77 ? 287  GLN C OE1 1 
ATOM   7446  N  NE2 . GLN C 1 287 ? 27.095  78.394  72.649  1.00 54.49 ? 287  GLN C NE2 1 
ATOM   7447  N  N   . TYR C 1 288 ? 29.280  76.610  67.187  1.00 50.18 ? 288  TYR C N   1 
ATOM   7448  C  CA  . TYR C 1 288 ? 29.525  75.430  66.363  1.00 49.06 ? 288  TYR C CA  1 
ATOM   7449  C  C   . TYR C 1 288 ? 30.175  74.297  67.152  1.00 48.08 ? 288  TYR C C   1 
ATOM   7450  O  O   . TYR C 1 288 ? 30.301  74.371  68.375  1.00 49.26 ? 288  TYR C O   1 
ATOM   7451  C  CB  . TYR C 1 288 ? 30.397  75.797  65.159  1.00 49.80 ? 288  TYR C CB  1 
ATOM   7452  C  CG  . TYR C 1 288 ? 29.746  76.779  64.214  1.00 51.28 ? 288  TYR C CG  1 
ATOM   7453  C  CD1 . TYR C 1 288 ? 29.702  78.139  64.513  1.00 52.48 ? 288  TYR C CD1 1 
ATOM   7454  C  CD2 . TYR C 1 288 ? 29.157  76.346  63.028  1.00 52.06 ? 288  TYR C CD2 1 
ATOM   7455  C  CE1 . TYR C 1 288 ? 29.084  79.045  63.658  1.00 54.16 ? 288  TYR C CE1 1 
ATOM   7456  C  CE2 . TYR C 1 288 ? 28.535  77.244  62.163  1.00 53.74 ? 288  TYR C CE2 1 
ATOM   7457  C  CZ  . TYR C 1 288 ? 28.501  78.591  62.486  1.00 54.16 ? 288  TYR C CZ  1 
ATOM   7458  O  OH  . TYR C 1 288 ? 27.881  79.485  61.643  1.00 54.35 ? 288  TYR C OH  1 
ATOM   7459  N  N   . GLU C 1 289 ? 30.598  73.259  66.436  1.00 46.73 ? 289  GLU C N   1 
ATOM   7460  C  CA  . GLU C 1 289 ? 31.230  72.093  67.044  1.00 45.12 ? 289  GLU C CA  1 
ATOM   7461  C  C   . GLU C 1 289 ? 32.177  71.437  66.042  1.00 44.28 ? 289  GLU C C   1 
ATOM   7462  O  O   . GLU C 1 289 ? 31.786  71.141  64.913  1.00 45.05 ? 289  GLU C O   1 
ATOM   7463  C  CB  . GLU C 1 289 ? 30.151  71.098  67.480  1.00 44.71 ? 289  GLU C CB  1 
ATOM   7464  C  CG  . GLU C 1 289 ? 30.662  69.877  68.217  1.00 44.85 ? 289  GLU C CG  1 
ATOM   7465  C  CD  . GLU C 1 289 ? 29.535  68.986  68.703  1.00 46.65 ? 289  GLU C CD  1 
ATOM   7466  O  OE1 . GLU C 1 289 ? 28.757  68.491  67.858  1.00 46.58 ? 289  GLU C OE1 1 
ATOM   7467  O  OE2 . GLU C 1 289 ? 29.423  68.787  69.932  1.00 48.16 ? 289  GLU C OE2 1 
ATOM   7468  N  N   . LEU C 1 290 ? 33.423  71.217  66.454  1.00 42.84 ? 290  LEU C N   1 
ATOM   7469  C  CA  . LEU C 1 290 ? 34.414  70.603  65.576  1.00 40.64 ? 290  LEU C CA  1 
ATOM   7470  C  C   . LEU C 1 290 ? 34.386  69.078  65.650  1.00 38.73 ? 290  LEU C C   1 
ATOM   7471  O  O   . LEU C 1 290 ? 34.642  68.492  66.703  1.00 37.44 ? 290  LEU C O   1 
ATOM   7472  C  CB  . LEU C 1 290 ? 35.816  71.124  65.902  1.00 40.24 ? 290  LEU C CB  1 
ATOM   7473  C  CG  . LEU C 1 290 ? 36.873  70.856  64.827  1.00 39.48 ? 290  LEU C CG  1 
ATOM   7474  C  CD1 . LEU C 1 290 ? 36.422  71.452  63.502  1.00 40.64 ? 290  LEU C CD1 1 
ATOM   7475  C  CD2 . LEU C 1 290 ? 38.203  71.450  65.237  1.00 41.08 ? 290  LEU C CD2 1 
ATOM   7476  N  N   . ARG C 1 291 ? 34.085  68.446  64.518  1.00 38.05 ? 291  ARG C N   1 
ATOM   7477  C  CA  . ARG C 1 291 ? 34.010  66.990  64.437  1.00 37.35 ? 291  ARG C CA  1 
ATOM   7478  C  C   . ARG C 1 291 ? 34.715  66.386  63.225  1.00 36.98 ? 291  ARG C C   1 
ATOM   7479  O  O   . ARG C 1 291 ? 34.728  66.969  62.140  1.00 37.04 ? 291  ARG C O   1 
ATOM   7480  C  CB  . ARG C 1 291 ? 32.549  66.527  64.428  1.00 34.94 ? 291  ARG C CB  1 
ATOM   7481  C  CG  . ARG C 1 291 ? 31.849  66.600  65.769  1.00 34.74 ? 291  ARG C CG  1 
ATOM   7482  C  CD  . ARG C 1 291 ? 30.463  65.975  65.696  1.00 33.11 ? 291  ARG C CD  1 
ATOM   7483  N  NE  . ARG C 1 291 ? 29.809  65.945  67.002  1.00 32.19 ? 291  ARG C NE  1 
ATOM   7484  C  CZ  . ARG C 1 291 ? 29.984  64.990  67.911  1.00 31.21 ? 291  ARG C CZ  1 
ATOM   7485  N  NH1 . ARG C 1 291 ? 30.795  63.970  67.664  1.00 30.08 ? 291  ARG C NH1 1 
ATOM   7486  N  NH2 . ARG C 1 291 ? 29.349  65.058  69.073  1.00 32.41 ? 291  ARG C NH2 1 
ATOM   7487  N  N   . LEU C 1 292 ? 35.306  65.213  63.433  1.00 37.86 ? 292  LEU C N   1 
ATOM   7488  C  CA  . LEU C 1 292 ? 35.986  64.471  62.378  1.00 37.78 ? 292  LEU C CA  1 
ATOM   7489  C  C   . LEU C 1 292 ? 35.028  63.365  61.954  1.00 38.29 ? 292  LEU C C   1 
ATOM   7490  O  O   . LEU C 1 292 ? 34.628  62.534  62.771  1.00 37.97 ? 292  LEU C O   1 
ATOM   7491  C  CB  . LEU C 1 292 ? 37.292  63.862  62.894  1.00 37.55 ? 292  LEU C CB  1 
ATOM   7492  C  CG  . LEU C 1 292 ? 38.526  64.764  62.953  1.00 38.94 ? 292  LEU C CG  1 
ATOM   7493  C  CD1 . LEU C 1 292 ? 39.661  64.054  63.676  1.00 37.35 ? 292  LEU C CD1 1 
ATOM   7494  C  CD2 . LEU C 1 292 ? 38.946  65.145  61.542  1.00 39.44 ? 292  LEU C CD2 1 
HETATM 7495  N  N   . MSE C 1 293 ? 34.642  63.371  60.684  1.00 38.70 ? 293  MSE C N   1 
HETATM 7496  C  CA  . MSE C 1 293 ? 33.706  62.380  60.171  1.00 40.33 ? 293  MSE C CA  1 
HETATM 7497  C  C   . MSE C 1 293 ? 34.175  61.765  58.856  1.00 39.03 ? 293  MSE C C   1 
HETATM 7498  O  O   . MSE C 1 293 ? 35.033  62.319  58.174  1.00 39.65 ? 293  MSE C O   1 
HETATM 7499  C  CB  . MSE C 1 293 ? 32.321  63.020  60.015  1.00 42.60 ? 293  MSE C CB  1 
HETATM 7500  C  CG  . MSE C 1 293 ? 31.782  63.606  61.322  1.00 46.37 ? 293  MSE C CG  1 
HETATM 7501  SE SE  . MSE C 1 293 ? 30.169  64.649  61.171  1.00 51.26 ? 293  MSE C SE  1 
HETATM 7502  C  CE  . MSE C 1 293 ? 30.930  66.245  60.400  1.00 50.64 ? 293  MSE C CE  1 
ATOM   7503  N  N   . VAL C 1 294 ? 33.631  60.596  58.527  1.00 37.99 ? 294  VAL C N   1 
ATOM   7504  C  CA  . VAL C 1 294 ? 33.989  59.895  57.297  1.00 36.06 ? 294  VAL C CA  1 
ATOM   7505  C  C   . VAL C 1 294 ? 32.741  59.591  56.469  1.00 34.13 ? 294  VAL C C   1 
ATOM   7506  O  O   . VAL C 1 294 ? 31.710  59.196  57.014  1.00 33.77 ? 294  VAL C O   1 
ATOM   7507  C  CB  . VAL C 1 294 ? 34.719  58.557  57.599  1.00 36.91 ? 294  VAL C CB  1 
ATOM   7508  C  CG1 . VAL C 1 294 ? 35.195  57.909  56.306  1.00 37.00 ? 294  VAL C CG1 1 
ATOM   7509  C  CG2 . VAL C 1 294 ? 35.895  58.786  58.534  1.00 36.63 ? 294  VAL C CG2 1 
ATOM   7510  N  N   . ALA C 1 295 ? 32.839  59.794  55.157  1.00 32.18 ? 295  ALA C N   1 
ATOM   7511  C  CA  . ALA C 1 295 ? 31.729  59.529  54.244  1.00 30.90 ? 295  ALA C CA  1 
ATOM   7512  C  C   . ALA C 1 295 ? 31.610  58.020  54.044  1.00 31.20 ? 295  ALA C C   1 
ATOM   7513  O  O   . ALA C 1 295 ? 32.484  57.401  53.439  1.00 30.09 ? 295  ALA C O   1 
ATOM   7514  C  CB  . ALA C 1 295 ? 31.971  60.222  52.912  1.00 30.53 ? 295  ALA C CB  1 
ATOM   7515  N  N   . LEU C 1 296 ? 30.532  57.433  54.559  1.00 31.97 ? 296  LEU C N   1 
ATOM   7516  C  CA  . LEU C 1 296 ? 30.325  55.989  54.455  1.00 32.19 ? 296  LEU C CA  1 
ATOM   7517  C  C   . LEU C 1 296 ? 28.900  55.575  54.092  1.00 32.03 ? 296  LEU C C   1 
ATOM   7518  O  O   . LEU C 1 296 ? 28.506  54.431  54.321  1.00 32.86 ? 296  LEU C O   1 
ATOM   7519  C  CB  . LEU C 1 296 ? 30.728  55.313  55.770  1.00 31.64 ? 296  LEU C CB  1 
ATOM   7520  C  CG  . LEU C 1 296 ? 32.200  55.397  56.178  1.00 32.62 ? 296  LEU C CG  1 
ATOM   7521  C  CD1 . LEU C 1 296 ? 32.369  54.916  57.606  1.00 31.37 ? 296  LEU C CD1 1 
ATOM   7522  C  CD2 . LEU C 1 296 ? 33.058  54.582  55.217  1.00 33.45 ? 296  LEU C CD2 1 
ATOM   7523  N  N   . ASP C 1 297 ? 28.139  56.493  53.506  1.00 31.00 ? 297  ASP C N   1 
ATOM   7524  C  CA  . ASP C 1 297 ? 26.761  56.204  53.122  1.00 31.27 ? 297  ASP C CA  1 
ATOM   7525  C  C   . ASP C 1 297 ? 26.301  57.209  52.069  1.00 32.12 ? 297  ASP C C   1 
ATOM   7526  O  O   . ASP C 1 297 ? 26.943  58.238  51.861  1.00 33.22 ? 297  ASP C O   1 
ATOM   7527  C  CB  . ASP C 1 297 ? 25.850  56.269  54.358  1.00 30.29 ? 297  ASP C CB  1 
ATOM   7528  C  CG  . ASP C 1 297 ? 24.498  55.595  54.143  1.00 28.96 ? 297  ASP C CG  1 
ATOM   7529  O  OD1 . ASP C 1 297 ? 24.296  54.927  53.107  1.00 29.74 ? 297  ASP C OD1 1 
ATOM   7530  O  OD2 . ASP C 1 297 ? 23.631  55.727  55.030  1.00 28.90 ? 297  ASP C OD2 1 
ATOM   7531  N  N   . VAL C 1 298 ? 25.203  56.888  51.388  1.00 32.81 ? 298  VAL C N   1 
ATOM   7532  C  CA  . VAL C 1 298 ? 24.646  57.758  50.355  1.00 32.67 ? 298  VAL C CA  1 
ATOM   7533  C  C   . VAL C 1 298 ? 23.176  58.064  50.640  1.00 33.93 ? 298  VAL C C   1 
ATOM   7534  O  O   . VAL C 1 298 ? 22.614  57.587  51.626  1.00 33.74 ? 298  VAL C O   1 
ATOM   7535  C  CB  . VAL C 1 298 ? 24.770  57.123  48.944  1.00 31.01 ? 298  VAL C CB  1 
ATOM   7536  C  CG1 . VAL C 1 298 ? 26.232  56.868  48.602  1.00 27.92 ? 298  VAL C CG1 1 
ATOM   7537  C  CG2 . VAL C 1 298 ? 23.964  55.834  48.868  1.00 29.72 ? 298  VAL C CG2 1 
ATOM   7538  N  N   . GLY C 1 299 ? 22.564  58.859  49.767  1.00 36.05 ? 299  GLY C N   1 
ATOM   7539  C  CA  . GLY C 1 299 ? 21.166  59.218  49.929  1.00 38.55 ? 299  GLY C CA  1 
ATOM   7540  C  C   . GLY C 1 299 ? 20.570  59.774  48.650  1.00 40.16 ? 299  GLY C C   1 
ATOM   7541  O  O   . GLY C 1 299 ? 21.276  60.381  47.841  1.00 40.50 ? 299  GLY C O   1 
ATOM   7542  N  N   . GLY C 1 300 ? 19.268  59.568  48.468  1.00 41.47 ? 300  GLY C N   1 
ATOM   7543  C  CA  . GLY C 1 300 ? 18.590  60.054  47.278  1.00 43.18 ? 300  GLY C CA  1 
ATOM   7544  C  C   . GLY C 1 300 ? 18.502  61.568  47.198  1.00 44.04 ? 300  GLY C C   1 
ATOM   7545  O  O   . GLY C 1 300 ? 18.530  62.142  46.109  1.00 43.50 ? 300  GLY C O   1 
ATOM   7546  N  N   . ALA C 1 301 ? 18.387  62.214  48.356  1.00 45.35 ? 301  ALA C N   1 
ATOM   7547  C  CA  . ALA C 1 301 ? 18.295  63.668  48.430  1.00 46.22 ? 301  ALA C CA  1 
ATOM   7548  C  C   . ALA C 1 301 ? 19.627  64.303  48.827  1.00 47.15 ? 301  ALA C C   1 
ATOM   7549  O  O   . ALA C 1 301 ? 19.698  65.508  49.074  1.00 48.77 ? 301  ALA C O   1 
ATOM   7550  C  CB  . ALA C 1 301 ? 17.202  64.075  49.409  1.00 45.69 ? 301  ALA C CB  1 
ATOM   7551  N  N   . ILE C 1 302 ? 20.675  63.486  48.899  1.00 47.75 ? 302  ILE C N   1 
ATOM   7552  C  CA  . ILE C 1 302 ? 22.002  63.971  49.263  1.00 47.57 ? 302  ILE C CA  1 
ATOM   7553  C  C   . ILE C 1 302 ? 22.850  64.105  48.002  1.00 47.64 ? 302  ILE C C   1 
ATOM   7554  O  O   . ILE C 1 302 ? 23.527  63.160  47.593  1.00 46.32 ? 302  ILE C O   1 
ATOM   7555  C  CB  . ILE C 1 302 ? 22.711  63.011  50.253  1.00 48.62 ? 302  ILE C CB  1 
ATOM   7556  C  CG1 . ILE C 1 302 ? 21.779  62.648  51.417  1.00 48.71 ? 302  ILE C CG1 1 
ATOM   7557  C  CG2 . ILE C 1 302 ? 23.987  63.654  50.783  1.00 48.69 ? 302  ILE C CG2 1 
ATOM   7558  C  CD1 . ILE C 1 302 ? 21.295  63.832  52.235  1.00 50.23 ? 302  ILE C CD1 1 
ATOM   7559  N  N   . LYS C 1 303 ? 22.790  65.279  47.379  1.00 49.63 ? 303  LYS C N   1 
ATOM   7560  C  CA  . LYS C 1 303 ? 23.539  65.550  46.155  1.00 50.44 ? 303  LYS C CA  1 
ATOM   7561  C  C   . LYS C 1 303 ? 24.350  66.835  46.275  1.00 50.63 ? 303  LYS C C   1 
ATOM   7562  O  O   . LYS C 1 303 ? 23.972  67.753  47.005  1.00 50.32 ? 303  LYS C O   1 
ATOM   7563  C  CB  . LYS C 1 303 ? 22.587  65.666  44.958  1.00 51.99 ? 303  LYS C CB  1 
ATOM   7564  C  CG  . LYS C 1 303 ? 21.659  64.473  44.759  1.00 54.42 ? 303  LYS C CG  1 
ATOM   7565  C  CD  . LYS C 1 303 ? 22.435  63.188  44.512  1.00 56.37 ? 303  LYS C CD  1 
ATOM   7566  C  CE  . LYS C 1 303 ? 21.507  61.986  44.460  1.00 56.60 ? 303  LYS C CE  1 
ATOM   7567  N  NZ  . LYS C 1 303 ? 22.259  60.710  44.308  1.00 56.84 ? 303  LYS C NZ  1 
ATOM   7568  N  N   . GLY C 1 304 ? 25.465  66.888  45.551  1.00 51.64 ? 304  GLY C N   1 
ATOM   7569  C  CA  . GLY C 1 304 ? 26.326  68.060  45.563  1.00 51.47 ? 304  GLY C CA  1 
ATOM   7570  C  C   . GLY C 1 304 ? 26.926  68.394  46.915  1.00 51.47 ? 304  GLY C C   1 
ATOM   7571  O  O   . GLY C 1 304 ? 27.312  67.502  47.673  1.00 52.06 ? 304  GLY C O   1 
ATOM   7572  N  N   . GLN C 1 305 ? 27.011  69.690  47.206  1.00 51.65 ? 305  GLN C N   1 
ATOM   7573  C  CA  . GLN C 1 305 ? 27.563  70.181  48.466  1.00 50.63 ? 305  GLN C CA  1 
ATOM   7574  C  C   . GLN C 1 305 ? 26.528  70.017  49.583  1.00 49.77 ? 305  GLN C C   1 
ATOM   7575  O  O   . GLN C 1 305 ? 25.929  70.992  50.044  1.00 49.34 ? 305  GLN C O   1 
ATOM   7576  C  CB  . GLN C 1 305 ? 27.955  71.656  48.323  1.00 50.18 ? 305  GLN C CB  1 
ATOM   7577  C  CG  . GLN C 1 305 ? 28.945  71.963  47.199  1.00 49.81 ? 305  GLN C CG  1 
ATOM   7578  C  CD  . GLN C 1 305 ? 30.363  71.512  47.507  1.00 48.88 ? 305  GLN C CD  1 
ATOM   7579  O  OE1 . GLN C 1 305 ? 31.072  72.147  48.287  1.00 48.58 ? 305  GLN C OE1 1 
ATOM   7580  N  NE2 . GLN C 1 305 ? 30.788  70.421  46.882  1.00 49.19 ? 305  GLN C NE2 1 
ATOM   7581  N  N   . HIS C 1 306 ? 26.335  68.774  50.018  1.00 48.79 ? 306  HIS C N   1 
ATOM   7582  C  CA  . HIS C 1 306 ? 25.367  68.458  51.062  1.00 47.45 ? 306  HIS C CA  1 
ATOM   7583  C  C   . HIS C 1 306 ? 25.756  67.182  51.809  1.00 45.74 ? 306  HIS C C   1 
ATOM   7584  O  O   . HIS C 1 306 ? 26.176  66.197  51.197  1.00 45.64 ? 306  HIS C O   1 
ATOM   7585  C  CB  . HIS C 1 306 ? 23.975  68.298  50.436  1.00 48.32 ? 306  HIS C CB  1 
ATOM   7586  C  CG  . HIS C 1 306 ? 22.894  67.988  51.424  1.00 49.06 ? 306  HIS C CG  1 
ATOM   7587  N  ND1 . HIS C 1 306 ? 22.896  68.480  52.711  1.00 48.78 ? 306  HIS C ND1 1 
ATOM   7588  C  CD2 . HIS C 1 306 ? 21.774  67.237  51.311  1.00 49.10 ? 306  HIS C CD2 1 
ATOM   7589  C  CE1 . HIS C 1 306 ? 21.824  68.046  53.348  1.00 48.22 ? 306  HIS C CE1 1 
ATOM   7590  N  NE2 . HIS C 1 306 ? 21.126  67.289  52.521  1.00 48.85 ? 306  HIS C NE2 1 
ATOM   7591  N  N   . PHE C 1 307 ? 25.612  67.210  53.133  1.00 44.10 ? 307  PHE C N   1 
ATOM   7592  C  CA  . PHE C 1 307 ? 25.940  66.063  53.976  1.00 42.60 ? 307  PHE C CA  1 
ATOM   7593  C  C   . PHE C 1 307 ? 24.815  65.707  54.938  1.00 42.20 ? 307  PHE C C   1 
ATOM   7594  O  O   . PHE C 1 307 ? 24.076  66.577  55.400  1.00 42.80 ? 307  PHE C O   1 
ATOM   7595  C  CB  . PHE C 1 307 ? 27.212  66.327  54.787  1.00 40.35 ? 307  PHE C CB  1 
ATOM   7596  C  CG  . PHE C 1 307 ? 28.461  66.381  53.962  1.00 38.72 ? 307  PHE C CG  1 
ATOM   7597  C  CD1 . PHE C 1 307 ? 28.835  65.300  53.173  1.00 36.51 ? 307  PHE C CD1 1 
ATOM   7598  C  CD2 . PHE C 1 307 ? 29.269  67.511  53.978  1.00 38.95 ? 307  PHE C CD2 1 
ATOM   7599  C  CE1 . PHE C 1 307 ? 29.996  65.343  52.412  1.00 35.98 ? 307  PHE C CE1 1 
ATOM   7600  C  CE2 . PHE C 1 307 ? 30.433  67.564  53.221  1.00 39.22 ? 307  PHE C CE2 1 
ATOM   7601  C  CZ  . PHE C 1 307 ? 30.797  66.477  52.436  1.00 37.88 ? 307  PHE C CZ  1 
ATOM   7602  N  N   . ALA C 1 308 ? 24.703  64.418  55.239  1.00 41.84 ? 308  ALA C N   1 
ATOM   7603  C  CA  . ALA C 1 308 ? 23.691  63.920  56.160  1.00 41.76 ? 308  ALA C CA  1 
ATOM   7604  C  C   . ALA C 1 308 ? 24.403  63.272  57.339  1.00 40.51 ? 308  ALA C C   1 
ATOM   7605  O  O   . ALA C 1 308 ? 24.843  62.124  57.260  1.00 41.78 ? 308  ALA C O   1 
ATOM   7606  C  CB  . ALA C 1 308 ? 22.785  62.914  55.461  1.00 43.17 ? 308  ALA C CB  1 
ATOM   7607  N  N   . ILE C 1 309 ? 24.534  64.028  58.423  1.00 38.23 ? 309  ILE C N   1 
ATOM   7608  C  CA  . ILE C 1 309 ? 25.207  63.553  59.627  1.00 35.16 ? 309  ILE C CA  1 
ATOM   7609  C  C   . ILE C 1 309 ? 24.441  62.437  60.329  1.00 33.16 ? 309  ILE C C   1 
ATOM   7610  O  O   . ILE C 1 309 ? 23.285  62.615  60.721  1.00 34.13 ? 309  ILE C O   1 
ATOM   7611  C  CB  . ILE C 1 309 ? 25.428  64.704  60.632  1.00 34.79 ? 309  ILE C CB  1 
ATOM   7612  C  CG1 . ILE C 1 309 ? 26.159  65.863  59.951  1.00 32.70 ? 309  ILE C CG1 1 
ATOM   7613  C  CG2 . ILE C 1 309 ? 26.225  64.211  61.837  1.00 32.81 ? 309  ILE C CG2 1 
ATOM   7614  C  CD1 . ILE C 1 309 ? 26.257  67.105  60.804  1.00 33.88 ? 309  ILE C CD1 1 
ATOM   7615  N  N   . TYR C 1 310 ? 25.086  61.280  60.461  1.00 30.54 ? 310  TYR C N   1 
ATOM   7616  C  CA  . TYR C 1 310 ? 24.482  60.140  61.139  1.00 28.75 ? 310  TYR C CA  1 
ATOM   7617  C  C   . TYR C 1 310 ? 24.538  60.434  62.635  1.00 29.20 ? 310  TYR C C   1 
ATOM   7618  O  O   . TYR C 1 310 ? 25.618  60.481  63.221  1.00 30.16 ? 310  TYR C O   1 
ATOM   7619  C  CB  . TYR C 1 310 ? 25.253  58.855  60.819  1.00 25.59 ? 310  TYR C CB  1 
ATOM   7620  C  CG  . TYR C 1 310 ? 24.716  57.633  61.528  1.00 21.93 ? 310  TYR C CG  1 
ATOM   7621  C  CD1 . TYR C 1 310 ? 23.438  57.148  61.252  1.00 21.94 ? 310  TYR C CD1 1 
ATOM   7622  C  CD2 . TYR C 1 310 ? 25.475  56.975  62.492  1.00 21.37 ? 310  TYR C CD2 1 
ATOM   7623  C  CE1 . TYR C 1 310 ? 22.928  56.041  61.922  1.00 22.72 ? 310  TYR C CE1 1 
ATOM   7624  C  CE2 . TYR C 1 310 ? 24.975  55.866  63.169  1.00 21.08 ? 310  TYR C CE2 1 
ATOM   7625  C  CZ  . TYR C 1 310 ? 23.702  55.407  62.879  1.00 22.44 ? 310  TYR C CZ  1 
ATOM   7626  O  OH  . TYR C 1 310 ? 23.196  54.319  63.552  1.00 23.99 ? 310  TYR C OH  1 
ATOM   7627  N  N   . GLN C 1 311 ? 23.373  60.648  63.240  1.00 30.07 ? 311  GLN C N   1 
ATOM   7628  C  CA  . GLN C 1 311 ? 23.287  60.969  64.663  1.00 30.29 ? 311  GLN C CA  1 
ATOM   7629  C  C   . GLN C 1 311 ? 23.482  59.793  65.613  1.00 30.76 ? 311  GLN C C   1 
ATOM   7630  O  O   . GLN C 1 311 ? 24.151  59.931  66.642  1.00 31.89 ? 311  GLN C O   1 
ATOM   7631  C  CB  . GLN C 1 311 ? 21.966  61.674  64.964  1.00 29.99 ? 311  GLN C CB  1 
ATOM   7632  C  CG  . GLN C 1 311 ? 21.799  62.997  64.235  1.00 30.43 ? 311  GLN C CG  1 
ATOM   7633  C  CD  . GLN C 1 311 ? 22.869  64.008  64.595  1.00 30.87 ? 311  GLN C CD  1 
ATOM   7634  O  OE1 . GLN C 1 311 ? 23.278  64.112  65.750  1.00 33.02 ? 311  GLN C OE1 1 
ATOM   7635  N  NE2 . GLN C 1 311 ? 23.326  64.765  63.603  1.00 30.90 ? 311  GLN C NE2 1 
ATOM   7636  N  N   . GLY C 1 312 ? 22.879  58.652  65.288  1.00 30.02 ? 312  GLY C N   1 
ATOM   7637  C  CA  . GLY C 1 312 ? 23.022  57.482  66.137  1.00 28.56 ? 312  GLY C CA  1 
ATOM   7638  C  C   . GLY C 1 312 ? 21.824  56.554  66.147  1.00 28.22 ? 312  GLY C C   1 
ATOM   7639  O  O   . GLY C 1 312 ? 21.082  56.466  65.170  1.00 28.52 ? 312  GLY C O   1 
ATOM   7640  N  N   . ILE C 1 313 ? 21.640  55.862  67.267  1.00 27.85 ? 313  ILE C N   1 
ATOM   7641  C  CA  . ILE C 1 313 ? 20.538  54.919  67.436  1.00 28.39 ? 313  ILE C CA  1 
ATOM   7642  C  C   . ILE C 1 313 ? 19.683  55.318  68.639  1.00 29.34 ? 313  ILE C C   1 
ATOM   7643  O  O   . ILE C 1 313 ? 20.213  55.610  69.713  1.00 31.59 ? 313  ILE C O   1 
ATOM   7644  C  CB  . ILE C 1 313 ? 21.068  53.482  67.689  1.00 27.47 ? 313  ILE C CB  1 
ATOM   7645  C  CG1 . ILE C 1 313 ? 22.116  53.103  66.641  1.00 25.90 ? 313  ILE C CG1 1 
ATOM   7646  C  CG2 . ILE C 1 313 ? 19.919  52.480  67.659  1.00 27.53 ? 313  ILE C CG2 1 
ATOM   7647  C  CD1 . ILE C 1 313 ? 22.856  51.823  66.957  1.00 22.29 ? 313  ILE C CD1 1 
ATOM   7648  N  N   . GLY C 1 314 ? 18.366  55.339  68.455  1.00 30.32 ? 314  GLY C N   1 
ATOM   7649  C  CA  . GLY C 1 314 ? 17.479  55.682  69.552  1.00 33.56 ? 314  GLY C CA  1 
ATOM   7650  C  C   . GLY C 1 314 ? 16.707  56.983  69.432  1.00 36.08 ? 314  GLY C C   1 
ATOM   7651  O  O   . GLY C 1 314 ? 16.860  57.719  68.455  1.00 36.31 ? 314  GLY C O   1 
ATOM   7652  N  N   . PRO C 1 315 ? 15.857  57.289  70.429  1.00 37.58 ? 315  PRO C N   1 
ATOM   7653  C  CA  . PRO C 1 315 ? 15.019  58.490  70.507  1.00 39.78 ? 315  PRO C CA  1 
ATOM   7654  C  C   . PRO C 1 315 ? 15.820  59.788  70.511  1.00 41.38 ? 315  PRO C C   1 
ATOM   7655  O  O   . PRO C 1 315 ? 15.583  60.670  69.686  1.00 42.33 ? 315  PRO C O   1 
ATOM   7656  C  CB  . PRO C 1 315 ? 14.279  58.301  71.832  1.00 38.86 ? 315  PRO C CB  1 
ATOM   7657  C  CG  . PRO C 1 315 ? 14.195  56.815  71.965  1.00 38.00 ? 315  PRO C CG  1 
ATOM   7658  C  CD  . PRO C 1 315 ? 15.584  56.400  71.572  1.00 36.82 ? 315  PRO C CD  1 
ATOM   7659  N  N   . GLU C 1 316 ? 16.764  59.895  71.445  1.00 43.62 ? 316  GLU C N   1 
ATOM   7660  C  CA  . GLU C 1 316 ? 17.608  61.081  71.578  1.00 44.96 ? 316  GLU C CA  1 
ATOM   7661  C  C   . GLU C 1 316 ? 18.340  61.414  70.282  1.00 44.58 ? 316  GLU C C   1 
ATOM   7662  O  O   . GLU C 1 316 ? 18.519  62.585  69.944  1.00 44.82 ? 316  GLU C O   1 
ATOM   7663  C  CB  . GLU C 1 316 ? 18.606  60.897  72.724  1.00 47.07 ? 316  GLU C CB  1 
ATOM   7664  C  CG  . GLU C 1 316 ? 17.947  60.737  74.088  1.00 49.58 ? 316  GLU C CG  1 
ATOM   7665  C  CD  . GLU C 1 316 ? 18.950  60.535  75.209  1.00 51.41 ? 316  GLU C CD  1 
ATOM   7666  O  OE1 . GLU C 1 316 ? 19.599  61.524  75.616  1.00 51.54 ? 316  GLU C OE1 1 
ATOM   7667  O  OE2 . GLU C 1 316 ? 19.084  59.389  75.687  1.00 51.95 ? 316  GLU C OE2 1 
ATOM   7668  N  N   . ALA C 1 317 ? 18.744  60.375  69.554  1.00 44.63 ? 317  ALA C N   1 
ATOM   7669  C  CA  . ALA C 1 317 ? 19.439  60.540  68.281  1.00 42.93 ? 317  ALA C CA  1 
ATOM   7670  C  C   . ALA C 1 317 ? 18.460  61.035  67.217  1.00 42.62 ? 317  ALA C C   1 
ATOM   7671  O  O   . ALA C 1 317 ? 18.854  61.701  66.259  1.00 41.60 ? 317  ALA C O   1 
ATOM   7672  C  CB  . ALA C 1 317 ? 20.060  59.222  67.851  1.00 42.20 ? 317  ALA C CB  1 
ATOM   7673  N  N   . GLY C 1 318 ? 17.183  60.703  67.401  1.00 42.82 ? 318  GLY C N   1 
ATOM   7674  C  CA  . GLY C 1 318 ? 16.148  61.116  66.469  1.00 43.02 ? 318  GLY C CA  1 
ATOM   7675  C  C   . GLY C 1 318 ? 15.731  62.563  66.637  1.00 43.33 ? 318  GLY C C   1 
ATOM   7676  O  O   . GLY C 1 318 ? 15.444  63.249  65.654  1.00 43.83 ? 318  GLY C O   1 
ATOM   7677  N  N   . HIS C 1 319 ? 15.681  63.020  67.886  1.00 43.26 ? 319  HIS C N   1 
ATOM   7678  C  CA  . HIS C 1 319 ? 15.308  64.396  68.196  1.00 43.09 ? 319  HIS C CA  1 
ATOM   7679  C  C   . HIS C 1 319 ? 16.380  65.328  67.644  1.00 41.98 ? 319  HIS C C   1 
ATOM   7680  O  O   . HIS C 1 319 ? 16.079  66.357  67.041  1.00 41.75 ? 319  HIS C O   1 
ATOM   7681  C  CB  . HIS C 1 319 ? 15.195  64.590  69.712  1.00 44.82 ? 319  HIS C CB  1 
ATOM   7682  C  CG  . HIS C 1 319 ? 14.246  63.641  70.378  1.00 46.42 ? 319  HIS C CG  1 
ATOM   7683  N  ND1 . HIS C 1 319 ? 13.122  63.148  69.751  1.00 47.51 ? 319  HIS C ND1 1 
ATOM   7684  C  CD2 . HIS C 1 319 ? 14.259  63.091  71.615  1.00 47.44 ? 319  HIS C CD2 1 
ATOM   7685  C  CE1 . HIS C 1 319 ? 12.484  62.334  70.573  1.00 48.09 ? 319  HIS C CE1 1 
ATOM   7686  N  NE2 . HIS C 1 319 ? 13.153  62.282  71.711  1.00 48.18 ? 319  HIS C NE2 1 
ATOM   7687  N  N   . ARG C 1 320 ? 17.633  64.929  67.835  1.00 41.25 ? 320  ARG C N   1 
ATOM   7688  C  CA  . ARG C 1 320 ? 18.790  65.689  67.382  1.00 40.02 ? 320  ARG C CA  1 
ATOM   7689  C  C   . ARG C 1 320 ? 18.883  65.728  65.855  1.00 40.76 ? 320  ARG C C   1 
ATOM   7690  O  O   . ARG C 1 320 ? 19.264  66.747  65.277  1.00 40.96 ? 320  ARG C O   1 
ATOM   7691  C  CB  . ARG C 1 320 ? 20.056  65.073  67.984  1.00 38.96 ? 320  ARG C CB  1 
ATOM   7692  C  CG  . ARG C 1 320 ? 21.341  65.846  67.746  1.00 37.34 ? 320  ARG C CG  1 
ATOM   7693  C  CD  . ARG C 1 320 ? 22.467  65.305  68.624  1.00 35.25 ? 320  ARG C CD  1 
ATOM   7694  N  NE  . ARG C 1 320 ? 22.695  63.874  68.423  1.00 32.35 ? 320  ARG C NE  1 
ATOM   7695  C  CZ  . ARG C 1 320 ? 22.631  62.959  69.386  1.00 32.74 ? 320  ARG C CZ  1 
ATOM   7696  N  NH1 . ARG C 1 320 ? 22.344  63.314  70.632  1.00 32.12 ? 320  ARG C NH1 1 
ATOM   7697  N  NH2 . ARG C 1 320 ? 22.858  61.682  69.103  1.00 33.78 ? 320  ARG C NH2 1 
ATOM   7698  N  N   . ALA C 1 321 ? 18.496  64.629  65.212  1.00 40.97 ? 321  ALA C N   1 
ATOM   7699  C  CA  . ALA C 1 321 ? 18.535  64.513  63.754  1.00 40.76 ? 321  ALA C CA  1 
ATOM   7700  C  C   . ALA C 1 321 ? 17.434  65.290  63.038  1.00 40.79 ? 321  ALA C C   1 
ATOM   7701  O  O   . ALA C 1 321 ? 17.679  65.901  61.997  1.00 40.28 ? 321  ALA C O   1 
ATOM   7702  C  CB  . ALA C 1 321 ? 18.478  63.047  63.348  1.00 40.78 ? 321  ALA C CB  1 
ATOM   7703  N  N   . GLY C 1 322 ? 16.225  65.252  63.593  1.00 41.63 ? 322  GLY C N   1 
ATOM   7704  C  CA  . GLY C 1 322 ? 15.096  65.942  62.990  1.00 43.25 ? 322  GLY C CA  1 
ATOM   7705  C  C   . GLY C 1 322 ? 15.219  67.454  62.907  1.00 44.42 ? 322  GLY C C   1 
ATOM   7706  O  O   . GLY C 1 322 ? 14.604  68.082  62.042  1.00 44.14 ? 322  GLY C O   1 
ATOM   7707  N  N   . TRP C 1 323 ? 16.010  68.036  63.806  1.00 45.28 ? 323  TRP C N   1 
ATOM   7708  C  CA  . TRP C 1 323 ? 16.215  69.482  63.846  1.00 45.22 ? 323  TRP C CA  1 
ATOM   7709  C  C   . TRP C 1 323 ? 17.227  70.001  62.829  1.00 46.26 ? 323  TRP C C   1 
ATOM   7710  O  O   . TRP C 1 323 ? 17.106  71.129  62.351  1.00 46.65 ? 323  TRP C O   1 
ATOM   7711  C  CB  . TRP C 1 323 ? 16.645  69.922  65.249  1.00 43.72 ? 323  TRP C CB  1 
ATOM   7712  C  CG  . TRP C 1 323 ? 15.539  69.930  66.261  1.00 43.74 ? 323  TRP C CG  1 
ATOM   7713  C  CD1 . TRP C 1 323 ? 15.504  69.245  67.441  1.00 43.08 ? 323  TRP C CD1 1 
ATOM   7714  C  CD2 . TRP C 1 323 ? 14.314  70.673  66.192  1.00 44.08 ? 323  TRP C CD2 1 
ATOM   7715  N  NE1 . TRP C 1 323 ? 14.335  69.515  68.112  1.00 43.00 ? 323  TRP C NE1 1 
ATOM   7716  C  CE2 . TRP C 1 323 ? 13.587  70.388  67.369  1.00 43.29 ? 323  TRP C CE2 1 
ATOM   7717  C  CE3 . TRP C 1 323 ? 13.763  71.555  65.251  1.00 44.54 ? 323  TRP C CE3 1 
ATOM   7718  C  CZ2 . TRP C 1 323 ? 12.333  70.953  67.632  1.00 43.52 ? 323  TRP C CZ2 1 
ATOM   7719  C  CZ3 . TRP C 1 323 ? 12.516  72.118  65.514  1.00 43.95 ? 323  TRP C CZ3 1 
ATOM   7720  C  CH2 . TRP C 1 323 ? 11.816  71.813  66.696  1.00 43.42 ? 323  TRP C CH2 1 
ATOM   7721  N  N   . TYR C 1 324 ? 18.218  69.177  62.499  1.00 47.99 ? 324  TYR C N   1 
ATOM   7722  C  CA  . TYR C 1 324 ? 19.260  69.577  61.560  1.00 49.65 ? 324  TYR C CA  1 
ATOM   7723  C  C   . TYR C 1 324 ? 18.803  69.975  60.165  1.00 50.62 ? 324  TYR C C   1 
ATOM   7724  O  O   . TYR C 1 324 ? 18.285  69.161  59.398  1.00 50.52 ? 324  TYR C O   1 
ATOM   7725  C  CB  . TYR C 1 324 ? 20.370  68.525  61.491  1.00 51.38 ? 324  TYR C CB  1 
ATOM   7726  C  CG  . TYR C 1 324 ? 21.401  68.690  62.585  1.00 53.40 ? 324  TYR C CG  1 
ATOM   7727  C  CD1 . TYR C 1 324 ? 22.322  69.738  62.546  1.00 53.69 ? 324  TYR C CD1 1 
ATOM   7728  C  CD2 . TYR C 1 324 ? 21.435  67.825  63.677  1.00 54.09 ? 324  TYR C CD2 1 
ATOM   7729  C  CE1 . TYR C 1 324 ? 23.248  69.924  63.571  1.00 54.44 ? 324  TYR C CE1 1 
ATOM   7730  C  CE2 . TYR C 1 324 ? 22.357  68.001  64.709  1.00 55.46 ? 324  TYR C CE2 1 
ATOM   7731  C  CZ  . TYR C 1 324 ? 23.260  69.053  64.650  1.00 55.15 ? 324  TYR C CZ  1 
ATOM   7732  O  OH  . TYR C 1 324 ? 24.166  69.237  65.670  1.00 55.51 ? 324  TYR C OH  1 
ATOM   7733  N  N   . ASN C 1 325 ? 19.005  71.256  59.867  1.00 51.64 ? 325  ASN C N   1 
ATOM   7734  C  CA  . ASN C 1 325 ? 18.660  71.864  58.585  1.00 52.40 ? 325  ASN C CA  1 
ATOM   7735  C  C   . ASN C 1 325 ? 19.422  73.193  58.542  1.00 52.23 ? 325  ASN C C   1 
ATOM   7736  O  O   . ASN C 1 325 ? 18.949  74.189  57.987  1.00 51.73 ? 325  ASN C O   1 
ATOM   7737  C  CB  . ASN C 1 325 ? 17.146  72.105  58.500  1.00 52.64 ? 325  ASN C CB  1 
ATOM   7738  C  CG  . ASN C 1 325 ? 16.668  72.367  57.078  1.00 53.13 ? 325  ASN C CG  1 
ATOM   7739  O  OD1 . ASN C 1 325 ? 17.455  72.353  56.129  1.00 54.01 ? 325  ASN C OD1 1 
ATOM   7740  N  ND2 . ASN C 1 325 ? 15.368  72.600  56.927  1.00 51.48 ? 325  ASN C ND2 1 
ATOM   7741  N  N   . HIS C 1 326 ? 20.613  73.185  59.140  1.00 52.15 ? 326  HIS C N   1 
ATOM   7742  C  CA  . HIS C 1 326 ? 21.469  74.365  59.218  1.00 51.54 ? 326  HIS C CA  1 
ATOM   7743  C  C   . HIS C 1 326 ? 22.706  74.272  58.324  1.00 50.25 ? 326  HIS C C   1 
ATOM   7744  O  O   . HIS C 1 326 ? 22.819  73.366  57.499  1.00 49.59 ? 326  HIS C O   1 
ATOM   7745  C  CB  . HIS C 1 326 ? 21.883  74.608  60.673  1.00 52.25 ? 326  HIS C CB  1 
ATOM   7746  C  CG  . HIS C 1 326 ? 20.727  74.827  61.600  1.00 53.11 ? 326  HIS C CG  1 
ATOM   7747  N  ND1 . HIS C 1 326 ? 19.667  73.950  61.690  1.00 53.32 ? 326  HIS C ND1 1 
ATOM   7748  C  CD2 . HIS C 1 326 ? 20.460  75.829  62.470  1.00 53.85 ? 326  HIS C CD2 1 
ATOM   7749  C  CE1 . HIS C 1 326 ? 18.797  74.403  62.574  1.00 54.07 ? 326  HIS C CE1 1 
ATOM   7750  N  NE2 . HIS C 1 326 ? 19.254  75.542  63.062  1.00 54.62 ? 326  HIS C NE2 1 
ATOM   7751  N  N   . TYR C 1 327 ? 23.626  75.222  58.491  1.00 49.01 ? 327  TYR C N   1 
ATOM   7752  C  CA  . TYR C 1 327 ? 24.852  75.271  57.697  1.00 48.40 ? 327  TYR C CA  1 
ATOM   7753  C  C   . TYR C 1 327 ? 26.116  75.324  58.552  1.00 47.77 ? 327  TYR C C   1 
ATOM   7754  O  O   . TYR C 1 327 ? 26.087  75.766  59.701  1.00 47.59 ? 327  TYR C O   1 
ATOM   7755  C  CB  . TYR C 1 327 ? 24.830  76.479  56.756  1.00 47.93 ? 327  TYR C CB  1 
ATOM   7756  C  CG  . TYR C 1 327 ? 23.707  76.464  55.743  1.00 48.42 ? 327  TYR C CG  1 
ATOM   7757  C  CD1 . TYR C 1 327 ? 22.396  76.760  56.119  1.00 49.28 ? 327  TYR C CD1 1 
ATOM   7758  C  CD2 . TYR C 1 327 ? 23.954  76.166  54.406  1.00 49.56 ? 327  TYR C CD2 1 
ATOM   7759  C  CE1 . TYR C 1 327 ? 21.361  76.761  55.190  1.00 50.32 ? 327  TYR C CE1 1 
ATOM   7760  C  CE2 . TYR C 1 327 ? 22.926  76.165  53.467  1.00 51.25 ? 327  TYR C CE2 1 
ATOM   7761  C  CZ  . TYR C 1 327 ? 21.632  76.464  53.866  1.00 51.64 ? 327  TYR C CZ  1 
ATOM   7762  O  OH  . TYR C 1 327 ? 20.611  76.471  52.941  1.00 52.51 ? 327  TYR C OH  1 
ATOM   7763  N  N   . GLY C 1 328 ? 27.229  74.893  57.964  1.00 46.96 ? 328  GLY C N   1 
ATOM   7764  C  CA  . GLY C 1 328 ? 28.503  74.890  58.662  1.00 46.35 ? 328  GLY C CA  1 
ATOM   7765  C  C   . GLY C 1 328 ? 29.656  74.616  57.716  1.00 46.57 ? 328  GLY C C   1 
ATOM   7766  O  O   . GLY C 1 328 ? 29.468  74.012  56.660  1.00 48.04 ? 328  GLY C O   1 
ATOM   7767  N  N   . ARG C 1 329 ? 30.853  75.053  58.097  1.00 45.82 ? 329  ARG C N   1 
ATOM   7768  C  CA  . ARG C 1 329 ? 32.049  74.866  57.276  1.00 44.20 ? 329  ARG C CA  1 
ATOM   7769  C  C   . ARG C 1 329 ? 32.607  73.445  57.367  1.00 41.09 ? 329  ARG C C   1 
ATOM   7770  O  O   . ARG C 1 329 ? 32.477  72.785  58.397  1.00 39.68 ? 329  ARG C O   1 
ATOM   7771  C  CB  . ARG C 1 329 ? 33.124  75.870  57.692  1.00 46.62 ? 329  ARG C CB  1 
ATOM   7772  C  CG  . ARG C 1 329 ? 32.663  77.317  57.663  1.00 49.75 ? 329  ARG C CG  1 
ATOM   7773  C  CD  . ARG C 1 329 ? 33.633  78.214  58.407  1.00 53.84 ? 329  ARG C CD  1 
ATOM   7774  N  NE  . ARG C 1 329 ? 33.835  77.775  59.787  1.00 57.94 ? 329  ARG C NE  1 
ATOM   7775  C  CZ  . ARG C 1 329 ? 33.702  78.555  60.856  1.00 59.38 ? 329  ARG C CZ  1 
ATOM   7776  N  NH1 . ARG C 1 329 ? 33.363  79.828  60.719  1.00 59.80 ? 329  ARG C NH1 1 
ATOM   7777  N  NH2 . ARG C 1 329 ? 33.922  78.065  62.068  1.00 59.49 ? 329  ARG C NH2 1 
ATOM   7778  N  N   . VAL C 1 330 ? 33.237  72.988  56.288  1.00 38.54 ? 330  VAL C N   1 
ATOM   7779  C  CA  . VAL C 1 330 ? 33.818  71.648  56.243  1.00 36.63 ? 330  VAL C CA  1 
ATOM   7780  C  C   . VAL C 1 330 ? 35.044  71.574  55.334  1.00 34.64 ? 330  VAL C C   1 
ATOM   7781  O  O   . VAL C 1 330 ? 35.067  72.157  54.249  1.00 34.20 ? 330  VAL C O   1 
ATOM   7782  C  CB  . VAL C 1 330 ? 32.768  70.583  55.811  1.00 36.96 ? 330  VAL C CB  1 
ATOM   7783  C  CG1 . VAL C 1 330 ? 32.167  70.941  54.471  1.00 37.36 ? 330  VAL C CG1 1 
ATOM   7784  C  CG2 . VAL C 1 330 ? 33.395  69.194  55.761  1.00 36.02 ? 330  VAL C CG2 1 
ATOM   7785  N  N   . TRP C 1 331 ? 36.070  70.871  55.805  1.00 33.56 ? 331  TRP C N   1 
ATOM   7786  C  CA  . TRP C 1 331 ? 37.310  70.703  55.058  1.00 32.69 ? 331  TRP C CA  1 
ATOM   7787  C  C   . TRP C 1 331 ? 37.553  69.234  54.732  1.00 32.36 ? 331  TRP C C   1 
ATOM   7788  O  O   . TRP C 1 331 ? 37.519  68.375  55.615  1.00 31.79 ? 331  TRP C O   1 
ATOM   7789  C  CB  . TRP C 1 331 ? 38.503  71.243  55.857  1.00 33.57 ? 331  TRP C CB  1 
ATOM   7790  C  CG  . TRP C 1 331 ? 38.450  72.716  56.136  1.00 32.31 ? 331  TRP C CG  1 
ATOM   7791  C  CD1 . TRP C 1 331 ? 39.124  73.700  55.473  1.00 30.66 ? 331  TRP C CD1 1 
ATOM   7792  C  CD2 . TRP C 1 331 ? 37.676  73.373  57.149  1.00 32.38 ? 331  TRP C CD2 1 
ATOM   7793  N  NE1 . TRP C 1 331 ? 38.818  74.928  56.008  1.00 29.12 ? 331  TRP C NE1 1 
ATOM   7794  C  CE2 . TRP C 1 331 ? 37.930  74.757  57.036  1.00 30.80 ? 331  TRP C CE2 1 
ATOM   7795  C  CE3 . TRP C 1 331 ? 36.791  72.925  58.141  1.00 33.12 ? 331  TRP C CE3 1 
ATOM   7796  C  CZ2 . TRP C 1 331 ? 37.330  75.701  57.877  1.00 31.89 ? 331  TRP C CZ2 1 
ATOM   7797  C  CZ3 . TRP C 1 331 ? 36.194  73.864  58.977  1.00 34.02 ? 331  TRP C CZ3 1 
ATOM   7798  C  CH2 . TRP C 1 331 ? 36.468  75.237  58.837  1.00 33.10 ? 331  TRP C CH2 1 
ATOM   7799  N  N   . VAL C 1 332 ? 37.774  68.953  53.452  1.00 33.11 ? 332  VAL C N   1 
ATOM   7800  C  CA  . VAL C 1 332 ? 38.047  67.597  52.993  1.00 32.78 ? 332  VAL C CA  1 
ATOM   7801  C  C   . VAL C 1 332 ? 39.523  67.314  53.268  1.00 32.69 ? 332  VAL C C   1 
ATOM   7802  O  O   . VAL C 1 332 ? 40.404  67.875  52.613  1.00 33.13 ? 332  VAL C O   1 
ATOM   7803  C  CB  . VAL C 1 332 ? 37.759  67.450  51.477  1.00 33.24 ? 332  VAL C CB  1 
ATOM   7804  C  CG1 . VAL C 1 332 ? 38.078  66.039  51.006  1.00 33.13 ? 332  VAL C CG1 1 
ATOM   7805  C  CG2 . VAL C 1 332 ? 36.307  67.790  51.182  1.00 31.45 ? 332  VAL C CG2 1 
ATOM   7806  N  N   . LEU C 1 333 ? 39.787  66.470  54.259  1.00 31.01 ? 333  LEU C N   1 
ATOM   7807  C  CA  . LEU C 1 333 ? 41.157  66.134  54.625  1.00 31.34 ? 333  LEU C CA  1 
ATOM   7808  C  C   . LEU C 1 333 ? 41.776  65.077  53.718  1.00 32.31 ? 333  LEU C C   1 
ATOM   7809  O  O   . LEU C 1 333 ? 41.243  63.977  53.567  1.00 33.32 ? 333  LEU C O   1 
ATOM   7810  C  CB  . LEU C 1 333 ? 41.225  65.687  56.086  1.00 29.65 ? 333  LEU C CB  1 
ATOM   7811  C  CG  . LEU C 1 333 ? 40.692  66.692  57.110  1.00 27.95 ? 333  LEU C CG  1 
ATOM   7812  C  CD1 . LEU C 1 333 ? 40.877  66.140  58.512  1.00 27.60 ? 333  LEU C CD1 1 
ATOM   7813  C  CD2 . LEU C 1 333 ? 41.406  68.029  56.961  1.00 26.87 ? 333  LEU C CD2 1 
ATOM   7814  N  N   . LYS C 1 334 ? 42.902  65.433  53.109  1.00 34.55 ? 334  LYS C N   1 
ATOM   7815  C  CA  . LYS C 1 334 ? 43.631  64.545  52.208  1.00 36.70 ? 334  LYS C CA  1 
ATOM   7816  C  C   . LYS C 1 334 ? 45.113  64.574  52.578  1.00 37.25 ? 334  LYS C C   1 
ATOM   7817  O  O   . LYS C 1 334 ? 45.491  65.158  53.594  1.00 37.52 ? 334  LYS C O   1 
ATOM   7818  C  CB  . LYS C 1 334 ? 43.435  64.990  50.752  1.00 36.70 ? 334  LYS C CB  1 
ATOM   7819  C  CG  . LYS C 1 334 ? 41.987  64.937  50.275  1.00 38.18 ? 334  LYS C CG  1 
ATOM   7820  C  CD  . LYS C 1 334 ? 41.817  65.519  48.878  1.00 41.94 ? 334  LYS C CD  1 
ATOM   7821  C  CE  . LYS C 1 334 ? 42.557  64.706  47.825  1.00 45.98 ? 334  LYS C CE  1 
ATOM   7822  N  NZ  . LYS C 1 334 ? 42.365  65.266  46.456  1.00 45.32 ? 334  LYS C NZ  1 
ATOM   7823  N  N   . THR C 1 335 ? 45.947  63.929  51.768  1.00 38.62 ? 335  THR C N   1 
ATOM   7824  C  CA  . THR C 1 335 ? 47.384  63.899  52.026  1.00 39.23 ? 335  THR C CA  1 
ATOM   7825  C  C   . THR C 1 335 ? 48.143  64.930  51.197  1.00 40.03 ? 335  THR C C   1 
ATOM   7826  O  O   . THR C 1 335 ? 47.681  65.350  50.134  1.00 39.96 ? 335  THR C O   1 
ATOM   7827  C  CB  . THR C 1 335 ? 47.984  62.500  51.769  1.00 38.64 ? 335  THR C CB  1 
ATOM   7828  O  OG1 . THR C 1 335 ? 47.571  62.021  50.483  1.00 39.35 ? 335  THR C OG1 1 
ATOM   7829  C  CG2 . THR C 1 335 ? 47.537  61.528  52.842  1.00 39.53 ? 335  THR C CG2 1 
ATOM   7830  N  N   . ALA C 1 336 ? 49.306  65.338  51.701  1.00 41.26 ? 336  ALA C N   1 
ATOM   7831  C  CA  . ALA C 1 336 ? 50.151  66.317  51.026  1.00 41.49 ? 336  ALA C CA  1 
ATOM   7832  C  C   . ALA C 1 336 ? 51.171  65.641  50.110  1.00 41.77 ? 336  ALA C C   1 
ATOM   7833  O  O   . ALA C 1 336 ? 51.967  64.815  50.558  1.00 42.20 ? 336  ALA C O   1 
ATOM   7834  C  CB  . ALA C 1 336 ? 50.863  67.189  52.053  1.00 41.19 ? 336  ALA C CB  1 
ATOM   7835  N  N   . PRO C 1 337 ? 51.147  65.976  48.807  1.00 42.41 ? 337  PRO C N   1 
ATOM   7836  C  CA  . PRO C 1 337 ? 52.063  65.413  47.808  1.00 43.47 ? 337  PRO C CA  1 
ATOM   7837  C  C   . PRO C 1 337 ? 53.519  65.873  47.972  1.00 44.43 ? 337  PRO C C   1 
ATOM   7838  O  O   . PRO C 1 337 ? 53.896  66.925  47.411  1.00 45.20 ? 337  PRO C O   1 
ATOM   7839  C  CB  . PRO C 1 337 ? 51.450  65.882  46.485  1.00 43.02 ? 337  PRO C CB  1 
ATOM   7840  C  CG  . PRO C 1 337 ? 50.810  67.184  46.853  1.00 42.54 ? 337  PRO C CG  1 
ATOM   7841  C  CD  . PRO C 1 337 ? 50.151  66.855  48.167  1.00 42.72 ? 337  PRO C CD  1 
ATOM   7842  N  N   . SER D 1 3   ? -20.183 12.052  93.184  1.00 50.26 ? 3    SER D N   1 
ATOM   7843  C  CA  . SER D 1 3   ? -18.894 11.902  92.443  1.00 50.31 ? 3    SER D CA  1 
ATOM   7844  C  C   . SER D 1 3   ? -18.130 13.223  92.375  1.00 50.00 ? 3    SER D C   1 
ATOM   7845  O  O   . SER D 1 3   ? -18.588 14.245  92.891  1.00 50.36 ? 3    SER D O   1 
ATOM   7846  C  CB  . SER D 1 3   ? -19.156 11.384  91.026  1.00 49.78 ? 3    SER D CB  1 
ATOM   7847  O  OG  . SER D 1 3   ? -19.940 12.300  90.278  1.00 49.03 ? 3    SER D OG  1 
ATOM   7848  N  N   . LYS D 1 4   ? -16.955 13.188  91.752  1.00 49.77 ? 4    LYS D N   1 
ATOM   7849  C  CA  . LYS D 1 4   ? -16.124 14.379  91.599  1.00 49.62 ? 4    LYS D CA  1 
ATOM   7850  C  C   . LYS D 1 4   ? -16.440 15.024  90.253  1.00 50.46 ? 4    LYS D C   1 
ATOM   7851  O  O   . LYS D 1 4   ? -16.070 14.494  89.202  1.00 49.86 ? 4    LYS D O   1 
ATOM   7852  C  CB  . LYS D 1 4   ? -14.631 14.025  91.659  1.00 46.60 ? 4    LYS D CB  1 
ATOM   7853  C  CG  . LYS D 1 4   ? -14.222 13.160  92.838  1.00 44.94 ? 4    LYS D CG  1 
ATOM   7854  C  CD  . LYS D 1 4   ? -14.422 11.685  92.530  1.00 44.06 ? 4    LYS D CD  1 
ATOM   7855  C  CE  . LYS D 1 4   ? -14.325 10.842  93.785  1.00 45.54 ? 4    LYS D CE  1 
ATOM   7856  N  NZ  . LYS D 1 4   ? -15.442 11.135  94.729  1.00 46.95 ? 4    LYS D NZ  1 
ATOM   7857  N  N   . PRO D 1 5   ? -17.144 16.170  90.266  1.00 50.89 ? 5    PRO D N   1 
ATOM   7858  C  CA  . PRO D 1 5   ? -17.507 16.880  89.035  1.00 50.50 ? 5    PRO D CA  1 
ATOM   7859  C  C   . PRO D 1 5   ? -16.275 17.326  88.248  1.00 49.70 ? 5    PRO D C   1 
ATOM   7860  O  O   . PRO D 1 5   ? -15.485 18.142  88.720  1.00 50.11 ? 5    PRO D O   1 
ATOM   7861  C  CB  . PRO D 1 5   ? -18.320 18.068  89.556  1.00 51.24 ? 5    PRO D CB  1 
ATOM   7862  C  CG  . PRO D 1 5   ? -17.738 18.311  90.921  1.00 51.27 ? 5    PRO D CG  1 
ATOM   7863  C  CD  . PRO D 1 5   ? -17.605 16.910  91.454  1.00 50.86 ? 5    PRO D CD  1 
ATOM   7864  N  N   . THR D 1 6   ? -16.118 16.771  87.049  1.00 48.89 ? 6    THR D N   1 
ATOM   7865  C  CA  . THR D 1 6   ? -14.982 17.083  86.185  1.00 47.78 ? 6    THR D CA  1 
ATOM   7866  C  C   . THR D 1 6   ? -15.079 18.431  85.472  1.00 47.57 ? 6    THR D C   1 
ATOM   7867  O  O   . THR D 1 6   ? -14.603 18.579  84.344  1.00 48.34 ? 6    THR D O   1 
ATOM   7868  C  CB  . THR D 1 6   ? -14.758 15.970  85.139  1.00 48.30 ? 6    THR D CB  1 
ATOM   7869  O  OG1 . THR D 1 6   ? -15.998 15.659  84.491  1.00 48.64 ? 6    THR D OG1 1 
ATOM   7870  C  CG2 . THR D 1 6   ? -14.201 14.719  85.800  1.00 48.52 ? 6    THR D CG2 1 
ATOM   7871  N  N   . ASP D 1 7   ? -15.685 19.414  86.134  1.00 46.47 ? 7    ASP D N   1 
ATOM   7872  C  CA  . ASP D 1 7   ? -15.826 20.752  85.564  1.00 44.82 ? 7    ASP D CA  1 
ATOM   7873  C  C   . ASP D 1 7   ? -14.474 21.465  85.546  1.00 44.13 ? 7    ASP D C   1 
ATOM   7874  O  O   . ASP D 1 7   ? -14.243 22.365  84.736  1.00 43.17 ? 7    ASP D O   1 
ATOM   7875  C  CB  . ASP D 1 7   ? -16.855 21.572  86.356  1.00 44.83 ? 7    ASP D CB  1 
ATOM   7876  C  CG  . ASP D 1 7   ? -16.454 21.783  87.807  1.00 43.92 ? 7    ASP D CG  1 
ATOM   7877  O  OD1 . ASP D 1 7   ? -16.590 20.838  88.610  1.00 44.37 ? 7    ASP D OD1 1 
ATOM   7878  O  OD2 . ASP D 1 7   ? -16.010 22.899  88.147  1.00 44.42 ? 7    ASP D OD2 1 
ATOM   7879  N  N   . ARG D 1 8   ? -13.586 21.041  86.442  1.00 43.69 ? 8    ARG D N   1 
ATOM   7880  C  CA  . ARG D 1 8   ? -12.245 21.607  86.557  1.00 42.93 ? 8    ARG D CA  1 
ATOM   7881  C  C   . ARG D 1 8   ? -11.169 20.519  86.505  1.00 43.89 ? 8    ARG D C   1 
ATOM   7882  O  O   . ARG D 1 8   ? -10.080 20.683  87.058  1.00 43.85 ? 8    ARG D O   1 
ATOM   7883  C  CB  . ARG D 1 8   ? -12.118 22.414  87.851  1.00 39.33 ? 8    ARG D CB  1 
ATOM   7884  C  CG  . ARG D 1 8   ? -12.776 23.781  87.797  1.00 36.61 ? 8    ARG D CG  1 
ATOM   7885  C  CD  . ARG D 1 8   ? -12.860 24.409  89.178  1.00 35.84 ? 8    ARG D CD  1 
ATOM   7886  N  NE  . ARG D 1 8   ? -11.554 24.538  89.819  1.00 33.16 ? 8    ARG D NE  1 
ATOM   7887  C  CZ  . ARG D 1 8   ? -11.377 24.749  91.120  1.00 32.60 ? 8    ARG D CZ  1 
ATOM   7888  N  NH1 . ARG D 1 8   ? -12.423 24.856  91.927  1.00 32.42 ? 8    ARG D NH1 1 
ATOM   7889  N  NH2 . ARG D 1 8   ? -10.152 24.858  91.615  1.00 33.16 ? 8    ARG D NH2 1 
ATOM   7890  N  N   . GLY D 1 9   ? -11.489 19.406  85.849  1.00 43.19 ? 9    GLY D N   1 
ATOM   7891  C  CA  . GLY D 1 9   ? -10.542 18.311  85.719  1.00 44.12 ? 9    GLY D CA  1 
ATOM   7892  C  C   . GLY D 1 9   ? -10.258 17.515  86.979  1.00 44.48 ? 9    GLY D C   1 
ATOM   7893  O  O   . GLY D 1 9   ? -9.227  17.711  87.620  1.00 45.06 ? 9    GLY D O   1 
ATOM   7894  N  N   . GLN D 1 10  ? -11.164 16.603  87.321  1.00 45.06 ? 10   GLN D N   1 
ATOM   7895  C  CA  . GLN D 1 10  ? -11.011 15.762  88.505  1.00 43.74 ? 10   GLN D CA  1 
ATOM   7896  C  C   . GLN D 1 10  ? -11.208 14.287  88.153  1.00 44.83 ? 10   GLN D C   1 
ATOM   7897  O  O   . GLN D 1 10  ? -12.330 13.778  88.198  1.00 44.29 ? 10   GLN D O   1 
ATOM   7898  C  CB  . GLN D 1 10  ? -12.008 16.173  89.601  1.00 40.09 ? 10   GLN D CB  1 
ATOM   7899  C  CG  . GLN D 1 10  ? -11.779 17.558  90.212  1.00 36.01 ? 10   GLN D CG  1 
ATOM   7900  C  CD  . GLN D 1 10  ? -12.627 18.648  89.574  1.00 32.78 ? 10   GLN D CD  1 
ATOM   7901  O  OE1 . GLN D 1 10  ? -12.891 18.628  88.374  1.00 34.20 ? 10   GLN D OE1 1 
ATOM   7902  N  NE2 . GLN D 1 10  ? -13.062 19.606  90.384  1.00 31.11 ? 10   GLN D NE2 1 
ATOM   7903  N  N   . GLN D 1 11  ? -10.119 13.607  87.793  1.00 46.90 ? 11   GLN D N   1 
ATOM   7904  C  CA  . GLN D 1 11  ? -10.186 12.189  87.436  1.00 49.41 ? 11   GLN D CA  1 
ATOM   7905  C  C   . GLN D 1 11  ? -10.155 11.309  88.686  1.00 51.15 ? 11   GLN D C   1 
ATOM   7906  O  O   . GLN D 1 11  ? -9.805  11.772  89.774  1.00 50.81 ? 11   GLN D O   1 
ATOM   7907  C  CB  . GLN D 1 11  ? -9.043  11.803  86.486  1.00 48.81 ? 11   GLN D CB  1 
ATOM   7908  C  CG  . GLN D 1 11  ? -9.252  10.460  85.784  1.00 48.30 ? 11   GLN D CG  1 
ATOM   7909  C  CD  . GLN D 1 11  ? -8.121  10.088  84.842  1.00 48.00 ? 11   GLN D CD  1 
ATOM   7910  O  OE1 . GLN D 1 11  ? -7.511  8.933   85.079  1.00 48.08 ? 11   GLN D OE1 1 
ATOM   7911  N  NE2 . GLN D 1 11  ? -7.803  10.825  83.909  1.00 47.80 ? 11   GLN D NE2 1 
ATOM   7912  N  N   . TYR D 1 12  ? -10.513 10.038  88.520  1.00 54.04 ? 12   TYR D N   1 
ATOM   7913  C  CA  . TYR D 1 12  ? -10.546 9.095   89.631  1.00 56.14 ? 12   TYR D CA  1 
ATOM   7914  C  C   . TYR D 1 12  ? -10.300 7.660   89.146  1.00 56.28 ? 12   TYR D C   1 
ATOM   7915  O  O   . TYR D 1 12  ? -10.951 6.717   89.598  1.00 56.21 ? 12   TYR D O   1 
ATOM   7916  C  CB  . TYR D 1 12  ? -11.901 9.204   90.344  1.00 57.49 ? 12   TYR D CB  1 
ATOM   7917  C  CG  . TYR D 1 12  ? -11.985 8.488   91.673  1.00 59.13 ? 12   TYR D CG  1 
ATOM   7918  C  CD1 . TYR D 1 12  ? -12.994 7.557   91.919  1.00 60.28 ? 12   TYR D CD1 1 
ATOM   7919  C  CD2 . TYR D 1 12  ? -11.064 8.748   92.687  1.00 59.81 ? 12   TYR D CD2 1 
ATOM   7920  C  CE1 . TYR D 1 12  ? -13.086 6.901   93.142  1.00 61.34 ? 12   TYR D CE1 1 
ATOM   7921  C  CE2 . TYR D 1 12  ? -11.148 8.098   93.916  1.00 61.27 ? 12   TYR D CE2 1 
ATOM   7922  C  CZ  . TYR D 1 12  ? -12.161 7.176   94.135  1.00 61.90 ? 12   TYR D CZ  1 
ATOM   7923  O  OH  . TYR D 1 12  ? -12.250 6.529   95.346  1.00 62.71 ? 12   TYR D OH  1 
ATOM   7924  N  N   . LYS D 1 13  ? -9.349  7.504   88.230  1.00 57.25 ? 13   LYS D N   1 
ATOM   7925  C  CA  . LYS D 1 13  ? -9.016  6.190   87.685  1.00 58.53 ? 13   LYS D CA  1 
ATOM   7926  C  C   . LYS D 1 13  ? -7.701  5.655   88.254  1.00 59.03 ? 13   LYS D C   1 
ATOM   7927  O  O   . LYS D 1 13  ? -6.709  5.512   87.534  1.00 59.68 ? 13   LYS D O   1 
ATOM   7928  C  CB  . LYS D 1 13  ? -8.950  6.250   86.156  1.00 59.30 ? 13   LYS D CB  1 
ATOM   7929  C  CG  . LYS D 1 13  ? -10.268 6.628   85.491  1.00 60.68 ? 13   LYS D CG  1 
ATOM   7930  C  CD  . LYS D 1 13  ? -10.116 6.780   83.986  1.00 62.03 ? 13   LYS D CD  1 
ATOM   7931  C  CE  . LYS D 1 13  ? -9.693  5.477   83.325  1.00 62.70 ? 13   LYS D CE  1 
ATOM   7932  N  NZ  . LYS D 1 13  ? -9.521  5.644   81.854  1.00 63.49 ? 13   LYS D NZ  1 
ATOM   7933  N  N   . ASP D 1 14  ? -7.705  5.364   89.552  1.00 58.99 ? 14   ASP D N   1 
ATOM   7934  C  CA  . ASP D 1 14  ? -6.525  4.841   90.238  1.00 58.29 ? 14   ASP D CA  1 
ATOM   7935  C  C   . ASP D 1 14  ? -6.907  3.964   91.427  1.00 57.95 ? 14   ASP D C   1 
ATOM   7936  O  O   . ASP D 1 14  ? -6.195  3.016   91.765  1.00 57.58 ? 14   ASP D O   1 
ATOM   7937  C  CB  . ASP D 1 14  ? -5.607  5.986   90.695  1.00 58.77 ? 14   ASP D CB  1 
ATOM   7938  C  CG  . ASP D 1 14  ? -6.327  7.022   91.549  1.00 59.19 ? 14   ASP D CG  1 
ATOM   7939  O  OD1 . ASP D 1 14  ? -6.582  6.753   92.744  1.00 58.88 ? 14   ASP D OD1 1 
ATOM   7940  O  OD2 . ASP D 1 14  ? -6.623  8.117   91.025  1.00 60.67 ? 14   ASP D OD2 1 
ATOM   7941  N  N   . GLY D 1 15  ? -8.036  4.286   92.053  1.00 58.21 ? 15   GLY D N   1 
ATOM   7942  C  CA  . GLY D 1 15  ? -8.501  3.525   93.200  1.00 58.33 ? 15   GLY D CA  1 
ATOM   7943  C  C   . GLY D 1 15  ? -8.990  4.436   94.309  1.00 58.08 ? 15   GLY D C   1 
ATOM   7944  O  O   . GLY D 1 15  ? -9.925  5.211   94.114  1.00 57.88 ? 15   GLY D O   1 
ATOM   7945  N  N   . LYS D 1 16  ? -8.355  4.340   95.473  1.00 58.11 ? 16   LYS D N   1 
ATOM   7946  C  CA  . LYS D 1 16  ? -8.710  5.160   96.628  1.00 59.13 ? 16   LYS D CA  1 
ATOM   7947  C  C   . LYS D 1 16  ? -7.505  5.203   97.562  1.00 61.17 ? 16   LYS D C   1 
ATOM   7948  O  O   . LYS D 1 16  ? -7.284  4.283   98.355  1.00 61.43 ? 16   LYS D O   1 
ATOM   7949  C  CB  . LYS D 1 16  ? -9.918  4.564   97.360  1.00 57.44 ? 16   LYS D CB  1 
ATOM   7950  C  CG  . LYS D 1 16  ? -10.853 5.590   98.002  1.00 55.46 ? 16   LYS D CG  1 
ATOM   7951  C  CD  . LYS D 1 16  ? -10.162 6.475   99.031  1.00 52.79 ? 16   LYS D CD  1 
ATOM   7952  C  CE  . LYS D 1 16  ? -11.160 7.415   99.686  1.00 52.38 ? 16   LYS D CE  1 
ATOM   7953  N  NZ  . LYS D 1 16  ? -10.528 8.378   100.626 1.00 52.50 ? 16   LYS D NZ  1 
ATOM   7954  N  N   . PHE D 1 17  ? -6.725  6.274   97.453  1.00 62.81 ? 17   PHE D N   1 
ATOM   7955  C  CA  . PHE D 1 17  ? -5.528  6.448   98.269  1.00 63.59 ? 17   PHE D CA  1 
ATOM   7956  C  C   . PHE D 1 17  ? -5.604  7.756   99.057  1.00 63.85 ? 17   PHE D C   1 
ATOM   7957  O  O   . PHE D 1 17  ? -5.516  8.845   98.486  1.00 63.28 ? 17   PHE D O   1 
ATOM   7958  C  CB  . PHE D 1 17  ? -4.286  6.417   97.372  1.00 62.98 ? 17   PHE D CB  1 
ATOM   7959  C  CG  . PHE D 1 17  ? -4.210  5.202   96.482  1.00 62.82 ? 17   PHE D CG  1 
ATOM   7960  C  CD1 . PHE D 1 17  ? -4.001  3.936   97.023  1.00 63.08 ? 17   PHE D CD1 1 
ATOM   7961  C  CD2 . PHE D 1 17  ? -4.369  5.322   95.104  1.00 62.45 ? 17   PHE D CD2 1 
ATOM   7962  C  CE1 . PHE D 1 17  ? -3.952  2.804   96.203  1.00 63.08 ? 17   PHE D CE1 1 
ATOM   7963  C  CE2 . PHE D 1 17  ? -4.321  4.199   94.276  1.00 62.06 ? 17   PHE D CE2 1 
ATOM   7964  C  CZ  . PHE D 1 17  ? -4.113  2.938   94.827  1.00 62.03 ? 17   PHE D CZ  1 
ATOM   7965  N  N   . THR D 1 18  ? -5.764  7.633   100.374 1.00 64.42 ? 18   THR D N   1 
ATOM   7966  C  CA  . THR D 1 18  ? -5.885  8.787   101.263 1.00 64.83 ? 18   THR D CA  1 
ATOM   7967  C  C   . THR D 1 18  ? -4.571  9.260   101.894 1.00 64.81 ? 18   THR D C   1 
ATOM   7968  O  O   . THR D 1 18  ? -4.410  10.452  102.162 1.00 65.10 ? 18   THR D O   1 
ATOM   7969  C  CB  . THR D 1 18  ? -6.908  8.507   102.387 1.00 65.10 ? 18   THR D CB  1 
ATOM   7970  O  OG1 . THR D 1 18  ? -8.117  7.995   101.814 1.00 65.77 ? 18   THR D OG1 1 
ATOM   7971  C  CG2 . THR D 1 18  ? -7.234  9.784   103.154 1.00 65.93 ? 18   THR D CG2 1 
ATOM   7972  N  N   . GLN D 1 19  ? -3.644  8.334   102.141 1.00 64.04 ? 19   GLN D N   1 
ATOM   7973  C  CA  . GLN D 1 19  ? -2.354  8.674   102.748 1.00 62.02 ? 19   GLN D CA  1 
ATOM   7974  C  C   . GLN D 1 19  ? -1.573  9.702   101.920 1.00 60.59 ? 19   GLN D C   1 
ATOM   7975  O  O   . GLN D 1 19  ? -1.692  9.739   100.691 1.00 59.80 ? 19   GLN D O   1 
ATOM   7976  C  CB  . GLN D 1 19  ? -1.510  7.409   102.973 1.00 62.09 ? 19   GLN D CB  1 
ATOM   7977  C  CG  . GLN D 1 19  ? -1.210  6.607   101.711 1.00 63.25 ? 19   GLN D CG  1 
ATOM   7978  C  CD  . GLN D 1 19  ? -0.300  5.413   101.963 1.00 63.40 ? 19   GLN D CD  1 
ATOM   7979  O  OE1 . GLN D 1 19  ? 0.502   5.410   102.899 1.00 63.41 ? 19   GLN D OE1 1 
ATOM   7980  N  NE2 . GLN D 1 19  ? -0.413  4.395   101.114 1.00 62.37 ? 19   GLN D NE2 1 
ATOM   7981  N  N   . PRO D 1 20  ? -0.778  10.563  102.589 1.00 59.40 ? 20   PRO D N   1 
ATOM   7982  C  CA  . PRO D 1 20  ? 0.029   11.604  101.936 1.00 57.76 ? 20   PRO D CA  1 
ATOM   7983  C  C   . PRO D 1 20  ? 0.841   11.070  100.758 1.00 56.51 ? 20   PRO D C   1 
ATOM   7984  O  O   . PRO D 1 20  ? 0.722   11.566  99.635  1.00 55.79 ? 20   PRO D O   1 
ATOM   7985  C  CB  . PRO D 1 20  ? 0.931   12.087  103.070 1.00 57.04 ? 20   PRO D CB  1 
ATOM   7986  C  CG  . PRO D 1 20  ? 0.045   11.957  104.263 1.00 57.36 ? 20   PRO D CG  1 
ATOM   7987  C  CD  . PRO D 1 20  ? -0.578  10.595  104.051 1.00 58.13 ? 20   PRO D CD  1 
ATOM   7988  N  N   . PHE D 1 21  ? 1.668   10.063  101.028 1.00 55.17 ? 21   PHE D N   1 
ATOM   7989  C  CA  . PHE D 1 21  ? 2.496   9.437   100.003 1.00 52.67 ? 21   PHE D CA  1 
ATOM   7990  C  C   . PHE D 1 21  ? 2.034   8.001   99.778  1.00 51.38 ? 21   PHE D C   1 
ATOM   7991  O  O   . PHE D 1 21  ? 2.496   7.072   100.442 1.00 51.58 ? 21   PHE D O   1 
ATOM   7992  C  CB  . PHE D 1 21  ? 3.975   9.469   100.406 1.00 52.54 ? 21   PHE D CB  1 
ATOM   7993  C  CG  . PHE D 1 21  ? 4.677   10.761  100.069 1.00 51.71 ? 21   PHE D CG  1 
ATOM   7994  C  CD1 . PHE D 1 21  ? 3.956   11.932  99.836  1.00 51.19 ? 21   PHE D CD1 1 
ATOM   7995  C  CD2 . PHE D 1 21  ? 6.065   10.803  99.979  1.00 51.07 ? 21   PHE D CD2 1 
ATOM   7996  C  CE1 . PHE D 1 21  ? 4.605   13.122  99.520  1.00 50.63 ? 21   PHE D CE1 1 
ATOM   7997  C  CE2 . PHE D 1 21  ? 6.725   11.988  99.663  1.00 51.62 ? 21   PHE D CE2 1 
ATOM   7998  C  CZ  . PHE D 1 21  ? 5.992   13.151  99.433  1.00 51.85 ? 21   PHE D CZ  1 
ATOM   7999  N  N   . SER D 1 22  ? 1.099   7.838   98.848  1.00 50.32 ? 22   SER D N   1 
ATOM   8000  C  CA  . SER D 1 22  ? 0.539   6.533   98.512  1.00 48.46 ? 22   SER D CA  1 
ATOM   8001  C  C   . SER D 1 22  ? 1.441   5.764   97.555  1.00 46.44 ? 22   SER D C   1 
ATOM   8002  O  O   . SER D 1 22  ? 1.393   5.976   96.343  1.00 46.25 ? 22   SER D O   1 
ATOM   8003  C  CB  . SER D 1 22  ? -0.846  6.707   97.883  1.00 49.59 ? 22   SER D CB  1 
ATOM   8004  O  OG  . SER D 1 22  ? -1.697  7.480   98.713  1.00 49.89 ? 22   SER D OG  1 
ATOM   8005  N  N   . LEU D 1 23  ? 2.253   4.863   98.102  1.00 44.52 ? 23   LEU D N   1 
ATOM   8006  C  CA  . LEU D 1 23  ? 3.162   4.064   97.289  1.00 43.16 ? 23   LEU D CA  1 
ATOM   8007  C  C   . LEU D 1 23  ? 2.428   3.022   96.451  1.00 44.60 ? 23   LEU D C   1 
ATOM   8008  O  O   . LEU D 1 23  ? 2.108   1.931   96.928  1.00 45.76 ? 23   LEU D O   1 
ATOM   8009  C  CB  . LEU D 1 23  ? 4.218   3.383   98.164  1.00 39.92 ? 23   LEU D CB  1 
ATOM   8010  C  CG  . LEU D 1 23  ? 5.227   2.481   97.444  1.00 37.10 ? 23   LEU D CG  1 
ATOM   8011  C  CD1 . LEU D 1 23  ? 5.957   3.261   96.363  1.00 36.66 ? 23   LEU D CD1 1 
ATOM   8012  C  CD2 . LEU D 1 23  ? 6.211   1.903   98.444  1.00 37.61 ? 23   LEU D CD2 1 
ATOM   8013  N  N   . VAL D 1 24  ? 2.142   3.384   95.204  1.00 45.56 ? 24   VAL D N   1 
ATOM   8014  C  CA  . VAL D 1 24  ? 1.468   2.488   94.274  1.00 46.09 ? 24   VAL D CA  1 
ATOM   8015  C  C   . VAL D 1 24  ? 2.538   1.700   93.523  1.00 47.34 ? 24   VAL D C   1 
ATOM   8016  O  O   . VAL D 1 24  ? 3.702   2.108   93.489  1.00 47.44 ? 24   VAL D O   1 
ATOM   8017  C  CB  . VAL D 1 24  ? 0.598   3.274   93.258  1.00 46.12 ? 24   VAL D CB  1 
ATOM   8018  C  CG1 . VAL D 1 24  ? -0.451  4.098   93.993  1.00 46.12 ? 24   VAL D CG1 1 
ATOM   8019  C  CG2 . VAL D 1 24  ? 1.465   4.175   92.386  1.00 43.90 ? 24   VAL D CG2 1 
ATOM   8020  N  N   . ASN D 1 25  ? 2.159   0.561   92.951  1.00 49.14 ? 25   ASN D N   1 
ATOM   8021  C  CA  . ASN D 1 25  ? 3.107   -0.257  92.198  1.00 50.47 ? 25   ASN D CA  1 
ATOM   8022  C  C   . ASN D 1 25  ? 3.611   0.581   91.025  1.00 51.23 ? 25   ASN D C   1 
ATOM   8023  O  O   . ASN D 1 25  ? 4.796   0.911   90.945  1.00 51.41 ? 25   ASN D O   1 
ATOM   8024  C  CB  . ASN D 1 25  ? 2.431   -1.536  91.687  1.00 49.81 ? 25   ASN D CB  1 
ATOM   8025  C  CG  . ASN D 1 25  ? 3.408   -2.489  91.018  1.00 50.10 ? 25   ASN D CG  1 
ATOM   8026  O  OD1 . ASN D 1 25  ? 4.116   -3.240  91.688  1.00 50.64 ? 25   ASN D OD1 1 
ATOM   8027  N  ND2 . ASN D 1 25  ? 3.450   -2.460  89.690  1.00 50.01 ? 25   ASN D ND2 1 
ATOM   8028  N  N   . GLN D 1 26  ? 2.683   0.957   90.151  1.00 52.20 ? 26   GLN D N   1 
ATOM   8029  C  CA  . GLN D 1 26  ? 2.975   1.773   88.978  1.00 54.01 ? 26   GLN D CA  1 
ATOM   8030  C  C   . GLN D 1 26  ? 1.717   2.556   88.597  1.00 54.58 ? 26   GLN D C   1 
ATOM   8031  O  O   . GLN D 1 26  ? 0.641   1.979   88.431  1.00 55.19 ? 26   GLN D O   1 
ATOM   8032  C  CB  . GLN D 1 26  ? 3.461   0.894   87.818  1.00 55.55 ? 26   GLN D CB  1 
ATOM   8033  C  CG  . GLN D 1 26  ? 4.904   0.413   87.988  1.00 57.21 ? 26   GLN D CG  1 
ATOM   8034  C  CD  . GLN D 1 26  ? 5.299   -0.691  87.026  1.00 58.32 ? 26   GLN D CD  1 
ATOM   8035  O  OE1 . GLN D 1 26  ? 6.457   -0.784  86.617  1.00 58.30 ? 26   GLN D OE1 1 
ATOM   8036  N  NE2 . GLN D 1 26  ? 4.345   -1.548  86.675  1.00 59.74 ? 26   GLN D NE2 1 
ATOM   8037  N  N   . PRO D 1 27  ? 1.844   3.889   88.466  1.00 54.16 ? 27   PRO D N   1 
ATOM   8038  C  CA  . PRO D 1 27  ? 0.785   4.846   88.118  1.00 54.56 ? 27   PRO D CA  1 
ATOM   8039  C  C   . PRO D 1 27  ? -0.037  4.550   86.867  1.00 54.95 ? 27   PRO D C   1 
ATOM   8040  O  O   . PRO D 1 27  ? 0.383   3.796   85.988  1.00 54.87 ? 27   PRO D O   1 
ATOM   8041  C  CB  . PRO D 1 27  ? 1.551   6.164   87.979  1.00 54.66 ? 27   PRO D CB  1 
ATOM   8042  C  CG  . PRO D 1 27  ? 2.923   5.733   87.605  1.00 54.09 ? 27   PRO D CG  1 
ATOM   8043  C  CD  . PRO D 1 27  ? 3.143   4.577   88.535  1.00 54.15 ? 27   PRO D CD  1 
ATOM   8044  N  N   . ASP D 1 28  ? -1.211  5.173   86.802  1.00 55.24 ? 28   ASP D N   1 
ATOM   8045  C  CA  . ASP D 1 28  ? -2.130  5.010   85.682  1.00 55.95 ? 28   ASP D CA  1 
ATOM   8046  C  C   . ASP D 1 28  ? -1.856  6.033   84.580  1.00 55.80 ? 28   ASP D C   1 
ATOM   8047  O  O   . ASP D 1 28  ? -2.068  7.234   84.768  1.00 55.81 ? 28   ASP D O   1 
ATOM   8048  C  CB  . ASP D 1 28  ? -3.580  5.134   86.171  1.00 55.98 ? 28   ASP D CB  1 
ATOM   8049  C  CG  . ASP D 1 28  ? -4.596  4.880   85.070  1.00 56.10 ? 28   ASP D CG  1 
ATOM   8050  O  OD1 . ASP D 1 28  ? -4.499  3.832   84.393  1.00 56.25 ? 28   ASP D OD1 1 
ATOM   8051  O  OD2 . ASP D 1 28  ? -5.495  5.728   84.886  1.00 55.40 ? 28   ASP D OD2 1 
ATOM   8052  N  N   . ALA D 1 29  ? -1.381  5.545   83.436  1.00 55.26 ? 29   ALA D N   1 
ATOM   8053  C  CA  . ALA D 1 29  ? -1.075  6.395   82.287  1.00 55.22 ? 29   ALA D CA  1 
ATOM   8054  C  C   . ALA D 1 29  ? -0.695  5.564   81.066  1.00 54.84 ? 29   ALA D C   1 
ATOM   8055  O  O   . ALA D 1 29  ? -0.156  4.462   81.194  1.00 54.19 ? 29   ALA D O   1 
ATOM   8056  C  CB  . ALA D 1 29  ? 0.050   7.371   82.628  1.00 55.28 ? 29   ALA D CB  1 
ATOM   8057  N  N   . VAL D 1 30  ? -0.986  6.100   79.883  1.00 55.32 ? 30   VAL D N   1 
ATOM   8058  C  CA  . VAL D 1 30  ? -0.677  5.424   78.626  1.00 56.16 ? 30   VAL D CA  1 
ATOM   8059  C  C   . VAL D 1 30  ? 0.406   6.186   77.860  1.00 56.31 ? 30   VAL D C   1 
ATOM   8060  O  O   . VAL D 1 30  ? 0.280   7.389   77.617  1.00 56.70 ? 30   VAL D O   1 
ATOM   8061  C  CB  . VAL D 1 30  ? -1.933  5.298   77.726  1.00 55.63 ? 30   VAL D CB  1 
ATOM   8062  C  CG1 . VAL D 1 30  ? -1.611  4.479   76.480  1.00 55.41 ? 30   VAL D CG1 1 
ATOM   8063  C  CG2 . VAL D 1 30  ? -3.079  4.662   78.498  1.00 55.13 ? 30   VAL D CG2 1 
ATOM   8064  N  N   . GLY D 1 31  ? 1.472   5.478   77.492  1.00 55.55 ? 31   GLY D N   1 
ATOM   8065  C  CA  . GLY D 1 31  ? 2.561   6.095   76.756  1.00 54.11 ? 31   GLY D CA  1 
ATOM   8066  C  C   . GLY D 1 31  ? 3.594   6.788   77.626  1.00 53.35 ? 31   GLY D C   1 
ATOM   8067  O  O   . GLY D 1 31  ? 3.492   6.796   78.855  1.00 52.89 ? 31   GLY D O   1 
ATOM   8068  N  N   . ALA D 1 32  ? 4.594   7.372   76.972  1.00 51.74 ? 32   ALA D N   1 
ATOM   8069  C  CA  . ALA D 1 32  ? 5.676   8.079   77.651  1.00 50.61 ? 32   ALA D CA  1 
ATOM   8070  C  C   . ALA D 1 32  ? 5.344   9.556   77.868  1.00 49.95 ? 32   ALA D C   1 
ATOM   8071  O  O   . ALA D 1 32  ? 4.454   10.102  77.212  1.00 49.96 ? 32   ALA D O   1 
ATOM   8072  C  CB  . ALA D 1 32  ? 6.962   7.945   76.844  1.00 50.21 ? 32   ALA D CB  1 
ATOM   8073  N  N   . PRO D 1 33  ? 6.036   10.212  78.820  1.00 48.99 ? 33   PRO D N   1 
ATOM   8074  C  CA  . PRO D 1 33  ? 5.818   11.632  79.121  1.00 47.70 ? 33   PRO D CA  1 
ATOM   8075  C  C   . PRO D 1 33  ? 6.113   12.502  77.899  1.00 46.00 ? 33   PRO D C   1 
ATOM   8076  O  O   . PRO D 1 33  ? 6.977   12.170  77.084  1.00 45.81 ? 33   PRO D O   1 
ATOM   8077  C  CB  . PRO D 1 33  ? 6.823   11.896  80.240  1.00 48.45 ? 33   PRO D CB  1 
ATOM   8078  C  CG  . PRO D 1 33  ? 6.881   10.585  80.948  1.00 48.55 ? 33   PRO D CG  1 
ATOM   8079  C  CD  . PRO D 1 33  ? 6.969   9.618   79.795  1.00 47.90 ? 33   PRO D CD  1 
ATOM   8080  N  N   . ILE D 1 34  ? 5.399   13.616  77.780  1.00 44.30 ? 34   ILE D N   1 
ATOM   8081  C  CA  . ILE D 1 34  ? 5.578   14.519  76.649  1.00 43.55 ? 34   ILE D CA  1 
ATOM   8082  C  C   . ILE D 1 34  ? 6.892   15.311  76.702  1.00 42.52 ? 34   ILE D C   1 
ATOM   8083  O  O   . ILE D 1 34  ? 7.504   15.572  75.664  1.00 41.86 ? 34   ILE D O   1 
ATOM   8084  C  CB  . ILE D 1 34  ? 4.363   15.481  76.505  1.00 42.83 ? 34   ILE D CB  1 
ATOM   8085  C  CG1 . ILE D 1 34  ? 4.430   16.241  75.177  1.00 42.69 ? 34   ILE D CG1 1 
ATOM   8086  C  CG2 . ILE D 1 34  ? 4.305   16.449  77.676  1.00 43.24 ? 34   ILE D CG2 1 
ATOM   8087  C  CD1 . ILE D 1 34  ? 4.380   15.348  73.950  1.00 41.13 ? 34   ILE D CD1 1 
ATOM   8088  N  N   . ASN D 1 35  ? 7.337   15.658  77.909  1.00 41.93 ? 35   ASN D N   1 
ATOM   8089  C  CA  . ASN D 1 35  ? 8.573   16.422  78.079  1.00 40.38 ? 35   ASN D CA  1 
ATOM   8090  C  C   . ASN D 1 35  ? 9.736   15.610  78.659  1.00 38.93 ? 35   ASN D C   1 
ATOM   8091  O  O   . ASN D 1 35  ? 10.230  15.901  79.749  1.00 39.43 ? 35   ASN D O   1 
ATOM   8092  C  CB  . ASN D 1 35  ? 8.314   17.678  78.927  1.00 40.16 ? 35   ASN D CB  1 
ATOM   8093  C  CG  . ASN D 1 35  ? 7.846   17.357  80.338  1.00 41.20 ? 35   ASN D CG  1 
ATOM   8094  O  OD1 . ASN D 1 35  ? 7.443   16.232  80.635  1.00 42.28 ? 35   ASN D OD1 1 
ATOM   8095  N  ND2 . ASN D 1 35  ? 7.908   18.351  81.219  1.00 40.91 ? 35   ASN D ND2 1 
ATOM   8096  N  N   . ALA D 1 36  ? 10.185  14.605  77.912  1.00 37.61 ? 36   ALA D N   1 
ATOM   8097  C  CA  . ALA D 1 36  ? 11.290  13.756  78.348  1.00 35.33 ? 36   ALA D CA  1 
ATOM   8098  C  C   . ALA D 1 36  ? 12.636  14.457  78.181  1.00 34.77 ? 36   ALA D C   1 
ATOM   8099  O  O   . ALA D 1 36  ? 13.391  14.601  79.142  1.00 36.13 ? 36   ALA D O   1 
ATOM   8100  C  CB  . ALA D 1 36  ? 11.278  12.444  77.586  1.00 35.48 ? 36   ALA D CB  1 
ATOM   8101  N  N   . GLY D 1 37  ? 12.931  14.887  76.957  1.00 34.07 ? 37   GLY D N   1 
ATOM   8102  C  CA  . GLY D 1 37  ? 14.181  15.577  76.689  1.00 32.95 ? 37   GLY D CA  1 
ATOM   8103  C  C   . GLY D 1 37  ? 14.214  16.938  77.358  1.00 33.37 ? 37   GLY D C   1 
ATOM   8104  O  O   . GLY D 1 37  ? 15.282  17.471  77.661  1.00 33.07 ? 37   GLY D O   1 
ATOM   8105  N  N   . ASP D 1 38  ? 13.029  17.494  77.593  1.00 34.33 ? 38   ASP D N   1 
ATOM   8106  C  CA  . ASP D 1 38  ? 12.882  18.796  78.235  1.00 33.77 ? 38   ASP D CA  1 
ATOM   8107  C  C   . ASP D 1 38  ? 13.168  18.673  79.728  1.00 33.56 ? 38   ASP D C   1 
ATOM   8108  O  O   . ASP D 1 38  ? 13.609  19.630  80.366  1.00 33.27 ? 38   ASP D O   1 
ATOM   8109  C  CB  . ASP D 1 38  ? 11.466  19.330  78.010  1.00 34.13 ? 38   ASP D CB  1 
ATOM   8110  C  CG  . ASP D 1 38  ? 11.062  19.311  76.545  1.00 35.61 ? 38   ASP D CG  1 
ATOM   8111  O  OD1 . ASP D 1 38  ? 10.595  18.252  76.070  1.00 29.00 ? 38   ASP D OD1 1 
ATOM   8112  O  OD2 . ASP D 1 38  ? 11.220  20.351  75.869  1.00 36.87 ? 38   ASP D OD2 1 
ATOM   8113  N  N   . PHE D 1 39  ? 12.909  17.485  80.273  1.00 33.68 ? 39   PHE D N   1 
ATOM   8114  C  CA  . PHE D 1 39  ? 13.143  17.198  81.685  1.00 33.16 ? 39   PHE D CA  1 
ATOM   8115  C  C   . PHE D 1 39  ? 14.645  17.152  81.958  1.00 31.94 ? 39   PHE D C   1 
ATOM   8116  O  O   . PHE D 1 39  ? 15.100  17.542  83.033  1.00 32.22 ? 39   PHE D O   1 
ATOM   8117  C  CB  . PHE D 1 39  ? 12.496  15.861  82.065  1.00 33.43 ? 39   PHE D CB  1 
ATOM   8118  C  CG  . PHE D 1 39  ? 12.712  15.462  83.502  1.00 34.74 ? 39   PHE D CG  1 
ATOM   8119  C  CD1 . PHE D 1 39  ? 12.083  16.153  84.535  1.00 35.62 ? 39   PHE D CD1 1 
ATOM   8120  C  CD2 . PHE D 1 39  ? 13.537  14.388  83.821  1.00 33.08 ? 39   PHE D CD2 1 
ATOM   8121  C  CE1 . PHE D 1 39  ? 12.273  15.779  85.866  1.00 35.00 ? 39   PHE D CE1 1 
ATOM   8122  C  CE2 . PHE D 1 39  ? 13.733  14.008  85.147  1.00 33.55 ? 39   PHE D CE2 1 
ATOM   8123  C  CZ  . PHE D 1 39  ? 13.100  14.705  86.171  1.00 33.33 ? 39   PHE D CZ  1 
ATOM   8124  N  N   . ALA D 1 40  ? 15.406  16.684  80.970  1.00 31.23 ? 40   ALA D N   1 
ATOM   8125  C  CA  . ALA D 1 40  ? 16.859  16.584  81.078  1.00 31.08 ? 40   ALA D CA  1 
ATOM   8126  C  C   . ALA D 1 40  ? 17.502  17.958  81.257  1.00 30.61 ? 40   ALA D C   1 
ATOM   8127  O  O   . ALA D 1 40  ? 18.422  18.118  82.059  1.00 30.28 ? 40   ALA D O   1 
ATOM   8128  C  CB  . ALA D 1 40  ? 17.429  15.891  79.846  1.00 29.67 ? 40   ALA D CB  1 
ATOM   8129  N  N   . GLU D 1 41  ? 17.009  18.940  80.505  1.00 31.57 ? 41   GLU D N   1 
ATOM   8130  C  CA  . GLU D 1 41  ? 17.512  20.311  80.571  1.00 31.84 ? 41   GLU D CA  1 
ATOM   8131  C  C   . GLU D 1 41  ? 17.265  20.898  81.959  1.00 31.71 ? 41   GLU D C   1 
ATOM   8132  O  O   . GLU D 1 41  ? 18.142  21.542  82.536  1.00 33.33 ? 41   GLU D O   1 
ATOM   8133  C  CB  . GLU D 1 41  ? 16.812  21.181  79.524  1.00 33.52 ? 41   GLU D CB  1 
ATOM   8134  C  CG  . GLU D 1 41  ? 17.258  22.641  79.524  1.00 36.07 ? 41   GLU D CG  1 
ATOM   8135  C  CD  . GLU D 1 41  ? 16.285  23.564  78.807  1.00 37.40 ? 41   GLU D CD  1 
ATOM   8136  O  OE1 . GLU D 1 41  ? 15.565  23.100  77.897  1.00 39.27 ? 41   GLU D OE1 1 
ATOM   8137  O  OE2 . GLU D 1 41  ? 16.240  24.763  79.158  1.00 39.73 ? 41   GLU D OE2 1 
ATOM   8138  N  N   . GLN D 1 42  ? 16.061  20.668  82.478  1.00 30.88 ? 42   GLN D N   1 
ATOM   8139  C  CA  . GLN D 1 42  ? 15.657  21.153  83.794  1.00 29.26 ? 42   GLN D CA  1 
ATOM   8140  C  C   . GLN D 1 42  ? 16.599  20.611  84.864  1.00 27.78 ? 42   GLN D C   1 
ATOM   8141  O  O   . GLN D 1 42  ? 17.053  21.349  85.739  1.00 27.81 ? 42   GLN D O   1 
ATOM   8142  C  CB  . GLN D 1 42  ? 14.225  20.700  84.091  1.00 29.84 ? 42   GLN D CB  1 
ATOM   8143  C  CG  . GLN D 1 42  ? 13.339  21.754  84.739  1.00 31.40 ? 42   GLN D CG  1 
ATOM   8144  C  CD  . GLN D 1 42  ? 13.831  22.196  86.097  1.00 30.63 ? 42   GLN D CD  1 
ATOM   8145  O  OE1 . GLN D 1 42  ? 13.947  21.391  87.019  1.00 32.56 ? 42   GLN D OE1 1 
ATOM   8146  N  NE2 . GLN D 1 42  ? 14.117  23.486  86.232  1.00 31.16 ? 42   GLN D NE2 1 
ATOM   8147  N  N   . ILE D 1 43  ? 16.894  19.317  84.770  1.00 27.08 ? 43   ILE D N   1 
ATOM   8148  C  CA  . ILE D 1 43  ? 17.781  18.637  85.708  1.00 26.22 ? 43   ILE D CA  1 
ATOM   8149  C  C   . ILE D 1 43  ? 19.218  19.137  85.585  1.00 26.41 ? 43   ILE D C   1 
ATOM   8150  O  O   . ILE D 1 43  ? 19.897  19.340  86.591  1.00 26.84 ? 43   ILE D O   1 
ATOM   8151  C  CB  . ILE D 1 43  ? 17.751  17.104  85.486  1.00 25.35 ? 43   ILE D CB  1 
ATOM   8152  C  CG1 . ILE D 1 43  ? 16.340  16.563  85.728  1.00 22.88 ? 43   ILE D CG1 1 
ATOM   8153  C  CG2 . ILE D 1 43  ? 18.753  16.408  86.395  1.00 25.48 ? 43   ILE D CG2 1 
ATOM   8154  C  CD1 . ILE D 1 43  ? 15.769  16.911  87.082  1.00 21.11 ? 43   ILE D CD1 1 
ATOM   8155  N  N   . ASN D 1 44  ? 19.670  19.337  84.349  1.00 28.06 ? 44   ASN D N   1 
ATOM   8156  C  CA  . ASN D 1 44  ? 21.024  19.816  84.081  1.00 28.54 ? 44   ASN D CA  1 
ATOM   8157  C  C   . ASN D 1 44  ? 21.277  21.150  84.782  1.00 27.85 ? 44   ASN D C   1 
ATOM   8158  O  O   . ASN D 1 44  ? 22.385  21.418  85.247  1.00 26.15 ? 44   ASN D O   1 
ATOM   8159  C  CB  . ASN D 1 44  ? 21.242  19.959  82.571  1.00 30.66 ? 44   ASN D CB  1 
ATOM   8160  C  CG  . ASN D 1 44  ? 22.639  20.438  82.223  1.00 32.74 ? 44   ASN D CG  1 
ATOM   8161  O  OD1 . ASN D 1 44  ? 23.625  19.736  82.452  1.00 34.20 ? 44   ASN D OD1 1 
ATOM   8162  N  ND2 . ASN D 1 44  ? 22.729  21.640  81.665  1.00 33.50 ? 44   ASN D ND2 1 
ATOM   8163  N  N   . HIS D 1 45  ? 20.236  21.976  84.856  1.00 28.30 ? 45   HIS D N   1 
ATOM   8164  C  CA  . HIS D 1 45  ? 20.319  23.277  85.507  1.00 27.39 ? 45   HIS D CA  1 
ATOM   8165  C  C   . HIS D 1 45  ? 20.495  23.128  87.014  1.00 29.10 ? 45   HIS D C   1 
ATOM   8166  O  O   . HIS D 1 45  ? 21.190  23.925  87.644  1.00 30.78 ? 45   HIS D O   1 
ATOM   8167  C  CB  . HIS D 1 45  ? 19.069  24.104  85.200  1.00 27.11 ? 45   HIS D CB  1 
ATOM   8168  C  CG  . HIS D 1 45  ? 19.067  24.711  83.831  1.00 25.46 ? 45   HIS D CG  1 
ATOM   8169  N  ND1 . HIS D 1 45  ? 20.133  25.431  83.336  1.00 24.07 ? 45   HIS D ND1 1 
ATOM   8170  C  CD2 . HIS D 1 45  ? 18.124  24.721  82.860  1.00 25.75 ? 45   HIS D CD2 1 
ATOM   8171  C  CE1 . HIS D 1 45  ? 19.846  25.859  82.120  1.00 24.06 ? 45   HIS D CE1 1 
ATOM   8172  N  NE2 . HIS D 1 45  ? 18.633  25.442  81.807  1.00 24.79 ? 45   HIS D NE2 1 
ATOM   8173  N  N   . ILE D 1 46  ? 19.869  22.099  87.581  1.00 29.95 ? 46   ILE D N   1 
ATOM   8174  C  CA  . ILE D 1 46  ? 19.957  21.820  89.013  1.00 29.42 ? 46   ILE D CA  1 
ATOM   8175  C  C   . ILE D 1 46  ? 21.387  21.424  89.381  1.00 31.21 ? 46   ILE D C   1 
ATOM   8176  O  O   . ILE D 1 46  ? 21.853  21.696  90.487  1.00 34.17 ? 46   ILE D O   1 
ATOM   8177  C  CB  . ILE D 1 46  ? 18.981  20.685  89.419  1.00 27.54 ? 46   ILE D CB  1 
ATOM   8178  C  CG1 . ILE D 1 46  ? 17.541  21.106  89.120  1.00 24.98 ? 46   ILE D CG1 1 
ATOM   8179  C  CG2 . ILE D 1 46  ? 19.134  20.344  90.898  1.00 26.10 ? 46   ILE D CG2 1 
ATOM   8180  C  CD1 . ILE D 1 46  ? 16.513  20.039  89.401  1.00 23.39 ? 46   ILE D CD1 1 
ATOM   8181  N  N   . ARG D 1 47  ? 22.082  20.809  88.429  1.00 32.33 ? 47   ARG D N   1 
ATOM   8182  C  CA  . ARG D 1 47  ? 23.461  20.366  88.610  1.00 32.16 ? 47   ARG D CA  1 
ATOM   8183  C  C   . ARG D 1 47  ? 24.444  21.530  88.772  1.00 33.03 ? 47   ARG D C   1 
ATOM   8184  O  O   . ARG D 1 47  ? 25.288  21.520  89.671  1.00 33.26 ? 47   ARG D O   1 
ATOM   8185  C  CB  . ARG D 1 47  ? 23.883  19.502  87.414  1.00 30.81 ? 47   ARG D CB  1 
ATOM   8186  C  CG  . ARG D 1 47  ? 25.345  19.075  87.419  1.00 31.29 ? 47   ARG D CG  1 
ATOM   8187  C  CD  . ARG D 1 47  ? 25.795  18.613  86.040  1.00 31.90 ? 47   ARG D CD  1 
ATOM   8188  N  NE  . ARG D 1 47  ? 25.093  17.412  85.592  1.00 32.10 ? 47   ARG D NE  1 
ATOM   8189  C  CZ  . ARG D 1 47  ? 25.625  16.193  85.578  1.00 33.38 ? 47   ARG D CZ  1 
ATOM   8190  N  NH1 . ARG D 1 47  ? 26.874  16.002  85.988  1.00 33.65 ? 47   ARG D NH1 1 
ATOM   8191  N  NH2 . ARG D 1 47  ? 24.910  15.162  85.150  1.00 32.41 ? 47   ARG D NH2 1 
ATOM   8192  N  N   . ASN D 1 48  ? 24.320  22.531  87.904  1.00 32.69 ? 48   ASN D N   1 
ATOM   8193  C  CA  . ASN D 1 48  ? 25.213  23.687  87.920  1.00 32.51 ? 48   ASN D CA  1 
ATOM   8194  C  C   . ASN D 1 48  ? 24.779  24.860  88.797  1.00 32.31 ? 48   ASN D C   1 
ATOM   8195  O  O   . ASN D 1 48  ? 25.624  25.611  89.292  1.00 32.41 ? 48   ASN D O   1 
ATOM   8196  C  CB  . ASN D 1 48  ? 25.452  24.175  86.489  1.00 32.91 ? 48   ASN D CB  1 
ATOM   8197  C  CG  . ASN D 1 48  ? 26.030  23.096  85.595  1.00 32.58 ? 48   ASN D CG  1 
ATOM   8198  O  OD1 . ASN D 1 48  ? 27.075  22.519  85.894  1.00 33.22 ? 48   ASN D OD1 1 
ATOM   8199  N  ND2 . ASN D 1 48  ? 25.346  22.814  84.493  1.00 34.52 ? 48   ASN D ND2 1 
ATOM   8200  N  N   . SER D 1 49  ? 23.473  25.026  88.980  1.00 31.63 ? 49   SER D N   1 
ATOM   8201  C  CA  . SER D 1 49  ? 22.951  26.127  89.788  1.00 30.28 ? 49   SER D CA  1 
ATOM   8202  C  C   . SER D 1 49  ? 22.778  25.789  91.265  1.00 28.54 ? 49   SER D C   1 
ATOM   8203  O  O   . SER D 1 49  ? 22.741  26.684  92.112  1.00 26.78 ? 49   SER D O   1 
ATOM   8204  C  CB  . SER D 1 49  ? 21.635  26.638  89.202  1.00 30.74 ? 49   SER D CB  1 
ATOM   8205  O  OG  . SER D 1 49  ? 21.832  27.144  87.891  1.00 31.07 ? 49   SER D OG  1 
ATOM   8206  N  N   . SER D 1 50  ? 22.664  24.500  91.569  1.00 28.43 ? 50   SER D N   1 
ATOM   8207  C  CA  . SER D 1 50  ? 22.509  24.044  92.947  1.00 26.87 ? 50   SER D CA  1 
ATOM   8208  C  C   . SER D 1 50  ? 23.153  22.667  93.086  1.00 25.45 ? 50   SER D C   1 
ATOM   8209  O  O   . SER D 1 50  ? 22.463  21.651  93.165  1.00 25.06 ? 50   SER D O   1 
ATOM   8210  C  CB  . SER D 1 50  ? 21.028  23.987  93.330  1.00 26.76 ? 50   SER D CB  1 
ATOM   8211  O  OG  . SER D 1 50  ? 20.871  23.788  94.724  1.00 26.12 ? 50   SER D OG  1 
ATOM   8212  N  N   . PRO D 1 51  ? 24.497  22.625  93.123  1.00 26.66 ? 51   PRO D N   1 
ATOM   8213  C  CA  . PRO D 1 51  ? 25.297  21.401  93.247  1.00 27.21 ? 51   PRO D CA  1 
ATOM   8214  C  C   . PRO D 1 51  ? 25.023  20.555  94.490  1.00 26.56 ? 51   PRO D C   1 
ATOM   8215  O  O   . PRO D 1 51  ? 25.339  19.363  94.513  1.00 26.06 ? 51   PRO D O   1 
ATOM   8216  C  CB  . PRO D 1 51  ? 26.733  21.930  93.221  1.00 28.32 ? 51   PRO D CB  1 
ATOM   8217  C  CG  . PRO D 1 51  ? 26.599  23.306  93.797  1.00 28.68 ? 51   PRO D CG  1 
ATOM   8218  C  CD  . PRO D 1 51  ? 25.371  23.811  93.101  1.00 26.66 ? 51   PRO D CD  1 
ATOM   8219  N  N   . ARG D 1 52  ? 24.451  21.169  95.522  1.00 26.47 ? 52   ARG D N   1 
ATOM   8220  C  CA  . ARG D 1 52  ? 24.140  20.441  96.746  1.00 26.93 ? 52   ARG D CA  1 
ATOM   8221  C  C   . ARG D 1 52  ? 22.781  19.756  96.611  1.00 27.25 ? 52   ARG D C   1 
ATOM   8222  O  O   . ARG D 1 52  ? 22.564  18.675  97.158  1.00 27.43 ? 52   ARG D O   1 
ATOM   8223  C  CB  . ARG D 1 52  ? 24.145  21.373  97.960  1.00 26.34 ? 52   ARG D CB  1 
ATOM   8224  C  CG  . ARG D 1 52  ? 24.470  20.649  99.255  1.00 25.95 ? 52   ARG D CG  1 
ATOM   8225  C  CD  . ARG D 1 52  ? 24.191  21.494  100.485 1.00 25.80 ? 52   ARG D CD  1 
ATOM   8226  N  NE  . ARG D 1 52  ? 24.568  20.805  101.720 1.00 26.11 ? 52   ARG D NE  1 
ATOM   8227  C  CZ  . ARG D 1 52  ? 24.069  19.638  102.128 1.00 24.86 ? 52   ARG D CZ  1 
ATOM   8228  N  NH1 . ARG D 1 52  ? 23.155  19.000  101.407 1.00 22.87 ? 52   ARG D NH1 1 
ATOM   8229  N  NH2 . ARG D 1 52  ? 24.489  19.105  103.267 1.00 26.95 ? 52   ARG D NH2 1 
ATOM   8230  N  N   . LEU D 1 53  ? 21.876  20.392  95.871  1.00 27.89 ? 53   LEU D N   1 
ATOM   8231  C  CA  . LEU D 1 53  ? 20.542  19.851  95.637  1.00 27.95 ? 53   LEU D CA  1 
ATOM   8232  C  C   . LEU D 1 53  ? 20.625  18.673  94.667  1.00 28.50 ? 53   LEU D C   1 
ATOM   8233  O  O   . LEU D 1 53  ? 19.847  17.723  94.761  1.00 29.29 ? 53   LEU D O   1 
ATOM   8234  C  CB  . LEU D 1 53  ? 19.627  20.933  95.063  1.00 28.78 ? 53   LEU D CB  1 
ATOM   8235  C  CG  . LEU D 1 53  ? 18.158  20.573  94.833  1.00 29.54 ? 53   LEU D CG  1 
ATOM   8236  C  CD1 . LEU D 1 53  ? 17.505  20.191  96.153  1.00 30.26 ? 53   LEU D CD1 1 
ATOM   8237  C  CD2 . LEU D 1 53  ? 17.435  21.751  94.198  1.00 28.60 ? 53   LEU D CD2 1 
ATOM   8238  N  N   . TYR D 1 54  ? 21.570  18.751  93.734  1.00 28.86 ? 54   TYR D N   1 
ATOM   8239  C  CA  . TYR D 1 54  ? 21.779  17.697  92.748  1.00 29.19 ? 54   TYR D CA  1 
ATOM   8240  C  C   . TYR D 1 54  ? 22.361  16.460  93.422  1.00 29.98 ? 54   TYR D C   1 
ATOM   8241  O  O   . TYR D 1 54  ? 21.915  15.343  93.167  1.00 31.34 ? 54   TYR D O   1 
ATOM   8242  C  CB  . TYR D 1 54  ? 22.721  18.180  91.638  1.00 29.81 ? 54   TYR D CB  1 
ATOM   8243  C  CG  . TYR D 1 54  ? 23.038  17.128  90.593  1.00 30.99 ? 54   TYR D CG  1 
ATOM   8244  C  CD1 . TYR D 1 54  ? 22.039  16.615  89.765  1.00 31.11 ? 54   TYR D CD1 1 
ATOM   8245  C  CD2 . TYR D 1 54  ? 24.336  16.633  90.444  1.00 30.27 ? 54   TYR D CD2 1 
ATOM   8246  C  CE1 . TYR D 1 54  ? 22.321  15.633  88.818  1.00 31.18 ? 54   TYR D CE1 1 
ATOM   8247  C  CE2 . TYR D 1 54  ? 24.629  15.651  89.498  1.00 29.53 ? 54   TYR D CE2 1 
ATOM   8248  C  CZ  . TYR D 1 54  ? 23.616  15.156  88.690  1.00 31.12 ? 54   TYR D CZ  1 
ATOM   8249  O  OH  . TYR D 1 54  ? 23.893  14.181  87.758  1.00 30.08 ? 54   TYR D OH  1 
ATOM   8250  N  N   . GLY D 1 55  ? 23.347  16.675  94.292  1.00 30.56 ? 55   GLY D N   1 
ATOM   8251  C  CA  . GLY D 1 55  ? 23.986  15.577  95.000  1.00 30.38 ? 55   GLY D CA  1 
ATOM   8252  C  C   . GLY D 1 55  ? 23.028  14.732  95.821  1.00 29.75 ? 55   GLY D C   1 
ATOM   8253  O  O   . GLY D 1 55  ? 23.232  13.529  95.977  1.00 29.69 ? 55   GLY D O   1 
ATOM   8254  N  N   . ASN D 1 56  ? 21.977  15.363  96.336  1.00 30.87 ? 56   ASN D N   1 
ATOM   8255  C  CA  . ASN D 1 56  ? 20.974  14.678  97.144  1.00 31.68 ? 56   ASN D CA  1 
ATOM   8256  C  C   . ASN D 1 56  ? 19.967  13.898  96.303  1.00 31.65 ? 56   ASN D C   1 
ATOM   8257  O  O   . ASN D 1 56  ? 19.360  12.938  96.783  1.00 32.50 ? 56   ASN D O   1 
ATOM   8258  C  CB  . ASN D 1 56  ? 20.238  15.681  98.038  1.00 32.58 ? 56   ASN D CB  1 
ATOM   8259  C  CG  . ASN D 1 56  ? 21.114  16.220  99.159  1.00 34.29 ? 56   ASN D CG  1 
ATOM   8260  O  OD1 . ASN D 1 56  ? 22.296  16.504  98.962  1.00 35.58 ? 56   ASN D OD1 1 
ATOM   8261  N  ND2 . ASN D 1 56  ? 20.533  16.360  100.345 1.00 34.86 ? 56   ASN D ND2 1 
ATOM   8262  N  N   . GLN D 1 57  ? 19.798  14.306  95.048  1.00 31.29 ? 57   GLN D N   1 
ATOM   8263  C  CA  . GLN D 1 57  ? 18.857  13.646  94.149  1.00 31.51 ? 57   GLN D CA  1 
ATOM   8264  C  C   . GLN D 1 57  ? 19.525  13.107  92.886  1.00 31.74 ? 57   GLN D C   1 
ATOM   8265  O  O   . GLN D 1 57  ? 18.870  12.940  91.858  1.00 32.88 ? 57   GLN D O   1 
ATOM   8266  C  CB  . GLN D 1 57  ? 17.731  14.610  93.763  1.00 31.91 ? 57   GLN D CB  1 
ATOM   8267  C  CG  . GLN D 1 57  ? 16.969  15.212  94.936  1.00 33.92 ? 57   GLN D CG  1 
ATOM   8268  C  CD  . GLN D 1 57  ? 16.261  14.170  95.782  1.00 36.50 ? 57   GLN D CD  1 
ATOM   8269  O  OE1 . GLN D 1 57  ? 15.718  13.195  95.264  1.00 37.75 ? 57   GLN D OE1 1 
ATOM   8270  N  NE2 . GLN D 1 57  ? 16.262  14.375  97.093  1.00 39.84 ? 57   GLN D NE2 1 
ATOM   8271  N  N   . SER D 1 58  ? 20.822  12.820  92.971  1.00 33.20 ? 58   SER D N   1 
ATOM   8272  C  CA  . SER D 1 58  ? 21.580  12.298  91.833  1.00 33.59 ? 58   SER D CA  1 
ATOM   8273  C  C   . SER D 1 58  ? 20.997  10.981  91.334  1.00 35.05 ? 58   SER D C   1 
ATOM   8274  O  O   . SER D 1 58  ? 20.594  10.869  90.175  1.00 34.74 ? 58   SER D O   1 
ATOM   8275  C  CB  . SER D 1 58  ? 23.046  12.087  92.216  1.00 32.20 ? 58   SER D CB  1 
ATOM   8276  O  OG  . SER D 1 58  ? 23.662  13.303  92.592  1.00 31.92 ? 58   SER D OG  1 
ATOM   8277  N  N   . ASN D 1 59  ? 20.944  9.998   92.229  1.00 35.72 ? 59   ASN D N   1 
ATOM   8278  C  CA  . ASN D 1 59  ? 20.420  8.669   91.921  1.00 35.16 ? 59   ASN D CA  1 
ATOM   8279  C  C   . ASN D 1 59  ? 18.980  8.678   91.407  1.00 33.53 ? 59   ASN D C   1 
ATOM   8280  O  O   . ASN D 1 59  ? 18.601  7.830   90.600  1.00 33.09 ? 59   ASN D O   1 
ATOM   8281  C  CB  . ASN D 1 59  ? 20.539  7.755   93.149  1.00 37.48 ? 59   ASN D CB  1 
ATOM   8282  C  CG  . ASN D 1 59  ? 19.889  8.345   94.398  1.00 38.38 ? 59   ASN D CG  1 
ATOM   8283  O  OD1 . ASN D 1 59  ? 19.477  9.506   94.417  1.00 39.57 ? 59   ASN D OD1 1 
ATOM   8284  N  ND2 . ASN D 1 59  ? 19.804  7.540   95.452  1.00 38.39 ? 59   ASN D ND2 1 
ATOM   8285  N  N   . VAL D 1 60  ? 18.190  9.640   91.875  1.00 31.60 ? 60   VAL D N   1 
ATOM   8286  C  CA  . VAL D 1 60  ? 16.795  9.767   91.465  1.00 30.38 ? 60   VAL D CA  1 
ATOM   8287  C  C   . VAL D 1 60  ? 16.699  10.256  90.023  1.00 31.60 ? 60   VAL D C   1 
ATOM   8288  O  O   . VAL D 1 60  ? 15.956  9.694   89.215  1.00 30.71 ? 60   VAL D O   1 
ATOM   8289  C  CB  . VAL D 1 60  ? 16.025  10.742  92.387  1.00 28.91 ? 60   VAL D CB  1 
ATOM   8290  C  CG1 . VAL D 1 60  ? 14.572  10.851  91.949  1.00 28.45 ? 60   VAL D CG1 1 
ATOM   8291  C  CG2 . VAL D 1 60  ? 16.106  10.273  93.829  1.00 29.81 ? 60   VAL D CG2 1 
ATOM   8292  N  N   . TYR D 1 61  ? 17.469  11.294  89.707  1.00 32.95 ? 61   TYR D N   1 
ATOM   8293  C  CA  . TYR D 1 61  ? 17.485  11.875  88.368  1.00 32.01 ? 61   TYR D CA  1 
ATOM   8294  C  C   . TYR D 1 61  ? 18.074  10.914  87.345  1.00 31.57 ? 61   TYR D C   1 
ATOM   8295  O  O   . TYR D 1 61  ? 17.536  10.763  86.250  1.00 33.11 ? 61   TYR D O   1 
ATOM   8296  C  CB  . TYR D 1 61  ? 18.277  13.186  88.365  1.00 30.71 ? 61   TYR D CB  1 
ATOM   8297  C  CG  . TYR D 1 61  ? 17.693  14.272  89.246  1.00 30.38 ? 61   TYR D CG  1 
ATOM   8298  C  CD1 . TYR D 1 61  ? 16.339  14.279  89.581  1.00 30.10 ? 61   TYR D CD1 1 
ATOM   8299  C  CD2 . TYR D 1 61  ? 18.495  15.302  89.736  1.00 30.96 ? 61   TYR D CD2 1 
ATOM   8300  C  CE1 . TYR D 1 61  ? 15.799  15.282  90.380  1.00 29.86 ? 61   TYR D CE1 1 
ATOM   8301  C  CE2 . TYR D 1 61  ? 17.965  16.311  90.535  1.00 30.21 ? 61   TYR D CE2 1 
ATOM   8302  C  CZ  . TYR D 1 61  ? 16.618  16.294  90.852  1.00 30.45 ? 61   TYR D CZ  1 
ATOM   8303  O  OH  . TYR D 1 61  ? 16.089  17.288  91.641  1.00 32.44 ? 61   TYR D OH  1 
ATOM   8304  N  N   . ASN D 1 62  ? 19.172  10.259  87.713  1.00 31.73 ? 62   ASN D N   1 
ATOM   8305  C  CA  . ASN D 1 62  ? 19.841  9.306   86.831  1.00 32.24 ? 62   ASN D CA  1 
ATOM   8306  C  C   . ASN D 1 62  ? 18.966  8.095   86.522  1.00 33.36 ? 62   ASN D C   1 
ATOM   8307  O  O   . ASN D 1 62  ? 19.054  7.519   85.437  1.00 34.78 ? 62   ASN D O   1 
ATOM   8308  C  CB  . ASN D 1 62  ? 21.162  8.840   87.450  1.00 31.12 ? 62   ASN D CB  1 
ATOM   8309  C  CG  . ASN D 1 62  ? 22.160  9.969   87.617  1.00 28.54 ? 62   ASN D CG  1 
ATOM   8310  O  OD1 . ASN D 1 62  ? 22.308  10.819  86.740  1.00 29.44 ? 62   ASN D OD1 1 
ATOM   8311  N  ND2 . ASN D 1 62  ? 22.855  9.979   88.747  1.00 28.83 ? 62   ASN D ND2 1 
ATOM   8312  N  N   . ALA D 1 63  ? 18.121  7.720   87.481  1.00 35.33 ? 63   ALA D N   1 
ATOM   8313  C  CA  . ALA D 1 63  ? 17.225  6.577   87.331  1.00 35.70 ? 63   ALA D CA  1 
ATOM   8314  C  C   . ALA D 1 63  ? 16.115  6.822   86.312  1.00 36.47 ? 63   ALA D C   1 
ATOM   8315  O  O   . ALA D 1 63  ? 15.914  6.015   85.402  1.00 36.24 ? 63   ALA D O   1 
ATOM   8316  C  CB  . ALA D 1 63  ? 16.627  6.198   88.678  1.00 36.08 ? 63   ALA D CB  1 
ATOM   8317  N  N   . VAL D 1 64  ? 15.401  7.936   86.467  1.00 37.52 ? 64   VAL D N   1 
ATOM   8318  C  CA  . VAL D 1 64  ? 14.307  8.282   85.561  1.00 39.18 ? 64   VAL D CA  1 
ATOM   8319  C  C   . VAL D 1 64  ? 14.771  8.534   84.125  1.00 40.08 ? 64   VAL D C   1 
ATOM   8320  O  O   . VAL D 1 64  ? 13.994  8.377   83.186  1.00 39.30 ? 64   VAL D O   1 
ATOM   8321  C  CB  . VAL D 1 64  ? 13.505  9.509   86.064  1.00 38.61 ? 64   VAL D CB  1 
ATOM   8322  C  CG1 . VAL D 1 64  ? 12.866  9.205   87.410  1.00 39.12 ? 64   VAL D CG1 1 
ATOM   8323  C  CG2 . VAL D 1 64  ? 14.400  10.728  86.165  1.00 38.63 ? 64   VAL D CG2 1 
ATOM   8324  N  N   . GLN D 1 65  ? 16.038  8.912   83.964  1.00 41.94 ? 65   GLN D N   1 
ATOM   8325  C  CA  . GLN D 1 65  ? 16.607  9.175   82.642  1.00 44.36 ? 65   GLN D CA  1 
ATOM   8326  C  C   . GLN D 1 65  ? 16.630  7.917   81.780  1.00 44.75 ? 65   GLN D C   1 
ATOM   8327  O  O   . GLN D 1 65  ? 16.299  7.964   80.592  1.00 43.11 ? 65   GLN D O   1 
ATOM   8328  C  CB  . GLN D 1 65  ? 18.024  9.743   82.765  1.00 45.79 ? 65   GLN D CB  1 
ATOM   8329  C  CG  . GLN D 1 65  ? 18.083  11.201  83.197  1.00 49.31 ? 65   GLN D CG  1 
ATOM   8330  C  CD  . GLN D 1 65  ? 17.453  12.140  82.183  1.00 51.23 ? 65   GLN D CD  1 
ATOM   8331  O  OE1 . GLN D 1 65  ? 17.656  11.999  80.975  1.00 52.72 ? 65   GLN D OE1 1 
ATOM   8332  N  NE2 . GLN D 1 65  ? 16.686  13.107  82.672  1.00 52.62 ? 65   GLN D NE2 1 
ATOM   8333  N  N   . GLU D 1 66  ? 17.026  6.798   82.383  1.00 45.44 ? 66   GLU D N   1 
ATOM   8334  C  CA  . GLU D 1 66  ? 17.085  5.521   81.678  1.00 45.96 ? 66   GLU D CA  1 
ATOM   8335  C  C   . GLU D 1 66  ? 15.668  5.037   81.382  1.00 44.86 ? 66   GLU D C   1 
ATOM   8336  O  O   . GLU D 1 66  ? 15.409  4.437   80.337  1.00 45.00 ? 66   GLU D O   1 
ATOM   8337  C  CB  . GLU D 1 66  ? 17.831  4.480   82.516  1.00 47.03 ? 66   GLU D CB  1 
ATOM   8338  C  CG  . GLU D 1 66  ? 18.130  3.177   81.778  1.00 50.66 ? 66   GLU D CG  1 
ATOM   8339  C  CD  . GLU D 1 66  ? 19.110  3.358   80.630  1.00 51.70 ? 66   GLU D CD  1 
ATOM   8340  O  OE1 . GLU D 1 66  ? 20.328  3.205   80.860  1.00 53.24 ? 66   GLU D OE1 1 
ATOM   8341  O  OE2 . GLU D 1 66  ? 18.664  3.648   79.500  1.00 51.50 ? 66   GLU D OE2 1 
ATOM   8342  N  N   . TRP D 1 67  ? 14.758  5.313   82.313  1.00 43.14 ? 67   TRP D N   1 
ATOM   8343  C  CA  . TRP D 1 67  ? 13.353  4.942   82.185  1.00 40.62 ? 67   TRP D CA  1 
ATOM   8344  C  C   . TRP D 1 67  ? 12.739  5.637   80.967  1.00 39.92 ? 67   TRP D C   1 
ATOM   8345  O  O   . TRP D 1 67  ? 11.927  5.051   80.249  1.00 40.84 ? 67   TRP D O   1 
ATOM   8346  C  CB  . TRP D 1 67  ? 12.601  5.327   83.468  1.00 38.98 ? 67   TRP D CB  1 
ATOM   8347  C  CG  . TRP D 1 67  ? 11.102  5.282   83.366  1.00 37.23 ? 67   TRP D CG  1 
ATOM   8348  C  CD1 . TRP D 1 67  ? 10.328  4.200   83.057  1.00 36.07 ? 67   TRP D CD1 1 
ATOM   8349  C  CD2 . TRP D 1 67  ? 10.199  6.378   83.561  1.00 36.50 ? 67   TRP D CD2 1 
ATOM   8350  N  NE1 . TRP D 1 67  ? 9.001   4.554   83.043  1.00 33.97 ? 67   TRP D NE1 1 
ATOM   8351  C  CE2 . TRP D 1 67  ? 8.893   5.885   83.349  1.00 35.19 ? 67   TRP D CE2 1 
ATOM   8352  C  CE3 . TRP D 1 67  ? 10.368  7.729   83.893  1.00 36.66 ? 67   TRP D CE3 1 
ATOM   8353  C  CZ2 . TRP D 1 67  ? 7.759   6.698   83.456  1.00 35.45 ? 67   TRP D CZ2 1 
ATOM   8354  C  CZ3 . TRP D 1 67  ? 9.239   8.538   84.000  1.00 35.70 ? 67   TRP D CZ3 1 
ATOM   8355  C  CH2 . TRP D 1 67  ? 7.952   8.017   83.781  1.00 36.25 ? 67   TRP D CH2 1 
ATOM   8356  N  N   . LEU D 1 68  ? 13.154  6.880   80.733  1.00 38.72 ? 68   LEU D N   1 
ATOM   8357  C  CA  . LEU D 1 68  ? 12.669  7.675   79.609  1.00 37.51 ? 68   LEU D CA  1 
ATOM   8358  C  C   . LEU D 1 68  ? 13.315  7.247   78.294  1.00 36.85 ? 68   LEU D C   1 
ATOM   8359  O  O   . LEU D 1 68  ? 12.661  7.230   77.249  1.00 36.12 ? 68   LEU D O   1 
ATOM   8360  C  CB  . LEU D 1 68  ? 12.954  9.160   79.851  1.00 38.41 ? 68   LEU D CB  1 
ATOM   8361  C  CG  . LEU D 1 68  ? 12.235  9.839   81.018  1.00 36.90 ? 68   LEU D CG  1 
ATOM   8362  C  CD1 . LEU D 1 68  ? 12.813  11.226  81.250  1.00 36.87 ? 68   LEU D CD1 1 
ATOM   8363  C  CD2 . LEU D 1 68  ? 10.747  9.912   80.734  1.00 38.37 ? 68   LEU D CD2 1 
ATOM   8364  N  N   . ARG D 1 69  ? 14.603  6.914   78.356  1.00 36.15 ? 69   ARG D N   1 
ATOM   8365  C  CA  . ARG D 1 69  ? 15.359  6.493   77.180  1.00 35.78 ? 69   ARG D CA  1 
ATOM   8366  C  C   . ARG D 1 69  ? 15.056  5.066   76.725  1.00 35.21 ? 69   ARG D C   1 
ATOM   8367  O  O   . ARG D 1 69  ? 15.395  4.681   75.605  1.00 33.94 ? 69   ARG D O   1 
ATOM   8368  C  CB  . ARG D 1 69  ? 16.860  6.656   77.432  1.00 36.69 ? 69   ARG D CB  1 
ATOM   8369  C  CG  . ARG D 1 69  ? 17.342  8.099   77.444  1.00 38.29 ? 69   ARG D CG  1 
ATOM   8370  C  CD  . ARG D 1 69  ? 17.070  8.784   76.107  1.00 39.10 ? 69   ARG D CD  1 
ATOM   8371  N  NE  . ARG D 1 69  ? 17.672  10.113  76.030  1.00 40.45 ? 69   ARG D NE  1 
ATOM   8372  C  CZ  . ARG D 1 69  ? 17.137  11.214  76.549  1.00 42.72 ? 69   ARG D CZ  1 
ATOM   8373  N  NH1 . ARG D 1 69  ? 15.976  11.157  77.191  1.00 43.39 ? 69   ARG D NH1 1 
ATOM   8374  N  NH2 . ARG D 1 69  ? 17.762  12.377  76.422  1.00 43.25 ? 69   ARG D NH2 1 
ATOM   8375  N  N   . ALA D 1 70  ? 14.422  4.289   77.598  1.00 35.16 ? 70   ALA D N   1 
ATOM   8376  C  CA  . ALA D 1 70  ? 14.067  2.909   77.288  1.00 34.50 ? 70   ALA D CA  1 
ATOM   8377  C  C   . ALA D 1 70  ? 12.668  2.819   76.680  1.00 33.26 ? 70   ALA D C   1 
ATOM   8378  O  O   . ALA D 1 70  ? 12.474  2.195   75.635  1.00 34.63 ? 70   ALA D O   1 
ATOM   8379  C  CB  . ALA D 1 70  ? 14.155  2.050   78.544  1.00 35.62 ? 70   ALA D CB  1 
ATOM   8380  N  N   . GLY D 1 71  ? 11.701  3.451   77.338  1.00 31.81 ? 71   GLY D N   1 
ATOM   8381  C  CA  . GLY D 1 71  ? 10.330  3.436   76.857  1.00 30.54 ? 71   GLY D CA  1 
ATOM   8382  C  C   . GLY D 1 71  ? 9.549   4.642   77.338  1.00 29.57 ? 71   GLY D C   1 
ATOM   8383  O  O   . GLY D 1 71  ? 8.957   5.364   76.536  1.00 28.10 ? 71   GLY D O   1 
ATOM   8384  N  N   . GLY D 1 72  ? 9.547   4.856   78.651  1.00 29.76 ? 72   GLY D N   1 
ATOM   8385  C  CA  . GLY D 1 72  ? 8.842   5.987   79.227  1.00 29.94 ? 72   GLY D CA  1 
ATOM   8386  C  C   . GLY D 1 72  ? 7.456   5.675   79.760  1.00 31.35 ? 72   GLY D C   1 
ATOM   8387  O  O   . GLY D 1 72  ? 6.828   6.531   80.382  1.00 31.93 ? 72   GLY D O   1 
ATOM   8388  N  N   . ASP D 1 73  ? 6.972   4.461   79.511  1.00 32.87 ? 73   ASP D N   1 
ATOM   8389  C  CA  . ASP D 1 73  ? 5.650   4.048   79.976  1.00 34.07 ? 73   ASP D CA  1 
ATOM   8390  C  C   . ASP D 1 73  ? 5.617   3.911   81.495  1.00 34.33 ? 73   ASP D C   1 
ATOM   8391  O  O   . ASP D 1 73  ? 6.552   3.384   82.100  1.00 34.02 ? 73   ASP D O   1 
ATOM   8392  C  CB  . ASP D 1 73  ? 5.235   2.727   79.321  1.00 35.13 ? 73   ASP D CB  1 
ATOM   8393  C  CG  . ASP D 1 73  ? 4.892   2.883   77.846  1.00 36.33 ? 73   ASP D CG  1 
ATOM   8394  O  OD1 . ASP D 1 73  ? 5.798   3.205   77.047  1.00 35.38 ? 73   ASP D OD1 1 
ATOM   8395  O  OD2 . ASP D 1 73  ? 3.713   2.679   77.487  1.00 36.99 ? 73   ASP D OD2 1 
ATOM   8396  N  N   . THR D 1 74  ? 4.530   4.383   82.100  1.00 34.84 ? 74   THR D N   1 
ATOM   8397  C  CA  . THR D 1 74  ? 4.353   4.331   83.551  1.00 35.04 ? 74   THR D CA  1 
ATOM   8398  C  C   . THR D 1 74  ? 4.150   2.912   84.088  1.00 36.65 ? 74   THR D C   1 
ATOM   8399  O  O   . THR D 1 74  ? 3.657   2.718   85.200  1.00 35.80 ? 74   THR D O   1 
ATOM   8400  C  CB  . THR D 1 74  ? 3.176   5.225   83.999  1.00 32.41 ? 74   THR D CB  1 
ATOM   8401  O  OG1 . THR D 1 74  ? 1.995   4.868   83.272  1.00 32.18 ? 74   THR D OG1 1 
ATOM   8402  C  CG2 . THR D 1 74  ? 3.497   6.689   83.752  1.00 31.38 ? 74   THR D CG2 1 
ATOM   8403  N  N   . ARG D 1 75  ? 4.550   1.928   83.289  1.00 39.09 ? 75   ARG D N   1 
ATOM   8404  C  CA  . ARG D 1 75  ? 4.434   0.519   83.650  1.00 40.88 ? 75   ARG D CA  1 
ATOM   8405  C  C   . ARG D 1 75  ? 5.822   -0.121  83.662  1.00 43.07 ? 75   ARG D C   1 
ATOM   8406  O  O   . ARG D 1 75  ? 5.968   -1.306  83.968  1.00 43.84 ? 75   ARG D O   1 
ATOM   8407  C  CB  . ARG D 1 75  ? 3.551   -0.209  82.633  1.00 40.26 ? 75   ARG D CB  1 
ATOM   8408  C  CG  . ARG D 1 75  ? 2.193   0.433   82.399  1.00 38.52 ? 75   ARG D CG  1 
ATOM   8409  C  CD  . ARG D 1 75  ? 1.501   -0.190  81.201  1.00 37.19 ? 75   ARG D CD  1 
ATOM   8410  N  NE  . ARG D 1 75  ? 2.286   -0.032  79.979  1.00 35.79 ? 75   ARG D NE  1 
ATOM   8411  C  CZ  . ARG D 1 75  ? 2.162   -0.799  78.900  1.00 34.80 ? 75   ARG D CZ  1 
ATOM   8412  N  NH1 . ARG D 1 75  ? 1.279   -1.790  78.880  1.00 33.25 ? 75   ARG D NH1 1 
ATOM   8413  N  NH2 . ARG D 1 75  ? 2.928   -0.576  77.840  1.00 34.68 ? 75   ARG D NH2 1 
ATOM   8414  N  N   . ASN D 1 76  ? 6.837   0.670   83.321  1.00 44.62 ? 76   ASN D N   1 
ATOM   8415  C  CA  . ASN D 1 76  ? 8.217   0.195   83.276  1.00 46.26 ? 76   ASN D CA  1 
ATOM   8416  C  C   . ASN D 1 76  ? 9.092   0.968   84.260  1.00 46.89 ? 76   ASN D C   1 
ATOM   8417  O  O   . ASN D 1 76  ? 10.315  1.024   84.109  1.00 47.60 ? 76   ASN D O   1 
ATOM   8418  C  CB  . ASN D 1 76  ? 8.780   0.354   81.858  1.00 46.88 ? 76   ASN D CB  1 
ATOM   8419  C  CG  . ASN D 1 76  ? 7.874   -0.244  80.797  1.00 46.82 ? 76   ASN D CG  1 
ATOM   8420  O  OD1 . ASN D 1 76  ? 7.494   0.431   79.841  1.00 47.58 ? 76   ASN D OD1 1 
ATOM   8421  N  ND2 . ASN D 1 76  ? 7.520   -1.513  80.964  1.00 47.03 ? 76   ASN D ND2 1 
HETATM 8422  N  N   . MSE D 1 77  ? 8.458   1.548   85.275  1.00 47.80 ? 77   MSE D N   1 
HETATM 8423  C  CA  . MSE D 1 77  ? 9.154   2.339   86.287  1.00 48.60 ? 77   MSE D CA  1 
HETATM 8424  C  C   . MSE D 1 77  ? 9.866   1.487   87.332  1.00 47.78 ? 77   MSE D C   1 
HETATM 8425  O  O   . MSE D 1 77  ? 11.072  1.631   87.542  1.00 46.43 ? 77   MSE D O   1 
HETATM 8426  C  CB  . MSE D 1 77  ? 8.168   3.279   86.978  1.00 51.15 ? 77   MSE D CB  1 
HETATM 8427  C  CG  . MSE D 1 77  ? 7.368   4.131   86.015  1.00 54.36 ? 77   MSE D CG  1 
HETATM 8428  SE SE  . MSE D 1 77  ? 6.070   5.228   86.901  1.00 60.41 ? 77   MSE D SE  1 
HETATM 8429  C  CE  . MSE D 1 77  ? 7.132   6.820   87.110  1.00 57.38 ? 77   MSE D CE  1 
ATOM   8430  N  N   . ARG D 1 78  ? 9.112   0.603   87.982  1.00 47.47 ? 78   ARG D N   1 
ATOM   8431  C  CA  . ARG D 1 78  ? 9.651   -0.276  89.016  1.00 47.19 ? 78   ARG D CA  1 
ATOM   8432  C  C   . ARG D 1 78  ? 10.764  -1.176  88.475  1.00 46.38 ? 78   ARG D C   1 
ATOM   8433  O  O   . ARG D 1 78  ? 11.578  -1.702  89.239  1.00 46.32 ? 78   ARG D O   1 
ATOM   8434  C  CB  . ARG D 1 78  ? 8.527   -1.126  89.621  1.00 47.72 ? 78   ARG D CB  1 
ATOM   8435  C  CG  . ARG D 1 78  ? 8.907   -1.851  90.905  1.00 48.73 ? 78   ARG D CG  1 
ATOM   8436  C  CD  . ARG D 1 78  ? 9.272   -0.866  92.006  1.00 49.28 ? 78   ARG D CD  1 
ATOM   8437  N  NE  . ARG D 1 78  ? 9.768   -1.532  93.210  1.00 50.31 ? 78   ARG D NE  1 
ATOM   8438  C  CZ  . ARG D 1 78  ? 11.012  -1.975  93.368  1.00 50.11 ? 78   ARG D CZ  1 
ATOM   8439  N  NH1 . ARG D 1 78  ? 11.905  -1.828  92.397  1.00 49.56 ? 78   ARG D NH1 1 
ATOM   8440  N  NH2 . ARG D 1 78  ? 11.369  -2.555  94.506  1.00 49.70 ? 78   ARG D NH2 1 
ATOM   8441  N  N   . GLN D 1 79  ? 10.811  -1.319  87.153  1.00 45.54 ? 79   GLN D N   1 
ATOM   8442  C  CA  . GLN D 1 79  ? 11.814  -2.141  86.484  1.00 45.73 ? 79   GLN D CA  1 
ATOM   8443  C  C   . GLN D 1 79  ? 13.221  -1.550  86.601  1.00 45.93 ? 79   GLN D C   1 
ATOM   8444  O  O   . GLN D 1 79  ? 14.200  -2.173  86.183  1.00 45.22 ? 79   GLN D O   1 
ATOM   8445  C  CB  . GLN D 1 79  ? 11.441  -2.323  85.011  1.00 46.12 ? 79   GLN D CB  1 
ATOM   8446  C  CG  . GLN D 1 79  ? 10.034  -2.870  84.798  1.00 46.12 ? 79   GLN D CG  1 
ATOM   8447  C  CD  . GLN D 1 79  ? 9.692   -3.103  83.335  1.00 46.91 ? 79   GLN D CD  1 
ATOM   8448  O  OE1 . GLN D 1 79  ? 8.529   -3.306  82.987  1.00 46.45 ? 79   GLN D OE1 1 
ATOM   8449  N  NE2 . GLN D 1 79  ? 10.706  -3.088  82.473  1.00 46.54 ? 79   GLN D NE2 1 
ATOM   8450  N  N   . PHE D 1 80  ? 13.315  -0.349  87.169  1.00 46.64 ? 80   PHE D N   1 
ATOM   8451  C  CA  . PHE D 1 80  ? 14.600  0.321   87.352  1.00 46.20 ? 80   PHE D CA  1 
ATOM   8452  C  C   . PHE D 1 80  ? 14.739  0.850   88.785  1.00 44.82 ? 80   PHE D C   1 
ATOM   8453  O  O   . PHE D 1 80  ? 15.538  1.749   89.056  1.00 44.96 ? 80   PHE D O   1 
ATOM   8454  C  CB  . PHE D 1 80  ? 14.763  1.460   86.336  1.00 47.26 ? 80   PHE D CB  1 
ATOM   8455  C  CG  . PHE D 1 80  ? 16.199  1.784   86.016  1.00 49.15 ? 80   PHE D CG  1 
ATOM   8456  C  CD1 . PHE D 1 80  ? 16.921  0.988   85.130  1.00 49.66 ? 80   PHE D CD1 1 
ATOM   8457  C  CD2 . PHE D 1 80  ? 16.836  2.867   86.613  1.00 49.47 ? 80   PHE D CD2 1 
ATOM   8458  C  CE1 . PHE D 1 80  ? 18.257  1.264   84.846  1.00 49.85 ? 80   PHE D CE1 1 
ATOM   8459  C  CE2 . PHE D 1 80  ? 18.173  3.152   86.336  1.00 49.49 ? 80   PHE D CE2 1 
ATOM   8460  C  CZ  . PHE D 1 80  ? 18.884  2.349   85.451  1.00 49.86 ? 80   PHE D CZ  1 
ATOM   8461  N  N   . GLY D 1 81  ? 13.953  0.280   89.697  1.00 42.85 ? 81   GLY D N   1 
ATOM   8462  C  CA  . GLY D 1 81  ? 14.001  0.682   91.093  1.00 39.89 ? 81   GLY D CA  1 
ATOM   8463  C  C   . GLY D 1 81  ? 13.310  1.990   91.434  1.00 37.59 ? 81   GLY D C   1 
ATOM   8464  O  O   . GLY D 1 81  ? 13.559  2.567   92.493  1.00 36.82 ? 81   GLY D O   1 
ATOM   8465  N  N   . ILE D 1 82  ? 12.441  2.463   90.547  1.00 35.75 ? 82   ILE D N   1 
ATOM   8466  C  CA  . ILE D 1 82  ? 11.720  3.708   90.780  1.00 34.35 ? 82   ILE D CA  1 
ATOM   8467  C  C   . ILE D 1 82  ? 10.399  3.436   91.492  1.00 33.78 ? 82   ILE D C   1 
ATOM   8468  O  O   . ILE D 1 82  ? 9.644   2.542   91.105  1.00 31.96 ? 82   ILE D O   1 
ATOM   8469  C  CB  . ILE D 1 82  ? 11.441  4.454   89.459  1.00 35.38 ? 82   ILE D CB  1 
ATOM   8470  C  CG1 . ILE D 1 82  ? 12.745  4.645   88.679  1.00 35.85 ? 82   ILE D CG1 1 
ATOM   8471  C  CG2 . ILE D 1 82  ? 10.795  5.807   89.745  1.00 34.12 ? 82   ILE D CG2 1 
ATOM   8472  C  CD1 . ILE D 1 82  ? 12.552  5.201   87.282  1.00 35.48 ? 82   ILE D CD1 1 
ATOM   8473  N  N   . ASP D 1 83  ? 10.138  4.210   92.542  1.00 33.44 ? 83   ASP D N   1 
ATOM   8474  C  CA  . ASP D 1 83  ? 8.914   4.078   93.326  1.00 32.09 ? 83   ASP D CA  1 
ATOM   8475  C  C   . ASP D 1 83  ? 8.041   5.322   93.181  1.00 32.16 ? 83   ASP D C   1 
ATOM   8476  O  O   . ASP D 1 83  ? 8.499   6.444   93.405  1.00 30.35 ? 83   ASP D O   1 
ATOM   8477  C  CB  . ASP D 1 83  ? 9.250   3.852   94.805  1.00 30.61 ? 83   ASP D CB  1 
ATOM   8478  C  CG  . ASP D 1 83  ? 10.054  2.588   95.036  1.00 29.00 ? 83   ASP D CG  1 
ATOM   8479  O  OD1 . ASP D 1 83  ? 9.469   1.487   94.967  1.00 27.09 ? 83   ASP D OD1 1 
ATOM   8480  O  OD2 . ASP D 1 83  ? 11.271  2.696   95.288  1.00 30.66 ? 83   ASP D OD2 1 
ATOM   8481  N  N   . ALA D 1 84  ? 6.784   5.112   92.801  1.00 33.37 ? 84   ALA D N   1 
ATOM   8482  C  CA  . ALA D 1 84  ? 5.833   6.204   92.626  1.00 34.18 ? 84   ALA D CA  1 
ATOM   8483  C  C   . ALA D 1 84  ? 4.973   6.383   93.877  1.00 35.34 ? 84   ALA D C   1 
ATOM   8484  O  O   . ALA D 1 84  ? 4.231   5.480   94.263  1.00 36.07 ? 84   ALA D O   1 
ATOM   8485  C  CB  . ALA D 1 84  ? 4.955   5.942   91.414  1.00 34.17 ? 84   ALA D CB  1 
ATOM   8486  N  N   . TRP D 1 85  ? 5.088   7.547   94.509  1.00 36.11 ? 85   TRP D N   1 
ATOM   8487  C  CA  . TRP D 1 85  ? 4.326   7.851   95.718  1.00 37.05 ? 85   TRP D CA  1 
ATOM   8488  C  C   . TRP D 1 85  ? 3.205   8.846   95.421  1.00 38.71 ? 85   TRP D C   1 
ATOM   8489  O  O   . TRP D 1 85  ? 3.400   10.061  95.512  1.00 40.09 ? 85   TRP D O   1 
ATOM   8490  C  CB  . TRP D 1 85  ? 5.249   8.419   96.802  1.00 37.23 ? 85   TRP D CB  1 
ATOM   8491  C  CG  . TRP D 1 85  ? 6.354   7.497   97.221  1.00 35.49 ? 85   TRP D CG  1 
ATOM   8492  C  CD1 . TRP D 1 85  ? 7.509   7.239   96.541  1.00 36.43 ? 85   TRP D CD1 1 
ATOM   8493  C  CD2 . TRP D 1 85  ? 6.416   6.724   98.425  1.00 35.50 ? 85   TRP D CD2 1 
ATOM   8494  N  NE1 . TRP D 1 85  ? 8.289   6.354   97.247  1.00 36.56 ? 85   TRP D NE1 1 
ATOM   8495  C  CE2 . TRP D 1 85  ? 7.642   6.022   98.408  1.00 37.02 ? 85   TRP D CE2 1 
ATOM   8496  C  CE3 . TRP D 1 85  ? 5.556   6.556   99.518  1.00 35.96 ? 85   TRP D CE3 1 
ATOM   8497  C  CZ2 . TRP D 1 85  ? 8.030   5.163   99.443  1.00 37.61 ? 85   TRP D CZ2 1 
ATOM   8498  C  CZ3 . TRP D 1 85  ? 5.941   5.702   100.549 1.00 37.95 ? 85   TRP D CZ3 1 
ATOM   8499  C  CH2 . TRP D 1 85  ? 7.169   5.017   100.502 1.00 38.13 ? 85   TRP D CH2 1 
ATOM   8500  N  N   . GLN D 1 86  ? 2.030   8.321   95.079  1.00 38.68 ? 86   GLN D N   1 
ATOM   8501  C  CA  . GLN D 1 86  ? 0.867   9.147   94.760  1.00 38.36 ? 86   GLN D CA  1 
ATOM   8502  C  C   . GLN D 1 86  ? 0.477   10.057  95.923  1.00 39.93 ? 86   GLN D C   1 
ATOM   8503  O  O   . GLN D 1 86  ? 0.711   9.729   97.086  1.00 38.81 ? 86   GLN D O   1 
ATOM   8504  C  CB  . GLN D 1 86  ? -0.320  8.262   94.365  1.00 35.79 ? 86   GLN D CB  1 
ATOM   8505  C  CG  . GLN D 1 86  ? -1.498  9.023   93.763  1.00 30.67 ? 86   GLN D CG  1 
ATOM   8506  C  CD  . GLN D 1 86  ? -2.575  8.109   93.207  1.00 26.93 ? 86   GLN D CD  1 
ATOM   8507  O  OE1 . GLN D 1 86  ? -2.287  7.024   92.698  1.00 27.61 ? 86   GLN D OE1 1 
ATOM   8508  N  NE2 . GLN D 1 86  ? -3.824  8.549   93.293  1.00 23.75 ? 86   GLN D NE2 1 
HETATM 8509  N  N   . MSE D 1 87  ? -0.099  11.210  95.595  1.00 40.60 ? 87   MSE D N   1 
HETATM 8510  C  CA  . MSE D 1 87  ? -0.525  12.174  96.603  1.00 41.76 ? 87   MSE D CA  1 
HETATM 8511  C  C   . MSE D 1 87  ? -2.036  12.163  96.809  1.00 42.12 ? 87   MSE D C   1 
HETATM 8512  O  O   . MSE D 1 87  ? -2.801  11.951  95.866  1.00 42.86 ? 87   MSE D O   1 
HETATM 8513  C  CB  . MSE D 1 87  ? -0.058  13.578  96.221  1.00 42.34 ? 87   MSE D CB  1 
HETATM 8514  C  CG  . MSE D 1 87  ? 1.449   13.748  96.242  1.00 43.77 ? 87   MSE D CG  1 
HETATM 8515  SE SE  . MSE D 1 87  ? 1.993   15.489  95.639  1.00 46.54 ? 87   MSE D SE  1 
HETATM 8516  C  CE  . MSE D 1 87  ? 1.586   16.495  97.227  1.00 44.61 ? 87   MSE D CE  1 
ATOM   8517  N  N   . GLU D 1 88  ? -2.455  12.397  98.049  1.00 42.52 ? 88   GLU D N   1 
ATOM   8518  C  CA  . GLU D 1 88  ? -3.870  12.418  98.404  1.00 43.03 ? 88   GLU D CA  1 
ATOM   8519  C  C   . GLU D 1 88  ? -4.634  13.534  97.696  1.00 43.93 ? 88   GLU D C   1 
ATOM   8520  O  O   . GLU D 1 88  ? -5.733  13.316  97.185  1.00 45.55 ? 88   GLU D O   1 
ATOM   8521  C  CB  . GLU D 1 88  ? -4.038  12.551  99.921  1.00 42.54 ? 88   GLU D CB  1 
ATOM   8522  C  CG  . GLU D 1 88  ? -3.272  13.713  100.543 1.00 43.31 ? 88   GLU D CG  1 
ATOM   8523  C  CD  . GLU D 1 88  ? -3.607  13.926  102.009 1.00 43.81 ? 88   GLU D CD  1 
ATOM   8524  O  OE1 . GLU D 1 88  ? -3.460  12.974  102.806 1.00 42.02 ? 88   GLU D OE1 1 
ATOM   8525  O  OE2 . GLU D 1 88  ? -4.014  15.053  102.364 1.00 44.19 ? 88   GLU D OE2 1 
ATOM   8526  N  N   . GLY D 1 89  ? -4.039  14.722  97.658  1.00 43.64 ? 89   GLY D N   1 
ATOM   8527  C  CA  . GLY D 1 89  ? -4.680  15.852  97.015  1.00 43.55 ? 89   GLY D CA  1 
ATOM   8528  C  C   . GLY D 1 89  ? -5.623  16.594  97.940  1.00 44.28 ? 89   GLY D C   1 
ATOM   8529  O  O   . GLY D 1 89  ? -5.496  16.521  99.164  1.00 42.33 ? 89   GLY D O   1 
ATOM   8530  N  N   . ALA D 1 90  ? -6.573  17.310  97.347  1.00 46.17 ? 90   ALA D N   1 
ATOM   8531  C  CA  . ALA D 1 90  ? -7.553  18.084  98.101  1.00 47.86 ? 90   ALA D CA  1 
ATOM   8532  C  C   . ALA D 1 90  ? -8.586  17.200  98.803  1.00 47.80 ? 90   ALA D C   1 
ATOM   8533  O  O   . ALA D 1 90  ? -8.596  17.101  100.032 1.00 49.38 ? 90   ALA D O   1 
ATOM   8534  C  CB  . ALA D 1 90  ? -8.248  19.083  97.179  1.00 48.75 ? 90   ALA D CB  1 
ATOM   8535  N  N   . ASP D 1 91  ? -9.441  16.554  98.013  1.00 46.12 ? 91   ASP D N   1 
ATOM   8536  C  CA  . ASP D 1 91  ? -10.491 15.681  98.536  1.00 43.98 ? 91   ASP D CA  1 
ATOM   8537  C  C   . ASP D 1 91  ? -9.968  14.358  99.098  1.00 43.87 ? 91   ASP D C   1 
ATOM   8538  O  O   . ASP D 1 91  ? -10.745 13.534  99.582  1.00 44.30 ? 91   ASP D O   1 
ATOM   8539  C  CB  . ASP D 1 91  ? -11.543 15.410  97.449  1.00 42.35 ? 91   ASP D CB  1 
ATOM   8540  C  CG  . ASP D 1 91  ? -10.989 14.629  96.260  1.00 41.18 ? 91   ASP D CG  1 
ATOM   8541  O  OD1 . ASP D 1 91  ? -9.758  14.620  96.040  1.00 40.24 ? 91   ASP D OD1 1 
ATOM   8542  O  OD2 . ASP D 1 91  ? -11.801 14.019  95.535  1.00 42.05 ? 91   ASP D OD2 1 
ATOM   8543  N  N   . ASN D 1 92  ? -8.652  14.168  99.020  1.00 43.69 ? 92   ASN D N   1 
ATOM   8544  C  CA  . ASN D 1 92  ? -7.982  12.960  99.504  1.00 43.71 ? 92   ASN D CA  1 
ATOM   8545  C  C   . ASN D 1 92  ? -8.271  11.718  98.662  1.00 43.64 ? 92   ASN D C   1 
ATOM   8546  O  O   . ASN D 1 92  ? -7.779  10.629  98.964  1.00 43.74 ? 92   ASN D O   1 
ATOM   8547  C  CB  . ASN D 1 92  ? -8.317  12.692  100.976 1.00 43.67 ? 92   ASN D CB  1 
ATOM   8548  C  CG  . ASN D 1 92  ? -7.872  13.817  101.891 1.00 41.95 ? 92   ASN D CG  1 
ATOM   8549  O  OD1 . ASN D 1 92  ? -6.903  14.521  101.606 1.00 42.06 ? 92   ASN D OD1 1 
ATOM   8550  N  ND2 . ASN D 1 92  ? -8.583  13.994  102.997 1.00 42.32 ? 92   ASN D ND2 1 
ATOM   8551  N  N   . TYR D 1 93  ? -9.069  11.884  97.610  1.00 43.21 ? 93   TYR D N   1 
ATOM   8552  C  CA  . TYR D 1 93  ? -9.407  10.778  96.719  1.00 43.85 ? 93   TYR D CA  1 
ATOM   8553  C  C   . TYR D 1 93  ? -8.385  10.655  95.591  1.00 44.03 ? 93   TYR D C   1 
ATOM   8554  O  O   . TYR D 1 93  ? -8.183  9.571   95.038  1.00 44.00 ? 93   TYR D O   1 
ATOM   8555  C  CB  . TYR D 1 93  ? -10.814 10.956  96.141  1.00 44.00 ? 93   TYR D CB  1 
ATOM   8556  C  CG  . TYR D 1 93  ? -11.928 10.564  97.087  1.00 43.50 ? 93   TYR D CG  1 
ATOM   8557  C  CD1 . TYR D 1 93  ? -12.324 11.409  98.122  1.00 43.11 ? 93   TYR D CD1 1 
ATOM   8558  C  CD2 . TYR D 1 93  ? -12.584 9.341   96.951  1.00 43.47 ? 93   TYR D CD2 1 
ATOM   8559  C  CE1 . TYR D 1 93  ? -13.343 11.047  98.999  1.00 43.20 ? 93   TYR D CE1 1 
ATOM   8560  C  CE2 . TYR D 1 93  ? -13.606 8.969   97.820  1.00 43.56 ? 93   TYR D CE2 1 
ATOM   8561  C  CZ  . TYR D 1 93  ? -13.979 9.825   98.842  1.00 43.59 ? 93   TYR D CZ  1 
ATOM   8562  O  OH  . TYR D 1 93  ? -14.981 9.455   99.710  1.00 43.84 ? 93   TYR D OH  1 
ATOM   8563  N  N   . GLY D 1 94  ? -7.743  11.772  95.261  1.00 44.82 ? 94   GLY D N   1 
ATOM   8564  C  CA  . GLY D 1 94  ? -6.745  11.777  94.207  1.00 44.94 ? 94   GLY D CA  1 
ATOM   8565  C  C   . GLY D 1 94  ? -6.882  12.969  93.281  1.00 44.95 ? 94   GLY D C   1 
ATOM   8566  O  O   . GLY D 1 94  ? -6.917  12.807  92.059  1.00 45.91 ? 94   GLY D O   1 
ATOM   8567  N  N   . ASN D 1 95  ? -6.967  14.165  93.861  1.00 43.59 ? 95   ASN D N   1 
ATOM   8568  C  CA  . ASN D 1 95  ? -7.103  15.396  93.085  1.00 42.70 ? 95   ASN D CA  1 
ATOM   8569  C  C   . ASN D 1 95  ? -6.234  16.523  93.639  1.00 42.94 ? 95   ASN D C   1 
ATOM   8570  O  O   . ASN D 1 95  ? -6.640  17.252  94.548  1.00 42.46 ? 95   ASN D O   1 
ATOM   8571  C  CB  . ASN D 1 95  ? -8.571  15.841  93.027  1.00 39.68 ? 95   ASN D CB  1 
ATOM   8572  C  CG  . ASN D 1 95  ? -9.425  14.932  92.163  1.00 36.81 ? 95   ASN D CG  1 
ATOM   8573  O  OD1 . ASN D 1 95  ? -9.040  14.575  91.050  1.00 36.75 ? 95   ASN D OD1 1 
ATOM   8574  N  ND2 . ASN D 1 95  ? -10.591 14.554  92.671  1.00 35.90 ? 95   ASN D ND2 1 
ATOM   8575  N  N   . VAL D 1 96  ? -5.034  16.651  93.079  1.00 42.69 ? 96   VAL D N   1 
ATOM   8576  C  CA  . VAL D 1 96  ? -4.080  17.678  93.488  1.00 41.64 ? 96   VAL D CA  1 
ATOM   8577  C  C   . VAL D 1 96  ? -4.280  18.940  92.653  1.00 40.04 ? 96   VAL D C   1 
ATOM   8578  O  O   . VAL D 1 96  ? -4.285  18.885  91.423  1.00 38.89 ? 96   VAL D O   1 
ATOM   8579  C  CB  . VAL D 1 96  ? -2.623  17.182  93.326  1.00 41.89 ? 96   VAL D CB  1 
ATOM   8580  C  CG1 . VAL D 1 96  ? -1.646  18.218  93.864  1.00 42.97 ? 96   VAL D CG1 1 
ATOM   8581  C  CG2 . VAL D 1 96  ? -2.441  15.850  94.042  1.00 41.45 ? 96   VAL D CG2 1 
ATOM   8582  N  N   . GLN D 1 97  ? -4.432  20.075  93.331  1.00 39.86 ? 97   GLN D N   1 
ATOM   8583  C  CA  . GLN D 1 97  ? -4.646  21.358  92.667  1.00 39.65 ? 97   GLN D CA  1 
ATOM   8584  C  C   . GLN D 1 97  ? -3.458  21.797  91.809  1.00 38.81 ? 97   GLN D C   1 
ATOM   8585  O  O   . GLN D 1 97  ? -2.300  21.580  92.168  1.00 36.56 ? 97   GLN D O   1 
ATOM   8586  C  CB  . GLN D 1 97  ? -4.982  22.437  93.701  1.00 40.02 ? 97   GLN D CB  1 
ATOM   8587  C  CG  . GLN D 1 97  ? -5.498  23.740  93.103  1.00 40.92 ? 97   GLN D CG  1 
ATOM   8588  C  CD  . GLN D 1 97  ? -5.826  24.788  94.154  1.00 42.24 ? 97   GLN D CD  1 
ATOM   8589  O  OE1 . GLN D 1 97  ? -5.570  24.596  95.345  1.00 41.71 ? 97   GLN D OE1 1 
ATOM   8590  N  NE2 . GLN D 1 97  ? -6.392  25.907  93.715  1.00 41.68 ? 97   GLN D NE2 1 
ATOM   8591  N  N   . PHE D 1 98  ? -3.769  22.410  90.669  1.00 39.40 ? 98   PHE D N   1 
ATOM   8592  C  CA  . PHE D 1 98  ? -2.762  22.891  89.728  1.00 39.24 ? 98   PHE D CA  1 
ATOM   8593  C  C   . PHE D 1 98  ? -3.072  24.297  89.231  1.00 39.71 ? 98   PHE D C   1 
ATOM   8594  O  O   . PHE D 1 98  ? -4.102  24.528  88.594  1.00 40.45 ? 98   PHE D O   1 
ATOM   8595  C  CB  . PHE D 1 98  ? -2.668  21.958  88.513  1.00 40.21 ? 98   PHE D CB  1 
ATOM   8596  C  CG  . PHE D 1 98  ? -1.935  20.675  88.778  1.00 41.44 ? 98   PHE D CG  1 
ATOM   8597  C  CD1 . PHE D 1 98  ? -0.552  20.669  88.933  1.00 41.39 ? 98   PHE D CD1 1 
ATOM   8598  C  CD2 . PHE D 1 98  ? -2.623  19.470  88.859  1.00 41.64 ? 98   PHE D CD2 1 
ATOM   8599  C  CE1 . PHE D 1 98  ? 0.134   19.481  89.165  1.00 41.84 ? 98   PHE D CE1 1 
ATOM   8600  C  CE2 . PHE D 1 98  ? -1.946  18.276  89.091  1.00 41.21 ? 98   PHE D CE2 1 
ATOM   8601  C  CZ  . PHE D 1 98  ? -0.565  18.282  89.245  1.00 42.43 ? 98   PHE D CZ  1 
ATOM   8602  N  N   . THR D 1 99  ? -2.182  25.236  89.535  1.00 39.50 ? 99   THR D N   1 
ATOM   8603  C  CA  . THR D 1 99  ? -2.330  26.615  89.085  1.00 38.48 ? 99   THR D CA  1 
ATOM   8604  C  C   . THR D 1 99  ? -1.119  26.928  88.205  1.00 37.40 ? 99   THR D C   1 
ATOM   8605  O  O   . THR D 1 99  ? -0.289  26.050  87.959  1.00 37.12 ? 99   THR D O   1 
ATOM   8606  C  CB  . THR D 1 99  ? -2.423  27.611  90.271  1.00 38.57 ? 99   THR D CB  1 
ATOM   8607  O  OG1 . THR D 1 99  ? -2.809  28.901  89.783  1.00 39.53 ? 99   THR D OG1 1 
ATOM   8608  C  CG2 . THR D 1 99  ? -1.092  27.734  90.990  1.00 38.53 ? 99   THR D CG2 1 
ATOM   8609  N  N   . GLY D 1 100 ? -1.013  28.163  87.726  1.00 36.07 ? 100  GLY D N   1 
ATOM   8610  C  CA  . GLY D 1 100 ? 0.115   28.505  86.880  1.00 32.93 ? 100  GLY D CA  1 
ATOM   8611  C  C   . GLY D 1 100 ? 0.571   29.947  86.943  1.00 32.18 ? 100  GLY D C   1 
ATOM   8612  O  O   . GLY D 1 100 ? -0.190  30.841  87.310  1.00 31.54 ? 100  GLY D O   1 
ATOM   8613  N  N   . TYR D 1 101 ? 1.836   30.157  86.590  1.00 31.10 ? 101  TYR D N   1 
ATOM   8614  C  CA  . TYR D 1 101 ? 2.445   31.481  86.568  1.00 29.01 ? 101  TYR D CA  1 
ATOM   8615  C  C   . TYR D 1 101 ? 3.538   31.496  85.502  1.00 28.13 ? 101  TYR D C   1 
ATOM   8616  O  O   . TYR D 1 101 ? 4.058   30.446  85.125  1.00 29.47 ? 101  TYR D O   1 
ATOM   8617  C  CB  . TYR D 1 101 ? 3.021   31.849  87.944  1.00 28.61 ? 101  TYR D CB  1 
ATOM   8618  C  CG  . TYR D 1 101 ? 4.226   31.040  88.378  1.00 27.24 ? 101  TYR D CG  1 
ATOM   8619  C  CD1 . TYR D 1 101 ? 4.100   29.701  88.740  1.00 26.79 ? 101  TYR D CD1 1 
ATOM   8620  C  CD2 . TYR D 1 101 ? 5.492   31.622  88.439  1.00 26.70 ? 101  TYR D CD2 1 
ATOM   8621  C  CE1 . TYR D 1 101 ? 5.204   28.961  89.152  1.00 25.40 ? 101  TYR D CE1 1 
ATOM   8622  C  CE2 . TYR D 1 101 ? 6.602   30.890  88.849  1.00 25.50 ? 101  TYR D CE2 1 
ATOM   8623  C  CZ  . TYR D 1 101 ? 6.451   29.560  89.204  1.00 26.98 ? 101  TYR D CZ  1 
ATOM   8624  O  OH  . TYR D 1 101 ? 7.545   28.831  89.612  1.00 28.89 ? 101  TYR D OH  1 
ATOM   8625  N  N   . TYR D 1 102 ? 3.876   32.685  85.013  1.00 27.49 ? 102  TYR D N   1 
ATOM   8626  C  CA  . TYR D 1 102 ? 4.899   32.818  83.980  1.00 26.50 ? 102  TYR D CA  1 
ATOM   8627  C  C   . TYR D 1 102 ? 5.788   34.036  84.215  1.00 25.79 ? 102  TYR D C   1 
ATOM   8628  O  O   . TYR D 1 102 ? 5.660   34.728  85.225  1.00 26.67 ? 102  TYR D O   1 
ATOM   8629  C  CB  . TYR D 1 102 ? 4.242   32.920  82.597  1.00 25.94 ? 102  TYR D CB  1 
ATOM   8630  C  CG  . TYR D 1 102 ? 3.536   34.238  82.335  1.00 23.80 ? 102  TYR D CG  1 
ATOM   8631  C  CD1 . TYR D 1 102 ? 2.490   34.672  83.154  1.00 23.95 ? 102  TYR D CD1 1 
ATOM   8632  C  CD2 . TYR D 1 102 ? 3.920   35.055  81.273  1.00 22.66 ? 102  TYR D CD2 1 
ATOM   8633  C  CE1 . TYR D 1 102 ? 1.848   35.885  82.920  1.00 22.62 ? 102  TYR D CE1 1 
ATOM   8634  C  CE2 . TYR D 1 102 ? 3.284   36.269  81.031  1.00 21.57 ? 102  TYR D CE2 1 
ATOM   8635  C  CZ  . TYR D 1 102 ? 2.250   36.677  81.857  1.00 22.50 ? 102  TYR D CZ  1 
ATOM   8636  O  OH  . TYR D 1 102 ? 1.617   37.874  81.617  1.00 23.13 ? 102  TYR D OH  1 
ATOM   8637  N  N   . THR D 1 103 ? 6.688   34.285  83.267  1.00 25.90 ? 103  THR D N   1 
ATOM   8638  C  CA  . THR D 1 103 ? 7.603   35.417  83.332  1.00 24.67 ? 103  THR D CA  1 
ATOM   8639  C  C   . THR D 1 103 ? 7.277   36.377  82.192  1.00 24.53 ? 103  THR D C   1 
ATOM   8640  O  O   . THR D 1 103 ? 7.675   36.158  81.048  1.00 24.90 ? 103  THR D O   1 
ATOM   8641  C  CB  . THR D 1 103 ? 9.067   34.956  83.215  1.00 24.80 ? 103  THR D CB  1 
ATOM   8642  O  OG1 . THR D 1 103 ? 9.348   34.002  84.246  1.00 27.98 ? 103  THR D OG1 1 
ATOM   8643  C  CG2 . THR D 1 103 ? 10.013  36.135  83.361  1.00 28.09 ? 103  THR D CG2 1 
ATOM   8644  N  N   . PRO D 1 104 ? 6.515   37.441  82.488  1.00 24.04 ? 104  PRO D N   1 
ATOM   8645  C  CA  . PRO D 1 104 ? 6.120   38.444  81.496  1.00 23.75 ? 104  PRO D CA  1 
ATOM   8646  C  C   . PRO D 1 104 ? 7.234   39.408  81.097  1.00 23.04 ? 104  PRO D C   1 
ATOM   8647  O  O   . PRO D 1 104 ? 8.177   39.634  81.854  1.00 24.33 ? 104  PRO D O   1 
ATOM   8648  C  CB  . PRO D 1 104 ? 4.986   39.182  82.204  1.00 24.48 ? 104  PRO D CB  1 
ATOM   8649  C  CG  . PRO D 1 104 ? 5.422   39.152  83.630  1.00 24.08 ? 104  PRO D CG  1 
ATOM   8650  C  CD  . PRO D 1 104 ? 5.893   37.725  83.795  1.00 23.65 ? 104  PRO D CD  1 
ATOM   8651  N  N   . VAL D 1 105 ? 7.123   39.954  79.891  1.00 21.56 ? 105  VAL D N   1 
ATOM   8652  C  CA  . VAL D 1 105 ? 8.094   40.920  79.394  1.00 22.07 ? 105  VAL D CA  1 
ATOM   8653  C  C   . VAL D 1 105 ? 7.363   42.253  79.251  1.00 23.10 ? 105  VAL D C   1 
ATOM   8654  O  O   . VAL D 1 105 ? 6.313   42.330  78.609  1.00 23.82 ? 105  VAL D O   1 
ATOM   8655  C  CB  . VAL D 1 105 ? 8.686   40.503  78.028  1.00 20.83 ? 105  VAL D CB  1 
ATOM   8656  C  CG1 . VAL D 1 105 ? 9.729   41.517  77.578  1.00 19.40 ? 105  VAL D CG1 1 
ATOM   8657  C  CG2 . VAL D 1 105 ? 9.304   39.117  78.120  1.00 20.16 ? 105  VAL D CG2 1 
ATOM   8658  N  N   . ILE D 1 106 ? 7.901   43.290  79.886  1.00 23.76 ? 106  ILE D N   1 
ATOM   8659  C  CA  . ILE D 1 106 ? 7.295   44.616  79.847  1.00 22.83 ? 106  ILE D CA  1 
ATOM   8660  C  C   . ILE D 1 106 ? 8.304   45.654  79.369  1.00 21.65 ? 106  ILE D C   1 
ATOM   8661  O  O   . ILE D 1 106 ? 9.503   45.525  79.621  1.00 20.67 ? 106  ILE D O   1 
ATOM   8662  C  CB  . ILE D 1 106 ? 6.784   45.029  81.250  1.00 25.45 ? 106  ILE D CB  1 
ATOM   8663  C  CG1 . ILE D 1 106 ? 5.907   43.921  81.838  1.00 25.07 ? 106  ILE D CG1 1 
ATOM   8664  C  CG2 . ILE D 1 106 ? 5.986   46.327  81.164  1.00 25.46 ? 106  ILE D CG2 1 
ATOM   8665  C  CD1 . ILE D 1 106 ? 5.548   44.131  83.286  1.00 27.31 ? 106  ILE D CD1 1 
ATOM   8666  N  N   . GLN D 1 107 ? 7.816   46.666  78.658  1.00 22.42 ? 107  GLN D N   1 
ATOM   8667  C  CA  . GLN D 1 107 ? 8.673   47.735  78.159  1.00 22.28 ? 107  GLN D CA  1 
ATOM   8668  C  C   . GLN D 1 107 ? 8.707   48.872  79.175  1.00 22.71 ? 107  GLN D C   1 
ATOM   8669  O  O   . GLN D 1 107 ? 7.707   49.153  79.839  1.00 20.70 ? 107  GLN D O   1 
ATOM   8670  C  CB  . GLN D 1 107 ? 8.181   48.252  76.802  1.00 24.21 ? 107  GLN D CB  1 
ATOM   8671  C  CG  . GLN D 1 107 ? 9.093   49.311  76.186  1.00 26.20 ? 107  GLN D CG  1 
ATOM   8672  C  CD  . GLN D 1 107 ? 8.656   49.762  74.802  1.00 26.33 ? 107  GLN D CD  1 
ATOM   8673  O  OE1 . GLN D 1 107 ? 9.455   50.298  74.034  1.00 25.44 ? 107  GLN D OE1 1 
ATOM   8674  N  NE2 . GLN D 1 107 ? 7.383   49.554  74.481  1.00 28.54 ? 107  GLN D NE2 1 
ATOM   8675  N  N   . ALA D 1 108 ? 9.861   49.520  79.291  1.00 23.02 ? 108  ALA D N   1 
ATOM   8676  C  CA  . ALA D 1 108 ? 10.024  50.619  80.232  1.00 23.34 ? 108  ALA D CA  1 
ATOM   8677  C  C   . ALA D 1 108 ? 11.221  51.494  79.887  1.00 24.18 ? 108  ALA D C   1 
ATOM   8678  O  O   . ALA D 1 108 ? 12.032  51.152  79.026  1.00 24.86 ? 108  ALA D O   1 
ATOM   8679  C  CB  . ALA D 1 108 ? 10.169  50.072  81.647  1.00 23.12 ? 108  ALA D CB  1 
ATOM   8680  N  N   . ARG D 1 109 ? 11.311  52.635  80.561  1.00 25.25 ? 109  ARG D N   1 
ATOM   8681  C  CA  . ARG D 1 109 ? 12.404  53.578  80.362  1.00 27.29 ? 109  ARG D CA  1 
ATOM   8682  C  C   . ARG D 1 109 ? 13.007  53.921  81.718  1.00 28.27 ? 109  ARG D C   1 
ATOM   8683  O  O   . ARG D 1 109 ? 12.337  53.816  82.744  1.00 26.24 ? 109  ARG D O   1 
ATOM   8684  C  CB  . ARG D 1 109 ? 11.894  54.858  79.695  1.00 28.10 ? 109  ARG D CB  1 
ATOM   8685  C  CG  . ARG D 1 109 ? 11.368  54.677  78.283  1.00 30.07 ? 109  ARG D CG  1 
ATOM   8686  C  CD  . ARG D 1 109 ? 12.468  54.280  77.308  1.00 30.51 ? 109  ARG D CD  1 
ATOM   8687  N  NE  . ARG D 1 109 ? 11.955  54.145  75.947  1.00 28.84 ? 109  ARG D NE  1 
ATOM   8688  C  CZ  . ARG D 1 109 ? 11.348  53.059  75.477  1.00 27.90 ? 109  ARG D CZ  1 
ATOM   8689  N  NH1 . ARG D 1 109 ? 11.178  51.997  76.253  1.00 29.82 ? 109  ARG D NH1 1 
ATOM   8690  N  NH2 . ARG D 1 109 ? 10.886  53.044  74.235  1.00 27.67 ? 109  ARG D NH2 1 
ATOM   8691  N  N   . HIS D 1 110 ? 14.275  54.321  81.717  1.00 31.53 ? 110  HIS D N   1 
ATOM   8692  C  CA  . HIS D 1 110 ? 14.962  54.691  82.952  1.00 35.57 ? 110  HIS D CA  1 
ATOM   8693  C  C   . HIS D 1 110 ? 14.379  55.979  83.530  1.00 37.84 ? 110  HIS D C   1 
ATOM   8694  O  O   . HIS D 1 110 ? 14.382  56.182  84.745  1.00 38.56 ? 110  HIS D O   1 
ATOM   8695  C  CB  . HIS D 1 110 ? 16.463  54.859  82.701  1.00 35.15 ? 110  HIS D CB  1 
ATOM   8696  C  CG  . HIS D 1 110 ? 17.165  53.583  82.355  1.00 34.21 ? 110  HIS D CG  1 
ATOM   8697  N  ND1 . HIS D 1 110 ? 17.673  53.330  81.100  1.00 34.90 ? 110  HIS D ND1 1 
ATOM   8698  C  CD2 . HIS D 1 110 ? 17.452  52.493  83.104  1.00 34.15 ? 110  HIS D CD2 1 
ATOM   8699  C  CE1 . HIS D 1 110 ? 18.244  52.139  81.090  1.00 34.36 ? 110  HIS D CE1 1 
ATOM   8700  N  NE2 . HIS D 1 110 ? 18.123  51.610  82.294  1.00 33.83 ? 110  HIS D NE2 1 
ATOM   8701  N  N   . THR D 1 111 ? 13.882  56.842  82.645  1.00 40.25 ? 111  THR D N   1 
ATOM   8702  C  CA  . THR D 1 111 ? 13.276  58.114  83.033  1.00 42.16 ? 111  THR D CA  1 
ATOM   8703  C  C   . THR D 1 111 ? 11.853  58.191  82.484  1.00 43.40 ? 111  THR D C   1 
ATOM   8704  O  O   . THR D 1 111 ? 11.571  57.668  81.404  1.00 44.51 ? 111  THR D O   1 
ATOM   8705  C  CB  . THR D 1 111 ? 14.086  59.318  82.495  1.00 41.80 ? 111  THR D CB  1 
ATOM   8706  O  OG1 . THR D 1 111 ? 14.234  59.205  81.074  1.00 41.74 ? 111  THR D OG1 1 
ATOM   8707  C  CG2 . THR D 1 111 ? 15.461  59.376  83.144  1.00 42.08 ? 111  THR D CG2 1 
ATOM   8708  N  N   . ARG D 1 112 ? 10.958  58.831  83.233  1.00 44.80 ? 112  ARG D N   1 
ATOM   8709  C  CA  . ARG D 1 112 ? 9.566   58.965  82.808  1.00 46.47 ? 112  ARG D CA  1 
ATOM   8710  C  C   . ARG D 1 112 ? 9.416   59.863  81.586  1.00 46.72 ? 112  ARG D C   1 
ATOM   8711  O  O   . ARG D 1 112 ? 9.952   60.973  81.543  1.00 47.20 ? 112  ARG D O   1 
ATOM   8712  C  CB  . ARG D 1 112 ? 8.682   59.468  83.955  1.00 47.97 ? 112  ARG D CB  1 
ATOM   8713  C  CG  . ARG D 1 112 ? 9.181   60.717  84.663  1.00 50.71 ? 112  ARG D CG  1 
ATOM   8714  C  CD  . ARG D 1 112 ? 8.122   61.260  85.610  1.00 53.27 ? 112  ARG D CD  1 
ATOM   8715  N  NE  . ARG D 1 112 ? 7.646   60.246  86.548  1.00 56.43 ? 112  ARG D NE  1 
ATOM   8716  C  CZ  . ARG D 1 112 ? 6.481   60.302  87.188  1.00 58.65 ? 112  ARG D CZ  1 
ATOM   8717  N  NH1 . ARG D 1 112 ? 5.661   61.326  86.995  1.00 60.28 ? 112  ARG D NH1 1 
ATOM   8718  N  NH2 . ARG D 1 112 ? 6.131   59.327  88.017  1.00 59.26 ? 112  ARG D NH2 1 
ATOM   8719  N  N   . GLN D 1 113 ? 8.686   59.365  80.592  1.00 46.55 ? 113  GLN D N   1 
ATOM   8720  C  CA  . GLN D 1 113 ? 8.462   60.096  79.351  1.00 47.36 ? 113  GLN D CA  1 
ATOM   8721  C  C   . GLN D 1 113 ? 7.297   59.505  78.569  1.00 46.84 ? 113  GLN D C   1 
ATOM   8722  O  O   . GLN D 1 113 ? 7.219   58.292  78.377  1.00 48.28 ? 113  GLN D O   1 
ATOM   8723  C  CB  . GLN D 1 113 ? 9.734   60.074  78.492  1.00 49.11 ? 113  GLN D CB  1 
ATOM   8724  C  CG  . GLN D 1 113 ? 10.281  58.676  78.214  1.00 50.90 ? 113  GLN D CG  1 
ATOM   8725  C  CD  . GLN D 1 113 ? 11.634  58.700  77.530  1.00 52.67 ? 113  GLN D CD  1 
ATOM   8726  O  OE1 . GLN D 1 113 ? 11.724  58.830  76.308  1.00 55.32 ? 113  GLN D OE1 1 
ATOM   8727  N  NE2 . GLN D 1 113 ? 12.696  58.569  78.316  1.00 52.96 ? 113  GLN D NE2 1 
ATOM   8728  N  N   . GLY D 1 114 ? 6.385   60.370  78.137  1.00 47.05 ? 114  GLY D N   1 
ATOM   8729  C  CA  . GLY D 1 114 ? 5.232   59.929  77.371  1.00 47.54 ? 114  GLY D CA  1 
ATOM   8730  C  C   . GLY D 1 114 ? 4.316   58.972  78.111  1.00 47.67 ? 114  GLY D C   1 
ATOM   8731  O  O   . GLY D 1 114 ? 3.767   59.309  79.160  1.00 47.40 ? 114  GLY D O   1 
ATOM   8732  N  N   . GLU D 1 115 ? 4.159   57.771  77.559  1.00 48.54 ? 115  GLU D N   1 
ATOM   8733  C  CA  . GLU D 1 115 ? 3.302   56.746  78.149  1.00 48.94 ? 115  GLU D CA  1 
ATOM   8734  C  C   . GLU D 1 115 ? 3.947   56.045  79.344  1.00 47.42 ? 115  GLU D C   1 
ATOM   8735  O  O   . GLU D 1 115 ? 3.271   55.354  80.106  1.00 47.56 ? 115  GLU D O   1 
ATOM   8736  C  CB  . GLU D 1 115 ? 2.913   55.710  77.089  1.00 50.95 ? 115  GLU D CB  1 
ATOM   8737  C  CG  . GLU D 1 115 ? 2.210   56.293  75.864  1.00 56.06 ? 115  GLU D CG  1 
ATOM   8738  C  CD  . GLU D 1 115 ? 0.909   57.005  76.206  1.00 58.53 ? 115  GLU D CD  1 
ATOM   8739  O  OE1 . GLU D 1 115 ? -0.048  56.328  76.642  1.00 60.15 ? 115  GLU D OE1 1 
ATOM   8740  O  OE2 . GLU D 1 115 ? 0.842   58.241  76.032  1.00 58.94 ? 115  GLU D OE2 1 
ATOM   8741  N  N   . PHE D 1 116 ? 5.255   56.228  79.500  1.00 46.44 ? 116  PHE D N   1 
ATOM   8742  C  CA  . PHE D 1 116 ? 6.004   55.618  80.595  1.00 44.90 ? 116  PHE D CA  1 
ATOM   8743  C  C   . PHE D 1 116 ? 5.955   56.498  81.844  1.00 44.12 ? 116  PHE D C   1 
ATOM   8744  O  O   . PHE D 1 116 ? 6.808   57.365  82.037  1.00 43.81 ? 116  PHE D O   1 
ATOM   8745  C  CB  . PHE D 1 116 ? 7.456   55.383  80.166  1.00 42.69 ? 116  PHE D CB  1 
ATOM   8746  C  CG  . PHE D 1 116 ? 7.588   54.616  78.881  1.00 41.33 ? 116  PHE D CG  1 
ATOM   8747  C  CD1 . PHE D 1 116 ? 7.364   53.244  78.849  1.00 40.97 ? 116  PHE D CD1 1 
ATOM   8748  C  CD2 . PHE D 1 116 ? 7.916   55.269  77.698  1.00 40.14 ? 116  PHE D CD2 1 
ATOM   8749  C  CE1 . PHE D 1 116 ? 7.462   52.533  77.657  1.00 39.50 ? 116  PHE D CE1 1 
ATOM   8750  C  CE2 . PHE D 1 116 ? 8.016   54.567  76.501  1.00 39.75 ? 116  PHE D CE2 1 
ATOM   8751  C  CZ  . PHE D 1 116 ? 7.788   53.196  76.481  1.00 39.64 ? 116  PHE D CZ  1 
ATOM   8752  N  N   . GLN D 1 117 ? 4.952   56.268  82.689  1.00 43.17 ? 117  GLN D N   1 
ATOM   8753  C  CA  . GLN D 1 117 ? 4.781   57.048  83.914  1.00 43.96 ? 117  GLN D CA  1 
ATOM   8754  C  C   . GLN D 1 117 ? 4.504   56.177  85.144  1.00 42.26 ? 117  GLN D C   1 
ATOM   8755  O  O   . GLN D 1 117 ? 4.108   56.690  86.192  1.00 43.19 ? 117  GLN D O   1 
ATOM   8756  C  CB  . GLN D 1 117 ? 3.629   58.050  83.745  1.00 45.72 ? 117  GLN D CB  1 
ATOM   8757  C  CG  . GLN D 1 117 ? 3.756   59.008  82.564  1.00 49.09 ? 117  GLN D CG  1 
ATOM   8758  C  CD  . GLN D 1 117 ? 4.936   59.956  82.686  1.00 52.25 ? 117  GLN D CD  1 
ATOM   8759  O  OE1 . GLN D 1 117 ? 5.183   60.529  83.748  1.00 54.13 ? 117  GLN D OE1 1 
ATOM   8760  N  NE2 . GLN D 1 117 ? 5.666   60.133  81.591  1.00 54.15 ? 117  GLN D NE2 1 
ATOM   8761  N  N   . TYR D 1 118 ? 4.722   54.870  85.021  1.00 39.61 ? 118  TYR D N   1 
ATOM   8762  C  CA  . TYR D 1 118 ? 4.469   53.944  86.124  1.00 36.17 ? 118  TYR D CA  1 
ATOM   8763  C  C   . TYR D 1 118 ? 5.756   53.300  86.635  1.00 34.19 ? 118  TYR D C   1 
ATOM   8764  O  O   . TYR D 1 118 ? 6.299   52.387  86.016  1.00 33.26 ? 118  TYR D O   1 
ATOM   8765  C  CB  . TYR D 1 118 ? 3.455   52.882  85.689  1.00 36.70 ? 118  TYR D CB  1 
ATOM   8766  C  CG  . TYR D 1 118 ? 2.236   53.481  85.023  1.00 37.08 ? 118  TYR D CG  1 
ATOM   8767  C  CD1 . TYR D 1 118 ? 1.281   54.175  85.765  1.00 36.40 ? 118  TYR D CD1 1 
ATOM   8768  C  CD2 . TYR D 1 118 ? 2.067   53.405  83.640  1.00 37.49 ? 118  TYR D CD2 1 
ATOM   8769  C  CE1 . TYR D 1 118 ? 0.191   54.783  85.146  1.00 35.99 ? 118  TYR D CE1 1 
ATOM   8770  C  CE2 . TYR D 1 118 ? 0.983   54.010  83.012  1.00 36.99 ? 118  TYR D CE2 1 
ATOM   8771  C  CZ  . TYR D 1 118 ? 0.050   54.698  83.770  1.00 37.36 ? 118  TYR D CZ  1 
ATOM   8772  O  OH  . TYR D 1 118 ? -1.015  55.309  83.149  1.00 38.87 ? 118  TYR D OH  1 
ATOM   8773  N  N   . PRO D 1 119 ? 6.248   53.770  87.793  1.00 34.08 ? 119  PRO D N   1 
ATOM   8774  C  CA  . PRO D 1 119 ? 7.467   53.313  88.469  1.00 32.91 ? 119  PRO D CA  1 
ATOM   8775  C  C   . PRO D 1 119 ? 7.492   51.865  88.960  1.00 31.85 ? 119  PRO D C   1 
ATOM   8776  O  O   . PRO D 1 119 ? 6.482   51.319  89.409  1.00 31.06 ? 119  PRO D O   1 
ATOM   8777  C  CB  . PRO D 1 119 ? 7.581   54.277  89.653  1.00 32.06 ? 119  PRO D CB  1 
ATOM   8778  C  CG  . PRO D 1 119 ? 6.856   55.495  89.192  1.00 32.73 ? 119  PRO D CG  1 
ATOM   8779  C  CD  . PRO D 1 119 ? 5.655   54.901  88.526  1.00 33.76 ? 119  PRO D CD  1 
ATOM   8780  N  N   . ILE D 1 120 ? 8.674   51.263  88.866  1.00 30.52 ? 120  ILE D N   1 
ATOM   8781  C  CA  . ILE D 1 120 ? 8.922   49.901  89.325  1.00 28.66 ? 120  ILE D CA  1 
ATOM   8782  C  C   . ILE D 1 120 ? 10.000  50.084  90.389  1.00 27.53 ? 120  ILE D C   1 
ATOM   8783  O  O   . ILE D 1 120 ? 11.105  50.531  90.091  1.00 26.37 ? 120  ILE D O   1 
ATOM   8784  C  CB  . ILE D 1 120 ? 9.444   48.998  88.188  1.00 28.74 ? 120  ILE D CB  1 
ATOM   8785  C  CG1 . ILE D 1 120 ? 8.403   48.914  87.067  1.00 28.32 ? 120  ILE D CG1 1 
ATOM   8786  C  CG2 . ILE D 1 120 ? 9.758   47.605  88.724  1.00 28.57 ? 120  ILE D CG2 1 
ATOM   8787  C  CD1 . ILE D 1 120 ? 8.854   48.118  85.863  1.00 27.50 ? 120  ILE D CD1 1 
ATOM   8788  N  N   . TYR D 1 121 ? 9.661   49.762  91.633  1.00 28.03 ? 121  TYR D N   1 
ATOM   8789  C  CA  . TYR D 1 121 ? 10.576  49.946  92.754  1.00 27.23 ? 121  TYR D CA  1 
ATOM   8790  C  C   . TYR D 1 121 ? 11.457  48.765  93.155  1.00 27.85 ? 121  TYR D C   1 
ATOM   8791  O  O   . TYR D 1 121 ? 11.153  47.607  92.866  1.00 26.79 ? 121  TYR D O   1 
ATOM   8792  C  CB  . TYR D 1 121 ? 9.793   50.431  93.979  1.00 25.81 ? 121  TYR D CB  1 
ATOM   8793  C  CG  . TYR D 1 121 ? 9.028   51.720  93.757  1.00 26.41 ? 121  TYR D CG  1 
ATOM   8794  C  CD1 . TYR D 1 121 ? 7.789   51.718  93.117  1.00 25.96 ? 121  TYR D CD1 1 
ATOM   8795  C  CD2 . TYR D 1 121 ? 9.543   52.941  94.192  1.00 27.27 ? 121  TYR D CD2 1 
ATOM   8796  C  CE1 . TYR D 1 121 ? 7.081   52.899  92.915  1.00 25.47 ? 121  TYR D CE1 1 
ATOM   8797  C  CE2 . TYR D 1 121 ? 8.843   54.127  93.996  1.00 26.80 ? 121  TYR D CE2 1 
ATOM   8798  C  CZ  . TYR D 1 121 ? 7.614   54.099  93.357  1.00 26.91 ? 121  TYR D CZ  1 
ATOM   8799  O  OH  . TYR D 1 121 ? 6.916   55.270  93.168  1.00 28.17 ? 121  TYR D OH  1 
ATOM   8800  N  N   . ARG D 1 122 ? 12.561  49.093  93.824  1.00 28.79 ? 122  ARG D N   1 
ATOM   8801  C  CA  . ARG D 1 122 ? 13.511  48.107  94.326  1.00 29.67 ? 122  ARG D CA  1 
ATOM   8802  C  C   . ARG D 1 122 ? 13.352  48.047  95.843  1.00 29.78 ? 122  ARG D C   1 
ATOM   8803  O  O   . ARG D 1 122 ? 12.507  48.741  96.405  1.00 28.94 ? 122  ARG D O   1 
ATOM   8804  C  CB  . ARG D 1 122 ? 14.948  48.499  93.962  1.00 30.61 ? 122  ARG D CB  1 
ATOM   8805  C  CG  . ARG D 1 122 ? 15.411  49.838  94.525  1.00 31.05 ? 122  ARG D CG  1 
ATOM   8806  C  CD  . ARG D 1 122 ? 16.836  50.149  94.097  1.00 30.31 ? 122  ARG D CD  1 
ATOM   8807  N  NE  . ARG D 1 122 ? 17.247  51.501  94.471  1.00 30.63 ? 122  ARG D NE  1 
ATOM   8808  C  CZ  . ARG D 1 122 ? 17.776  51.831  95.646  1.00 30.95 ? 122  ARG D CZ  1 
ATOM   8809  N  NH1 . ARG D 1 122 ? 17.966  50.907  96.579  1.00 31.07 ? 122  ARG D NH1 1 
ATOM   8810  N  NH2 . ARG D 1 122 ? 18.118  53.089  95.889  1.00 29.59 ? 122  ARG D NH2 1 
HETATM 8811  N  N   . MSE D 1 123 ? 14.173  47.230  96.496  1.00 32.28 ? 123  MSE D N   1 
HETATM 8812  C  CA  . MSE D 1 123 ? 14.127  47.071  97.950  1.00 33.88 ? 123  MSE D CA  1 
HETATM 8813  C  C   . MSE D 1 123 ? 14.525  48.313  98.743  1.00 33.12 ? 123  MSE D C   1 
HETATM 8814  O  O   . MSE D 1 123 ? 15.683  48.735  98.715  1.00 34.41 ? 123  MSE D O   1 
HETATM 8815  C  CB  . MSE D 1 123 ? 15.001  45.892  98.381  1.00 37.37 ? 123  MSE D CB  1 
HETATM 8816  C  CG  . MSE D 1 123 ? 14.266  44.573  98.452  1.00 39.88 ? 123  MSE D CG  1 
HETATM 8817  SE SE  . MSE D 1 123 ? 13.079  44.508  99.965  1.00 45.55 ? 123  MSE D SE  1 
HETATM 8818  C  CE  . MSE D 1 123 ? 14.202  43.491  101.160 1.00 41.17 ? 123  MSE D CE  1 
ATOM   8819  N  N   . PRO D 1 124 ? 13.555  48.925  99.445  1.00 31.24 ? 124  PRO D N   1 
ATOM   8820  C  CA  . PRO D 1 124 ? 13.762  50.122  100.265 1.00 30.73 ? 124  PRO D CA  1 
ATOM   8821  C  C   . PRO D 1 124 ? 14.144  49.717  101.695 1.00 31.01 ? 124  PRO D C   1 
ATOM   8822  O  O   . PRO D 1 124 ? 14.147  48.528  102.025 1.00 29.92 ? 124  PRO D O   1 
ATOM   8823  C  CB  . PRO D 1 124 ? 12.391  50.786  100.213 1.00 29.44 ? 124  PRO D CB  1 
ATOM   8824  C  CG  . PRO D 1 124 ? 11.479  49.620  100.286 1.00 29.25 ? 124  PRO D CG  1 
ATOM   8825  C  CD  . PRO D 1 124 ? 12.117  48.605  99.351  1.00 29.39 ? 124  PRO D CD  1 
ATOM   8826  N  N   . PRO D 1 125 ? 14.468  50.696  102.562 1.00 31.53 ? 125  PRO D N   1 
ATOM   8827  C  CA  . PRO D 1 125 ? 14.843  50.392  103.948 1.00 33.51 ? 125  PRO D CA  1 
ATOM   8828  C  C   . PRO D 1 125 ? 13.732  49.701  104.741 1.00 34.75 ? 125  PRO D C   1 
ATOM   8829  O  O   . PRO D 1 125 ? 12.644  49.452  104.220 1.00 35.82 ? 125  PRO D O   1 
ATOM   8830  C  CB  . PRO D 1 125 ? 15.176  51.772  104.520 1.00 32.33 ? 125  PRO D CB  1 
ATOM   8831  C  CG  . PRO D 1 125 ? 14.305  52.690  103.723 1.00 31.70 ? 125  PRO D CG  1 
ATOM   8832  C  CD  . PRO D 1 125 ? 14.495  52.150  102.331 1.00 30.86 ? 125  PRO D CD  1 
ATOM   8833  N  N   . LYS D 1 126 ? 14.015  49.410  106.007 1.00 37.17 ? 126  LYS D N   1 
ATOM   8834  C  CA  . LYS D 1 126 ? 13.069  48.734  106.891 1.00 38.90 ? 126  LYS D CA  1 
ATOM   8835  C  C   . LYS D 1 126 ? 11.718  49.431  107.052 1.00 38.56 ? 126  LYS D C   1 
ATOM   8836  O  O   . LYS D 1 126 ? 10.673  48.812  106.850 1.00 38.52 ? 126  LYS D O   1 
ATOM   8837  C  CB  . LYS D 1 126 ? 13.703  48.493  108.267 1.00 41.16 ? 126  LYS D CB  1 
ATOM   8838  C  CG  . LYS D 1 126 ? 14.716  47.347  108.313 1.00 44.30 ? 126  LYS D CG  1 
ATOM   8839  C  CD  . LYS D 1 126 ? 15.918  47.596  107.409 1.00 44.15 ? 126  LYS D CD  1 
ATOM   8840  C  CE  . LYS D 1 126 ? 16.808  46.369  107.323 1.00 44.30 ? 126  LYS D CE  1 
ATOM   8841  N  NZ  . LYS D 1 126 ? 17.884  46.549  106.315 1.00 44.63 ? 126  LYS D NZ  1 
ATOM   8842  N  N   . ARG D 1 127 ? 11.739  50.715  107.400 1.00 38.61 ? 127  ARG D N   1 
ATOM   8843  C  CA  . ARG D 1 127 ? 10.503  51.468  107.595 1.00 38.90 ? 127  ARG D CA  1 
ATOM   8844  C  C   . ARG D 1 127 ? 9.825   51.914  106.300 1.00 37.41 ? 127  ARG D C   1 
ATOM   8845  O  O   . ARG D 1 127 ? 8.684   52.379  106.319 1.00 37.83 ? 127  ARG D O   1 
ATOM   8846  C  CB  . ARG D 1 127 ? 10.732  52.660  108.532 1.00 43.41 ? 127  ARG D CB  1 
ATOM   8847  C  CG  . ARG D 1 127 ? 11.662  53.745  108.010 1.00 48.15 ? 127  ARG D CG  1 
ATOM   8848  C  CD  . ARG D 1 127 ? 11.883  54.803  109.086 1.00 52.08 ? 127  ARG D CD  1 
ATOM   8849  N  NE  . ARG D 1 127 ? 12.568  55.991  108.582 1.00 55.63 ? 127  ARG D NE  1 
ATOM   8850  C  CZ  . ARG D 1 127 ? 11.951  57.108  108.204 1.00 56.41 ? 127  ARG D CZ  1 
ATOM   8851  N  NH1 . ARG D 1 127 ? 10.628  57.195  108.270 1.00 57.14 ? 127  ARG D NH1 1 
ATOM   8852  N  NH2 . ARG D 1 127 ? 12.656  58.143  107.765 1.00 56.54 ? 127  ARG D NH2 1 
ATOM   8853  N  N   . GLY D 1 128 ? 10.528  51.767  105.181 1.00 35.25 ? 128  GLY D N   1 
ATOM   8854  C  CA  . GLY D 1 128 ? 9.967   52.144  103.895 1.00 31.46 ? 128  GLY D CA  1 
ATOM   8855  C  C   . GLY D 1 128 ? 9.106   51.033  103.323 1.00 30.17 ? 128  GLY D C   1 
ATOM   8856  O  O   . GLY D 1 128 ? 8.261   51.268  102.459 1.00 30.04 ? 128  GLY D O   1 
ATOM   8857  N  N   . ARG D 1 129 ? 9.326   49.817  103.817 1.00 29.02 ? 129  ARG D N   1 
ATOM   8858  C  CA  . ARG D 1 129 ? 8.586   48.639  103.377 1.00 27.00 ? 129  ARG D CA  1 
ATOM   8859  C  C   . ARG D 1 129 ? 7.226   48.491  104.054 1.00 26.79 ? 129  ARG D C   1 
ATOM   8860  O  O   . ARG D 1 129 ? 6.489   47.548  103.774 1.00 27.31 ? 129  ARG D O   1 
ATOM   8861  C  CB  . ARG D 1 129 ? 9.424   47.380  103.613 1.00 25.56 ? 129  ARG D CB  1 
ATOM   8862  C  CG  . ARG D 1 129 ? 10.542  47.189  102.604 1.00 24.66 ? 129  ARG D CG  1 
ATOM   8863  C  CD  . ARG D 1 129 ? 11.417  45.999  102.953 1.00 27.38 ? 129  ARG D CD  1 
ATOM   8864  N  NE  . ARG D 1 129 ? 12.584  46.381  103.744 1.00 28.53 ? 129  ARG D NE  1 
ATOM   8865  C  CZ  . ARG D 1 129 ? 13.334  45.530  104.437 1.00 29.35 ? 129  ARG D CZ  1 
ATOM   8866  N  NH1 . ARG D 1 129 ? 13.042  44.237  104.452 1.00 32.16 ? 129  ARG D NH1 1 
ATOM   8867  N  NH2 . ARG D 1 129 ? 14.400  45.966  105.088 1.00 31.30 ? 129  ARG D NH2 1 
ATOM   8868  N  N   . LEU D 1 130 ? 6.899   49.425  104.943 1.00 26.13 ? 130  LEU D N   1 
ATOM   8869  C  CA  . LEU D 1 130 ? 5.631   49.403  105.665 1.00 25.04 ? 130  LEU D CA  1 
ATOM   8870  C  C   . LEU D 1 130 ? 4.465   49.915  104.824 1.00 26.15 ? 130  LEU D C   1 
ATOM   8871  O  O   . LEU D 1 130 ? 3.330   49.468  104.989 1.00 27.37 ? 130  LEU D O   1 
ATOM   8872  C  CB  . LEU D 1 130 ? 5.741   50.236  106.945 1.00 23.42 ? 130  LEU D CB  1 
ATOM   8873  C  CG  . LEU D 1 130 ? 6.679   49.716  108.034 1.00 22.45 ? 130  LEU D CG  1 
ATOM   8874  C  CD1 . LEU D 1 130 ? 6.839   50.760  109.125 1.00 22.13 ? 130  LEU D CD1 1 
ATOM   8875  C  CD2 . LEU D 1 130 ? 6.136   48.418  108.608 1.00 21.29 ? 130  LEU D CD2 1 
ATOM   8876  N  N   . SER D 1 131 ? 4.761   50.844  103.917 1.00 28.00 ? 131  SER D N   1 
ATOM   8877  C  CA  . SER D 1 131 ? 3.759   51.453  103.044 1.00 29.17 ? 131  SER D CA  1 
ATOM   8878  C  C   . SER D 1 131 ? 3.000   50.468  102.154 1.00 28.95 ? 131  SER D C   1 
ATOM   8879  O  O   . SER D 1 131 ? 3.575   49.506  101.642 1.00 29.79 ? 131  SER D O   1 
ATOM   8880  C  CB  . SER D 1 131 ? 4.414   52.528  102.175 1.00 30.89 ? 131  SER D CB  1 
ATOM   8881  O  OG  . SER D 1 131 ? 5.011   53.534  102.976 1.00 35.73 ? 131  SER D OG  1 
ATOM   8882  N  N   . SER D 1 132 ? 1.705   50.722  101.978 1.00 28.68 ? 132  SER D N   1 
ATOM   8883  C  CA  . SER D 1 132 ? 0.848   49.878  101.147 1.00 28.24 ? 132  SER D CA  1 
ATOM   8884  C  C   . SER D 1 132 ? 0.931   50.297  99.684  1.00 28.41 ? 132  SER D C   1 
ATOM   8885  O  O   . SER D 1 132 ? 1.503   51.336  99.362  1.00 30.87 ? 132  SER D O   1 
ATOM   8886  C  CB  . SER D 1 132 ? -0.608  49.957  101.619 1.00 27.52 ? 132  SER D CB  1 
ATOM   8887  O  OG  . SER D 1 132 ? -1.143  51.254  101.429 1.00 29.38 ? 132  SER D OG  1 
ATOM   8888  N  N   . ARG D 1 133 ? 0.335   49.493  98.808  1.00 27.53 ? 133  ARG D N   1 
ATOM   8889  C  CA  . ARG D 1 133 ? 0.335   49.767  97.373  1.00 27.35 ? 133  ARG D CA  1 
ATOM   8890  C  C   . ARG D 1 133 ? -0.265  51.132  97.029  1.00 26.79 ? 133  ARG D C   1 
ATOM   8891  O  O   . ARG D 1 133 ? 0.314   51.890  96.251  1.00 27.56 ? 133  ARG D O   1 
ATOM   8892  C  CB  . ARG D 1 133 ? -0.418  48.661  96.629  1.00 26.96 ? 133  ARG D CB  1 
ATOM   8893  C  CG  . ARG D 1 133 ? -0.533  48.887  95.132  1.00 26.23 ? 133  ARG D CG  1 
ATOM   8894  C  CD  . ARG D 1 133 ? -1.272  47.750  94.449  1.00 24.43 ? 133  ARG D CD  1 
ATOM   8895  N  NE  . ARG D 1 133 ? -0.528  46.494  94.501  1.00 23.11 ? 133  ARG D NE  1 
ATOM   8896  C  CZ  . ARG D 1 133 ? 0.406   46.134  93.625  1.00 22.31 ? 133  ARG D CZ  1 
ATOM   8897  N  NH1 . ARG D 1 133 ? 0.726   46.931  92.614  1.00 22.61 ? 133  ARG D NH1 1 
ATOM   8898  N  NH2 . ARG D 1 133 ? 1.017   44.968  93.758  1.00 24.30 ? 133  ARG D NH2 1 
ATOM   8899  N  N   . ALA D 1 134 ? -1.417  51.437  97.622  1.00 26.87 ? 134  ALA D N   1 
ATOM   8900  C  CA  . ALA D 1 134 ? -2.111  52.702  97.389  1.00 25.21 ? 134  ALA D CA  1 
ATOM   8901  C  C   . ALA D 1 134 ? -1.260  53.907  97.774  1.00 26.54 ? 134  ALA D C   1 
ATOM   8902  O  O   . ALA D 1 134 ? -1.267  54.928  97.083  1.00 26.86 ? 134  ALA D O   1 
ATOM   8903  C  CB  . ALA D 1 134 ? -3.423  52.725  98.154  1.00 25.82 ? 134  ALA D CB  1 
ATOM   8904  N  N   . GLU D 1 135 ? -0.532  53.782  98.881  1.00 26.53 ? 135  GLU D N   1 
ATOM   8905  C  CA  . GLU D 1 135 ? 0.334   54.850  99.370  1.00 26.15 ? 135  GLU D CA  1 
ATOM   8906  C  C   . GLU D 1 135 ? 1.550   55.019  98.468  1.00 25.93 ? 135  GLU D C   1 
ATOM   8907  O  O   . GLU D 1 135 ? 2.013   56.135  98.241  1.00 25.74 ? 135  GLU D O   1 
ATOM   8908  C  CB  . GLU D 1 135 ? 0.790   54.545  100.794 1.00 26.88 ? 135  GLU D CB  1 
ATOM   8909  C  CG  . GLU D 1 135 ? -0.347  54.431  101.798 1.00 29.18 ? 135  GLU D CG  1 
ATOM   8910  C  CD  . GLU D 1 135 ? 0.110   53.911  103.148 1.00 30.68 ? 135  GLU D CD  1 
ATOM   8911  O  OE1 . GLU D 1 135 ? 1.324   53.972  103.438 1.00 32.41 ? 135  GLU D OE1 1 
ATOM   8912  O  OE2 . GLU D 1 135 ? -0.747  53.438  103.921 1.00 32.33 ? 135  GLU D OE2 1 
ATOM   8913  N  N   . ILE D 1 136 ? 2.069   53.900  97.970  1.00 27.33 ? 136  ILE D N   1 
ATOM   8914  C  CA  . ILE D 1 136 ? 3.224   53.906  97.079  1.00 27.74 ? 136  ILE D CA  1 
ATOM   8915  C  C   . ILE D 1 136 ? 2.835   54.553  95.751  1.00 28.46 ? 136  ILE D C   1 
ATOM   8916  O  O   . ILE D 1 136 ? 3.646   55.234  95.123  1.00 31.07 ? 136  ILE D O   1 
ATOM   8917  C  CB  . ILE D 1 136 ? 3.764   52.471  96.858  1.00 26.52 ? 136  ILE D CB  1 
ATOM   8918  C  CG1 . ILE D 1 136 ? 4.288   51.914  98.185  1.00 23.31 ? 136  ILE D CG1 1 
ATOM   8919  C  CG2 . ILE D 1 136 ? 4.874   52.465  95.812  1.00 25.11 ? 136  ILE D CG2 1 
ATOM   8920  C  CD1 . ILE D 1 136 ? 4.739   50.478  98.121  1.00 23.86 ? 136  ILE D CD1 1 
ATOM   8921  N  N   . TYR D 1 137 ? 1.583   54.353  95.343  1.00 29.71 ? 137  TYR D N   1 
ATOM   8922  C  CA  . TYR D 1 137 ? 1.069   54.945  94.111  1.00 30.76 ? 137  TYR D CA  1 
ATOM   8923  C  C   . TYR D 1 137 ? 1.015   56.462  94.276  1.00 31.11 ? 137  TYR D C   1 
ATOM   8924  O  O   . TYR D 1 137 ? 1.249   57.211  93.326  1.00 31.62 ? 137  TYR D O   1 
ATOM   8925  C  CB  . TYR D 1 137 ? -0.338  54.421  93.803  1.00 31.16 ? 137  TYR D CB  1 
ATOM   8926  C  CG  . TYR D 1 137 ? -0.401  53.041  93.177  1.00 32.72 ? 137  TYR D CG  1 
ATOM   8927  C  CD1 . TYR D 1 137 ? 0.759   52.321  92.887  1.00 33.13 ? 137  TYR D CD1 1 
ATOM   8928  C  CD2 . TYR D 1 137 ? -1.629  52.462  92.858  1.00 33.37 ? 137  TYR D CD2 1 
ATOM   8929  C  CE1 . TYR D 1 137 ? 0.694   51.061  92.292  1.00 34.30 ? 137  TYR D CE1 1 
ATOM   8930  C  CE2 . TYR D 1 137 ? -1.705  51.204  92.264  1.00 34.10 ? 137  TYR D CE2 1 
ATOM   8931  C  CZ  . TYR D 1 137 ? -0.541  50.510  91.984  1.00 35.60 ? 137  TYR D CZ  1 
ATOM   8932  O  OH  . TYR D 1 137 ? -0.615  49.269  91.393  1.00 36.64 ? 137  TYR D OH  1 
ATOM   8933  N  N   . ALA D 1 138 ? 0.718   56.901  95.498  1.00 31.62 ? 138  ALA D N   1 
ATOM   8934  C  CA  . ALA D 1 138 ? 0.625   58.322  95.825  1.00 31.66 ? 138  ALA D CA  1 
ATOM   8935  C  C   . ALA D 1 138 ? 1.985   58.973  96.087  1.00 31.35 ? 138  ALA D C   1 
ATOM   8936  O  O   . ALA D 1 138 ? 2.078   60.196  96.198  1.00 33.44 ? 138  ALA D O   1 
ATOM   8937  C  CB  . ALA D 1 138 ? -0.299  58.526  97.016  1.00 30.47 ? 138  ALA D CB  1 
ATOM   8938  N  N   . GLY D 1 139 ? 3.029   58.157  96.209  1.00 31.00 ? 139  GLY D N   1 
ATOM   8939  C  CA  . GLY D 1 139 ? 4.364   58.686  96.438  1.00 30.80 ? 139  GLY D CA  1 
ATOM   8940  C  C   . GLY D 1 139 ? 4.941   58.512  97.832  1.00 31.25 ? 139  GLY D C   1 
ATOM   8941  O  O   . GLY D 1 139 ? 5.610   59.410  98.341  1.00 30.77 ? 139  GLY D O   1 
ATOM   8942  N  N   . ALA D 1 140 ? 4.714   57.351  98.441  1.00 32.35 ? 140  ALA D N   1 
ATOM   8943  C  CA  . ALA D 1 140 ? 5.226   57.075  99.781  1.00 33.78 ? 140  ALA D CA  1 
ATOM   8944  C  C   . ALA D 1 140 ? 6.731   56.826  99.774  1.00 35.11 ? 140  ALA D C   1 
ATOM   8945  O  O   . ALA D 1 140 ? 7.432   57.183  100.721 1.00 36.11 ? 140  ALA D O   1 
ATOM   8946  C  CB  . ALA D 1 140 ? 4.501   55.885  100.386 1.00 34.57 ? 140  ALA D CB  1 
ATOM   8947  N  N   . LEU D 1 141 ? 7.218   56.206  98.702  1.00 36.53 ? 141  LEU D N   1 
ATOM   8948  C  CA  . LEU D 1 141 ? 8.638   55.900  98.556  1.00 36.46 ? 141  LEU D CA  1 
ATOM   8949  C  C   . LEU D 1 141 ? 9.381   56.974  97.772  1.00 36.44 ? 141  LEU D C   1 
ATOM   8950  O  O   . LEU D 1 141 ? 8.815   57.611  96.883  1.00 37.46 ? 141  LEU D O   1 
ATOM   8951  C  CB  . LEU D 1 141 ? 8.821   54.550  97.861  1.00 35.92 ? 141  LEU D CB  1 
ATOM   8952  C  CG  . LEU D 1 141 ? 8.351   53.305  98.612  1.00 33.97 ? 141  LEU D CG  1 
ATOM   8953  C  CD1 . LEU D 1 141 ? 8.495   52.092  97.716  1.00 32.91 ? 141  LEU D CD1 1 
ATOM   8954  C  CD2 . LEU D 1 141 ? 9.162   53.133  99.885  1.00 33.78 ? 141  LEU D CD2 1 
ATOM   8955  N  N   . SER D 1 142 ? 10.658  57.155  98.099  1.00 37.67 ? 142  SER D N   1 
ATOM   8956  C  CA  . SER D 1 142 ? 11.499  58.141  97.429  1.00 39.05 ? 142  SER D CA  1 
ATOM   8957  C  C   . SER D 1 142 ? 11.789  57.708  95.994  1.00 39.81 ? 142  SER D C   1 
ATOM   8958  O  O   . SER D 1 142 ? 11.826  56.515  95.692  1.00 40.35 ? 142  SER D O   1 
ATOM   8959  C  CB  . SER D 1 142 ? 12.812  58.329  98.194  1.00 38.95 ? 142  SER D CB  1 
ATOM   8960  O  OG  . SER D 1 142 ? 13.640  59.292  97.566  1.00 39.89 ? 142  SER D OG  1 
ATOM   8961  N  N   . ASP D 1 143 ? 12.001  58.687  95.119  1.00 40.91 ? 143  ASP D N   1 
ATOM   8962  C  CA  . ASP D 1 143 ? 12.280  58.427  93.709  1.00 41.52 ? 143  ASP D CA  1 
ATOM   8963  C  C   . ASP D 1 143 ? 13.601  57.712  93.446  1.00 41.15 ? 143  ASP D C   1 
ATOM   8964  O  O   . ASP D 1 143 ? 13.817  57.192  92.351  1.00 42.15 ? 143  ASP D O   1 
ATOM   8965  C  CB  . ASP D 1 143 ? 12.228  59.731  92.905  1.00 43.70 ? 143  ASP D CB  1 
ATOM   8966  C  CG  . ASP D 1 143 ? 10.812  60.246  92.711  1.00 44.88 ? 143  ASP D CG  1 
ATOM   8967  O  OD1 . ASP D 1 143 ? 10.008  60.183  93.667  1.00 48.44 ? 143  ASP D OD1 1 
ATOM   8968  O  OD2 . ASP D 1 143 ? 10.502  60.716  91.597  1.00 44.93 ? 143  ASP D OD2 1 
ATOM   8969  N  N   . LYS D 1 144 ? 14.483  57.683  94.442  1.00 40.62 ? 144  LYS D N   1 
ATOM   8970  C  CA  . LYS D 1 144 ? 15.772  57.018  94.282  1.00 40.62 ? 144  LYS D CA  1 
ATOM   8971  C  C   . LYS D 1 144 ? 15.656  55.496  94.363  1.00 39.95 ? 144  LYS D C   1 
ATOM   8972  O  O   . LYS D 1 144 ? 16.628  54.780  94.123  1.00 39.67 ? 144  LYS D O   1 
ATOM   8973  C  CB  . LYS D 1 144 ? 16.791  57.540  95.303  1.00 41.75 ? 144  LYS D CB  1 
ATOM   8974  C  CG  . LYS D 1 144 ? 16.457  57.264  96.758  1.00 42.89 ? 144  LYS D CG  1 
ATOM   8975  C  CD  . LYS D 1 144 ? 17.582  57.751  97.659  1.00 43.72 ? 144  LYS D CD  1 
ATOM   8976  C  CE  . LYS D 1 144 ? 17.310  57.440  99.119  1.00 43.28 ? 144  LYS D CE  1 
ATOM   8977  N  NZ  . LYS D 1 144 ? 18.451  57.843  99.984  1.00 41.79 ? 144  LYS D NZ  1 
ATOM   8978  N  N   . TYR D 1 145 ? 14.463  55.011  94.698  1.00 38.40 ? 145  TYR D N   1 
ATOM   8979  C  CA  . TYR D 1 145 ? 14.212  53.576  94.795  1.00 36.81 ? 145  TYR D CA  1 
ATOM   8980  C  C   . TYR D 1 145 ? 13.525  53.042  93.540  1.00 36.39 ? 145  TYR D C   1 
ATOM   8981  O  O   . TYR D 1 145 ? 13.175  51.864  93.465  1.00 36.57 ? 145  TYR D O   1 
ATOM   8982  C  CB  . TYR D 1 145 ? 13.384  53.256  96.044  1.00 36.25 ? 145  TYR D CB  1 
ATOM   8983  C  CG  . TYR D 1 145 ? 14.117  53.554  97.332  1.00 35.50 ? 145  TYR D CG  1 
ATOM   8984  C  CD1 . TYR D 1 145 ? 15.182  52.758  97.749  1.00 33.55 ? 145  TYR D CD1 1 
ATOM   8985  C  CD2 . TYR D 1 145 ? 13.773  54.657  98.113  1.00 37.17 ? 145  TYR D CD2 1 
ATOM   8986  C  CE1 . TYR D 1 145 ? 15.891  53.055  98.908  1.00 33.68 ? 145  TYR D CE1 1 
ATOM   8987  C  CE2 . TYR D 1 145 ? 14.477  54.963  99.275  1.00 35.04 ? 145  TYR D CE2 1 
ATOM   8988  C  CZ  . TYR D 1 145 ? 15.535  54.160  99.664  1.00 34.35 ? 145  TYR D CZ  1 
ATOM   8989  O  OH  . TYR D 1 145 ? 16.245  54.468  100.800 1.00 37.60 ? 145  TYR D OH  1 
ATOM   8990  N  N   . ILE D 1 146 ? 13.339  53.917  92.557  1.00 35.45 ? 146  ILE D N   1 
ATOM   8991  C  CA  . ILE D 1 146 ? 12.709  53.542  91.298  1.00 34.48 ? 146  ILE D CA  1 
ATOM   8992  C  C   . ILE D 1 146 ? 13.759  52.957  90.356  1.00 35.42 ? 146  ILE D C   1 
ATOM   8993  O  O   . ILE D 1 146 ? 14.874  53.473  90.257  1.00 36.28 ? 146  ILE D O   1 
ATOM   8994  C  CB  . ILE D 1 146 ? 12.036  54.758  90.623  1.00 33.99 ? 146  ILE D CB  1 
ATOM   8995  C  CG1 . ILE D 1 146 ? 10.990  55.362  91.564  1.00 33.61 ? 146  ILE D CG1 1 
ATOM   8996  C  CG2 . ILE D 1 146 ? 11.389  54.340  89.307  1.00 33.79 ? 146  ILE D CG2 1 
ATOM   8997  C  CD1 . ILE D 1 146 ? 10.301  56.596  91.022  1.00 33.37 ? 146  ILE D CD1 1 
ATOM   8998  N  N   . LEU D 1 147 ? 13.403  51.863  89.692  1.00 35.29 ? 147  LEU D N   1 
ATOM   8999  C  CA  . LEU D 1 147 ? 14.299  51.192  88.756  1.00 33.78 ? 147  LEU D CA  1 
ATOM   9000  C  C   . LEU D 1 147 ? 13.962  51.548  87.313  1.00 34.87 ? 147  LEU D C   1 
ATOM   9001  O  O   . LEU D 1 147 ? 14.854  51.651  86.468  1.00 36.49 ? 147  LEU D O   1 
ATOM   9002  C  CB  . LEU D 1 147 ? 14.220  49.676  88.944  1.00 31.99 ? 147  LEU D CB  1 
ATOM   9003  C  CG  . LEU D 1 147 ? 14.690  49.124  90.290  1.00 29.34 ? 147  LEU D CG  1 
ATOM   9004  C  CD1 . LEU D 1 147 ? 14.279  47.670  90.427  1.00 30.01 ? 147  LEU D CD1 1 
ATOM   9005  C  CD2 . LEU D 1 147 ? 16.197  49.278  90.416  1.00 28.81 ? 147  LEU D CD2 1 
ATOM   9006  N  N   . ALA D 1 148 ? 12.672  51.740  87.041  1.00 34.63 ? 148  ALA D N   1 
ATOM   9007  C  CA  . ALA D 1 148 ? 12.201  52.079  85.701  1.00 34.98 ? 148  ALA D CA  1 
ATOM   9008  C  C   . ALA D 1 148 ? 10.741  52.526  85.705  1.00 34.69 ? 148  ALA D C   1 
ATOM   9009  O  O   . ALA D 1 148 ? 10.048  52.407  86.715  1.00 35.41 ? 148  ALA D O   1 
ATOM   9010  C  CB  . ALA D 1 148 ? 12.379  50.885  84.767  1.00 36.45 ? 148  ALA D CB  1 
ATOM   9011  N  N   . TYR D 1 149 ? 10.288  53.047  84.566  1.00 34.82 ? 149  TYR D N   1 
ATOM   9012  C  CA  . TYR D 1 149 ? 8.914   53.515  84.397  1.00 34.11 ? 149  TYR D CA  1 
ATOM   9013  C  C   . TYR D 1 149 ? 8.278   52.788  83.216  1.00 34.71 ? 149  TYR D C   1 
ATOM   9014  O  O   . TYR D 1 149 ? 8.712   52.954  82.077  1.00 34.79 ? 149  TYR D O   1 
ATOM   9015  C  CB  . TYR D 1 149 ? 8.885   55.020  84.120  1.00 34.34 ? 149  TYR D CB  1 
ATOM   9016  C  CG  . TYR D 1 149 ? 9.450   55.892  85.218  1.00 33.55 ? 149  TYR D CG  1 
ATOM   9017  C  CD1 . TYR D 1 149 ? 10.814  56.168  85.285  1.00 33.37 ? 149  TYR D CD1 1 
ATOM   9018  C  CD2 . TYR D 1 149 ? 8.614   56.473  86.171  1.00 34.20 ? 149  TYR D CD2 1 
ATOM   9019  C  CE1 . TYR D 1 149 ? 11.335  57.006  86.271  1.00 32.19 ? 149  TYR D CE1 1 
ATOM   9020  C  CE2 . TYR D 1 149 ? 9.125   57.312  87.162  1.00 32.74 ? 149  TYR D CE2 1 
ATOM   9021  C  CZ  . TYR D 1 149 ? 10.484  57.574  87.204  1.00 31.60 ? 149  TYR D CZ  1 
ATOM   9022  O  OH  . TYR D 1 149 ? 10.992  58.406  88.173  1.00 32.04 ? 149  TYR D OH  1 
ATOM   9023  N  N   . SER D 1 150 ? 7.249   51.991  83.487  1.00 36.02 ? 150  SER D N   1 
ATOM   9024  C  CA  . SER D 1 150 ? 6.561   51.240  82.439  1.00 36.86 ? 150  SER D CA  1 
ATOM   9025  C  C   . SER D 1 150 ? 5.418   52.032  81.806  1.00 37.91 ? 150  SER D C   1 
ATOM   9026  O  O   . SER D 1 150 ? 5.052   53.107  82.283  1.00 38.33 ? 150  SER D O   1 
ATOM   9027  C  CB  . SER D 1 150 ? 6.016   49.925  82.997  1.00 37.31 ? 150  SER D CB  1 
ATOM   9028  O  OG  . SER D 1 150 ? 4.944   50.163  83.891  1.00 38.49 ? 150  SER D OG  1 
ATOM   9029  N  N   . ASN D 1 151 ? 4.851   51.476  80.738  1.00 39.02 ? 151  ASN D N   1 
ATOM   9030  C  CA  . ASN D 1 151 ? 3.746   52.104  80.019  1.00 38.58 ? 151  ASN D CA  1 
ATOM   9031  C  C   . ASN D 1 151 ? 2.379   51.543  80.416  1.00 38.12 ? 151  ASN D C   1 
ATOM   9032  O  O   . ASN D 1 151 ? 1.362   51.880  79.807  1.00 37.98 ? 151  ASN D O   1 
ATOM   9033  C  CB  . ASN D 1 151 ? 3.951   51.963  78.504  1.00 38.13 ? 151  ASN D CB  1 
ATOM   9034  C  CG  . ASN D 1 151 ? 4.130   50.516  78.059  1.00 37.70 ? 151  ASN D CG  1 
ATOM   9035  O  OD1 . ASN D 1 151 ? 3.872   49.576  78.813  1.00 37.03 ? 151  ASN D OD1 1 
ATOM   9036  N  ND2 . ASN D 1 151 ? 4.575   50.336  76.821  1.00 37.42 ? 151  ASN D ND2 1 
ATOM   9037  N  N   . SER D 1 152 ? 2.358   50.699  81.445  1.00 37.37 ? 152  SER D N   1 
ATOM   9038  C  CA  . SER D 1 152 ? 1.115   50.093  81.906  1.00 36.90 ? 152  SER D CA  1 
ATOM   9039  C  C   . SER D 1 152 ? 1.144   49.740  83.388  1.00 35.58 ? 152  SER D C   1 
ATOM   9040  O  O   . SER D 1 152 ? 2.017   49.001  83.844  1.00 35.71 ? 152  SER D O   1 
ATOM   9041  C  CB  . SER D 1 152 ? 0.803   48.840  81.083  1.00 35.71 ? 152  SER D CB  1 
ATOM   9042  O  OG  . SER D 1 152 ? -0.375  48.198  81.541  1.00 35.88 ? 152  SER D OG  1 
ATOM   9043  N  N   . LEU D 1 153 ? 0.175   50.271  84.128  1.00 35.99 ? 153  LEU D N   1 
ATOM   9044  C  CA  . LEU D 1 153 ? 0.057   50.013  85.558  1.00 35.88 ? 153  LEU D CA  1 
ATOM   9045  C  C   . LEU D 1 153 ? -0.421  48.576  85.769  1.00 36.08 ? 153  LEU D C   1 
ATOM   9046  O  O   . LEU D 1 153 ? -0.120  47.955  86.790  1.00 36.60 ? 153  LEU D O   1 
ATOM   9047  C  CB  . LEU D 1 153 ? -0.931  50.996  86.194  1.00 35.03 ? 153  LEU D CB  1 
ATOM   9048  C  CG  . LEU D 1 153 ? -1.039  51.002  87.722  1.00 35.35 ? 153  LEU D CG  1 
ATOM   9049  C  CD1 . LEU D 1 153 ? 0.286   51.426  88.338  1.00 34.43 ? 153  LEU D CD1 1 
ATOM   9050  C  CD2 . LEU D 1 153 ? -2.150  51.943  88.154  1.00 34.58 ? 153  LEU D CD2 1 
HETATM 9051  N  N   . MSE D 1 154 ? -1.158  48.058  84.787  1.00 36.22 ? 154  MSE D N   1 
HETATM 9052  C  CA  . MSE D 1 154 ? -1.683  46.697  84.832  1.00 37.21 ? 154  MSE D CA  1 
HETATM 9053  C  C   . MSE D 1 154 ? -0.552  45.685  84.662  1.00 36.17 ? 154  MSE D C   1 
HETATM 9054  O  O   . MSE D 1 154 ? -0.516  44.667  85.352  1.00 36.47 ? 154  MSE D O   1 
HETATM 9055  C  CB  . MSE D 1 154 ? -2.741  46.498  83.743  1.00 40.12 ? 154  MSE D CB  1 
HETATM 9056  C  CG  . MSE D 1 154 ? -3.433  45.139  83.771  1.00 45.11 ? 154  MSE D CG  1 
HETATM 9057  SE SE  . MSE D 1 154 ? -4.326  44.766  85.448  1.00 53.76 ? 154  MSE D SE  1 
HETATM 9058  C  CE  . MSE D 1 154 ? -5.979  45.709  85.127  1.00 49.16 ? 154  MSE D CE  1 
ATOM   9059  N  N   . ASP D 1 155 ? 0.368   45.974  83.743  1.00 36.06 ? 155  ASP D N   1 
ATOM   9060  C  CA  . ASP D 1 155 ? 1.510   45.099  83.496  1.00 34.01 ? 155  ASP D CA  1 
ATOM   9061  C  C   . ASP D 1 155 ? 2.366   44.996  84.753  1.00 32.97 ? 155  ASP D C   1 
ATOM   9062  O  O   . ASP D 1 155 ? 2.847   43.917  85.094  1.00 33.27 ? 155  ASP D O   1 
ATOM   9063  C  CB  . ASP D 1 155 ? 2.355   45.620  82.327  1.00 34.28 ? 155  ASP D CB  1 
ATOM   9064  C  CG  . ASP D 1 155 ? 1.689   45.409  80.970  1.00 35.15 ? 155  ASP D CG  1 
ATOM   9065  O  OD1 . ASP D 1 155 ? 0.622   44.758  80.902  1.00 34.56 ? 155  ASP D OD1 1 
ATOM   9066  O  OD2 . ASP D 1 155 ? 2.246   45.895  79.961  1.00 34.23 ? 155  ASP D OD2 1 
ATOM   9067  N  N   . ASN D 1 156 ? 2.542   46.124  85.439  1.00 33.06 ? 156  ASN D N   1 
ATOM   9068  C  CA  . ASN D 1 156 ? 3.320   46.170  86.675  1.00 32.44 ? 156  ASN D CA  1 
ATOM   9069  C  C   . ASN D 1 156 ? 2.645   45.324  87.741  1.00 32.36 ? 156  ASN D C   1 
ATOM   9070  O  O   . ASN D 1 156 ? 3.311   44.633  88.512  1.00 33.69 ? 156  ASN D O   1 
ATOM   9071  C  CB  . ASN D 1 156 ? 3.448   47.609  87.182  1.00 32.64 ? 156  ASN D CB  1 
ATOM   9072  C  CG  . ASN D 1 156 ? 4.359   48.451  86.321  1.00 33.68 ? 156  ASN D CG  1 
ATOM   9073  O  OD1 . ASN D 1 156 ? 4.909   47.974  85.329  1.00 35.15 ? 156  ASN D OD1 1 
ATOM   9074  N  ND2 . ASN D 1 156 ? 4.531   49.712  86.699  1.00 33.36 ? 156  ASN D ND2 1 
ATOM   9075  N  N   . PHE D 1 157 ? 1.317   45.381  87.768  1.00 31.06 ? 157  PHE D N   1 
ATOM   9076  C  CA  . PHE D 1 157 ? 0.526   44.625  88.728  1.00 31.24 ? 157  PHE D CA  1 
ATOM   9077  C  C   . PHE D 1 157 ? 0.613   43.125  88.459  1.00 31.66 ? 157  PHE D C   1 
ATOM   9078  O  O   . PHE D 1 157 ? 0.738   42.332  89.389  1.00 31.87 ? 157  PHE D O   1 
ATOM   9079  C  CB  . PHE D 1 157 ? -0.934  45.080  88.687  1.00 30.59 ? 157  PHE D CB  1 
ATOM   9080  C  CG  . PHE D 1 157 ? -1.764  44.529  89.803  1.00 29.02 ? 157  PHE D CG  1 
ATOM   9081  C  CD1 . PHE D 1 157 ? -1.817  45.181  91.029  1.00 29.34 ? 157  PHE D CD1 1 
ATOM   9082  C  CD2 . PHE D 1 157 ? -2.468  43.341  89.644  1.00 27.84 ? 157  PHE D CD2 1 
ATOM   9083  C  CE1 . PHE D 1 157 ? -2.555  44.660  92.082  1.00 27.32 ? 157  PHE D CE1 1 
ATOM   9084  C  CE2 . PHE D 1 157 ? -3.208  42.811  90.691  1.00 28.41 ? 157  PHE D CE2 1 
ATOM   9085  C  CZ  . PHE D 1 157 ? -3.249  43.473  91.913  1.00 27.98 ? 157  PHE D CZ  1 
ATOM   9086  N  N   . ILE D 1 158 ? 0.532   42.743  87.186  1.00 32.41 ? 158  ILE D N   1 
ATOM   9087  C  CA  . ILE D 1 158 ? 0.610   41.336  86.800  1.00 33.58 ? 158  ILE D CA  1 
ATOM   9088  C  C   . ILE D 1 158 ? 1.995   40.787  87.129  1.00 33.67 ? 158  ILE D C   1 
ATOM   9089  O  O   . ILE D 1 158 ? 2.120   39.698  87.687  1.00 33.97 ? 158  ILE D O   1 
ATOM   9090  C  CB  . ILE D 1 158 ? 0.309   41.142  85.296  1.00 34.26 ? 158  ILE D CB  1 
ATOM   9091  C  CG1 . ILE D 1 158 ? -1.134  41.560  84.999  1.00 34.74 ? 158  ILE D CG1 1 
ATOM   9092  C  CG2 . ILE D 1 158 ? 0.527   39.687  84.891  1.00 33.82 ? 158  ILE D CG2 1 
ATOM   9093  C  CD1 . ILE D 1 158 ? -1.518  41.468  83.539  1.00 36.39 ? 158  ILE D CD1 1 
HETATM 9094  N  N   . MSE D 1 159 ? 3.025   41.561  86.796  1.00 33.21 ? 159  MSE D N   1 
HETATM 9095  C  CA  . MSE D 1 159 ? 4.409   41.183  87.066  1.00 32.82 ? 159  MSE D CA  1 
HETATM 9096  C  C   . MSE D 1 159 ? 4.606   41.044  88.573  1.00 31.77 ? 159  MSE D C   1 
HETATM 9097  O  O   . MSE D 1 159 ? 5.373   40.201  89.037  1.00 31.46 ? 159  MSE D O   1 
HETATM 9098  C  CB  . MSE D 1 159 ? 5.353   42.253  86.514  1.00 35.24 ? 159  MSE D CB  1 
HETATM 9099  C  CG  . MSE D 1 159 ? 6.813   42.066  86.882  1.00 35.29 ? 159  MSE D CG  1 
HETATM 9100  SE SE  . MSE D 1 159 ? 7.892   43.517  86.232  1.00 37.16 ? 159  MSE D SE  1 
HETATM 9101  C  CE  . MSE D 1 159 ? 7.181   44.938  87.326  1.00 36.05 ? 159  MSE D CE  1 
ATOM   9102  N  N   . ASP D 1 160 ? 3.891   41.879  89.320  1.00 32.13 ? 160  ASP D N   1 
ATOM   9103  C  CA  . ASP D 1 160 ? 3.932   41.891  90.777  1.00 32.63 ? 160  ASP D CA  1 
ATOM   9104  C  C   . ASP D 1 160 ? 3.386   40.564  91.306  1.00 31.88 ? 160  ASP D C   1 
ATOM   9105  O  O   . ASP D 1 160 ? 3.930   39.984  92.248  1.00 32.11 ? 160  ASP D O   1 
ATOM   9106  C  CB  . ASP D 1 160 ? 3.079   43.056  91.291  1.00 35.06 ? 160  ASP D CB  1 
ATOM   9107  C  CG  . ASP D 1 160 ? 3.289   43.341  92.762  1.00 37.40 ? 160  ASP D CG  1 
ATOM   9108  O  OD1 . ASP D 1 160 ? 2.729   42.606  93.603  1.00 36.88 ? 160  ASP D OD1 1 
ATOM   9109  O  OD2 . ASP D 1 160 ? 3.993   44.326  93.074  1.00 39.51 ? 160  ASP D OD2 1 
ATOM   9110  N  N   . VAL D 1 161 ? 2.315   40.087  90.678  1.00 31.20 ? 161  VAL D N   1 
ATOM   9111  C  CA  . VAL D 1 161 ? 1.673   38.832  91.057  1.00 30.13 ? 161  VAL D CA  1 
ATOM   9112  C  C   . VAL D 1 161 ? 2.532   37.626  90.680  1.00 29.64 ? 161  VAL D C   1 
ATOM   9113  O  O   . VAL D 1 161 ? 2.595   36.647  91.422  1.00 30.56 ? 161  VAL D O   1 
ATOM   9114  C  CB  . VAL D 1 161 ? 0.279   38.695  90.388  1.00 29.67 ? 161  VAL D CB  1 
ATOM   9115  C  CG1 . VAL D 1 161 ? -0.362  37.358  90.741  1.00 28.47 ? 161  VAL D CG1 1 
ATOM   9116  C  CG2 . VAL D 1 161 ? -0.621  39.837  90.823  1.00 28.39 ? 161  VAL D CG2 1 
ATOM   9117  N  N   . GLN D 1 162 ? 3.203   37.710  89.534  1.00 29.60 ? 162  GLN D N   1 
ATOM   9118  C  CA  . GLN D 1 162 ? 4.050   36.620  89.058  1.00 29.98 ? 162  GLN D CA  1 
ATOM   9119  C  C   . GLN D 1 162 ? 5.303   36.441  89.910  1.00 29.36 ? 162  GLN D C   1 
ATOM   9120  O  O   . GLN D 1 162 ? 5.820   35.330  90.039  1.00 28.94 ? 162  GLN D O   1 
ATOM   9121  C  CB  . GLN D 1 162 ? 4.444   36.845  87.594  1.00 31.10 ? 162  GLN D CB  1 
ATOM   9122  C  CG  . GLN D 1 162 ? 3.274   37.108  86.655  1.00 31.18 ? 162  GLN D CG  1 
ATOM   9123  C  CD  . GLN D 1 162 ? 2.138   36.119  86.833  1.00 30.96 ? 162  GLN D CD  1 
ATOM   9124  O  OE1 . GLN D 1 162 ? 2.328   34.908  86.724  1.00 32.02 ? 162  GLN D OE1 1 
ATOM   9125  N  NE2 . GLN D 1 162 ? 0.946   36.635  87.114  1.00 29.68 ? 162  GLN D NE2 1 
ATOM   9126  N  N   . GLY D 1 163 ? 5.782   37.539  90.487  1.00 29.41 ? 163  GLY D N   1 
ATOM   9127  C  CA  . GLY D 1 163 ? 6.969   37.489  91.321  1.00 29.36 ? 163  GLY D CA  1 
ATOM   9128  C  C   . GLY D 1 163 ? 8.196   38.082  90.656  1.00 29.28 ? 163  GLY D C   1 
ATOM   9129  O  O   . GLY D 1 163 ? 9.128   38.509  91.337  1.00 30.31 ? 163  GLY D O   1 
ATOM   9130  N  N   . SER D 1 164 ? 8.194   38.117  89.326  1.00 29.88 ? 164  SER D N   1 
ATOM   9131  C  CA  . SER D 1 164 ? 9.315   38.656  88.561  1.00 29.28 ? 164  SER D CA  1 
ATOM   9132  C  C   . SER D 1 164 ? 8.934   38.926  87.105  1.00 29.46 ? 164  SER D C   1 
ATOM   9133  O  O   . SER D 1 164 ? 7.781   38.742  86.708  1.00 29.49 ? 164  SER D O   1 
ATOM   9134  C  CB  . SER D 1 164 ? 10.505  37.692  88.617  1.00 29.58 ? 164  SER D CB  1 
ATOM   9135  O  OG  . SER D 1 164 ? 10.168  36.422  88.085  1.00 31.27 ? 164  SER D OG  1 
ATOM   9136  N  N   . GLY D 1 165 ? 9.913   39.368  86.319  1.00 28.79 ? 165  GLY D N   1 
ATOM   9137  C  CA  . GLY D 1 165 ? 9.676   39.657  84.915  1.00 27.09 ? 165  GLY D CA  1 
ATOM   9138  C  C   . GLY D 1 165 ? 10.841  40.356  84.236  1.00 26.79 ? 165  GLY D C   1 
ATOM   9139  O  O   . GLY D 1 165 ? 11.635  41.036  84.887  1.00 26.42 ? 165  GLY D O   1 
ATOM   9140  N  N   . TYR D 1 166 ? 10.953  40.168  82.924  1.00 27.10 ? 166  TYR D N   1 
ATOM   9141  C  CA  . TYR D 1 166 ? 12.014  40.791  82.138  1.00 25.97 ? 166  TYR D CA  1 
ATOM   9142  C  C   . TYR D 1 166 ? 11.631  42.208  81.742  1.00 26.22 ? 166  TYR D C   1 
ATOM   9143  O  O   . TYR D 1 166 ? 10.502  42.458  81.316  1.00 25.90 ? 166  TYR D O   1 
ATOM   9144  C  CB  . TYR D 1 166 ? 12.292  39.988  80.868  1.00 25.55 ? 166  TYR D CB  1 
ATOM   9145  C  CG  . TYR D 1 166 ? 13.150  38.763  81.063  1.00 24.48 ? 166  TYR D CG  1 
ATOM   9146  C  CD1 . TYR D 1 166 ? 14.521  38.877  81.290  1.00 22.64 ? 166  TYR D CD1 1 
ATOM   9147  C  CD2 . TYR D 1 166 ? 12.600  37.486  80.980  1.00 25.40 ? 166  TYR D CD2 1 
ATOM   9148  C  CE1 . TYR D 1 166 ? 15.326  37.749  81.426  1.00 22.25 ? 166  TYR D CE1 1 
ATOM   9149  C  CE2 . TYR D 1 166 ? 13.394  36.350  81.114  1.00 25.93 ? 166  TYR D CE2 1 
ATOM   9150  C  CZ  . TYR D 1 166 ? 14.755  36.488  81.336  1.00 24.03 ? 166  TYR D CZ  1 
ATOM   9151  O  OH  . TYR D 1 166 ? 15.539  35.364  81.458  1.00 24.10 ? 166  TYR D OH  1 
ATOM   9152  N  N   . ILE D 1 167 ? 12.576  43.133  81.879  1.00 27.28 ? 167  ILE D N   1 
ATOM   9153  C  CA  . ILE D 1 167 ? 12.335  44.523  81.519  1.00 26.78 ? 167  ILE D CA  1 
ATOM   9154  C  C   . ILE D 1 167 ? 13.065  44.880  80.231  1.00 28.75 ? 167  ILE D C   1 
ATOM   9155  O  O   . ILE D 1 167 ? 14.293  44.818  80.153  1.00 29.16 ? 167  ILE D O   1 
ATOM   9156  C  CB  . ILE D 1 167 ? 12.748  45.489  82.649  1.00 24.23 ? 167  ILE D CB  1 
ATOM   9157  C  CG1 . ILE D 1 167 ? 11.920  45.205  83.904  1.00 22.45 ? 167  ILE D CG1 1 
ATOM   9158  C  CG2 . ILE D 1 167 ? 12.550  46.937  82.211  1.00 22.95 ? 167  ILE D CG2 1 
ATOM   9159  C  CD1 . ILE D 1 167 ? 10.424  45.354  83.712  1.00 19.81 ? 167  ILE D CD1 1 
ATOM   9160  N  N   . ASP D 1 168 ? 12.283  45.221  79.214  1.00 30.46 ? 168  ASP D N   1 
ATOM   9161  C  CA  . ASP D 1 168 ? 12.809  45.596  77.911  1.00 30.96 ? 168  ASP D CA  1 
ATOM   9162  C  C   . ASP D 1 168 ? 12.822  47.117  77.794  1.00 31.20 ? 168  ASP D C   1 
ATOM   9163  O  O   . ASP D 1 168 ? 11.768  47.752  77.768  1.00 31.61 ? 168  ASP D O   1 
ATOM   9164  C  CB  . ASP D 1 168 ? 11.938  44.977  76.814  1.00 32.54 ? 168  ASP D CB  1 
ATOM   9165  C  CG  . ASP D 1 168 ? 12.370  45.383  75.423  1.00 34.15 ? 168  ASP D CG  1 
ATOM   9166  O  OD1 . ASP D 1 168 ? 13.430  44.908  74.961  1.00 36.31 ? 168  ASP D OD1 1 
ATOM   9167  O  OD2 . ASP D 1 168 ? 11.642  46.178  74.793  1.00 36.31 ? 168  ASP D OD2 1 
ATOM   9168  N  N   . PHE D 1 169 ? 14.017  47.698  77.740  1.00 32.10 ? 169  PHE D N   1 
ATOM   9169  C  CA  . PHE D 1 169 ? 14.162  49.148  77.631  1.00 32.97 ? 169  PHE D CA  1 
ATOM   9170  C  C   . PHE D 1 169 ? 14.030  49.685  76.207  1.00 35.65 ? 169  PHE D C   1 
ATOM   9171  O  O   . PHE D 1 169 ? 14.074  50.899  75.991  1.00 35.56 ? 169  PHE D O   1 
ATOM   9172  C  CB  . PHE D 1 169 ? 15.483  49.601  78.257  1.00 30.23 ? 169  PHE D CB  1 
ATOM   9173  C  CG  . PHE D 1 169 ? 15.515  49.470  79.752  1.00 27.66 ? 169  PHE D CG  1 
ATOM   9174  C  CD1 . PHE D 1 169 ? 14.851  50.390  80.555  1.00 27.07 ? 169  PHE D CD1 1 
ATOM   9175  C  CD2 . PHE D 1 169 ? 16.190  48.417  80.358  1.00 29.18 ? 169  PHE D CD2 1 
ATOM   9176  C  CE1 . PHE D 1 169 ? 14.857  50.265  81.941  1.00 25.51 ? 169  PHE D CE1 1 
ATOM   9177  C  CE2 . PHE D 1 169 ? 16.203  48.282  81.746  1.00 28.94 ? 169  PHE D CE2 1 
ATOM   9178  C  CZ  . PHE D 1 169 ? 15.534  49.210  82.538  1.00 26.99 ? 169  PHE D CZ  1 
ATOM   9179  N  N   . GLY D 1 170 ? 13.869  48.776  75.246  1.00 37.73 ? 170  GLY D N   1 
ATOM   9180  C  CA  . GLY D 1 170 ? 13.713  49.154  73.849  1.00 40.18 ? 170  GLY D CA  1 
ATOM   9181  C  C   . GLY D 1 170 ? 14.760  50.108  73.304  1.00 41.75 ? 170  GLY D C   1 
ATOM   9182  O  O   . GLY D 1 170 ? 14.430  51.042  72.570  1.00 42.74 ? 170  GLY D O   1 
ATOM   9183  N  N   . ASP D 1 171 ? 16.020  49.871  73.657  1.00 41.92 ? 171  ASP D N   1 
ATOM   9184  C  CA  . ASP D 1 171 ? 17.120  50.717  73.202  1.00 42.39 ? 171  ASP D CA  1 
ATOM   9185  C  C   . ASP D 1 171 ? 18.290  49.905  72.653  1.00 42.23 ? 171  ASP D C   1 
ATOM   9186  O  O   . ASP D 1 171 ? 19.275  50.468  72.173  1.00 42.55 ? 171  ASP D O   1 
ATOM   9187  C  CB  . ASP D 1 171 ? 17.598  51.634  74.339  1.00 43.33 ? 171  ASP D CB  1 
ATOM   9188  C  CG  . ASP D 1 171 ? 18.090  50.865  75.566  1.00 44.81 ? 171  ASP D CG  1 
ATOM   9189  O  OD1 . ASP D 1 171 ? 17.960  49.622  75.616  1.00 44.31 ? 171  ASP D OD1 1 
ATOM   9190  O  OD2 . ASP D 1 171 ? 18.609  51.518  76.496  1.00 45.34 ? 171  ASP D OD2 1 
ATOM   9191  N  N   . GLY D 1 172 ? 18.175  48.582  72.732  1.00 42.22 ? 172  GLY D N   1 
ATOM   9192  C  CA  . GLY D 1 172 ? 19.231  47.714  72.244  1.00 43.48 ? 172  GLY D CA  1 
ATOM   9193  C  C   . GLY D 1 172 ? 19.764  46.786  73.316  1.00 43.72 ? 172  GLY D C   1 
ATOM   9194  O  O   . GLY D 1 172 ? 20.047  45.614  73.051  1.00 43.45 ? 172  GLY D O   1 
ATOM   9195  N  N   . SER D 1 173 ? 19.894  47.315  74.530  1.00 42.94 ? 173  SER D N   1 
ATOM   9196  C  CA  . SER D 1 173 ? 20.398  46.554  75.667  1.00 41.75 ? 173  SER D CA  1 
ATOM   9197  C  C   . SER D 1 173 ? 19.530  45.330  75.957  1.00 41.98 ? 173  SER D C   1 
ATOM   9198  O  O   . SER D 1 173 ? 18.315  45.354  75.741  1.00 42.06 ? 173  SER D O   1 
ATOM   9199  C  CB  . SER D 1 173 ? 20.477  47.448  76.908  1.00 41.02 ? 173  SER D CB  1 
ATOM   9200  O  OG  . SER D 1 173 ? 19.194  47.911  77.292  1.00 38.71 ? 173  SER D OG  1 
ATOM   9201  N  N   . PRO D 1 174 ? 20.152  44.238  76.436  1.00 41.67 ? 174  PRO D N   1 
ATOM   9202  C  CA  . PRO D 1 174 ? 19.469  42.981  76.766  1.00 41.81 ? 174  PRO D CA  1 
ATOM   9203  C  C   . PRO D 1 174 ? 18.378  43.159  77.815  1.00 41.19 ? 174  PRO D C   1 
ATOM   9204  O  O   . PRO D 1 174 ? 18.353  44.158  78.537  1.00 42.71 ? 174  PRO D O   1 
ATOM   9205  C  CB  . PRO D 1 174 ? 20.606  42.111  77.302  1.00 41.02 ? 174  PRO D CB  1 
ATOM   9206  C  CG  . PRO D 1 174 ? 21.790  42.606  76.544  1.00 42.34 ? 174  PRO D CG  1 
ATOM   9207  C  CD  . PRO D 1 174 ? 21.606  44.098  76.627  1.00 42.11 ? 174  PRO D CD  1 
ATOM   9208  N  N   . LEU D 1 175 ? 17.471  42.190  77.884  1.00 40.31 ? 175  LEU D N   1 
ATOM   9209  C  CA  . LEU D 1 175 ? 16.378  42.231  78.847  1.00 38.76 ? 175  LEU D CA  1 
ATOM   9210  C  C   . LEU D 1 175 ? 16.901  42.002  80.260  1.00 37.27 ? 175  LEU D C   1 
ATOM   9211  O  O   . LEU D 1 175 ? 17.565  41.004  80.530  1.00 37.18 ? 175  LEU D O   1 
ATOM   9212  C  CB  . LEU D 1 175 ? 15.321  41.180  78.507  1.00 39.68 ? 175  LEU D CB  1 
ATOM   9213  C  CG  . LEU D 1 175 ? 14.340  41.498  77.377  1.00 40.90 ? 175  LEU D CG  1 
ATOM   9214  C  CD1 . LEU D 1 175 ? 15.063  41.667  76.048  1.00 41.80 ? 175  LEU D CD1 1 
ATOM   9215  C  CD2 . LEU D 1 175 ? 13.315  40.384  77.295  1.00 42.18 ? 175  LEU D CD2 1 
ATOM   9216  N  N   . ASN D 1 176 ? 16.609  42.944  81.149  1.00 35.57 ? 176  ASN D N   1 
ATOM   9217  C  CA  . ASN D 1 176 ? 17.044  42.861  82.538  1.00 32.90 ? 176  ASN D CA  1 
ATOM   9218  C  C   . ASN D 1 176 ? 16.002  42.108  83.363  1.00 31.16 ? 176  ASN D C   1 
ATOM   9219  O  O   . ASN D 1 176 ? 14.840  42.508  83.428  1.00 32.25 ? 176  ASN D O   1 
ATOM   9220  C  CB  . ASN D 1 176 ? 17.256  44.272  83.101  1.00 33.08 ? 176  ASN D CB  1 
ATOM   9221  C  CG  . ASN D 1 176 ? 18.058  44.280  84.393  1.00 32.04 ? 176  ASN D CG  1 
ATOM   9222  O  OD1 . ASN D 1 176 ? 17.848  43.452  85.278  1.00 33.74 ? 176  ASN D OD1 1 
ATOM   9223  N  ND2 . ASN D 1 176 ? 18.980  45.228  84.507  1.00 32.86 ? 176  ASN D ND2 1 
ATOM   9224  N  N   . PHE D 1 177 ? 16.424  41.011  83.983  1.00 30.00 ? 177  PHE D N   1 
ATOM   9225  C  CA  . PHE D 1 177 ? 15.529  40.204  84.803  1.00 29.10 ? 177  PHE D CA  1 
ATOM   9226  C  C   . PHE D 1 177 ? 15.350  40.785  86.204  1.00 29.36 ? 177  PHE D C   1 
ATOM   9227  O  O   . PHE D 1 177 ? 16.283  40.796  87.007  1.00 29.42 ? 177  PHE D O   1 
ATOM   9228  C  CB  . PHE D 1 177 ? 16.044  38.763  84.897  1.00 27.86 ? 177  PHE D CB  1 
ATOM   9229  C  CG  . PHE D 1 177 ? 15.166  37.857  85.717  1.00 27.45 ? 177  PHE D CG  1 
ATOM   9230  C  CD1 . PHE D 1 177 ? 13.845  37.623  85.347  1.00 25.77 ? 177  PHE D CD1 1 
ATOM   9231  C  CD2 . PHE D 1 177 ? 15.655  37.250  86.869  1.00 27.77 ? 177  PHE D CD2 1 
ATOM   9232  C  CE1 . PHE D 1 177 ? 13.024  36.800  86.113  1.00 26.45 ? 177  PHE D CE1 1 
ATOM   9233  C  CE2 . PHE D 1 177 ? 14.841  36.424  87.642  1.00 25.69 ? 177  PHE D CE2 1 
ATOM   9234  C  CZ  . PHE D 1 177 ? 13.524  36.200  87.264  1.00 25.60 ? 177  PHE D CZ  1 
ATOM   9235  N  N   . PHE D 1 178 ? 14.147  41.277  86.482  1.00 29.45 ? 178  PHE D N   1 
ATOM   9236  C  CA  . PHE D 1 178 ? 13.825  41.847  87.786  1.00 28.08 ? 178  PHE D CA  1 
ATOM   9237  C  C   . PHE D 1 178 ? 13.321  40.743  88.713  1.00 26.17 ? 178  PHE D C   1 
ATOM   9238  O  O   . PHE D 1 178 ? 12.130  40.433  88.738  1.00 25.76 ? 178  PHE D O   1 
ATOM   9239  C  CB  . PHE D 1 178 ? 12.767  42.949  87.647  1.00 27.89 ? 178  PHE D CB  1 
ATOM   9240  C  CG  . PHE D 1 178 ? 13.311  44.267  87.154  1.00 26.81 ? 178  PHE D CG  1 
ATOM   9241  C  CD1 . PHE D 1 178 ? 14.462  44.323  86.372  1.00 24.90 ? 178  PHE D CD1 1 
ATOM   9242  C  CD2 . PHE D 1 178 ? 12.663  45.457  87.474  1.00 26.57 ? 178  PHE D CD2 1 
ATOM   9243  C  CE1 . PHE D 1 178 ? 14.958  45.542  85.916  1.00 24.37 ? 178  PHE D CE1 1 
ATOM   9244  C  CE2 . PHE D 1 178 ? 13.152  46.682  87.023  1.00 25.61 ? 178  PHE D CE2 1 
ATOM   9245  C  CZ  . PHE D 1 178 ? 14.301  46.724  86.243  1.00 24.34 ? 178  PHE D CZ  1 
ATOM   9246  N  N   . SER D 1 179 ? 14.243  40.150  89.466  1.00 26.15 ? 179  SER D N   1 
ATOM   9247  C  CA  . SER D 1 179 ? 13.922  39.067  90.392  1.00 25.72 ? 179  SER D CA  1 
ATOM   9248  C  C   . SER D 1 179 ? 13.195  39.532  91.650  1.00 25.49 ? 179  SER D C   1 
ATOM   9249  O  O   . SER D 1 179 ? 13.258  40.702  92.021  1.00 26.05 ? 179  SER D O   1 
ATOM   9250  C  CB  . SER D 1 179 ? 15.198  38.320  90.788  1.00 25.51 ? 179  SER D CB  1 
ATOM   9251  O  OG  . SER D 1 179 ? 16.101  39.171  91.472  1.00 24.78 ? 179  SER D OG  1 
ATOM   9252  N  N   . TYR D 1 180 ? 12.511  38.593  92.299  1.00 25.47 ? 180  TYR D N   1 
ATOM   9253  C  CA  . TYR D 1 180 ? 11.769  38.858  93.529  1.00 24.31 ? 180  TYR D CA  1 
ATOM   9254  C  C   . TYR D 1 180 ? 12.767  39.161  94.645  1.00 24.40 ? 180  TYR D C   1 
ATOM   9255  O  O   . TYR D 1 180 ? 13.466  38.266  95.122  1.00 25.41 ? 180  TYR D O   1 
ATOM   9256  C  CB  . TYR D 1 180 ? 10.924  37.628  93.891  1.00 24.64 ? 180  TYR D CB  1 
ATOM   9257  C  CG  . TYR D 1 180 ? 10.010  37.803  95.084  1.00 25.29 ? 180  TYR D CG  1 
ATOM   9258  C  CD1 . TYR D 1 180 ? 10.477  37.601  96.383  1.00 25.60 ? 180  TYR D CD1 1 
ATOM   9259  C  CD2 . TYR D 1 180 ? 8.672   38.157  94.914  1.00 27.80 ? 180  TYR D CD2 1 
ATOM   9260  C  CE1 . TYR D 1 180 ? 9.637   37.749  97.482  1.00 25.44 ? 180  TYR D CE1 1 
ATOM   9261  C  CE2 . TYR D 1 180 ? 7.823   38.306  96.007  1.00 28.15 ? 180  TYR D CE2 1 
ATOM   9262  C  CZ  . TYR D 1 180 ? 8.313   38.101  97.288  1.00 27.25 ? 180  TYR D CZ  1 
ATOM   9263  O  OH  . TYR D 1 180 ? 7.481   38.252  98.374  1.00 30.24 ? 180  TYR D OH  1 
ATOM   9264  N  N   . ALA D 1 181 ? 12.845  40.429  95.038  1.00 24.85 ? 181  ALA D N   1 
ATOM   9265  C  CA  . ALA D 1 181 ? 13.762  40.856  96.091  1.00 24.05 ? 181  ALA D CA  1 
ATOM   9266  C  C   . ALA D 1 181 ? 13.094  40.945  97.462  1.00 23.98 ? 181  ALA D C   1 
ATOM   9267  O  O   . ALA D 1 181 ? 13.740  40.728  98.488  1.00 24.17 ? 181  ALA D O   1 
ATOM   9268  C  CB  . ALA D 1 181 ? 14.390  42.187  95.727  1.00 22.96 ? 181  ALA D CB  1 
ATOM   9269  N  N   . GLY D 1 182 ? 11.805  41.271  97.472  1.00 23.05 ? 182  GLY D N   1 
ATOM   9270  C  CA  . GLY D 1 182 ? 11.078  41.384  98.723  1.00 21.92 ? 182  GLY D CA  1 
ATOM   9271  C  C   . GLY D 1 182 ? 9.647   41.849  98.538  1.00 22.57 ? 182  GLY D C   1 
ATOM   9272  O  O   . GLY D 1 182 ? 9.163   41.965  97.411  1.00 23.01 ? 182  GLY D O   1 
ATOM   9273  N  N   . LYS D 1 183 ? 8.979   42.144  99.649  1.00 22.66 ? 183  LYS D N   1 
ATOM   9274  C  CA  . LYS D 1 183 ? 7.589   42.592  99.622  1.00 24.53 ? 183  LYS D CA  1 
ATOM   9275  C  C   . LYS D 1 183 ? 7.321   43.567  100.770 1.00 25.14 ? 183  LYS D C   1 
ATOM   9276  O  O   . LYS D 1 183 ? 8.153   43.727  101.666 1.00 24.76 ? 183  LYS D O   1 
ATOM   9277  C  CB  . LYS D 1 183 ? 6.660   41.379  99.741  1.00 24.45 ? 183  LYS D CB  1 
ATOM   9278  C  CG  . LYS D 1 183 ? 5.228   41.625  99.301  1.00 26.88 ? 183  LYS D CG  1 
ATOM   9279  C  CD  . LYS D 1 183 ? 4.377   40.380  99.485  1.00 28.58 ? 183  LYS D CD  1 
ATOM   9280  C  CE  . LYS D 1 183 ? 4.142   40.080  100.954 1.00 30.53 ? 183  LYS D CE  1 
ATOM   9281  N  NZ  . LYS D 1 183 ? 3.374   41.172  101.613 1.00 31.28 ? 183  LYS D NZ  1 
ATOM   9282  N  N   . ASN D 1 184 ? 6.166   44.229  100.731 1.00 26.44 ? 184  ASN D N   1 
ATOM   9283  C  CA  . ASN D 1 184 ? 5.789   45.179  101.774 1.00 26.45 ? 184  ASN D CA  1 
ATOM   9284  C  C   . ASN D 1 184 ? 5.110   44.484  102.956 1.00 26.52 ? 184  ASN D C   1 
ATOM   9285  O  O   . ASN D 1 184 ? 4.852   43.281  102.914 1.00 27.73 ? 184  ASN D O   1 
ATOM   9286  C  CB  . ASN D 1 184 ? 4.888   46.284  101.203 1.00 25.76 ? 184  ASN D CB  1 
ATOM   9287  C  CG  . ASN D 1 184 ? 3.546   45.766  100.714 1.00 25.16 ? 184  ASN D CG  1 
ATOM   9288  O  OD1 . ASN D 1 184 ? 3.325   44.558  100.616 1.00 25.71 ? 184  ASN D OD1 1 
ATOM   9289  N  ND2 . ASN D 1 184 ? 2.642   46.686  100.401 1.00 21.86 ? 184  ASN D ND2 1 
ATOM   9290  N  N   . GLY D 1 185 ? 4.818   45.249  104.005 1.00 26.36 ? 185  GLY D N   1 
ATOM   9291  C  CA  . GLY D 1 185 ? 4.183   44.687  105.184 1.00 28.29 ? 185  GLY D CA  1 
ATOM   9292  C  C   . GLY D 1 185 ? 2.670   44.586  105.117 1.00 30.01 ? 185  GLY D C   1 
ATOM   9293  O  O   . GLY D 1 185 ? 1.987   44.858  106.104 1.00 31.46 ? 185  GLY D O   1 
ATOM   9294  N  N   . HIS D 1 186 ? 2.145   44.184  103.961 1.00 31.78 ? 186  HIS D N   1 
ATOM   9295  C  CA  . HIS D 1 186 ? 0.703   44.047  103.773 1.00 31.59 ? 186  HIS D CA  1 
ATOM   9296  C  C   . HIS D 1 186 ? 0.335   42.736  103.085 1.00 32.34 ? 186  HIS D C   1 
ATOM   9297  O  O   . HIS D 1 186 ? 0.968   42.338  102.105 1.00 30.74 ? 186  HIS D O   1 
ATOM   9298  C  CB  . HIS D 1 186 ? 0.148   45.231  102.977 1.00 31.40 ? 186  HIS D CB  1 
ATOM   9299  C  CG  . HIS D 1 186 ? 0.167   46.526  103.728 1.00 31.65 ? 186  HIS D CG  1 
ATOM   9300  N  ND1 . HIS D 1 186 ? -0.896  46.959  104.490 1.00 32.26 ? 186  HIS D ND1 1 
ATOM   9301  C  CD2 . HIS D 1 186 ? 1.124   47.476  103.843 1.00 31.20 ? 186  HIS D CD2 1 
ATOM   9302  C  CE1 . HIS D 1 186 ? -0.594  48.120  105.043 1.00 30.60 ? 186  HIS D CE1 1 
ATOM   9303  N  NE2 . HIS D 1 186 ? 0.626   48.456  104.667 1.00 29.18 ? 186  HIS D NE2 1 
ATOM   9304  N  N   . ALA D 1 187 ? -0.704  42.084  103.603 1.00 33.55 ? 187  ALA D N   1 
ATOM   9305  C  CA  . ALA D 1 187 ? -1.181  40.807  103.077 1.00 32.87 ? 187  ALA D CA  1 
ATOM   9306  C  C   . ALA D 1 187 ? -1.833  40.915  101.701 1.00 32.17 ? 187  ALA D C   1 
ATOM   9307  O  O   . ALA D 1 187 ? -2.532  41.885  101.406 1.00 31.97 ? 187  ALA D O   1 
ATOM   9308  C  CB  . ALA D 1 187 ? -2.148  40.166  104.064 1.00 33.55 ? 187  ALA D CB  1 
ATOM   9309  N  N   . TYR D 1 188 ? -1.598  39.901  100.872 1.00 32.05 ? 188  TYR D N   1 
ATOM   9310  C  CA  . TYR D 1 188 ? -2.153  39.847  99.523  1.00 32.10 ? 188  TYR D CA  1 
ATOM   9311  C  C   . TYR D 1 188 ? -3.653  39.568  99.557  1.00 33.11 ? 188  TYR D C   1 
ATOM   9312  O  O   . TYR D 1 188 ? -4.120  38.719  100.318 1.00 33.63 ? 188  TYR D O   1 
ATOM   9313  C  CB  . TYR D 1 188 ? -1.444  38.768  98.695  1.00 31.22 ? 188  TYR D CB  1 
ATOM   9314  C  CG  . TYR D 1 188 ? -1.996  38.613  97.292  1.00 30.88 ? 188  TYR D CG  1 
ATOM   9315  C  CD1 . TYR D 1 188 ? -1.611  39.480  96.271  1.00 32.76 ? 188  TYR D CD1 1 
ATOM   9316  C  CD2 . TYR D 1 188 ? -2.927  37.619  96.994  1.00 30.22 ? 188  TYR D CD2 1 
ATOM   9317  C  CE1 . TYR D 1 188 ? -2.143  39.365  94.987  1.00 33.25 ? 188  TYR D CE1 1 
ATOM   9318  C  CE2 . TYR D 1 188 ? -3.465  37.495  95.714  1.00 32.45 ? 188  TYR D CE2 1 
ATOM   9319  C  CZ  . TYR D 1 188 ? -3.070  38.373  94.716  1.00 32.41 ? 188  TYR D CZ  1 
ATOM   9320  O  OH  . TYR D 1 188 ? -3.608  38.266  93.454  1.00 31.16 ? 188  TYR D OH  1 
ATOM   9321  N  N   . ARG D 1 189 ? -4.401  40.287  98.725  1.00 33.64 ? 189  ARG D N   1 
ATOM   9322  C  CA  . ARG D 1 189 ? -5.847  40.121  98.652  1.00 34.36 ? 189  ARG D CA  1 
ATOM   9323  C  C   . ARG D 1 189 ? -6.289  40.067  97.191  1.00 35.05 ? 189  ARG D C   1 
ATOM   9324  O  O   . ARG D 1 189 ? -5.872  40.888  96.373  1.00 34.16 ? 189  ARG D O   1 
ATOM   9325  C  CB  . ARG D 1 189 ? -6.552  41.257  99.402  1.00 35.40 ? 189  ARG D CB  1 
ATOM   9326  C  CG  . ARG D 1 189 ? -6.041  41.444  100.831 1.00 36.43 ? 189  ARG D CG  1 
ATOM   9327  C  CD  . ARG D 1 189 ? -6.814  42.499  101.609 1.00 37.92 ? 189  ARG D CD  1 
ATOM   9328  N  NE  . ARG D 1 189 ? -6.117  42.896  102.836 1.00 37.50 ? 189  ARG D NE  1 
ATOM   9329  C  CZ  . ARG D 1 189 ? -5.886  42.097  103.876 1.00 38.06 ? 189  ARG D CZ  1 
ATOM   9330  N  NH1 . ARG D 1 189 ? -6.294  40.835  103.865 1.00 38.45 ? 189  ARG D NH1 1 
ATOM   9331  N  NH2 . ARG D 1 189 ? -5.234  42.562  104.932 1.00 38.36 ? 189  ARG D NH2 1 
ATOM   9332  N  N   . SER D 1 190 ? -7.125  39.080  96.878  1.00 37.23 ? 190  SER D N   1 
ATOM   9333  C  CA  . SER D 1 190 ? -7.642  38.851  95.527  1.00 38.96 ? 190  SER D CA  1 
ATOM   9334  C  C   . SER D 1 190 ? -8.285  40.062  94.850  1.00 39.78 ? 190  SER D C   1 
ATOM   9335  O  O   . SER D 1 190 ? -9.218  40.665  95.383  1.00 40.01 ? 190  SER D O   1 
ATOM   9336  C  CB  . SER D 1 190 ? -8.639  37.690  95.544  1.00 38.91 ? 190  SER D CB  1 
ATOM   9337  O  OG  . SER D 1 190 ? -8.031  36.496  96.004  1.00 39.84 ? 190  SER D OG  1 
ATOM   9338  N  N   . ILE D 1 191 ? -7.784  40.393  93.662  1.00 41.01 ? 191  ILE D N   1 
ATOM   9339  C  CA  . ILE D 1 191 ? -8.293  41.517  92.877  1.00 41.95 ? 191  ILE D CA  1 
ATOM   9340  C  C   . ILE D 1 191 ? -9.451  41.079  91.983  1.00 43.81 ? 191  ILE D C   1 
ATOM   9341  O  O   . ILE D 1 191 ? -10.401 41.837  91.769  1.00 44.55 ? 191  ILE D O   1 
ATOM   9342  C  CB  . ILE D 1 191 ? -7.168  42.151  92.021  1.00 41.68 ? 191  ILE D CB  1 
ATOM   9343  C  CG1 . ILE D 1 191 ? -6.178  42.871  92.933  1.00 41.04 ? 191  ILE D CG1 1 
ATOM   9344  C  CG2 . ILE D 1 191 ? -7.739  43.128  90.993  1.00 40.43 ? 191  ILE D CG2 1 
ATOM   9345  C  CD1 . ILE D 1 191 ? -6.778  44.028  93.699  1.00 42.13 ? 191  ILE D CD1 1 
ATOM   9346  N  N   . GLY D 1 192 ? -9.364  39.856  91.465  1.00 44.77 ? 192  GLY D N   1 
ATOM   9347  C  CA  . GLY D 1 192 ? -10.418 39.330  90.615  1.00 45.81 ? 192  GLY D CA  1 
ATOM   9348  C  C   . GLY D 1 192 ? -11.722 39.224  91.383  1.00 46.24 ? 192  GLY D C   1 
ATOM   9349  O  O   . GLY D 1 192 ? -12.805 39.358  90.812  1.00 46.23 ? 192  GLY D O   1 
ATOM   9350  N  N   . LYS D 1 193 ? -11.606 38.998  92.690  1.00 46.64 ? 193  LYS D N   1 
ATOM   9351  C  CA  . LYS D 1 193 ? -12.759 38.879  93.574  1.00 47.48 ? 193  LYS D CA  1 
ATOM   9352  C  C   . LYS D 1 193 ? -13.510 40.207  93.659  1.00 48.16 ? 193  LYS D C   1 
ATOM   9353  O  O   . LYS D 1 193 ? -14.740 40.228  93.706  1.00 49.04 ? 193  LYS D O   1 
ATOM   9354  C  CB  . LYS D 1 193 ? -12.307 38.446  94.973  1.00 47.24 ? 193  LYS D CB  1 
ATOM   9355  C  CG  . LYS D 1 193 ? -13.439 38.275  95.974  1.00 46.73 ? 193  LYS D CG  1 
ATOM   9356  C  CD  . LYS D 1 193 ? -12.908 37.947  97.359  1.00 45.79 ? 193  LYS D CD  1 
ATOM   9357  C  CE  . LYS D 1 193 ? -14.037 37.846  98.373  1.00 44.61 ? 193  LYS D CE  1 
ATOM   9358  N  NZ  . LYS D 1 193 ? -15.006 36.771  98.023  1.00 43.82 ? 193  LYS D NZ  1 
ATOM   9359  N  N   . VAL D 1 194 ? -12.763 41.308  93.663  1.00 48.23 ? 194  VAL D N   1 
ATOM   9360  C  CA  . VAL D 1 194 ? -13.346 42.646  93.737  1.00 47.98 ? 194  VAL D CA  1 
ATOM   9361  C  C   . VAL D 1 194 ? -14.205 42.934  92.505  1.00 48.24 ? 194  VAL D C   1 
ATOM   9362  O  O   . VAL D 1 194 ? -15.160 43.710  92.571  1.00 48.14 ? 194  VAL D O   1 
ATOM   9363  C  CB  . VAL D 1 194 ? -12.251 43.729  93.877  1.00 47.64 ? 194  VAL D CB  1 
ATOM   9364  C  CG1 . VAL D 1 194 ? -12.879 45.090  94.135  1.00 47.74 ? 194  VAL D CG1 1 
ATOM   9365  C  CG2 . VAL D 1 194 ? -11.298 43.368  95.006  1.00 48.79 ? 194  VAL D CG2 1 
ATOM   9366  N  N   . LEU D 1 195 ? -13.863 42.301  91.385  1.00 48.59 ? 195  LEU D N   1 
ATOM   9367  C  CA  . LEU D 1 195 ? -14.613 42.464  90.141  1.00 47.51 ? 195  LEU D CA  1 
ATOM   9368  C  C   . LEU D 1 195 ? -15.971 41.783  90.277  1.00 46.87 ? 195  LEU D C   1 
ATOM   9369  O  O   . LEU D 1 195 ? -16.970 42.242  89.722  1.00 46.31 ? 195  LEU D O   1 
ATOM   9370  C  CB  . LEU D 1 195 ? -13.839 41.853  88.969  1.00 47.05 ? 195  LEU D CB  1 
ATOM   9371  C  CG  . LEU D 1 195 ? -12.531 42.552  88.590  1.00 46.50 ? 195  LEU D CG  1 
ATOM   9372  C  CD1 . LEU D 1 195 ? -11.797 41.774  87.512  1.00 46.45 ? 195  LEU D CD1 1 
ATOM   9373  C  CD2 . LEU D 1 195 ? -12.839 43.954  88.119  1.00 45.61 ? 195  LEU D CD2 1 
ATOM   9374  N  N   . ILE D 1 196 ? -15.989 40.691  91.035  1.00 46.00 ? 196  ILE D N   1 
ATOM   9375  C  CA  . ILE D 1 196 ? -17.199 39.916  91.282  1.00 44.47 ? 196  ILE D CA  1 
ATOM   9376  C  C   . ILE D 1 196 ? -18.040 40.553  92.394  1.00 43.92 ? 196  ILE D C   1 
ATOM   9377  O  O   . ILE D 1 196 ? -19.263 40.409  92.414  1.00 44.34 ? 196  ILE D O   1 
ATOM   9378  C  CB  . ILE D 1 196 ? -16.841 38.460  91.667  1.00 43.50 ? 196  ILE D CB  1 
ATOM   9379  C  CG1 . ILE D 1 196 ? -16.000 37.819  90.558  1.00 41.94 ? 196  ILE D CG1 1 
ATOM   9380  C  CG2 . ILE D 1 196 ? -18.103 37.648  91.913  1.00 44.98 ? 196  ILE D CG2 1 
ATOM   9381  C  CD1 . ILE D 1 196 ? -15.499 36.428  90.884  1.00 40.70 ? 196  ILE D CD1 1 
ATOM   9382  N  N   . ASP D 1 197 ? -17.378 41.268  93.303  1.00 43.42 ? 197  ASP D N   1 
ATOM   9383  C  CA  . ASP D 1 197 ? -18.049 41.932  94.421  1.00 42.93 ? 197  ASP D CA  1 
ATOM   9384  C  C   . ASP D 1 197 ? -18.966 43.069  93.979  1.00 43.59 ? 197  ASP D C   1 
ATOM   9385  O  O   . ASP D 1 197 ? -20.020 43.292  94.579  1.00 43.91 ? 197  ASP D O   1 
ATOM   9386  C  CB  . ASP D 1 197 ? -17.023 42.476  95.425  1.00 42.60 ? 197  ASP D CB  1 
ATOM   9387  C  CG  . ASP D 1 197 ? -16.242 41.379  96.133  1.00 42.30 ? 197  ASP D CG  1 
ATOM   9388  O  OD1 . ASP D 1 197 ? -16.636 40.194  96.056  1.00 43.39 ? 197  ASP D OD1 1 
ATOM   9389  O  OD2 . ASP D 1 197 ? -15.226 41.710  96.778  1.00 41.56 ? 197  ASP D OD2 1 
ATOM   9390  N  N   . ARG D 1 198 ? -18.550 43.801  92.948  1.00 43.85 ? 198  ARG D N   1 
ATOM   9391  C  CA  . ARG D 1 198 ? -19.339 44.919  92.437  1.00 44.01 ? 198  ARG D CA  1 
ATOM   9392  C  C   . ARG D 1 198 ? -20.144 44.557  91.188  1.00 44.42 ? 198  ARG D C   1 
ATOM   9393  O  O   . ARG D 1 198 ? -20.887 45.387  90.658  1.00 43.73 ? 198  ARG D O   1 
ATOM   9394  C  CB  . ARG D 1 198 ? -18.444 46.136  92.168  1.00 43.70 ? 198  ARG D CB  1 
ATOM   9395  C  CG  . ARG D 1 198 ? -17.842 46.760  93.429  1.00 43.75 ? 198  ARG D CG  1 
ATOM   9396  C  CD  . ARG D 1 198 ? -16.687 45.931  93.978  1.00 42.29 ? 198  ARG D CD  1 
ATOM   9397  N  NE  . ARG D 1 198 ? -16.654 45.902  95.440  1.00 42.26 ? 198  ARG D NE  1 
ATOM   9398  C  CZ  . ARG D 1 198 ? -16.005 46.778  96.203  1.00 42.06 ? 198  ARG D CZ  1 
ATOM   9399  N  NH1 . ARG D 1 198 ? -15.322 47.772  95.653  1.00 42.95 ? 198  ARG D NH1 1 
ATOM   9400  N  NH2 . ARG D 1 198 ? -16.032 46.651  97.523  1.00 40.97 ? 198  ARG D NH2 1 
ATOM   9401  N  N   . GLY D 1 199 ? -20.008 43.310  90.740  1.00 45.94 ? 199  GLY D N   1 
ATOM   9402  C  CA  . GLY D 1 199 ? -20.727 42.847  89.565  1.00 46.96 ? 199  GLY D CA  1 
ATOM   9403  C  C   . GLY D 1 199 ? -20.152 43.365  88.261  1.00 48.13 ? 199  GLY D C   1 
ATOM   9404  O  O   . GLY D 1 199 ? -20.876 43.919  87.429  1.00 47.59 ? 199  GLY D O   1 
ATOM   9405  N  N   . GLU D 1 200 ? -18.846 43.184  88.084  1.00 48.56 ? 200  GLU D N   1 
ATOM   9406  C  CA  . GLU D 1 200 ? -18.156 43.632  86.880  1.00 49.53 ? 200  GLU D CA  1 
ATOM   9407  C  C   . GLU D 1 200 ? -17.745 42.451  86.002  1.00 50.25 ? 200  GLU D C   1 
ATOM   9408  O  O   . GLU D 1 200 ? -17.758 42.547  84.773  1.00 50.86 ? 200  GLU D O   1 
ATOM   9409  C  CB  . GLU D 1 200 ? -16.922 44.461  87.255  1.00 49.84 ? 200  GLU D CB  1 
ATOM   9410  C  CG  . GLU D 1 200 ? -17.212 45.695  88.112  1.00 50.77 ? 200  GLU D CG  1 
ATOM   9411  C  CD  . GLU D 1 200 ? -18.033 46.751  87.387  1.00 51.72 ? 200  GLU D CD  1 
ATOM   9412  O  OE1 . GLU D 1 200 ? -17.473 47.447  86.514  1.00 52.91 ? 200  GLU D OE1 1 
ATOM   9413  O  OE2 . GLU D 1 200 ? -19.235 46.893  87.698  1.00 52.00 ? 200  GLU D OE2 1 
ATOM   9414  N  N   . VAL D 1 201 ? -17.381 41.339  86.638  1.00 50.77 ? 201  VAL D N   1 
ATOM   9415  C  CA  . VAL D 1 201 ? -16.964 40.130  85.926  1.00 50.74 ? 201  VAL D CA  1 
ATOM   9416  C  C   . VAL D 1 201 ? -17.693 38.893  86.459  1.00 50.83 ? 201  VAL D C   1 
ATOM   9417  O  O   . VAL D 1 201 ? -18.026 38.815  87.644  1.00 50.66 ? 201  VAL D O   1 
ATOM   9418  C  CB  . VAL D 1 201 ? -15.427 39.916  86.026  1.00 50.82 ? 201  VAL D CB  1 
ATOM   9419  C  CG1 . VAL D 1 201 ? -15.021 38.590  85.390  1.00 50.18 ? 201  VAL D CG1 1 
ATOM   9420  C  CG2 . VAL D 1 201 ? -14.695 41.062  85.342  1.00 50.10 ? 201  VAL D CG2 1 
ATOM   9421  N  N   . LYS D 1 202 ? -17.943 37.938  85.565  1.00 50.66 ? 202  LYS D N   1 
ATOM   9422  C  CA  . LYS D 1 202 ? -18.633 36.696  85.905  1.00 50.17 ? 202  LYS D CA  1 
ATOM   9423  C  C   . LYS D 1 202 ? -17.749 35.748  86.712  1.00 50.15 ? 202  LYS D C   1 
ATOM   9424  O  O   . LYS D 1 202 ? -16.547 35.636  86.465  1.00 50.85 ? 202  LYS D O   1 
ATOM   9425  C  CB  . LYS D 1 202 ? -19.118 36.001  84.629  1.00 49.06 ? 202  LYS D CB  1 
ATOM   9426  C  CG  . LYS D 1 202 ? -20.021 36.867  83.767  1.00 48.31 ? 202  LYS D CG  1 
ATOM   9427  C  CD  . LYS D 1 202 ? -20.404 36.171  82.474  1.00 47.33 ? 202  LYS D CD  1 
ATOM   9428  C  CE  . LYS D 1 202 ? -21.284 37.065  81.614  1.00 46.91 ? 202  LYS D CE  1 
ATOM   9429  N  NZ  . LYS D 1 202 ? -21.678 36.406  80.340  1.00 45.75 ? 202  LYS D NZ  1 
ATOM   9430  N  N   . LYS D 1 203 ? -18.363 35.063  87.672  1.00 49.99 ? 203  LYS D N   1 
ATOM   9431  C  CA  . LYS D 1 203 ? -17.664 34.119  88.539  1.00 50.98 ? 203  LYS D CA  1 
ATOM   9432  C  C   . LYS D 1 203 ? -17.101 32.939  87.749  1.00 51.42 ? 203  LYS D C   1 
ATOM   9433  O  O   . LYS D 1 203 ? -15.947 32.550  87.934  1.00 51.31 ? 203  LYS D O   1 
ATOM   9434  C  CB  . LYS D 1 203 ? -18.618 33.602  89.622  1.00 51.75 ? 203  LYS D CB  1 
ATOM   9435  C  CG  . LYS D 1 203 ? -19.312 34.697  90.424  1.00 50.59 ? 203  LYS D CG  1 
ATOM   9436  C  CD  . LYS D 1 203 ? -20.389 34.135  91.344  1.00 50.45 ? 203  LYS D CD  1 
ATOM   9437  C  CE  . LYS D 1 203 ? -19.807 33.266  92.450  1.00 50.87 ? 203  LYS D CE  1 
ATOM   9438  N  NZ  . LYS D 1 203 ? -18.961 34.046  93.397  1.00 52.59 ? 203  LYS D NZ  1 
ATOM   9439  N  N   . GLU D 1 204 ? -17.926 32.381  86.866  1.00 52.45 ? 204  GLU D N   1 
ATOM   9440  C  CA  . GLU D 1 204 ? -17.543 31.239  86.040  1.00 53.10 ? 204  GLU D CA  1 
ATOM   9441  C  C   . GLU D 1 204 ? -16.545 31.621  84.947  1.00 53.21 ? 204  GLU D C   1 
ATOM   9442  O  O   . GLU D 1 204 ? -15.731 30.798  84.525  1.00 52.75 ? 204  GLU D O   1 
ATOM   9443  C  CB  . GLU D 1 204 ? -18.793 30.610  85.412  1.00 53.64 ? 204  GLU D CB  1 
ATOM   9444  C  CG  . GLU D 1 204 ? -18.551 29.302  84.661  1.00 54.41 ? 204  GLU D CG  1 
ATOM   9445  C  CD  . GLU D 1 204 ? -18.165 28.152  85.575  1.00 54.37 ? 204  GLU D CD  1 
ATOM   9446  O  OE1 . GLU D 1 204 ? -19.067 27.575  86.218  1.00 55.12 ? 204  GLU D OE1 1 
ATOM   9447  O  OE2 . GLU D 1 204 ? -16.963 27.818  85.644  1.00 55.28 ? 204  GLU D OE2 1 
ATOM   9448  N  N   . ASP D 1 205 ? -16.614 32.869  84.493  1.00 54.02 ? 205  ASP D N   1 
ATOM   9449  C  CA  . ASP D 1 205 ? -15.719 33.356  83.448  1.00 55.46 ? 205  ASP D CA  1 
ATOM   9450  C  C   . ASP D 1 205 ? -14.619 34.251  84.022  1.00 56.14 ? 205  ASP D C   1 
ATOM   9451  O  O   . ASP D 1 205 ? -14.282 35.291  83.452  1.00 55.71 ? 205  ASP D O   1 
ATOM   9452  C  CB  . ASP D 1 205 ? -16.520 34.101  82.373  1.00 56.55 ? 205  ASP D CB  1 
ATOM   9453  C  CG  . ASP D 1 205 ? -17.560 33.215  81.702  1.00 57.77 ? 205  ASP D CG  1 
ATOM   9454  O  OD1 . ASP D 1 205 ? -18.678 33.089  82.245  1.00 58.55 ? 205  ASP D OD1 1 
ATOM   9455  O  OD2 . ASP D 1 205 ? -17.260 32.642  80.633  1.00 57.62 ? 205  ASP D OD2 1 
HETATM 9456  N  N   . MSE D 1 206 ? -14.061 33.826  85.153  1.00 57.52 ? 206  MSE D N   1 
HETATM 9457  C  CA  . MSE D 1 206 ? -12.996 34.557  85.833  1.00 58.13 ? 206  MSE D CA  1 
HETATM 9458  C  C   . MSE D 1 206 ? -11.631 34.058  85.361  1.00 57.37 ? 206  MSE D C   1 
HETATM 9459  O  O   . MSE D 1 206 ? -11.317 32.875  85.504  1.00 56.96 ? 206  MSE D O   1 
HETATM 9460  C  CB  . MSE D 1 206 ? -13.122 34.366  87.347  1.00 60.66 ? 206  MSE D CB  1 
HETATM 9461  C  CG  . MSE D 1 206 ? -12.187 35.232  88.174  1.00 64.52 ? 206  MSE D CG  1 
HETATM 9462  SE SE  . MSE D 1 206 ? -12.584 37.111  88.003  1.00 71.04 ? 206  MSE D SE  1 
HETATM 9463  C  CE  . MSE D 1 206 ? -11.195 37.610  86.764  1.00 66.97 ? 206  MSE D CE  1 
ATOM   9464  N  N   . SER D 1 207 ? -10.819 34.963  84.814  1.00 56.99 ? 207  SER D N   1 
ATOM   9465  C  CA  . SER D 1 207 ? -9.491  34.602  84.315  1.00 56.39 ? 207  SER D CA  1 
ATOM   9466  C  C   . SER D 1 207 ? -8.566  35.800  84.099  1.00 56.47 ? 207  SER D C   1 
ATOM   9467  O  O   . SER D 1 207 ? -8.892  36.929  84.467  1.00 56.79 ? 207  SER D O   1 
ATOM   9468  C  CB  . SER D 1 207 ? -9.620  33.822  83.003  1.00 56.39 ? 207  SER D CB  1 
ATOM   9469  O  OG  . SER D 1 207 ? -10.276 34.593  82.010  1.00 55.08 ? 207  SER D OG  1 
HETATM 9470  N  N   . MSE D 1 208 ? -7.408  35.530  83.498  1.00 56.72 ? 208  MSE D N   1 
HETATM 9471  C  CA  . MSE D 1 208 ? -6.401  36.547  83.203  1.00 57.17 ? 208  MSE D CA  1 
HETATM 9472  C  C   . MSE D 1 208 ? -6.866  37.514  82.120  1.00 56.88 ? 208  MSE D C   1 
HETATM 9473  O  O   . MSE D 1 208 ? -6.609  38.716  82.204  1.00 57.14 ? 208  MSE D O   1 
HETATM 9474  C  CB  . MSE D 1 208 ? -5.093  35.880  82.762  1.00 59.88 ? 208  MSE D CB  1 
HETATM 9475  C  CG  . MSE D 1 208 ? -3.980  35.882  83.806  1.00 61.53 ? 208  MSE D CG  1 
HETATM 9476  SE SE  . MSE D 1 208 ? -3.007  37.552  83.893  1.00 65.66 ? 208  MSE D SE  1 
HETATM 9477  C  CE  . MSE D 1 208 ? -3.856  38.319  85.452  1.00 62.33 ? 208  MSE D CE  1 
ATOM   9478  N  N   . GLN D 1 209 ? -7.540  36.982  81.101  1.00 56.60 ? 209  GLN D N   1 
ATOM   9479  C  CA  . GLN D 1 209 ? -8.044  37.796  79.996  1.00 55.91 ? 209  GLN D CA  1 
ATOM   9480  C  C   . GLN D 1 209 ? -9.193  38.698  80.436  1.00 55.12 ? 209  GLN D C   1 
ATOM   9481  O  O   . GLN D 1 209 ? -9.413  39.760  79.854  1.00 54.78 ? 209  GLN D O   1 
ATOM   9482  C  CB  . GLN D 1 209 ? -8.496  36.911  78.828  1.00 55.85 ? 209  GLN D CB  1 
ATOM   9483  C  CG  . GLN D 1 209 ? -9.707  36.037  79.126  1.00 56.31 ? 209  GLN D CG  1 
ATOM   9484  C  CD  . GLN D 1 209 ? -10.211 35.286  77.904  1.00 56.12 ? 209  GLN D CD  1 
ATOM   9485  O  OE1 . GLN D 1 209 ? -9.470  35.057  76.947  1.00 55.63 ? 209  GLN D OE1 1 
ATOM   9486  N  NE2 . GLN D 1 209 ? -11.478 34.886  77.938  1.00 55.76 ? 209  GLN D NE2 1 
ATOM   9487  N  N   . ALA D 1 210 ? -9.923  38.263  81.462  1.00 54.78 ? 210  ALA D N   1 
ATOM   9488  C  CA  . ALA D 1 210 ? -11.048 39.023  81.995  1.00 54.05 ? 210  ALA D CA  1 
ATOM   9489  C  C   . ALA D 1 210 ? -10.561 40.277  82.714  1.00 53.85 ? 210  ALA D C   1 
ATOM   9490  O  O   . ALA D 1 210 ? -11.132 41.356  82.546  1.00 53.91 ? 210  ALA D O   1 
ATOM   9491  C  CB  . ALA D 1 210 ? -11.868 38.154  82.940  1.00 53.69 ? 210  ALA D CB  1 
ATOM   9492  N  N   . ILE D 1 211 ? -9.499  40.127  83.505  1.00 53.65 ? 211  ILE D N   1 
ATOM   9493  C  CA  . ILE D 1 211 ? -8.915  41.239  84.253  1.00 53.52 ? 211  ILE D CA  1 
ATOM   9494  C  C   . ILE D 1 211 ? -8.283  42.253  83.299  1.00 52.93 ? 211  ILE D C   1 
ATOM   9495  O  O   . ILE D 1 211 ? -8.436  43.463  83.477  1.00 52.25 ? 211  ILE D O   1 
ATOM   9496  C  CB  . ILE D 1 211 ? -7.838  40.745  85.253  1.00 54.14 ? 211  ILE D CB  1 
ATOM   9497  C  CG1 . ILE D 1 211 ? -8.446  39.733  86.227  1.00 53.79 ? 211  ILE D CG1 1 
ATOM   9498  C  CG2 . ILE D 1 211 ? -7.252  41.923  86.030  1.00 53.90 ? 211  ILE D CG2 1 
ATOM   9499  C  CD1 . ILE D 1 211 ? -7.450  39.134  87.202  1.00 54.29 ? 211  ILE D CD1 1 
ATOM   9500  N  N   . ARG D 1 212 ? -7.580  41.748  82.289  1.00 53.18 ? 212  ARG D N   1 
ATOM   9501  C  CA  . ARG D 1 212 ? -6.926  42.597  81.298  1.00 52.78 ? 212  ARG D CA  1 
ATOM   9502  C  C   . ARG D 1 212 ? -7.953  43.321  80.431  1.00 50.53 ? 212  ARG D C   1 
ATOM   9503  O  O   . ARG D 1 212 ? -7.769  44.490  80.087  1.00 50.06 ? 212  ARG D O   1 
ATOM   9504  C  CB  . ARG D 1 212 ? -5.978  41.767  80.426  1.00 55.94 ? 212  ARG D CB  1 
ATOM   9505  C  CG  . ARG D 1 212 ? -5.321  42.549  79.294  1.00 60.79 ? 212  ARG D CG  1 
ATOM   9506  C  CD  . ARG D 1 212 ? -4.256  41.730  78.579  1.00 63.69 ? 212  ARG D CD  1 
ATOM   9507  N  NE  . ARG D 1 212 ? -3.052  41.556  79.391  1.00 67.28 ? 212  ARG D NE  1 
ATOM   9508  C  CZ  . ARG D 1 212 ? -2.089  42.468  79.516  1.00 68.13 ? 212  ARG D CZ  1 
ATOM   9509  N  NH1 . ARG D 1 212 ? -2.179  43.631  78.883  1.00 67.80 ? 212  ARG D NH1 1 
ATOM   9510  N  NH2 . ARG D 1 212 ? -1.028  42.212  80.270  1.00 69.18 ? 212  ARG D NH2 1 
ATOM   9511  N  N   . HIS D 1 213 ? -9.034  42.624  80.090  1.00 48.58 ? 213  HIS D N   1 
ATOM   9512  C  CA  . HIS D 1 213 ? -10.102 43.196  79.275  1.00 48.01 ? 213  HIS D CA  1 
ATOM   9513  C  C   . HIS D 1 213 ? -10.852 44.271  80.055  1.00 46.97 ? 213  HIS D C   1 
ATOM   9514  O  O   . HIS D 1 213 ? -11.242 45.295  79.494  1.00 47.40 ? 213  HIS D O   1 
ATOM   9515  C  CB  . HIS D 1 213 ? -11.077 42.103  78.826  1.00 49.76 ? 213  HIS D CB  1 
ATOM   9516  C  CG  . HIS D 1 213 ? -12.232 42.614  78.020  1.00 51.02 ? 213  HIS D CG  1 
ATOM   9517  N  ND1 . HIS D 1 213 ? -12.069 43.320  76.848  1.00 51.87 ? 213  HIS D ND1 1 
ATOM   9518  C  CD2 . HIS D 1 213 ? -13.568 42.523  78.222  1.00 51.56 ? 213  HIS D CD2 1 
ATOM   9519  C  CE1 . HIS D 1 213 ? -13.254 43.643  76.362  1.00 51.94 ? 213  HIS D CE1 1 
ATOM   9520  N  NE2 . HIS D 1 213 ? -14.181 43.171  77.177  1.00 51.74 ? 213  HIS D NE2 1 
ATOM   9521  N  N   . TRP D 1 214 ? -11.047 44.027  81.350  1.00 45.68 ? 214  TRP D N   1 
ATOM   9522  C  CA  . TRP D 1 214 ? -11.744 44.962  82.229  1.00 42.95 ? 214  TRP D CA  1 
ATOM   9523  C  C   . TRP D 1 214 ? -10.985 46.284  82.305  1.00 42.54 ? 214  TRP D C   1 
ATOM   9524  O  O   . TRP D 1 214 ? -11.583 47.358  82.224  1.00 42.74 ? 214  TRP D O   1 
ATOM   9525  C  CB  . TRP D 1 214 ? -11.883 44.362  83.632  1.00 41.76 ? 214  TRP D CB  1 
ATOM   9526  C  CG  . TRP D 1 214 ? -12.733 45.175  84.571  1.00 41.80 ? 214  TRP D CG  1 
ATOM   9527  C  CD1 . TRP D 1 214 ? -14.059 44.994  84.837  1.00 41.22 ? 214  TRP D CD1 1 
ATOM   9528  C  CD2 . TRP D 1 214 ? -12.314 46.292  85.370  1.00 41.18 ? 214  TRP D CD2 1 
ATOM   9529  N  NE1 . TRP D 1 214 ? -14.493 45.926  85.750  1.00 41.09 ? 214  TRP D NE1 1 
ATOM   9530  C  CE2 . TRP D 1 214 ? -13.442 46.735  86.093  1.00 41.15 ? 214  TRP D CE2 1 
ATOM   9531  C  CE3 . TRP D 1 214 ? -11.094 46.961  85.543  1.00 40.67 ? 214  TRP D CE3 1 
ATOM   9532  C  CZ2 . TRP D 1 214 ? -13.389 47.818  86.978  1.00 40.99 ? 214  TRP D CZ2 1 
ATOM   9533  C  CZ3 . TRP D 1 214 ? -11.042 48.039  86.421  1.00 40.29 ? 214  TRP D CZ3 1 
ATOM   9534  C  CH2 . TRP D 1 214 ? -12.184 48.455  87.127  1.00 41.32 ? 214  TRP D CH2 1 
ATOM   9535  N  N   . GLY D 1 215 ? -9.666  46.191  82.461  1.00 42.32 ? 215  GLY D N   1 
ATOM   9536  C  CA  . GLY D 1 215 ? -8.830  47.376  82.549  1.00 42.72 ? 215  GLY D CA  1 
ATOM   9537  C  C   . GLY D 1 215 ? -8.878  48.245  81.308  1.00 43.64 ? 215  GLY D C   1 
ATOM   9538  O  O   . GLY D 1 215 ? -8.723  49.463  81.392  1.00 44.58 ? 215  GLY D O   1 
ATOM   9539  N  N   . GLU D 1 216 ? -9.087  47.616  80.156  1.00 44.72 ? 216  GLU D N   1 
ATOM   9540  C  CA  . GLU D 1 216 ? -9.160  48.330  78.884  1.00 45.77 ? 216  GLU D CA  1 
ATOM   9541  C  C   . GLU D 1 216 ? -10.546 48.939  78.675  1.00 45.37 ? 216  GLU D C   1 
ATOM   9542  O  O   . GLU D 1 216 ? -10.698 49.917  77.942  1.00 44.69 ? 216  GLU D O   1 
ATOM   9543  C  CB  . GLU D 1 216 ? -8.815  47.384  77.731  1.00 46.37 ? 216  GLU D CB  1 
ATOM   9544  C  CG  . GLU D 1 216 ? -7.418  46.781  77.828  1.00 47.68 ? 216  GLU D CG  1 
ATOM   9545  C  CD  . GLU D 1 216 ? -7.156  45.720  76.775  1.00 49.35 ? 216  GLU D CD  1 
ATOM   9546  O  OE1 . GLU D 1 216 ? -7.855  44.682  76.783  1.00 49.96 ? 216  GLU D OE1 1 
ATOM   9547  O  OE2 . GLU D 1 216 ? -6.246  45.918  75.944  1.00 50.70 ? 216  GLU D OE2 1 
ATOM   9548  N  N   . THR D 1 217 ? -11.548 48.360  79.335  1.00 45.85 ? 217  THR D N   1 
ATOM   9549  C  CA  . THR D 1 217 ? -12.931 48.826  79.243  1.00 45.47 ? 217  THR D CA  1 
ATOM   9550  C  C   . THR D 1 217 ? -13.163 50.039  80.143  1.00 44.84 ? 217  THR D C   1 
ATOM   9551  O  O   . THR D 1 217 ? -13.948 50.930  79.812  1.00 45.76 ? 217  THR D O   1 
ATOM   9552  C  CB  . THR D 1 217 ? -13.926 47.709  79.653  1.00 45.74 ? 217  THR D CB  1 
ATOM   9553  O  OG1 . THR D 1 217 ? -13.724 46.558  78.825  1.00 47.04 ? 217  THR D OG1 1 
ATOM   9554  C  CG2 . THR D 1 217 ? -15.367 48.181  79.500  1.00 46.06 ? 217  THR D CG2 1 
ATOM   9555  N  N   . HIS D 1 218 ? -12.474 50.064  81.281  1.00 44.36 ? 218  HIS D N   1 
ATOM   9556  C  CA  . HIS D 1 218 ? -12.605 51.153  82.243  1.00 42.55 ? 218  HIS D CA  1 
ATOM   9557  C  C   . HIS D 1 218 ? -11.439 52.138  82.190  1.00 41.93 ? 218  HIS D C   1 
ATOM   9558  O  O   . HIS D 1 218 ? -10.384 51.836  81.633  1.00 40.77 ? 218  HIS D O   1 
ATOM   9559  C  CB  . HIS D 1 218 ? -12.771 50.582  83.652  1.00 42.60 ? 218  HIS D CB  1 
ATOM   9560  C  CG  . HIS D 1 218 ? -13.986 49.719  83.810  1.00 42.69 ? 218  HIS D CG  1 
ATOM   9561  N  ND1 . HIS D 1 218 ? -14.197 48.585  83.055  1.00 41.08 ? 218  HIS D ND1 1 
ATOM   9562  C  CD2 . HIS D 1 218 ? -15.064 49.836  84.622  1.00 43.07 ? 218  HIS D CD2 1 
ATOM   9563  C  CE1 . HIS D 1 218 ? -15.353 48.042  83.393  1.00 41.26 ? 218  HIS D CE1 1 
ATOM   9564  N  NE2 . HIS D 1 218 ? -15.899 48.781  84.341  1.00 41.48 ? 218  HIS D NE2 1 
ATOM   9565  N  N   . SER D 1 219 ? -11.645 53.318  82.771  1.00 43.34 ? 219  SER D N   1 
ATOM   9566  C  CA  . SER D 1 219 ? -10.634 54.376  82.790  1.00 44.24 ? 219  SER D CA  1 
ATOM   9567  C  C   . SER D 1 219 ? -9.485  54.129  83.764  1.00 44.76 ? 219  SER D C   1 
ATOM   9568  O  O   . SER D 1 219 ? -9.555  53.242  84.614  1.00 44.66 ? 219  SER D O   1 
ATOM   9569  C  CB  . SER D 1 219 ? -11.289 55.725  83.103  1.00 45.05 ? 219  SER D CB  1 
ATOM   9570  O  OG  . SER D 1 219 ? -11.881 55.723  84.391  1.00 45.91 ? 219  SER D OG  1 
ATOM   9571  N  N   . GLU D 1 220 ? -8.441  54.947  83.641  1.00 45.31 ? 220  GLU D N   1 
ATOM   9572  C  CA  . GLU D 1 220 ? -7.253  54.859  84.487  1.00 46.84 ? 220  GLU D CA  1 
ATOM   9573  C  C   . GLU D 1 220 ? -7.591  54.953  85.976  1.00 46.38 ? 220  GLU D C   1 
ATOM   9574  O  O   . GLU D 1 220 ? -7.076  54.180  86.784  1.00 46.19 ? 220  GLU D O   1 
ATOM   9575  C  CB  . GLU D 1 220 ? -6.261  55.963  84.102  1.00 49.15 ? 220  GLU D CB  1 
ATOM   9576  C  CG  . GLU D 1 220 ? -4.982  56.013  84.940  1.00 52.33 ? 220  GLU D CG  1 
ATOM   9577  C  CD  . GLU D 1 220 ? -4.139  54.752  84.829  1.00 53.91 ? 220  GLU D CD  1 
ATOM   9578  O  OE1 . GLU D 1 220 ? -3.985  54.222  83.707  1.00 55.47 ? 220  GLU D OE1 1 
ATOM   9579  O  OE2 . GLU D 1 220 ? -3.622  54.294  85.870  1.00 55.10 ? 220  GLU D OE2 1 
ATOM   9580  N  N   . ALA D 1 221 ? -8.462  55.896  86.326  1.00 46.61 ? 221  ALA D N   1 
ATOM   9581  C  CA  . ALA D 1 221 ? -8.878  56.099  87.710  1.00 45.99 ? 221  ALA D CA  1 
ATOM   9582  C  C   . ALA D 1 221 ? -9.602  54.874  88.255  1.00 46.31 ? 221  ALA D C   1 
ATOM   9583  O  O   . ALA D 1 221 ? -9.423  54.504  89.415  1.00 46.25 ? 221  ALA D O   1 
ATOM   9584  C  CB  . ALA D 1 221 ? -9.770  57.330  87.815  1.00 45.25 ? 221  ALA D CB  1 
ATOM   9585  N  N   . GLU D 1 222 ? -10.417 54.249  87.409  1.00 47.67 ? 222  GLU D N   1 
ATOM   9586  C  CA  . GLU D 1 222 ? -11.172 53.059  87.793  1.00 49.41 ? 222  GLU D CA  1 
ATOM   9587  C  C   . GLU D 1 222 ? -10.271 51.830  87.903  1.00 49.86 ? 222  GLU D C   1 
ATOM   9588  O  O   . GLU D 1 222 ? -10.542 50.923  88.694  1.00 50.19 ? 222  GLU D O   1 
ATOM   9589  C  CB  . GLU D 1 222 ? -12.301 52.795  86.792  1.00 50.23 ? 222  GLU D CB  1 
ATOM   9590  C  CG  . GLU D 1 222 ? -13.358 53.889  86.745  1.00 51.58 ? 222  GLU D CG  1 
ATOM   9591  C  CD  . GLU D 1 222 ? -14.486 53.574  85.782  1.00 52.56 ? 222  GLU D CD  1 
ATOM   9592  O  OE1 . GLU D 1 222 ? -14.368 53.924  84.589  1.00 54.44 ? 222  GLU D OE1 1 
ATOM   9593  O  OE2 . GLU D 1 222 ? -15.492 52.975  86.217  1.00 52.25 ? 222  GLU D OE2 1 
ATOM   9594  N  N   . VAL D 1 223 ? -9.209  51.802  87.101  1.00 49.22 ? 223  VAL D N   1 
ATOM   9595  C  CA  . VAL D 1 223 ? -8.259  50.693  87.116  1.00 48.55 ? 223  VAL D CA  1 
ATOM   9596  C  C   . VAL D 1 223 ? -7.373  50.796  88.355  1.00 46.89 ? 223  VAL D C   1 
ATOM   9597  O  O   . VAL D 1 223 ? -7.202  49.821  89.087  1.00 46.88 ? 223  VAL D O   1 
ATOM   9598  C  CB  . VAL D 1 223 ? -7.365  50.683  85.848  1.00 49.40 ? 223  VAL D CB  1 
ATOM   9599  C  CG1 . VAL D 1 223 ? -6.341  49.556  85.926  1.00 49.28 ? 223  VAL D CG1 1 
ATOM   9600  C  CG2 . VAL D 1 223 ? -8.220  50.521  84.603  1.00 49.35 ? 223  VAL D CG2 1 
ATOM   9601  N  N   . ARG D 1 224 ? -6.830  51.990  88.587  1.00 44.68 ? 224  ARG D N   1 
ATOM   9602  C  CA  . ARG D 1 224 ? -5.964  52.247  89.733  1.00 42.50 ? 224  ARG D CA  1 
ATOM   9603  C  C   . ARG D 1 224 ? -6.676  51.923  91.045  1.00 41.94 ? 224  ARG D C   1 
ATOM   9604  O  O   . ARG D 1 224 ? -6.093  51.306  91.935  1.00 41.83 ? 224  ARG D O   1 
ATOM   9605  C  CB  . ARG D 1 224 ? -5.499  53.706  89.730  1.00 41.89 ? 224  ARG D CB  1 
ATOM   9606  C  CG  . ARG D 1 224 ? -4.615  54.087  90.908  1.00 42.40 ? 224  ARG D CG  1 
ATOM   9607  C  CD  . ARG D 1 224 ? -4.163  55.536  90.821  1.00 42.62 ? 224  ARG D CD  1 
ATOM   9608  N  NE  . ARG D 1 224 ? -3.442  55.959  92.019  1.00 42.73 ? 224  ARG D NE  1 
ATOM   9609  C  CZ  . ARG D 1 224 ? -2.809  57.122  92.145  1.00 41.88 ? 224  ARG D CZ  1 
ATOM   9610  N  NH1 . ARG D 1 224 ? -2.797  57.990  91.143  1.00 42.31 ? 224  ARG D NH1 1 
ATOM   9611  N  NH2 . ARG D 1 224 ? -2.202  57.426  93.285  1.00 41.79 ? 224  ARG D NH2 1 
ATOM   9612  N  N   . GLU D 1 225 ? -7.943  52.319  91.143  1.00 41.02 ? 225  GLU D N   1 
ATOM   9613  C  CA  . GLU D 1 225 ? -8.751  52.073  92.336  1.00 40.18 ? 225  GLU D CA  1 
ATOM   9614  C  C   . GLU D 1 225 ? -8.884  50.573  92.603  1.00 38.73 ? 225  GLU D C   1 
ATOM   9615  O  O   . GLU D 1 225 ? -8.802  50.130  93.750  1.00 37.86 ? 225  GLU D O   1 
ATOM   9616  C  CB  . GLU D 1 225 ? -10.135 52.717  92.171  1.00 42.30 ? 225  GLU D CB  1 
ATOM   9617  C  CG  . GLU D 1 225 ? -11.073 52.594  93.377  1.00 45.54 ? 225  GLU D CG  1 
ATOM   9618  C  CD  . GLU D 1 225 ? -11.808 51.261  93.444  1.00 47.21 ? 225  GLU D CD  1 
ATOM   9619  O  OE1 . GLU D 1 225 ? -12.274 50.776  92.389  1.00 48.36 ? 225  GLU D OE1 1 
ATOM   9620  O  OE2 . GLU D 1 225 ? -11.921 50.701  94.555  1.00 47.32 ? 225  GLU D OE2 1 
ATOM   9621  N  N   . LEU D 1 226 ? -9.087  49.801  91.538  1.00 36.93 ? 226  LEU D N   1 
ATOM   9622  C  CA  . LEU D 1 226 ? -9.226  48.352  91.648  1.00 34.56 ? 226  LEU D CA  1 
ATOM   9623  C  C   . LEU D 1 226 ? -7.915  47.691  92.061  1.00 32.99 ? 226  LEU D C   1 
ATOM   9624  O  O   . LEU D 1 226 ? -7.900  46.819  92.929  1.00 32.38 ? 226  LEU D O   1 
ATOM   9625  C  CB  . LEU D 1 226 ? -9.693  47.756  90.319  1.00 34.54 ? 226  LEU D CB  1 
ATOM   9626  C  CG  . LEU D 1 226 ? -9.809  46.228  90.286  1.00 33.98 ? 226  LEU D CG  1 
ATOM   9627  C  CD1 . LEU D 1 226 ? -10.995 45.773  91.118  1.00 33.49 ? 226  LEU D CD1 1 
ATOM   9628  C  CD2 . LEU D 1 226 ? -9.949  45.750  88.859  1.00 33.38 ? 226  LEU D CD2 1 
ATOM   9629  N  N   . LEU D 1 227 ? -6.821  48.104  91.429  1.00 31.35 ? 227  LEU D N   1 
ATOM   9630  C  CA  . LEU D 1 227 ? -5.506  47.544  91.722  1.00 30.35 ? 227  LEU D CA  1 
ATOM   9631  C  C   . LEU D 1 227 ? -5.042  47.855  93.143  1.00 29.61 ? 227  LEU D C   1 
ATOM   9632  O  O   . LEU D 1 227 ? -4.274  47.093  93.729  1.00 27.91 ? 227  LEU D O   1 
ATOM   9633  C  CB  . LEU D 1 227 ? -4.475  48.030  90.699  1.00 29.73 ? 227  LEU D CB  1 
ATOM   9634  C  CG  . LEU D 1 227 ? -4.770  47.712  89.228  1.00 28.45 ? 227  LEU D CG  1 
ATOM   9635  C  CD1 . LEU D 1 227 ? -3.589  48.120  88.367  1.00 28.76 ? 227  LEU D CD1 1 
ATOM   9636  C  CD2 . LEU D 1 227 ? -5.064  46.230  89.049  1.00 28.26 ? 227  LEU D CD2 1 
ATOM   9637  N  N   . GLU D 1 228 ? -5.535  48.960  93.697  1.00 31.09 ? 228  GLU D N   1 
ATOM   9638  C  CA  . GLU D 1 228 ? -5.186  49.375  95.054  1.00 30.91 ? 228  GLU D CA  1 
ATOM   9639  C  C   . GLU D 1 228 ? -5.853  48.509  96.118  1.00 33.05 ? 228  GLU D C   1 
ATOM   9640  O  O   . GLU D 1 228 ? -5.468  48.553  97.288  1.00 33.85 ? 228  GLU D O   1 
ATOM   9641  C  CB  . GLU D 1 228 ? -5.555  50.842  95.286  1.00 29.37 ? 228  GLU D CB  1 
ATOM   9642  C  CG  . GLU D 1 228 ? -4.681  51.833  94.533  1.00 27.20 ? 228  GLU D CG  1 
ATOM   9643  C  CD  . GLU D 1 228 ? -5.089  53.279  94.758  1.00 25.44 ? 228  GLU D CD  1 
ATOM   9644  O  OE1 . GLU D 1 228 ? -6.292  53.540  94.979  1.00 27.49 ? 228  GLU D OE1 1 
ATOM   9645  O  OE2 . GLU D 1 228 ? -4.205  54.159  94.706  1.00 24.35 ? 228  GLU D OE2 1 
ATOM   9646  N  N   . GLN D 1 229 ? -6.856  47.730  95.711  1.00 34.28 ? 229  GLN D N   1 
ATOM   9647  C  CA  . GLN D 1 229 ? -7.570  46.844  96.631  1.00 34.33 ? 229  GLN D CA  1 
ATOM   9648  C  C   . GLN D 1 229 ? -6.648  45.738  97.144  1.00 33.78 ? 229  GLN D C   1 
ATOM   9649  O  O   . GLN D 1 229 ? -7.001  44.990  98.058  1.00 35.08 ? 229  GLN D O   1 
ATOM   9650  C  CB  . GLN D 1 229 ? -8.808  46.247  95.958  1.00 36.23 ? 229  GLN D CB  1 
ATOM   9651  C  CG  . GLN D 1 229 ? -9.821  47.287  95.487  1.00 38.51 ? 229  GLN D CG  1 
ATOM   9652  C  CD  . GLN D 1 229 ? -10.293 48.203  96.603  1.00 38.75 ? 229  GLN D CD  1 
ATOM   9653  O  OE1 . GLN D 1 229 ? -10.951 47.764  97.547  1.00 40.19 ? 229  GLN D OE1 1 
ATOM   9654  N  NE2 . GLN D 1 229 ? -9.957  49.483  96.499  1.00 39.07 ? 229  GLN D NE2 1 
ATOM   9655  N  N   . ASN D 1 230 ? -5.478  45.632  96.522  1.00 31.32 ? 230  ASN D N   1 
ATOM   9656  C  CA  . ASN D 1 230 ? -4.458  44.669  96.910  1.00 28.35 ? 230  ASN D CA  1 
ATOM   9657  C  C   . ASN D 1 230 ? -3.364  45.504  97.572  1.00 28.11 ? 230  ASN D C   1 
ATOM   9658  O  O   . ASN D 1 230 ? -2.536  46.106  96.889  1.00 28.09 ? 230  ASN D O   1 
ATOM   9659  C  CB  . ASN D 1 230 ? -3.902  43.952  95.676  1.00 27.17 ? 230  ASN D CB  1 
ATOM   9660  C  CG  . ASN D 1 230 ? -2.796  42.970  96.016  1.00 24.36 ? 230  ASN D CG  1 
ATOM   9661  O  OD1 . ASN D 1 230 ? -2.809  42.340  97.072  1.00 25.02 ? 230  ASN D OD1 1 
ATOM   9662  N  ND2 . ASN D 1 230 ? -1.830  42.836  95.116  1.00 23.69 ? 230  ASN D ND2 1 
ATOM   9663  N  N   . PRO D 1 231 ? -3.373  45.580  98.914  1.00 27.70 ? 231  PRO D N   1 
ATOM   9664  C  CA  . PRO D 1 231 ? -2.389  46.349  99.684  1.00 27.83 ? 231  PRO D CA  1 
ATOM   9665  C  C   . PRO D 1 231 ? -0.945  45.858  99.572  1.00 26.62 ? 231  PRO D C   1 
ATOM   9666  O  O   . PRO D 1 231 ? -0.010  46.584  99.916  1.00 26.15 ? 231  PRO D O   1 
ATOM   9667  C  CB  . PRO D 1 231 ? -2.919  46.238  101.114 1.00 28.43 ? 231  PRO D CB  1 
ATOM   9668  C  CG  . PRO D 1 231 ? -3.577  44.898  101.122 1.00 28.21 ? 231  PRO D CG  1 
ATOM   9669  C  CD  . PRO D 1 231 ? -4.326  44.907  99.815  1.00 27.27 ? 231  PRO D CD  1 
ATOM   9670  N  N   . SER D 1 232 ? -0.769  44.634  99.081  1.00 26.70 ? 232  SER D N   1 
ATOM   9671  C  CA  . SER D 1 232 ? 0.558   44.044  98.920  1.00 26.05 ? 232  SER D CA  1 
ATOM   9672  C  C   . SER D 1 232 ? 1.297   44.625  97.711  1.00 24.00 ? 232  SER D C   1 
ATOM   9673  O  O   . SER D 1 232 ? 0.694   44.884  96.669  1.00 24.09 ? 232  SER D O   1 
ATOM   9674  C  CB  . SER D 1 232 ? 0.443   42.525  98.787  1.00 26.58 ? 232  SER D CB  1 
ATOM   9675  O  OG  . SER D 1 232 ? 1.718   41.913  98.816  1.00 29.13 ? 232  SER D OG  1 
ATOM   9676  N  N   . PHE D 1 233 ? 2.605   44.813  97.861  1.00 21.36 ? 233  PHE D N   1 
ATOM   9677  C  CA  . PHE D 1 233 ? 3.445   45.368  96.802  1.00 20.41 ? 233  PHE D CA  1 
ATOM   9678  C  C   . PHE D 1 233 ? 4.797   44.654  96.812  1.00 21.08 ? 233  PHE D C   1 
ATOM   9679  O  O   . PHE D 1 233 ? 5.416   44.493  97.865  1.00 20.05 ? 233  PHE D O   1 
ATOM   9680  C  CB  . PHE D 1 233 ? 3.637   46.872  97.030  1.00 18.02 ? 233  PHE D CB  1 
ATOM   9681  C  CG  . PHE D 1 233 ? 4.188   47.611  95.841  1.00 15.35 ? 233  PHE D CG  1 
ATOM   9682  C  CD1 . PHE D 1 233 ? 3.334   48.134  94.877  1.00 12.50 ? 233  PHE D CD1 1 
ATOM   9683  C  CD2 . PHE D 1 233 ? 5.557   47.814  95.702  1.00 17.05 ? 233  PHE D CD2 1 
ATOM   9684  C  CE1 . PHE D 1 233 ? 3.835   48.853  93.793  1.00 13.88 ? 233  PHE D CE1 1 
ATOM   9685  C  CE2 . PHE D 1 233 ? 6.068   48.532  94.621  1.00 15.54 ? 233  PHE D CE2 1 
ATOM   9686  C  CZ  . PHE D 1 233 ? 5.205   49.052  93.666  1.00 13.86 ? 233  PHE D CZ  1 
ATOM   9687  N  N   . VAL D 1 234 ? 5.247   44.231  95.634  1.00 21.34 ? 234  VAL D N   1 
ATOM   9688  C  CA  . VAL D 1 234 ? 6.516   43.517  95.490  1.00 22.02 ? 234  VAL D CA  1 
ATOM   9689  C  C   . VAL D 1 234 ? 7.667   44.401  95.006  1.00 21.55 ? 234  VAL D C   1 
ATOM   9690  O  O   . VAL D 1 234 ? 7.481   45.287  94.170  1.00 22.13 ? 234  VAL D O   1 
ATOM   9691  C  CB  . VAL D 1 234 ? 6.360   42.296  94.539  1.00 20.23 ? 234  VAL D CB  1 
ATOM   9692  C  CG1 . VAL D 1 234 ? 7.707   41.642  94.270  1.00 22.03 ? 234  VAL D CG1 1 
ATOM   9693  C  CG2 . VAL D 1 234 ? 5.404   41.282  95.145  1.00 20.42 ? 234  VAL D CG2 1 
ATOM   9694  N  N   . PHE D 1 235 ? 8.853   44.149  95.554  1.00 21.45 ? 235  PHE D N   1 
ATOM   9695  C  CA  . PHE D 1 235 ? 10.063  44.884  95.198  1.00 22.26 ? 235  PHE D CA  1 
ATOM   9696  C  C   . PHE D 1 235 ? 10.996  43.944  94.440  1.00 23.10 ? 235  PHE D C   1 
ATOM   9697  O  O   . PHE D 1 235 ? 11.165  42.785  94.822  1.00 25.67 ? 235  PHE D O   1 
ATOM   9698  C  CB  . PHE D 1 235 ? 10.736  45.428  96.458  1.00 17.50 ? 235  PHE D CB  1 
ATOM   9699  C  CG  . PHE D 1 235 ? 9.851   46.331  97.266  1.00 16.87 ? 235  PHE D CG  1 
ATOM   9700  C  CD1 . PHE D 1 235 ? 9.499   47.588  96.787  1.00 17.60 ? 235  PHE D CD1 1 
ATOM   9701  C  CD2 . PHE D 1 235 ? 9.339   45.913  98.488  1.00 16.76 ? 235  PHE D CD2 1 
ATOM   9702  C  CE1 . PHE D 1 235 ? 8.649   48.415  97.513  1.00 17.34 ? 235  PHE D CE1 1 
ATOM   9703  C  CE2 . PHE D 1 235 ? 8.486   46.734  99.223  1.00 16.82 ? 235  PHE D CE2 1 
ATOM   9704  C  CZ  . PHE D 1 235 ? 8.140   47.986  98.734  1.00 15.88 ? 235  PHE D CZ  1 
ATOM   9705  N  N   . PHE D 1 236 ? 11.603  44.448  93.370  1.00 23.24 ? 236  PHE D N   1 
ATOM   9706  C  CA  . PHE D 1 236 ? 12.484  43.637  92.535  1.00 24.46 ? 236  PHE D CA  1 
ATOM   9707  C  C   . PHE D 1 236 ? 13.964  43.994  92.604  1.00 24.99 ? 236  PHE D C   1 
ATOM   9708  O  O   . PHE D 1 236 ? 14.346  45.025  93.158  1.00 25.44 ? 236  PHE D O   1 
ATOM   9709  C  CB  . PHE D 1 236 ? 12.020  43.711  91.078  1.00 25.03 ? 236  PHE D CB  1 
ATOM   9710  C  CG  . PHE D 1 236 ? 10.558  43.424  90.889  1.00 25.01 ? 236  PHE D CG  1 
ATOM   9711  C  CD1 . PHE D 1 236 ? 10.099  42.116  90.795  1.00 25.13 ? 236  PHE D CD1 1 
ATOM   9712  C  CD2 . PHE D 1 236 ? 9.639   44.465  90.811  1.00 26.47 ? 236  PHE D CD2 1 
ATOM   9713  C  CE1 . PHE D 1 236 ? 8.743   41.848  90.626  1.00 26.95 ? 236  PHE D CE1 1 
ATOM   9714  C  CE2 . PHE D 1 236 ? 8.280   44.208  90.643  1.00 28.04 ? 236  PHE D CE2 1 
ATOM   9715  C  CZ  . PHE D 1 236 ? 7.832   42.897  90.550  1.00 26.37 ? 236  PHE D CZ  1 
ATOM   9716  N  N   . LYS D 1 237 ? 14.789  43.118  92.033  1.00 25.85 ? 237  LYS D N   1 
ATOM   9717  C  CA  . LYS D 1 237 ? 16.235  43.308  91.981  1.00 27.11 ? 237  LYS D CA  1 
ATOM   9718  C  C   . LYS D 1 237 ? 16.748  42.904  90.600  1.00 27.98 ? 237  LYS D C   1 
ATOM   9719  O  O   . LYS D 1 237 ? 16.680  41.735  90.220  1.00 28.15 ? 237  LYS D O   1 
ATOM   9720  C  CB  . LYS D 1 237 ? 16.945  42.478  93.056  1.00 26.17 ? 237  LYS D CB  1 
ATOM   9721  C  CG  . LYS D 1 237 ? 18.456  42.679  93.065  1.00 26.70 ? 237  LYS D CG  1 
ATOM   9722  C  CD  . LYS D 1 237 ? 19.153  41.837  94.119  1.00 28.17 ? 237  LYS D CD  1 
ATOM   9723  C  CE  . LYS D 1 237 ? 20.655  42.084  94.091  1.00 28.57 ? 237  LYS D CE  1 
ATOM   9724  N  NZ  . LYS D 1 237 ? 21.386  41.268  95.097  1.00 31.30 ? 237  LYS D NZ  1 
ATOM   9725  N  N   . PRO D 1 238 ? 17.262  43.876  89.830  1.00 29.73 ? 238  PRO D N   1 
ATOM   9726  C  CA  . PRO D 1 238 ? 17.798  43.664  88.480  1.00 30.82 ? 238  PRO D CA  1 
ATOM   9727  C  C   . PRO D 1 238 ? 18.949  42.664  88.455  1.00 31.46 ? 238  PRO D C   1 
ATOM   9728  O  O   . PRO D 1 238 ? 19.891  42.769  89.243  1.00 33.21 ? 238  PRO D O   1 
ATOM   9729  C  CB  . PRO D 1 238 ? 18.271  45.061  88.082  1.00 31.96 ? 238  PRO D CB  1 
ATOM   9730  C  CG  . PRO D 1 238 ? 17.349  45.957  88.837  1.00 31.33 ? 238  PRO D CG  1 
ATOM   9731  C  CD  . PRO D 1 238 ? 17.312  45.303  90.187  1.00 30.08 ? 238  PRO D CD  1 
ATOM   9732  N  N   . GLN D 1 239 ? 18.860  41.697  87.548  1.00 32.30 ? 239  GLN D N   1 
ATOM   9733  C  CA  . GLN D 1 239 ? 19.883  40.666  87.411  1.00 33.45 ? 239  GLN D CA  1 
ATOM   9734  C  C   . GLN D 1 239 ? 20.673  40.788  86.113  1.00 34.48 ? 239  GLN D C   1 
ATOM   9735  O  O   . GLN D 1 239 ? 21.719  40.154  85.957  1.00 34.24 ? 239  GLN D O   1 
ATOM   9736  C  CB  . GLN D 1 239 ? 19.257  39.274  87.511  1.00 33.56 ? 239  GLN D CB  1 
ATOM   9737  C  CG  . GLN D 1 239 ? 18.604  38.975  88.854  1.00 32.53 ? 239  GLN D CG  1 
ATOM   9738  C  CD  . GLN D 1 239 ? 19.570  39.079  90.022  1.00 31.50 ? 239  GLN D CD  1 
ATOM   9739  O  OE1 . GLN D 1 239 ? 20.774  38.855  89.876  1.00 30.76 ? 239  GLN D OE1 1 
ATOM   9740  N  NE2 . GLN D 1 239 ? 19.042  39.417  91.193  1.00 31.26 ? 239  GLN D NE2 1 
ATOM   9741  N  N   . SER D 1 240 ? 20.143  41.571  85.174  1.00 35.32 ? 240  SER D N   1 
ATOM   9742  C  CA  . SER D 1 240 ? 20.785  41.815  83.884  1.00 36.18 ? 240  SER D CA  1 
ATOM   9743  C  C   . SER D 1 240 ? 20.939  40.574  83.000  1.00 36.42 ? 240  SER D C   1 
ATOM   9744  O  O   . SER D 1 240 ? 21.993  39.937  82.979  1.00 39.92 ? 240  SER D O   1 
ATOM   9745  C  CB  . SER D 1 240 ? 22.140  42.502  84.105  1.00 36.41 ? 240  SER D CB  1 
ATOM   9746  O  OG  . SER D 1 240 ? 22.804  42.759  82.883  1.00 39.53 ? 240  SER D OG  1 
ATOM   9747  N  N   . PHE D 1 241 ? 19.880  40.258  82.260  1.00 35.48 ? 241  PHE D N   1 
ATOM   9748  C  CA  . PHE D 1 241 ? 19.834  39.112  81.349  1.00 33.89 ? 241  PHE D CA  1 
ATOM   9749  C  C   . PHE D 1 241 ? 20.300  37.793  81.964  1.00 31.04 ? 241  PHE D C   1 
ATOM   9750  O  O   . PHE D 1 241 ? 21.248  37.160  81.493  1.00 29.18 ? 241  PHE D O   1 
ATOM   9751  C  CB  . PHE D 1 241 ? 20.599  39.410  80.054  1.00 36.14 ? 241  PHE D CB  1 
ATOM   9752  C  CG  . PHE D 1 241 ? 20.241  38.491  78.917  1.00 39.09 ? 241  PHE D CG  1 
ATOM   9753  C  CD1 . PHE D 1 241 ? 18.914  38.337  78.523  1.00 41.59 ? 241  PHE D CD1 1 
ATOM   9754  C  CD2 . PHE D 1 241 ? 21.224  37.772  78.247  1.00 40.48 ? 241  PHE D CD2 1 
ATOM   9755  C  CE1 . PHE D 1 241 ? 18.572  37.480  77.480  1.00 43.13 ? 241  PHE D CE1 1 
ATOM   9756  C  CE2 . PHE D 1 241 ? 20.893  36.912  77.201  1.00 41.92 ? 241  PHE D CE2 1 
ATOM   9757  C  CZ  . PHE D 1 241 ? 19.565  36.766  76.818  1.00 42.59 ? 241  PHE D CZ  1 
ATOM   9758  N  N   . ALA D 1 242 ? 19.616  37.395  83.029  1.00 29.45 ? 242  ALA D N   1 
ATOM   9759  C  CA  . ALA D 1 242 ? 19.904  36.157  83.735  1.00 27.28 ? 242  ALA D CA  1 
ATOM   9760  C  C   . ALA D 1 242 ? 18.684  35.259  83.575  1.00 28.04 ? 242  ALA D C   1 
ATOM   9761  O  O   . ALA D 1 242 ? 17.569  35.752  83.394  1.00 28.44 ? 242  ALA D O   1 
ATOM   9762  C  CB  . ALA D 1 242 ? 20.160  36.445  85.210  1.00 26.27 ? 242  ALA D CB  1 
ATOM   9763  N  N   . PRO D 1 243 ? 18.877  33.930  83.612  1.00 28.39 ? 243  PRO D N   1 
ATOM   9764  C  CA  . PRO D 1 243 ? 17.747  33.007  83.467  1.00 28.57 ? 243  PRO D CA  1 
ATOM   9765  C  C   . PRO D 1 243 ? 16.743  33.167  84.610  1.00 28.76 ? 243  PRO D C   1 
ATOM   9766  O  O   . PRO D 1 243 ? 17.107  33.581  85.713  1.00 29.36 ? 243  PRO D O   1 
ATOM   9767  C  CB  . PRO D 1 243 ? 18.426  31.635  83.488  1.00 28.40 ? 243  PRO D CB  1 
ATOM   9768  C  CG  . PRO D 1 243 ? 19.642  31.867  84.330  1.00 28.41 ? 243  PRO D CG  1 
ATOM   9769  C  CD  . PRO D 1 243 ? 20.135  33.188  83.805  1.00 28.86 ? 243  PRO D CD  1 
ATOM   9770  N  N   . VAL D 1 244 ? 15.477  32.877  84.324  1.00 27.08 ? 244  VAL D N   1 
ATOM   9771  C  CA  . VAL D 1 244 ? 14.418  32.989  85.321  1.00 23.95 ? 244  VAL D CA  1 
ATOM   9772  C  C   . VAL D 1 244 ? 14.655  32.012  86.466  1.00 23.39 ? 244  VAL D C   1 
ATOM   9773  O  O   . VAL D 1 244 ? 14.583  30.798  86.283  1.00 25.99 ? 244  VAL D O   1 
ATOM   9774  C  CB  . VAL D 1 244 ? 13.032  32.722  84.702  1.00 23.54 ? 244  VAL D CB  1 
ATOM   9775  C  CG1 . VAL D 1 244 ? 11.943  32.866  85.757  1.00 23.00 ? 244  VAL D CG1 1 
ATOM   9776  C  CG2 . VAL D 1 244 ? 12.784  33.679  83.553  1.00 23.38 ? 244  VAL D CG2 1 
ATOM   9777  N  N   . LYS D 1 245 ? 14.959  32.554  87.640  1.00 21.17 ? 245  LYS D N   1 
ATOM   9778  C  CA  . LYS D 1 245 ? 15.213  31.741  88.821  1.00 18.67 ? 245  LYS D CA  1 
ATOM   9779  C  C   . LYS D 1 245 ? 14.147  31.959  89.887  1.00 18.34 ? 245  LYS D C   1 
ATOM   9780  O  O   . LYS D 1 245 ? 13.625  33.064  90.041  1.00 19.51 ? 245  LYS D O   1 
ATOM   9781  C  CB  . LYS D 1 245 ? 16.601  32.051  89.386  1.00 16.54 ? 245  LYS D CB  1 
ATOM   9782  C  CG  . LYS D 1 245 ? 17.733  31.735  88.425  1.00 13.07 ? 245  LYS D CG  1 
ATOM   9783  C  CD  . LYS D 1 245 ? 19.088  32.006  89.044  1.00 12.88 ? 245  LYS D CD  1 
ATOM   9784  C  CE  . LYS D 1 245 ? 20.200  31.618  88.087  1.00 15.23 ? 245  LYS D CE  1 
ATOM   9785  N  NZ  . LYS D 1 245 ? 21.548  31.796  88.685  1.00 20.16 ? 245  LYS D NZ  1 
ATOM   9786  N  N   . GLY D 1 246 ? 13.809  30.889  90.599  1.00 17.41 ? 246  GLY D N   1 
ATOM   9787  C  CA  . GLY D 1 246 ? 12.809  30.977  91.647  1.00 18.49 ? 246  GLY D CA  1 
ATOM   9788  C  C   . GLY D 1 246 ? 13.440  31.052  93.022  1.00 19.40 ? 246  GLY D C   1 
ATOM   9789  O  O   . GLY D 1 246 ? 14.520  31.619  93.187  1.00 21.03 ? 246  GLY D O   1 
ATOM   9790  N  N   . ALA D 1 247 ? 12.772  30.463  94.008  1.00 20.46 ? 247  ALA D N   1 
ATOM   9791  C  CA  . ALA D 1 247 ? 13.265  30.461  95.381  1.00 21.85 ? 247  ALA D CA  1 
ATOM   9792  C  C   . ALA D 1 247 ? 14.519  29.606  95.548  1.00 23.15 ? 247  ALA D C   1 
ATOM   9793  O  O   . ALA D 1 247 ? 15.394  29.930  96.352  1.00 23.63 ? 247  ALA D O   1 
ATOM   9794  C  CB  . ALA D 1 247 ? 12.176  29.982  96.324  1.00 22.38 ? 247  ALA D CB  1 
ATOM   9795  N  N   . SER D 1 248 ? 14.603  28.523  94.780  1.00 24.91 ? 248  SER D N   1 
ATOM   9796  C  CA  . SER D 1 248 ? 15.743  27.609  94.842  1.00 25.40 ? 248  SER D CA  1 
ATOM   9797  C  C   . SER D 1 248 ? 16.980  28.118  94.102  1.00 25.80 ? 248  SER D C   1 
ATOM   9798  O  O   . SER D 1 248 ? 18.023  27.461  94.106  1.00 25.49 ? 248  SER D O   1 
ATOM   9799  C  CB  . SER D 1 248 ? 15.347  26.230  94.306  1.00 26.89 ? 248  SER D CB  1 
ATOM   9800  O  OG  . SER D 1 248 ? 14.325  25.646  95.096  1.00 26.13 ? 248  SER D OG  1 
ATOM   9801  N  N   . ALA D 1 249 ? 16.854  29.285  93.471  1.00 25.52 ? 249  ALA D N   1 
ATOM   9802  C  CA  . ALA D 1 249 ? 17.946  29.910  92.722  1.00 25.37 ? 249  ALA D CA  1 
ATOM   9803  C  C   . ALA D 1 249 ? 18.419  29.059  91.543  1.00 24.77 ? 249  ALA D C   1 
ATOM   9804  O  O   . ALA D 1 249 ? 19.588  29.106  91.151  1.00 24.37 ? 249  ALA D O   1 
ATOM   9805  C  CB  . ALA D 1 249 ? 19.115  30.237  93.654  1.00 26.76 ? 249  ALA D CB  1 
ATOM   9806  N  N   . VAL D 1 250 ? 17.494  28.286  90.983  1.00 24.86 ? 250  VAL D N   1 
ATOM   9807  C  CA  . VAL D 1 250 ? 17.779  27.418  89.846  1.00 23.22 ? 250  VAL D CA  1 
ATOM   9808  C  C   . VAL D 1 250 ? 16.915  27.864  88.668  1.00 22.00 ? 250  VAL D C   1 
ATOM   9809  O  O   . VAL D 1 250 ? 15.712  28.083  88.823  1.00 21.66 ? 250  VAL D O   1 
ATOM   9810  C  CB  . VAL D 1 250 ? 17.459  25.933  90.178  1.00 21.66 ? 250  VAL D CB  1 
ATOM   9811  C  CG1 . VAL D 1 250 ? 17.734  25.043  88.976  1.00 20.78 ? 250  VAL D CG1 1 
ATOM   9812  C  CG2 . VAL D 1 250 ? 18.277  25.468  91.369  1.00 20.33 ? 250  VAL D CG2 1 
ATOM   9813  N  N   . PRO D 1 251 ? 17.527  28.051  87.485  1.00 21.72 ? 251  PRO D N   1 
ATOM   9814  C  CA  . PRO D 1 251 ? 16.789  28.473  86.290  1.00 22.87 ? 251  PRO D CA  1 
ATOM   9815  C  C   . PRO D 1 251 ? 15.625  27.540  85.962  1.00 22.88 ? 251  PRO D C   1 
ATOM   9816  O  O   . PRO D 1 251 ? 15.807  26.341  85.736  1.00 22.26 ? 251  PRO D O   1 
ATOM   9817  C  CB  . PRO D 1 251 ? 17.867  28.481  85.198  1.00 21.49 ? 251  PRO D CB  1 
ATOM   9818  C  CG  . PRO D 1 251 ? 18.958  27.608  85.748  1.00 22.05 ? 251  PRO D CG  1 
ATOM   9819  C  CD  . PRO D 1 251 ? 18.965  27.954  87.197  1.00 21.28 ? 251  PRO D CD  1 
ATOM   9820  N  N   . LEU D 1 252 ? 14.426  28.113  85.982  1.00 23.30 ? 252  LEU D N   1 
ATOM   9821  C  CA  . LEU D 1 252 ? 13.184  27.395  85.720  1.00 22.86 ? 252  LEU D CA  1 
ATOM   9822  C  C   . LEU D 1 252 ? 12.945  27.128  84.237  1.00 22.83 ? 252  LEU D C   1 
ATOM   9823  O  O   . LEU D 1 252 ? 13.126  28.013  83.400  1.00 23.00 ? 252  LEU D O   1 
ATOM   9824  C  CB  . LEU D 1 252 ? 12.004  28.192  86.287  1.00 21.43 ? 252  LEU D CB  1 
ATOM   9825  C  CG  . LEU D 1 252 ? 12.046  28.571  87.770  1.00 19.32 ? 252  LEU D CG  1 
ATOM   9826  C  CD1 . LEU D 1 252 ? 10.982  29.609  88.074  1.00 17.12 ? 252  LEU D CD1 1 
ATOM   9827  C  CD2 . LEU D 1 252 ? 11.862  27.334  88.636  1.00 21.22 ? 252  LEU D CD2 1 
ATOM   9828  N  N   . VAL D 1 253 ? 12.537  25.900  83.926  1.00 24.42 ? 253  VAL D N   1 
ATOM   9829  C  CA  . VAL D 1 253 ? 12.246  25.502  82.551  1.00 24.22 ? 253  VAL D CA  1 
ATOM   9830  C  C   . VAL D 1 253 ? 10.731  25.426  82.359  1.00 23.91 ? 253  VAL D C   1 
ATOM   9831  O  O   . VAL D 1 253 ? 10.006  24.969  83.245  1.00 25.21 ? 253  VAL D O   1 
ATOM   9832  C  CB  . VAL D 1 253 ? 12.898  24.143  82.204  1.00 23.91 ? 253  VAL D CB  1 
ATOM   9833  C  CG1 . VAL D 1 253 ? 12.561  23.735  80.774  1.00 24.91 ? 253  VAL D CG1 1 
ATOM   9834  C  CG2 . VAL D 1 253 ? 14.405  24.230  82.376  1.00 24.73 ? 253  VAL D CG2 1 
ATOM   9835  N  N   . GLY D 1 254 ? 10.267  25.891  81.202  1.00 23.61 ? 254  GLY D N   1 
ATOM   9836  C  CA  . GLY D 1 254 ? 8.847   25.895  80.894  1.00 25.47 ? 254  GLY D CA  1 
ATOM   9837  C  C   . GLY D 1 254 ? 8.133   24.561  81.009  1.00 27.21 ? 254  GLY D C   1 
ATOM   9838  O  O   . GLY D 1 254 ? 8.417   23.625  80.260  1.00 28.66 ? 254  GLY D O   1 
ATOM   9839  N  N   . ARG D 1 255 ? 7.198   24.491  81.955  1.00 27.61 ? 255  ARG D N   1 
ATOM   9840  C  CA  . ARG D 1 255 ? 6.388   23.300  82.218  1.00 27.45 ? 255  ARG D CA  1 
ATOM   9841  C  C   . ARG D 1 255 ? 7.167   22.059  82.647  1.00 27.76 ? 255  ARG D C   1 
ATOM   9842  O  O   . ARG D 1 255 ? 6.674   20.935  82.543  1.00 29.06 ? 255  ARG D O   1 
ATOM   9843  C  CB  . ARG D 1 255 ? 5.486   22.989  81.022  1.00 27.88 ? 255  ARG D CB  1 
ATOM   9844  C  CG  . ARG D 1 255 ? 4.328   23.961  80.863  1.00 26.24 ? 255  ARG D CG  1 
ATOM   9845  C  CD  . ARG D 1 255 ? 3.608   23.754  79.547  1.00 26.34 ? 255  ARG D CD  1 
ATOM   9846  N  NE  . ARG D 1 255 ? 4.443   24.128  78.409  1.00 27.61 ? 255  ARG D NE  1 
ATOM   9847  C  CZ  . ARG D 1 255 ? 4.081   23.998  77.137  1.00 30.63 ? 255  ARG D CZ  1 
ATOM   9848  N  NH1 . ARG D 1 255 ? 2.891   23.497  76.828  1.00 30.96 ? 255  ARG D NH1 1 
ATOM   9849  N  NH2 . ARG D 1 255 ? 4.904   24.382  76.171  1.00 30.96 ? 255  ARG D NH2 1 
ATOM   9850  N  N   . ALA D 1 256 ? 8.382   22.276  83.140  1.00 27.24 ? 256  ALA D N   1 
ATOM   9851  C  CA  . ALA D 1 256 ? 9.234   21.193  83.614  1.00 25.98 ? 256  ALA D CA  1 
ATOM   9852  C  C   . ALA D 1 256 ? 9.596   21.468  85.071  1.00 25.80 ? 256  ALA D C   1 
ATOM   9853  O  O   . ALA D 1 256 ? 10.410  20.763  85.668  1.00 27.66 ? 256  ALA D O   1 
ATOM   9854  C  CB  . ALA D 1 256 ? 10.488  21.094  82.757  1.00 24.73 ? 256  ALA D CB  1 
ATOM   9855  N  N   . SER D 1 257 ? 8.959   22.489  85.636  1.00 25.69 ? 257  SER D N   1 
ATOM   9856  C  CA  . SER D 1 257 ? 9.177   22.893  87.019  1.00 26.51 ? 257  SER D CA  1 
ATOM   9857  C  C   . SER D 1 257 ? 7.894   23.485  87.598  1.00 28.35 ? 257  SER D C   1 
ATOM   9858  O  O   . SER D 1 257 ? 7.057   24.016  86.862  1.00 28.02 ? 257  SER D O   1 
ATOM   9859  C  CB  . SER D 1 257 ? 10.314  23.918  87.099  1.00 26.72 ? 257  SER D CB  1 
ATOM   9860  O  OG  . SER D 1 257 ? 10.076  25.020  86.240  1.00 26.86 ? 257  SER D OG  1 
ATOM   9861  N  N   . VAL D 1 258 ? 7.737   23.375  88.915  1.00 29.21 ? 258  VAL D N   1 
ATOM   9862  C  CA  . VAL D 1 258 ? 6.555   23.894  89.602  1.00 29.17 ? 258  VAL D CA  1 
ATOM   9863  C  C   . VAL D 1 258 ? 6.899   24.520  90.946  1.00 29.41 ? 258  VAL D C   1 
ATOM   9864  O  O   . VAL D 1 258 ? 7.973   24.283  91.501  1.00 32.31 ? 258  VAL D O   1 
ATOM   9865  C  CB  . VAL D 1 258 ? 5.501   22.782  89.866  1.00 28.94 ? 258  VAL D CB  1 
ATOM   9866  C  CG1 . VAL D 1 258 ? 4.961   22.231  88.562  1.00 29.88 ? 258  VAL D CG1 1 
ATOM   9867  C  CG2 . VAL D 1 258 ? 6.100   21.665  90.708  1.00 27.75 ? 258  VAL D CG2 1 
ATOM   9868  N  N   . ALA D 1 259 ? 5.983   25.338  91.452  1.00 28.73 ? 259  ALA D N   1 
ATOM   9869  C  CA  . ALA D 1 259 ? 6.150   25.978  92.749  1.00 28.00 ? 259  ALA D CA  1 
ATOM   9870  C  C   . ALA D 1 259 ? 5.384   25.111  93.741  1.00 28.77 ? 259  ALA D C   1 
ATOM   9871  O  O   . ALA D 1 259 ? 4.297   24.621  93.429  1.00 28.72 ? 259  ALA D O   1 
ATOM   9872  C  CB  . ALA D 1 259 ? 5.587   27.381  92.724  1.00 26.96 ? 259  ALA D CB  1 
ATOM   9873  N  N   . SER D 1 260 ? 5.943   24.919  94.931  1.00 29.60 ? 260  SER D N   1 
ATOM   9874  C  CA  . SER D 1 260 ? 5.296   24.078  95.930  1.00 30.71 ? 260  SER D CA  1 
ATOM   9875  C  C   . SER D 1 260 ? 5.489   24.545  97.365  1.00 32.11 ? 260  SER D C   1 
ATOM   9876  O  O   . SER D 1 260 ? 6.180   25.530  97.632  1.00 30.21 ? 260  SER D O   1 
ATOM   9877  C  CB  . SER D 1 260 ? 5.815   22.645  95.804  1.00 29.28 ? 260  SER D CB  1 
ATOM   9878  O  OG  . SER D 1 260 ? 7.210   22.590  96.048  1.00 27.28 ? 260  SER D OG  1 
ATOM   9879  N  N   . ASP D 1 261 ? 4.843   23.831  98.281  1.00 34.71 ? 261  ASP D N   1 
ATOM   9880  C  CA  . ASP D 1 261 ? 4.943   24.113  99.704  1.00 37.67 ? 261  ASP D CA  1 
ATOM   9881  C  C   . ASP D 1 261 ? 6.162   23.332  100.184 1.00 39.17 ? 261  ASP D C   1 
ATOM   9882  O  O   . ASP D 1 261 ? 6.126   22.104  100.265 1.00 39.02 ? 261  ASP D O   1 
ATOM   9883  C  CB  . ASP D 1 261 ? 3.678   23.634  100.428 1.00 38.01 ? 261  ASP D CB  1 
ATOM   9884  C  CG  . ASP D 1 261 ? 3.636   24.052  101.894 1.00 38.39 ? 261  ASP D CG  1 
ATOM   9885  O  OD1 . ASP D 1 261 ? 4.446   24.909  102.314 1.00 39.48 ? 261  ASP D OD1 1 
ATOM   9886  O  OD2 . ASP D 1 261 ? 2.778   23.523  102.630 1.00 36.78 ? 261  ASP D OD2 1 
ATOM   9887  N  N   . ARG D 1 262 ? 7.243   24.051  100.472 1.00 41.85 ? 262  ARG D N   1 
ATOM   9888  C  CA  . ARG D 1 262 ? 8.495   23.442  100.917 1.00 44.94 ? 262  ARG D CA  1 
ATOM   9889  C  C   . ARG D 1 262 ? 8.380   22.552  102.156 1.00 45.35 ? 262  ARG D C   1 
ATOM   9890  O  O   . ARG D 1 262 ? 9.221   21.675  102.373 1.00 45.07 ? 262  ARG D O   1 
ATOM   9891  C  CB  . ARG D 1 262 ? 9.562   24.518  101.138 1.00 48.68 ? 262  ARG D CB  1 
ATOM   9892  C  CG  . ARG D 1 262 ? 9.243   25.516  102.244 1.00 54.10 ? 262  ARG D CG  1 
ATOM   9893  C  CD  . ARG D 1 262 ? 10.378  26.514  102.423 1.00 59.52 ? 262  ARG D CD  1 
ATOM   9894  N  NE  . ARG D 1 262 ? 11.651  25.847  102.689 1.00 64.30 ? 262  ARG D NE  1 
ATOM   9895  C  CZ  . ARG D 1 262 ? 12.820  26.472  102.809 1.00 66.84 ? 262  ARG D CZ  1 
ATOM   9896  N  NH1 . ARG D 1 262 ? 12.892  27.793  102.691 1.00 67.64 ? 262  ARG D NH1 1 
ATOM   9897  N  NH2 . ARG D 1 262 ? 13.924  25.772  103.038 1.00 67.84 ? 262  ARG D NH2 1 
ATOM   9898  N  N   . SER D 1 263 ? 7.348   22.778  102.965 1.00 45.62 ? 263  SER D N   1 
ATOM   9899  C  CA  . SER D 1 263 ? 7.139   21.982  104.171 1.00 47.00 ? 263  SER D CA  1 
ATOM   9900  C  C   . SER D 1 263 ? 6.634   20.580  103.827 1.00 47.92 ? 263  SER D C   1 
ATOM   9901  O  O   . SER D 1 263 ? 6.994   19.604  104.487 1.00 49.48 ? 263  SER D O   1 
ATOM   9902  C  CB  . SER D 1 263 ? 6.164   22.683  105.123 1.00 46.70 ? 263  SER D CB  1 
ATOM   9903  O  OG  . SER D 1 263 ? 4.893   22.870  104.527 1.00 48.12 ? 263  SER D OG  1 
ATOM   9904  N  N   . ILE D 1 264 ? 5.806   20.490  102.788 1.00 47.83 ? 264  ILE D N   1 
ATOM   9905  C  CA  . ILE D 1 264 ? 5.253   19.212  102.346 1.00 46.78 ? 264  ILE D CA  1 
ATOM   9906  C  C   . ILE D 1 264 ? 6.111   18.631  101.221 1.00 45.19 ? 264  ILE D C   1 
ATOM   9907  O  O   . ILE D 1 264 ? 6.634   17.521  101.343 1.00 45.66 ? 264  ILE D O   1 
ATOM   9908  C  CB  . ILE D 1 264 ? 3.786   19.364  101.868 1.00 47.41 ? 264  ILE D CB  1 
ATOM   9909  C  CG1 . ILE D 1 264 ? 2.939   20.040  102.956 1.00 48.21 ? 264  ILE D CG1 1 
ATOM   9910  C  CG2 . ILE D 1 264 ? 3.196   18.002  101.519 1.00 47.09 ? 264  ILE D CG2 1 
ATOM   9911  C  CD1 . ILE D 1 264 ? 2.925   19.309  104.293 1.00 45.26 ? 264  ILE D CD1 1 
ATOM   9912  N  N   . ILE D 1 265 ? 6.250   19.385  100.131 1.00 42.63 ? 265  ILE D N   1 
ATOM   9913  C  CA  . ILE D 1 265 ? 7.059   18.962  98.987  1.00 39.51 ? 265  ILE D CA  1 
ATOM   9914  C  C   . ILE D 1 265 ? 8.300   19.854  98.896  1.00 37.77 ? 265  ILE D C   1 
ATOM   9915  O  O   . ILE D 1 265 ? 8.240   20.966  98.365  1.00 36.72 ? 265  ILE D O   1 
ATOM   9916  C  CB  . ILE D 1 265 ? 6.283   19.058  97.642  1.00 39.29 ? 265  ILE D CB  1 
ATOM   9917  C  CG1 . ILE D 1 265 ? 4.937   18.333  97.729  1.00 38.30 ? 265  ILE D CG1 1 
ATOM   9918  C  CG2 . ILE D 1 265 ? 7.111   18.463  96.511  1.00 38.00 ? 265  ILE D CG2 1 
ATOM   9919  C  CD1 . ILE D 1 265 ? 3.794   19.219  98.181  1.00 38.28 ? 265  ILE D CD1 1 
ATOM   9920  N  N   . PRO D 1 266 ? 9.441   19.378  99.423  1.00 36.30 ? 266  PRO D N   1 
ATOM   9921  C  CA  . PRO D 1 266 ? 10.706  20.123  99.409  1.00 36.51 ? 266  PRO D CA  1 
ATOM   9922  C  C   . PRO D 1 266 ? 11.281  20.323  98.005  1.00 36.66 ? 266  PRO D C   1 
ATOM   9923  O  O   . PRO D 1 266 ? 10.936  19.595  97.072  1.00 37.32 ? 266  PRO D O   1 
ATOM   9924  C  CB  . PRO D 1 266 ? 11.618  19.251  100.275 1.00 35.92 ? 266  PRO D CB  1 
ATOM   9925  C  CG  . PRO D 1 266 ? 11.101  17.875  100.029 1.00 35.59 ? 266  PRO D CG  1 
ATOM   9926  C  CD  . PRO D 1 266 ? 9.611   18.078  100.097 1.00 35.89 ? 266  PRO D CD  1 
ATOM   9927  N  N   . PRO D 1 267 ? 12.147  21.339  97.833  1.00 35.80 ? 267  PRO D N   1 
ATOM   9928  C  CA  . PRO D 1 267 ? 12.766  21.629  96.534  1.00 34.79 ? 267  PRO D CA  1 
ATOM   9929  C  C   . PRO D 1 267 ? 13.678  20.501  96.049  1.00 33.68 ? 267  PRO D C   1 
ATOM   9930  O  O   . PRO D 1 267 ? 14.403  19.892  96.837  1.00 33.89 ? 267  PRO D O   1 
ATOM   9931  C  CB  . PRO D 1 267 ? 13.547  22.916  96.810  1.00 34.19 ? 267  PRO D CB  1 
ATOM   9932  C  CG  . PRO D 1 267 ? 13.875  22.814  98.271  1.00 35.06 ? 267  PRO D CG  1 
ATOM   9933  C  CD  . PRO D 1 267 ? 12.577  22.320  98.846  1.00 34.34 ? 267  PRO D CD  1 
ATOM   9934  N  N   . GLY D 1 268 ? 13.624  20.228  94.749  1.00 32.19 ? 268  GLY D N   1 
ATOM   9935  C  CA  . GLY D 1 268 ? 14.433  19.172  94.166  1.00 31.09 ? 268  GLY D CA  1 
ATOM   9936  C  C   . GLY D 1 268 ? 13.662  17.873  94.005  1.00 30.65 ? 268  GLY D C   1 
ATOM   9937  O  O   . GLY D 1 268 ? 14.190  16.890  93.482  1.00 30.14 ? 268  GLY D O   1 
ATOM   9938  N  N   . THR D 1 269 ? 12.407  17.875  94.446  1.00 30.65 ? 269  THR D N   1 
ATOM   9939  C  CA  . THR D 1 269 ? 11.545  16.699  94.363  1.00 30.39 ? 269  THR D CA  1 
ATOM   9940  C  C   . THR D 1 269 ? 11.028  16.459  92.945  1.00 30.16 ? 269  THR D C   1 
ATOM   9941  O  O   . THR D 1 269 ? 10.416  17.341  92.339  1.00 28.68 ? 269  THR D O   1 
ATOM   9942  C  CB  . THR D 1 269 ? 10.338  16.821  95.326  1.00 28.66 ? 269  THR D CB  1 
ATOM   9943  O  OG1 . THR D 1 269 ? 10.808  16.910  96.676  1.00 29.08 ? 269  THR D OG1 1 
ATOM   9944  C  CG2 . THR D 1 269 ? 9.423   15.615  95.202  1.00 27.17 ? 269  THR D CG2 1 
ATOM   9945  N  N   . THR D 1 270 ? 11.292  15.261  92.426  1.00 29.93 ? 270  THR D N   1 
ATOM   9946  C  CA  . THR D 1 270 ? 10.851  14.874  91.090  1.00 28.87 ? 270  THR D CA  1 
ATOM   9947  C  C   . THR D 1 270 ? 9.366   14.524  91.152  1.00 30.38 ? 270  THR D C   1 
ATOM   9948  O  O   . THR D 1 270 ? 8.941   13.723  91.987  1.00 29.94 ? 270  THR D O   1 
ATOM   9949  C  CB  . THR D 1 270 ? 11.646  13.661  90.567  1.00 26.71 ? 270  THR D CB  1 
ATOM   9950  O  OG1 . THR D 1 270 ? 13.047  13.955  90.607  1.00 24.66 ? 270  THR D OG1 1 
ATOM   9951  C  CG2 . THR D 1 270 ? 11.252  13.340  89.134  1.00 27.09 ? 270  THR D CG2 1 
ATOM   9952  N  N   . LEU D 1 271 ? 8.586   15.127  90.260  1.00 31.65 ? 271  LEU D N   1 
ATOM   9953  C  CA  . LEU D 1 271 ? 7.145   14.910  90.226  1.00 31.89 ? 271  LEU D CA  1 
ATOM   9954  C  C   . LEU D 1 271 ? 6.611   14.589  88.836  1.00 33.15 ? 271  LEU D C   1 
ATOM   9955  O  O   . LEU D 1 271 ? 6.787   15.368  87.900  1.00 34.58 ? 271  LEU D O   1 
ATOM   9956  C  CB  . LEU D 1 271 ? 6.420   16.160  90.735  1.00 30.40 ? 271  LEU D CB  1 
ATOM   9957  C  CG  . LEU D 1 271 ? 6.761   16.725  92.114  1.00 28.28 ? 271  LEU D CG  1 
ATOM   9958  C  CD1 . LEU D 1 271 ? 6.199   18.129  92.241  1.00 25.09 ? 271  LEU D CD1 1 
ATOM   9959  C  CD2 . LEU D 1 271 ? 6.216   15.820  93.202  1.00 28.76 ? 271  LEU D CD2 1 
ATOM   9960  N  N   . ILE D 1 272 ? 5.974   13.430  88.704  1.00 34.01 ? 272  ILE D N   1 
ATOM   9961  C  CA  . ILE D 1 272 ? 5.364   13.042  87.439  1.00 34.61 ? 272  ILE D CA  1 
ATOM   9962  C  C   . ILE D 1 272 ? 3.873   13.284  87.655  1.00 34.39 ? 272  ILE D C   1 
ATOM   9963  O  O   . ILE D 1 272 ? 3.291   12.782  88.618  1.00 33.35 ? 272  ILE D O   1 
ATOM   9964  C  CB  . ILE D 1 272 ? 5.647   11.559  87.074  1.00 35.79 ? 272  ILE D CB  1 
ATOM   9965  C  CG1 . ILE D 1 272 ? 4.967   11.209  85.747  1.00 35.86 ? 272  ILE D CG1 1 
ATOM   9966  C  CG2 . ILE D 1 272 ? 5.201   10.625  88.189  1.00 36.55 ? 272  ILE D CG2 1 
ATOM   9967  C  CD1 . ILE D 1 272 ? 5.225   9.801   85.273  1.00 37.07 ? 272  ILE D CD1 1 
ATOM   9968  N  N   . ALA D 1 273 ? 3.263   14.088  86.792  1.00 35.44 ? 273  ALA D N   1 
ATOM   9969  C  CA  . ALA D 1 273 ? 1.852   14.400  86.960  1.00 37.49 ? 273  ALA D CA  1 
ATOM   9970  C  C   . ALA D 1 273 ? 1.010   14.433  85.696  1.00 40.17 ? 273  ALA D C   1 
ATOM   9971  O  O   . ALA D 1 273 ? 1.513   14.639  84.590  1.00 39.82 ? 273  ALA D O   1 
ATOM   9972  C  CB  . ALA D 1 273 ? 1.707   15.718  87.706  1.00 37.34 ? 273  ALA D CB  1 
ATOM   9973  N  N   . GLU D 1 274 ? -0.288  14.217  85.890  1.00 42.94 ? 274  GLU D N   1 
ATOM   9974  C  CA  . GLU D 1 274 ? -1.268  14.240  84.816  1.00 46.49 ? 274  GLU D CA  1 
ATOM   9975  C  C   . GLU D 1 274 ? -1.887  15.632  84.801  1.00 47.13 ? 274  GLU D C   1 
ATOM   9976  O  O   . GLU D 1 274 ? -2.896  15.884  85.461  1.00 47.62 ? 274  GLU D O   1 
ATOM   9977  C  CB  . GLU D 1 274 ? -2.348  13.182  85.059  1.00 49.54 ? 274  GLU D CB  1 
ATOM   9978  C  CG  . GLU D 1 274 ? -1.953  11.771  84.654  1.00 55.39 ? 274  GLU D CG  1 
ATOM   9979  C  CD  . GLU D 1 274 ? -2.076  11.537  83.159  1.00 59.29 ? 274  GLU D CD  1 
ATOM   9980  O  OE1 . GLU D 1 274 ? -1.083  11.753  82.432  1.00 62.15 ? 274  GLU D OE1 1 
ATOM   9981  O  OE2 . GLU D 1 274 ? -3.171  11.136  82.710  1.00 62.46 ? 274  GLU D OE2 1 
ATOM   9982  N  N   . VAL D 1 275 ? -1.236  16.543  84.084  1.00 48.86 ? 275  VAL D N   1 
ATOM   9983  C  CA  . VAL D 1 275 ? -1.695  17.923  83.970  1.00 50.28 ? 275  VAL D CA  1 
ATOM   9984  C  C   . VAL D 1 275 ? -2.886  18.019  83.015  1.00 51.70 ? 275  VAL D C   1 
ATOM   9985  O  O   . VAL D 1 275 ? -2.768  17.712  81.827  1.00 52.97 ? 275  VAL D O   1 
ATOM   9986  C  CB  . VAL D 1 275 ? -0.558  18.845  83.471  1.00 49.68 ? 275  VAL D CB  1 
ATOM   9987  C  CG1 . VAL D 1 275 ? -1.042  20.281  83.368  1.00 50.78 ? 275  VAL D CG1 1 
ATOM   9988  C  CG2 . VAL D 1 275 ? 0.637   18.757  84.408  1.00 49.58 ? 275  VAL D CG2 1 
ATOM   9989  N  N   . PRO D 1 276 ? -4.052  18.446  83.530  1.00 53.03 ? 276  PRO D N   1 
ATOM   9990  C  CA  . PRO D 1 276 ? -5.279  18.588  82.737  1.00 53.45 ? 276  PRO D CA  1 
ATOM   9991  C  C   . PRO D 1 276 ? -5.148  19.609  81.607  1.00 53.75 ? 276  PRO D C   1 
ATOM   9992  O  O   . PRO D 1 276 ? -4.719  20.743  81.824  1.00 54.69 ? 276  PRO D O   1 
ATOM   9993  C  CB  . PRO D 1 276 ? -6.309  19.025  83.782  1.00 53.31 ? 276  PRO D CB  1 
ATOM   9994  C  CG  . PRO D 1 276 ? -5.479  19.763  84.792  1.00 53.78 ? 276  PRO D CG  1 
ATOM   9995  C  CD  . PRO D 1 276 ? -4.282  18.863  84.926  1.00 53.05 ? 276  PRO D CD  1 
ATOM   9996  N  N   . LEU D 1 277 ? -5.505  19.189  80.397  1.00 54.11 ? 277  LEU D N   1 
ATOM   9997  C  CA  . LEU D 1 277 ? -5.429  20.060  79.229  1.00 54.71 ? 277  LEU D CA  1 
ATOM   9998  C  C   . LEU D 1 277 ? -6.648  20.961  79.087  1.00 55.21 ? 277  LEU D C   1 
ATOM   9999  O  O   . LEU D 1 277 ? -7.738  20.632  79.556  1.00 55.63 ? 277  LEU D O   1 
ATOM   10000 C  CB  . LEU D 1 277 ? -5.257  19.232  77.956  1.00 54.34 ? 277  LEU D CB  1 
ATOM   10001 C  CG  . LEU D 1 277 ? -3.939  18.476  77.795  1.00 53.96 ? 277  LEU D CG  1 
ATOM   10002 C  CD1 . LEU D 1 277 ? -4.021  17.597  76.565  1.00 54.22 ? 277  LEU D CD1 1 
ATOM   10003 C  CD2 . LEU D 1 277 ? -2.777  19.453  77.689  1.00 53.80 ? 277  LEU D CD2 1 
ATOM   10004 N  N   . LEU D 1 278 ? -6.448  22.095  78.424  1.00 56.08 ? 278  LEU D N   1 
ATOM   10005 C  CA  . LEU D 1 278 ? -7.510  23.067  78.193  1.00 56.55 ? 278  LEU D CA  1 
ATOM   10006 C  C   . LEU D 1 278 ? -7.233  23.898  76.942  1.00 57.63 ? 278  LEU D C   1 
ATOM   10007 O  O   . LEU D 1 278 ? -6.080  24.216  76.636  1.00 57.96 ? 278  LEU D O   1 
ATOM   10008 C  CB  . LEU D 1 278 ? -7.705  23.961  79.431  1.00 55.01 ? 278  LEU D CB  1 
ATOM   10009 C  CG  . LEU D 1 278 ? -6.499  24.500  80.211  1.00 53.64 ? 278  LEU D CG  1 
ATOM   10010 C  CD1 . LEU D 1 278 ? -5.846  25.669  79.484  1.00 54.26 ? 278  LEU D CD1 1 
ATOM   10011 C  CD2 . LEU D 1 278 ? -6.960  24.939  81.590  1.00 52.25 ? 278  LEU D CD2 1 
ATOM   10012 N  N   . ASP D 1 279 ? -8.294  24.215  76.206  1.00 58.58 ? 279  ASP D N   1 
ATOM   10013 C  CA  . ASP D 1 279 ? -8.188  24.997  74.976  1.00 59.43 ? 279  ASP D CA  1 
ATOM   10014 C  C   . ASP D 1 279 ? -7.829  26.465  75.212  1.00 59.80 ? 279  ASP D C   1 
ATOM   10015 O  O   . ASP D 1 279 ? -7.499  26.864  76.330  1.00 59.91 ? 279  ASP D O   1 
ATOM   10016 C  CB  . ASP D 1 279 ? -9.487  24.888  74.165  1.00 60.47 ? 279  ASP D CB  1 
ATOM   10017 C  CG  . ASP D 1 279 ? -10.731 25.101  75.013  1.00 60.78 ? 279  ASP D CG  1 
ATOM   10018 O  OD1 . ASP D 1 279 ? -11.061 26.267  75.314  1.00 60.04 ? 279  ASP D OD1 1 
ATOM   10019 O  OD2 . ASP D 1 279 ? -11.381 24.097  75.374  1.00 61.56 ? 279  ASP D OD2 1 
ATOM   10020 N  N   . ASN D 1 280 ? -7.897  27.260  74.146  1.00 60.18 ? 280  ASN D N   1 
ATOM   10021 C  CA  . ASN D 1 280 ? -7.579  28.686  74.207  1.00 60.51 ? 280  ASN D CA  1 
ATOM   10022 C  C   . ASN D 1 280 ? -8.500  29.463  75.144  1.00 60.05 ? 280  ASN D C   1 
ATOM   10023 O  O   . ASN D 1 280 ? -8.121  30.513  75.666  1.00 60.45 ? 280  ASN D O   1 
ATOM   10024 C  CB  . ASN D 1 280 ? -7.627  29.296  72.805  1.00 61.75 ? 280  ASN D CB  1 
ATOM   10025 C  CG  . ASN D 1 280 ? -6.629  28.657  71.860  1.00 63.83 ? 280  ASN D CG  1 
ATOM   10026 O  OD1 . ASN D 1 280 ? -6.882  27.589  71.300  1.00 65.25 ? 280  ASN D OD1 1 
ATOM   10027 N  ND2 . ASN D 1 280 ? -5.481  29.303  71.686  1.00 64.09 ? 280  ASN D ND2 1 
ATOM   10028 N  N   . ASN D 1 281 ? -9.710  28.947  75.346  1.00 59.02 ? 281  ASN D N   1 
ATOM   10029 C  CA  . ASN D 1 281 ? -10.684 29.582  76.228  1.00 58.47 ? 281  ASN D CA  1 
ATOM   10030 C  C   . ASN D 1 281 ? -10.592 29.025  77.648  1.00 58.33 ? 281  ASN D C   1 
ATOM   10031 O  O   . ASN D 1 281 ? -11.429 29.331  78.502  1.00 58.33 ? 281  ASN D O   1 
ATOM   10032 C  CB  . ASN D 1 281 ? -12.100 29.401  75.677  1.00 58.48 ? 281  ASN D CB  1 
ATOM   10033 C  CG  . ASN D 1 281 ? -12.277 30.031  74.312  1.00 58.54 ? 281  ASN D CG  1 
ATOM   10034 O  OD1 . ASN D 1 281 ? -12.007 31.218  74.124  1.00 58.50 ? 281  ASN D OD1 1 
ATOM   10035 N  ND2 . ASN D 1 281 ? -12.725 29.236  73.347  1.00 59.06 ? 281  ASN D ND2 1 
ATOM   10036 N  N   . GLY D 1 282 ? -9.575  28.200  77.886  1.00 57.10 ? 282  GLY D N   1 
ATOM   10037 C  CA  . GLY D 1 282 ? -9.360  27.613  79.197  1.00 56.42 ? 282  GLY D CA  1 
ATOM   10038 C  C   . GLY D 1 282 ? -10.398 26.613  79.660  1.00 56.75 ? 282  GLY D C   1 
ATOM   10039 O  O   . GLY D 1 282 ? -10.462 26.288  80.846  1.00 56.73 ? 282  GLY D O   1 
ATOM   10040 N  N   . LYS D 1 283 ? -11.213 26.129  78.729  1.00 57.54 ? 283  LYS D N   1 
ATOM   10041 C  CA  . LYS D 1 283 ? -12.248 25.154  79.048  1.00 58.21 ? 283  LYS D CA  1 
ATOM   10042 C  C   . LYS D 1 283 ? -11.647 23.752  79.080  1.00 59.63 ? 283  LYS D C   1 
ATOM   10043 O  O   . LYS D 1 283 ? -10.895 23.370  78.180  1.00 60.32 ? 283  LYS D O   1 
ATOM   10044 C  CB  . LYS D 1 283 ? -13.377 25.219  78.013  1.00 56.85 ? 283  LYS D CB  1 
ATOM   10045 C  CG  . LYS D 1 283 ? -14.505 24.230  78.259  1.00 55.74 ? 283  LYS D CG  1 
ATOM   10046 C  CD  . LYS D 1 283 ? -15.571 24.324  77.184  1.00 53.93 ? 283  LYS D CD  1 
ATOM   10047 C  CE  . LYS D 1 283 ? -16.674 23.309  77.425  1.00 53.89 ? 283  LYS D CE  1 
ATOM   10048 N  NZ  . LYS D 1 283 ? -17.744 23.396  76.393  1.00 54.30 ? 283  LYS D NZ  1 
ATOM   10049 N  N   . PHE D 1 284 ? -11.969 22.998  80.127  1.00 60.48 ? 284  PHE D N   1 
ATOM   10050 C  CA  . PHE D 1 284 ? -11.466 21.637  80.276  1.00 61.36 ? 284  PHE D CA  1 
ATOM   10051 C  C   . PHE D 1 284 ? -12.111 20.712  79.248  1.00 62.04 ? 284  PHE D C   1 
ATOM   10052 O  O   . PHE D 1 284 ? -13.294 20.380  79.348  1.00 62.69 ? 284  PHE D O   1 
ATOM   10053 C  CB  . PHE D 1 284 ? -11.728 21.119  81.695  1.00 60.99 ? 284  PHE D CB  1 
ATOM   10054 C  CG  . PHE D 1 284 ? -11.186 19.739  81.947  1.00 60.85 ? 284  PHE D CG  1 
ATOM   10055 C  CD1 . PHE D 1 284 ? -9.835  19.462  81.763  1.00 60.85 ? 284  PHE D CD1 1 
ATOM   10056 C  CD2 . PHE D 1 284 ? -12.030 18.713  82.361  1.00 61.30 ? 284  PHE D CD2 1 
ATOM   10057 C  CE1 . PHE D 1 284 ? -9.330  18.183  81.987  1.00 61.62 ? 284  PHE D CE1 1 
ATOM   10058 C  CE2 . PHE D 1 284 ? -11.536 17.430  82.588  1.00 61.72 ? 284  PHE D CE2 1 
ATOM   10059 C  CZ  . PHE D 1 284 ? -10.182 17.165  82.400  1.00 61.79 ? 284  PHE D CZ  1 
ATOM   10060 N  N   . ASN D 1 285 ? -11.323 20.314  78.253  1.00 62.55 ? 285  ASN D N   1 
ATOM   10061 C  CA  . ASN D 1 285 ? -11.794 19.428  77.192  1.00 62.60 ? 285  ASN D CA  1 
ATOM   10062 C  C   . ASN D 1 285 ? -12.054 17.994  77.663  1.00 61.70 ? 285  ASN D C   1 
ATOM   10063 O  O   . ASN D 1 285 ? -12.944 17.320  77.142  1.00 61.50 ? 285  ASN D O   1 
ATOM   10064 C  CB  . ASN D 1 285 ? -10.819 19.444  76.002  1.00 63.21 ? 285  ASN D CB  1 
ATOM   10065 C  CG  . ASN D 1 285 ? -9.358  19.369  76.429  1.00 63.09 ? 285  ASN D CG  1 
ATOM   10066 O  OD1 . ASN D 1 285 ? -9.022  18.782  77.459  1.00 62.44 ? 285  ASN D OD1 1 
ATOM   10067 N  ND2 . ASN D 1 285 ? -8.482  19.969  75.630  1.00 62.29 ? 285  ASN D ND2 1 
ATOM   10068 N  N   . GLY D 1 286 ? -11.281 17.537  78.647  1.00 60.72 ? 286  GLY D N   1 
ATOM   10069 C  CA  . GLY D 1 286 ? -11.461 16.191  79.167  1.00 59.44 ? 286  GLY D CA  1 
ATOM   10070 C  C   . GLY D 1 286 ? -10.212 15.327  79.193  1.00 58.40 ? 286  GLY D C   1 
ATOM   10071 O  O   . GLY D 1 286 ? -10.173 14.311  79.890  1.00 58.08 ? 286  GLY D O   1 
ATOM   10072 N  N   . GLN D 1 287 ? -9.193  15.722  78.435  1.00 57.39 ? 287  GLN D N   1 
ATOM   10073 C  CA  . GLN D 1 287 ? -7.944  14.970  78.368  1.00 56.40 ? 287  GLN D CA  1 
ATOM   10074 C  C   . GLN D 1 287 ? -6.848  15.541  79.269  1.00 55.35 ? 287  GLN D C   1 
ATOM   10075 O  O   . GLN D 1 287 ? -6.933  16.683  79.725  1.00 54.92 ? 287  GLN D O   1 
ATOM   10076 C  CB  . GLN D 1 287 ? -7.463  14.878  76.916  1.00 57.63 ? 287  GLN D CB  1 
ATOM   10077 C  CG  . GLN D 1 287 ? -7.443  16.208  76.176  1.00 59.36 ? 287  GLN D CG  1 
ATOM   10078 C  CD  . GLN D 1 287 ? -7.306  16.044  74.674  1.00 60.02 ? 287  GLN D CD  1 
ATOM   10079 O  OE1 . GLN D 1 287 ? -6.219  16.195  74.117  1.00 58.99 ? 287  GLN D OE1 1 
ATOM   10080 N  NE2 . GLN D 1 287 ? -8.416  15.740  74.009  1.00 60.11 ? 287  GLN D NE2 1 
ATOM   10081 N  N   . TYR D 1 288 ? -5.834  14.723  79.539  1.00 54.22 ? 288  TYR D N   1 
ATOM   10082 C  CA  . TYR D 1 288 ? -4.714  15.120  80.388  1.00 52.46 ? 288  TYR D CA  1 
ATOM   10083 C  C   . TYR D 1 288 ? -3.389  15.119  79.630  1.00 51.02 ? 288  TYR D C   1 
ATOM   10084 O  O   . TYR D 1 288 ? -3.354  14.905  78.417  1.00 51.69 ? 288  TYR D O   1 
ATOM   10085 C  CB  . TYR D 1 288 ? -4.619  14.198  81.608  1.00 53.37 ? 288  TYR D CB  1 
ATOM   10086 C  CG  . TYR D 1 288 ? -5.805  14.299  82.537  1.00 54.76 ? 288  TYR D CG  1 
ATOM   10087 C  CD1 . TYR D 1 288 ? -7.009  13.667  82.231  1.00 55.98 ? 288  TYR D CD1 1 
ATOM   10088 C  CD2 . TYR D 1 288 ? -5.732  15.047  83.709  1.00 55.83 ? 288  TYR D CD2 1 
ATOM   10089 C  CE1 . TYR D 1 288 ? -8.115  13.782  83.069  1.00 57.84 ? 288  TYR D CE1 1 
ATOM   10090 C  CE2 . TYR D 1 288 ? -6.831  15.168  84.556  1.00 57.34 ? 288  TYR D CE2 1 
ATOM   10091 C  CZ  . TYR D 1 288 ? -8.019  14.535  84.229  1.00 58.08 ? 288  TYR D CZ  1 
ATOM   10092 O  OH  . TYR D 1 288 ? -9.111  14.663  85.057  1.00 58.45 ? 288  TYR D OH  1 
ATOM   10093 N  N   . GLU D 1 289 ? -2.300  15.346  80.360  1.00 49.01 ? 289  GLU D N   1 
ATOM   10094 C  CA  . GLU D 1 289 ? -0.965  15.387  79.774  1.00 46.89 ? 289  GLU D CA  1 
ATOM   10095 C  C   . GLU D 1 289 ? 0.061   14.904  80.792  1.00 45.71 ? 289  GLU D C   1 
ATOM   10096 O  O   . GLU D 1 289 ? 0.103   15.393  81.920  1.00 46.15 ? 289  GLU D O   1 
ATOM   10097 C  CB  . GLU D 1 289 ? -0.643  16.818  79.334  1.00 45.60 ? 289  GLU D CB  1 
ATOM   10098 C  CG  . GLU D 1 289 ? 0.659   16.977  78.577  1.00 45.03 ? 289  GLU D CG  1 
ATOM   10099 C  CD  . GLU D 1 289 ? 0.848   18.386  78.051  1.00 46.38 ? 289  GLU D CD  1 
ATOM   10100 O  OE1 . GLU D 1 289 ? 0.854   19.332  78.868  1.00 47.27 ? 289  GLU D OE1 1 
ATOM   10101 O  OE2 . GLU D 1 289 ? 0.982   18.548  76.818  1.00 46.65 ? 289  GLU D OE2 1 
ATOM   10102 N  N   . LEU D 1 290 ? 0.880   13.936  80.393  1.00 44.72 ? 290  LEU D N   1 
ATOM   10103 C  CA  . LEU D 1 290 ? 1.899   13.387  81.281  1.00 43.61 ? 290  LEU D CA  1 
ATOM   10104 C  C   . LEU D 1 290 ? 3.188   14.205  81.233  1.00 42.17 ? 290  LEU D C   1 
ATOM   10105 O  O   . LEU D 1 290 ? 3.843   14.291  80.192  1.00 42.06 ? 290  LEU D O   1 
ATOM   10106 C  CB  . LEU D 1 290 ? 2.184   11.927  80.922  1.00 44.41 ? 290  LEU D CB  1 
ATOM   10107 C  CG  . LEU D 1 290 ? 2.970   11.120  81.959  1.00 45.05 ? 290  LEU D CG  1 
ATOM   10108 C  CD1 . LEU D 1 290 ? 2.220   11.105  83.284  1.00 45.61 ? 290  LEU D CD1 1 
ATOM   10109 C  CD2 . LEU D 1 290 ? 3.184   9.704   81.451  1.00 45.98 ? 290  LEU D CD2 1 
ATOM   10110 N  N   . ARG D 1 291 ? 3.546   14.797  82.370  1.00 39.80 ? 291  ARG D N   1 
ATOM   10111 C  CA  . ARG D 1 291 ? 4.748   15.617  82.468  1.00 37.86 ? 291  ARG D CA  1 
ATOM   10112 C  C   . ARG D 1 291 ? 5.602   15.335  83.699  1.00 36.76 ? 291  ARG D C   1 
ATOM   10113 O  O   . ARG D 1 291 ? 5.089   15.028  84.775  1.00 35.75 ? 291  ARG D O   1 
ATOM   10114 C  CB  . ARG D 1 291 ? 4.389   17.107  82.457  1.00 36.68 ? 291  ARG D CB  1 
ATOM   10115 C  CG  . ARG D 1 291 ? 4.024   17.662  81.097  1.00 37.41 ? 291  ARG D CG  1 
ATOM   10116 C  CD  . ARG D 1 291 ? 3.868   19.176  81.142  1.00 35.57 ? 291  ARG D CD  1 
ATOM   10117 N  NE  . ARG D 1 291 ? 3.614   19.734  79.816  1.00 33.57 ? 291  ARG D NE  1 
ATOM   10118 C  CZ  . ARG D 1 291 ? 4.561   20.065  78.943  1.00 32.49 ? 291  ARG D CZ  1 
ATOM   10119 N  NH1 . ARG D 1 291 ? 5.840   19.903  79.249  1.00 32.52 ? 291  ARG D NH1 1 
ATOM   10120 N  NH2 . ARG D 1 291 ? 4.226   20.547  77.754  1.00 33.77 ? 291  ARG D NH2 1 
ATOM   10121 N  N   . LEU D 1 292 ? 6.915   15.437  83.514  1.00 36.21 ? 292  LEU D N   1 
ATOM   10122 C  CA  . LEU D 1 292 ? 7.881   15.247  84.587  1.00 34.52 ? 292  LEU D CA  1 
ATOM   10123 C  C   . LEU D 1 292 ? 8.349   16.641  84.978  1.00 34.36 ? 292  LEU D C   1 
ATOM   10124 O  O   . LEU D 1 292 ? 8.846   17.395  84.139  1.00 35.05 ? 292  LEU D O   1 
ATOM   10125 C  CB  . LEU D 1 292 ? 9.068   14.410  84.109  1.00 34.38 ? 292  LEU D CB  1 
ATOM   10126 C  CG  . LEU D 1 292 ? 8.921   12.889  84.145  1.00 35.07 ? 292  LEU D CG  1 
ATOM   10127 C  CD1 . LEU D 1 292 ? 10.106  12.244  83.454  1.00 35.23 ? 292  LEU D CD1 1 
ATOM   10128 C  CD2 . LEU D 1 292 ? 8.825   12.413  85.586  1.00 34.58 ? 292  LEU D CD2 1 
HETATM 10129 N  N   . MSE D 1 293 ? 8.165   16.989  86.247  1.00 32.48 ? 293  MSE D N   1 
HETATM 10130 C  CA  . MSE D 1 293 ? 8.545   18.306  86.736  1.00 31.77 ? 293  MSE D CA  1 
HETATM 10131 C  C   . MSE D 1 293 ? 9.293   18.232  88.061  1.00 30.41 ? 293  MSE D C   1 
HETATM 10132 O  O   . MSE D 1 293 ? 9.254   17.214  88.749  1.00 31.53 ? 293  MSE D O   1 
HETATM 10133 C  CB  . MSE D 1 293 ? 7.292   19.176  86.877  1.00 33.39 ? 293  MSE D CB  1 
HETATM 10134 C  CG  . MSE D 1 293 ? 6.504   19.302  85.579  1.00 34.89 ? 293  MSE D CG  1 
HETATM 10135 SE SE  . MSE D 1 293 ? 4.793   20.142  85.767  1.00 39.88 ? 293  MSE D SE  1 
HETATM 10136 C  CE  . MSE D 1 293 ? 3.832   18.670  86.554  1.00 36.82 ? 293  MSE D CE  1 
ATOM   10137 N  N   . VAL D 1 294 ? 9.997   19.309  88.399  1.00 29.11 ? 294  VAL D N   1 
ATOM   10138 C  CA  . VAL D 1 294 ? 10.760  19.376  89.642  1.00 26.32 ? 294  VAL D CA  1 
ATOM   10139 C  C   . VAL D 1 294 ? 10.375  20.623  90.438  1.00 25.50 ? 294  VAL D C   1 
ATOM   10140 O  O   . VAL D 1 294 ? 10.236  21.710  89.873  1.00 24.54 ? 294  VAL D O   1 
ATOM   10141 C  CB  . VAL D 1 294 ? 12.288  19.405  89.371  1.00 25.45 ? 294  VAL D CB  1 
ATOM   10142 C  CG1 . VAL D 1 294 ? 13.059  19.381  90.679  1.00 24.98 ? 294  VAL D CG1 1 
ATOM   10143 C  CG2 . VAL D 1 294 ? 12.698  18.230  88.503  1.00 23.13 ? 294  VAL D CG2 1 
ATOM   10144 N  N   . ALA D 1 295 ? 10.186  20.451  91.744  1.00 23.53 ? 295  ALA D N   1 
ATOM   10145 C  CA  . ALA D 1 295 ? 9.830   21.556  92.630  1.00 23.30 ? 295  ALA D CA  1 
ATOM   10146 C  C   . ALA D 1 295 ? 11.061  22.430  92.851  1.00 22.98 ? 295  ALA D C   1 
ATOM   10147 O  O   . ALA D 1 295 ? 12.018  22.007  93.498  1.00 22.24 ? 295  ALA D O   1 
ATOM   10148 C  CB  . ALA D 1 295 ? 9.318   21.017  93.957  1.00 24.51 ? 295  ALA D CB  1 
ATOM   10149 N  N   . LEU D 1 296 ? 11.036  23.646  92.310  1.00 23.39 ? 296  LEU D N   1 
ATOM   10150 C  CA  . LEU D 1 296 ? 12.169  24.560  92.437  1.00 24.78 ? 296  LEU D CA  1 
ATOM   10151 C  C   . LEU D 1 296 ? 11.785  25.999  92.769  1.00 24.60 ? 296  LEU D C   1 
ATOM   10152 O  O   . LEU D 1 296 ? 12.572  26.922  92.549  1.00 24.44 ? 296  LEU D O   1 
ATOM   10153 C  CB  . LEU D 1 296 ? 12.999  24.544  91.150  1.00 23.81 ? 296  LEU D CB  1 
ATOM   10154 C  CG  . LEU D 1 296 ? 13.713  23.243  90.782  1.00 23.78 ? 296  LEU D CG  1 
ATOM   10155 C  CD1 . LEU D 1 296 ? 14.308  23.372  89.398  1.00 23.11 ? 296  LEU D CD1 1 
ATOM   10156 C  CD2 . LEU D 1 296 ? 14.790  22.921  91.806  1.00 21.80 ? 296  LEU D CD2 1 
ATOM   10157 N  N   . ASP D 1 297 ? 10.590  26.190  93.317  1.00 24.98 ? 297  ASP D N   1 
ATOM   10158 C  CA  . ASP D 1 297 ? 10.124  27.527  93.666  1.00 26.42 ? 297  ASP D CA  1 
ATOM   10159 C  C   . ASP D 1 297 ? 9.026   27.441  94.722  1.00 26.89 ? 297  ASP D C   1 
ATOM   10160 O  O   . ASP D 1 297 ? 8.495   26.363  94.989  1.00 27.51 ? 297  ASP D O   1 
ATOM   10161 C  CB  . ASP D 1 297 ? 9.605   28.241  92.409  1.00 25.85 ? 297  ASP D CB  1 
ATOM   10162 C  CG  . ASP D 1 297 ? 9.479   29.750  92.586  1.00 24.73 ? 297  ASP D CG  1 
ATOM   10163 O  OD1 . ASP D 1 297 ? 9.973   30.301  93.593  1.00 24.96 ? 297  ASP D OD1 1 
ATOM   10164 O  OD2 . ASP D 1 297 ? 8.889   30.392  91.694  1.00 25.32 ? 297  ASP D OD2 1 
ATOM   10165 N  N   . VAL D 1 298 ? 8.718   28.577  95.342  1.00 27.75 ? 298  VAL D N   1 
ATOM   10166 C  CA  . VAL D 1 298 ? 7.682   28.649  96.366  1.00 26.78 ? 298  VAL D CA  1 
ATOM   10167 C  C   . VAL D 1 298 ? 6.688   29.760  96.037  1.00 27.63 ? 298  VAL D C   1 
ATOM   10168 O  O   . VAL D 1 298 ? 6.874   30.508  95.076  1.00 27.11 ? 298  VAL D O   1 
ATOM   10169 C  CB  . VAL D 1 298 ? 8.282   28.908  97.775  1.00 26.06 ? 298  VAL D CB  1 
ATOM   10170 C  CG1 . VAL D 1 298 ? 9.239   27.786  98.161  1.00 24.66 ? 298  VAL D CG1 1 
ATOM   10171 C  CG2 . VAL D 1 298 ? 8.984   30.259  97.819  1.00 21.60 ? 298  VAL D CG2 1 
ATOM   10172 N  N   . GLY D 1 299 ? 5.636   29.859  96.844  1.00 29.44 ? 299  GLY D N   1 
ATOM   10173 C  CA  . GLY D 1 299 ? 4.625   30.880  96.640  1.00 30.78 ? 299  GLY D CA  1 
ATOM   10174 C  C   . GLY D 1 299 ? 3.839   31.136  97.910  1.00 32.59 ? 299  GLY D C   1 
ATOM   10175 O  O   . GLY D 1 299 ? 3.655   30.231  98.726  1.00 34.02 ? 299  GLY D O   1 
ATOM   10176 N  N   . GLY D 1 300 ? 3.383   32.374  98.082  1.00 33.86 ? 300  GLY D N   1 
ATOM   10177 C  CA  . GLY D 1 300 ? 2.617   32.732  99.264  1.00 36.00 ? 300  GLY D CA  1 
ATOM   10178 C  C   . GLY D 1 300 ? 1.261   32.054  99.323  1.00 37.67 ? 300  GLY D C   1 
ATOM   10179 O  O   . GLY D 1 300 ? 0.740   31.782  100.406 1.00 36.68 ? 300  GLY D O   1 
ATOM   10180 N  N   . ALA D 1 301 ? 0.690   31.782  98.152  1.00 39.83 ? 301  ALA D N   1 
ATOM   10181 C  CA  . ALA D 1 301 ? -0.611  31.131  98.054  1.00 41.46 ? 301  ALA D CA  1 
ATOM   10182 C  C   . ALA D 1 301 ? -0.488  29.651  97.695  1.00 43.06 ? 301  ALA D C   1 
ATOM   10183 O  O   . ALA D 1 301 ? -1.490  28.985  97.429  1.00 44.60 ? 301  ALA D O   1 
ATOM   10184 C  CB  . ALA D 1 301 ? -1.479  31.853  97.034  1.00 41.47 ? 301  ALA D CB  1 
ATOM   10185 N  N   . ILE D 1 302 ? 0.742   29.144  97.680  1.00 44.86 ? 302  ILE D N   1 
ATOM   10186 C  CA  . ILE D 1 302 ? 0.991   27.742  97.359  1.00 45.97 ? 302  ILE D CA  1 
ATOM   10187 C  C   . ILE D 1 302 ? 1.272   26.970  98.647  1.00 46.26 ? 302  ILE D C   1 
ATOM   10188 O  O   . ILE D 1 302 ? 2.419   26.868  99.087  1.00 44.44 ? 302  ILE D O   1 
ATOM   10189 C  CB  . ILE D 1 302 ? 2.193   27.580  96.391  1.00 46.39 ? 302  ILE D CB  1 
ATOM   10190 C  CG1 . ILE D 1 302 ? 2.056   28.532  95.195  1.00 47.04 ? 302  ILE D CG1 1 
ATOM   10191 C  CG2 . ILE D 1 302 ? 2.287   26.140  95.909  1.00 45.96 ? 302  ILE D CG2 1 
ATOM   10192 C  CD1 . ILE D 1 302 ? 0.786   28.353  94.381  1.00 46.51 ? 302  ILE D CD1 1 
ATOM   10193 N  N   . LYS D 1 303 ? 0.210   26.445  99.253  1.00 48.24 ? 303  LYS D N   1 
ATOM   10194 C  CA  . LYS D 1 303 ? 0.322   25.691  100.499 1.00 49.34 ? 303  LYS D CA  1 
ATOM   10195 C  C   . LYS D 1 303 ? -0.372  24.334  100.400 1.00 49.20 ? 303  LYS D C   1 
ATOM   10196 O  O   . LYS D 1 303 ? -1.387  24.193  99.714  1.00 49.07 ? 303  LYS D O   1 
ATOM   10197 C  CB  . LYS D 1 303 ? -0.289  26.489  101.659 1.00 50.52 ? 303  LYS D CB  1 
ATOM   10198 C  CG  . LYS D 1 303 ? 0.256   27.905  101.824 1.00 51.32 ? 303  LYS D CG  1 
ATOM   10199 C  CD  . LYS D 1 303 ? 1.750   27.908  102.106 1.00 53.31 ? 303  LYS D CD  1 
ATOM   10200 C  CE  . LYS D 1 303 ? 2.301   29.325  102.138 1.00 52.39 ? 303  LYS D CE  1 
ATOM   10201 N  NZ  . LYS D 1 303 ? 3.777   29.340  102.330 1.00 53.08 ? 303  LYS D NZ  1 
ATOM   10202 N  N   . GLY D 1 304 ? 0.186   23.343  101.093 1.00 49.38 ? 304  GLY D N   1 
ATOM   10203 C  CA  . GLY D 1 304 ? -0.380  22.004  101.099 1.00 49.45 ? 304  GLY D CA  1 
ATOM   10204 C  C   . GLY D 1 304 ? -0.357  21.289  99.762  1.00 49.12 ? 304  GLY D C   1 
ATOM   10205 O  O   . GLY D 1 304 ? 0.623   21.372  99.020  1.00 49.48 ? 304  GLY D O   1 
ATOM   10206 N  N   . GLN D 1 305 ? -1.441  20.572  99.469  1.00 48.96 ? 305  GLN D N   1 
ATOM   10207 C  CA  . GLN D 1 305 ? -1.584  19.825  98.221  1.00 48.24 ? 305  GLN D CA  1 
ATOM   10208 C  C   . GLN D 1 305 ? -1.944  20.782  97.082  1.00 46.86 ? 305  GLN D C   1 
ATOM   10209 O  O   . GLN D 1 305 ? -3.077  20.795  96.594  1.00 45.74 ? 305  GLN D O   1 
ATOM   10210 C  CB  . GLN D 1 305 ? -2.671  18.755  98.375  1.00 48.52 ? 305  GLN D CB  1 
ATOM   10211 C  CG  . GLN D 1 305 ? -2.449  17.776  99.526  1.00 48.58 ? 305  GLN D CG  1 
ATOM   10212 C  CD  . GLN D 1 305 ? -1.308  16.807  99.274  1.00 48.30 ? 305  GLN D CD  1 
ATOM   10213 O  OE1 . GLN D 1 305 ? -1.434  15.878  98.476  1.00 50.18 ? 305  GLN D OE1 1 
ATOM   10214 N  NE2 . GLN D 1 305 ? -0.193  17.011  99.965  1.00 47.71 ? 305  GLN D NE2 1 
ATOM   10215 N  N   . HIS D 1 306 ? -0.961  21.570  96.656  1.00 45.61 ? 306  HIS D N   1 
ATOM   10216 C  CA  . HIS D 1 306 ? -1.155  22.551  95.596  1.00 43.35 ? 306  HIS D CA  1 
ATOM   10217 C  C   . HIS D 1 306 ? 0.163   22.855  94.886  1.00 42.01 ? 306  HIS D C   1 
ATOM   10218 O  O   . HIS D 1 306 ? 1.202   23.014  95.528  1.00 41.04 ? 306  HIS D O   1 
ATOM   10219 C  CB  . HIS D 1 306 ? -1.738  23.836  96.194  1.00 44.51 ? 306  HIS D CB  1 
ATOM   10220 C  CG  . HIS D 1 306 ? -2.013  24.908  95.187  1.00 45.13 ? 306  HIS D CG  1 
ATOM   10221 N  ND1 . HIS D 1 306 ? -2.356  24.634  93.881  1.00 46.08 ? 306  HIS D ND1 1 
ATOM   10222 C  CD2 . HIS D 1 306 ? -1.999  26.258  95.297  1.00 45.59 ? 306  HIS D CD2 1 
ATOM   10223 C  CE1 . HIS D 1 306 ? -2.542  25.768  93.230  1.00 45.65 ? 306  HIS D CE1 1 
ATOM   10224 N  NE2 . HIS D 1 306 ? -2.332  26.768  94.066  1.00 45.26 ? 306  HIS D NE2 1 
ATOM   10225 N  N   . PHE D 1 307 ? 0.108   22.932  93.558  1.00 41.22 ? 307  PHE D N   1 
ATOM   10226 C  CA  . PHE D 1 307 ? 1.287   23.219  92.744  1.00 40.68 ? 307  PHE D CA  1 
ATOM   10227 C  C   . PHE D 1 307 ? 1.042   24.352  91.760  1.00 40.71 ? 307  PHE D C   1 
ATOM   10228 O  O   . PHE D 1 307 ? -0.065  24.519  91.252  1.00 41.01 ? 307  PHE D O   1 
ATOM   10229 C  CB  . PHE D 1 307 ? 1.726   21.980  91.960  1.00 39.25 ? 307  PHE D CB  1 
ATOM   10230 C  CG  . PHE D 1 307 ? 2.288   20.884  92.815  1.00 38.69 ? 307  PHE D CG  1 
ATOM   10231 C  CD1 . PHE D 1 307 ? 3.376   21.122  93.647  1.00 36.99 ? 307  PHE D CD1 1 
ATOM   10232 C  CD2 . PHE D 1 307 ? 1.733   19.610  92.786  1.00 38.92 ? 307  PHE D CD2 1 
ATOM   10233 C  CE1 . PHE D 1 307 ? 3.902   20.108  94.438  1.00 36.87 ? 307  PHE D CE1 1 
ATOM   10234 C  CE2 . PHE D 1 307 ? 2.252   18.589  93.574  1.00 39.30 ? 307  PHE D CE2 1 
ATOM   10235 C  CZ  . PHE D 1 307 ? 3.339   18.839  94.402  1.00 36.82 ? 307  PHE D CZ  1 
ATOM   10236 N  N   . ALA D 1 308 ? 2.092   25.122  91.494  1.00 41.27 ? 308  ALA D N   1 
ATOM   10237 C  CA  . ALA D 1 308 ? 2.024   26.233  90.553  1.00 41.27 ? 308  ALA D CA  1 
ATOM   10238 C  C   . ALA D 1 308 ? 2.963   25.925  89.396  1.00 40.42 ? 308  ALA D C   1 
ATOM   10239 O  O   . ALA D 1 308 ? 4.176   26.105  89.501  1.00 40.26 ? 308  ALA D O   1 
ATOM   10240 C  CB  . ALA D 1 308 ? 2.421   27.534  91.234  1.00 42.04 ? 308  ALA D CB  1 
ATOM   10241 N  N   . ILE D 1 309 ? 2.392   25.434  88.301  1.00 40.23 ? 309  ILE D N   1 
ATOM   10242 C  CA  . ILE D 1 309 ? 3.162   25.073  87.115  1.00 38.61 ? 309  ILE D CA  1 
ATOM   10243 C  C   . ILE D 1 309 ? 3.744   26.286  86.397  1.00 37.52 ? 309  ILE D C   1 
ATOM   10244 O  O   . ILE D 1 309 ? 3.009   27.179  85.969  1.00 38.11 ? 309  ILE D O   1 
ATOM   10245 C  CB  . ILE D 1 309 ? 2.298   24.271  86.116  1.00 38.45 ? 309  ILE D CB  1 
ATOM   10246 C  CG1 . ILE D 1 309 ? 1.660   23.070  86.822  1.00 36.85 ? 309  ILE D CG1 1 
ATOM   10247 C  CG2 . ILE D 1 309 ? 3.148   23.807  84.935  1.00 37.34 ? 309  ILE D CG2 1 
ATOM   10248 C  CD1 . ILE D 1 309 ? 0.647   22.331  85.978  1.00 37.84 ? 309  ILE D CD1 1 
ATOM   10249 N  N   . TYR D 1 310 ? 5.069   26.319  86.293  1.00 36.37 ? 310  TYR D N   1 
ATOM   10250 C  CA  . TYR D 1 310 ? 5.756   27.406  85.605  1.00 35.65 ? 310  TYR D CA  1 
ATOM   10251 C  C   . TYR D 1 310 ? 5.566   27.176  84.108  1.00 36.33 ? 310  TYR D C   1 
ATOM   10252 O  O   . TYR D 1 310 ? 6.096   26.216  83.552  1.00 36.62 ? 310  TYR D O   1 
ATOM   10253 C  CB  . TYR D 1 310 ? 7.247   27.407  85.961  1.00 33.24 ? 310  TYR D CB  1 
ATOM   10254 C  CG  . TYR D 1 310 ? 8.052   28.458  85.230  1.00 30.61 ? 310  TYR D CG  1 
ATOM   10255 C  CD1 . TYR D 1 310 ? 7.906   29.811  85.531  1.00 30.14 ? 310  TYR D CD1 1 
ATOM   10256 C  CD2 . TYR D 1 310 ? 8.948   28.101  84.225  1.00 31.19 ? 310  TYR D CD2 1 
ATOM   10257 C  CE1 . TYR D 1 310 ? 8.631   30.782  84.847  1.00 29.88 ? 310  TYR D CE1 1 
ATOM   10258 C  CE2 . TYR D 1 310 ? 9.678   29.063  83.535  1.00 30.61 ? 310  TYR D CE2 1 
ATOM   10259 C  CZ  . TYR D 1 310 ? 9.515   30.401  83.851  1.00 30.60 ? 310  TYR D CZ  1 
ATOM   10260 O  OH  . TYR D 1 310 ? 10.234  31.352  83.167  1.00 31.70 ? 310  TYR D OH  1 
ATOM   10261 N  N   . GLN D 1 311 ? 4.794   28.051  83.469  1.00 37.36 ? 311  GLN D N   1 
ATOM   10262 C  CA  . GLN D 1 311 ? 4.504   27.936  82.043  1.00 37.84 ? 311  GLN D CA  1 
ATOM   10263 C  C   . GLN D 1 311 ? 5.634   28.354  81.106  1.00 38.40 ? 311  GLN D C   1 
ATOM   10264 O  O   . GLN D 1 311 ? 5.862   27.707  80.080  1.00 38.78 ? 311  GLN D O   1 
ATOM   10265 C  CB  . GLN D 1 311 ? 3.225   28.702  81.704  1.00 38.60 ? 311  GLN D CB  1 
ATOM   10266 C  CG  . GLN D 1 311 ? 1.985   28.174  82.413  1.00 39.06 ? 311  GLN D CG  1 
ATOM   10267 C  CD  . GLN D 1 311 ? 1.660   26.738  82.048  1.00 40.24 ? 311  GLN D CD  1 
ATOM   10268 O  OE1 . GLN D 1 311 ? 1.814   26.326  80.899  1.00 41.81 ? 311  GLN D OE1 1 
ATOM   10269 N  NE2 . GLN D 1 311 ? 1.205   25.967  83.029  1.00 40.44 ? 311  GLN D NE2 1 
ATOM   10270 N  N   . GLY D 1 312 ? 6.320   29.443  81.442  1.00 37.87 ? 312  GLY D N   1 
ATOM   10271 C  CA  . GLY D 1 312 ? 7.416   29.904  80.607  1.00 36.42 ? 312  GLY D CA  1 
ATOM   10272 C  C   . GLY D 1 312 ? 7.597   31.409  80.573  1.00 35.43 ? 312  GLY D C   1 
ATOM   10273 O  O   . GLY D 1 312 ? 7.303   32.105  81.543  1.00 34.95 ? 312  GLY D O   1 
ATOM   10274 N  N   . ILE D 1 313 ? 8.085   31.907  79.440  1.00 35.89 ? 313  ILE D N   1 
ATOM   10275 C  CA  . ILE D 1 313 ? 8.328   33.334  79.249  1.00 37.39 ? 313  ILE D CA  1 
ATOM   10276 C  C   . ILE D 1 313 ? 7.570   33.841  78.021  1.00 39.64 ? 313  ILE D C   1 
ATOM   10277 O  O   . ILE D 1 313 ? 7.581   33.198  76.970  1.00 40.92 ? 313  ILE D O   1 
ATOM   10278 C  CB  . ILE D 1 313 ? 9.839   33.618  79.029  1.00 35.43 ? 313  ILE D CB  1 
ATOM   10279 C  CG1 . ILE D 1 313 ? 10.674  32.962  80.132  1.00 35.03 ? 313  ILE D CG1 1 
ATOM   10280 C  CG2 . ILE D 1 313 ? 10.099  35.119  79.004  1.00 33.17 ? 313  ILE D CG2 1 
ATOM   10281 C  CD1 . ILE D 1 313 ? 12.165  32.965  79.859  1.00 32.13 ? 313  ILE D CD1 1 
ATOM   10282 N  N   . GLY D 1 314 ? 6.905   34.985  78.162  1.00 41.25 ? 314  GLY D N   1 
ATOM   10283 C  CA  . GLY D 1 314 ? 6.177   35.558  77.042  1.00 44.15 ? 314  GLY D CA  1 
ATOM   10284 C  C   . GLY D 1 314 ? 4.661   35.546  77.130  1.00 46.39 ? 314  GLY D C   1 
ATOM   10285 O  O   . GLY D 1 314 ? 4.091   35.060  78.108  1.00 46.77 ? 314  GLY D O   1 
ATOM   10286 N  N   . PRO D 1 315 ? 3.980   36.090  76.105  1.00 47.15 ? 315  PRO D N   1 
ATOM   10287 C  CA  . PRO D 1 315 ? 2.520   36.179  75.997  1.00 47.73 ? 315  PRO D CA  1 
ATOM   10288 C  C   . PRO D 1 315 ? 1.833   34.817  75.991  1.00 48.66 ? 315  PRO D C   1 
ATOM   10289 O  O   . PRO D 1 315 ? 0.925   34.572  76.786  1.00 49.63 ? 315  PRO D O   1 
ATOM   10290 C  CB  . PRO D 1 315 ? 2.322   36.897  74.660  1.00 47.36 ? 315  PRO D CB  1 
ATOM   10291 C  CG  . PRO D 1 315 ? 3.552   37.738  74.541  1.00 46.68 ? 315  PRO D CG  1 
ATOM   10292 C  CD  . PRO D 1 315 ? 4.620   36.771  74.965  1.00 46.53 ? 315  PRO D CD  1 
ATOM   10293 N  N   . GLU D 1 316 ? 2.273   33.939  75.091  1.00 49.22 ? 316  GLU D N   1 
ATOM   10294 C  CA  . GLU D 1 316 ? 1.706   32.598  74.963  1.00 48.75 ? 316  GLU D CA  1 
ATOM   10295 C  C   . GLU D 1 316 ? 1.762   31.816  76.272  1.00 47.89 ? 316  GLU D C   1 
ATOM   10296 O  O   . GLU D 1 316 ? 0.862   31.031  76.572  1.00 47.82 ? 316  GLU D O   1 
ATOM   10297 C  CB  . GLU D 1 316 ? 2.418   31.826  73.849  1.00 50.02 ? 316  GLU D CB  1 
ATOM   10298 C  CG  . GLU D 1 316 ? 2.241   32.445  72.468  1.00 52.67 ? 316  GLU D CG  1 
ATOM   10299 C  CD  . GLU D 1 316 ? 2.946   31.665  71.373  1.00 54.27 ? 316  GLU D CD  1 
ATOM   10300 O  OE1 . GLU D 1 316 ? 2.441   30.592  70.981  1.00 54.34 ? 316  GLU D OE1 1 
ATOM   10301 O  OE2 . GLU D 1 316 ? 4.004   32.131  70.897  1.00 54.57 ? 316  GLU D OE2 1 
ATOM   10302 N  N   . ALA D 1 317 ? 2.816   32.050  77.050  1.00 47.37 ? 317  ALA D N   1 
ATOM   10303 C  CA  . ALA D 1 317 ? 2.994   31.389  78.340  1.00 46.17 ? 317  ALA D CA  1 
ATOM   10304 C  C   . ALA D 1 317 ? 2.052   31.998  79.377  1.00 46.06 ? 317  ALA D C   1 
ATOM   10305 O  O   . ALA D 1 317 ? 1.671   31.339  80.346  1.00 44.69 ? 317  ALA D O   1 
ATOM   10306 C  CB  . ALA D 1 317 ? 4.436   31.518  78.799  1.00 46.04 ? 317  ALA D CB  1 
ATOM   10307 N  N   . GLY D 1 318 ? 1.687   33.261  79.162  1.00 46.34 ? 318  GLY D N   1 
ATOM   10308 C  CA  . GLY D 1 318 ? 0.788   33.956  80.066  1.00 45.94 ? 318  GLY D CA  1 
ATOM   10309 C  C   . GLY D 1 318 ? -0.664  33.573  79.867  1.00 45.57 ? 318  GLY D C   1 
ATOM   10310 O  O   . GLY D 1 318 ? -1.423  33.473  80.833  1.00 45.52 ? 318  GLY D O   1 
ATOM   10311 N  N   . HIS D 1 319 ? -1.052  33.378  78.608  1.00 44.61 ? 319  HIS D N   1 
ATOM   10312 C  CA  . HIS D 1 319 ? -2.416  32.992  78.263  1.00 44.12 ? 319  HIS D CA  1 
ATOM   10313 C  C   . HIS D 1 319 ? -2.692  31.613  78.846  1.00 43.58 ? 319  HIS D C   1 
ATOM   10314 O  O   . HIS D 1 319 ? -3.737  31.374  79.448  1.00 43.75 ? 319  HIS D O   1 
ATOM   10315 C  CB  . HIS D 1 319 ? -2.587  32.936  76.741  1.00 44.32 ? 319  HIS D CB  1 
ATOM   10316 C  CG  . HIS D 1 319 ? -2.265  34.221  76.044  1.00 45.59 ? 319  HIS D CG  1 
ATOM   10317 N  ND1 . HIS D 1 319 ? -2.481  35.456  76.616  1.00 47.56 ? 319  HIS D ND1 1 
ATOM   10318 C  CD2 . HIS D 1 319 ? -1.740  34.462  74.818  1.00 45.68 ? 319  HIS D CD2 1 
ATOM   10319 C  CE1 . HIS D 1 319 ? -2.103  36.402  75.775  1.00 47.28 ? 319  HIS D CE1 1 
ATOM   10320 N  NE2 . HIS D 1 319 ? -1.649  35.826  74.677  1.00 46.98 ? 319  HIS D NE2 1 
ATOM   10321 N  N   . ARG D 1 320 ? -1.714  30.726  78.688  1.00 43.19 ? 320  ARG D N   1 
ATOM   10322 C  CA  . ARG D 1 320 ? -1.790  29.352  79.166  1.00 42.08 ? 320  ARG D CA  1 
ATOM   10323 C  C   . ARG D 1 320 ? -1.797  29.251  80.694  1.00 41.68 ? 320  ARG D C   1 
ATOM   10324 O  O   . ARG D 1 320 ? -2.423  28.354  81.260  1.00 41.02 ? 320  ARG D O   1 
ATOM   10325 C  CB  . ARG D 1 320 ? -0.617  28.561  78.575  1.00 41.58 ? 320  ARG D CB  1 
ATOM   10326 C  CG  . ARG D 1 320 ? -0.645  27.060  78.807  1.00 40.56 ? 320  ARG D CG  1 
ATOM   10327 C  CD  . ARG D 1 320 ? 0.404   26.361  77.946  1.00 37.13 ? 320  ARG D CD  1 
ATOM   10328 N  NE  . ARG D 1 320 ? 1.747   26.900  78.153  1.00 35.56 ? 320  ARG D NE  1 
ATOM   10329 C  CZ  . ARG D 1 320 ? 2.521   27.385  77.185  1.00 34.69 ? 320  ARG D CZ  1 
ATOM   10330 N  NH1 . ARG D 1 320 ? 2.090   27.405  75.930  1.00 34.44 ? 320  ARG D NH1 1 
ATOM   10331 N  NH2 . ARG D 1 320 ? 3.731   27.848  77.470  1.00 34.89 ? 320  ARG D NH2 1 
ATOM   10332 N  N   . ALA D 1 321 ? -1.133  30.200  81.351  1.00 42.25 ? 321  ALA D N   1 
ATOM   10333 C  CA  . ALA D 1 321 ? -1.031  30.231  82.812  1.00 42.11 ? 321  ALA D CA  1 
ATOM   10334 C  C   . ALA D 1 321 ? -2.257  30.768  83.550  1.00 41.81 ? 321  ALA D C   1 
ATOM   10335 O  O   . ALA D 1 321 ? -2.572  30.313  84.652  1.00 40.23 ? 321  ALA D O   1 
ATOM   10336 C  CB  . ALA D 1 321 ? 0.204   31.021  83.225  1.00 41.50 ? 321  ALA D CB  1 
ATOM   10337 N  N   . GLY D 1 322 ? -2.938  31.738  82.947  1.00 42.73 ? 322  GLY D N   1 
ATOM   10338 C  CA  . GLY D 1 322 ? -4.106  32.335  83.576  1.00 44.86 ? 322  GLY D CA  1 
ATOM   10339 C  C   . GLY D 1 322 ? -5.320  31.448  83.803  1.00 46.12 ? 322  GLY D C   1 
ATOM   10340 O  O   . GLY D 1 322 ? -6.129  31.729  84.687  1.00 46.90 ? 322  GLY D O   1 
ATOM   10341 N  N   . TRP D 1 323 ? -5.456  30.385  83.014  1.00 46.26 ? 323  TRP D N   1 
ATOM   10342 C  CA  . TRP D 1 323 ? -6.595  29.475  83.136  1.00 45.59 ? 323  TRP D CA  1 
ATOM   10343 C  C   . TRP D 1 323 ? -6.442  28.441  84.246  1.00 46.91 ? 323  TRP D C   1 
ATOM   10344 O  O   . TRP D 1 323 ? -7.424  28.029  84.865  1.00 47.24 ? 323  TRP D O   1 
ATOM   10345 C  CB  . TRP D 1 323 ? -6.827  28.727  81.820  1.00 43.30 ? 323  TRP D CB  1 
ATOM   10346 C  CG  . TRP D 1 323 ? -6.975  29.598  80.618  1.00 40.69 ? 323  TRP D CG  1 
ATOM   10347 C  CD1 . TRP D 1 323 ? -6.090  29.726  79.589  1.00 40.12 ? 323  TRP D CD1 1 
ATOM   10348 C  CD2 . TRP D 1 323 ? -8.078  30.458  80.308  1.00 40.51 ? 323  TRP D CD2 1 
ATOM   10349 N  NE1 . TRP D 1 323 ? -6.568  30.615  78.657  1.00 41.43 ? 323  TRP D NE1 1 
ATOM   10350 C  CE2 . TRP D 1 323 ? -7.788  31.079  79.073  1.00 41.34 ? 323  TRP D CE2 1 
ATOM   10351 C  CE3 . TRP D 1 323 ? -9.284  30.763  80.953  1.00 41.01 ? 323  TRP D CE3 1 
ATOM   10352 C  CZ2 . TRP D 1 323 ? -8.663  31.989  78.469  1.00 40.62 ? 323  TRP D CZ2 1 
ATOM   10353 C  CZ3 . TRP D 1 323 ? -10.153 31.667  80.352  1.00 40.50 ? 323  TRP D CZ3 1 
ATOM   10354 C  CH2 . TRP D 1 323 ? -9.836  32.268  79.122  1.00 40.33 ? 323  TRP D CH2 1 
ATOM   10355 N  N   . TYR D 1 324 ? -5.201  28.034  84.494  1.00 48.52 ? 324  TYR D N   1 
ATOM   10356 C  CA  . TYR D 1 324 ? -4.898  27.012  85.484  1.00 49.23 ? 324  TYR D CA  1 
ATOM   10357 C  C   . TYR D 1 324 ? -5.301  27.215  86.941  1.00 49.84 ? 324  TYR D C   1 
ATOM   10358 O  O   . TYR D 1 324 ? -4.701  28.002  87.680  1.00 49.62 ? 324  TYR D O   1 
ATOM   10359 C  CB  . TYR D 1 324 ? -3.430  26.588  85.380  1.00 51.04 ? 324  TYR D CB  1 
ATOM   10360 C  CG  . TYR D 1 324 ? -3.185  25.548  84.308  1.00 53.25 ? 324  TYR D CG  1 
ATOM   10361 C  CD1 . TYR D 1 324 ? -3.536  24.214  84.517  1.00 53.61 ? 324  TYR D CD1 1 
ATOM   10362 C  CD2 . TYR D 1 324 ? -2.622  25.896  83.079  1.00 54.91 ? 324  TYR D CD2 1 
ATOM   10363 C  CE1 . TYR D 1 324 ? -3.335  23.251  83.531  1.00 53.71 ? 324  TYR D CE1 1 
ATOM   10364 C  CE2 . TYR D 1 324 ? -2.417  24.937  82.082  1.00 55.29 ? 324  TYR D CE2 1 
ATOM   10365 C  CZ  . TYR D 1 324 ? -2.777  23.618  82.317  1.00 54.21 ? 324  TYR D CZ  1 
ATOM   10366 O  OH  . TYR D 1 324 ? -2.585  22.670  81.340  1.00 54.08 ? 324  TYR D OH  1 
ATOM   10367 N  N   . ASN D 1 325 ? -6.392  26.539  87.293  1.00 50.16 ? 325  ASN D N   1 
ATOM   10368 C  CA  . ASN D 1 325 ? -6.953  26.511  88.640  1.00 50.27 ? 325  ASN D CA  1 
ATOM   10369 C  C   . ASN D 1 325 ? -7.652  25.150  88.742  1.00 49.97 ? 325  ASN D C   1 
ATOM   10370 O  O   . ASN D 1 325 ? -8.661  25.000  89.431  1.00 49.68 ? 325  ASN D O   1 
ATOM   10371 C  CB  . ASN D 1 325 ? -7.961  27.647  88.845  1.00 50.72 ? 325  ASN D CB  1 
ATOM   10372 C  CG  . ASN D 1 325 ? -8.267  27.900  90.317  1.00 50.97 ? 325  ASN D CG  1 
ATOM   10373 O  OD1 . ASN D 1 325 ? -7.917  27.098  91.187  1.00 49.90 ? 325  ASN D OD1 1 
ATOM   10374 N  ND2 . ASN D 1 325 ? -8.916  29.024  90.600  1.00 50.96 ? 325  ASN D ND2 1 
ATOM   10375 N  N   . HIS D 1 326 ? -7.090  24.164  88.045  1.00 50.04 ? 326  HIS D N   1 
ATOM   10376 C  CA  . HIS D 1 326 ? -7.640  22.812  87.983  1.00 49.72 ? 326  HIS D CA  1 
ATOM   10377 C  C   . HIS D 1 326 ? -6.990  21.786  88.912  1.00 48.43 ? 326  HIS D C   1 
ATOM   10378 O  O   . HIS D 1 326 ? -6.207  22.140  89.791  1.00 47.81 ? 326  HIS D O   1 
ATOM   10379 C  CB  . HIS D 1 326 ? -7.590  22.322  86.534  1.00 50.89 ? 326  HIS D CB  1 
ATOM   10380 C  CG  . HIS D 1 326 ? -8.311  23.218  85.574  1.00 52.59 ? 326  HIS D CG  1 
ATOM   10381 N  ND1 . HIS D 1 326 ? -8.099  24.579  85.525  1.00 52.70 ? 326  HIS D ND1 1 
ATOM   10382 C  CD2 . HIS D 1 326 ? -9.259  22.951  84.646  1.00 53.92 ? 326  HIS D CD2 1 
ATOM   10383 C  CE1 . HIS D 1 326 ? -8.888  25.112  84.610  1.00 53.42 ? 326  HIS D CE1 1 
ATOM   10384 N  NE2 . HIS D 1 326 ? -9.602  24.146  84.061  1.00 54.73 ? 326  HIS D NE2 1 
ATOM   10385 N  N   . TYR D 1 327 ? -7.345  20.516  88.713  1.00 47.15 ? 327  TYR D N   1 
ATOM   10386 C  CA  . TYR D 1 327 ? -6.828  19.405  89.517  1.00 46.68 ? 327  TYR D CA  1 
ATOM   10387 C  C   . TYR D 1 327 ? -6.232  18.279  88.669  1.00 46.29 ? 327  TYR D C   1 
ATOM   10388 O  O   . TYR D 1 327 ? -6.377  18.262  87.447  1.00 46.84 ? 327  TYR D O   1 
ATOM   10389 C  CB  . TYR D 1 327 ? -7.939  18.824  90.398  1.00 45.77 ? 327  TYR D CB  1 
ATOM   10390 C  CG  . TYR D 1 327 ? -8.458  19.764  91.459  1.00 46.03 ? 327  TYR D CG  1 
ATOM   10391 C  CD1 . TYR D 1 327 ? -9.476  20.675  91.175  1.00 46.06 ? 327  TYR D CD1 1 
ATOM   10392 C  CD2 . TYR D 1 327 ? -7.938  19.739  92.752  1.00 46.30 ? 327  TYR D CD2 1 
ATOM   10393 C  CE1 . TYR D 1 327 ? -9.963  21.538  92.153  1.00 47.20 ? 327  TYR D CE1 1 
ATOM   10394 C  CE2 . TYR D 1 327 ? -8.417  20.597  93.738  1.00 48.21 ? 327  TYR D CE2 1 
ATOM   10395 C  CZ  . TYR D 1 327 ? -9.430  21.493  93.433  1.00 48.13 ? 327  TYR D CZ  1 
ATOM   10396 O  OH  . TYR D 1 327 ? -9.908  22.339  94.408  1.00 47.89 ? 327  TYR D OH  1 
ATOM   10397 N  N   . GLY D 1 328 ? -5.587  17.326  89.338  1.00 45.76 ? 328  GLY D N   1 
ATOM   10398 C  CA  . GLY D 1 328 ? -4.976  16.197  88.654  1.00 44.94 ? 328  GLY D CA  1 
ATOM   10399 C  C   . GLY D 1 328 ? -4.147  15.349  89.602  1.00 44.58 ? 328  GLY D C   1 
ATOM   10400 O  O   . GLY D 1 328 ? -3.899  15.755  90.737  1.00 44.36 ? 328  GLY D O   1 
ATOM   10401 N  N   . ARG D 1 329 ? -3.720  14.173  89.149  1.00 44.61 ? 329  ARG D N   1 
ATOM   10402 C  CA  . ARG D 1 329 ? -2.914  13.283  89.986  1.00 43.73 ? 329  ARG D CA  1 
ATOM   10403 C  C   . ARG D 1 329 ? -1.413  13.542  89.845  1.00 41.15 ? 329  ARG D C   1 
ATOM   10404 O  O   . ARG D 1 329 ? -0.948  14.023  88.811  1.00 38.97 ? 329  ARG D O   1 
ATOM   10405 C  CB  . ARG D 1 329 ? -3.211  11.812  89.673  1.00 46.54 ? 329  ARG D CB  1 
ATOM   10406 C  CG  . ARG D 1 329 ? -4.654  11.378  89.906  1.00 50.44 ? 329  ARG D CG  1 
ATOM   10407 C  CD  . ARG D 1 329 ? -5.453  11.375  88.614  1.00 54.06 ? 329  ARG D CD  1 
ATOM   10408 N  NE  . ARG D 1 329 ? -4.921  10.422  87.640  1.00 58.13 ? 329  ARG D NE  1 
ATOM   10409 C  CZ  . ARG D 1 329 ? -5.069  10.534  86.323  1.00 59.58 ? 329  ARG D CZ  1 
ATOM   10410 N  NH1 . ARG D 1 329 ? -5.734  11.560  85.812  1.00 60.53 ? 329  ARG D NH1 1 
ATOM   10411 N  NH2 . ARG D 1 329 ? -4.556  9.617   85.514  1.00 59.40 ? 329  ARG D NH2 1 
ATOM   10412 N  N   . VAL D 1 330 ? -0.662  13.212  90.893  1.00 39.42 ? 330  VAL D N   1 
ATOM   10413 C  CA  . VAL D 1 330 ? 0.786   13.397  90.899  1.00 38.99 ? 330  VAL D CA  1 
ATOM   10414 C  C   . VAL D 1 330 ? 1.475   12.350  91.776  1.00 38.30 ? 330  VAL D C   1 
ATOM   10415 O  O   . VAL D 1 330 ? 0.991   12.007  92.856  1.00 37.63 ? 330  VAL D O   1 
ATOM   10416 C  CB  . VAL D 1 330 ? 1.178   14.833  91.353  1.00 38.54 ? 330  VAL D CB  1 
ATOM   10417 C  CG1 . VAL D 1 330 ? 0.629   15.125  92.729  1.00 38.68 ? 330  VAL D CG1 1 
ATOM   10418 C  CG2 . VAL D 1 330 ? 2.690   15.012  91.328  1.00 37.07 ? 330  VAL D CG2 1 
ATOM   10419 N  N   . TRP D 1 331 ? 2.592   11.823  91.280  1.00 38.53 ? 331  TRP D N   1 
ATOM   10420 C  CA  . TRP D 1 331 ? 3.359   10.809  91.995  1.00 38.70 ? 331  TRP D CA  1 
ATOM   10421 C  C   . TRP D 1 331 ? 4.771   11.296  92.299  1.00 39.46 ? 331  TRP D C   1 
ATOM   10422 O  O   . TRP D 1 331 ? 5.512   11.689  91.397  1.00 38.89 ? 331  TRP D O   1 
ATOM   10423 C  CB  . TRP D 1 331 ? 3.434   9.514   91.174  1.00 38.69 ? 331  TRP D CB  1 
ATOM   10424 C  CG  . TRP D 1 331 ? 2.102   8.863   90.916  1.00 37.54 ? 331  TRP D CG  1 
ATOM   10425 C  CD1 . TRP D 1 331 ? 1.561   7.809   91.593  1.00 35.53 ? 331  TRP D CD1 1 
ATOM   10426 C  CD2 . TRP D 1 331 ? 1.142   9.233   89.917  1.00 35.92 ? 331  TRP D CD2 1 
ATOM   10427 N  NE1 . TRP D 1 331 ? 0.322   7.503   91.085  1.00 34.48 ? 331  TRP D NE1 1 
ATOM   10428 C  CE2 . TRP D 1 331 ? 0.040   8.361   90.055  1.00 34.38 ? 331  TRP D CE2 1 
ATOM   10429 C  CE3 . TRP D 1 331 ? 1.106   10.218  88.919  1.00 36.17 ? 331  TRP D CE3 1 
ATOM   10430 C  CZ2 . TRP D 1 331 ? -1.089  8.443   89.233  1.00 35.51 ? 331  TRP D CZ2 1 
ATOM   10431 C  CZ3 . TRP D 1 331 ? -0.016  10.299  88.102  1.00 36.35 ? 331  TRP D CZ3 1 
ATOM   10432 C  CH2 . TRP D 1 331 ? -1.098  9.415   88.265  1.00 37.20 ? 331  TRP D CH2 1 
ATOM   10433 N  N   . VAL D 1 332 ? 5.127   11.287  93.580  1.00 41.54 ? 332  VAL D N   1 
ATOM   10434 C  CA  . VAL D 1 332 ? 6.455   11.705  94.017  1.00 42.14 ? 332  VAL D CA  1 
ATOM   10435 C  C   . VAL D 1 332 ? 7.422   10.561  93.726  1.00 42.29 ? 332  VAL D C   1 
ATOM   10436 O  O   . VAL D 1 332 ? 7.367   9.508   94.366  1.00 42.71 ? 332  VAL D O   1 
ATOM   10437 C  CB  . VAL D 1 332 ? 6.472   12.033  95.532  1.00 42.38 ? 332  VAL D CB  1 
ATOM   10438 C  CG1 . VAL D 1 332 ? 7.878   12.411  95.981  1.00 41.53 ? 332  VAL D CG1 1 
ATOM   10439 C  CG2 . VAL D 1 332 ? 5.499   13.163  95.833  1.00 41.02 ? 332  VAL D CG2 1 
ATOM   10440 N  N   . LEU D 1 333 ? 8.292   10.765  92.742  1.00 41.49 ? 333  LEU D N   1 
ATOM   10441 C  CA  . LEU D 1 333 ? 9.253   9.743   92.353  1.00 41.18 ? 333  LEU D CA  1 
ATOM   10442 C  C   . LEU D 1 333 ? 10.478  9.652   93.254  1.00 42.05 ? 333  LEU D C   1 
ATOM   10443 O  O   . LEU D 1 333 ? 11.213  10.623  93.435  1.00 42.54 ? 333  LEU D O   1 
ATOM   10444 C  CB  . LEU D 1 333 ? 9.677   9.939   90.896  1.00 40.00 ? 333  LEU D CB  1 
ATOM   10445 C  CG  . LEU D 1 333 ? 8.537   9.879   89.878  1.00 38.38 ? 333  LEU D CG  1 
ATOM   10446 C  CD1 . LEU D 1 333 ? 9.095   9.979   88.470  1.00 38.44 ? 333  LEU D CD1 1 
ATOM   10447 C  CD2 . LEU D 1 333 ? 7.755   8.587   90.053  1.00 38.54 ? 333  LEU D CD2 1 
ATOM   10448 N  N   . LYS D 1 334 ? 10.674  8.467   93.823  1.00 43.14 ? 334  LYS D N   1 
ATOM   10449 C  CA  . LYS D 1 334 ? 11.798  8.185   94.707  1.00 44.43 ? 334  LYS D CA  1 
ATOM   10450 C  C   . LYS D 1 334 ? 12.395  6.845   94.292  1.00 45.07 ? 334  LYS D C   1 
ATOM   10451 O  O   . LYS D 1 334 ? 11.681  5.964   93.819  1.00 45.91 ? 334  LYS D O   1 
ATOM   10452 C  CB  . LYS D 1 334 ? 11.329  8.109   96.166  1.00 44.10 ? 334  LYS D CB  1 
ATOM   10453 C  CG  . LYS D 1 334 ? 10.745  9.404   96.717  1.00 43.47 ? 334  LYS D CG  1 
ATOM   10454 C  CD  . LYS D 1 334 ? 10.228  9.227   98.139  1.00 45.88 ? 334  LYS D CD  1 
ATOM   10455 C  CE  . LYS D 1 334 ? 11.343  8.846   99.106  1.00 47.49 ? 334  LYS D CE  1 
ATOM   10456 N  NZ  . LYS D 1 334 ? 10.835  8.653   100.494 1.00 47.64 ? 334  LYS D NZ  1 
ATOM   10457 N  N   . THR D 1 335 ? 13.705  6.700   94.444  1.00 46.75 ? 335  THR D N   1 
ATOM   10458 C  CA  . THR D 1 335 ? 14.374  5.457   94.082  1.00 47.68 ? 335  THR D CA  1 
ATOM   10459 C  C   . THR D 1 335 ? 14.464  4.496   95.262  1.00 50.04 ? 335  THR D C   1 
ATOM   10460 O  O   . THR D 1 335 ? 14.451  4.917   96.421  1.00 51.54 ? 335  THR D O   1 
ATOM   10461 C  CB  . THR D 1 335 ? 15.788  5.718   93.535  1.00 46.91 ? 335  THR D CB  1 
ATOM   10462 O  OG1 . THR D 1 335 ? 16.515  6.544   94.452  1.00 45.96 ? 335  THR D OG1 1 
ATOM   10463 C  CG2 . THR D 1 335 ? 15.713  6.400   92.183  1.00 46.31 ? 335  THR D CG2 1 
ATOM   10464 N  N   . ALA D 1 336 ? 14.539  3.203   94.955  1.00 51.60 ? 336  ALA D N   1 
ATOM   10465 C  CA  . ALA D 1 336 ? 14.641  2.166   95.977  1.00 52.47 ? 336  ALA D CA  1 
ATOM   10466 C  C   . ALA D 1 336 ? 16.034  2.192   96.602  1.00 53.85 ? 336  ALA D C   1 
ATOM   10467 O  O   . ALA D 1 336 ? 17.042  2.187   95.890  1.00 54.12 ? 336  ALA D O   1 
ATOM   10468 C  CB  . ALA D 1 336 ? 14.356  0.798   95.369  1.00 51.85 ? 336  ALA D CB  1 
ATOM   10469 N  N   . PRO D 1 337 ? 16.106  2.237   97.944  1.00 54.35 ? 337  PRO D N   1 
ATOM   10470 C  CA  . PRO D 1 337 ? 17.373  2.268   98.685  1.00 55.01 ? 337  PRO D CA  1 
ATOM   10471 C  C   . PRO D 1 337 ? 18.231  1.009   98.513  1.00 55.53 ? 337  PRO D C   1 
ATOM   10472 O  O   . PRO D 1 337 ? 19.455  1.164   98.317  1.00 55.69 ? 337  PRO D O   1 
ATOM   10473 C  CB  . PRO D 1 337 ? 16.914  2.456   100.133 1.00 54.52 ? 337  PRO D CB  1 
ATOM   10474 C  CG  . PRO D 1 337 ? 15.576  1.779   100.156 1.00 54.56 ? 337  PRO D CG  1 
ATOM   10475 C  CD  . PRO D 1 337 ? 14.959  2.264   98.870  1.00 54.36 ? 337  PRO D CD  1 
HETATM 10476 C  C1  . NAG E 2 .   ? 53.263  45.335  87.128  1.00 62.71 ? 1    NAG E C1  1 
HETATM 10477 C  C2  . NAG E 2 .   ? 52.918  44.759  88.507  1.00 62.59 ? 1    NAG E C2  1 
HETATM 10478 C  C3  . NAG E 2 .   ? 51.542  44.082  88.480  1.00 61.62 ? 1    NAG E C3  1 
HETATM 10479 C  C4  . NAG E 2 .   ? 50.496  45.028  87.890  1.00 59.86 ? 1    NAG E C4  1 
HETATM 10480 C  C5  . NAG E 2 .   ? 50.965  45.559  86.537  1.00 61.17 ? 1    NAG E C5  1 
HETATM 10481 C  C6  . NAG E 2 .   ? 49.999  46.569  85.945  1.00 61.60 ? 1    NAG E C6  1 
HETATM 10482 C  C7  . NAG E 2 .   ? 54.248  43.636  90.186  1.00 59.40 ? 1    NAG E C7  1 
HETATM 10483 C  C8  . NAG E 2 .   ? 55.327  42.615  90.497  1.00 59.09 ? 1    NAG E C8  1 
HETATM 10484 N  N2  . NAG E 2 .   ? 53.935  43.802  88.904  1.00 61.41 ? 1    NAG E N2  1 
HETATM 10485 O  O1  . NAG E 2 .   ? 54.445  46.055  87.204  1.00 61.82 ? 1    NAG E O1  1 
HETATM 10486 O  O3  . NAG E 2 .   ? 51.162  43.714  89.800  1.00 61.74 ? 1    NAG E O3  1 
HETATM 10487 O  O4  . NAG E 2 .   ? 49.238  44.340  87.737  1.00 54.73 ? 1    NAG E O4  1 
HETATM 10488 O  O5  . NAG E 2 .   ? 52.234  46.224  86.686  1.00 62.92 ? 1    NAG E O5  1 
HETATM 10489 O  O6  . NAG E 2 .   ? 49.625  46.210  84.623  1.00 61.21 ? 1    NAG E O6  1 
HETATM 10490 O  O7  . NAG E 2 .   ? 53.699  44.250  91.102  1.00 58.50 ? 1    NAG E O7  1 
HETATM 10491 C  C1  . NAG E 2 .   ? 48.171  44.888  88.433  1.00 49.67 ? 2    NAG E C1  1 
HETATM 10492 C  C2  . NAG E 2 .   ? 46.848  44.382  87.861  1.00 46.72 ? 2    NAG E C2  1 
HETATM 10493 C  C3  . NAG E 2 .   ? 45.678  44.927  88.687  1.00 43.67 ? 2    NAG E C3  1 
HETATM 10494 C  C4  . NAG E 2 .   ? 45.890  44.685  90.188  1.00 42.25 ? 2    NAG E C4  1 
HETATM 10495 C  C5  . NAG E 2 .   ? 47.291  45.125  90.620  1.00 44.66 ? 2    NAG E C5  1 
HETATM 10496 C  C6  . NAG E 2 .   ? 47.604  44.767  92.060  1.00 45.07 ? 2    NAG E C6  1 
HETATM 10497 C  C7  . NAG E 2 .   ? 47.084  43.992  85.488  1.00 46.58 ? 2    NAG E C7  1 
HETATM 10498 C  C8  . NAG E 2 .   ? 46.899  44.503  84.068  1.00 44.97 ? 2    NAG E C8  1 
HETATM 10499 N  N2  . NAG E 2 .   ? 46.707  44.798  86.477  1.00 47.33 ? 2    NAG E N2  1 
HETATM 10500 O  O3  . NAG E 2 .   ? 44.472  44.304  88.271  1.00 40.50 ? 2    NAG E O3  1 
HETATM 10501 O  O4  . NAG E 2 .   ? 44.915  45.429  90.945  1.00 39.60 ? 2    NAG E O4  1 
HETATM 10502 O  O5  . NAG E 2 .   ? 48.286  44.494  89.798  1.00 47.76 ? 2    NAG E O5  1 
HETATM 10503 O  O6  . NAG E 2 .   ? 47.951  43.396  92.188  1.00 48.26 ? 2    NAG E O6  1 
HETATM 10504 O  O7  . NAG E 2 .   ? 47.570  42.878  85.679  1.00 46.20 ? 2    NAG E O7  1 
HETATM 10505 C  C1  . NAG E 2 .   ? 43.606  44.977  90.927  1.00 34.20 ? 3    NAG E C1  1 
HETATM 10506 C  C2  . NAG E 2 .   ? 43.275  44.303  92.257  1.00 33.35 ? 3    NAG E C2  1 
HETATM 10507 C  C3  . NAG E 2 .   ? 41.812  43.870  92.257  1.00 30.75 ? 3    NAG E C3  1 
HETATM 10508 C  C4  . NAG E 2 .   ? 40.908  45.055  91.930  1.00 29.07 ? 3    NAG E C4  1 
HETATM 10509 C  C5  . NAG E 2 .   ? 41.368  45.759  90.653  1.00 29.17 ? 3    NAG E C5  1 
HETATM 10510 C  C6  . NAG E 2 .   ? 40.600  47.043  90.408  1.00 27.99 ? 3    NAG E C6  1 
HETATM 10511 C  C7  . NAG E 2 .   ? 44.884  43.057  93.555  1.00 35.88 ? 3    NAG E C7  1 
HETATM 10512 C  C8  . NAG E 2 .   ? 45.752  41.816  93.686  1.00 34.04 ? 3    NAG E C8  1 
HETATM 10513 N  N2  . NAG E 2 .   ? 44.133  43.151  92.462  1.00 34.94 ? 3    NAG E N2  1 
HETATM 10514 O  O3  . NAG E 2 .   ? 41.464  43.342  93.528  1.00 30.97 ? 3    NAG E O3  1 
HETATM 10515 O  O4  . NAG E 2 .   ? 39.560  44.587  91.756  1.00 28.32 ? 3    NAG E O4  1 
HETATM 10516 O  O5  . NAG E 2 .   ? 42.760  46.114  90.742  1.00 32.53 ? 3    NAG E O5  1 
HETATM 10517 O  O6  . NAG E 2 .   ? 41.053  48.084  91.261  1.00 27.07 ? 3    NAG E O6  1 
HETATM 10518 O  O7  . NAG E 2 .   ? 44.900  43.917  94.438  1.00 38.33 ? 3    NAG E O7  1 
HETATM 10519 C  C1  . NAG E 2 .   ? 38.596  45.189  92.544  1.00 26.87 ? 4    NAG E C1  1 
HETATM 10520 C  C2  . NAG E 2 .   ? 37.210  44.806  92.033  1.00 27.04 ? 4    NAG E C2  1 
HETATM 10521 C  C3  . NAG E 2 .   ? 36.129  45.359  92.956  1.00 26.54 ? 4    NAG E C3  1 
HETATM 10522 C  C4  . NAG E 2 .   ? 36.410  44.977  94.409  1.00 26.64 ? 4    NAG E C4  1 
HETATM 10523 C  C5  . NAG E 2 .   ? 37.844  45.340  94.792  1.00 25.29 ? 4    NAG E C5  1 
HETATM 10524 C  C6  . NAG E 2 .   ? 38.212  44.875  96.187  1.00 25.13 ? 4    NAG E C6  1 
HETATM 10525 C  C7  . NAG E 2 .   ? 36.573  44.518  89.729  1.00 25.90 ? 4    NAG E C7  1 
HETATM 10526 C  C8  . NAG E 2 .   ? 36.388  45.125  88.348  1.00 25.72 ? 4    NAG E C8  1 
HETATM 10527 N  N2  . NAG E 2 .   ? 37.014  45.320  90.691  1.00 26.91 ? 4    NAG E N2  1 
HETATM 10528 O  O3  . NAG E 2 .   ? 34.865  44.844  92.563  1.00 27.27 ? 4    NAG E O3  1 
HETATM 10529 O  O4  . NAG E 2 .   ? 35.489  45.665  95.276  1.00 27.50 ? 4    NAG E O4  1 
HETATM 10530 O  O5  . NAG E 2 .   ? 38.767  44.720  93.882  1.00 26.89 ? 4    NAG E O5  1 
HETATM 10531 O  O6  . NAG E 2 .   ? 39.541  45.251  96.519  1.00 24.89 ? 4    NAG E O6  1 
HETATM 10532 O  O7  . NAG E 2 .   ? 36.319  43.328  89.915  1.00 27.80 ? 4    NAG E O7  1 
HETATM 10533 C  C1  . NAG E 2 .   ? 34.511  44.878  95.860  1.00 26.71 ? 5    NAG E C1  1 
HETATM 10534 C  C2  . NAG E 2 .   ? 33.994  45.550  97.129  1.00 25.98 ? 5    NAG E C2  1 
HETATM 10535 C  C3  . NAG E 2 .   ? 32.840  44.737  97.724  1.00 25.97 ? 5    NAG E C3  1 
HETATM 10536 C  C4  . NAG E 2 .   ? 31.782  44.429  96.663  1.00 27.25 ? 5    NAG E C4  1 
HETATM 10537 C  C5  . NAG E 2 .   ? 32.427  43.841  95.407  1.00 25.70 ? 5    NAG E C5  1 
HETATM 10538 C  C6  . NAG E 2 .   ? 31.435  43.642  94.278  1.00 25.39 ? 5    NAG E C6  1 
HETATM 10539 C  C7  . NAG E 2 .   ? 35.357  46.831  98.652  1.00 25.30 ? 5    NAG E C7  1 
HETATM 10540 C  C8  . NAG E 2 .   ? 36.507  46.859  99.647  1.00 22.80 ? 5    NAG E C8  1 
HETATM 10541 N  N2  . NAG E 2 .   ? 35.073  45.659  98.092  1.00 24.87 ? 5    NAG E N2  1 
HETATM 10542 O  O3  . NAG E 2 .   ? 32.242  45.462  98.789  1.00 26.26 ? 5    NAG E O3  1 
HETATM 10543 O  O4  . NAG E 2 .   ? 30.826  43.493  97.194  1.00 29.42 ? 5    NAG E O4  1 
HETATM 10544 O  O5  . NAG E 2 .   ? 33.448  44.725  94.920  1.00 27.58 ? 5    NAG E O5  1 
HETATM 10545 O  O6  . NAG E 2 .   ? 32.062  43.068  93.140  1.00 24.80 ? 5    NAG E O6  1 
HETATM 10546 O  O7  . NAG E 2 .   ? 34.728  47.862  98.408  1.00 27.08 ? 5    NAG E O7  1 
HETATM 10547 C  C1  . NAG E 2 .   ? 29.507  43.912  97.218  1.00 32.11 ? 6    NAG E C1  1 
HETATM 10548 C  C2  . NAG E 2 .   ? 28.584  42.694  97.312  1.00 32.97 ? 6    NAG E C2  1 
HETATM 10549 C  C3  . NAG E 2 .   ? 27.130  43.136  97.489  1.00 33.34 ? 6    NAG E C3  1 
HETATM 10550 C  C4  . NAG E 2 .   ? 27.010  44.118  98.652  1.00 33.13 ? 6    NAG E C4  1 
HETATM 10551 C  C5  . NAG E 2 .   ? 27.997  45.267  98.466  1.00 33.33 ? 6    NAG E C5  1 
HETATM 10552 C  C6  . NAG E 2 .   ? 27.981  46.245  99.624  1.00 32.42 ? 6    NAG E C6  1 
HETATM 10553 C  C7  . NAG E 2 .   ? 29.378  40.737  96.140  1.00 35.21 ? 6    NAG E C7  1 
HETATM 10554 C  C8  . NAG E 2 .   ? 29.453  39.953  94.839  1.00 34.61 ? 6    NAG E C8  1 
HETATM 10555 N  N2  . NAG E 2 .   ? 28.705  41.885  96.114  1.00 35.04 ? 6    NAG E N2  1 
HETATM 10556 O  O3  . NAG E 2 .   ? 26.311  42.002  97.734  1.00 31.53 ? 6    NAG E O3  1 
HETATM 10557 O  O4  . NAG E 2 .   ? 25.685  44.627  98.714  1.00 34.34 ? 6    NAG E O4  1 
HETATM 10558 O  O5  . NAG E 2 .   ? 29.336  44.752  98.363  1.00 33.65 ? 6    NAG E O5  1 
HETATM 10559 O  O6  . NAG E 2 .   ? 28.562  45.674  100.787 1.00 34.98 ? 6    NAG E O6  1 
HETATM 10560 O  O7  . NAG E 2 .   ? 29.931  40.304  97.152  1.00 36.26 ? 6    NAG E O7  1 
HETATM 10561 C  C1  . NAG F 2 .   ? 30.998  9.594   59.682  1.00 49.37 ? 1    NAG F C1  1 
HETATM 10562 C  C2  . NAG F 2 .   ? 30.757  9.966   58.225  1.00 48.31 ? 1    NAG F C2  1 
HETATM 10563 C  C3  . NAG F 2 .   ? 30.902  11.477  58.032  1.00 47.17 ? 1    NAG F C3  1 
HETATM 10564 C  C4  . NAG F 2 .   ? 30.092  12.265  59.072  1.00 47.11 ? 1    NAG F C4  1 
HETATM 10565 C  C5  . NAG F 2 .   ? 30.314  11.714  60.485  1.00 49.53 ? 1    NAG F C5  1 
HETATM 10566 C  C6  . NAG F 2 .   ? 29.387  12.337  61.510  1.00 51.36 ? 1    NAG F C6  1 
HETATM 10567 C  C7  . NAG F 2 .   ? 31.301  8.271   56.599  1.00 50.38 ? 1    NAG F C7  1 
HETATM 10568 C  C8  . NAG F 2 .   ? 32.357  7.594   55.739  1.00 50.42 ? 1    NAG F C8  1 
HETATM 10569 N  N2  . NAG F 2 .   ? 31.706  9.270   57.378  1.00 49.43 ? 1    NAG F N2  1 
HETATM 10570 O  O1  . NAG F 2 .   ? 30.793  8.238   59.863  1.00 49.72 ? 1    NAG F O1  1 
HETATM 10571 O  O3  . NAG F 2 .   ? 30.464  11.827  56.729  1.00 47.23 ? 1    NAG F O3  1 
HETATM 10572 O  O4  . NAG F 2 .   ? 30.483  13.655  59.037  1.00 42.98 ? 1    NAG F O4  1 
HETATM 10573 O  O5  . NAG F 2 .   ? 30.078  10.295  60.512  1.00 49.87 ? 1    NAG F O5  1 
HETATM 10574 O  O6  . NAG F 2 .   ? 29.372  11.579  62.711  1.00 53.90 ? 1    NAG F O6  1 
HETATM 10575 O  O7  . NAG F 2 .   ? 30.132  7.888   56.552  1.00 51.39 ? 1    NAG F O7  1 
HETATM 10576 C  C1  . NAG F 2 .   ? 29.644  14.510  58.339  1.00 39.81 ? 2    NAG F C1  1 
HETATM 10577 C  C2  . NAG F 2 .   ? 29.829  15.945  58.818  1.00 37.96 ? 2    NAG F C2  1 
HETATM 10578 C  C3  . NAG F 2 .   ? 28.883  16.858  58.037  1.00 36.75 ? 2    NAG F C3  1 
HETATM 10579 C  C4  . NAG F 2 .   ? 29.060  16.662  56.522  1.00 36.36 ? 2    NAG F C4  1 
HETATM 10580 C  C5  . NAG F 2 .   ? 29.062  15.174  56.141  1.00 37.93 ? 2    NAG F C5  1 
HETATM 10581 C  C6  . NAG F 2 .   ? 29.465  14.947  54.697  1.00 37.16 ? 2    NAG F C6  1 
HETATM 10582 C  C7  . NAG F 2 .   ? 30.565  16.075  61.114  1.00 34.09 ? 2    NAG F C7  1 
HETATM 10583 C  C8  . NAG F 2 .   ? 30.197  16.178  62.585  1.00 32.27 ? 2    NAG F C8  1 
HETATM 10584 N  N2  . NAG F 2 .   ? 29.561  16.043  60.241  1.00 36.81 ? 2    NAG F N2  1 
HETATM 10585 O  O3  . NAG F 2 .   ? 29.141  18.213  58.377  1.00 34.38 ? 2    NAG F O3  1 
HETATM 10586 O  O4  . NAG F 2 .   ? 27.985  17.311  55.814  1.00 34.09 ? 2    NAG F O4  1 
HETATM 10587 O  O5  . NAG F 2 .   ? 29.986  14.437  56.958  1.00 39.63 ? 2    NAG F O5  1 
HETATM 10588 O  O6  . NAG F 2 .   ? 30.839  15.243  54.494  1.00 37.34 ? 2    NAG F O6  1 
HETATM 10589 O  O7  . NAG F 2 .   ? 31.749  16.027  60.779  1.00 30.89 ? 2    NAG F O7  1 
HETATM 10590 C  C1  . NAG F 2 .   ? 27.859  18.685  55.928  1.00 28.80 ? 3    NAG F C1  1 
HETATM 10591 C  C2  . NAG F 2 .   ? 28.372  19.349  54.648  1.00 26.98 ? 3    NAG F C2  1 
HETATM 10592 C  C3  . NAG F 2 .   ? 28.106  20.851  54.694  1.00 24.98 ? 3    NAG F C3  1 
HETATM 10593 C  C4  . NAG F 2 .   ? 26.633  21.110  54.967  1.00 24.95 ? 3    NAG F C4  1 
HETATM 10594 C  C5  . NAG F 2 .   ? 26.186  20.367  56.223  1.00 25.60 ? 3    NAG F C5  1 
HETATM 10595 C  C6  . NAG F 2 .   ? 24.693  20.499  56.448  1.00 26.32 ? 3    NAG F C6  1 
HETATM 10596 C  C7  . NAG F 2 .   ? 30.257  18.518  53.391  1.00 29.44 ? 3    NAG F C7  1 
HETATM 10597 C  C8  . NAG F 2 .   ? 31.759  18.298  53.308  1.00 26.64 ? 3    NAG F C8  1 
HETATM 10598 N  N2  . NAG F 2 .   ? 29.793  19.104  54.492  1.00 28.18 ? 3    NAG F N2  1 
HETATM 10599 O  O3  . NAG F 2 .   ? 28.472  21.445  53.458  1.00 23.26 ? 3    NAG F O3  1 
HETATM 10600 O  O4  . NAG F 2 .   ? 26.418  22.520  55.144  1.00 24.73 ? 3    NAG F O4  1 
HETATM 10601 O  O5  . NAG F 2 .   ? 26.467  18.962  56.098  1.00 27.47 ? 3    NAG F O5  1 
HETATM 10602 O  O6  . NAG F 2 .   ? 23.973  19.536  55.693  1.00 25.69 ? 3    NAG F O6  1 
HETATM 10603 O  O7  . NAG F 2 .   ? 29.530  18.153  52.465  1.00 32.04 ? 3    NAG F O7  1 
HETATM 10604 C  C1  . NAG F 2 .   ? 25.422  23.086  54.370  1.00 22.25 ? 4    NAG F C1  1 
HETATM 10605 C  C2  . NAG F 2 .   ? 25.101  24.483  54.896  1.00 22.71 ? 4    NAG F C2  1 
HETATM 10606 C  C3  . NAG F 2 .   ? 24.106  25.189  53.979  1.00 22.21 ? 4    NAG F C3  1 
HETATM 10607 C  C4  . NAG F 2 .   ? 24.572  25.128  52.526  1.00 21.28 ? 4    NAG F C4  1 
HETATM 10608 C  C5  . NAG F 2 .   ? 24.912  23.695  52.134  1.00 19.49 ? 4    NAG F C5  1 
HETATM 10609 C  C6  . NAG F 2 .   ? 25.478  23.598  50.733  1.00 16.85 ? 4    NAG F C6  1 
HETATM 10610 C  C7  . NAG F 2 .   ? 25.065  25.116  57.219  1.00 22.89 ? 4    NAG F C7  1 
HETATM 10611 C  C8  . NAG F 2 .   ? 24.428  24.971  58.592  1.00 20.70 ? 4    NAG F C8  1 
HETATM 10612 N  N2  . NAG F 2 .   ? 24.547  24.392  56.233  1.00 22.80 ? 4    NAG F N2  1 
HETATM 10613 O  O3  . NAG F 2 .   ? 23.976  26.545  54.381  1.00 22.94 ? 4    NAG F O3  1 
HETATM 10614 O  O4  . NAG F 2 .   ? 23.537  25.630  51.663  1.00 21.90 ? 4    NAG F O4  1 
HETATM 10615 O  O5  . NAG F 2 .   ? 25.903  23.166  53.029  1.00 22.29 ? 4    NAG F O5  1 
HETATM 10616 O  O6  . NAG F 2 .   ? 25.708  22.246  50.368  1.00 20.01 ? 4    NAG F O6  1 
HETATM 10617 O  O7  . NAG F 2 .   ? 26.018  25.876  57.061  1.00 24.58 ? 4    NAG F O7  1 
HETATM 10618 C  C1  . NAG F 2 .   ? 23.789  26.859  51.079  1.00 21.62 ? 5    NAG F C1  1 
HETATM 10619 C  C2  . NAG F 2 .   ? 22.970  27.001  49.800  1.00 21.76 ? 5    NAG F C2  1 
HETATM 10620 C  C3  . NAG F 2 .   ? 23.136  28.401  49.206  1.00 21.51 ? 5    NAG F C3  1 
HETATM 10621 C  C4  . NAG F 2 .   ? 22.923  29.486  50.267  1.00 22.41 ? 5    NAG F C4  1 
HETATM 10622 C  C5  . NAG F 2 .   ? 23.735  29.184  51.525  1.00 20.00 ? 5    NAG F C5  1 
HETATM 10623 C  C6  . NAG F 2 .   ? 23.455  30.153  52.654  1.00 19.95 ? 5    NAG F C6  1 
HETATM 10624 C  C7  . NAG F 2 .   ? 22.518  25.198  48.266  1.00 23.98 ? 5    NAG F C7  1 
HETATM 10625 C  C8  . NAG F 2 .   ? 23.058  24.180  47.273  1.00 23.71 ? 5    NAG F C8  1 
HETATM 10626 N  N2  . NAG F 2 .   ? 23.403  26.006  48.838  1.00 23.56 ? 5    NAG F N2  1 
HETATM 10627 O  O3  . NAG F 2 .   ? 22.203  28.584  48.152  1.00 20.41 ? 5    NAG F O3  1 
HETATM 10628 O  O4  . NAG F 2 .   ? 23.328  30.762  49.735  1.00 25.39 ? 5    NAG F O4  1 
HETATM 10629 O  O5  . NAG F 2 .   ? 23.418  27.872  52.010  1.00 21.24 ? 5    NAG F O5  1 
HETATM 10630 O  O6  . NAG F 2 .   ? 24.277  29.874  53.778  1.00 22.67 ? 5    NAG F O6  1 
HETATM 10631 O  O7  . NAG F 2 .   ? 21.308  25.252  48.497  1.00 26.55 ? 5    NAG F O7  1 
HETATM 10632 C  C1  . NAG F 2 .   ? 22.363  31.754  49.715  1.00 27.58 ? 6    NAG F C1  1 
HETATM 10633 C  C2  . NAG F 2 .   ? 23.040  33.126  49.655  1.00 27.89 ? 6    NAG F C2  1 
HETATM 10634 C  C3  . NAG F 2 .   ? 22.000  34.230  49.472  1.00 28.84 ? 6    NAG F C3  1 
HETATM 10635 C  C4  . NAG F 2 .   ? 21.078  33.912  48.296  1.00 29.97 ? 6    NAG F C4  1 
HETATM 10636 C  C5  . NAG F 2 .   ? 20.491  32.513  48.458  1.00 29.02 ? 6    NAG F C5  1 
HETATM 10637 C  C6  . NAG F 2 .   ? 19.617  32.102  47.289  1.00 27.07 ? 6    NAG F C6  1 
HETATM 10638 C  C7  . NAG F 2 .   ? 25.116  33.341  50.875  1.00 28.68 ? 6    NAG F C7  1 
HETATM 10639 C  C8  . NAG F 2 .   ? 25.809  33.602  52.203  1.00 26.24 ? 6    NAG F C8  1 
HETATM 10640 N  N2  . NAG F 2 .   ? 23.786  33.363  50.878  1.00 29.83 ? 6    NAG F N2  1 
HETATM 10641 O  O3  . NAG F 2 .   ? 22.656  35.468  49.245  1.00 30.00 ? 6    NAG F O3  1 
HETATM 10642 O  O4  . NAG F 2 .   ? 20.029  34.868  48.238  1.00 32.20 ? 6    NAG F O4  1 
HETATM 10643 O  O5  . NAG F 2 .   ? 21.552  31.548  48.556  1.00 28.86 ? 6    NAG F O5  1 
HETATM 10644 O  O6  . NAG F 2 .   ? 20.401  31.718  46.169  1.00 26.85 ? 6    NAG F O6  1 
HETATM 10645 O  O7  . NAG F 2 .   ? 25.785  33.118  49.866  1.00 28.79 ? 6    NAG F O7  1 
HETATM 10646 C  C1  . NAG G 2 .   ? 13.766  68.651  56.988  1.00 57.44 ? 1    NAG G C1  1 
HETATM 10647 C  C2  . NAG G 2 .   ? 13.430  67.997  55.645  1.00 57.22 ? 1    NAG G C2  1 
HETATM 10648 C  C3  . NAG G 2 .   ? 13.450  66.470  55.769  1.00 56.06 ? 1    NAG G C3  1 
HETATM 10649 C  C4  . NAG G 2 .   ? 14.751  65.996  56.422  1.00 54.19 ? 1    NAG G C4  1 
HETATM 10650 C  C5  . NAG G 2 .   ? 14.991  66.752  57.729  1.00 54.55 ? 1    NAG G C5  1 
HETATM 10651 C  C6  . NAG G 2 .   ? 16.311  66.387  58.382  1.00 53.56 ? 1    NAG G C6  1 
HETATM 10652 C  C7  . NAG G 2 .   ? 11.889  68.661  53.909  1.00 57.43 ? 1    NAG G C7  1 
HETATM 10653 C  C8  . NAG G 2 .   ? 10.493  69.126  53.525  1.00 56.31 ? 1    NAG G C8  1 
HETATM 10654 N  N2  . NAG G 2 .   ? 12.120  68.438  55.200  1.00 57.81 ? 1    NAG G N2  1 
HETATM 10655 O  O1  . NAG G 2 .   ? 13.871  70.023  56.826  1.00 58.95 ? 1    NAG G O1  1 
HETATM 10656 O  O3  . NAG G 2 .   ? 13.323  65.882  54.482  1.00 55.90 ? 1    NAG G O3  1 
HETATM 10657 O  O4  . NAG G 2 .   ? 14.679  64.579  56.683  1.00 50.97 ? 1    NAG G O4  1 
HETATM 10658 O  O5  . NAG G 2 .   ? 15.019  68.168  57.477  1.00 55.47 ? 1    NAG G O5  1 
HETATM 10659 O  O6  . NAG G 2 .   ? 16.462  67.039  59.633  1.00 54.33 ? 1    NAG G O6  1 
HETATM 10660 O  O7  . NAG G 2 .   ? 12.742  68.498  53.037  1.00 57.66 ? 1    NAG G O7  1 
HETATM 10661 C  C1  . NAG G 2 .   ? 15.699  63.815  56.139  1.00 46.14 ? 2    NAG G C1  1 
HETATM 10662 C  C2  . NAG G 2 .   ? 15.760  62.451  56.821  1.00 44.40 ? 2    NAG G C2  1 
HETATM 10663 C  C3  . NAG G 2 .   ? 16.852  61.597  56.171  1.00 43.10 ? 2    NAG G C3  1 
HETATM 10664 C  C4  . NAG G 2 .   ? 16.697  61.564  54.646  1.00 41.69 ? 2    NAG G C4  1 
HETATM 10665 C  C5  . NAG G 2 .   ? 16.504  62.971  54.077  1.00 42.02 ? 2    NAG G C5  1 
HETATM 10666 C  C6  . NAG G 2 .   ? 16.170  62.964  52.597  1.00 40.54 ? 2    NAG G C6  1 
HETATM 10667 C  C7  . NAG G 2 .   ? 15.036  62.594  59.119  1.00 40.71 ? 2    NAG G C7  1 
HETATM 10668 C  C8  . NAG G 2 .   ? 15.406  62.761  60.583  1.00 40.42 ? 2    NAG G C8  1 
HETATM 10669 N  N2  . NAG G 2 .   ? 16.032  62.608  58.238  1.00 42.16 ? 2    NAG G N2  1 
HETATM 10670 O  O3  . NAG G 2 .   ? 16.792  60.273  56.683  1.00 43.29 ? 2    NAG G O3  1 
HETATM 10671 O  O4  . NAG G 2 .   ? 17.873  60.980  54.053  1.00 39.63 ? 2    NAG G O4  1 
HETATM 10672 O  O5  . NAG G 2 .   ? 15.426  63.640  54.752  1.00 44.54 ? 2    NAG G O5  1 
HETATM 10673 O  O6  . NAG G 2 .   ? 14.789  62.721  52.378  1.00 37.94 ? 2    NAG G O6  1 
HETATM 10674 O  O7  . NAG G 2 .   ? 13.856  62.454  58.796  1.00 41.13 ? 2    NAG G O7  1 
HETATM 10675 C  C1  . NAG G 2 .   ? 18.055  59.619  54.230  1.00 38.53 ? 3    NAG G C1  1 
HETATM 10676 C  C2  . NAG G 2 .   ? 17.501  58.860  53.025  1.00 37.85 ? 3    NAG G C2  1 
HETATM 10677 C  C3  . NAG G 2 .   ? 17.780  57.369  53.180  1.00 35.50 ? 3    NAG G C3  1 
HETATM 10678 C  C4  . NAG G 2 .   ? 19.265  57.130  53.433  1.00 34.63 ? 3    NAG G C4  1 
HETATM 10679 C  C5  . NAG G 2 .   ? 19.769  58.001  54.584  1.00 35.46 ? 3    NAG G C5  1 
HETATM 10680 C  C6  . NAG G 2 .   ? 21.272  57.910  54.734  1.00 34.57 ? 3    NAG G C6  1 
HETATM 10681 C  C7  . NAG G 2 .   ? 15.563  59.542  51.759  1.00 39.35 ? 3    NAG G C7  1 
HETATM 10682 C  C8  . NAG G 2 .   ? 14.057  59.745  51.712  1.00 39.21 ? 3    NAG G C8  1 
HETATM 10683 N  N2  . NAG G 2 .   ? 16.073  59.085  52.899  1.00 38.98 ? 3    NAG G N2  1 
HETATM 10684 O  O3  . NAG G 2 .   ? 17.385  56.683  52.001  1.00 37.00 ? 3    NAG G O3  1 
HETATM 10685 O  O4  . NAG G 2 .   ? 19.484  55.742  53.749  1.00 31.26 ? 3    NAG G O4  1 
HETATM 10686 O  O5  . NAG G 2 .   ? 19.459  59.385  54.341  1.00 37.25 ? 3    NAG G O5  1 
HETATM 10687 O  O6  . NAG G 2 .   ? 21.927  58.774  53.819  1.00 32.68 ? 3    NAG G O6  1 
HETATM 10688 O  O7  . NAG G 2 .   ? 16.250  59.808  50.771  1.00 40.42 ? 3    NAG G O7  1 
HETATM 10689 C  C1  . NAG G 2 .   ? 20.444  55.093  52.992  1.00 30.52 ? 4    NAG G C1  1 
HETATM 10690 C  C2  . NAG G 2 .   ? 20.753  53.733  53.610  1.00 30.08 ? 4    NAG G C2  1 
HETATM 10691 C  C3  . NAG G 2 .   ? 21.723  52.953  52.723  1.00 29.78 ? 4    NAG G C3  1 
HETATM 10692 C  C4  . NAG G 2 .   ? 21.223  52.915  51.278  1.00 27.25 ? 4    NAG G C4  1 
HETATM 10693 C  C5  . NAG G 2 .   ? 20.884  54.319  50.789  1.00 27.96 ? 4    NAG G C5  1 
HETATM 10694 C  C6  . NAG G 2 .   ? 20.274  54.313  49.401  1.00 24.98 ? 4    NAG G C6  1 
HETATM 10695 C  C7  . NAG G 2 .   ? 20.850  53.241  55.969  1.00 32.84 ? 4    NAG G C7  1 
HETATM 10696 C  C8  . NAG G 2 .   ? 21.509  53.487  57.317  1.00 32.67 ? 4    NAG G C8  1 
HETATM 10697 N  N2  . NAG G 2 .   ? 21.331  53.913  54.928  1.00 31.97 ? 4    NAG G N2  1 
HETATM 10698 O  O3  . NAG G 2 .   ? 21.853  51.627  53.216  1.00 29.54 ? 4    NAG G O3  1 
HETATM 10699 O  O4  . NAG G 2 .   ? 22.230  52.340  50.426  1.00 25.60 ? 4    NAG G O4  1 
HETATM 10700 O  O5  . NAG G 2 .   ? 19.925  54.925  51.672  1.00 30.56 ? 4    NAG G O5  1 
HETATM 10701 O  O6  . NAG G 2 .   ? 20.067  55.634  48.924  1.00 24.48 ? 4    NAG G O6  1 
HETATM 10702 O  O7  . NAG G 2 .   ? 19.916  52.444  55.880  1.00 34.46 ? 4    NAG G O7  1 
HETATM 10703 C  C1  . NAG G 2 .   ? 21.966  51.062  49.968  1.00 25.08 ? 5    NAG G C1  1 
HETATM 10704 C  C2  . NAG G 2 .   ? 22.755  50.795  48.692  1.00 26.76 ? 5    NAG G C2  1 
HETATM 10705 C  C3  . NAG G 2 .   ? 22.561  49.345  48.242  1.00 27.73 ? 5    NAG G C3  1 
HETATM 10706 C  C4  . NAG G 2 .   ? 22.803  48.364  49.393  1.00 26.32 ? 5    NAG G C4  1 
HETATM 10707 C  C5  . NAG G 2 .   ? 22.029  48.791  50.638  1.00 25.14 ? 5    NAG G C5  1 
HETATM 10708 C  C6  . NAG G 2 .   ? 22.347  47.934  51.846  1.00 23.65 ? 5    NAG G C6  1 
HETATM 10709 C  C7  . NAG G 2 .   ? 23.190  52.456  46.988  1.00 31.55 ? 5    NAG G C7  1 
HETATM 10710 C  C8  . NAG G 2 .   ? 22.635  53.372  45.910  1.00 31.50 ? 5    NAG G C8  1 
HETATM 10711 N  N2  . NAG G 2 .   ? 22.313  51.699  47.645  1.00 30.32 ? 5    NAG G N2  1 
HETATM 10712 O  O3  . NAG G 2 .   ? 23.453  49.052  47.176  1.00 28.45 ? 5    NAG G O3  1 
HETATM 10713 O  O4  . NAG G 2 .   ? 22.377  47.046  48.997  1.00 29.13 ? 5    NAG G O4  1 
HETATM 10714 O  O5  . NAG G 2 .   ? 22.360  50.144  50.983  1.00 25.79 ? 5    NAG G O5  1 
HETATM 10715 O  O6  . NAG G 2 .   ? 21.535  48.288  52.955  1.00 22.34 ? 5    NAG G O6  1 
HETATM 10716 O  O7  . NAG G 2 .   ? 24.402  52.439  47.215  1.00 31.68 ? 5    NAG G O7  1 
HETATM 10717 C  C1  . NAG G 2 .   ? 23.337  46.048  49.021  1.00 28.96 ? 6    NAG G C1  1 
HETATM 10718 C  C2  . NAG G 2 .   ? 22.651  44.681  49.062  1.00 28.17 ? 6    NAG G C2  1 
HETATM 10719 C  C3  . NAG G 2 .   ? 23.683  43.561  48.949  1.00 29.53 ? 6    NAG G C3  1 
HETATM 10720 C  C4  . NAG G 2 .   ? 24.596  43.789  47.746  1.00 30.86 ? 6    NAG G C4  1 
HETATM 10721 C  C5  . NAG G 2 .   ? 25.181  45.198  47.783  1.00 31.12 ? 6    NAG G C5  1 
HETATM 10722 C  C6  . NAG G 2 .   ? 26.017  45.513  46.558  1.00 32.74 ? 6    NAG G C6  1 
HETATM 10723 C  C7  . NAG G 2 .   ? 20.579  44.520  50.290  1.00 24.94 ? 6    NAG G C7  1 
HETATM 10724 C  C8  . NAG G 2 .   ? 19.880  44.365  51.630  1.00 23.54 ? 6    NAG G C8  1 
HETATM 10725 N  N2  . NAG G 2 .   ? 21.908  44.537  50.301  1.00 27.11 ? 6    NAG G N2  1 
HETATM 10726 O  O3  . NAG G 2 .   ? 23.019  42.314  48.813  1.00 30.29 ? 6    NAG G O3  1 
HETATM 10727 O  O4  . NAG G 2 .   ? 25.648  42.835  47.756  1.00 32.45 ? 6    NAG G O4  1 
HETATM 10728 O  O5  . NAG G 2 .   ? 24.121  46.167  47.834  1.00 31.05 ? 6    NAG G O5  1 
HETATM 10729 O  O6  . NAG G 2 .   ? 25.204  45.669  45.404  1.00 36.42 ? 6    NAG G O6  1 
HETATM 10730 O  O7  . NAG G 2 .   ? 19.913  44.625  49.261  1.00 26.89 ? 6    NAG G O7  1 
HETATM 10731 C  C1  . NAG H 2 .   ? -7.299  33.006  90.094  1.00 46.38 ? 1    NAG H C1  1 
HETATM 10732 C  C2  . NAG H 2 .   ? -6.623  33.981  91.064  1.00 45.82 ? 1    NAG H C2  1 
HETATM 10733 C  C3  . NAG H 2 .   ? -5.205  34.341  90.601  1.00 46.23 ? 1    NAG H C3  1 
HETATM 10734 C  C4  . NAG H 2 .   ? -4.409  33.089  90.230  1.00 45.59 ? 1    NAG H C4  1 
HETATM 10735 C  C5  . NAG H 2 .   ? -5.215  32.235  89.256  1.00 45.03 ? 1    NAG H C5  1 
HETATM 10736 C  C6  . NAG H 2 .   ? -4.511  30.952  88.866  1.00 43.65 ? 1    NAG H C6  1 
HETATM 10737 C  C7  . NAG H 2 .   ? -7.638  35.759  92.345  1.00 40.26 ? 1    NAG H C7  1 
HETATM 10738 C  C8  . NAG H 2 .   ? -8.480  37.023  92.351  1.00 40.56 ? 1    NAG H C8  1 
HETATM 10739 N  N2  . NAG H 2 .   ? -7.418  35.192  91.163  1.00 42.75 ? 1    NAG H N2  1 
HETATM 10740 O  O1  . NAG H 2 .   ? -8.492  32.557  90.637  1.00 48.46 ? 1    NAG H O1  1 
HETATM 10741 O  O3  . NAG H 2 .   ? -4.528  35.043  91.635  1.00 47.88 ? 1    NAG H O3  1 
HETATM 10742 O  O4  . NAG H 2 .   ? -3.153  33.468  89.628  1.00 44.63 ? 1    NAG H O4  1 
HETATM 10743 O  O5  . NAG H 2 .   ? -6.465  31.869  89.863  1.00 45.80 ? 1    NAG H O5  1 
HETATM 10744 O  O6  . NAG H 2 .   ? -4.261  30.908  87.469  1.00 44.12 ? 1    NAG H O6  1 
HETATM 10745 O  O7  . NAG H 2 .   ? -7.197  35.308  93.403  1.00 38.17 ? 1    NAG H O7  1 
HETATM 10746 C  C1  . NAG H 2 .   ? -2.009  33.037  90.284  1.00 40.07 ? 2    NAG H C1  1 
HETATM 10747 C  C2  . NAG H 2 .   ? -0.769  33.680  89.665  1.00 38.06 ? 2    NAG H C2  1 
HETATM 10748 C  C3  . NAG H 2 .   ? 0.481   33.246  90.438  1.00 37.06 ? 2    NAG H C3  1 
HETATM 10749 C  C4  . NAG H 2 .   ? 0.306   33.464  91.949  1.00 35.40 ? 2    NAG H C4  1 
HETATM 10750 C  C5  . NAG H 2 .   ? -1.031  32.904  92.439  1.00 35.21 ? 2    NAG H C5  1 
HETATM 10751 C  C6  . NAG H 2 .   ? -1.316  33.266  93.883  1.00 33.91 ? 2    NAG H C6  1 
HETATM 10752 C  C7  . NAG H 2 .   ? -1.115  34.089  87.307  1.00 33.92 ? 2    NAG H C7  1 
HETATM 10753 C  C8  . NAG H 2 .   ? -0.942  33.615  85.875  1.00 33.02 ? 2    NAG H C8  1 
HETATM 10754 N  N2  . NAG H 2 .   ? -0.646  33.297  88.269  1.00 36.35 ? 2    NAG H N2  1 
HETATM 10755 O  O3  . NAG H 2 .   ? 1.604   33.984  89.978  1.00 36.80 ? 2    NAG H O3  1 
HETATM 10756 O  O4  . NAG H 2 .   ? 1.371   32.808  92.665  1.00 33.05 ? 2    NAG H O4  1 
HETATM 10757 O  O5  . NAG H 2 .   ? -2.113  33.425  91.651  1.00 38.67 ? 2    NAG H O5  1 
HETATM 10758 O  O6  . NAG H 2 .   ? -1.797  34.598  93.995  1.00 32.13 ? 2    NAG H O6  1 
HETATM 10759 O  O7  . NAG H 2 .   ? -1.673  35.163  87.533  1.00 36.39 ? 2    NAG H O7  1 
HETATM 10760 C  C1  . NAG H 2 .   ? 2.651   33.313  92.506  1.00 31.26 ? 3    NAG H C1  1 
HETATM 10761 C  C2  . NAG H 2 .   ? 3.022   34.174  93.713  1.00 30.07 ? 3    NAG H C2  1 
HETATM 10762 C  C3  . NAG H 2 .   ? 4.465   34.654  93.580  1.00 29.16 ? 3    NAG H C3  1 
HETATM 10763 C  C4  . NAG H 2 .   ? 5.401   33.473  93.348  1.00 28.02 ? 3    NAG H C4  1 
HETATM 10764 C  C5  . NAG H 2 .   ? 4.905   32.603  92.196  1.00 28.24 ? 3    NAG H C5  1 
HETATM 10765 C  C6  . NAG H 2 .   ? 5.718   31.333  92.067  1.00 26.64 ? 3    NAG H C6  1 
HETATM 10766 C  C7  . NAG H 2 .   ? 1.388   35.495  94.902  1.00 27.20 ? 3    NAG H C7  1 
HETATM 10767 C  C8  . NAG H 2 .   ? 0.483   36.714  94.923  1.00 26.85 ? 3    NAG H C8  1 
HETATM 10768 N  N2  . NAG H 2 .   ? 2.129   35.313  93.811  1.00 29.04 ? 3    NAG H N2  1 
HETATM 10769 O  O3  . NAG H 2 .   ? 4.853   35.340  94.762  1.00 33.88 ? 3    NAG H O3  1 
HETATM 10770 O  O4  . NAG H 2 .   ? 6.724   33.958  93.050  1.00 25.80 ? 3    NAG H O4  1 
HETATM 10771 O  O5  . NAG H 2 .   ? 3.541   32.200  92.420  1.00 31.60 ? 3    NAG H O5  1 
HETATM 10772 O  O6  . NAG H 2 .   ? 5.270   30.347  92.984  1.00 24.41 ? 3    NAG H O6  1 
HETATM 10773 O  O7  . NAG H 2 .   ? 1.405   34.725  95.864  1.00 26.94 ? 3    NAG H O7  1 
HETATM 10774 C  C1  . NAG H 2 .   ? 7.743   33.472  93.851  1.00 24.10 ? 4    NAG H C1  1 
HETATM 10775 C  C2  . NAG H 2 .   ? 9.095   33.831  93.244  1.00 22.74 ? 4    NAG H C2  1 
HETATM 10776 C  C3  . NAG H 2 .   ? 10.220  33.372  94.168  1.00 23.59 ? 4    NAG H C3  1 
HETATM 10777 C  C4  . NAG H 2 .   ? 9.997   33.892  95.587  1.00 21.96 ? 4    NAG H C4  1 
HETATM 10778 C  C5  . NAG H 2 .   ? 8.587   33.561  96.071  1.00 22.34 ? 4    NAG H C5  1 
HETATM 10779 C  C6  . NAG H 2 .   ? 8.281   34.178  97.421  1.00 20.28 ? 4    NAG H C6  1 
HETATM 10780 C  C7  . NAG H 2 .   ? 9.590   33.923  90.886  1.00 21.89 ? 4    NAG H C7  1 
HETATM 10781 C  C8  . NAG H 2 .   ? 9.721   33.186  89.563  1.00 22.58 ? 4    NAG H C8  1 
HETATM 10782 N  N2  . NAG H 2 .   ? 9.240   33.201  91.946  1.00 22.67 ? 4    NAG H N2  1 
HETATM 10783 O  O3  . NAG H 2 .   ? 11.464  33.851  93.676  1.00 26.41 ? 4    NAG H O3  1 
HETATM 10784 O  O4  . NAG H 2 .   ? 10.961  33.302  96.475  1.00 21.65 ? 4    NAG H O4  1 
HETATM 10785 O  O5  . NAG H 2 .   ? 7.615   34.071  95.142  1.00 23.18 ? 4    NAG H O5  1 
HETATM 10786 O  O6  . NAG H 2 .   ? 7.040   33.713  97.930  1.00 19.50 ? 4    NAG H O6  1 
HETATM 10787 O  O7  . NAG H 2 .   ? 9.803   35.134  90.938  1.00 23.81 ? 4    NAG H O7  1 
HETATM 10788 C  C1  . NAG H 2 .   ? 11.955  34.152  96.929  1.00 23.03 ? 5    NAG H C1  1 
HETATM 10789 C  C2  . NAG H 2 .   ? 12.548  33.610  98.223  1.00 24.18 ? 5    NAG H C2  1 
HETATM 10790 C  C3  . NAG H 2 .   ? 13.710  34.494  98.676  1.00 25.46 ? 5    NAG H C3  1 
HETATM 10791 C  C4  . NAG H 2 .   ? 14.712  34.714  97.541  1.00 25.55 ? 5    NAG H C4  1 
HETATM 10792 C  C5  . NAG H 2 .   ? 13.995  35.166  96.270  1.00 24.04 ? 5    NAG H C5  1 
HETATM 10793 C  C6  . NAG H 2 .   ? 14.929  35.263  95.081  1.00 23.69 ? 5    NAG H C6  1 
HETATM 10794 C  C7  . NAG H 2 .   ? 11.251  32.437  99.890  1.00 25.85 ? 5    NAG H C7  1 
HETATM 10795 C  C8  . NAG H 2 .   ? 10.166  32.492  100.953 1.00 26.48 ? 5    NAG H C8  1 
HETATM 10796 N  N2  . NAG H 2 .   ? 11.526  33.572  99.253  1.00 27.26 ? 5    NAG H N2  1 
HETATM 10797 O  O3  . NAG H 2 .   ? 14.369  33.888  99.778  1.00 27.96 ? 5    NAG H O3  1 
HETATM 10798 O  O4  . NAG H 2 .   ? 15.664  35.721  97.933  1.00 28.83 ? 5    NAG H O4  1 
HETATM 10799 O  O5  . NAG H 2 .   ? 12.966  34.225  95.925  1.00 24.11 ? 5    NAG H O5  1 
HETATM 10800 O  O6  . NAG H 2 .   ? 14.273  35.832  93.959  1.00 27.73 ? 5    NAG H O6  1 
HETATM 10801 O  O7  . NAG H 2 .   ? 11.826  31.373  99.655  1.00 25.06 ? 5    NAG H O7  1 
HETATM 10802 C  C1  . NAG H 2 .   ? 16.999  35.349  97.939  1.00 30.53 ? 6    NAG H C1  1 
HETATM 10803 C  C2  . NAG H 2 .   ? 17.878  36.602  97.886  1.00 30.52 ? 6    NAG H C2  1 
HETATM 10804 C  C3  . NAG H 2 .   ? 19.354  36.235  98.045  1.00 31.67 ? 6    NAG H C3  1 
HETATM 10805 C  C4  . NAG H 2 .   ? 19.563  35.347  99.270  1.00 33.07 ? 6    NAG H C4  1 
HETATM 10806 C  C5  . NAG H 2 .   ? 18.605  34.160  99.233  1.00 33.04 ? 6    NAG H C5  1 
HETATM 10807 C  C6  . NAG H 2 .   ? 18.705  33.291  100.473 1.00 35.30 ? 6    NAG H C6  1 
HETATM 10808 C  C7  . NAG H 2 .   ? 17.025  38.453  96.591  1.00 26.27 ? 6    NAG H C7  1 
HETATM 10809 C  C8  . NAG H 2 .   ? 16.871  39.116  95.232  1.00 24.73 ? 6    NAG H C8  1 
HETATM 10810 N  N2  . NAG H 2 .   ? 17.683  37.298  96.627  1.00 28.50 ? 6    NAG H N2  1 
HETATM 10811 O  O3  . NAG H 2 .   ? 20.129  37.418  98.177  1.00 31.72 ? 6    NAG H O3  1 
HETATM 10812 O  O4  . NAG H 2 .   ? 20.903  34.877  99.296  1.00 35.51 ? 6    NAG H O4  1 
HETATM 10813 O  O5  . NAG H 2 .   ? 17.246  34.627  99.147  1.00 32.03 ? 6    NAG H O5  1 
HETATM 10814 O  O6  . NAG H 2 .   ? 18.171  33.951  101.613 1.00 37.73 ? 6    NAG H O6  1 
HETATM 10815 O  O7  . NAG H 2 .   ? 16.539  38.983  97.590  1.00 26.53 ? 6    NAG H O7  1 
HETATM 10816 P  P   . PO4 I 3 .   ? 25.160  41.324  94.243  1.00 20.86 ? 699  PO4 A P   1 
HETATM 10817 O  O1  . PO4 I 3 .   ? 26.299  42.254  94.439  1.00 22.68 ? 699  PO4 A O1  1 
HETATM 10818 O  O2  . PO4 I 3 .   ? 25.675  39.980  93.887  1.00 21.95 ? 699  PO4 A O2  1 
HETATM 10819 O  O3  . PO4 I 3 .   ? 24.292  41.829  93.148  1.00 25.44 ? 699  PO4 A O3  1 
HETATM 10820 O  O4  . PO4 I 3 .   ? 24.373  41.235  95.496  1.00 22.82 ? 699  PO4 A O4  1 
HETATM 10821 P  P   . PO4 J 3 .   ? 22.857  36.544  52.747  1.00 28.40 ? 696  PO4 B P   1 
HETATM 10822 O  O1  . PO4 J 3 .   ? 21.447  36.917  52.472  1.00 29.05 ? 696  PO4 B O1  1 
HETATM 10823 O  O2  . PO4 J 3 .   ? 23.634  36.586  51.482  1.00 27.47 ? 696  PO4 B O2  1 
HETATM 10824 O  O3  . PO4 J 3 .   ? 22.906  35.172  53.314  1.00 28.40 ? 696  PO4 B O3  1 
HETATM 10825 O  O4  . PO4 J 3 .   ? 23.442  37.501  53.720  1.00 28.39 ? 696  PO4 B O4  1 
HETATM 10826 P  P   . PO4 K 3 .   ? 23.234  41.637  52.346  1.00 25.55 ? 697  PO4 C P   1 
HETATM 10827 O  O1  . PO4 K 3 .   ? 22.915  41.025  51.031  1.00 24.61 ? 697  PO4 C O1  1 
HETATM 10828 O  O2  . PO4 K 3 .   ? 24.392  40.933  52.951  1.00 25.15 ? 697  PO4 C O2  1 
HETATM 10829 O  O3  . PO4 K 3 .   ? 22.059  41.520  53.245  1.00 23.88 ? 697  PO4 C O3  1 
HETATM 10830 O  O4  . PO4 K 3 .   ? 23.572  43.071  52.156  1.00 25.31 ? 697  PO4 C O4  1 
HETATM 10831 P  P   . PO4 L 3 .   ? 9.375   35.389  47.090  1.00 46.54 ? 701  PO4 C P   1 
HETATM 10832 O  O1  . PO4 L 3 .   ? 7.921   35.658  47.224  1.00 45.80 ? 701  PO4 C O1  1 
HETATM 10833 O  O2  . PO4 L 3 .   ? 10.136  36.349  47.930  1.00 46.41 ? 701  PO4 C O2  1 
HETATM 10834 O  O3  . PO4 L 3 .   ? 9.780   35.547  45.669  1.00 44.84 ? 701  PO4 C O3  1 
HETATM 10835 O  O4  . PO4 L 3 .   ? 9.664   34.003  47.538  1.00 44.35 ? 701  PO4 C O4  1 
HETATM 10836 P  P   . PO4 M 3 .   ? 21.268  37.871  94.585  1.00 20.71 ? 698  PO4 D P   1 
HETATM 10837 O  O1  . PO4 M 3 .   ? 19.982  37.366  94.042  1.00 24.67 ? 698  PO4 D O1  1 
HETATM 10838 O  O2  . PO4 M 3 .   ? 21.013  38.630  95.835  1.00 25.84 ? 698  PO4 D O2  1 
HETATM 10839 O  O3  . PO4 M 3 .   ? 21.908  38.764  93.587  1.00 23.43 ? 698  PO4 D O3  1 
HETATM 10840 O  O4  . PO4 M 3 .   ? 22.166  36.726  94.875  1.00 22.84 ? 698  PO4 D O4  1 
HETATM 10841 P  P   . PO4 N 3 .   ? 19.441  52.959  99.744  1.00 43.09 ? 700  PO4 D P   1 
HETATM 10842 O  O1  . PO4 N 3 .   ? 20.888  53.042  100.067 1.00 42.95 ? 700  PO4 D O1  1 
HETATM 10843 O  O2  . PO4 N 3 .   ? 19.117  51.590  99.271  1.00 42.57 ? 700  PO4 D O2  1 
HETATM 10844 O  O3  . PO4 N 3 .   ? 19.115  53.941  98.680  1.00 42.50 ? 700  PO4 D O3  1 
HETATM 10845 O  O4  . PO4 N 3 .   ? 18.643  53.262  100.960 1.00 42.35 ? 700  PO4 D O4  1 
HETATM 10846 O  O   . HOH O 4 .   ? 38.443  43.709  86.376  1.00 10.00 ? 1001 HOH A O   1 
HETATM 10847 O  O   . HOH O 4 .   ? 40.314  30.383  90.288  1.00 10.53 ? 1007 HOH A O   1 
HETATM 10848 O  O   . HOH O 4 .   ? 48.374  27.821  82.637  1.00 20.59 ? 1008 HOH A O   1 
HETATM 10849 O  O   . HOH O 4 .   ? 24.005  31.726  83.656  1.00 14.04 ? 1015 HOH A O   1 
HETATM 10850 O  O   . HOH O 4 .   ? 33.820  65.770  91.017  1.00 10.00 ? 1023 HOH A O   1 
HETATM 10851 O  O   . HOH O 4 .   ? 28.586  42.827  89.464  1.00 16.06 ? 1027 HOH A O   1 
HETATM 10852 O  O   . HOH O 4 .   ? 27.958  45.172  92.835  1.00 25.66 ? 1029 HOH A O   1 
HETATM 10853 O  O   . HOH O 4 .   ? 33.136  66.332  93.963  1.00 15.54 ? 1030 HOH A O   1 
HETATM 10854 O  O   . HOH O 4 .   ? 50.927  44.760  73.511  1.00 23.93 ? 1035 HOH A O   1 
HETATM 10855 O  O   . HOH O 4 .   ? 31.199  19.524  101.404 1.00 14.20 ? 1043 HOH A O   1 
HETATM 10856 O  O   . HOH O 4 .   ? 44.575  46.861  93.973  1.00 19.35 ? 1045 HOH A O   1 
HETATM 10857 O  O   . HOH O 4 .   ? 27.991  27.190  100.963 1.00 15.57 ? 1046 HOH A O   1 
HETATM 10858 O  O   . HOH O 4 .   ? 48.324  53.155  75.868  1.00 31.01 ? 1047 HOH A O   1 
HETATM 10859 O  O   . HOH O 4 .   ? 42.240  42.651  66.902  1.00 17.45 ? 1054 HOH A O   1 
HETATM 10860 O  O   . HOH O 4 .   ? 40.455  25.795  73.374  1.00 26.26 ? 1055 HOH A O   1 
HETATM 10861 O  O   . HOH O 4 .   ? 62.798  31.957  96.684  1.00 24.88 ? 1057 HOH A O   1 
HETATM 10862 O  O   . HOH O 4 .   ? 24.597  43.636  90.982  1.00 11.76 ? 1059 HOH A O   1 
HETATM 10863 O  O   . HOH O 4 .   ? 44.337  20.384  88.267  1.00 27.43 ? 1060 HOH A O   1 
HETATM 10864 O  O   . HOH O 4 .   ? 45.420  36.603  94.769  1.00 16.76 ? 1067 HOH A O   1 
HETATM 10865 O  O   . HOH O 4 .   ? 48.925  35.723  105.932 1.00 17.12 ? 1068 HOH A O   1 
HETATM 10866 O  O   . HOH O 4 .   ? 36.495  55.286  94.168  1.00 25.99 ? 1075 HOH A O   1 
HETATM 10867 O  O   . HOH O 4 .   ? 30.354  44.735  91.131  1.00 15.47 ? 1079 HOH A O   1 
HETATM 10868 O  O   . HOH O 4 .   ? 30.397  46.073  80.658  1.00 10.00 ? 1080 HOH A O   1 
HETATM 10869 O  O   . HOH O 4 .   ? 61.