data_2PME
# 
_entry.id   2PME 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2PME         
RCSB  RCSB042537   
WWPDB D_1000042537 
# 
_pdbx_database_status.entry_id                        2PME 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-21 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Xie, W.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Long-range structural effects of a Charcot-Marie- Tooth disease-causing mutation in human glycyl-tRNA synthetase.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            104 
_citation.page_first                9976 
_citation.page_last                 9981 
_citation.year                      2007 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17545306 
_citation.pdbx_database_id_DOI      10.1073/pnas.0703908104 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xie, W.'      1 
primary 'Nangle, L.A.' 2 
primary 'Zhang, W.'    3 
primary 'Schimmel, P.' 4 
primary 'Yang, X.L.'   5 
# 
_cell.length_a           91.742 
_cell.length_b           91.742 
_cell.length_c           247.176 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2PME 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.entry_id                         2PME 
_symmetry.Int_Tables_number                96 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Glycyl-tRNA synthetase' 78704.828 1   6.1.1.14 ? ? ? 
2 water   nat water                    18.015    122 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Glycine--tRNA ligase, GlyRS' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRA
DHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYG
WIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLL
NEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQ
IRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEELEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRA
DHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYG
WIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLL
NEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQ
IRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEELEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   GLY n 
1 4   ALA n 
1 5   GLY n 
1 6   ALA n 
1 7   GLU n 
1 8   GLU n 
1 9   VAL n 
1 10  LEU n 
1 11  ALA n 
1 12  PRO n 
1 13  LEU n 
1 14  ARG n 
1 15  LEU n 
1 16  ALA n 
1 17  VAL n 
1 18  ARG n 
1 19  GLN n 
1 20  GLN n 
1 21  GLY n 
1 22  ASP n 
1 23  LEU n 
1 24  VAL n 
1 25  ARG n 
1 26  LYS n 
1 27  LEU n 
1 28  LYS n 
1 29  GLU n 
1 30  ASP n 
1 31  LYS n 
1 32  ALA n 
1 33  PRO n 
1 34  GLN n 
1 35  VAL n 
1 36  ASP n 
1 37  VAL n 
1 38  ASP n 
1 39  LYS n 
1 40  ALA n 
1 41  VAL n 
1 42  ALA n 
1 43  GLU n 
1 44  LEU n 
1 45  LYS n 
1 46  ALA n 
1 47  ARG n 
1 48  LYS n 
1 49  ARG n 
1 50  VAL n 
1 51  LEU n 
1 52  GLU n 
1 53  ALA n 
1 54  LYS n 
1 55  GLU n 
1 56  LEU n 
1 57  ALA n 
1 58  LEU n 
1 59  GLN n 
1 60  PRO n 
1 61  LYS n 
1 62  ASP n 
1 63  ASP n 
1 64  ILE n 
1 65  VAL n 
1 66  ASP n 
1 67  ARG n 
1 68  ALA n 
1 69  LYS n 
1 70  MET n 
1 71  GLU n 
1 72  ASP n 
1 73  THR n 
1 74  LEU n 
1 75  LYS n 
1 76  ARG n 
1 77  ARG n 
1 78  PHE n 
1 79  PHE n 
1 80  TYR n 
1 81  ASP n 
1 82  GLN n 
1 83  ALA n 
1 84  PHE n 
1 85  ALA n 
1 86  ILE n 
1 87  TYR n 
1 88  GLY n 
1 89  GLY n 
1 90  VAL n 
1 91  SER n 
1 92  GLY n 
1 93  LEU n 
1 94  TYR n 
1 95  ASP n 
1 96  PHE n 
1 97  GLY n 
1 98  PRO n 
1 99  VAL n 
1 100 GLY n 
1 101 CYS n 
1 102 ALA n 
1 103 LEU n 
1 104 LYS n 
1 105 ASN n 
1 106 ASN n 
1 107 ILE n 
1 108 ILE n 
1 109 GLN n 
1 110 THR n 
1 111 TRP n 
1 112 ARG n 
1 113 GLN n 
1 114 HIS n 
1 115 PHE n 
1 116 ILE n 
1 117 GLN n 
1 118 GLU n 
1 119 GLU n 
1 120 GLN n 
1 121 ILE n 
1 122 LEU n 
1 123 GLU n 
1 124 ILE n 
1 125 ASP n 
1 126 CYS n 
1 127 THR n 
1 128 MET n 
1 129 LEU n 
1 130 THR n 
1 131 PRO n 
1 132 GLU n 
1 133 PRO n 
1 134 VAL n 
1 135 LEU n 
1 136 LYS n 
1 137 THR n 
1 138 SER n 
1 139 GLY n 
1 140 HIS n 
1 141 VAL n 
1 142 ASP n 
1 143 LYS n 
1 144 PHE n 
1 145 ALA n 
1 146 ASP n 
1 147 PHE n 
1 148 MET n 
1 149 VAL n 
1 150 LYS n 
1 151 ASP n 
1 152 VAL n 
1 153 LYS n 
1 154 ASN n 
1 155 GLY n 
1 156 GLU n 
1 157 CYS n 
1 158 PHE n 
1 159 ARG n 
1 160 ALA n 
1 161 ASP n 
1 162 HIS n 
1 163 LEU n 
1 164 LEU n 
1 165 LYS n 
1 166 ALA n 
1 167 HIS n 
1 168 LEU n 
1 169 GLN n 
1 170 LYS n 
1 171 LEU n 
1 172 MET n 
1 173 SER n 
1 174 ASP n 
1 175 LYS n 
1 176 LYS n 
1 177 CYS n 
1 178 SER n 
1 179 VAL n 
1 180 GLU n 
1 181 LYS n 
1 182 LYS n 
1 183 SER n 
1 184 GLU n 
1 185 MET n 
1 186 GLU n 
1 187 SER n 
1 188 VAL n 
1 189 LEU n 
1 190 ALA n 
1 191 GLN n 
1 192 LEU n 
1 193 ASP n 
1 194 ASN n 
1 195 TYR n 
1 196 GLY n 
1 197 GLN n 
1 198 GLN n 
1 199 GLU n 
1 200 LEU n 
1 201 ALA n 
1 202 ASP n 
1 203 LEU n 
1 204 PHE n 
1 205 VAL n 
1 206 ASN n 
1 207 TYR n 
1 208 ASN n 
1 209 VAL n 
1 210 LYS n 
1 211 SER n 
1 212 PRO n 
1 213 ILE n 
1 214 THR n 
1 215 GLY n 
1 216 ASN n 
1 217 ASP n 
1 218 LEU n 
1 219 SER n 
1 220 PRO n 
1 221 PRO n 
1 222 VAL n 
1 223 SER n 
1 224 PHE n 
1 225 ASN n 
1 226 LEU n 
1 227 MET n 
1 228 PHE n 
1 229 LYS n 
1 230 THR n 
1 231 PHE n 
1 232 ILE n 
1 233 GLY n 
1 234 PRO n 
1 235 GLY n 
1 236 GLY n 
1 237 ASN n 
1 238 MET n 
1 239 PRO n 
1 240 GLY n 
1 241 TYR n 
1 242 LEU n 
1 243 ARG n 
1 244 PRO n 
1 245 GLU n 
1 246 THR n 
1 247 ALA n 
1 248 GLN n 
1 249 GLY n 
1 250 ILE n 
1 251 PHE n 
1 252 LEU n 
1 253 ASN n 
1 254 PHE n 
1 255 LYS n 
1 256 ARG n 
1 257 LEU n 
1 258 LEU n 
1 259 GLU n 
1 260 PHE n 
1 261 ASN n 
1 262 GLN n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 PRO n 
1 267 PHE n 
1 268 ALA n 
1 269 ALA n 
1 270 ALA n 
1 271 GLN n 
1 272 ILE n 
1 273 GLY n 
1 274 ASN n 
1 275 SER n 
1 276 PHE n 
1 277 ARG n 
1 278 ASN n 
1 279 GLU n 
1 280 ILE n 
1 281 SER n 
1 282 PRO n 
1 283 ARG n 
1 284 SER n 
1 285 GLY n 
1 286 LEU n 
1 287 ILE n 
1 288 ARG n 
1 289 VAL n 
1 290 ARG n 
1 291 GLU n 
1 292 PHE n 
1 293 THR n 
1 294 MET n 
1 295 ALA n 
1 296 GLU n 
1 297 ILE n 
1 298 GLU n 
1 299 HIS n 
1 300 PHE n 
1 301 VAL n 
1 302 ASP n 
1 303 PRO n 
1 304 SER n 
1 305 GLU n 
1 306 LYS n 
1 307 ASP n 
1 308 HIS n 
1 309 PRO n 
1 310 LYS n 
1 311 PHE n 
1 312 GLN n 
1 313 ASN n 
1 314 VAL n 
1 315 ALA n 
1 316 ASP n 
1 317 LEU n 
1 318 HIS n 
1 319 LEU n 
1 320 TYR n 
1 321 LEU n 
1 322 TYR n 
1 323 SER n 
1 324 ALA n 
1 325 LYS n 
1 326 ALA n 
1 327 GLN n 
1 328 VAL n 
1 329 SER n 
1 330 GLY n 
1 331 GLN n 
1 332 SER n 
1 333 ALA n 
1 334 ARG n 
1 335 LYS n 
1 336 MET n 
1 337 ARG n 
1 338 LEU n 
1 339 GLY n 
1 340 ASP n 
1 341 ALA n 
1 342 VAL n 
1 343 GLU n 
1 344 GLN n 
1 345 GLY n 
1 346 VAL n 
1 347 ILE n 
1 348 ASN n 
1 349 ASN n 
1 350 THR n 
1 351 VAL n 
1 352 LEU n 
1 353 GLY n 
1 354 TYR n 
1 355 PHE n 
1 356 ILE n 
1 357 GLY n 
1 358 ARG n 
1 359 ILE n 
1 360 TYR n 
1 361 LEU n 
1 362 TYR n 
1 363 LEU n 
1 364 THR n 
1 365 LYS n 
1 366 VAL n 
1 367 GLY n 
1 368 ILE n 
1 369 SER n 
1 370 PRO n 
1 371 ASP n 
1 372 LYS n 
1 373 LEU n 
1 374 ARG n 
1 375 PHE n 
1 376 ARG n 
1 377 GLN n 
1 378 HIS n 
1 379 MET n 
1 380 GLU n 
1 381 ASN n 
1 382 GLU n 
1 383 MET n 
1 384 ALA n 
1 385 HIS n 
1 386 TYR n 
1 387 ALA n 
1 388 CYS n 
1 389 ASP n 
1 390 CYS n 
1 391 TRP n 
1 392 ASP n 
1 393 ALA n 
1 394 GLU n 
1 395 SER n 
1 396 LYS n 
1 397 THR n 
1 398 SER n 
1 399 TYR n 
1 400 GLY n 
1 401 TRP n 
1 402 ILE n 
1 403 GLU n 
1 404 ILE n 
1 405 VAL n 
1 406 GLY n 
1 407 CYS n 
1 408 ALA n 
1 409 ASP n 
1 410 ARG n 
1 411 SER n 
1 412 CYS n 
1 413 TYR n 
1 414 ASP n 
1 415 LEU n 
1 416 SER n 
1 417 CYS n 
1 418 HIS n 
1 419 ALA n 
1 420 ARG n 
1 421 ALA n 
1 422 THR n 
1 423 LYS n 
1 424 VAL n 
1 425 PRO n 
1 426 LEU n 
1 427 VAL n 
1 428 ALA n 
1 429 GLU n 
1 430 LYS n 
1 431 PRO n 
1 432 LEU n 
1 433 LYS n 
1 434 GLU n 
1 435 PRO n 
1 436 LYS n 
1 437 THR n 
1 438 VAL n 
1 439 ASN n 
1 440 VAL n 
1 441 VAL n 
1 442 GLN n 
1 443 PHE n 
1 444 GLU n 
1 445 PRO n 
1 446 SER n 
1 447 LYS n 
1 448 GLY n 
1 449 ALA n 
1 450 ILE n 
1 451 GLY n 
1 452 LYS n 
1 453 ALA n 
1 454 TYR n 
1 455 LYS n 
1 456 LYS n 
1 457 ASP n 
1 458 ALA n 
1 459 LYS n 
1 460 LEU n 
1 461 VAL n 
1 462 MET n 
1 463 GLU n 
1 464 TYR n 
1 465 LEU n 
1 466 ALA n 
1 467 ILE n 
1 468 CYS n 
1 469 ASP n 
1 470 GLU n 
1 471 CYS n 
1 472 TYR n 
1 473 ILE n 
1 474 THR n 
1 475 GLU n 
1 476 MET n 
1 477 GLU n 
1 478 MET n 
1 479 LEU n 
1 480 LEU n 
1 481 ASN n 
1 482 GLU n 
1 483 LYS n 
1 484 GLY n 
1 485 GLU n 
1 486 PHE n 
1 487 THR n 
1 488 ILE n 
1 489 GLU n 
1 490 THR n 
1 491 GLU n 
1 492 GLY n 
1 493 LYS n 
1 494 THR n 
1 495 PHE n 
1 496 GLN n 
1 497 LEU n 
1 498 THR n 
1 499 LYS n 
1 500 ASP n 
1 501 MET n 
1 502 ILE n 
1 503 ASN n 
1 504 VAL n 
1 505 LYS n 
1 506 ARG n 
1 507 PHE n 
1 508 GLN n 
1 509 LYS n 
1 510 THR n 
1 511 LEU n 
1 512 TYR n 
1 513 VAL n 
1 514 GLU n 
1 515 GLU n 
1 516 VAL n 
1 517 VAL n 
1 518 PRO n 
1 519 ASN n 
1 520 VAL n 
1 521 ILE n 
1 522 GLU n 
1 523 PRO n 
1 524 SER n 
1 525 PHE n 
1 526 GLY n 
1 527 LEU n 
1 528 GLY n 
1 529 ARG n 
1 530 ILE n 
1 531 MET n 
1 532 TYR n 
1 533 THR n 
1 534 VAL n 
1 535 PHE n 
1 536 GLU n 
1 537 HIS n 
1 538 THR n 
1 539 PHE n 
1 540 HIS n 
1 541 VAL n 
1 542 ARG n 
1 543 GLU n 
1 544 GLY n 
1 545 ASP n 
1 546 GLU n 
1 547 GLN n 
1 548 ARG n 
1 549 THR n 
1 550 PHE n 
1 551 PHE n 
1 552 SER n 
1 553 PHE n 
1 554 PRO n 
1 555 ALA n 
1 556 VAL n 
1 557 VAL n 
1 558 ALA n 
1 559 PRO n 
1 560 PHE n 
1 561 LYS n 
1 562 CYS n 
1 563 SER n 
1 564 VAL n 
1 565 LEU n 
1 566 PRO n 
1 567 LEU n 
1 568 SER n 
1 569 GLN n 
1 570 ASN n 
1 571 GLN n 
1 572 GLU n 
1 573 PHE n 
1 574 MET n 
1 575 PRO n 
1 576 PHE n 
1 577 VAL n 
1 578 LYS n 
1 579 GLU n 
1 580 LEU n 
1 581 SER n 
1 582 GLU n 
1 583 ALA n 
1 584 LEU n 
1 585 THR n 
1 586 ARG n 
1 587 HIS n 
1 588 GLY n 
1 589 VAL n 
1 590 SER n 
1 591 HIS n 
1 592 LYS n 
1 593 VAL n 
1 594 ASP n 
1 595 ASP n 
1 596 SER n 
1 597 SER n 
1 598 GLY n 
1 599 SER n 
1 600 ILE n 
1 601 GLY n 
1 602 ARG n 
1 603 ARG n 
1 604 TYR n 
1 605 ALA n 
1 606 ARG n 
1 607 THR n 
1 608 ASP n 
1 609 GLU n 
1 610 ILE n 
1 611 GLY n 
1 612 VAL n 
1 613 ALA n 
1 614 PHE n 
1 615 GLY n 
1 616 VAL n 
1 617 THR n 
1 618 ILE n 
1 619 ASP n 
1 620 PHE n 
1 621 ASP n 
1 622 THR n 
1 623 VAL n 
1 624 ASN n 
1 625 LYS n 
1 626 THR n 
1 627 PRO n 
1 628 HIS n 
1 629 THR n 
1 630 ALA n 
1 631 THR n 
1 632 LEU n 
1 633 ARG n 
1 634 ASP n 
1 635 ARG n 
1 636 ASP n 
1 637 SER n 
1 638 MET n 
1 639 ARG n 
1 640 GLN n 
1 641 ILE n 
1 642 ARG n 
1 643 ALA n 
1 644 GLU n 
1 645 ILE n 
1 646 SER n 
1 647 GLU n 
1 648 LEU n 
1 649 PRO n 
1 650 SER n 
1 651 ILE n 
1 652 VAL n 
1 653 GLN n 
1 654 ASP n 
1 655 LEU n 
1 656 ALA n 
1 657 ASN n 
1 658 GLY n 
1 659 ASN n 
1 660 ILE n 
1 661 THR n 
1 662 TRP n 
1 663 ALA n 
1 664 ASP n 
1 665 VAL n 
1 666 GLU n 
1 667 ALA n 
1 668 ARG n 
1 669 TYR n 
1 670 PRO n 
1 671 LEU n 
1 672 PHE n 
1 673 GLU n 
1 674 GLY n 
1 675 GLN n 
1 676 GLU n 
1 677 THR n 
1 678 GLY n 
1 679 LYS n 
1 680 LYS n 
1 681 GLU n 
1 682 THR n 
1 683 ILE n 
1 684 GLU n 
1 685 GLU n 
1 686 LEU n 
1 687 GLU n 
1 688 HIS n 
1 689 HIS n 
1 690 HIS n 
1 691 HIS n 
1 692 HIS n 
1 693 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 GARS 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21-DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET21a(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SYG_HUMAN 
_struct_ref.pdbx_db_accession          P41250 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRA
DHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYG
WIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLL
NEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQ
IRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEE
;
_struct_ref.pdbx_align_begin           55 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2PME 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 685 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P41250 
_struct_ref_seq.db_align_beg                  55 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  739 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       685 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2PME LEU A 686 ? UNP P41250 ? ? 'CLONING ARTIFACT' 686 1 
1 2PME GLU A 687 ? UNP P41250 ? ? 'CLONING ARTIFACT' 687 2 
1 2PME HIS A 688 ? UNP P41250 ? ? 'CLONING ARTIFACT' 688 3 
1 2PME HIS A 689 ? UNP P41250 ? ? 'CLONING ARTIFACT' 689 4 
1 2PME HIS A 690 ? UNP P41250 ? ? 'CLONING ARTIFACT' 690 5 
1 2PME HIS A 691 ? UNP P41250 ? ? 'CLONING ARTIFACT' 691 6 
1 2PME HIS A 692 ? UNP P41250 ? ? 'CLONING ARTIFACT' 692 7 
1 2PME HIS A 693 ? UNP P41250 ? ? 'CLONING ARTIFACT' 693 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2PME 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.35 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   63.27 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-07-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
# 
_reflns.entry_id                     2PME 
_reflns.d_resolution_high            2.900 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   18765 
_reflns.pdbx_Rmerge_I_obs            0.099 
_reflns.pdbx_netI_over_sigmaI        9.100 
_reflns.pdbx_chi_squared             0.991 
_reflns.pdbx_redundancy              8.900 
_reflns.percent_possible_obs         77.100 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              3.00 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.524 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       0.916 
_reflns_shell.pdbx_redundancy        7.80 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1906 
_reflns_shell.percent_possible_all   80.20 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2PME 
_refine.ls_d_res_high                            2.900 
_refine.ls_d_res_low                             36.830 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    77.340 
_refine.ls_number_reflns_obs                     18744 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.ls_R_factor_obs                          0.232 
_refine.ls_R_factor_R_work                       0.230 
_refine.ls_R_factor_R_free                       0.271 
_refine.ls_percent_reflns_R_free                 5.200 
_refine.ls_number_reflns_R_free                  978 
_refine.B_iso_mean                               55.392 
_refine.aniso_B[1][1]                            -0.040 
_refine.aniso_B[2][2]                            -0.040 
_refine.aniso_B[3][3]                            0.090 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.914 
_refine.correlation_coeff_Fo_to_Fc_free          0.867 
_refine.pdbx_overall_ESU_R                       1.782 
_refine.pdbx_overall_ESU_R_Free                  0.427 
_refine.overall_SU_ML                            0.256 
_refine.overall_SU_B                             13.151 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4136 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             122 
_refine_hist.number_atoms_total               4258 
_refine_hist.d_res_high                       2.900 
_refine_hist.d_res_low                        36.830 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         4229 0.003  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      5711 0.756  1.949  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   517  5.632  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   207  25.307 23.720 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   720  15.039 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   30   13.646 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           617  0.062  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     3243 0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            1978 0.233  0.300  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          2887 0.325  0.500  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    279  0.243  0.500  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   71   0.176  0.300  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 6    0.315  0.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              2644 4.607  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             4170 6.528  4.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1760 3.296  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             1541 4.839  3.000  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.902 
_refine_ls_shell.d_res_low                        2.977 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               80.420 
_refine_ls_shell.number_reflns_R_work             1348 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.308 
_refine_ls_shell.R_factor_R_free                  0.415 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             65 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                1413 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2PME 
_struct.title                     'The Apo crystal Structure of the glycyl-tRNA synthetase' 
_struct.pdbx_descriptor           'Glycyl-tRNA synthetase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2PME 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'ClassIIa aminoacyl tRNA synthetase, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'The biological assembly is a dimer generated asymmetric unit by the operations:  y,x,-z' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 66  ? ARG A 77  ? ASP A 66  ARG A 77  1 ? 12 
HELX_P HELX_P2  2  PHE A 84  ? GLY A 88  ? PHE A 84  GLY A 88  5 ? 5  
HELX_P HELX_P3  3  GLY A 97  ? GLN A 120 ? GLY A 97  GLN A 120 1 ? 24 
HELX_P HELX_P4  4  GLU A 132 ? GLY A 139 ? GLU A 132 GLY A 139 1 ? 8  
HELX_P HELX_P5  5  ALA A 160 ? SER A 173 ? ALA A 160 SER A 173 1 ? 14 
HELX_P HELX_P6  6  SER A 178 ? ALA A 190 ? SER A 178 ALA A 190 1 ? 13 
HELX_P HELX_P7  7  GLN A 191 ? TYR A 195 ? GLN A 191 TYR A 195 5 ? 5  
HELX_P HELX_P8  8  GLY A 196 ? TYR A 207 ? GLY A 196 TYR A 207 1 ? 12 
HELX_P HELX_P9  9  THR A 246 ? ASN A 253 ? THR A 246 ASN A 253 1 ? 8  
HELX_P HELX_P10 10 ASN A 253 ? ASN A 261 ? ASN A 253 ASN A 261 1 ? 9  
HELX_P HELX_P11 11 ASP A 302 ? LYS A 306 ? ASP A 302 LYS A 306 5 ? 5  
HELX_P HELX_P12 12 LYS A 310 ? VAL A 314 ? LYS A 310 VAL A 314 5 ? 5  
HELX_P HELX_P13 13 SER A 323 ? GLY A 330 ? SER A 323 GLY A 330 1 ? 8  
HELX_P HELX_P14 14 LEU A 338 ? GLN A 344 ? LEU A 338 GLN A 344 1 ? 7  
HELX_P HELX_P15 15 ASN A 349 ? GLY A 367 ? ASN A 349 GLY A 367 1 ? 19 
HELX_P HELX_P16 16 SER A 369 ? ASP A 371 ? SER A 369 ASP A 371 5 ? 3  
HELX_P HELX_P17 17 ASP A 414 ? ALA A 419 ? ASP A 414 ALA A 419 1 ? 6  
HELX_P HELX_P18 18 LEU A 527 ? THR A 538 ? LEU A 527 THR A 538 1 ? 12 
HELX_P HELX_P19 19 ASN A 570 ? GLU A 572 ? ASN A 570 GLU A 572 5 ? 3  
HELX_P HELX_P20 20 PHE A 573 ? HIS A 587 ? PHE A 573 HIS A 587 1 ? 15 
HELX_P HELX_P21 21 SER A 599 ? ILE A 610 ? SER A 599 ILE A 610 1 ? 12 
HELX_P HELX_P22 22 ASP A 619 ? ASN A 624 ? ASP A 619 ASN A 624 1 ? 6  
HELX_P HELX_P23 23 GLU A 647 ? ASN A 657 ? GLU A 647 ASN A 657 1 ? 11 
HELX_P HELX_P24 24 THR A 661 ? TYR A 669 ? THR A 661 TYR A 669 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
C ? 3 ? 
D ? 3 ? 
E ? 2 ? 
F ? 2 ? 
G ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? parallel      
B 8 9 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 80  ? GLN A 82  ? TYR A 80  GLN A 82  
A 2 TYR A 94  ? PHE A 96  ? TYR A 94  PHE A 96  
B 1 LEU A 122 ? GLU A 123 ? LEU A 122 GLU A 123 
B 2 PHE A 267 ? PHE A 276 ? PHE A 267 PHE A 276 
B 3 GLU A 291 ? VAL A 301 ? GLU A 291 VAL A 301 
B 4 ASN A 519 ? GLY A 526 ? ASN A 519 GLY A 526 
B 5 GLY A 400 ? ARG A 410 ? GLY A 400 ARG A 410 
B 6 ASP A 389 ? THR A 397 ? ASP A 389 THR A 397 
B 7 LEU A 373 ? GLN A 377 ? LEU A 373 GLN A 377 
B 8 HIS A 318 ? TYR A 322 ? HIS A 318 TYR A 322 
B 9 ARG A 334 ? ARG A 337 ? ARG A 334 ARG A 337 
C 1 LEU A 129 ? PRO A 131 ? LEU A 129 PRO A 131 
C 2 PRO A 239 ? LEU A 242 ? PRO A 239 LEU A 242 
C 3 LYS A 229 ? PHE A 231 ? LYS A 229 PHE A 231 
D 1 GLY A 155 ? ARG A 159 ? GLY A 155 ARG A 159 
D 2 ALA A 145 ? ASP A 151 ? ALA A 145 ASP A 151 
D 3 VAL A 222 ? ASN A 225 ? VAL A 222 ASN A 225 
E 1 GLN A 508 ? LYS A 509 ? GLN A 508 LYS A 509 
E 2 GLU A 515 ? VAL A 516 ? GLU A 515 VAL A 516 
F 1 PHE A 539 ? VAL A 541 ? PHE A 539 VAL A 541 
F 2 THR A 549 ? PHE A 551 ? THR A 549 PHE A 551 
G 1 HIS A 591 ? VAL A 593 ? HIS A 591 VAL A 593 
G 2 CYS A 562 ? PRO A 566 ? CYS A 562 PRO A 566 
G 3 PHE A 614 ? ILE A 618 ? PHE A 614 ILE A 618 
G 4 THR A 629 ? ASP A 634 ? THR A 629 ASP A 634 
G 5 GLN A 640 ? GLU A 644 ? GLN A 640 GLU A 644 
G 6 LEU A 671 ? PHE A 672 ? LEU A 671 PHE A 672 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP A 81  ? N ASP A 81  O ASP A 95  ? O ASP A 95  
B 1 2 N LEU A 122 ? N LEU A 122 O ALA A 268 ? O ALA A 268 
B 2 3 N GLY A 273 ? N GLY A 273 O MET A 294 ? O MET A 294 
B 3 4 N ALA A 295 ? N ALA A 295 O PHE A 525 ? O PHE A 525 
B 4 5 O SER A 524 ? O SER A 524 N GLY A 406 ? N GLY A 406 
B 5 6 O VAL A 405 ? O VAL A 405 N ALA A 393 ? N ALA A 393 
B 6 7 O ASP A 392 ? O ASP A 392 N ARG A 376 ? N ARG A 376 
B 7 8 O PHE A 375 ? O PHE A 375 N TYR A 322 ? N TYR A 322 
B 8 9 N LEU A 321 ? N LEU A 321 O ARG A 334 ? O ARG A 334 
C 1 2 N THR A 130 ? N THR A 130 O TYR A 241 ? O TYR A 241 
C 2 3 O GLY A 240 ? O GLY A 240 N THR A 230 ? N THR A 230 
D 1 2 O PHE A 158 ? O PHE A 158 N VAL A 149 ? N VAL A 149 
D 2 3 N ASP A 146 ? N ASP A 146 O PHE A 224 ? O PHE A 224 
E 1 2 N GLN A 508 ? N GLN A 508 O VAL A 516 ? O VAL A 516 
F 1 2 N HIS A 540 ? N HIS A 540 O PHE A 550 ? O PHE A 550 
G 1 2 O LYS A 592 ? O LYS A 592 N CYS A 562 ? N CYS A 562 
G 2 3 N LEU A 565 ? N LEU A 565 O ILE A 618 ? O ILE A 618 
G 3 4 N GLY A 615 ? N GLY A 615 O ARG A 633 ? O ARG A 633 
G 4 5 N ALA A 630 ? N ALA A 630 O ALA A 643 ? O ALA A 643 
G 5 6 N GLN A 640 ? N GLN A 640 O PHE A 672 ? O PHE A 672 
# 
_atom_sites.entry_id                    2PME 
_atom_sites.fract_transf_matrix[1][1]   0.010900 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010900 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004046 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 63  ? -22.072 29.875  -4.207  1.00 93.30  ? 63  ASP A N   1 
ATOM   2    C CA  . ASP A 1 63  ? -21.621 28.479  -4.470  1.00 95.42  ? 63  ASP A CA  1 
ATOM   3    C C   . ASP A 1 63  ? -20.191 28.257  -3.987  1.00 94.99  ? 63  ASP A C   1 
ATOM   4    O O   . ASP A 1 63  ? -19.368 29.174  -4.012  1.00 97.47  ? 63  ASP A O   1 
ATOM   5    C CB  . ASP A 1 63  ? -21.740 28.153  -5.952  1.00 95.33  ? 63  ASP A CB  1 
ATOM   6    N N   . ILE A 1 64  ? -19.904 27.035  -3.549  1.00 93.42  ? 64  ILE A N   1 
ATOM   7    C CA  . ILE A 1 64  ? -18.578 26.686  -3.051  1.00 90.24  ? 64  ILE A CA  1 
ATOM   8    C C   . ILE A 1 64  ? -17.563 26.599  -4.187  1.00 87.05  ? 64  ILE A C   1 
ATOM   9    O O   . ILE A 1 64  ? -16.531 27.270  -4.160  1.00 86.91  ? 64  ILE A O   1 
ATOM   10   C CB  . ILE A 1 64  ? -18.631 25.375  -2.279  1.00 87.95  ? 64  ILE A CB  1 
ATOM   11   N N   . VAL A 1 65  ? -17.865 25.772  -5.184  1.00 83.13  ? 65  VAL A N   1 
ATOM   12   C CA  . VAL A 1 65  ? -16.989 25.598  -6.338  1.00 73.94  ? 65  VAL A CA  1 
ATOM   13   C C   . VAL A 1 65  ? -17.733 24.929  -7.495  1.00 70.45  ? 65  VAL A C   1 
ATOM   14   O O   . VAL A 1 65  ? -18.753 24.268  -7.291  1.00 70.26  ? 65  VAL A O   1 
ATOM   15   C CB  . VAL A 1 65  ? -15.731 24.772  -5.976  1.00 73.12  ? 65  VAL A CB  1 
ATOM   16   C CG1 . VAL A 1 65  ? -16.090 23.308  -5.768  1.00 71.49  ? 65  VAL A CG1 1 
ATOM   17   C CG2 . VAL A 1 65  ? -14.660 24.920  -7.048  1.00 75.94  ? 65  VAL A CG2 1 
ATOM   18   N N   . ASP A 1 66  ? -17.224 25.116  -8.709  1.00 64.56  ? 66  ASP A N   1 
ATOM   19   C CA  . ASP A 1 66  ? -17.796 24.484  -9.892  1.00 68.33  ? 66  ASP A CA  1 
ATOM   20   C C   . ASP A 1 66  ? -17.174 23.107  -10.084 1.00 66.42  ? 66  ASP A C   1 
ATOM   21   O O   . ASP A 1 66  ? -16.165 22.964  -10.775 1.00 70.51  ? 66  ASP A O   1 
ATOM   22   C CB  . ASP A 1 66  ? -17.550 25.352  -11.128 1.00 69.77  ? 66  ASP A CB  1 
ATOM   23   C CG  . ASP A 1 66  ? -18.288 24.848  -12.356 1.00 72.08  ? 66  ASP A CG  1 
ATOM   24   O OD1 . ASP A 1 66  ? -19.047 23.862  -12.242 1.00 71.54  ? 66  ASP A OD1 1 
ATOM   25   O OD2 . ASP A 1 66  ? -18.110 25.444  -13.439 1.00 73.81  ? 66  ASP A OD2 1 
ATOM   26   N N   . ARG A 1 67  ? -17.779 22.094  -9.473  1.00 62.24  ? 67  ARG A N   1 
ATOM   27   C CA  . ARG A 1 67  ? -17.177 20.766  -9.450  1.00 61.55  ? 67  ARG A CA  1 
ATOM   28   C C   . ARG A 1 67  ? -17.161 20.099  -10.823 1.00 61.62  ? 67  ARG A C   1 
ATOM   29   O O   . ARG A 1 67  ? -16.321 19.241  -11.086 1.00 71.76  ? 67  ARG A O   1 
ATOM   30   C CB  . ARG A 1 67  ? -17.865 19.864  -8.424  1.00 50.95  ? 67  ARG A CB  1 
ATOM   31   C CG  . ARG A 1 67  ? -18.987 19.011  -8.981  1.00 54.81  ? 67  ARG A CG  1 
ATOM   32   C CD  . ARG A 1 67  ? -19.153 17.760  -8.142  1.00 57.82  ? 67  ARG A CD  1 
ATOM   33   N NE  . ARG A 1 67  ? -19.517 18.079  -6.766  1.00 60.47  ? 67  ARG A NE  1 
ATOM   34   C CZ  . ARG A 1 67  ? -20.670 17.734  -6.203  1.00 62.09  ? 67  ARG A CZ  1 
ATOM   35   N NH1 . ARG A 1 67  ? -21.567 17.045  -6.895  1.00 65.06  ? 67  ARG A NH1 1 
ATOM   36   N NH2 . ARG A 1 67  ? -20.923 18.065  -4.944  1.00 62.37  ? 67  ARG A NH2 1 
ATOM   37   N N   . ALA A 1 68  ? -18.084 20.497  -11.693 1.00 58.51  ? 68  ALA A N   1 
ATOM   38   C CA  . ALA A 1 68  ? -18.153 19.938  -13.039 1.00 55.10  ? 68  ALA A CA  1 
ATOM   39   C C   . ALA A 1 68  ? -16.901 20.295  -13.832 1.00 57.12  ? 68  ALA A C   1 
ATOM   40   O O   . ALA A 1 68  ? -16.297 19.436  -14.474 1.00 64.65  ? 68  ALA A O   1 
ATOM   41   C CB  . ALA A 1 68  ? -19.398 20.428  -13.757 1.00 55.47  ? 68  ALA A CB  1 
ATOM   42   N N   . LYS A 1 69  ? -16.521 21.569  -13.784 1.00 57.71  ? 69  LYS A N   1 
ATOM   43   C CA  . LYS A 1 69  ? -15.281 22.017  -14.403 1.00 57.46  ? 69  LYS A CA  1 
ATOM   44   C C   . LYS A 1 69  ? -14.088 21.374  -13.717 1.00 56.36  ? 69  LYS A C   1 
ATOM   45   O O   . LYS A 1 69  ? -13.167 20.894  -14.378 1.00 61.03  ? 69  LYS A O   1 
ATOM   46   C CB  . LYS A 1 69  ? -15.154 23.540  -14.336 1.00 60.94  ? 69  LYS A CB  1 
ATOM   47   C CG  . LYS A 1 69  ? -15.714 24.268  -15.544 1.00 65.84  ? 69  LYS A CG  1 
ATOM   48   C CD  . LYS A 1 69  ? -15.403 25.753  -15.473 1.00 70.43  ? 69  LYS A CD  1 
ATOM   49   C CE  . LYS A 1 69  ? -15.909 26.483  -16.706 1.00 74.30  ? 69  LYS A CE  1 
ATOM   50   N NZ  . LYS A 1 69  ? -15.807 27.960  -16.545 1.00 77.82  ? 69  LYS A NZ  1 
ATOM   51   N N   . MET A 1 70  ? -14.109 21.366  -12.388 1.00 53.29  ? 70  MET A N   1 
ATOM   52   C CA  . MET A 1 70  ? -13.010 20.796  -11.623 1.00 45.56  ? 70  MET A CA  1 
ATOM   53   C C   . MET A 1 70  ? -12.812 19.324  -11.968 1.00 43.51  ? 70  MET A C   1 
ATOM   54   O O   . MET A 1 70  ? -11.685 18.873  -12.162 1.00 39.63  ? 70  MET A O   1 
ATOM   55   C CB  . MET A 1 70  ? -13.237 20.965  -10.120 1.00 38.88  ? 70  MET A CB  1 
ATOM   56   C CG  . MET A 1 70  ? -11.975 20.755  -9.298  1.00 35.11  ? 70  MET A CG  1 
ATOM   57   S SD  . MET A 1 70  ? -12.311 20.407  -7.566  1.00 36.76  ? 70  MET A SD  1 
ATOM   58   C CE  . MET A 1 70  ? -13.494 19.071  -7.726  1.00 29.06  ? 70  MET A CE  1 
ATOM   59   N N   . GLU A 1 71  ? -13.911 18.581  -12.056 1.00 37.98  ? 71  GLU A N   1 
ATOM   60   C CA  . GLU A 1 71  ? -13.845 17.155  -12.356 1.00 48.69  ? 71  GLU A CA  1 
ATOM   61   C C   . GLU A 1 71  ? -13.390 16.876  -13.785 1.00 51.21  ? 71  GLU A C   1 
ATOM   62   O O   . GLU A 1 71  ? -12.664 15.912  -14.030 1.00 54.92  ? 71  GLU A O   1 
ATOM   63   C CB  . GLU A 1 71  ? -15.187 16.476  -12.078 1.00 50.45  ? 71  GLU A CB  1 
ATOM   64   C CG  . GLU A 1 71  ? -15.511 16.346  -10.598 1.00 56.04  ? 71  GLU A CG  1 
ATOM   65   C CD  . GLU A 1 71  ? -16.844 15.671  -10.345 1.00 61.11  ? 71  GLU A CD  1 
ATOM   66   O OE1 . GLU A 1 71  ? -17.656 15.572  -11.290 1.00 65.22  ? 71  GLU A OE1 1 
ATOM   67   O OE2 . GLU A 1 71  ? -17.082 15.240  -9.197  1.00 61.73  ? 71  GLU A OE2 1 
ATOM   68   N N   . ASP A 1 72  ? -13.814 17.715  -14.726 1.00 56.72  ? 72  ASP A N   1 
ATOM   69   C CA  . ASP A 1 72  ? -13.395 17.553  -16.113 1.00 60.84  ? 72  ASP A CA  1 
ATOM   70   C C   . ASP A 1 72  ? -11.890 17.764  -16.237 1.00 53.52  ? 72  ASP A C   1 
ATOM   71   O O   . ASP A 1 72  ? -11.215 17.048  -16.975 1.00 46.45  ? 72  ASP A O   1 
ATOM   72   C CB  . ASP A 1 72  ? -14.143 18.515  -17.037 1.00 67.97  ? 72  ASP A CB  1 
ATOM   73   C CG  . ASP A 1 72  ? -13.953 18.175  -18.505 1.00 71.19  ? 72  ASP A CG  1 
ATOM   74   O OD1 . ASP A 1 72  ? -13.442 19.033  -19.256 1.00 72.77  ? 72  ASP A OD1 1 
ATOM   75   O OD2 . ASP A 1 72  ? -14.304 17.044  -18.906 1.00 70.06  ? 72  ASP A OD2 1 
ATOM   76   N N   . THR A 1 73  ? -11.373 18.748  -15.505 1.00 42.99  ? 73  THR A N   1 
ATOM   77   C CA  . THR A 1 73  ? -9.940  19.022  -15.492 1.00 45.41  ? 73  THR A CA  1 
ATOM   78   C C   . THR A 1 73  ? -9.168  17.885  -14.828 1.00 46.14  ? 73  THR A C   1 
ATOM   79   O O   . THR A 1 73  ? -8.184  17.389  -15.379 1.00 47.28  ? 73  THR A O   1 
ATOM   80   C CB  . THR A 1 73  ? -9.620  20.347  -14.772 1.00 41.96  ? 73  THR A CB  1 
ATOM   81   O OG1 . THR A 1 73  ? -10.128 21.442  -15.542 1.00 45.15  ? 73  THR A OG1 1 
ATOM   82   C CG2 . THR A 1 73  ? -8.116  20.516  -14.601 1.00 39.29  ? 73  THR A CG2 1 
ATOM   83   N N   . LEU A 1 74  ? -9.620  17.476  -13.646 1.00 37.12  ? 74  LEU A N   1 
ATOM   84   C CA  . LEU A 1 74  ? -8.986  16.383  -12.920 1.00 39.52  ? 74  LEU A CA  1 
ATOM   85   C C   . LEU A 1 74  ? -8.914  15.128  -13.784 1.00 43.87  ? 74  LEU A C   1 
ATOM   86   O O   . LEU A 1 74  ? -7.970  14.343  -13.682 1.00 43.32  ? 74  LEU A O   1 
ATOM   87   C CB  . LEU A 1 74  ? -9.749  16.086  -11.627 1.00 37.09  ? 74  LEU A CB  1 
ATOM   88   C CG  . LEU A 1 74  ? -9.708  17.175  -10.552 1.00 38.96  ? 74  LEU A CG  1 
ATOM   89   C CD1 . LEU A 1 74  ? -10.761 16.925  -9.482  1.00 34.18  ? 74  LEU A CD1 1 
ATOM   90   C CD2 . LEU A 1 74  ? -8.319  17.277  -9.934  1.00 39.19  ? 74  LEU A CD2 1 
ATOM   91   N N   . LYS A 1 75  ? -9.914  14.952  -14.640 1.00 43.41  ? 75  LYS A N   1 
ATOM   92   C CA  . LYS A 1 75  ? -10.005 13.771  -15.485 1.00 45.23  ? 75  LYS A CA  1 
ATOM   93   C C   . LYS A 1 75  ? -9.159  13.916  -16.741 1.00 43.56  ? 75  LYS A C   1 
ATOM   94   O O   . LYS A 1 75  ? -8.447  12.991  -17.133 1.00 51.68  ? 75  LYS A O   1 
ATOM   95   C CB  . LYS A 1 75  ? -11.462 13.506  -15.870 1.00 52.37  ? 75  LYS A CB  1 
ATOM   96   C CG  . LYS A 1 75  ? -11.664 12.269  -16.727 1.00 56.11  ? 75  LYS A CG  1 
ATOM   97   C CD  . LYS A 1 75  ? -13.095 12.172  -17.227 1.00 61.27  ? 75  LYS A CD  1 
ATOM   98   C CE  . LYS A 1 75  ? -13.298 10.911  -18.054 1.00 67.30  ? 75  LYS A CE  1 
ATOM   99   N NZ  . LYS A 1 75  ? -14.690 10.803  -18.573 1.00 69.68  ? 75  LYS A NZ  1 
ATOM   100  N N   . ARG A 1 76  ? -9.241  15.084  -17.368 1.00 45.81  ? 76  ARG A N   1 
ATOM   101  C CA  . ARG A 1 76  ? -8.555  15.322  -18.630 1.00 45.86  ? 76  ARG A CA  1 
ATOM   102  C C   . ARG A 1 76  ? -7.039  15.325  -18.450 1.00 47.45  ? 76  ARG A C   1 
ATOM   103  O O   . ARG A 1 76  ? -6.301  14.899  -19.337 1.00 53.11  ? 76  ARG A O   1 
ATOM   104  C CB  . ARG A 1 76  ? -9.030  16.637  -19.246 1.00 51.64  ? 76  ARG A CB  1 
ATOM   105  C CG  . ARG A 1 76  ? -8.812  16.740  -20.743 1.00 59.90  ? 76  ARG A CG  1 
ATOM   106  C CD  . ARG A 1 76  ? -9.608  17.896  -21.325 1.00 61.91  ? 76  ARG A CD  1 
ATOM   107  N NE  . ARG A 1 76  ? -9.660  19.032  -20.410 1.00 65.45  ? 76  ARG A NE  1 
ATOM   108  C CZ  . ARG A 1 76  ? -8.618  19.805  -20.115 1.00 67.97  ? 76  ARG A CZ  1 
ATOM   109  N NH1 . ARG A 1 76  ? -7.431  19.566  -20.660 1.00 67.72  ? 76  ARG A NH1 1 
ATOM   110  N NH2 . ARG A 1 76  ? -8.763  20.815  -19.270 1.00 67.96  ? 76  ARG A NH2 1 
ATOM   111  N N   . ARG A 1 77  ? -6.583  15.805  -17.296 1.00 50.08  ? 77  ARG A N   1 
ATOM   112  C CA  . ARG A 1 77  ? -5.158  15.803  -16.979 1.00 54.22  ? 77  ARG A CA  1 
ATOM   113  C C   . ARG A 1 77  ? -4.760  14.575  -16.167 1.00 53.32  ? 77  ARG A C   1 
ATOM   114  O O   . ARG A 1 77  ? -3.598  14.413  -15.790 1.00 54.16  ? 77  ARG A O   1 
ATOM   115  C CB  . ARG A 1 77  ? -4.758  17.090  -16.256 1.00 55.44  ? 77  ARG A CB  1 
ATOM   116  C CG  . ARG A 1 77  ? -4.527  18.254  -17.199 1.00 57.70  ? 77  ARG A CG  1 
ATOM   117  C CD  . ARG A 1 77  ? -3.749  17.789  -18.419 1.00 60.85  ? 77  ARG A CD  1 
ATOM   118  N NE  . ARG A 1 77  ? -3.405  18.889  -19.312 1.00 66.37  ? 77  ARG A NE  1 
ATOM   119  C CZ  . ARG A 1 77  ? -2.229  19.507  -19.316 1.00 69.66  ? 77  ARG A CZ  1 
ATOM   120  N NH1 . ARG A 1 77  ? -1.276  19.134  -18.472 1.00 70.13  ? 77  ARG A NH1 1 
ATOM   121  N NH2 . ARG A 1 77  ? -2.005  20.497  -20.166 1.00 72.74  ? 77  ARG A NH2 1 
ATOM   122  N N   . PHE A 1 78  ? -5.742  13.716  -15.909 1.00 51.37  ? 78  PHE A N   1 
ATOM   123  C CA  . PHE A 1 78  ? -5.520  12.430  -15.255 1.00 42.95  ? 78  PHE A CA  1 
ATOM   124  C C   . PHE A 1 78  ? -4.853  12.549  -13.883 1.00 44.74  ? 78  PHE A C   1 
ATOM   125  O O   . PHE A 1 78  ? -3.798  11.963  -13.638 1.00 43.45  ? 78  PHE A O   1 
ATOM   126  C CB  . PHE A 1 78  ? -4.734  11.485  -16.174 1.00 35.45  ? 78  PHE A CB  1 
ATOM   127  C CG  . PHE A 1 78  ? -4.782  10.042  -15.752 1.00 33.49  ? 78  PHE A CG  1 
ATOM   128  C CD1 . PHE A 1 78  ? -3.720  9.193   -16.022 1.00 31.52  ? 78  PHE A CD1 1 
ATOM   129  C CD2 . PHE A 1 78  ? -5.884  9.536   -15.081 1.00 32.54  ? 78  PHE A CD2 1 
ATOM   130  C CE1 . PHE A 1 78  ? -3.759  7.864   -15.636 1.00 30.96  ? 78  PHE A CE1 1 
ATOM   131  C CE2 . PHE A 1 78  ? -5.929  8.208   -14.689 1.00 30.21  ? 78  PHE A CE2 1 
ATOM   132  C CZ  . PHE A 1 78  ? -4.864  7.371   -14.967 1.00 31.43  ? 78  PHE A CZ  1 
ATOM   133  N N   . PHE A 1 79  ? -5.473  13.326  -13.000 1.00 44.57  ? 79  PHE A N   1 
ATOM   134  C CA  . PHE A 1 79  ? -5.099  13.329  -11.593 1.00 39.70  ? 79  PHE A CA  1 
ATOM   135  C C   . PHE A 1 79  ? -5.566  12.003  -11.008 1.00 42.48  ? 79  PHE A C   1 
ATOM   136  O O   . PHE A 1 79  ? -4.788  11.258  -10.413 1.00 39.31  ? 79  PHE A O   1 
ATOM   137  C CB  . PHE A 1 79  ? -5.770  14.487  -10.855 1.00 36.42  ? 79  PHE A CB  1 
ATOM   138  C CG  . PHE A 1 79  ? -5.106  15.817  -11.072 1.00 37.60  ? 79  PHE A CG  1 
ATOM   139  C CD1 . PHE A 1 79  ? -4.275  16.355  -10.102 1.00 37.47  ? 79  PHE A CD1 1 
ATOM   140  C CD2 . PHE A 1 79  ? -5.317  16.532  -12.240 1.00 37.80  ? 79  PHE A CD2 1 
ATOM   141  C CE1 . PHE A 1 79  ? -3.664  17.582  -10.292 1.00 34.33  ? 79  PHE A CE1 1 
ATOM   142  C CE2 . PHE A 1 79  ? -4.708  17.760  -12.438 1.00 38.14  ? 79  PHE A CE2 1 
ATOM   143  C CZ  . PHE A 1 79  ? -3.880  18.285  -11.462 1.00 35.60  ? 79  PHE A CZ  1 
ATOM   144  N N   . TYR A 1 80  ? -6.852  11.724  -11.196 1.00 38.20  ? 80  TYR A N   1 
ATOM   145  C CA  . TYR A 1 80  ? -7.451  10.460  -10.798 1.00 44.81  ? 80  TYR A CA  1 
ATOM   146  C C   . TYR A 1 80  ? -8.682  10.198  -11.659 1.00 51.18  ? 80  TYR A C   1 
ATOM   147  O O   . TYR A 1 80  ? -9.382  11.132  -12.052 1.00 63.77  ? 80  TYR A O   1 
ATOM   148  C CB  . TYR A 1 80  ? -7.823  10.474  -9.312  1.00 46.23  ? 80  TYR A CB  1 
ATOM   149  C CG  . TYR A 1 80  ? -8.925  11.447  -8.950  1.00 44.84  ? 80  TYR A CG  1 
ATOM   150  C CD1 . TYR A 1 80  ? -10.250 11.033  -8.884  1.00 40.86  ? 80  TYR A CD1 1 
ATOM   151  C CD2 . TYR A 1 80  ? -8.640  12.777  -8.667  1.00 40.02  ? 80  TYR A CD2 1 
ATOM   152  C CE1 . TYR A 1 80  ? -11.260 11.915  -8.554  1.00 40.53  ? 80  TYR A CE1 1 
ATOM   153  C CE2 . TYR A 1 80  ? -9.644  13.667  -8.334  1.00 43.47  ? 80  TYR A CE2 1 
ATOM   154  C CZ  . TYR A 1 80  ? -10.952 13.230  -8.279  1.00 44.43  ? 80  TYR A CZ  1 
ATOM   155  O OH  . TYR A 1 80  ? -11.958 14.110  -7.948  1.00 46.28  ? 80  TYR A OH  1 
ATOM   156  N N   . ASP A 1 81  ? -8.940  8.930   -11.958 1.00 50.51  ? 81  ASP A N   1 
ATOM   157  C CA  . ASP A 1 81  ? -10.075 8.568   -12.799 1.00 47.93  ? 81  ASP A CA  1 
ATOM   158  C C   . ASP A 1 81  ? -10.681 7.241   -12.356 1.00 49.02  ? 81  ASP A C   1 
ATOM   159  O O   . ASP A 1 81  ? -10.085 6.510   -11.564 1.00 40.97  ? 81  ASP A O   1 
ATOM   160  C CB  . ASP A 1 81  ? -9.649  8.498   -14.269 1.00 60.62  ? 81  ASP A CB  1 
ATOM   161  C CG  . ASP A 1 81  ? -10.824 8.604   -15.227 1.00 65.86  ? 81  ASP A CG  1 
ATOM   162  O OD1 . ASP A 1 81  ? -11.931 8.974   -14.782 1.00 65.80  ? 81  ASP A OD1 1 
ATOM   163  O OD2 . ASP A 1 81  ? -10.638 8.320   -16.429 1.00 70.40  ? 81  ASP A OD2 1 
ATOM   164  N N   . GLN A 1 82  ? -11.871 6.940   -12.868 1.00 52.16  ? 82  GLN A N   1 
ATOM   165  C CA  . GLN A 1 82  ? -12.570 5.709   -12.523 1.00 55.53  ? 82  GLN A CA  1 
ATOM   166  C C   . GLN A 1 82  ? -11.758 4.486   -12.928 1.00 47.41  ? 82  GLN A C   1 
ATOM   167  O O   . GLN A 1 82  ? -11.362 4.346   -14.085 1.00 51.02  ? 82  GLN A O   1 
ATOM   168  C CB  . GLN A 1 82  ? -13.947 5.668   -13.188 1.00 62.62  ? 82  GLN A CB  1 
ATOM   169  C CG  . GLN A 1 82  ? -14.802 4.482   -12.771 1.00 70.85  ? 82  GLN A CG  1 
ATOM   170  C CD  . GLN A 1 82  ? -16.149 4.461   -13.465 1.00 75.14  ? 82  GLN A CD  1 
ATOM   171  O OE1 . GLN A 1 82  ? -16.318 5.042   -14.537 1.00 79.85  ? 82  GLN A OE1 1 
ATOM   172  N NE2 . GLN A 1 82  ? -17.118 3.786   -12.856 1.00 78.48  ? 82  GLN A NE2 1 
ATOM   173  N N   . ALA A 1 83  ? -11.511 3.605   -11.964 1.00 43.14  ? 83  ALA A N   1 
ATOM   174  C CA  . ALA A 1 83  ? -10.741 2.394   -12.208 1.00 38.84  ? 83  ALA A CA  1 
ATOM   175  C C   . ALA A 1 83  ? -11.492 1.449   -13.139 1.00 44.98  ? 83  ALA A C   1 
ATOM   176  O O   . ALA A 1 83  ? -12.722 1.400   -13.124 1.00 55.37  ? 83  ALA A O   1 
ATOM   177  C CB  . ALA A 1 83  ? -10.422 1.701   -10.894 1.00 22.73  ? 83  ALA A CB  1 
ATOM   178  N N   . PHE A 1 84  ? -10.741 0.706   -13.949 1.00 46.49  ? 84  PHE A N   1 
ATOM   179  C CA  . PHE A 1 84  ? -11.311 -0.286  -14.858 1.00 38.90  ? 84  PHE A CA  1 
ATOM   180  C C   . PHE A 1 84  ? -12.337 0.331   -15.806 1.00 43.20  ? 84  PHE A C   1 
ATOM   181  O O   . PHE A 1 84  ? -13.417 -0.224  -16.009 1.00 43.50  ? 84  PHE A O   1 
ATOM   182  C CB  . PHE A 1 84  ? -11.944 -1.438  -14.069 1.00 35.62  ? 84  PHE A CB  1 
ATOM   183  C CG  . PHE A 1 84  ? -11.086 -1.948  -12.945 1.00 38.84  ? 84  PHE A CG  1 
ATOM   184  C CD1 . PHE A 1 84  ? -11.368 -1.611  -11.631 1.00 38.55  ? 84  PHE A CD1 1 
ATOM   185  C CD2 . PHE A 1 84  ? -9.995  -2.763  -13.202 1.00 39.94  ? 84  PHE A CD2 1 
ATOM   186  C CE1 . PHE A 1 84  ? -10.578 -2.075  -10.594 1.00 38.17  ? 84  PHE A CE1 1 
ATOM   187  C CE2 . PHE A 1 84  ? -9.201  -3.233  -12.169 1.00 38.91  ? 84  PHE A CE2 1 
ATOM   188  C CZ  . PHE A 1 84  ? -9.493  -2.888  -10.863 1.00 37.68  ? 84  PHE A CZ  1 
ATOM   189  N N   . ALA A 1 85  ? -11.989 1.477   -16.385 1.00 38.04  ? 85  ALA A N   1 
ATOM   190  C CA  . ALA A 1 85  ? -12.897 2.201   -17.272 1.00 42.91  ? 85  ALA A CA  1 
ATOM   191  C C   . ALA A 1 85  ? -13.308 1.379   -18.491 1.00 48.71  ? 85  ALA A C   1 
ATOM   192  O O   . ALA A 1 85  ? -14.460 1.434   -18.924 1.00 55.00  ? 85  ALA A O   1 
ATOM   193  C CB  . ALA A 1 85  ? -12.275 3.520   -17.707 1.00 38.97  ? 85  ALA A CB  1 
ATOM   194  N N   . ILE A 1 86  ? -12.366 0.617   -19.038 1.00 52.59  ? 86  ILE A N   1 
ATOM   195  C CA  . ILE A 1 86  ? -12.627 -0.187  -20.230 1.00 50.23  ? 86  ILE A CA  1 
ATOM   196  C C   . ILE A 1 86  ? -13.452 -1.434  -19.917 1.00 52.04  ? 86  ILE A C   1 
ATOM   197  O O   . ILE A 1 86  ? -13.862 -2.161  -20.822 1.00 58.34  ? 86  ILE A O   1 
ATOM   198  C CB  . ILE A 1 86  ? -11.321 -0.587  -20.951 1.00 55.50  ? 86  ILE A CB  1 
ATOM   199  C CG1 . ILE A 1 86  ? -10.447 -1.457  -20.045 1.00 59.42  ? 86  ILE A CG1 1 
ATOM   200  C CG2 . ILE A 1 86  ? -10.560 0.653   -21.404 1.00 53.70  ? 86  ILE A CG2 1 
ATOM   201  C CD1 . ILE A 1 86  ? -9.231  -2.035  -20.742 1.00 56.85  ? 86  ILE A CD1 1 
ATOM   202  N N   . TYR A 1 87  ? -13.694 -1.675  -18.632 1.00 54.25  ? 87  TYR A N   1 
ATOM   203  C CA  . TYR A 1 87  ? -14.521 -2.798  -18.200 1.00 53.74  ? 87  TYR A CA  1 
ATOM   204  C C   . TYR A 1 87  ? -15.863 -2.329  -17.650 1.00 52.83  ? 87  TYR A C   1 
ATOM   205  O O   . TYR A 1 87  ? -16.607 -3.109  -17.054 1.00 50.37  ? 87  TYR A O   1 
ATOM   206  C CB  . TYR A 1 87  ? -13.788 -3.641  -17.154 1.00 53.03  ? 87  TYR A CB  1 
ATOM   207  C CG  . TYR A 1 87  ? -12.867 -4.678  -17.750 1.00 53.01  ? 87  TYR A CG  1 
ATOM   208  C CD1 . TYR A 1 87  ? -13.294 -5.987  -17.936 1.00 51.65  ? 87  TYR A CD1 1 
ATOM   209  C CD2 . TYR A 1 87  ? -11.574 -4.348  -18.135 1.00 52.62  ? 87  TYR A CD2 1 
ATOM   210  C CE1 . TYR A 1 87  ? -12.457 -6.940  -18.484 1.00 53.60  ? 87  TYR A CE1 1 
ATOM   211  C CE2 . TYR A 1 87  ? -10.729 -5.294  -18.685 1.00 52.02  ? 87  TYR A CE2 1 
ATOM   212  C CZ  . TYR A 1 87  ? -11.176 -6.587  -18.856 1.00 52.55  ? 87  TYR A CZ  1 
ATOM   213  O OH  . TYR A 1 87  ? -10.340 -7.528  -19.403 1.00 50.24  ? 87  TYR A OH  1 
ATOM   214  N N   . GLY A 1 88  ? -16.167 -1.052  -17.857 1.00 50.21  ? 88  GLY A N   1 
ATOM   215  C CA  . GLY A 1 88  ? -17.415 -0.473  -17.376 1.00 55.93  ? 88  GLY A CA  1 
ATOM   216  C C   . GLY A 1 88  ? -17.213 0.406   -16.158 1.00 57.21  ? 88  GLY A C   1 
ATOM   217  O O   . GLY A 1 88  ? -18.037 1.272   -15.863 1.00 62.96  ? 88  GLY A O   1 
ATOM   218  N N   . GLY A 1 89  ? -16.111 0.181   -15.448 1.00 59.05  ? 89  GLY A N   1 
ATOM   219  C CA  . GLY A 1 89  ? -15.785 0.964   -14.262 1.00 55.32  ? 89  GLY A CA  1 
ATOM   220  C C   . GLY A 1 89  ? -16.418 0.420   -12.997 1.00 58.12  ? 89  GLY A C   1 
ATOM   221  O O   . GLY A 1 89  ? -17.583 0.023   -12.994 1.00 71.22  ? 89  GLY A O   1 
ATOM   222  N N   . VAL A 1 90  ? -15.645 0.400   -11.916 1.00 55.95  ? 90  VAL A N   1 
ATOM   223  C CA  . VAL A 1 90  ? -16.143 -0.053  -10.624 1.00 49.25  ? 90  VAL A CA  1 
ATOM   224  C C   . VAL A 1 90  ? -16.350 1.137   -9.692  1.00 46.89  ? 90  VAL A C   1 
ATOM   225  O O   . VAL A 1 90  ? -15.482 2.002   -9.571  1.00 47.39  ? 90  VAL A O   1 
ATOM   226  C CB  . VAL A 1 90  ? -15.182 -1.067  -9.967  1.00 47.50  ? 90  VAL A CB  1 
ATOM   227  C CG1 . VAL A 1 90  ? -15.739 -1.552  -8.635  1.00 40.02  ? 90  VAL A CG1 1 
ATOM   228  C CG2 . VAL A 1 90  ? -14.934 -2.241  -10.901 1.00 46.76  ? 90  VAL A CG2 1 
ATOM   229  N N   . SER A 1 91  ? -17.506 1.175   -9.039  1.00 48.01  ? 91  SER A N   1 
ATOM   230  C CA  . SER A 1 91  ? -17.838 2.260   -8.124  1.00 44.98  ? 91  SER A CA  1 
ATOM   231  C C   . SER A 1 91  ? -17.023 2.172   -6.838  1.00 43.35  ? 91  SER A C   1 
ATOM   232  O O   . SER A 1 91  ? -16.850 1.091   -6.273  1.00 37.56  ? 91  SER A O   1 
ATOM   233  C CB  . SER A 1 91  ? -19.332 2.241   -7.799  1.00 49.89  ? 91  SER A CB  1 
ATOM   234  O OG  . SER A 1 91  ? -20.111 2.278   -8.982  1.00 55.80  ? 91  SER A OG  1 
ATOM   235  N N   . GLY A 1 92  ? -16.522 3.316   -6.385  1.00 37.56  ? 92  GLY A N   1 
ATOM   236  C CA  . GLY A 1 92  ? -15.768 3.384   -5.138  1.00 40.82  ? 92  GLY A CA  1 
ATOM   237  C C   . GLY A 1 92  ? -14.283 3.126   -5.307  1.00 36.69  ? 92  GLY A C   1 
ATOM   238  O O   . GLY A 1 92  ? -13.524 3.174   -4.340  1.00 32.13  ? 92  GLY A O   1 
ATOM   239  N N   . LEU A 1 93  ? -13.868 2.850   -6.539  1.00 35.84  ? 93  LEU A N   1 
ATOM   240  C CA  . LEU A 1 93  ? -12.464 2.586   -6.835  1.00 32.09  ? 93  LEU A CA  1 
ATOM   241  C C   . LEU A 1 93  ? -11.931 3.567   -7.873  1.00 31.71  ? 93  LEU A C   1 
ATOM   242  O O   . LEU A 1 93  ? -12.581 3.825   -8.887  1.00 32.63  ? 93  LEU A O   1 
ATOM   243  C CB  . LEU A 1 93  ? -12.278 1.145   -7.317  1.00 30.15  ? 93  LEU A CB  1 
ATOM   244  C CG  . LEU A 1 93  ? -12.747 0.032   -6.374  1.00 31.37  ? 93  LEU A CG  1 
ATOM   245  C CD1 . LEU A 1 93  ? -12.404 -1.335  -6.947  1.00 31.28  ? 93  LEU A CD1 1 
ATOM   246  C CD2 . LEU A 1 93  ? -12.142 0.196   -4.987  1.00 28.06  ? 93  LEU A CD2 1 
ATOM   247  N N   . TYR A 1 94  ? -10.747 4.115   -7.615  1.00 33.73  ? 94  TYR A N   1 
ATOM   248  C CA  . TYR A 1 94  ? -10.155 5.107   -8.507  1.00 32.19  ? 94  TYR A CA  1 
ATOM   249  C C   . TYR A 1 94  ? -8.670  4.871   -8.754  1.00 33.19  ? 94  TYR A C   1 
ATOM   250  O O   . TYR A 1 94  ? -7.953  4.369   -7.887  1.00 32.26  ? 94  TYR A O   1 
ATOM   251  C CB  . TYR A 1 94  ? -10.375 6.521   -7.962  1.00 35.70  ? 94  TYR A CB  1 
ATOM   252  C CG  . TYR A 1 94  ? -11.808 6.991   -8.064  1.00 37.25  ? 94  TYR A CG  1 
ATOM   253  C CD1 . TYR A 1 94  ? -12.694 6.816   -7.008  1.00 36.00  ? 94  TYR A CD1 1 
ATOM   254  C CD2 . TYR A 1 94  ? -12.277 7.602   -9.220  1.00 34.27  ? 94  TYR A CD2 1 
ATOM   255  C CE1 . TYR A 1 94  ? -14.006 7.241   -7.100  1.00 37.41  ? 94  TYR A CE1 1 
ATOM   256  C CE2 . TYR A 1 94  ? -13.587 8.030   -9.320  1.00 36.00  ? 94  TYR A CE2 1 
ATOM   257  C CZ  . TYR A 1 94  ? -14.446 7.847   -8.258  1.00 36.52  ? 94  TYR A CZ  1 
ATOM   258  O OH  . TYR A 1 94  ? -15.751 8.271   -8.354  1.00 39.97  ? 94  TYR A OH  1 
ATOM   259  N N   . ASP A 1 95  ? -8.220  5.238   -9.949  1.00 34.82  ? 95  ASP A N   1 
ATOM   260  C CA  . ASP A 1 95  ? -6.811  5.155   -10.303 1.00 37.23  ? 95  ASP A CA  1 
ATOM   261  C C   . ASP A 1 95  ? -6.206  6.550   -10.371 1.00 37.60  ? 95  ASP A C   1 
ATOM   262  O O   . ASP A 1 95  ? -6.679  7.404   -11.120 1.00 40.32  ? 95  ASP A O   1 
ATOM   263  C CB  . ASP A 1 95  ? -6.634  4.450   -11.650 1.00 40.89  ? 95  ASP A CB  1 
ATOM   264  C CG  . ASP A 1 95  ? -6.928  2.965   -11.576 1.00 48.10  ? 95  ASP A CG  1 
ATOM   265  O OD1 . ASP A 1 95  ? -7.153  2.453   -10.459 1.00 50.38  ? 95  ASP A OD1 1 
ATOM   266  O OD2 . ASP A 1 95  ? -6.929  2.308   -12.638 1.00 54.52  ? 95  ASP A OD2 1 
ATOM   267  N N   . PHE A 1 96  ? -5.163  6.780   -9.581  1.00 34.82  ? 96  PHE A N   1 
ATOM   268  C CA  . PHE A 1 96  ? -4.454  8.051   -9.612  1.00 32.37  ? 96  PHE A CA  1 
ATOM   269  C C   . PHE A 1 96  ? -3.393  8.040   -10.707 1.00 29.53  ? 96  PHE A C   1 
ATOM   270  O O   . PHE A 1 96  ? -2.582  7.118   -10.787 1.00 32.13  ? 96  PHE A O   1 
ATOM   271  C CB  . PHE A 1 96  ? -3.824  8.352   -8.251  1.00 35.88  ? 96  PHE A CB  1 
ATOM   272  C CG  . PHE A 1 96  ? -4.822  8.725   -7.192  1.00 39.88  ? 96  PHE A CG  1 
ATOM   273  C CD1 . PHE A 1 96  ? -5.501  7.745   -6.483  1.00 42.76  ? 96  PHE A CD1 1 
ATOM   274  C CD2 . PHE A 1 96  ? -5.083  10.055  -6.907  1.00 39.32  ? 96  PHE A CD2 1 
ATOM   275  C CE1 . PHE A 1 96  ? -6.423  8.087   -5.510  1.00 43.02  ? 96  PHE A CE1 1 
ATOM   276  C CE2 . PHE A 1 96  ? -6.003  10.404  -5.934  1.00 38.65  ? 96  PHE A CE2 1 
ATOM   277  C CZ  . PHE A 1 96  ? -6.674  9.420   -5.235  1.00 41.17  ? 96  PHE A CZ  1 
ATOM   278  N N   . GLY A 1 97  ? -3.414  9.064   -11.554 1.00 28.90  ? 97  GLY A N   1 
ATOM   279  C CA  . GLY A 1 97  ? -2.469  9.167   -12.661 1.00 30.13  ? 97  GLY A CA  1 
ATOM   280  C C   . GLY A 1 97  ? -1.181  9.861   -12.264 1.00 32.71  ? 97  GLY A C   1 
ATOM   281  O O   . GLY A 1 97  ? -1.042  10.307  -11.126 1.00 37.51  ? 97  GLY A O   1 
ATOM   282  N N   . PRO A 1 98  ? -0.231  9.962   -13.208 1.00 32.51  ? 98  PRO A N   1 
ATOM   283  C CA  . PRO A 1 98  ? 1.093   10.529  -12.959 1.00 29.81  ? 98  PRO A CA  1 
ATOM   284  C C   . PRO A 1 98  ? 1.053   11.812  -12.134 1.00 34.40  ? 98  PRO A C   1 
ATOM   285  O O   . PRO A 1 98  ? 1.831   11.965  -11.192 1.00 39.91  ? 98  PRO A O   1 
ATOM   286  C CB  . PRO A 1 98  ? 1.610   10.823  -14.366 1.00 27.53  ? 98  PRO A CB  1 
ATOM   287  C CG  . PRO A 1 98  ? 0.969   9.785   -15.210 1.00 27.86  ? 98  PRO A CG  1 
ATOM   288  C CD  . PRO A 1 98  ? -0.387  9.525   -14.607 1.00 28.03  ? 98  PRO A CD  1 
ATOM   289  N N   . VAL A 1 99  ? 0.153   12.723  -12.490 1.00 38.93  ? 99  VAL A N   1 
ATOM   290  C CA  . VAL A 1 99  ? 0.036   13.998  -11.789 1.00 40.51  ? 99  VAL A CA  1 
ATOM   291  C C   . VAL A 1 99  ? -0.563  13.804  -10.399 1.00 32.44  ? 99  VAL A C   1 
ATOM   292  O O   . VAL A 1 99  ? -0.050  14.334  -9.414  1.00 36.35  ? 99  VAL A O   1 
ATOM   293  C CB  . VAL A 1 99  ? -0.810  15.011  -12.588 1.00 41.12  ? 99  VAL A CB  1 
ATOM   294  C CG1 . VAL A 1 99  ? -0.809  16.361  -11.898 1.00 41.28  ? 99  VAL A CG1 1 
ATOM   295  C CG2 . VAL A 1 99  ? -0.277  15.144  -14.005 1.00 40.68  ? 99  VAL A CG2 1 
ATOM   296  N N   . GLY A 1 100 ? -1.644  13.035  -10.325 1.00 29.70  ? 100 GLY A N   1 
ATOM   297  C CA  . GLY A 1 100 ? -2.261  12.714  -9.046  1.00 30.85  ? 100 GLY A CA  1 
ATOM   298  C C   . GLY A 1 100 ? -1.271  12.035  -8.121  1.00 29.93  ? 100 GLY A C   1 
ATOM   299  O O   . GLY A 1 100 ? -1.223  12.327  -6.927  1.00 30.33  ? 100 GLY A O   1 
ATOM   300  N N   . CYS A 1 101 ? -0.472  11.131  -8.684  1.00 34.17  ? 101 CYS A N   1 
ATOM   301  C CA  . CYS A 1 101 ? 0.550   10.418  -7.924  1.00 29.70  ? 101 CYS A CA  1 
ATOM   302  C C   . CYS A 1 101 ? 1.604   11.359  -7.355  1.00 27.14  ? 101 CYS A C   1 
ATOM   303  O O   . CYS A 1 101 ? 2.018   11.213  -6.205  1.00 24.41  ? 101 CYS A O   1 
ATOM   304  C CB  . CYS A 1 101 ? 1.220   9.351   -8.789  1.00 26.12  ? 101 CYS A CB  1 
ATOM   305  S SG  . CYS A 1 101 ? 0.366   7.767   -8.786  1.00 30.80  ? 101 CYS A SG  1 
ATOM   306  N N   . ALA A 1 102 ? 2.038   12.319  -8.165  1.00 19.98  ? 102 ALA A N   1 
ATOM   307  C CA  . ALA A 1 102 ? 3.006   13.309  -7.717  1.00 21.07  ? 102 ALA A CA  1 
ATOM   308  C C   . ALA A 1 102 ? 2.428   14.098  -6.551  1.00 29.14  ? 102 ALA A C   1 
ATOM   309  O O   . ALA A 1 102 ? 3.051   14.219  -5.495  1.00 28.16  ? 102 ALA A O   1 
ATOM   310  C CB  . ALA A 1 102 ? 3.378   14.239  -8.858  1.00 16.63  ? 102 ALA A CB  1 
ATOM   311  N N   . LEU A 1 103 ? 1.224   14.622  -6.753  1.00 26.19  ? 103 LEU A N   1 
ATOM   312  C CA  . LEU A 1 103 ? 0.526   15.384  -5.731  1.00 34.24  ? 103 LEU A CA  1 
ATOM   313  C C   . LEU A 1 103 ? 0.387   14.557  -4.457  1.00 40.61  ? 103 LEU A C   1 
ATOM   314  O O   . LEU A 1 103 ? 0.593   15.059  -3.352  1.00 40.09  ? 103 LEU A O   1 
ATOM   315  C CB  . LEU A 1 103 ? -0.852  15.789  -6.251  1.00 47.07  ? 103 LEU A CB  1 
ATOM   316  C CG  . LEU A 1 103 ? -1.489  17.056  -5.683  1.00 53.29  ? 103 LEU A CG  1 
ATOM   317  C CD1 . LEU A 1 103 ? -2.366  17.699  -6.740  1.00 55.60  ? 103 LEU A CD1 1 
ATOM   318  C CD2 . LEU A 1 103 ? -2.283  16.758  -4.419  1.00 56.07  ? 103 LEU A CD2 1 
ATOM   319  N N   . LYS A 1 104 ? 0.049   13.283  -4.628  1.00 37.39  ? 104 LYS A N   1 
ATOM   320  C CA  . LYS A 1 104 ? -0.180  12.371  -3.511  1.00 31.89  ? 104 LYS A CA  1 
ATOM   321  C C   . LYS A 1 104 ? 1.086   12.103  -2.695  1.00 36.20  ? 104 LYS A C   1 
ATOM   322  O O   . LYS A 1 104 ? 1.082   12.255  -1.473  1.00 36.04  ? 104 LYS A O   1 
ATOM   323  C CB  . LYS A 1 104 ? -0.770  11.056  -4.023  1.00 33.95  ? 104 LYS A CB  1 
ATOM   324  C CG  . LYS A 1 104 ? -1.055  10.030  -2.944  1.00 35.52  ? 104 LYS A CG  1 
ATOM   325  C CD  . LYS A 1 104 ? -1.833  8.855   -3.512  1.00 39.92  ? 104 LYS A CD  1 
ATOM   326  C CE  . LYS A 1 104 ? -2.074  7.791   -2.456  1.00 42.54  ? 104 LYS A CE  1 
ATOM   327  N NZ  . LYS A 1 104 ? -2.990  6.727   -2.950  1.00 45.09  ? 104 LYS A NZ  1 
ATOM   328  N N   . ASN A 1 105 ? 2.159   11.698  -3.371  1.00 23.32  ? 105 ASN A N   1 
ATOM   329  C CA  . ASN A 1 105 ? 3.451   11.499  -2.717  1.00 19.58  ? 105 ASN A CA  1 
ATOM   330  C C   . ASN A 1 105 ? 3.865   12.743  -1.945  1.00 21.08  ? 105 ASN A C   1 
ATOM   331  O O   . ASN A 1 105 ? 4.327   12.658  -0.808  1.00 22.58  ? 105 ASN A O   1 
ATOM   332  C CB  . ASN A 1 105 ? 4.533   11.168  -3.743  1.00 28.69  ? 105 ASN A CB  1 
ATOM   333  C CG  . ASN A 1 105 ? 4.275   9.868   -4.468  1.00 33.10  ? 105 ASN A CG  1 
ATOM   334  O OD1 . ASN A 1 105 ? 4.487   9.769   -5.676  1.00 37.62  ? 105 ASN A OD1 1 
ATOM   335  N ND2 . ASN A 1 105 ? 3.816   8.859   -3.737  1.00 32.92  ? 105 ASN A ND2 1 
ATOM   336  N N   . ASN A 1 106 ? 3.704   13.898  -2.585  1.00 21.09  ? 106 ASN A N   1 
ATOM   337  C CA  . ASN A 1 106 ? 3.999   15.182  -1.961  1.00 28.48  ? 106 ASN A CA  1 
ATOM   338  C C   . ASN A 1 106 ? 3.223   15.358  -0.667  1.00 26.88  ? 106 ASN A C   1 
ATOM   339  O O   . ASN A 1 106 ? 3.801   15.646  0.381   1.00 29.98  ? 106 ASN A O   1 
ATOM   340  C CB  . ASN A 1 106 ? 3.672   16.329  -2.917  1.00 29.22  ? 106 ASN A CB  1 
ATOM   341  C CG  . ASN A 1 106 ? 4.720   16.509  -3.993  1.00 30.86  ? 106 ASN A CG  1 
ATOM   342  O OD1 . ASN A 1 106 ? 5.800   15.919  -3.934  1.00 33.33  ? 106 ASN A OD1 1 
ATOM   343  N ND2 . ASN A 1 106 ? 4.409   17.333  -4.986  1.00 31.29  ? 106 ASN A ND2 1 
ATOM   344  N N   . ILE A 1 107 ? 1.906   15.186  -0.755  1.00 25.70  ? 107 ILE A N   1 
ATOM   345  C CA  . ILE A 1 107 ? 1.033   15.234  0.410   1.00 28.71  ? 107 ILE A CA  1 
ATOM   346  C C   . ILE A 1 107 ? 1.589   14.353  1.519   1.00 30.46  ? 107 ILE A C   1 
ATOM   347  O O   . ILE A 1 107 ? 1.726   14.790  2.663   1.00 32.02  ? 107 ILE A O   1 
ATOM   348  C CB  . ILE A 1 107 ? -0.384  14.724  0.069   1.00 32.58  ? 107 ILE A CB  1 
ATOM   349  C CG1 . ILE A 1 107 ? -1.052  15.610  -0.984  1.00 35.12  ? 107 ILE A CG1 1 
ATOM   350  C CG2 . ILE A 1 107 ? -1.243  14.650  1.321   1.00 34.99  ? 107 ILE A CG2 1 
ATOM   351  C CD1 . ILE A 1 107 ? -1.876  16.734  -0.409  1.00 31.96  ? 107 ILE A CD1 1 
ATOM   352  N N   . ILE A 1 108 ? 1.913   13.111  1.167   1.00 15.00  ? 108 ILE A N   1 
ATOM   353  C CA  . ILE A 1 108 ? 2.360   12.116  2.138   1.00 18.26  ? 108 ILE A CA  1 
ATOM   354  C C   . ILE A 1 108 ? 3.720   12.449  2.748   1.00 20.78  ? 108 ILE A C   1 
ATOM   355  O O   . ILE A 1 108 ? 3.920   12.294  3.953   1.00 25.60  ? 108 ILE A O   1 
ATOM   356  C CB  . ILE A 1 108 ? 2.406   10.701  1.524   1.00 21.67  ? 108 ILE A CB  1 
ATOM   357  C CG1 . ILE A 1 108 ? 1.023   10.300  1.007   1.00 26.45  ? 108 ILE A CG1 1 
ATOM   358  C CG2 . ILE A 1 108 ? 2.897   9.687   2.547   1.00 15.00  ? 108 ILE A CG2 1 
ATOM   359  C CD1 . ILE A 1 108 ? 0.953   8.883   0.474   1.00 19.28  ? 108 ILE A CD1 1 
ATOM   360  N N   . GLN A 1 109 ? 4.654   12.907  1.923   1.00 20.87  ? 109 GLN A N   1 
ATOM   361  C CA  . GLN A 1 109 ? 5.972   13.265  2.428   1.00 18.40  ? 109 GLN A CA  1 
ATOM   362  C C   . GLN A 1 109 ? 5.877   14.470  3.354   1.00 27.00  ? 109 GLN A C   1 
ATOM   363  O O   . GLN A 1 109 ? 6.554   14.526  4.382   1.00 35.60  ? 109 GLN A O   1 
ATOM   364  C CB  . GLN A 1 109 ? 6.949   13.537  1.284   1.00 25.12  ? 109 GLN A CB  1 
ATOM   365  C CG  . GLN A 1 109 ? 8.411   13.493  1.710   1.00 37.00  ? 109 GLN A CG  1 
ATOM   366  C CD  . GLN A 1 109 ? 8.797   12.170  2.357   1.00 46.14  ? 109 GLN A CD  1 
ATOM   367  O OE1 . GLN A 1 109 ? 8.344   11.102  1.938   1.00 45.90  ? 109 GLN A OE1 1 
ATOM   368  N NE2 . GLN A 1 109 ? 9.642   12.238  3.380   1.00 45.52  ? 109 GLN A NE2 1 
ATOM   369  N N   . THR A 1 110 ? 5.033   15.431  2.990   1.00 26.13  ? 110 THR A N   1 
ATOM   370  C CA  . THR A 1 110 ? 4.785   16.580  3.848   1.00 23.09  ? 110 THR A CA  1 
ATOM   371  C C   . THR A 1 110 ? 4.275   16.077  5.189   1.00 29.17  ? 110 THR A C   1 
ATOM   372  O O   . THR A 1 110 ? 4.681   16.563  6.245   1.00 29.40  ? 110 THR A O   1 
ATOM   373  C CB  . THR A 1 110 ? 3.745   17.532  3.240   1.00 29.39  ? 110 THR A CB  1 
ATOM   374  O OG1 . THR A 1 110 ? 4.117   17.858  1.896   1.00 34.41  ? 110 THR A OG1 1 
ATOM   375  C CG2 . THR A 1 110 ? 3.653   18.810  4.057   1.00 32.48  ? 110 THR A CG2 1 
ATOM   376  N N   . TRP A 1 111 ? 3.385   15.092  5.135   1.00 28.85  ? 111 TRP A N   1 
ATOM   377  C CA  . TRP A 1 111 ? 2.843   14.484  6.338   1.00 26.19  ? 111 TRP A CA  1 
ATOM   378  C C   . TRP A 1 111 ? 3.954   13.848  7.160   1.00 27.00  ? 111 TRP A C   1 
ATOM   379  O O   . TRP A 1 111 ? 4.112   14.150  8.343   1.00 21.79  ? 111 TRP A O   1 
ATOM   380  C CB  . TRP A 1 111 ? 1.791   13.437  5.984   1.00 22.19  ? 111 TRP A CB  1 
ATOM   381  C CG  . TRP A 1 111 ? 0.968   13.040  7.154   1.00 25.53  ? 111 TRP A CG  1 
ATOM   382  C CD1 . TRP A 1 111 ? -0.136  13.683  7.628   1.00 27.39  ? 111 TRP A CD1 1 
ATOM   383  C CD2 . TRP A 1 111 ? 1.180   11.915  8.016   1.00 26.05  ? 111 TRP A CD2 1 
ATOM   384  N NE1 . TRP A 1 111 ? -0.630  13.028  8.728   1.00 29.01  ? 111 TRP A NE1 1 
ATOM   385  C CE2 . TRP A 1 111 ? 0.160   11.940  8.989   1.00 25.54  ? 111 TRP A CE2 1 
ATOM   386  C CE3 . TRP A 1 111 ? 2.129   10.888  8.059   1.00 22.08  ? 111 TRP A CE3 1 
ATOM   387  C CZ2 . TRP A 1 111 ? 0.061   10.978  9.992   1.00 24.63  ? 111 TRP A CZ2 1 
ATOM   388  C CZ3 . TRP A 1 111 ? 2.029   9.932   9.058   1.00 18.17  ? 111 TRP A CZ3 1 
ATOM   389  C CH2 . TRP A 1 111 ? 1.003   9.985   10.010  1.00 22.45  ? 111 TRP A CH2 1 
ATOM   390  N N   . ARG A 1 112 ? 4.721   12.966  6.526   1.00 27.00  ? 112 ARG A N   1 
ATOM   391  C CA  . ARG A 1 112 ? 5.861   12.339  7.182   1.00 29.03  ? 112 ARG A CA  1 
ATOM   392  C C   . ARG A 1 112 ? 6.639   13.359  8.001   1.00 33.57  ? 112 ARG A C   1 
ATOM   393  O O   . ARG A 1 112 ? 6.815   13.198  9.209   1.00 27.64  ? 112 ARG A O   1 
ATOM   394  C CB  . ARG A 1 112 ? 6.784   11.687  6.157   1.00 28.33  ? 112 ARG A CB  1 
ATOM   395  C CG  . ARG A 1 112 ? 6.338   10.313  5.732   1.00 30.81  ? 112 ARG A CG  1 
ATOM   396  C CD  . ARG A 1 112 ? 7.530   9.441   5.391   1.00 35.62  ? 112 ARG A CD  1 
ATOM   397  N NE  . ARG A 1 112 ? 7.206   8.028   5.548   1.00 33.37  ? 112 ARG A NE  1 
ATOM   398  C CZ  . ARG A 1 112 ? 6.562   7.309   4.636   1.00 40.04  ? 112 ARG A CZ  1 
ATOM   399  N NH1 . ARG A 1 112 ? 6.176   7.867   3.496   1.00 45.12  ? 112 ARG A NH1 1 
ATOM   400  N NH2 . ARG A 1 112 ? 6.303   6.030   4.862   1.00 41.86  ? 112 ARG A NH2 1 
ATOM   401  N N   . GLN A 1 113 ? 7.101   14.410  7.333   1.00 32.97  ? 113 GLN A N   1 
ATOM   402  C CA  . GLN A 1 113 ? 7.821   15.488  7.997   1.00 35.78  ? 113 GLN A CA  1 
ATOM   403  C C   . GLN A 1 113 ? 7.075   16.053  9.203   1.00 41.28  ? 113 GLN A C   1 
ATOM   404  O O   . GLN A 1 113 ? 7.635   16.176  10.293  1.00 39.85  ? 113 GLN A O   1 
ATOM   405  C CB  . GLN A 1 113 ? 8.115   16.614  7.006   1.00 40.96  ? 113 GLN A CB  1 
ATOM   406  C CG  . GLN A 1 113 ? 9.511   16.570  6.426   1.00 53.60  ? 113 GLN A CG  1 
ATOM   407  C CD  . GLN A 1 113 ? 10.567  16.921  7.454   1.00 61.51  ? 113 GLN A CD  1 
ATOM   408  O OE1 . GLN A 1 113 ? 11.494  16.148  7.699   1.00 66.69  ? 113 GLN A OE1 1 
ATOM   409  N NE2 . GLN A 1 113 ? 10.427  18.090  8.071   1.00 62.50  ? 113 GLN A NE2 1 
ATOM   410  N N   . HIS A 1 114 ? 5.807   16.391  8.992   1.00 35.82  ? 114 HIS A N   1 
ATOM   411  C CA  . HIS A 1 114 ? 5.029   17.146  9.967   1.00 28.34  ? 114 HIS A CA  1 
ATOM   412  C C   . HIS A 1 114 ? 4.804   16.411  11.277  1.00 35.56  ? 114 HIS A C   1 
ATOM   413  O O   . HIS A 1 114 ? 4.826   17.016  12.349  1.00 37.89  ? 114 HIS A O   1 
ATOM   414  C CB  . HIS A 1 114 ? 3.677   17.518  9.371   1.00 32.46  ? 114 HIS A CB  1 
ATOM   415  C CG  . HIS A 1 114 ? 3.063   18.732  9.989   1.00 34.11  ? 114 HIS A CG  1 
ATOM   416  N ND1 . HIS A 1 114 ? 3.623   19.984  9.870   1.00 35.46  ? 114 HIS A ND1 1 
ATOM   417  C CD2 . HIS A 1 114 ? 1.934   18.892  10.719  1.00 33.48  ? 114 HIS A CD2 1 
ATOM   418  C CE1 . HIS A 1 114 ? 2.869   20.864  10.504  1.00 34.28  ? 114 HIS A CE1 1 
ATOM   419  N NE2 . HIS A 1 114 ? 1.837   20.227  11.027  1.00 31.27  ? 114 HIS A NE2 1 
ATOM   420  N N   . PHE A 1 115 ? 4.574   15.108  11.186  1.00 28.82  ? 115 PHE A N   1 
ATOM   421  C CA  . PHE A 1 115 ? 4.208   14.336  12.359  1.00 32.99  ? 115 PHE A CA  1 
ATOM   422  C C   . PHE A 1 115 ? 5.304   13.373  12.791  1.00 32.13  ? 115 PHE A C   1 
ATOM   423  O O   . PHE A 1 115 ? 5.805   13.465  13.911  1.00 30.92  ? 115 PHE A O   1 
ATOM   424  C CB  . PHE A 1 115 ? 2.876   13.620  12.126  1.00 35.97  ? 115 PHE A CB  1 
ATOM   425  C CG  . PHE A 1 115 ? 1.721   14.561  11.933  1.00 35.56  ? 115 PHE A CG  1 
ATOM   426  C CD1 . PHE A 1 115 ? 1.251   14.859  10.665  1.00 37.04  ? 115 PHE A CD1 1 
ATOM   427  C CD2 . PHE A 1 115 ? 1.125   15.173  13.025  1.00 34.51  ? 115 PHE A CD2 1 
ATOM   428  C CE1 . PHE A 1 115 ? 0.193   15.738  10.490  1.00 38.55  ? 115 PHE A CE1 1 
ATOM   429  C CE2 . PHE A 1 115 ? 0.070   16.050  12.858  1.00 35.28  ? 115 PHE A CE2 1 
ATOM   430  C CZ  . PHE A 1 115 ? -0.397  16.334  11.589  1.00 35.25  ? 115 PHE A CZ  1 
ATOM   431  N N   . ILE A 1 116 ? 5.686   12.461  11.903  1.00 29.86  ? 116 ILE A N   1 
ATOM   432  C CA  . ILE A 1 116 ? 6.684   11.449  12.242  1.00 31.36  ? 116 ILE A CA  1 
ATOM   433  C C   . ILE A 1 116 ? 8.013   12.061  12.685  1.00 31.27  ? 116 ILE A C   1 
ATOM   434  O O   . ILE A 1 116 ? 8.560   11.688  13.722  1.00 33.14  ? 116 ILE A O   1 
ATOM   435  C CB  . ILE A 1 116 ? 6.926   10.469  11.074  1.00 27.29  ? 116 ILE A CB  1 
ATOM   436  C CG1 . ILE A 1 116 ? 5.644   9.693   10.761  1.00 28.16  ? 116 ILE A CG1 1 
ATOM   437  C CG2 . ILE A 1 116 ? 8.056   9.506   11.409  1.00 25.29  ? 116 ILE A CG2 1 
ATOM   438  C CD1 . ILE A 1 116 ? 5.778   8.715   9.612   1.00 26.04  ? 116 ILE A CD1 1 
ATOM   439  N N   . GLN A 1 117 ? 8.520   13.005  11.899  1.00 37.86  ? 117 GLN A N   1 
ATOM   440  C CA  . GLN A 1 117 ? 9.824   13.608  12.157  1.00 33.85  ? 117 GLN A CA  1 
ATOM   441  C C   . GLN A 1 117 ? 9.786   14.563  13.338  1.00 38.91  ? 117 GLN A C   1 
ATOM   442  O O   . GLN A 1 117 ? 10.692  14.575  14.170  1.00 42.75  ? 117 GLN A O   1 
ATOM   443  C CB  . GLN A 1 117 ? 10.303  14.368  10.923  1.00 41.85  ? 117 GLN A CB  1 
ATOM   444  C CG  . GLN A 1 117 ? 10.227  13.577  9.636   1.00 49.78  ? 117 GLN A CG  1 
ATOM   445  C CD  . GLN A 1 117 ? 11.484  12.783  9.365   1.00 54.32  ? 117 GLN A CD  1 
ATOM   446  O OE1 . GLN A 1 117 ? 11.977  12.057  10.229  1.00 56.34  ? 117 GLN A OE1 1 
ATOM   447  N NE2 . GLN A 1 117 ? 12.010  12.914  8.154   1.00 59.07  ? 117 GLN A NE2 1 
ATOM   448  N N   . GLU A 1 118 ? 8.733   15.371  13.396  1.00 42.14  ? 118 GLU A N   1 
ATOM   449  C CA  . GLU A 1 118 ? 8.603   16.381  14.432  1.00 45.59  ? 118 GLU A CA  1 
ATOM   450  C C   . GLU A 1 118 ? 8.446   15.747  15.809  1.00 43.66  ? 118 GLU A C   1 
ATOM   451  O O   . GLU A 1 118 ? 8.935   16.281  16.803  1.00 49.69  ? 118 GLU A O   1 
ATOM   452  C CB  . GLU A 1 118 ? 7.414   17.297  14.135  1.00 49.88  ? 118 GLU A CB  1 
ATOM   453  C CG  . GLU A 1 118 ? 7.411   18.590  14.931  1.00 55.94  ? 118 GLU A CG  1 
ATOM   454  C CD  . GLU A 1 118 ? 8.491   19.556  14.482  1.00 62.03  ? 118 GLU A CD  1 
ATOM   455  O OE1 . GLU A 1 118 ? 8.935   19.460  13.318  1.00 62.29  ? 118 GLU A OE1 1 
ATOM   456  O OE2 . GLU A 1 118 ? 8.892   20.418  15.293  1.00 64.89  ? 118 GLU A OE2 1 
ATOM   457  N N   . GLU A 1 119 ? 7.769   14.604  15.862  1.00 35.08  ? 119 GLU A N   1 
ATOM   458  C CA  . GLU A 1 119 ? 7.462   13.965  17.139  1.00 37.06  ? 119 GLU A CA  1 
ATOM   459  C C   . GLU A 1 119 ? 8.222   12.669  17.395  1.00 40.13  ? 119 GLU A C   1 
ATOM   460  O O   . GLU A 1 119 ? 7.950   11.977  18.377  1.00 38.45  ? 119 GLU A O   1 
ATOM   461  C CB  . GLU A 1 119 ? 5.956   13.720  17.272  1.00 34.41  ? 119 GLU A CB  1 
ATOM   462  C CG  . GLU A 1 119 ? 5.243   14.724  18.160  1.00 33.16  ? 119 GLU A CG  1 
ATOM   463  C CD  . GLU A 1 119 ? 5.428   16.151  17.694  1.00 31.85  ? 119 GLU A CD  1 
ATOM   464  O OE1 . GLU A 1 119 ? 4.785   16.541  16.698  1.00 29.48  ? 119 GLU A OE1 1 
ATOM   465  O OE2 . GLU A 1 119 ? 6.212   16.885  18.331  1.00 34.87  ? 119 GLU A OE2 1 
ATOM   466  N N   . GLN A 1 120 ? 9.171   12.344  16.522  1.00 39.47  ? 120 GLN A N   1 
ATOM   467  C CA  . GLN A 1 120 ? 9.943   11.111  16.661  1.00 37.25  ? 120 GLN A CA  1 
ATOM   468  C C   . GLN A 1 120 ? 9.020   9.913   16.848  1.00 37.05  ? 120 GLN A C   1 
ATOM   469  O O   . GLN A 1 120 ? 9.155   9.145   17.802  1.00 39.10  ? 120 GLN A O   1 
ATOM   470  C CB  . GLN A 1 120 ? 10.932  11.223  17.823  1.00 48.55  ? 120 GLN A CB  1 
ATOM   471  C CG  . GLN A 1 120 ? 12.041  12.221  17.568  1.00 54.39  ? 120 GLN A CG  1 
ATOM   472  C CD  . GLN A 1 120 ? 12.845  11.876  16.332  1.00 59.54  ? 120 GLN A CD  1 
ATOM   473  O OE1 . GLN A 1 120 ? 12.618  12.427  15.254  1.00 62.85  ? 120 GLN A OE1 1 
ATOM   474  N NE2 . GLN A 1 120 ? 13.783  10.946  16.478  1.00 59.03  ? 120 GLN A NE2 1 
ATOM   475  N N   . ILE A 1 121 ? 8.078   9.772   15.922  1.00 32.55  ? 121 ILE A N   1 
ATOM   476  C CA  . ILE A 1 121 ? 7.091   8.704   15.965  1.00 29.76  ? 121 ILE A CA  1 
ATOM   477  C C   . ILE A 1 121 ? 7.687   7.406   15.437  1.00 23.28  ? 121 ILE A C   1 
ATOM   478  O O   . ILE A 1 121 ? 8.556   7.422   14.566  1.00 31.55  ? 121 ILE A O   1 
ATOM   479  C CB  . ILE A 1 121 ? 5.847   9.078   15.136  1.00 33.49  ? 121 ILE A CB  1 
ATOM   480  C CG1 . ILE A 1 121 ? 5.316   10.448  15.566  1.00 30.77  ? 121 ILE A CG1 1 
ATOM   481  C CG2 . ILE A 1 121 ? 4.768   8.022   15.274  1.00 29.93  ? 121 ILE A CG2 1 
ATOM   482  C CD1 . ILE A 1 121 ? 4.007   10.831  14.913  1.00 29.61  ? 121 ILE A CD1 1 
ATOM   483  N N   . LEU A 1 122 ? 7.221   6.282   15.973  1.00 31.36  ? 122 LEU A N   1 
ATOM   484  C CA  . LEU A 1 122 ? 7.708   4.975   15.551  1.00 31.43  ? 122 LEU A CA  1 
ATOM   485  C C   . LEU A 1 122 ? 6.849   4.423   14.424  1.00 31.01  ? 122 LEU A C   1 
ATOM   486  O O   . LEU A 1 122 ? 5.731   3.964   14.656  1.00 34.24  ? 122 LEU A O   1 
ATOM   487  C CB  . LEU A 1 122 ? 7.709   3.998   16.728  1.00 27.23  ? 122 LEU A CB  1 
ATOM   488  C CG  . LEU A 1 122 ? 8.454   4.439   17.990  1.00 32.63  ? 122 LEU A CG  1 
ATOM   489  C CD1 . LEU A 1 122 ? 8.356   3.368   19.064  1.00 33.30  ? 122 LEU A CD1 1 
ATOM   490  C CD2 . LEU A 1 122 ? 9.907   4.764   17.682  1.00 33.11  ? 122 LEU A CD2 1 
ATOM   491  N N   . GLU A 1 123 ? 7.370   4.472   13.202  1.00 36.33  ? 123 GLU A N   1 
ATOM   492  C CA  . GLU A 1 123 ? 6.620   3.986   12.053  1.00 38.97  ? 123 GLU A CA  1 
ATOM   493  C C   . GLU A 1 123 ? 6.560   2.464   12.042  1.00 40.75  ? 123 GLU A C   1 
ATOM   494  O O   . GLU A 1 123 ? 7.493   1.793   12.478  1.00 47.94  ? 123 GLU A O   1 
ATOM   495  C CB  . GLU A 1 123 ? 7.215   4.504   10.742  1.00 41.46  ? 123 GLU A CB  1 
ATOM   496  C CG  . GLU A 1 123 ? 6.241   4.424   9.574   1.00 45.34  ? 123 GLU A CG  1 
ATOM   497  C CD  . GLU A 1 123 ? 6.887   4.734   8.241   1.00 44.46  ? 123 GLU A CD  1 
ATOM   498  O OE1 . GLU A 1 123 ? 7.798   5.587   8.196   1.00 42.70  ? 123 GLU A OE1 1 
ATOM   499  O OE2 . GLU A 1 123 ? 6.474   4.123   7.232   1.00 46.41  ? 123 GLU A OE2 1 
ATOM   500  N N   . ILE A 1 124 ? 5.450   1.930   11.548  1.00 39.71  ? 124 ILE A N   1 
ATOM   501  C CA  . ILE A 1 124 ? 5.254   0.492   11.471  1.00 37.03  ? 124 ILE A CA  1 
ATOM   502  C C   . ILE A 1 124 ? 4.511   0.150   10.185  1.00 38.83  ? 124 ILE A C   1 
ATOM   503  O O   . ILE A 1 124 ? 3.734   0.957   9.677   1.00 37.52  ? 124 ILE A O   1 
ATOM   504  C CB  . ILE A 1 124 ? 4.473   -0.032  12.697  1.00 47.75  ? 124 ILE A CB  1 
ATOM   505  C CG1 . ILE A 1 124 ? 4.571   -1.554  12.793  1.00 52.53  ? 124 ILE A CG1 1 
ATOM   506  C CG2 . ILE A 1 124 ? 3.019   0.428   12.656  1.00 50.03  ? 124 ILE A CG2 1 
ATOM   507  C CD1 . ILE A 1 124 ? 3.953   -2.119  14.046  1.00 55.27  ? 124 ILE A CD1 1 
ATOM   508  N N   . ASP A 1 125 ? 4.766   -1.038  9.648   1.00 38.86  ? 125 ASP A N   1 
ATOM   509  C CA  . ASP A 1 125 ? 4.100   -1.474  8.428   1.00 43.80  ? 125 ASP A CA  1 
ATOM   510  C C   . ASP A 1 125 ? 3.500   -2.865  8.598   1.00 44.84  ? 125 ASP A C   1 
ATOM   511  O O   . ASP A 1 125 ? 4.159   -3.873  8.344   1.00 47.91  ? 125 ASP A O   1 
ATOM   512  C CB  . ASP A 1 125 ? 5.070   -1.457  7.246   1.00 52.32  ? 125 ASP A CB  1 
ATOM   513  C CG  . ASP A 1 125 ? 4.361   -1.541  5.909   1.00 61.37  ? 125 ASP A CG  1 
ATOM   514  O OD1 . ASP A 1 125 ? 3.123   -1.373  5.876   1.00 65.56  ? 125 ASP A OD1 1 
ATOM   515  O OD2 . ASP A 1 125 ? 5.042   -1.771  4.888   1.00 66.53  ? 125 ASP A OD2 1 
ATOM   516  N N   . CYS A 1 126 ? 2.244   -2.909  9.029   1.00 39.89  ? 126 CYS A N   1 
ATOM   517  C CA  . CYS A 1 126 ? 1.549   -4.172  9.242   1.00 33.01  ? 126 CYS A CA  1 
ATOM   518  C C   . CYS A 1 126 ? 0.835   -4.638  7.979   1.00 32.11  ? 126 CYS A C   1 
ATOM   519  O O   . CYS A 1 126 ? 0.824   -3.938  6.967   1.00 43.84  ? 126 CYS A O   1 
ATOM   520  C CB  . CYS A 1 126 ? 0.557   -4.048  10.398  1.00 46.37  ? 126 CYS A CB  1 
ATOM   521  S SG  . CYS A 1 126 ? 1.330   -3.739  12.001  1.00 48.22  ? 126 CYS A SG  1 
ATOM   522  N N   . THR A 1 127 ? 0.242   -5.825  8.048   1.00 34.94  ? 127 THR A N   1 
ATOM   523  C CA  . THR A 1 127 ? -0.429  -6.417  6.897   1.00 38.86  ? 127 THR A CA  1 
ATOM   524  C C   . THR A 1 127 ? -1.881  -5.963  6.797   1.00 39.99  ? 127 THR A C   1 
ATOM   525  O O   . THR A 1 127 ? -2.493  -5.581  7.794   1.00 41.78  ? 127 THR A O   1 
ATOM   526  C CB  . THR A 1 127 ? -0.392  -7.958  6.954   1.00 39.53  ? 127 THR A CB  1 
ATOM   527  O OG1 . THR A 1 127 ? -1.212  -8.420  8.035   1.00 40.36  ? 127 THR A OG1 1 
ATOM   528  C CG2 . THR A 1 127 ? 1.032   -8.454  7.155   1.00 41.04  ? 127 THR A CG2 1 
ATOM   529  N N   . MET A 1 128 ? -2.424  -6.011  5.585   1.00 42.82  ? 128 MET A N   1 
ATOM   530  C CA  . MET A 1 128 ? -3.821  -5.665  5.349   1.00 41.03  ? 128 MET A CA  1 
ATOM   531  C C   . MET A 1 128 ? -4.705  -6.884  5.575   1.00 42.17  ? 128 MET A C   1 
ATOM   532  O O   . MET A 1 128 ? -5.851  -6.765  6.008   1.00 48.79  ? 128 MET A O   1 
ATOM   533  C CB  . MET A 1 128 ? -4.002  -5.137  3.928   1.00 39.69  ? 128 MET A CB  1 
ATOM   534  C CG  . MET A 1 128 ? -2.961  -4.108  3.532   1.00 40.80  ? 128 MET A CG  1 
ATOM   535  S SD  . MET A 1 128 ? -3.084  -3.596  1.813   1.00 37.25  ? 128 MET A SD  1 
ATOM   536  C CE  . MET A 1 128 ? -1.652  -2.528  1.704   1.00 41.97  ? 128 MET A CE  1 
ATOM   537  N N   . LEU A 1 129 ? -4.159  -8.057  5.267   1.00 32.10  ? 129 LEU A N   1 
ATOM   538  C CA  . LEU A 1 129 ? -4.824  -9.319  5.553   1.00 34.10  ? 129 LEU A CA  1 
ATOM   539  C C   . LEU A 1 129 ? -4.827  -9.571  7.051   1.00 36.87  ? 129 LEU A C   1 
ATOM   540  O O   . LEU A 1 129 ? -3.773  -9.754  7.658   1.00 39.12  ? 129 LEU A O   1 
ATOM   541  C CB  . LEU A 1 129 ? -4.108  -10.469 4.844   1.00 40.82  ? 129 LEU A CB  1 
ATOM   542  C CG  . LEU A 1 129 ? -4.658  -10.974 3.509   1.00 41.31  ? 129 LEU A CG  1 
ATOM   543  C CD1 . LEU A 1 129 ? -5.409  -9.893  2.749   1.00 44.46  ? 129 LEU A CD1 1 
ATOM   544  C CD2 . LEU A 1 129 ? -3.535  -11.558 2.667   1.00 41.59  ? 129 LEU A CD2 1 
ATOM   545  N N   . THR A 1 130 ? -6.014  -9.572  7.646   1.00 40.79  ? 130 THR A N   1 
ATOM   546  C CA  . THR A 1 130 ? -6.146  -9.848  9.070   1.00 45.55  ? 130 THR A CA  1 
ATOM   547  C C   . THR A 1 130 ? -7.148  -10.972 9.301   1.00 46.72  ? 130 THR A C   1 
ATOM   548  O O   . THR A 1 130 ? -8.217  -10.989 8.689   1.00 42.03  ? 130 THR A O   1 
ATOM   549  C CB  . THR A 1 130 ? -6.605  -8.606  9.853   1.00 43.94  ? 130 THR A CB  1 
ATOM   550  O OG1 . THR A 1 130 ? -7.972  -8.320  9.535   1.00 51.23  ? 130 THR A OG1 1 
ATOM   551  C CG2 . THR A 1 130 ? -5.744  -7.397  9.511   1.00 44.58  ? 130 THR A CG2 1 
ATOM   552  N N   . PRO A 1 131 ? -6.801  -11.921 10.182  1.00 47.74  ? 131 PRO A N   1 
ATOM   553  C CA  . PRO A 1 131 ? -7.701  -13.015 10.529  1.00 43.48  ? 131 PRO A CA  1 
ATOM   554  C C   . PRO A 1 131 ? -8.908  -12.554 11.343  1.00 46.81  ? 131 PRO A C   1 
ATOM   555  O O   . PRO A 1 131 ? -8.861  -11.516 12.004  1.00 53.14  ? 131 PRO A O   1 
ATOM   556  C CB  . PRO A 1 131 ? -6.816  -13.952 11.355  1.00 43.73  ? 131 PRO A CB  1 
ATOM   557  C CG  . PRO A 1 131 ? -5.747  -13.086 11.904  1.00 44.88  ? 131 PRO A CG  1 
ATOM   558  C CD  . PRO A 1 131 ? -5.509  -12.016 10.885  1.00 47.62  ? 131 PRO A CD  1 
ATOM   559  N N   . GLU A 1 132 ? -9.973  -13.347 11.286  1.00 48.59  ? 132 GLU A N   1 
ATOM   560  C CA  . GLU A 1 132 ? -11.250 -13.022 11.914  1.00 45.09  ? 132 GLU A CA  1 
ATOM   561  C C   . GLU A 1 132 ? -11.187 -12.858 13.435  1.00 46.40  ? 132 GLU A C   1 
ATOM   562  O O   . GLU A 1 132 ? -11.846 -11.978 13.989  1.00 48.98  ? 132 GLU A O   1 
ATOM   563  C CB  . GLU A 1 132 ? -12.293 -14.076 11.532  1.00 48.22  ? 132 GLU A CB  1 
ATOM   564  C CG  . GLU A 1 132 ? -13.591 -13.982 12.304  1.00 56.50  ? 132 GLU A CG  1 
ATOM   565  C CD  . GLU A 1 132 ? -14.743 -14.633 11.567  1.00 62.08  ? 132 GLU A CD  1 
ATOM   566  O OE1 . GLU A 1 132 ? -14.638 -15.830 11.223  1.00 63.12  ? 132 GLU A OE1 1 
ATOM   567  O OE2 . GLU A 1 132 ? -15.757 -13.943 11.333  1.00 64.04  ? 132 GLU A OE2 1 
ATOM   568  N N   . PRO A 1 133 ? -10.397 -13.707 14.116  1.00 49.28  ? 133 PRO A N   1 
ATOM   569  C CA  . PRO A 1 133 ? -10.269 -13.621 15.570  1.00 52.21  ? 133 PRO A CA  1 
ATOM   570  C C   . PRO A 1 133 ? -9.859  -12.226 16.033  1.00 55.17  ? 133 PRO A C   1 
ATOM   571  O O   . PRO A 1 133 ? -10.424 -11.702 16.992  1.00 60.04  ? 133 PRO A O   1 
ATOM   572  C CB  . PRO A 1 133 ? -9.155  -14.624 15.880  1.00 48.56  ? 133 PRO A CB  1 
ATOM   573  C CG  . PRO A 1 133 ? -9.213  -15.600 14.769  1.00 46.90  ? 133 PRO A CG  1 
ATOM   574  C CD  . PRO A 1 133 ? -9.584  -14.803 13.560  1.00 48.20  ? 133 PRO A CD  1 
ATOM   575  N N   . VAL A 1 134 ? -8.879  -11.640 15.351  1.00 56.21  ? 134 VAL A N   1 
ATOM   576  C CA  . VAL A 1 134 ? -8.422  -10.293 15.664  1.00 53.56  ? 134 VAL A CA  1 
ATOM   577  C C   . VAL A 1 134 ? -9.565  -9.295  15.530  1.00 53.43  ? 134 VAL A C   1 
ATOM   578  O O   . VAL A 1 134 ? -9.845  -8.529  16.454  1.00 54.54  ? 134 VAL A O   1 
ATOM   579  C CB  . VAL A 1 134 ? -7.270  -9.858  14.736  1.00 55.79  ? 134 VAL A CB  1 
ATOM   580  C CG1 . VAL A 1 134 ? -6.825  -8.439  15.067  1.00 55.58  ? 134 VAL A CG1 1 
ATOM   581  C CG2 . VAL A 1 134 ? -6.103  -10.829 14.848  1.00 54.32  ? 134 VAL A CG2 1 
ATOM   582  N N   . LEU A 1 135 ? -10.228 -9.315  14.378  1.00 52.12  ? 135 LEU A N   1 
ATOM   583  C CA  . LEU A 1 135 ? -11.299 -8.366  14.097  1.00 51.01  ? 135 LEU A CA  1 
ATOM   584  C C   . LEU A 1 135 ? -12.577 -8.674  14.872  1.00 60.28  ? 135 LEU A C   1 
ATOM   585  O O   . LEU A 1 135 ? -13.531 -7.895  14.845  1.00 61.46  ? 135 LEU A O   1 
ATOM   586  C CB  . LEU A 1 135 ? -11.573 -8.285  12.594  1.00 49.54  ? 135 LEU A CB  1 
ATOM   587  C CG  . LEU A 1 135 ? -10.461 -7.607  11.790  1.00 50.84  ? 135 LEU A CG  1 
ATOM   588  C CD1 . LEU A 1 135 ? -10.779 -7.618  10.306  1.00 51.11  ? 135 LEU A CD1 1 
ATOM   589  C CD2 . LEU A 1 135 ? -10.225 -6.184  12.282  1.00 49.07  ? 135 LEU A CD2 1 
ATOM   590  N N   . LYS A 1 136 ? -12.593 -9.809  15.566  1.00 64.07  ? 136 LYS A N   1 
ATOM   591  C CA  . LYS A 1 136 ? -13.705 -10.136 16.448  1.00 64.13  ? 136 LYS A CA  1 
ATOM   592  C C   . LYS A 1 136 ? -13.459 -9.557  17.837  1.00 63.78  ? 136 LYS A C   1 
ATOM   593  O O   . LYS A 1 136 ? -14.368 -9.004  18.456  1.00 68.80  ? 136 LYS A O   1 
ATOM   594  C CB  . LYS A 1 136 ? -13.929 -11.647 16.523  1.00 71.21  ? 136 LYS A CB  1 
ATOM   595  C CG  . LYS A 1 136 ? -15.224 -12.033 17.220  1.00 75.36  ? 136 LYS A CG  1 
ATOM   596  C CD  . LYS A 1 136 ? -15.740 -13.378 16.739  1.00 78.87  ? 136 LYS A CD  1 
ATOM   597  C CE  . LYS A 1 136 ? -17.161 -13.622 17.226  1.00 79.05  ? 136 LYS A CE  1 
ATOM   598  N NZ  . LYS A 1 136 ? -17.731 -14.883 16.679  1.00 78.09  ? 136 LYS A NZ  1 
ATOM   599  N N   . THR A 1 137 ? -12.224 -9.683  18.319  1.00 61.83  ? 137 THR A N   1 
ATOM   600  C CA  . THR A 1 137 ? -11.812 -9.045  19.564  1.00 61.37  ? 137 THR A CA  1 
ATOM   601  C C   . THR A 1 137 ? -12.015 -7.541  19.426  1.00 65.91  ? 137 THR A C   1 
ATOM   602  O O   . THR A 1 137 ? -12.114 -6.809  20.415  1.00 61.72  ? 137 THR A O   1 
ATOM   603  C CB  . THR A 1 137 ? -10.330 -9.318  19.863  1.00 64.31  ? 137 THR A CB  1 
ATOM   604  O OG1 . THR A 1 137 ? -10.093 -10.730 19.864  1.00 67.50  ? 137 THR A OG1 1 
ATOM   605  C CG2 . THR A 1 137 ? -9.937  -8.745  21.215  1.00 63.96  ? 137 THR A CG2 1 
ATOM   606  N N   . SER A 1 138 ? -12.082 -7.101  18.173  1.00 70.73  ? 138 SER A N   1 
ATOM   607  C CA  . SER A 1 138 ? -12.262 -5.699  17.844  1.00 69.64  ? 138 SER A CA  1 
ATOM   608  C C   . SER A 1 138 ? -13.740 -5.356  17.995  1.00 70.24  ? 138 SER A C   1 
ATOM   609  O O   . SER A 1 138 ? -14.110 -4.450  18.747  1.00 71.43  ? 138 SER A O   1 
ATOM   610  C CB  . SER A 1 138 ? -11.807 -5.466  16.404  1.00 64.16  ? 138 SER A CB  1 
ATOM   611  O OG  . SER A 1 138 ? -11.124 -4.232  16.269  1.00 65.67  ? 138 SER A OG  1 
ATOM   612  N N   . GLY A 1 139 ? -14.574 -6.105  17.270  1.00 73.09  ? 139 GLY A N   1 
ATOM   613  C CA  . GLY A 1 139 ? -16.028 -6.024  17.402  1.00 76.67  ? 139 GLY A CA  1 
ATOM   614  C C   . GLY A 1 139 ? -16.622 -5.865  16.010  1.00 72.82  ? 139 GLY A C   1 
ATOM   615  O O   . GLY A 1 139 ? -17.841 -5.691  15.825  1.00 82.80  ? 139 GLY A O   1 
ATOM   616  N N   . HIS A 1 140 ? -15.736 -5.973  15.027  1.00 66.18  ? 140 HIS A N   1 
ATOM   617  C CA  . HIS A 1 140 ? -15.987 -5.462  13.687  1.00 58.09  ? 140 HIS A CA  1 
ATOM   618  C C   . HIS A 1 140 ? -16.843 -6.315  12.762  1.00 57.40  ? 140 HIS A C   1 
ATOM   619  O O   . HIS A 1 140 ? -17.198 -5.880  11.667  1.00 47.67  ? 140 HIS A O   1 
ATOM   620  C CB  . HIS A 1 140 ? -14.661 -5.127  13.020  1.00 57.76  ? 140 HIS A CB  1 
ATOM   621  C CG  . HIS A 1 140 ? -14.167 -3.754  13.338  1.00 58.64  ? 140 HIS A CG  1 
ATOM   622  N ND1 . HIS A 1 140 ? -13.515 -3.447  14.513  1.00 59.60  ? 140 HIS A ND1 1 
ATOM   623  C CD2 . HIS A 1 140 ? -14.243 -2.599  12.637  1.00 58.97  ? 140 HIS A CD2 1 
ATOM   624  C CE1 . HIS A 1 140 ? -13.205 -2.163  14.519  1.00 58.98  ? 140 HIS A CE1 1 
ATOM   625  N NE2 . HIS A 1 140 ? -13.635 -1.626  13.392  1.00 59.57  ? 140 HIS A NE2 1 
ATOM   626  N N   . VAL A 1 141 ? -17.163 -7.530  13.192  1.00 60.45  ? 141 VAL A N   1 
ATOM   627  C CA  . VAL A 1 141 ? -18.147 -8.323  12.475  1.00 62.99  ? 141 VAL A CA  1 
ATOM   628  C C   . VAL A 1 141 ? -19.494 -7.926  13.066  1.00 63.59  ? 141 VAL A C   1 
ATOM   629  O O   . VAL A 1 141 ? -19.945 -8.500  14.060  1.00 76.93  ? 141 VAL A O   1 
ATOM   630  C CB  . VAL A 1 141 ? -17.913 -9.838  12.656  1.00 65.16  ? 141 VAL A CB  1 
ATOM   631  C CG1 . VAL A 1 141 ? -18.729 -10.626 11.642  1.00 68.64  ? 141 VAL A CG1 1 
ATOM   632  C CG2 . VAL A 1 141 ? -16.434 -10.174 12.524  1.00 63.47  ? 141 VAL A CG2 1 
ATOM   633  N N   . ASP A 1 142 ? -20.103 -6.906  12.469  1.00 73.60  ? 142 ASP A N   1 
ATOM   634  C CA  . ASP A 1 142 ? -21.417 -6.388  12.881  1.00 73.06  ? 142 ASP A CA  1 
ATOM   635  C C   . ASP A 1 142 ? -21.500 -5.459  14.094  1.00 68.92  ? 142 ASP A C   1 
ATOM   636  O O   . ASP A 1 142 ? -22.530 -5.408  14.770  1.00 80.74  ? 142 ASP A O   1 
ATOM   637  C CB  . ASP A 1 142 ? -22.480 -7.488  12.952  1.00 73.08  ? 142 ASP A CB  1 
ATOM   638  C CG  . ASP A 1 142 ? -23.446 -7.423  11.788  1.00 74.08  ? 142 ASP A CG  1 
ATOM   639  O OD1 . ASP A 1 142 ? -23.235 -6.578  10.893  1.00 72.34  ? 142 ASP A OD1 1 
ATOM   640  O OD2 . ASP A 1 142 ? -24.417 -8.209  11.766  1.00 74.94  ? 142 ASP A OD2 1 
ATOM   641  N N   . LYS A 1 143 ? -20.432 -4.722  14.368  1.00 64.57  ? 143 LYS A N   1 
ATOM   642  C CA  . LYS A 1 143 ? -20.609 -3.456  15.066  1.00 63.95  ? 143 LYS A CA  1 
ATOM   643  C C   . LYS A 1 143 ? -20.050 -2.390  14.140  1.00 60.49  ? 143 LYS A C   1 
ATOM   644  O O   . LYS A 1 143 ? -20.060 -1.196  14.440  1.00 64.21  ? 143 LYS A O   1 
ATOM   645  C CB  . LYS A 1 143 ? -19.947 -3.450  16.444  1.00 68.99  ? 143 LYS A CB  1 
ATOM   646  C CG  . LYS A 1 143 ? -20.767 -4.189  17.492  1.00 75.24  ? 143 LYS A CG  1 
ATOM   647  C CD  . LYS A 1 143 ? -20.367 -3.813  18.906  1.00 80.04  ? 143 LYS A CD  1 
ATOM   648  C CE  . LYS A 1 143 ? -21.289 -4.473  19.923  1.00 84.26  ? 143 LYS A CE  1 
ATOM   649  N NZ  . LYS A 1 143 ? -20.919 -4.125  21.324  1.00 87.89  ? 143 LYS A NZ  1 
ATOM   650  N N   . PHE A 1 144 ? -19.582 -2.865  12.990  1.00 62.85  ? 144 PHE A N   1 
ATOM   651  C CA  . PHE A 1 144 ? -19.001 -2.040  11.949  1.00 57.58  ? 144 PHE A CA  1 
ATOM   652  C C   . PHE A 1 144 ? -19.708 -2.424  10.656  1.00 55.92  ? 144 PHE A C   1 
ATOM   653  O O   . PHE A 1 144 ? -19.085 -2.707  9.633   1.00 45.30  ? 144 PHE A O   1 
ATOM   654  C CB  . PHE A 1 144 ? -17.496 -2.309  11.879  1.00 54.32  ? 144 PHE A CB  1 
ATOM   655  C CG  . PHE A 1 144 ? -16.808 -1.692  10.695  1.00 55.31  ? 144 PHE A CG  1 
ATOM   656  C CD1 . PHE A 1 144 ? -16.328 -0.393  10.750  1.00 55.59  ? 144 PHE A CD1 1 
ATOM   657  C CD2 . PHE A 1 144 ? -16.609 -2.425  9.536   1.00 57.04  ? 144 PHE A CD2 1 
ATOM   658  C CE1 . PHE A 1 144 ? -15.682 0.170   9.662   1.00 49.41  ? 144 PHE A CE1 1 
ATOM   659  C CE2 . PHE A 1 144 ? -15.968 -1.868  8.446   1.00 56.32  ? 144 PHE A CE2 1 
ATOM   660  C CZ  . PHE A 1 144 ? -15.503 -0.569  8.508   1.00 51.44  ? 144 PHE A CZ  1 
ATOM   661  N N   . ALA A 1 145 ? -21.031 -2.451  10.731  1.00 60.80  ? 145 ALA A N   1 
ATOM   662  C CA  . ALA A 1 145 ? -21.860 -2.793  9.594   1.00 60.14  ? 145 ALA A CA  1 
ATOM   663  C C   . ALA A 1 145 ? -22.796 -1.633  9.326   1.00 55.90  ? 145 ALA A C   1 
ATOM   664  O O   . ALA A 1 145 ? -22.992 -0.774  10.186  1.00 57.59  ? 145 ALA A O   1 
ATOM   665  C CB  . ALA A 1 145 ? -22.652 -4.043  9.894   1.00 62.86  ? 145 ALA A CB  1 
ATOM   666  N N   . ASP A 1 146 ? -23.367 -1.595  8.131   1.00 59.99  ? 146 ASP A N   1 
ATOM   667  C CA  . ASP A 1 146 ? -24.425 -0.642  7.844   1.00 56.94  ? 146 ASP A CA  1 
ATOM   668  C C   . ASP A 1 146 ? -25.721 -1.376  7.551   1.00 57.94  ? 146 ASP A C   1 
ATOM   669  O O   . ASP A 1 146 ? -25.734 -2.597  7.391   1.00 60.62  ? 146 ASP A O   1 
ATOM   670  C CB  . ASP A 1 146 ? -24.050 0.271   6.679   1.00 61.83  ? 146 ASP A CB  1 
ATOM   671  C CG  . ASP A 1 146 ? -23.418 1.569   7.139   1.00 66.98  ? 146 ASP A CG  1 
ATOM   672  O OD1 . ASP A 1 146 ? -22.549 2.093   6.414   1.00 68.13  ? 146 ASP A OD1 1 
ATOM   673  O OD2 . ASP A 1 146 ? -23.787 2.063   8.226   1.00 68.88  ? 146 ASP A OD2 1 
ATOM   674  N N   . PHE A 1 147 ? -26.814 -0.627  7.488   1.00 54.45  ? 147 PHE A N   1 
ATOM   675  C CA  . PHE A 1 147 ? -28.111 -1.219  7.207   1.00 50.33  ? 147 PHE A CA  1 
ATOM   676  C C   . PHE A 1 147 ? -28.441 -1.162  5.723   1.00 47.27  ? 147 PHE A C   1 
ATOM   677  O O   . PHE A 1 147 ? -28.417 -0.096  5.107   1.00 44.49  ? 147 PHE A O   1 
ATOM   678  C CB  . PHE A 1 147 ? -29.209 -0.530  8.015   1.00 49.24  ? 147 PHE A CB  1 
ATOM   679  C CG  . PHE A 1 147 ? -29.148 -0.813  9.487   1.00 47.59  ? 147 PHE A CG  1 
ATOM   680  C CD1 . PHE A 1 147 ? -28.722 0.160   10.376  1.00 45.40  ? 147 PHE A CD1 1 
ATOM   681  C CD2 . PHE A 1 147 ? -29.522 -2.053  9.984   1.00 49.90  ? 147 PHE A CD2 1 
ATOM   682  C CE1 . PHE A 1 147 ? -28.668 -0.097  11.734  1.00 44.17  ? 147 PHE A CE1 1 
ATOM   683  C CE2 . PHE A 1 147 ? -29.469 -2.316  11.341  1.00 47.53  ? 147 PHE A CE2 1 
ATOM   684  C CZ  . PHE A 1 147 ? -29.041 -1.337  12.217  1.00 45.19  ? 147 PHE A CZ  1 
ATOM   685  N N   . MET A 1 148 ? -28.744 -2.323  5.157   1.00 48.87  ? 148 MET A N   1 
ATOM   686  C CA  . MET A 1 148 ? -29.188 -2.418  3.777   1.00 55.64  ? 148 MET A CA  1 
ATOM   687  C C   . MET A 1 148 ? -30.681 -2.680  3.716   1.00 56.32  ? 148 MET A C   1 
ATOM   688  O O   . MET A 1 148 ? -31.217 -3.461  4.503   1.00 54.76  ? 148 MET A O   1 
ATOM   689  C CB  . MET A 1 148 ? -28.472 -3.560  3.061   1.00 60.23  ? 148 MET A CB  1 
ATOM   690  C CG  . MET A 1 148 ? -27.328 -3.142  2.170   1.00 65.74  ? 148 MET A CG  1 
ATOM   691  S SD  . MET A 1 148 ? -26.978 -4.417  0.947   1.00 71.96  ? 148 MET A SD  1 
ATOM   692  C CE  . MET A 1 148 ? -26.975 -5.887  1.972   1.00 68.84  ? 148 MET A CE  1 
ATOM   693  N N   . VAL A 1 149 ? -31.351 -2.024  2.778   1.00 56.31  ? 149 VAL A N   1 
ATOM   694  C CA  . VAL A 1 149 ? -32.724 -2.372  2.451   1.00 57.07  ? 149 VAL A CA  1 
ATOM   695  C C   . VAL A 1 149 ? -32.765 -2.907  1.026   1.00 62.07  ? 149 VAL A C   1 
ATOM   696  O O   . VAL A 1 149 ? -32.422 -2.201  0.077   1.00 65.16  ? 149 VAL A O   1 
ATOM   697  C CB  . VAL A 1 149 ? -33.687 -1.174  2.599   1.00 51.28  ? 149 VAL A CB  1 
ATOM   698  C CG1 . VAL A 1 149 ? -33.979 -0.907  4.066   1.00 48.11  ? 149 VAL A CG1 1 
ATOM   699  C CG2 . VAL A 1 149 ? -33.117 0.066   1.925   1.00 48.18  ? 149 VAL A CG2 1 
ATOM   700  N N   . LYS A 1 150 ? -33.163 -4.165  0.882   1.00 68.19  ? 150 LYS A N   1 
ATOM   701  C CA  . LYS A 1 150 ? -33.245 -4.779  -0.436  1.00 71.05  ? 150 LYS A CA  1 
ATOM   702  C C   . LYS A 1 150 ? -34.631 -4.603  -1.042  1.00 73.62  ? 150 LYS A C   1 
ATOM   703  O O   . LYS A 1 150 ? -35.638 -4.599  -0.333  1.00 72.31  ? 150 LYS A O   1 
ATOM   704  C CB  . LYS A 1 150 ? -32.874 -6.263  -0.372  1.00 69.43  ? 150 LYS A CB  1 
ATOM   705  C CG  . LYS A 1 150 ? -31.378 -6.521  -0.286  1.00 69.21  ? 150 LYS A CG  1 
ATOM   706  C CD  . LYS A 1 150 ? -31.070 -8.009  -0.272  1.00 70.76  ? 150 LYS A CD  1 
ATOM   707  C CE  . LYS A 1 150 ? -31.535 -8.657  1.028   1.00 73.98  ? 150 LYS A CE  1 
ATOM   708  N NZ  . LYS A 1 150 ? -31.263 -10.132 1.025   1.00 74.63  ? 150 LYS A NZ  1 
ATOM   709  N N   . ASP A 1 151 ? -34.667 -4.453  -2.362  1.00 75.59  ? 151 ASP A N   1 
ATOM   710  C CA  . ASP A 1 151 ? -35.918 -4.334  -3.098  1.00 78.59  ? 151 ASP A CA  1 
ATOM   711  C C   . ASP A 1 151 ? -36.582 -5.707  -3.187  1.00 84.29  ? 151 ASP A C   1 
ATOM   712  O O   . ASP A 1 151 ? -35.968 -6.673  -3.641  1.00 89.92  ? 151 ASP A O   1 
ATOM   713  C CB  . ASP A 1 151 ? -35.650 -3.760  -4.491  1.00 78.74  ? 151 ASP A CB  1 
ATOM   714  C CG  . ASP A 1 151 ? -36.924 -3.465  -5.258  1.00 79.75  ? 151 ASP A CG  1 
ATOM   715  O OD1 . ASP A 1 151 ? -36.917 -2.520  -6.075  1.00 79.50  ? 151 ASP A OD1 1 
ATOM   716  O OD2 . ASP A 1 151 ? -37.932 -4.173  -5.052  1.00 80.63  ? 151 ASP A OD2 1 
ATOM   717  N N   . VAL A 1 152 ? -37.840 -5.779  -2.761  1.00 91.73  ? 152 VAL A N   1 
ATOM   718  C CA  . VAL A 1 152 ? -38.509 -7.061  -2.507  1.00 93.26  ? 152 VAL A CA  1 
ATOM   719  C C   . VAL A 1 152 ? -38.493 -8.078  -3.657  1.00 92.45  ? 152 VAL A C   1 
ATOM   720  O O   . VAL A 1 152 ? -38.599 -9.280  -3.410  1.00 89.72  ? 152 VAL A O   1 
ATOM   721  C CB  . VAL A 1 152 ? -39.949 -6.869  -1.973  1.00 93.26  ? 152 VAL A CB  1 
ATOM   722  C CG1 . VAL A 1 152 ? -39.926 -6.134  -0.640  1.00 94.41  ? 152 VAL A CG1 1 
ATOM   723  C CG2 . VAL A 1 152 ? -40.810 -6.137  -2.991  1.00 91.68  ? 152 VAL A CG2 1 
ATOM   724  N N   . LYS A 1 153 ? -38.362 -7.619  -4.900  1.00 89.70  ? 153 LYS A N   1 
ATOM   725  C CA  . LYS A 1 153 ? -38.085 -8.563  -5.992  1.00 88.68  ? 153 LYS A CA  1 
ATOM   726  C C   . LYS A 1 153 ? -36.916 -8.225  -6.919  1.00 87.10  ? 153 LYS A C   1 
ATOM   727  O O   . LYS A 1 153 ? -35.901 -8.921  -6.885  1.00 87.16  ? 153 LYS A O   1 
ATOM   728  C CB  . LYS A 1 153 ? -39.340 -8.995  -6.768  1.00 87.75  ? 153 LYS A CB  1 
ATOM   729  C CG  . LYS A 1 153 ? -39.791 -10.416 -6.393  1.00 84.21  ? 153 LYS A CG  1 
ATOM   730  C CD  . LYS A 1 153 ? -40.573 -11.103 -7.504  1.00 80.90  ? 153 LYS A CD  1 
ATOM   731  C CE  . LYS A 1 153 ? -40.854 -12.559 -7.145  1.00 78.44  ? 153 LYS A CE  1 
ATOM   732  N NZ  . LYS A 1 153 ? -41.614 -13.271 -8.209  1.00 77.20  ? 153 LYS A NZ  1 
ATOM   733  N N   . ASN A 1 154 ? -37.026 -7.185  -7.742  1.00 91.12  ? 154 ASN A N   1 
ATOM   734  C CA  . ASN A 1 154 ? -35.900 -6.885  -8.634  1.00 97.98  ? 154 ASN A CA  1 
ATOM   735  C C   . ASN A 1 154 ? -34.638 -6.323  -7.958  1.00 96.27  ? 154 ASN A C   1 
ATOM   736  O O   . ASN A 1 154 ? -34.017 -5.375  -8.441  1.00 94.28  ? 154 ASN A O   1 
ATOM   737  C CB  . ASN A 1 154 ? -36.310 -6.130  -9.908  1.00 103.09 ? 154 ASN A CB  1 
ATOM   738  C CG  . ASN A 1 154 ? -36.228 -7.013  -11.154 1.00 105.38 ? 154 ASN A CG  1 
ATOM   739  O OD1 . ASN A 1 154 ? -36.913 -6.775  -12.150 1.00 105.36 ? 154 ASN A OD1 1 
ATOM   740  N ND2 . ASN A 1 154 ? -35.385 -8.040  -11.094 1.00 105.56 ? 154 ASN A ND2 1 
ATOM   741  N N   . GLY A 1 155 ? -34.299 -6.927  -6.819  1.00 93.76  ? 155 GLY A N   1 
ATOM   742  C CA  . GLY A 1 155 ? -32.938 -6.942  -6.271  1.00 88.41  ? 155 GLY A CA  1 
ATOM   743  C C   . GLY A 1 155 ? -32.294 -5.759  -5.565  1.00 86.64  ? 155 GLY A C   1 
ATOM   744  O O   . GLY A 1 155 ? -31.971 -5.843  -4.378  1.00 83.94  ? 155 GLY A O   1 
ATOM   745  N N   . GLU A 1 156 ? -32.094 -4.667  -6.298  1.00 81.69  ? 156 GLU A N   1 
ATOM   746  C CA  . GLU A 1 156 ? -31.174 -3.588  -5.904  1.00 77.84  ? 156 GLU A CA  1 
ATOM   747  C C   . GLU A 1 156 ? -31.069 -3.271  -4.405  1.00 73.62  ? 156 GLU A C   1 
ATOM   748  O O   . GLU A 1 156 ? -32.067 -3.256  -3.684  1.00 76.01  ? 156 GLU A O   1 
ATOM   749  C CB  . GLU A 1 156 ? -31.484 -2.312  -6.691  1.00 82.15  ? 156 GLU A CB  1 
ATOM   750  C CG  . GLU A 1 156 ? -30.326 -1.331  -6.757  1.00 87.28  ? 156 GLU A CG  1 
ATOM   751  C CD  . GLU A 1 156 ? -30.602 -0.168  -7.685  1.00 91.11  ? 156 GLU A CD  1 
ATOM   752  O OE1 . GLU A 1 156 ? -31.713 -0.110  -8.252  1.00 93.32  ? 156 GLU A OE1 1 
ATOM   753  O OE2 . GLU A 1 156 ? -29.707 0.688   -7.850  1.00 91.98  ? 156 GLU A OE2 1 
ATOM   754  N N   . CYS A 1 157 ? -29.843 -3.003  -3.958  1.00 68.11  ? 157 CYS A N   1 
ATOM   755  C CA  . CYS A 1 157 ? -29.566 -2.714  -2.553  1.00 66.11  ? 157 CYS A CA  1 
ATOM   756  C C   . CYS A 1 157 ? -29.344 -1.224  -2.299  1.00 63.20  ? 157 CYS A C   1 
ATOM   757  O O   . CYS A 1 157 ? -28.786 -0.518  -3.138  1.00 61.67  ? 157 CYS A O   1 
ATOM   758  C CB  . CYS A 1 157 ? -28.348 -3.509  -2.083  1.00 67.77  ? 157 CYS A CB  1 
ATOM   759  S SG  . CYS A 1 157 ? -28.524 -5.299  -2.250  1.00 76.08  ? 157 CYS A SG  1 
ATOM   760  N N   . PHE A 1 158 ? -29.781 -0.758  -1.132  1.00 58.71  ? 158 PHE A N   1 
ATOM   761  C CA  . PHE A 1 158 ? -29.648 0.648   -0.755  1.00 56.38  ? 158 PHE A CA  1 
ATOM   762  C C   . PHE A 1 158 ? -29.219 0.799   0.701   1.00 54.59  ? 158 PHE A C   1 
ATOM   763  O O   . PHE A 1 158 ? -29.455 -0.088  1.521   1.00 44.88  ? 158 PHE A O   1 
ATOM   764  C CB  . PHE A 1 158 ? -30.971 1.388   -0.969  1.00 59.11  ? 158 PHE A CB  1 
ATOM   765  C CG  . PHE A 1 158 ? -31.407 1.459   -2.403  1.00 60.85  ? 158 PHE A CG  1 
ATOM   766  C CD1 . PHE A 1 158 ? -30.989 2.500   -3.218  1.00 62.04  ? 158 PHE A CD1 1 
ATOM   767  C CD2 . PHE A 1 158 ? -32.243 0.489   -2.937  1.00 58.11  ? 158 PHE A CD2 1 
ATOM   768  C CE1 . PHE A 1 158 ? -31.391 2.570   -4.539  1.00 63.09  ? 158 PHE A CE1 1 
ATOM   769  C CE2 . PHE A 1 158 ? -32.649 0.553   -4.257  1.00 60.78  ? 158 PHE A CE2 1 
ATOM   770  C CZ  . PHE A 1 158 ? -32.222 1.595   -5.060  1.00 61.77  ? 158 PHE A CZ  1 
ATOM   771  N N   . ARG A 1 159 ? -28.593 1.929   1.017   1.00 58.26  ? 159 ARG A N   1 
ATOM   772  C CA  . ARG A 1 159 ? -28.217 2.238   2.393   1.00 68.03  ? 159 ARG A CA  1 
ATOM   773  C C   . ARG A 1 159 ? -29.427 2.818   3.125   1.00 68.76  ? 159 ARG A C   1 
ATOM   774  O O   . ARG A 1 159 ? -30.015 3.805   2.680   1.00 71.60  ? 159 ARG A O   1 
ATOM   775  C CB  . ARG A 1 159 ? -27.039 3.217   2.420   1.00 72.85  ? 159 ARG A CB  1 
ATOM   776  C CG  . ARG A 1 159 ? -26.186 3.145   3.681   1.00 77.46  ? 159 ARG A CG  1 
ATOM   777  C CD  . ARG A 1 159 ? -24.915 3.976   3.541   1.00 78.59  ? 159 ARG A CD  1 
ATOM   778  N NE  . ARG A 1 159 ? -24.040 3.855   4.706   1.00 88.45  ? 159 ARG A NE  1 
ATOM   779  C CZ  . ARG A 1 159 ? -22.938 4.575   4.893   1.00 93.10  ? 159 ARG A CZ  1 
ATOM   780  N NH1 . ARG A 1 159 ? -22.572 5.477   3.993   1.00 95.43  ? 159 ARG A NH1 1 
ATOM   781  N NH2 . ARG A 1 159 ? -22.202 4.399   5.982   1.00 95.43  ? 159 ARG A NH2 1 
ATOM   782  N N   . ALA A 1 160 ? -29.796 2.197   4.243   1.00 66.07  ? 160 ALA A N   1 
ATOM   783  C CA  . ALA A 1 160 ? -31.029 2.540   4.958   1.00 63.07  ? 160 ALA A CA  1 
ATOM   784  C C   . ALA A 1 160 ? -31.017 3.949   5.549   1.00 62.54  ? 160 ALA A C   1 
ATOM   785  O O   . ALA A 1 160 ? -32.020 4.660   5.491   1.00 67.69  ? 160 ALA A O   1 
ATOM   786  C CB  . ALA A 1 160 ? -31.319 1.511   6.041   1.00 58.82  ? 160 ALA A CB  1 
ATOM   787  N N   . ASP A 1 161 ? -29.881 4.335   6.123   1.00 66.77  ? 161 ASP A N   1 
ATOM   788  C CA  . ASP A 1 161 ? -29.677 5.692   6.622   1.00 66.80  ? 161 ASP A CA  1 
ATOM   789  C C   . ASP A 1 161 ? -30.032 6.712   5.557   1.00 67.01  ? 161 ASP A C   1 
ATOM   790  O O   . ASP A 1 161 ? -30.747 7.683   5.811   1.00 64.96  ? 161 ASP A O   1 
ATOM   791  C CB  . ASP A 1 161 ? -28.207 5.904   6.993   1.00 72.84  ? 161 ASP A CB  1 
ATOM   792  C CG  . ASP A 1 161 ? -27.833 5.256   8.303   1.00 76.82  ? 161 ASP A CG  1 
ATOM   793  O OD1 . ASP A 1 161 ? -28.206 4.083   8.520   1.00 81.02  ? 161 ASP A OD1 1 
ATOM   794  O OD2 . ASP A 1 161 ? -27.154 5.921   9.116   1.00 77.92  ? 161 ASP A OD2 1 
ATOM   795  N N   . HIS A 1 162 ? -29.512 6.473   4.360   1.00 70.06  ? 162 HIS A N   1 
ATOM   796  C CA  . HIS A 1 162 ? -29.585 7.431   3.273   1.00 69.99  ? 162 HIS A CA  1 
ATOM   797  C C   . HIS A 1 162 ? -30.962 7.490   2.621   1.00 65.31  ? 162 HIS A C   1 
ATOM   798  O O   . HIS A 1 162 ? -31.501 8.575   2.402   1.00 66.22  ? 162 HIS A O   1 
ATOM   799  C CB  . HIS A 1 162 ? -28.510 7.121   2.234   1.00 76.04  ? 162 HIS A CB  1 
ATOM   800  C CG  . HIS A 1 162 ? -28.486 8.081   1.090   1.00 81.06  ? 162 HIS A CG  1 
ATOM   801  N ND1 . HIS A 1 162 ? -28.789 7.706   -0.200  1.00 82.48  ? 162 HIS A ND1 1 
ATOM   802  C CD2 . HIS A 1 162 ? -28.208 9.405   1.043   1.00 82.10  ? 162 HIS A CD2 1 
ATOM   803  C CE1 . HIS A 1 162 ? -28.690 8.756   -0.995  1.00 82.78  ? 162 HIS A CE1 1 
ATOM   804  N NE2 . HIS A 1 162 ? -28.340 9.800   -0.265  1.00 82.78  ? 162 HIS A NE2 1 
ATOM   805  N N   . LEU A 1 163 ? -31.528 6.328   2.306   1.00 59.87  ? 163 LEU A N   1 
ATOM   806  C CA  . LEU A 1 163 ? -32.883 6.276   1.771   1.00 58.29  ? 163 LEU A CA  1 
ATOM   807  C C   . LEU A 1 163 ? -33.848 6.998   2.699   1.00 58.83  ? 163 LEU A C   1 
ATOM   808  O O   . LEU A 1 163 ? -34.658 7.814   2.259   1.00 56.63  ? 163 LEU A O   1 
ATOM   809  C CB  . LEU A 1 163 ? -33.347 4.832   1.571   1.00 51.04  ? 163 LEU A CB  1 
ATOM   810  C CG  . LEU A 1 163 ? -33.238 4.279   0.151   1.00 51.71  ? 163 LEU A CG  1 
ATOM   811  C CD1 . LEU A 1 163 ? -34.108 3.046   0.004   1.00 45.64  ? 163 LEU A CD1 1 
ATOM   812  C CD2 . LEU A 1 163 ? -33.648 5.334   -0.865  1.00 51.47  ? 163 LEU A CD2 1 
ATOM   813  N N   . LEU A 1 164 ? -33.745 6.693   3.988   1.00 58.12  ? 164 LEU A N   1 
ATOM   814  C CA  . LEU A 1 164 ? -34.622 7.275   4.995   1.00 53.73  ? 164 LEU A CA  1 
ATOM   815  C C   . LEU A 1 164 ? -34.463 8.789   5.078   1.00 58.51  ? 164 LEU A C   1 
ATOM   816  O O   . LEU A 1 164 ? -35.449 9.524   5.037   1.00 59.95  ? 164 LEU A O   1 
ATOM   817  C CB  . LEU A 1 164 ? -34.357 6.641   6.361   1.00 53.57  ? 164 LEU A CB  1 
ATOM   818  C CG  . LEU A 1 164 ? -35.265 7.070   7.515   1.00 57.28  ? 164 LEU A CG  1 
ATOM   819  C CD1 . LEU A 1 164 ? -36.711 6.677   7.228   1.00 56.90  ? 164 LEU A CD1 1 
ATOM   820  C CD2 . LEU A 1 164 ? -34.792 6.435   8.816   1.00 59.62  ? 164 LEU A CD2 1 
ATOM   821  N N   . LYS A 1 165 ? -33.221 9.251   5.193   1.00 59.49  ? 165 LYS A N   1 
ATOM   822  C CA  . LYS A 1 165 ? -32.947 10.680  5.265   1.00 59.45  ? 165 LYS A CA  1 
ATOM   823  C C   . LYS A 1 165 ? -33.532 11.389  4.049   1.00 58.28  ? 165 LYS A C   1 
ATOM   824  O O   . LYS A 1 165 ? -34.184 12.424  4.177   1.00 63.08  ? 165 LYS A O   1 
ATOM   825  C CB  . LYS A 1 165 ? -31.441 10.936  5.354   1.00 63.51  ? 165 LYS A CB  1 
ATOM   826  C CG  . LYS A 1 165 ? -31.075 12.289  5.952   1.00 67.49  ? 165 LYS A CG  1 
ATOM   827  C CD  . LYS A 1 165 ? -29.580 12.562  5.803   1.00 71.44  ? 165 LYS A CD  1 
ATOM   828  C CE  . LYS A 1 165 ? -29.155 13.741  6.676   1.00 72.26  ? 165 LYS A CE  1 
ATOM   829  N NZ  . LYS A 1 165 ? -27.697 14.030  6.527   1.00 70.42  ? 165 LYS A NZ  1 
ATOM   830  N N   . ALA A 1 166 ? -33.303 10.813  2.872   1.00 56.39  ? 166 ALA A N   1 
ATOM   831  C CA  . ALA A 1 166 ? -33.792 11.382  1.619   1.00 60.57  ? 166 ALA A CA  1 
ATOM   832  C C   . ALA A 1 166 ? -35.317 11.415  1.566   1.00 65.56  ? 166 ALA A C   1 
ATOM   833  O O   . ALA A 1 166 ? -35.910 12.422  1.173   1.00 64.84  ? 166 ALA A O   1 
ATOM   834  C CB  . ALA A 1 166 ? -33.237 10.607  0.432   1.00 56.24  ? 166 ALA A CB  1 
ATOM   835  N N   . HIS A 1 167 ? -35.943 10.310  1.961   1.00 66.10  ? 167 HIS A N   1 
ATOM   836  C CA  . HIS A 1 167 ? -37.397 10.203  1.955   1.00 69.47  ? 167 HIS A CA  1 
ATOM   837  C C   . HIS A 1 167 ? -38.025 11.253  2.860   1.00 68.90  ? 167 HIS A C   1 
ATOM   838  O O   . HIS A 1 167 ? -38.988 11.918  2.477   1.00 67.49  ? 167 HIS A O   1 
ATOM   839  C CB  . HIS A 1 167 ? -37.835 8.810   2.403   1.00 77.81  ? 167 HIS A CB  1 
ATOM   840  C CG  . HIS A 1 167 ? -39.276 8.512   2.128   1.00 81.61  ? 167 HIS A CG  1 
ATOM   841  N ND1 . HIS A 1 167 ? -39.705 7.956   0.943   1.00 82.63  ? 167 HIS A ND1 1 
ATOM   842  C CD2 . HIS A 1 167 ? -40.386 8.691   2.883   1.00 83.28  ? 167 HIS A CD2 1 
ATOM   843  C CE1 . HIS A 1 167 ? -41.016 7.805   0.978   1.00 84.06  ? 167 HIS A CE1 1 
ATOM   844  N NE2 . HIS A 1 167 ? -41.455 8.243   2.144   1.00 84.12  ? 167 HIS A NE2 1 
ATOM   845  N N   . LEU A 1 168 ? -37.478 11.393  4.063   1.00 67.35  ? 168 LEU A N   1 
ATOM   846  C CA  . LEU A 1 168 ? -37.984 12.372  5.014   1.00 63.47  ? 168 LEU A CA  1 
ATOM   847  C C   . LEU A 1 168 ? -37.847 13.781  4.458   1.00 70.31  ? 168 LEU A C   1 
ATOM   848  O O   . LEU A 1 168 ? -38.800 14.556  4.487   1.00 79.78  ? 168 LEU A O   1 
ATOM   849  C CB  . LEU A 1 168 ? -37.273 12.252  6.363   1.00 58.66  ? 168 LEU A CB  1 
ATOM   850  C CG  . LEU A 1 168 ? -37.579 10.990  7.172   1.00 58.32  ? 168 LEU A CG  1 
ATOM   851  C CD1 . LEU A 1 168 ? -37.191 11.183  8.628   1.00 58.82  ? 168 LEU A CD1 1 
ATOM   852  C CD2 . LEU A 1 168 ? -39.048 10.623  7.063   1.00 56.08  ? 168 LEU A CD2 1 
ATOM   853  N N   . GLN A 1 169 ? -36.665 14.103  3.940   1.00 75.01  ? 169 GLN A N   1 
ATOM   854  C CA  . GLN A 1 169 ? -36.419 15.416  3.347   1.00 79.92  ? 169 GLN A CA  1 
ATOM   855  C C   . GLN A 1 169 ? -37.395 15.713  2.211   1.00 82.64  ? 169 GLN A C   1 
ATOM   856  O O   . GLN A 1 169 ? -37.789 16.862  2.006   1.00 80.14  ? 169 GLN A O   1 
ATOM   857  C CB  . GLN A 1 169 ? -34.975 15.524  2.851   1.00 80.78  ? 169 GLN A CB  1 
ATOM   858  C CG  . GLN A 1 169 ? -33.945 15.645  3.965   1.00 80.11  ? 169 GLN A CG  1 
ATOM   859  C CD  . GLN A 1 169 ? -32.520 15.705  3.447   1.00 79.90  ? 169 GLN A CD  1 
ATOM   860  O OE1 . GLN A 1 169 ? -31.609 16.136  4.155   1.00 79.39  ? 169 GLN A OE1 1 
ATOM   861  N NE2 . GLN A 1 169 ? -32.319 15.273  2.207   1.00 77.53  ? 169 GLN A NE2 1 
ATOM   862  N N   . LYS A 1 170 ? -37.781 14.672  1.479   1.00 85.40  ? 170 LYS A N   1 
ATOM   863  C CA  . LYS A 1 170 ? -38.738 14.811  0.387   1.00 87.87  ? 170 LYS A CA  1 
ATOM   864  C C   . LYS A 1 170 ? -40.122 15.172  0.922   1.00 89.41  ? 170 LYS A C   1 
ATOM   865  O O   . LYS A 1 170 ? -40.651 16.243  0.618   1.00 93.07  ? 170 LYS A O   1 
ATOM   866  C CB  . LYS A 1 170 ? -38.802 13.526  -0.444  1.00 88.51  ? 170 LYS A CB  1 
ATOM   867  C CG  . LYS A 1 170 ? -39.512 13.688  -1.781  1.00 90.49  ? 170 LYS A CG  1 
ATOM   868  C CD  . LYS A 1 170 ? -39.287 12.486  -2.690  1.00 94.17  ? 170 LYS A CD  1 
ATOM   869  C CE  . LYS A 1 170 ? -40.094 11.278  -2.235  1.00 97.56  ? 170 LYS A CE  1 
ATOM   870  N NZ  . LYS A 1 170 ? -39.891 10.109  -3.136  1.00 98.76  ? 170 LYS A NZ  1 
ATOM   871  N N   . LEU A 1 171 ? -40.698 14.277  1.721   1.00 87.90  ? 171 LEU A N   1 
ATOM   872  C CA  . LEU A 1 171 ? -42.001 14.517  2.335   1.00 87.18  ? 171 LEU A CA  1 
ATOM   873  C C   . LEU A 1 171 ? -42.009 15.823  3.120   1.00 91.23  ? 171 LEU A C   1 
ATOM   874  O O   . LEU A 1 171 ? -43.045 16.477  3.244   1.00 95.32  ? 171 LEU A O   1 
ATOM   875  C CB  . LEU A 1 171 ? -42.379 13.364  3.269   1.00 83.93  ? 171 LEU A CB  1 
ATOM   876  C CG  . LEU A 1 171 ? -42.614 11.980  2.662   1.00 82.56  ? 171 LEU A CG  1 
ATOM   877  C CD1 . LEU A 1 171 ? -42.946 10.974  3.753   1.00 82.07  ? 171 LEU A CD1 1 
ATOM   878  C CD2 . LEU A 1 171 ? -43.721 12.024  1.620   1.00 82.45  ? 171 LEU A CD2 1 
ATOM   879  N N   . MET A 1 172 ? -40.848 16.195  3.648   1.00 92.41  ? 172 MET A N   1 
ATOM   880  C CA  . MET A 1 172 ? -40.733 17.366  4.508   1.00 95.39  ? 172 MET A CA  1 
ATOM   881  C C   . MET A 1 172 ? -40.813 18.662  3.713   1.00 96.42  ? 172 MET A C   1 
ATOM   882  O O   . MET A 1 172 ? -41.459 19.620  4.139   1.00 99.90  ? 172 MET A O   1 
ATOM   883  C CB  . MET A 1 172 ? -39.426 17.319  5.293   1.00 97.01  ? 172 MET A CB  1 
ATOM   884  C CG  . MET A 1 172 ? -39.514 17.908  6.687   1.00 99.80  ? 172 MET A CG  1 
ATOM   885  S SD  . MET A 1 172 ? -37.949 17.736  7.559   1.00 103.60 ? 172 MET A SD  1 
ATOM   886  C CE  . MET A 1 172 ? -37.412 16.137  6.954   1.00 99.71  ? 172 MET A CE  1 
ATOM   887  N N   . SER A 1 173 ? -40.152 18.691  2.560   1.00 98.71  ? 173 SER A N   1 
ATOM   888  C CA  . SER A 1 173 ? -40.175 19.875  1.710   1.00 98.57  ? 173 SER A CA  1 
ATOM   889  C C   . SER A 1 173 ? -41.400 19.906  0.798   1.00 100.09 ? 173 SER A C   1 
ATOM   890  O O   . SER A 1 173 ? -41.432 20.649  -0.184  1.00 102.61 ? 173 SER A O   1 
ATOM   891  C CB  . SER A 1 173 ? -38.883 19.998  0.897   1.00 97.06  ? 173 SER A CB  1 
ATOM   892  O OG  . SER A 1 173 ? -38.617 18.809  0.171   1.00 97.52  ? 173 SER A OG  1 
ATOM   893  N N   . ASP A 1 174 ? -42.402 19.092  1.120   1.00 100.02 ? 174 ASP A N   1 
ATOM   894  C CA  . ASP A 1 174 ? -43.703 19.224  0.478   1.00 100.22 ? 174 ASP A CA  1 
ATOM   895  C C   . ASP A 1 174 ? -44.514 20.263  1.239   1.00 99.02  ? 174 ASP A C   1 
ATOM   896  O O   . ASP A 1 174 ? -44.714 20.148  2.449   1.00 94.84  ? 174 ASP A O   1 
ATOM   897  C CB  . ASP A 1 174 ? -44.456 17.895  0.434   1.00 100.49 ? 174 ASP A CB  1 
ATOM   898  C CG  . ASP A 1 174 ? -45.781 18.005  -0.300  1.00 101.05 ? 174 ASP A CG  1 
ATOM   899  O OD1 . ASP A 1 174 ? -46.179 19.138  -0.660  1.00 101.73 ? 174 ASP A OD1 1 
ATOM   900  O OD2 . ASP A 1 174 ? -46.423 16.957  -0.522  1.00 100.38 ? 174 ASP A OD2 1 
ATOM   901  N N   . LYS A 1 175 ? -44.983 21.275  0.518   1.00 101.57 ? 175 LYS A N   1 
ATOM   902  C CA  . LYS A 1 175 ? -45.617 22.433  1.138   1.00 103.95 ? 175 LYS A CA  1 
ATOM   903  C C   . LYS A 1 175 ? -47.078 22.210  1.531   1.00 100.22 ? 175 LYS A C   1 
ATOM   904  O O   . LYS A 1 175 ? -47.814 23.170  1.763   1.00 100.21 ? 175 LYS A O   1 
ATOM   905  C CB  . LYS A 1 175 ? -45.488 23.660  0.230   1.00 106.51 ? 175 LYS A CB  1 
ATOM   906  C CG  . LYS A 1 175 ? -44.049 24.077  -0.045  1.00 107.75 ? 175 LYS A CG  1 
ATOM   907  C CD  . LYS A 1 175 ? -43.983 25.334  -0.901  1.00 107.44 ? 175 LYS A CD  1 
ATOM   908  C CE  . LYS A 1 175 ? -44.526 26.546  -0.158  1.00 107.63 ? 175 LYS A CE  1 
ATOM   909  N NZ  . LYS A 1 175 ? -43.726 26.860  1.058   1.00 108.95 ? 175 LYS A NZ  1 
ATOM   910  N N   . LYS A 1 176 ? -47.497 20.951  1.605   1.00 96.37  ? 176 LYS A N   1 
ATOM   911  C CA  . LYS A 1 176 ? -48.830 20.623  2.109   1.00 93.76  ? 176 LYS A CA  1 
ATOM   912  C C   . LYS A 1 176 ? -48.739 19.680  3.306   1.00 90.09  ? 176 LYS A C   1 
ATOM   913  O O   . LYS A 1 176 ? -49.673 18.935  3.606   1.00 89.10  ? 176 LYS A O   1 
ATOM   914  C CB  . LYS A 1 176 ? -49.719 20.039  1.005   1.00 96.68  ? 176 LYS A CB  1 
ATOM   915  C CG  . LYS A 1 176 ? -49.137 18.838  0.281   1.00 99.18  ? 176 LYS A CG  1 
ATOM   916  C CD  . LYS A 1 176 ? -49.971 18.480  -0.939  1.00 100.00 ? 176 LYS A CD  1 
ATOM   917  C CE  . LYS A 1 176 ? -49.264 17.456  -1.812  1.00 100.93 ? 176 LYS A CE  1 
ATOM   918  N NZ  . LYS A 1 176 ? -50.058 17.110  -3.023  1.00 102.24 ? 176 LYS A NZ  1 
ATOM   919  N N   . CYS A 1 177 ? -47.598 19.732  3.985   1.00 86.34  ? 177 CYS A N   1 
ATOM   920  C CA  . CYS A 1 177 ? -47.355 18.939  5.180   1.00 81.70  ? 177 CYS A CA  1 
ATOM   921  C C   . CYS A 1 177 ? -47.484 19.833  6.410   1.00 74.16  ? 177 CYS A C   1 
ATOM   922  O O   . CYS A 1 177 ? -47.255 21.040  6.333   1.00 70.57  ? 177 CYS A O   1 
ATOM   923  C CB  . CYS A 1 177 ? -45.957 18.323  5.114   1.00 85.86  ? 177 CYS A CB  1 
ATOM   924  S SG  . CYS A 1 177 ? -45.490 17.320  6.535   1.00 88.46  ? 177 CYS A SG  1 
ATOM   925  N N   . SER A 1 178 ? -47.851 19.239  7.541   1.00 75.82  ? 178 SER A N   1 
ATOM   926  C CA  . SER A 1 178 ? -48.052 20.002  8.768   1.00 79.85  ? 178 SER A CA  1 
ATOM   927  C C   . SER A 1 178 ? -46.730 20.431  9.400   1.00 77.54  ? 178 SER A C   1 
ATOM   928  O O   . SER A 1 178 ? -45.689 19.812  9.173   1.00 76.64  ? 178 SER A O   1 
ATOM   929  C CB  . SER A 1 178 ? -48.879 19.197  9.774   1.00 82.87  ? 178 SER A CB  1 
ATOM   930  O OG  . SER A 1 178 ? -48.197 18.022  10.170  1.00 89.56  ? 178 SER A OG  1 
ATOM   931  N N   . VAL A 1 179 ? -46.785 21.501  10.187  1.00 78.01  ? 179 VAL A N   1 
ATOM   932  C CA  . VAL A 1 179 ? -45.627 21.973  10.934  1.00 78.76  ? 179 VAL A CA  1 
ATOM   933  C C   . VAL A 1 179 ? -45.219 20.922  11.960  1.00 78.58  ? 179 VAL A C   1 
ATOM   934  O O   . VAL A 1 179 ? -44.031 20.699  12.200  1.00 81.48  ? 179 VAL A O   1 
ATOM   935  C CB  . VAL A 1 179 ? -45.929 23.301  11.658  1.00 77.65  ? 179 VAL A CB  1 
ATOM   936  C CG1 . VAL A 1 179 ? -44.720 23.766  12.458  1.00 77.44  ? 179 VAL A CG1 1 
ATOM   937  C CG2 . VAL A 1 179 ? -46.356 24.367  10.659  1.00 78.01  ? 179 VAL A CG2 1 
ATOM   938  N N   . GLU A 1 180 ? -46.216 20.274  12.555  1.00 75.35  ? 180 GLU A N   1 
ATOM   939  C CA  . GLU A 1 180 ? -45.972 19.262  13.576  1.00 75.61  ? 180 GLU A CA  1 
ATOM   940  C C   . GLU A 1 180 ? -45.349 18.004  12.980  1.00 70.56  ? 180 GLU A C   1 
ATOM   941  O O   . GLU A 1 180 ? -44.611 17.289  13.660  1.00 60.22  ? 180 GLU A O   1 
ATOM   942  C CB  . GLU A 1 180 ? -47.260 18.939  14.335  1.00 84.48  ? 180 GLU A CB  1 
ATOM   943  C CG  . GLU A 1 180 ? -47.947 20.175  14.897  1.00 91.04  ? 180 GLU A CG  1 
ATOM   944  C CD  . GLU A 1 180 ? -48.792 19.882  16.121  1.00 96.98  ? 180 GLU A CD  1 
ATOM   945  O OE1 . GLU A 1 180 ? -49.010 18.691  16.430  1.00 99.13  ? 180 GLU A OE1 1 
ATOM   946  O OE2 . GLU A 1 180 ? -49.239 20.848  16.777  1.00 99.33  ? 180 GLU A OE2 1 
ATOM   947  N N   . LYS A 1 181 ? -45.647 17.738  11.711  1.00 70.14  ? 181 LYS A N   1 
ATOM   948  C CA  . LYS A 1 181 ? -44.952 16.689  10.975  1.00 69.83  ? 181 LYS A CA  1 
ATOM   949  C C   . LYS A 1 181 ? -43.488 17.052  10.805  1.00 73.55  ? 181 LYS A C   1 
ATOM   950  O O   . LYS A 1 181 ? -42.601 16.279  11.168  1.00 74.51  ? 181 LYS A O   1 
ATOM   951  C CB  . LYS A 1 181 ? -45.583 16.463  9.604   1.00 66.35  ? 181 LYS A CB  1 
ATOM   952  C CG  . LYS A 1 181 ? -46.191 15.090  9.424   1.00 65.41  ? 181 LYS A CG  1 
ATOM   953  C CD  . LYS A 1 181 ? -45.158 14.002  9.658   1.00 64.58  ? 181 LYS A CD  1 
ATOM   954  C CE  . LYS A 1 181 ? -45.733 12.633  9.354   1.00 65.02  ? 181 LYS A CE  1 
ATOM   955  N NZ  . LYS A 1 181 ? -44.872 11.535  9.866   1.00 66.34  ? 181 LYS A NZ  1 
ATOM   956  N N   . LYS A 1 182 ? -43.240 18.232  10.246  1.00 74.39  ? 182 LYS A N   1 
ATOM   957  C CA  . LYS A 1 182 ? -41.879 18.715  10.074  1.00 74.62  ? 182 LYS A CA  1 
ATOM   958  C C   . LYS A 1 182 ? -41.092 18.551  11.370  1.00 73.25  ? 182 LYS A C   1 
ATOM   959  O O   . LYS A 1 182 ? -39.924 18.169  11.348  1.00 79.82  ? 182 LYS A O   1 
ATOM   960  C CB  . LYS A 1 182 ? -41.879 20.177  9.619   1.00 79.38  ? 182 LYS A CB  1 
ATOM   961  C CG  . LYS A 1 182 ? -42.379 20.368  8.194   1.00 80.77  ? 182 LYS A CG  1 
ATOM   962  C CD  . LYS A 1 182 ? -42.782 21.809  7.927   1.00 82.85  ? 182 LYS A CD  1 
ATOM   963  C CE  . LYS A 1 182 ? -43.436 21.943  6.561   1.00 83.11  ? 182 LYS A CE  1 
ATOM   964  N NZ  . LYS A 1 182 ? -44.077 23.276  6.377   1.00 80.14  ? 182 LYS A NZ  1 
ATOM   965  N N   . SER A 1 183 ? -41.743 18.821  12.498  1.00 70.30  ? 183 SER A N   1 
ATOM   966  C CA  . SER A 1 183 ? -41.094 18.709  13.802  1.00 71.46  ? 183 SER A CA  1 
ATOM   967  C C   . SER A 1 183 ? -40.890 17.257  14.228  1.00 73.57  ? 183 SER A C   1 
ATOM   968  O O   . SER A 1 183 ? -39.873 16.921  14.835  1.00 73.98  ? 183 SER A O   1 
ATOM   969  C CB  . SER A 1 183 ? -41.890 19.466  14.867  1.00 71.00  ? 183 SER A CB  1 
ATOM   970  O OG  . SER A 1 183 ? -41.216 19.442  16.113  1.00 72.09  ? 183 SER A OG  1 
ATOM   971  N N   . GLU A 1 184 ? -41.861 16.404  13.915  1.00 75.47  ? 184 GLU A N   1 
ATOM   972  C CA  . GLU A 1 184 ? -41.744 14.973  14.180  1.00 72.79  ? 184 GLU A CA  1 
ATOM   973  C C   . GLU A 1 184 ? -40.600 14.377  13.366  1.00 72.38  ? 184 GLU A C   1 
ATOM   974  O O   . GLU A 1 184 ? -39.808 13.582  13.873  1.00 69.32  ? 184 GLU A O   1 
ATOM   975  C CB  . GLU A 1 184 ? -43.060 14.261  13.848  1.00 71.10  ? 184 GLU A CB  1 
ATOM   976  C CG  . GLU A 1 184 ? -42.939 12.753  13.658  1.00 73.89  ? 184 GLU A CG  1 
ATOM   977  C CD  . GLU A 1 184 ? -44.271 12.090  13.354  1.00 74.84  ? 184 GLU A CD  1 
ATOM   978  O OE1 . GLU A 1 184 ? -45.231 12.297  14.126  1.00 74.65  ? 184 GLU A OE1 1 
ATOM   979  O OE2 . GLU A 1 184 ? -44.356 11.353  12.348  1.00 74.67  ? 184 GLU A OE2 1 
ATOM   980  N N   . MET A 1 185 ? -40.517 14.781  12.102  1.00 69.06  ? 185 MET A N   1 
ATOM   981  C CA  . MET A 1 185 ? -39.533 14.235  11.171  1.00 66.57  ? 185 MET A CA  1 
ATOM   982  C C   . MET A 1 185 ? -38.097 14.652  11.486  1.00 71.36  ? 185 MET A C   1 
ATOM   983  O O   . MET A 1 185 ? -37.163 13.878  11.277  1.00 73.48  ? 185 MET A O   1 
ATOM   984  C CB  . MET A 1 185 ? -39.890 14.612  9.732   1.00 64.02  ? 185 MET A CB  1 
ATOM   985  C CG  . MET A 1 185 ? -41.011 13.775  9.139   1.00 63.98  ? 185 MET A CG  1 
ATOM   986  S SD  . MET A 1 185 ? -41.426 14.258  7.454   1.00 68.24  ? 185 MET A SD  1 
ATOM   987  C CE  . MET A 1 185 ? -42.480 12.893  6.968   1.00 67.11  ? 185 MET A CE  1 
ATOM   988  N N   . GLU A 1 186 ? -37.921 15.876  11.975  1.00 72.98  ? 186 GLU A N   1 
ATOM   989  C CA  . GLU A 1 186 ? -36.601 16.355  12.376  1.00 71.60  ? 186 GLU A CA  1 
ATOM   990  C C   . GLU A 1 186 ? -36.200 15.697  13.681  1.00 72.57  ? 186 GLU A C   1 
ATOM   991  O O   . GLU A 1 186 ? -35.031 15.372  13.896  1.00 75.18  ? 186 GLU A O   1 
ATOM   992  C CB  . GLU A 1 186 ? -36.605 17.870  12.545  1.00 77.00  ? 186 GLU A CB  1 
ATOM   993  C CG  . GLU A 1 186 ? -36.848 18.632  11.259  1.00 80.15  ? 186 GLU A CG  1 
ATOM   994  C CD  . GLU A 1 186 ? -37.076 20.107  11.505  1.00 83.23  ? 186 GLU A CD  1 
ATOM   995  O OE1 . GLU A 1 186 ? -37.311 20.490  12.671  1.00 85.44  ? 186 GLU A OE1 1 
ATOM   996  O OE2 . GLU A 1 186 ? -37.019 20.887  10.532  1.00 87.17  ? 186 GLU A OE2 1 
ATOM   997  N N   . SER A 1 187 ? -37.183 15.514  14.554  1.00 72.14  ? 187 SER A N   1 
ATOM   998  C CA  . SER A 1 187 ? -36.992 14.743  15.768  1.00 75.25  ? 187 SER A CA  1 
ATOM   999  C C   . SER A 1 187 ? -36.407 13.385  15.397  1.00 78.13  ? 187 SER A C   1 
ATOM   1000 O O   . SER A 1 187 ? -35.725 12.750  16.202  1.00 82.78  ? 187 SER A O   1 
ATOM   1001 C CB  . SER A 1 187 ? -38.327 14.560  16.493  1.00 76.31  ? 187 SER A CB  1 
ATOM   1002 O OG  . SER A 1 187 ? -38.206 13.648  17.570  1.00 78.70  ? 187 SER A OG  1 
ATOM   1003 N N   . VAL A 1 188 ? -36.669 12.955  14.166  1.00 78.09  ? 188 VAL A N   1 
ATOM   1004 C CA  . VAL A 1 188 ? -36.223 11.651  13.684  1.00 75.10  ? 188 VAL A CA  1 
ATOM   1005 C C   . VAL A 1 188 ? -34.844 11.708  13.025  1.00 74.21  ? 188 VAL A C   1 
ATOM   1006 O O   . VAL A 1 188 ? -34.000 10.844  13.268  1.00 76.65  ? 188 VAL A O   1 
ATOM   1007 C CB  . VAL A 1 188 ? -37.243 11.033  12.701  1.00 73.38  ? 188 VAL A CB  1 
ATOM   1008 C CG1 . VAL A 1 188 ? -36.633 9.857   11.959  1.00 73.16  ? 188 VAL A CG1 1 
ATOM   1009 C CG2 . VAL A 1 188 ? -38.504 10.610  13.438  1.00 71.97  ? 188 VAL A CG2 1 
ATOM   1010 N N   . LEU A 1 189 ? -34.617 12.725  12.199  1.00 74.39  ? 189 LEU A N   1 
ATOM   1011 C CA  . LEU A 1 189 ? -33.341 12.883  11.502  1.00 79.04  ? 189 LEU A CA  1 
ATOM   1012 C C   . LEU A 1 189 ? -32.180 13.120  12.464  1.00 85.34  ? 189 LEU A C   1 
ATOM   1013 O O   . LEU A 1 189 ? -31.021 12.876  12.125  1.00 88.86  ? 189 LEU A O   1 
ATOM   1014 C CB  . LEU A 1 189 ? -33.411 14.032  10.494  1.00 73.92  ? 189 LEU A CB  1 
ATOM   1015 C CG  . LEU A 1 189 ? -34.274 13.853  9.245   1.00 72.18  ? 189 LEU A CG  1 
ATOM   1016 C CD1 . LEU A 1 189 ? -34.153 15.077  8.354   1.00 70.82  ? 189 LEU A CD1 1 
ATOM   1017 C CD2 . LEU A 1 189 ? -33.872 12.603  8.486   1.00 72.47  ? 189 LEU A CD2 1 
ATOM   1018 N N   . ALA A 1 190 ? -32.498 13.597  13.664  1.00 87.02  ? 190 ALA A N   1 
ATOM   1019 C CA  . ALA A 1 190 ? -31.482 13.905  14.664  1.00 86.72  ? 190 ALA A CA  1 
ATOM   1020 C C   . ALA A 1 190 ? -31.126 12.690  15.517  1.00 83.46  ? 190 ALA A C   1 
ATOM   1021 O O   . ALA A 1 190 ? -30.355 12.797  16.471  1.00 86.35  ? 190 ALA A O   1 
ATOM   1022 C CB  . ALA A 1 190 ? -31.942 15.058  15.546  1.00 89.09  ? 190 ALA A CB  1 
ATOM   1023 N N   . GLN A 1 191 ? -31.689 11.537  15.171  1.00 81.06  ? 191 GLN A N   1 
ATOM   1024 C CA  . GLN A 1 191 ? -31.427 10.304  15.907  1.00 82.44  ? 191 GLN A CA  1 
ATOM   1025 C C   . GLN A 1 191 ? -31.118 9.142   14.965  1.00 81.50  ? 191 GLN A C   1 
ATOM   1026 O O   . GLN A 1 191 ? -31.059 7.989   15.392  1.00 83.58  ? 191 GLN A O   1 
ATOM   1027 C CB  . GLN A 1 191 ? -32.618 9.948   16.801  1.00 82.84  ? 191 GLN A CB  1 
ATOM   1028 C CG  . GLN A 1 191 ? -32.976 11.012  17.828  1.00 85.07  ? 191 GLN A CG  1 
ATOM   1029 C CD  . GLN A 1 191 ? -34.199 10.645  18.649  1.00 85.74  ? 191 GLN A CD  1 
ATOM   1030 O OE1 . GLN A 1 191 ? -34.574 9.475   18.737  1.00 86.12  ? 191 GLN A OE1 1 
ATOM   1031 N NE2 . GLN A 1 191 ? -34.826 11.645  19.256  1.00 85.33  ? 191 GLN A NE2 1 
ATOM   1032 N N   . LEU A 1 192 ? -30.920 9.455   13.687  1.00 78.46  ? 192 LEU A N   1 
ATOM   1033 C CA  . LEU A 1 192 ? -30.667 8.443   12.662  1.00 80.06  ? 192 LEU A CA  1 
ATOM   1034 C C   . LEU A 1 192 ? -29.603 7.428   13.067  1.00 82.32  ? 192 LEU A C   1 
ATOM   1035 O O   . LEU A 1 192 ? -29.840 6.220   13.035  1.00 87.13  ? 192 LEU A O   1 
ATOM   1036 C CB  . LEU A 1 192 ? -30.267 9.106   11.341  1.00 78.62  ? 192 LEU A CB  1 
ATOM   1037 C CG  . LEU A 1 192 ? -31.389 9.690   10.484  1.00 78.21  ? 192 LEU A CG  1 
ATOM   1038 C CD1 . LEU A 1 192 ? -30.812 10.481  9.320   1.00 79.77  ? 192 LEU A CD1 1 
ATOM   1039 C CD2 . LEU A 1 192 ? -32.302 8.586   9.983   1.00 75.37  ? 192 LEU A CD2 1 
ATOM   1040 N N   . ASP A 1 193 ? -28.431 7.926   13.447  1.00 84.77  ? 193 ASP A N   1 
ATOM   1041 C CA  . ASP A 1 193 ? -27.303 7.065   13.789  1.00 83.11  ? 193 ASP A CA  1 
ATOM   1042 C C   . ASP A 1 193 ? -27.389 6.514   15.212  1.00 82.89  ? 193 ASP A C   1 
ATOM   1043 O O   . ASP A 1 193 ? -26.367 6.309   15.868  1.00 90.11  ? 193 ASP A O   1 
ATOM   1044 C CB  . ASP A 1 193 ? -25.979 7.810   13.581  1.00 85.43  ? 193 ASP A CB  1 
ATOM   1045 C CG  . ASP A 1 193 ? -25.978 9.195   14.207  1.00 86.87  ? 193 ASP A CG  1 
ATOM   1046 O OD1 . ASP A 1 193 ? -24.896 9.816   14.274  1.00 86.53  ? 193 ASP A OD1 1 
ATOM   1047 O OD2 . ASP A 1 193 ? -27.056 9.666   14.630  1.00 85.82  ? 193 ASP A OD2 1 
ATOM   1048 N N   . ASN A 1 194 ? -28.610 6.266   15.678  1.00 77.21  ? 194 ASN A N   1 
ATOM   1049 C CA  . ASN A 1 194 ? -28.833 5.745   17.024  1.00 76.78  ? 194 ASN A CA  1 
ATOM   1050 C C   . ASN A 1 194 ? -29.928 4.681   17.084  1.00 73.70  ? 194 ASN A C   1 
ATOM   1051 O O   . ASN A 1 194 ? -30.029 3.941   18.064  1.00 71.58  ? 194 ASN A O   1 
ATOM   1052 C CB  . ASN A 1 194 ? -29.164 6.885   17.993  1.00 87.61  ? 194 ASN A CB  1 
ATOM   1053 C CG  . ASN A 1 194 ? -27.967 7.773   18.286  1.00 92.35  ? 194 ASN A CG  1 
ATOM   1054 O OD1 . ASN A 1 194 ? -26.833 7.302   18.374  1.00 96.72  ? 194 ASN A OD1 1 
ATOM   1055 N ND2 . ASN A 1 194 ? -28.220 9.066   18.450  1.00 93.48  ? 194 ASN A ND2 1 
ATOM   1056 N N   . TYR A 1 195 ? -30.746 4.610   16.038  1.00 70.11  ? 195 TYR A N   1 
ATOM   1057 C CA  . TYR A 1 195 ? -31.833 3.636   15.979  1.00 67.81  ? 195 TYR A CA  1 
ATOM   1058 C C   . TYR A 1 195 ? -31.308 2.217   15.783  1.00 64.54  ? 195 TYR A C   1 
ATOM   1059 O O   . TYR A 1 195 ? -30.404 1.985   14.980  1.00 60.31  ? 195 TYR A O   1 
ATOM   1060 C CB  . TYR A 1 195 ? -32.816 3.983   14.856  1.00 74.21  ? 195 TYR A CB  1 
ATOM   1061 C CG  . TYR A 1 195 ? -33.589 5.265   15.072  1.00 76.12  ? 195 TYR A CG  1 
ATOM   1062 C CD1 . TYR A 1 195 ? -33.413 6.356   14.229  1.00 76.82  ? 195 TYR A CD1 1 
ATOM   1063 C CD2 . TYR A 1 195 ? -34.498 5.385   16.116  1.00 76.61  ? 195 TYR A CD2 1 
ATOM   1064 C CE1 . TYR A 1 195 ? -34.121 7.529   14.421  1.00 76.69  ? 195 TYR A CE1 1 
ATOM   1065 C CE2 . TYR A 1 195 ? -35.210 6.554   16.316  1.00 75.31  ? 195 TYR A CE2 1 
ATOM   1066 C CZ  . TYR A 1 195 ? -35.017 7.623   15.466  1.00 76.34  ? 195 TYR A CZ  1 
ATOM   1067 O OH  . TYR A 1 195 ? -35.721 8.789   15.660  1.00 77.18  ? 195 TYR A OH  1 
ATOM   1068 N N   . GLY A 1 196 ? -31.884 1.272   16.519  1.00 62.24  ? 196 GLY A N   1 
ATOM   1069 C CA  . GLY A 1 196 ? -31.507 -0.133  16.402  1.00 61.06  ? 196 GLY A CA  1 
ATOM   1070 C C   . GLY A 1 196 ? -32.113 -0.787  15.175  1.00 63.40  ? 196 GLY A C   1 
ATOM   1071 O O   . GLY A 1 196 ? -32.754 -0.123  14.362  1.00 55.69  ? 196 GLY A O   1 
ATOM   1072 N N   . GLN A 1 197 ? -31.912 -2.095  15.044  1.00 70.13  ? 197 GLN A N   1 
ATOM   1073 C CA  . GLN A 1 197 ? -32.422 -2.842  13.898  1.00 71.85  ? 197 GLN A CA  1 
ATOM   1074 C C   . GLN A 1 197 ? -33.946 -2.780  13.824  1.00 74.41  ? 197 GLN A C   1 
ATOM   1075 O O   . GLN A 1 197 ? -34.510 -2.395  12.800  1.00 77.64  ? 197 GLN A O   1 
ATOM   1076 C CB  . GLN A 1 197 ? -31.947 -4.299  13.952  1.00 69.81  ? 197 GLN A CB  1 
ATOM   1077 C CG  . GLN A 1 197 ? -32.209 -5.100  12.680  1.00 70.08  ? 197 GLN A CG  1 
ATOM   1078 C CD  . GLN A 1 197 ? -33.645 -5.579  12.567  1.00 71.25  ? 197 GLN A CD  1 
ATOM   1079 O OE1 . GLN A 1 197 ? -34.283 -5.914  13.566  1.00 70.19  ? 197 GLN A OE1 1 
ATOM   1080 N NE2 . GLN A 1 197 ? -34.160 -5.620  11.343  1.00 72.54  ? 197 GLN A NE2 1 
ATOM   1081 N N   . GLN A 1 198 ? -34.605 -3.160  14.915  1.00 73.42  ? 198 GLN A N   1 
ATOM   1082 C CA  . GLN A 1 198 ? -36.063 -3.167  14.974  1.00 72.22  ? 198 GLN A CA  1 
ATOM   1083 C C   . GLN A 1 198 ? -36.630 -1.751  14.960  1.00 71.88  ? 198 GLN A C   1 
ATOM   1084 O O   . GLN A 1 198 ? -37.617 -1.475  14.277  1.00 73.45  ? 198 GLN A O   1 
ATOM   1085 C CB  . GLN A 1 198 ? -36.542 -3.915  16.222  1.00 71.38  ? 198 GLN A CB  1 
ATOM   1086 C CG  . GLN A 1 198 ? -38.054 -3.926  16.408  1.00 71.25  ? 198 GLN A CG  1 
ATOM   1087 C CD  . GLN A 1 198 ? -38.776 -4.723  15.338  1.00 71.09  ? 198 GLN A CD  1 
ATOM   1088 O OE1 . GLN A 1 198 ? -38.257 -5.717  14.829  1.00 70.71  ? 198 GLN A OE1 1 
ATOM   1089 N NE2 . GLN A 1 198 ? -39.984 -4.293  14.995  1.00 71.25  ? 198 GLN A NE2 1 
ATOM   1090 N N   . GLU A 1 199 ? -35.994 -0.859  15.713  1.00 69.57  ? 199 GLU A N   1 
ATOM   1091 C CA  . GLU A 1 199 ? -36.459 0.518   15.838  1.00 71.47  ? 199 GLU A CA  1 
ATOM   1092 C C   . GLU A 1 199 ? -36.414 1.254   14.501  1.00 68.87  ? 199 GLU A C   1 
ATOM   1093 O O   . GLU A 1 199 ? -37.274 2.086   14.212  1.00 71.99  ? 199 GLU A O   1 
ATOM   1094 C CB  . GLU A 1 199 ? -35.628 1.263   16.885  1.00 76.72  ? 199 GLU A CB  1 
ATOM   1095 C CG  . GLU A 1 199 ? -36.271 2.539   17.403  1.00 83.11  ? 199 GLU A CG  1 
ATOM   1096 C CD  . GLU A 1 199 ? -35.482 3.176   18.532  1.00 86.45  ? 199 GLU A CD  1 
ATOM   1097 O OE1 . GLU A 1 199 ? -34.392 2.663   18.864  1.00 87.34  ? 199 GLU A OE1 1 
ATOM   1098 O OE2 . GLU A 1 199 ? -35.952 4.191   19.087  1.00 89.79  ? 199 GLU A OE2 1 
ATOM   1099 N N   . LEU A 1 200 ? -35.409 0.940   13.689  1.00 71.32  ? 200 LEU A N   1 
ATOM   1100 C CA  . LEU A 1 200 ? -35.253 1.565   12.380  1.00 65.13  ? 200 LEU A CA  1 
ATOM   1101 C C   . LEU A 1 200 ? -36.187 0.920   11.358  1.00 59.67  ? 200 LEU A C   1 
ATOM   1102 O O   . LEU A 1 200 ? -36.628 1.569   10.410  1.00 54.74  ? 200 LEU A O   1 
ATOM   1103 C CB  . LEU A 1 200 ? -33.795 1.473   11.918  1.00 65.09  ? 200 LEU A CB  1 
ATOM   1104 C CG  . LEU A 1 200 ? -33.325 2.367   10.766  1.00 65.27  ? 200 LEU A CG  1 
ATOM   1105 C CD1 . LEU A 1 200 ? -31.873 2.777   10.964  1.00 68.34  ? 200 LEU A CD1 1 
ATOM   1106 C CD2 . LEU A 1 200 ? -33.513 1.684   9.420   1.00 63.45  ? 200 LEU A CD2 1 
ATOM   1107 N N   . ALA A 1 201 ? -36.487 -0.360  11.563  1.00 60.02  ? 201 ALA A N   1 
ATOM   1108 C CA  . ALA A 1 201 ? -37.377 -1.097  10.671  1.00 56.85  ? 201 ALA A CA  1 
ATOM   1109 C C   . ALA A 1 201 ? -38.801 -0.551  10.723  1.00 59.08  ? 201 ALA A C   1 
ATOM   1110 O O   . ALA A 1 201 ? -39.472 -0.445  9.696   1.00 60.86  ? 201 ALA A O   1 
ATOM   1111 C CB  . ALA A 1 201 ? -37.363 -2.578  11.013  1.00 49.27  ? 201 ALA A CB  1 
ATOM   1112 N N   . ASP A 1 202 ? -39.254 -0.206  11.925  1.00 58.30  ? 202 ASP A N   1 
ATOM   1113 C CA  . ASP A 1 202 ? -40.595 0.339   12.115  1.00 58.73  ? 202 ASP A CA  1 
ATOM   1114 C C   . ASP A 1 202 ? -40.737 1.708   11.460  1.00 60.71  ? 202 ASP A C   1 
ATOM   1115 O O   . ASP A 1 202 ? -41.820 2.077   11.008  1.00 62.21  ? 202 ASP A O   1 
ATOM   1116 C CB  . ASP A 1 202 ? -40.936 0.429   13.604  1.00 61.08  ? 202 ASP A CB  1 
ATOM   1117 C CG  . ASP A 1 202 ? -41.157 -0.932  14.237  1.00 63.31  ? 202 ASP A CG  1 
ATOM   1118 O OD1 . ASP A 1 202 ? -41.244 -1.933  13.493  1.00 62.39  ? 202 ASP A OD1 1 
ATOM   1119 O OD2 . ASP A 1 202 ? -41.246 -1.001  15.481  1.00 64.06  ? 202 ASP A OD2 1 
ATOM   1120 N N   . LEU A 1 203 ? -39.637 2.453   11.410  1.00 60.10  ? 203 LEU A N   1 
ATOM   1121 C CA  . LEU A 1 203 ? -39.631 3.774   10.791  1.00 55.43  ? 203 LEU A CA  1 
ATOM   1122 C C   . LEU A 1 203 ? -39.870 3.685   9.287   1.00 56.12  ? 203 LEU A C   1 
ATOM   1123 O O   . LEU A 1 203 ? -40.500 4.563   8.700   1.00 55.66  ? 203 LEU A O   1 
ATOM   1124 C CB  . LEU A 1 203 ? -38.312 4.496   11.074  1.00 61.13  ? 203 LEU A CB  1 
ATOM   1125 C CG  . LEU A 1 203 ? -38.061 4.922   12.522  1.00 62.35  ? 203 LEU A CG  1 
ATOM   1126 C CD1 . LEU A 1 203 ? -36.635 5.422   12.692  1.00 62.30  ? 203 LEU A CD1 1 
ATOM   1127 C CD2 . LEU A 1 203 ? -39.062 5.983   12.959  1.00 60.30  ? 203 LEU A CD2 1 
ATOM   1128 N N   . PHE A 1 204 ? -39.364 2.622   8.670   1.00 55.80  ? 204 PHE A N   1 
ATOM   1129 C CA  . PHE A 1 204 ? -39.566 2.403   7.242   1.00 59.14  ? 204 PHE A CA  1 
ATOM   1130 C C   . PHE A 1 204 ? -41.032 2.153   6.911   1.00 58.64  ? 204 PHE A C   1 
ATOM   1131 O O   . PHE A 1 204 ? -41.535 2.619   5.888   1.00 62.80  ? 204 PHE A O   1 
ATOM   1132 C CB  . PHE A 1 204 ? -38.694 1.250   6.738   1.00 61.96  ? 204 PHE A CB  1 
ATOM   1133 C CG  . PHE A 1 204 ? -37.395 1.698   6.135   1.00 63.40  ? 204 PHE A CG  1 
ATOM   1134 C CD1 . PHE A 1 204 ? -36.332 2.074   6.941   1.00 63.58  ? 204 PHE A CD1 1 
ATOM   1135 C CD2 . PHE A 1 204 ? -37.239 1.751   4.759   1.00 64.44  ? 204 PHE A CD2 1 
ATOM   1136 C CE1 . PHE A 1 204 ? -35.137 2.493   6.384   1.00 62.02  ? 204 PHE A CE1 1 
ATOM   1137 C CE2 . PHE A 1 204 ? -36.047 2.168   4.197   1.00 62.08  ? 204 PHE A CE2 1 
ATOM   1138 C CZ  . PHE A 1 204 ? -34.994 2.539   5.010   1.00 62.22  ? 204 PHE A CZ  1 
ATOM   1139 N N   . VAL A 1 205 ? -41.713 1.417   7.784   1.00 57.93  ? 205 VAL A N   1 
ATOM   1140 C CA  . VAL A 1 205 ? -43.129 1.125   7.601   1.00 58.92  ? 205 VAL A CA  1 
ATOM   1141 C C   . VAL A 1 205 ? -43.981 2.348   7.931   1.00 54.31  ? 205 VAL A C   1 
ATOM   1142 O O   . VAL A 1 205 ? -44.888 2.704   7.179   1.00 49.55  ? 205 VAL A O   1 
ATOM   1143 C CB  . VAL A 1 205 ? -43.581 -0.063  8.476   1.00 56.81  ? 205 VAL A CB  1 
ATOM   1144 C CG1 . VAL A 1 205 ? -45.026 -0.429  8.173   1.00 58.92  ? 205 VAL A CG1 1 
ATOM   1145 C CG2 . VAL A 1 205 ? -42.669 -1.262  8.259   1.00 55.40  ? 205 VAL A CG2 1 
ATOM   1146 N N   . ASN A 1 206 ? -43.672 2.994   9.052   1.00 54.36  ? 206 ASN A N   1 
ATOM   1147 C CA  . ASN A 1 206 ? -44.436 4.150   9.519   1.00 56.30  ? 206 ASN A CA  1 
ATOM   1148 C C   . ASN A 1 206 ? -44.278 5.387   8.638   1.00 57.46  ? 206 ASN A C   1 
ATOM   1149 O O   . ASN A 1 206 ? -44.955 6.394   8.846   1.00 63.26  ? 206 ASN A O   1 
ATOM   1150 C CB  . ASN A 1 206 ? -44.070 4.489   10.967  1.00 56.80  ? 206 ASN A CB  1 
ATOM   1151 C CG  . ASN A 1 206 ? -44.551 3.439   11.955  1.00 59.92  ? 206 ASN A CG  1 
ATOM   1152 O OD1 . ASN A 1 206 ? -44.195 3.473   13.132  1.00 63.69  ? 206 ASN A OD1 1 
ATOM   1153 N ND2 . ASN A 1 206 ? -45.362 2.501   11.479  1.00 58.89  ? 206 ASN A ND2 1 
ATOM   1154 N N   . TYR A 1 207 ? -43.382 5.310   7.659   1.00 59.21  ? 207 TYR A N   1 
ATOM   1155 C CA  . TYR A 1 207 ? -43.186 6.406   6.716   1.00 58.22  ? 207 TYR A CA  1 
ATOM   1156 C C   . TYR A 1 207 ? -43.344 5.939   5.274   1.00 54.77  ? 207 TYR A C   1 
ATOM   1157 O O   . TYR A 1 207 ? -43.125 6.706   4.336   1.00 46.96  ? 207 TYR A O   1 
ATOM   1158 C CB  . TYR A 1 207 ? -41.824 7.069   6.924   1.00 58.01  ? 207 TYR A CB  1 
ATOM   1159 C CG  . TYR A 1 207 ? -41.765 7.937   8.159   1.00 58.63  ? 207 TYR A CG  1 
ATOM   1160 C CD1 . TYR A 1 207 ? -41.244 7.450   9.351   1.00 59.80  ? 207 TYR A CD1 1 
ATOM   1161 C CD2 . TYR A 1 207 ? -42.239 9.242   8.137   1.00 56.12  ? 207 TYR A CD2 1 
ATOM   1162 C CE1 . TYR A 1 207 ? -41.191 8.240   10.485  1.00 58.24  ? 207 TYR A CE1 1 
ATOM   1163 C CE2 . TYR A 1 207 ? -42.190 10.040  9.264   1.00 54.81  ? 207 TYR A CE2 1 
ATOM   1164 C CZ  . TYR A 1 207 ? -41.666 9.534   10.435  1.00 57.06  ? 207 TYR A CZ  1 
ATOM   1165 O OH  . TYR A 1 207 ? -41.618 10.326  11.558  1.00 58.99  ? 207 TYR A OH  1 
ATOM   1166 N N   . ASN A 1 208 ? -43.727 4.676   5.112   1.00 55.52  ? 208 ASN A N   1 
ATOM   1167 C CA  . ASN A 1 208 ? -44.020 4.118   3.800   1.00 63.14  ? 208 ASN A CA  1 
ATOM   1168 C C   . ASN A 1 208 ? -42.906 4.399   2.800   1.00 66.43  ? 208 ASN A C   1 
ATOM   1169 O O   . ASN A 1 208 ? -43.142 4.969   1.734   1.00 72.39  ? 208 ASN A O   1 
ATOM   1170 C CB  . ASN A 1 208 ? -45.349 4.671   3.281   1.00 62.73  ? 208 ASN A CB  1 
ATOM   1171 C CG  . ASN A 1 208 ? -46.082 3.690   2.390   1.00 64.40  ? 208 ASN A CG  1 
ATOM   1172 O OD1 . ASN A 1 208 ? -46.092 2.485   2.649   1.00 58.17  ? 208 ASN A OD1 1 
ATOM   1173 N ND2 . ASN A 1 208 ? -46.710 4.202   1.338   1.00 65.90  ? 208 ASN A ND2 1 
ATOM   1174 N N   . VAL A 1 209 ? -41.689 4.001   3.154   1.00 71.52  ? 209 VAL A N   1 
ATOM   1175 C CA  . VAL A 1 209 ? -40.535 4.218   2.293   1.00 72.79  ? 209 VAL A CA  1 
ATOM   1176 C C   . VAL A 1 209 ? -40.410 3.082   1.288   1.00 72.59  ? 209 VAL A C   1 
ATOM   1177 O O   . VAL A 1 209 ? -40.565 1.911   1.635   1.00 67.77  ? 209 VAL A O   1 
ATOM   1178 C CB  . VAL A 1 209 ? -39.231 4.319   3.110   1.00 73.35  ? 209 VAL A CB  1 
ATOM   1179 C CG1 . VAL A 1 209 ? -38.044 4.586   2.195   1.00 73.20  ? 209 VAL A CG1 1 
ATOM   1180 C CG2 . VAL A 1 209 ? -39.348 5.409   4.165   1.00 71.26  ? 209 VAL A CG2 1 
ATOM   1181 N N   . LYS A 1 210 ? -40.141 3.435   0.039   1.00 75.59  ? 210 LYS A N   1 
ATOM   1182 C CA  . LYS A 1 210 ? -39.916 2.435   -0.990  1.00 83.68  ? 210 LYS A CA  1 
ATOM   1183 C C   . LYS A 1 210 ? -38.750 2.833   -1.875  1.00 84.74  ? 210 LYS A C   1 
ATOM   1184 O O   . LYS A 1 210 ? -38.206 3.929   -1.730  1.00 85.58  ? 210 LYS A O   1 
ATOM   1185 C CB  . LYS A 1 210 ? -41.189 2.198   -1.807  1.00 83.77  ? 210 LYS A CB  1 
ATOM   1186 C CG  . LYS A 1 210 ? -42.239 3.290   -1.676  1.00 83.74  ? 210 LYS A CG  1 
ATOM   1187 C CD  . LYS A 1 210 ? -43.642 2.722   -1.856  1.00 83.01  ? 210 LYS A CD  1 
ATOM   1188 C CE  . LYS A 1 210 ? -43.931 1.605   -0.855  1.00 80.72  ? 210 LYS A CE  1 
ATOM   1189 N NZ  . LYS A 1 210 ? -43.856 2.070   0.559   1.00 78.63  ? 210 LYS A NZ  1 
ATOM   1190 N N   . SER A 1 211 ? -38.347 1.928   -2.762  1.00 82.98  ? 211 SER A N   1 
ATOM   1191 C CA  . SER A 1 211 ? -37.310 2.238   -3.728  1.00 85.50  ? 211 SER A CA  1 
ATOM   1192 C C   . SER A 1 211 ? -37.440 3.719   -4.046  1.00 86.79  ? 211 SER A C   1 
ATOM   1193 O O   . SER A 1 211 ? -38.435 4.361   -3.668  1.00 90.11  ? 211 SER A O   1 
ATOM   1194 C CB  . SER A 1 211 ? -37.503 1.393   -4.993  1.00 85.74  ? 211 SER A CB  1 
ATOM   1195 O OG  . SER A 1 211 ? -36.556 1.725   -6.002  1.00 84.85  ? 211 SER A OG  1 
ATOM   1196 N N   . PRO A 1 212 ? -36.427 4.288   -4.719  1.00 88.04  ? 212 PRO A N   1 
ATOM   1197 C CA  . PRO A 1 212 ? -36.482 5.655   -5.183  1.00 90.15  ? 212 PRO A CA  1 
ATOM   1198 C C   . PRO A 1 212 ? -36.609 5.707   -6.697  1.00 93.15  ? 212 PRO A C   1 
ATOM   1199 O O   . PRO A 1 212 ? -37.130 6.687   -7.253  1.00 89.90  ? 212 PRO A O   1 
ATOM   1200 C CB  . PRO A 1 212 ? -35.116 6.196   -4.761  1.00 86.15  ? 212 PRO A CB  1 
ATOM   1201 C CG  . PRO A 1 212 ? -34.190 4.948   -4.729  1.00 86.06  ? 212 PRO A CG  1 
ATOM   1202 C CD  . PRO A 1 212 ? -35.081 3.705   -4.978  1.00 87.39  ? 212 PRO A CD  1 
ATOM   1203 N N   . ILE A 1 213 ? -36.111 4.662   -7.355  1.00 97.04  ? 213 ILE A N   1 
ATOM   1204 C CA  . ILE A 1 213 ? -36.359 4.488   -8.770  1.00 100.59 ? 213 ILE A CA  1 
ATOM   1205 C C   . ILE A 1 213 ? -37.610 3.632   -8.857  1.00 102.53 ? 213 ILE A C   1 
ATOM   1206 O O   . ILE A 1 213 ? -37.751 2.661   -8.102  1.00 104.49 ? 213 ILE A O   1 
ATOM   1207 C CB  . ILE A 1 213 ? -35.143 3.886   -9.509  1.00 102.35 ? 213 ILE A CB  1 
ATOM   1208 C CG1 . ILE A 1 213 ? -34.816 2.486   -8.976  1.00 101.75 ? 213 ILE A CG1 1 
ATOM   1209 C CG2 . ILE A 1 213 ? -33.927 4.815   -9.359  1.00 101.84 ? 213 ILE A CG2 1 
ATOM   1210 C CD1 . ILE A 1 213 ? -33.637 1.838   -9.717  1.00 99.95  ? 213 ILE A CD1 1 
ATOM   1211 N N   . THR A 1 214 ? -38.520 4.007   -9.763  1.00 103.74 ? 214 THR A N   1 
ATOM   1212 C CA  . THR A 1 214 ? -39.936 3.668   -9.545  1.00 103.98 ? 214 THR A CA  1 
ATOM   1213 C C   . THR A 1 214 ? -40.108 2.717   -8.374  1.00 100.92 ? 214 THR A C   1 
ATOM   1214 O O   . THR A 1 214 ? -39.665 1.566   -8.410  1.00 101.85 ? 214 THR A O   1 
ATOM   1215 C CB  . THR A 1 214 ? -40.643 3.077   -10.786 1.00 105.80 ? 214 THR A CB  1 
ATOM   1216 O OG1 . THR A 1 214 ? -40.985 1.706   -10.543 1.00 105.50 ? 214 THR A OG1 1 
ATOM   1217 C CG2 . THR A 1 214 ? -39.754 3.178   -12.022 1.00 106.24 ? 214 THR A CG2 1 
ATOM   1218 N N   . GLY A 1 215 ? -40.767 3.214   -7.339  1.00 94.52  ? 215 GLY A N   1 
ATOM   1219 C CA  . GLY A 1 215 ? -40.976 2.437   -6.143  1.00 92.89  ? 215 GLY A CA  1 
ATOM   1220 C C   . GLY A 1 215 ? -41.388 0.992   -6.408  1.00 95.40  ? 215 GLY A C   1 
ATOM   1221 O O   . GLY A 1 215 ? -42.171 0.677   -7.325  1.00 99.92  ? 215 GLY A O   1 
ATOM   1222 N N   . ASN A 1 216 ? -40.791 0.121   -5.607  1.00 94.95  ? 216 ASN A N   1 
ATOM   1223 C CA  . ASN A 1 216 ? -41.415 -1.119  -5.204  1.00 93.21  ? 216 ASN A CA  1 
ATOM   1224 C C   . ASN A 1 216 ? -41.229 -1.156  -3.698  1.00 90.82  ? 216 ASN A C   1 
ATOM   1225 O O   . ASN A 1 216 ? -40.655 -0.230  -3.126  1.00 92.96  ? 216 ASN A O   1 
ATOM   1226 C CB  . ASN A 1 216 ? -40.769 -2.325  -5.884  1.00 97.76  ? 216 ASN A CB  1 
ATOM   1227 C CG  . ASN A 1 216 ? -41.232 -2.499  -7.320  1.00 101.17 ? 216 ASN A CG  1 
ATOM   1228 O OD1 . ASN A 1 216 ? -42.250 -1.941  -7.732  1.00 103.93 ? 216 ASN A OD1 1 
ATOM   1229 N ND2 . ASN A 1 216 ? -40.484 -3.282  -8.088  1.00 100.59 ? 216 ASN A ND2 1 
ATOM   1230 N N   . ASP A 1 217 ? -41.705 -2.209  -3.048  1.00 86.76  ? 217 ASP A N   1 
ATOM   1231 C CA  . ASP A 1 217 ? -41.546 -2.311  -1.604  1.00 82.46  ? 217 ASP A CA  1 
ATOM   1232 C C   . ASP A 1 217 ? -40.091 -2.568  -1.221  1.00 80.01  ? 217 ASP A C   1 
ATOM   1233 O O   . ASP A 1 217 ? -39.291 -3.022  -2.041  1.00 79.03  ? 217 ASP A O   1 
ATOM   1234 C CB  . ASP A 1 217 ? -42.449 -3.406  -1.038  1.00 84.96  ? 217 ASP A CB  1 
ATOM   1235 C CG  . ASP A 1 217 ? -43.921 -3.090  -1.205  1.00 87.17  ? 217 ASP A CG  1 
ATOM   1236 O OD1 . ASP A 1 217 ? -44.244 -1.989  -1.700  1.00 88.86  ? 217 ASP A OD1 1 
ATOM   1237 O OD2 . ASP A 1 217 ? -44.756 -3.944  -0.839  1.00 88.46  ? 217 ASP A OD2 1 
ATOM   1238 N N   . LEU A 1 218 ? -39.757 -2.268  0.031   1.00 76.13  ? 218 LEU A N   1 
ATOM   1239 C CA  . LEU A 1 218 ? -38.417 -2.510  0.551   1.00 68.63  ? 218 LEU A CA  1 
ATOM   1240 C C   . LEU A 1 218 ? -38.452 -3.523  1.686   1.00 68.31  ? 218 LEU A C   1 
ATOM   1241 O O   . LEU A 1 218 ? -39.289 -3.433  2.585   1.00 74.78  ? 218 LEU A O   1 
ATOM   1242 C CB  . LEU A 1 218 ? -37.785 -1.210  1.046   1.00 63.93  ? 218 LEU A CB  1 
ATOM   1243 C CG  . LEU A 1 218 ? -37.385 -0.170  0.002   1.00 63.74  ? 218 LEU A CG  1 
ATOM   1244 C CD1 . LEU A 1 218 ? -36.951 1.109   0.693   1.00 63.81  ? 218 LEU A CD1 1 
ATOM   1245 C CD2 . LEU A 1 218 ? -36.280 -0.700  -0.899  1.00 66.82  ? 218 LEU A CD2 1 
ATOM   1246 N N   . SER A 1 219 ? -37.537 -4.485  1.640   1.00 63.43  ? 219 SER A N   1 
ATOM   1247 C CA  . SER A 1 219 ? -37.429 -5.494  2.685   1.00 61.76  ? 219 SER A CA  1 
ATOM   1248 C C   . SER A 1 219 ? -36.904 -4.872  3.975   1.00 64.68  ? 219 SER A C   1 
ATOM   1249 O O   . SER A 1 219 ? -36.213 -3.853  3.938   1.00 65.81  ? 219 SER A O   1 
ATOM   1250 C CB  . SER A 1 219 ? -36.503 -6.625  2.235   1.00 62.52  ? 219 SER A CB  1 
ATOM   1251 O OG  . SER A 1 219 ? -35.194 -6.141  1.989   1.00 61.18  ? 219 SER A OG  1 
ATOM   1252 N N   . PRO A 1 220 ? -37.239 -5.482  5.124   1.00 67.29  ? 220 PRO A N   1 
ATOM   1253 C CA  . PRO A 1 220 ? -36.752 -5.018  6.421   1.00 66.58  ? 220 PRO A CA  1 
ATOM   1254 C C   . PRO A 1 220 ? -35.237 -4.839  6.422   1.00 64.78  ? 220 PRO A C   1 
ATOM   1255 O O   . PRO A 1 220 ? -34.512 -5.722  5.960   1.00 64.30  ? 220 PRO A O   1 
ATOM   1256 C CB  . PRO A 1 220 ? -37.148 -6.154  7.366   1.00 66.91  ? 220 PRO A CB  1 
ATOM   1257 C CG  . PRO A 1 220 ? -38.342 -6.764  6.732   1.00 70.20  ? 220 PRO A CG  1 
ATOM   1258 C CD  . PRO A 1 220 ? -38.118 -6.659  5.252   1.00 69.89  ? 220 PRO A CD  1 
ATOM   1259 N N   . PRO A 1 221 ? -34.760 -3.696  6.938   1.00 60.47  ? 221 PRO A N   1 
ATOM   1260 C CA  . PRO A 1 221 ? -33.335 -3.374  6.973   1.00 61.73  ? 221 PRO A CA  1 
ATOM   1261 C C   . PRO A 1 221 ? -32.527 -4.362  7.810   1.00 62.89  ? 221 PRO A C   1 
ATOM   1262 O O   . PRO A 1 221 ? -32.812 -4.555  8.992   1.00 67.66  ? 221 PRO A O   1 
ATOM   1263 C CB  . PRO A 1 221 ? -33.302 -1.983  7.617   1.00 60.06  ? 221 PRO A CB  1 
ATOM   1264 C CG  . PRO A 1 221 ? -34.597 -1.857  8.340   1.00 58.32  ? 221 PRO A CG  1 
ATOM   1265 C CD  . PRO A 1 221 ? -35.583 -2.627  7.527   1.00 58.56  ? 221 PRO A CD  1 
ATOM   1266 N N   . VAL A 1 222 ? -31.527 -4.979  7.189   1.00 64.44  ? 222 VAL A N   1 
ATOM   1267 C CA  . VAL A 1 222 ? -30.642 -5.905  7.887   1.00 67.06  ? 222 VAL A CA  1 
ATOM   1268 C C   . VAL A 1 222 ? -29.228 -5.337  7.973   1.00 64.70  ? 222 VAL A C   1 
ATOM   1269 O O   . VAL A 1 222 ? -28.852 -4.462  7.193   1.00 62.97  ? 222 VAL A O   1 
ATOM   1270 C CB  . VAL A 1 222 ? -30.604 -7.288  7.203   1.00 68.44  ? 222 VAL A CB  1 
ATOM   1271 C CG1 . VAL A 1 222 ? -31.938 -8.000  7.368   1.00 71.11  ? 222 VAL A CG1 1 
ATOM   1272 C CG2 . VAL A 1 222 ? -30.243 -7.149  5.729   1.00 70.21  ? 222 VAL A CG2 1 
ATOM   1273 N N   . SER A 1 223 ? -28.451 -5.839  8.927   1.00 63.64  ? 223 SER A N   1 
ATOM   1274 C CA  . SER A 1 223 ? -27.089 -5.365  9.137   1.00 58.74  ? 223 SER A CA  1 
ATOM   1275 C C   . SER A 1 223 ? -26.139 -5.947  8.093   1.00 55.78  ? 223 SER A C   1 
ATOM   1276 O O   . SER A 1 223 ? -26.062 -7.163  7.923   1.00 59.91  ? 223 SER A O   1 
ATOM   1277 C CB  . SER A 1 223 ? -26.614 -5.725  10.545  1.00 58.42  ? 223 SER A CB  1 
ATOM   1278 O OG  . SER A 1 223 ? -25.411 -5.053  10.867  1.00 60.55  ? 223 SER A OG  1 
ATOM   1279 N N   . PHE A 1 224 ? -25.421 -5.071  7.396   1.00 52.47  ? 224 PHE A N   1 
ATOM   1280 C CA  . PHE A 1 224 ? -24.484 -5.493  6.357   1.00 48.46  ? 224 PHE A CA  1 
ATOM   1281 C C   . PHE A 1 224 ? -23.054 -5.090  6.696   1.00 45.64  ? 224 PHE A C   1 
ATOM   1282 O O   . PHE A 1 224 ? -22.716 -3.907  6.685   1.00 42.53  ? 224 PHE A O   1 
ATOM   1283 C CB  . PHE A 1 224 ? -24.884 -4.907  5.000   1.00 50.96  ? 224 PHE A CB  1 
ATOM   1284 C CG  . PHE A 1 224 ? -23.865 -5.136  3.918   1.00 52.25  ? 224 PHE A CG  1 
ATOM   1285 C CD1 . PHE A 1 224 ? -23.683 -6.398  3.376   1.00 54.49  ? 224 PHE A CD1 1 
ATOM   1286 C CD2 . PHE A 1 224 ? -23.093 -4.088  3.439   1.00 53.47  ? 224 PHE A CD2 1 
ATOM   1287 C CE1 . PHE A 1 224 ? -22.747 -6.613  2.379   1.00 53.95  ? 224 PHE A CE1 1 
ATOM   1288 C CE2 . PHE A 1 224 ? -22.156 -4.297  2.443   1.00 53.37  ? 224 PHE A CE2 1 
ATOM   1289 C CZ  . PHE A 1 224 ? -21.983 -5.561  1.912   1.00 54.20  ? 224 PHE A CZ  1 
ATOM   1290 N N   . ASN A 1 225 ? -22.220 -6.083  6.990   1.00 49.22  ? 225 ASN A N   1 
ATOM   1291 C CA  . ASN A 1 225 ? -20.832 -5.841  7.369   1.00 43.58  ? 225 ASN A CA  1 
ATOM   1292 C C   . ASN A 1 225 ? -20.034 -5.178  6.250   1.00 42.32  ? 225 ASN A C   1 
ATOM   1293 O O   . ASN A 1 225 ? -20.153 -5.555  5.085   1.00 44.17  ? 225 ASN A O   1 
ATOM   1294 C CB  . ASN A 1 225 ? -20.161 -7.146  7.795   1.00 46.63  ? 225 ASN A CB  1 
ATOM   1295 C CG  . ASN A 1 225 ? -18.960 -6.916  8.687   1.00 52.51  ? 225 ASN A CG  1 
ATOM   1296 O OD1 . ASN A 1 225 ? -18.977 -6.042  9.551   1.00 56.62  ? 225 ASN A OD1 1 
ATOM   1297 N ND2 . ASN A 1 225 ? -17.911 -7.703  8.484   1.00 54.69  ? 225 ASN A ND2 1 
ATOM   1298 N N   . LEU A 1 226 ? -19.219 -4.191  6.611   1.00 41.62  ? 226 LEU A N   1 
ATOM   1299 C CA  . LEU A 1 226 ? -18.481 -3.404  5.626   1.00 41.76  ? 226 LEU A CA  1 
ATOM   1300 C C   . LEU A 1 226 ? -17.075 -3.939  5.359   1.00 45.69  ? 226 LEU A C   1 
ATOM   1301 O O   . LEU A 1 226 ? -16.305 -3.331  4.616   1.00 48.92  ? 226 LEU A O   1 
ATOM   1302 C CB  . LEU A 1 226 ? -18.407 -1.938  6.061   1.00 38.09  ? 226 LEU A CB  1 
ATOM   1303 C CG  . LEU A 1 226 ? -19.726 -1.166  6.120   1.00 34.69  ? 226 LEU A CG  1 
ATOM   1304 C CD1 . LEU A 1 226 ? -19.535 0.163   6.833   1.00 38.30  ? 226 LEU A CD1 1 
ATOM   1305 C CD2 . LEU A 1 226 ? -20.292 -0.954  4.724   1.00 32.01  ? 226 LEU A CD2 1 
ATOM   1306 N N   . MET A 1 227 ? -16.743 -5.073  5.965   1.00 44.50  ? 227 MET A N   1 
ATOM   1307 C CA  . MET A 1 227 ? -15.436 -5.684  5.762   1.00 40.14  ? 227 MET A CA  1 
ATOM   1308 C C   . MET A 1 227 ? -15.443 -6.624  4.565   1.00 42.16  ? 227 MET A C   1 
ATOM   1309 O O   . MET A 1 227 ? -16.404 -7.362  4.351   1.00 40.85  ? 227 MET A O   1 
ATOM   1310 C CB  . MET A 1 227 ? -15.003 -6.449  7.008   1.00 41.34  ? 227 MET A CB  1 
ATOM   1311 C CG  . MET A 1 227 ? -14.609 -5.567  8.168   1.00 41.13  ? 227 MET A CG  1 
ATOM   1312 S SD  . MET A 1 227 ? -14.085 -6.550  9.577   1.00 48.76  ? 227 MET A SD  1 
ATOM   1313 C CE  . MET A 1 227 ? -13.294 -5.289  10.560  1.00 42.61  ? 227 MET A CE  1 
ATOM   1314 N N   . PHE A 1 228 ? -14.366 -6.590  3.787   1.00 43.00  ? 228 PHE A N   1 
ATOM   1315 C CA  . PHE A 1 228 ? -14.201 -7.514  2.676   1.00 34.51  ? 228 PHE A CA  1 
ATOM   1316 C C   . PHE A 1 228 ? -13.807 -8.887  3.199   1.00 33.72  ? 228 PHE A C   1 
ATOM   1317 O O   . PHE A 1 228 ? -12.706 -9.069  3.716   1.00 41.36  ? 228 PHE A O   1 
ATOM   1318 C CB  . PHE A 1 228 ? -13.138 -7.004  1.702   1.00 30.95  ? 228 PHE A CB  1 
ATOM   1319 C CG  . PHE A 1 228 ? -13.608 -5.886  0.820   1.00 28.80  ? 228 PHE A CG  1 
ATOM   1320 C CD1 . PHE A 1 228 ? -14.323 -6.153  -0.336  1.00 31.49  ? 228 PHE A CD1 1 
ATOM   1321 C CD2 . PHE A 1 228 ? -13.330 -4.568  1.141   1.00 30.91  ? 228 PHE A CD2 1 
ATOM   1322 C CE1 . PHE A 1 228 ? -14.754 -5.126  -1.155  1.00 36.15  ? 228 PHE A CE1 1 
ATOM   1323 C CE2 . PHE A 1 228 ? -13.758 -3.535  0.327   1.00 32.85  ? 228 PHE A CE2 1 
ATOM   1324 C CZ  . PHE A 1 228 ? -14.472 -3.814  -0.822  1.00 34.54  ? 228 PHE A CZ  1 
ATOM   1325 N N   . LYS A 1 229 ? -14.714 -9.850  3.070   1.00 36.60  ? 229 LYS A N   1 
ATOM   1326 C CA  . LYS A 1 229 ? -14.455 -11.209 3.527   1.00 39.92  ? 229 LYS A CA  1 
ATOM   1327 C C   . LYS A 1 229 ? -13.530 -11.942 2.567   1.00 35.73  ? 229 LYS A C   1 
ATOM   1328 O O   . LYS A 1 229 ? -13.661 -11.822 1.349   1.00 36.12  ? 229 LYS A O   1 
ATOM   1329 C CB  . LYS A 1 229 ? -15.762 -11.993 3.667   1.00 57.78  ? 229 LYS A CB  1 
ATOM   1330 C CG  . LYS A 1 229 ? -16.704 -11.473 4.737   1.00 70.90  ? 229 LYS A CG  1 
ATOM   1331 C CD  . LYS A 1 229 ? -17.931 -12.364 4.864   1.00 75.32  ? 229 LYS A CD  1 
ATOM   1332 C CE  . LYS A 1 229 ? -18.853 -11.890 5.975   1.00 76.68  ? 229 LYS A CE  1 
ATOM   1333 N NZ  . LYS A 1 229 ? -20.086 -12.718 6.066   1.00 75.93  ? 229 LYS A NZ  1 
ATOM   1334 N N   . THR A 1 230 ? -12.594 -12.701 3.124   1.00 30.15  ? 230 THR A N   1 
ATOM   1335 C CA  . THR A 1 230 ? -11.734 -13.565 2.326   1.00 34.25  ? 230 THR A CA  1 
ATOM   1336 C C   . THR A 1 230 ? -11.289 -14.780 3.132   1.00 33.25  ? 230 THR A C   1 
ATOM   1337 O O   . THR A 1 230 ? -11.724 -14.983 4.266   1.00 27.06  ? 230 THR A O   1 
ATOM   1338 C CB  . THR A 1 230 ? -10.500 -12.814 1.777   1.00 38.77  ? 230 THR A CB  1 
ATOM   1339 O OG1 . THR A 1 230 ? -9.755  -13.681 0.912   1.00 40.01  ? 230 THR A OG1 1 
ATOM   1340 C CG2 . THR A 1 230 ? -9.605  -12.337 2.914   1.00 37.16  ? 230 THR A CG2 1 
ATOM   1341 N N   . PHE A 1 231 ? -10.421 -15.587 2.534   1.00 30.59  ? 231 PHE A N   1 
ATOM   1342 C CA  . PHE A 1 231 ? -9.960  -16.813 3.165   1.00 33.65  ? 231 PHE A CA  1 
ATOM   1343 C C   . PHE A 1 231 ? -8.461  -16.980 2.998   1.00 34.35  ? 231 PHE A C   1 
ATOM   1344 O O   . PHE A 1 231 ? -7.946  -16.982 1.880   1.00 39.49  ? 231 PHE A O   1 
ATOM   1345 C CB  . PHE A 1 231 ? -10.696 -18.018 2.583   1.00 36.25  ? 231 PHE A CB  1 
ATOM   1346 C CG  . PHE A 1 231 ? -12.055 -18.233 3.174   1.00 38.07  ? 231 PHE A CG  1 
ATOM   1347 C CD1 . PHE A 1 231 ? -12.206 -18.981 4.329   1.00 40.22  ? 231 PHE A CD1 1 
ATOM   1348 C CD2 . PHE A 1 231 ? -13.181 -17.685 2.582   1.00 40.39  ? 231 PHE A CD2 1 
ATOM   1349 C CE1 . PHE A 1 231 ? -13.456 -19.183 4.883   1.00 42.87  ? 231 PHE A CE1 1 
ATOM   1350 C CE2 . PHE A 1 231 ? -14.436 -17.882 3.130   1.00 39.35  ? 231 PHE A CE2 1 
ATOM   1351 C CZ  . PHE A 1 231 ? -14.573 -18.633 4.282   1.00 40.33  ? 231 PHE A CZ  1 
ATOM   1352 N N   . ILE A 1 232 ? -7.765  -17.121 4.119   1.00 33.37  ? 232 ILE A N   1 
ATOM   1353 C CA  . ILE A 1 232 ? -6.315  -17.224 4.104   1.00 40.99  ? 232 ILE A CA  1 
ATOM   1354 C C   . ILE A 1 232 ? -5.875  -18.681 4.074   1.00 50.63  ? 232 ILE A C   1 
ATOM   1355 O O   . ILE A 1 232 ? -6.125  -19.437 5.014   1.00 54.87  ? 232 ILE A O   1 
ATOM   1356 C CB  . ILE A 1 232 ? -5.694  -16.523 5.324   1.00 35.26  ? 232 ILE A CB  1 
ATOM   1357 C CG1 . ILE A 1 232 ? -6.367  -15.167 5.555   1.00 32.87  ? 232 ILE A CG1 1 
ATOM   1358 C CG2 . ILE A 1 232 ? -4.191  -16.370 5.145   1.00 34.01  ? 232 ILE A CG2 1 
ATOM   1359 C CD1 . ILE A 1 232 ? -5.895  -14.444 6.800   1.00 30.88  ? 232 ILE A CD1 1 
ATOM   1360 N N   . GLY A 1 233 ? -5.223  -19.071 2.985   1.00 53.95  ? 233 GLY A N   1 
ATOM   1361 C CA  . GLY A 1 233 ? -4.720  -20.429 2.844   1.00 56.32  ? 233 GLY A CA  1 
ATOM   1362 C C   . GLY A 1 233 ? -5.713  -21.362 2.180   1.00 61.68  ? 233 GLY A C   1 
ATOM   1363 O O   . GLY A 1 233 ? -6.741  -20.922 1.665   1.00 64.75  ? 233 GLY A O   1 
ATOM   1364 N N   . PRO A 1 234 ? -5.404  -22.667 2.192   1.00 64.30  ? 234 PRO A N   1 
ATOM   1365 C CA  . PRO A 1 234 ? -6.191  -23.721 1.559   1.00 62.35  ? 234 PRO A CA  1 
ATOM   1366 C C   . PRO A 1 234 ? -7.625  -23.846 2.083   1.00 67.25  ? 234 PRO A C   1 
ATOM   1367 O O   . PRO A 1 234 ? -7.878  -24.589 3.037   1.00 67.76  ? 234 PRO A O   1 
ATOM   1368 C CB  . PRO A 1 234 ? -5.392  -24.991 1.876   1.00 62.64  ? 234 PRO A CB  1 
ATOM   1369 C CG  . PRO A 1 234 ? -4.010  -24.514 2.161   1.00 62.58  ? 234 PRO A CG  1 
ATOM   1370 C CD  . PRO A 1 234 ? -4.198  -23.203 2.844   1.00 64.71  ? 234 PRO A CD  1 
ATOM   1371 N N   . GLY A 1 235 ? -8.533  -23.091 1.458   1.00 76.11  ? 235 GLY A N   1 
ATOM   1372 C CA  . GLY A 1 235 ? -9.993  -23.228 1.600   1.00 80.40  ? 235 GLY A CA  1 
ATOM   1373 C C   . GLY A 1 235 ? -10.637 -23.446 2.980   1.00 80.90  ? 235 GLY A C   1 
ATOM   1374 O O   . GLY A 1 235 ? -11.858 -23.621 3.086   1.00 84.71  ? 235 GLY A O   1 
ATOM   1375 N N   . GLY A 1 236 ? -9.833  -23.416 4.039   1.00 79.41  ? 236 GLY A N   1 
ATOM   1376 C CA  . GLY A 1 236 ? -10.253 -24.026 5.297   1.00 77.33  ? 236 GLY A CA  1 
ATOM   1377 C C   . GLY A 1 236 ? -10.736 -23.188 6.466   1.00 75.93  ? 236 GLY A C   1 
ATOM   1378 O O   . GLY A 1 236 ? -11.577 -22.296 6.325   1.00 66.63  ? 236 GLY A O   1 
ATOM   1379 N N   . ASN A 1 237 ? -10.196 -23.515 7.637   1.00 80.25  ? 237 ASN A N   1 
ATOM   1380 C CA  . ASN A 1 237 ? -10.666 -22.982 8.906   1.00 80.71  ? 237 ASN A CA  1 
ATOM   1381 C C   . ASN A 1 237 ? -9.923  -21.727 9.347   1.00 76.04  ? 237 ASN A C   1 
ATOM   1382 O O   . ASN A 1 237 ? -9.660  -21.537 10.534  1.00 80.40  ? 237 ASN A O   1 
ATOM   1383 C CB  . ASN A 1 237 ? -10.568 -24.058 9.994   1.00 87.75  ? 237 ASN A CB  1 
ATOM   1384 C CG  . ASN A 1 237 ? -11.488 -25.239 9.733   1.00 89.61  ? 237 ASN A CG  1 
ATOM   1385 O OD1 . ASN A 1 237 ? -12.517 -25.108 9.069   1.00 87.99  ? 237 ASN A OD1 1 
ATOM   1386 N ND2 . ASN A 1 237 ? -11.123 -26.401 10.265  1.00 90.98  ? 237 ASN A ND2 1 
ATOM   1387 N N   . MET A 1 238 ? -9.579  -20.874 8.387   1.00 68.80  ? 238 MET A N   1 
ATOM   1388 C CA  . MET A 1 238 ? -9.003  -19.572 8.703   1.00 64.69  ? 238 MET A CA  1 
ATOM   1389 C C   . MET A 1 238 ? -9.558  -18.479 7.793   1.00 58.32  ? 238 MET A C   1 
ATOM   1390 O O   . MET A 1 238 ? -8.914  -18.081 6.821   1.00 50.05  ? 238 MET A O   1 
ATOM   1391 C CB  . MET A 1 238 ? -7.471  -19.606 8.645   1.00 64.71  ? 238 MET A CB  1 
ATOM   1392 C CG  . MET A 1 238 ? -6.815  -18.309 9.112   1.00 68.64  ? 238 MET A CG  1 
ATOM   1393 S SD  . MET A 1 238 ? -5.061  -18.458 9.509   1.00 68.90  ? 238 MET A SD  1 
ATOM   1394 C CE  . MET A 1 238 ? -4.388  -18.969 7.931   1.00 75.71  ? 238 MET A CE  1 
ATOM   1395 N N   . PRO A 1 239 ? -10.769 -17.995 8.107   1.00 56.33  ? 239 PRO A N   1 
ATOM   1396 C CA  . PRO A 1 239 ? -11.355 -16.877 7.383   1.00 57.83  ? 239 PRO A CA  1 
ATOM   1397 C C   . PRO A 1 239 ? -10.745 -15.559 7.848   1.00 54.10  ? 239 PRO A C   1 
ATOM   1398 O O   . PRO A 1 239 ? -10.348 -15.433 9.008   1.00 55.04  ? 239 PRO A O   1 
ATOM   1399 C CB  . PRO A 1 239 ? -12.832 -16.948 7.770   1.00 47.75  ? 239 PRO A CB  1 
ATOM   1400 C CG  . PRO A 1 239 ? -12.833 -17.563 9.120   1.00 47.71  ? 239 PRO A CG  1 
ATOM   1401 C CD  . PRO A 1 239 ? -11.654 -18.493 9.176   1.00 49.43  ? 239 PRO A CD  1 
ATOM   1402 N N   . GLY A 1 240 ? -10.666 -14.587 6.946   1.00 44.89  ? 240 GLY A N   1 
ATOM   1403 C CA  . GLY A 1 240 ? -10.065 -13.303 7.272   1.00 37.56  ? 240 GLY A CA  1 
ATOM   1404 C C   . GLY A 1 240 ? -10.721 -12.144 6.554   1.00 35.22  ? 240 GLY A C   1 
ATOM   1405 O O   . GLY A 1 240 ? -11.631 -12.332 5.746   1.00 31.01  ? 240 GLY A O   1 
ATOM   1406 N N   . TYR A 1 241 ? -10.256 -10.937 6.856   1.00 34.46  ? 241 TYR A N   1 
ATOM   1407 C CA  . TYR A 1 241 ? -10.790 -9.737  6.233   1.00 37.64  ? 241 TYR A CA  1 
ATOM   1408 C C   . TYR A 1 241 ? -9.664  -8.799  5.828   1.00 38.55  ? 241 TYR A C   1 
ATOM   1409 O O   . TYR A 1 241 ? -8.517  -8.969  6.244   1.00 37.70  ? 241 TYR A O   1 
ATOM   1410 C CB  . TYR A 1 241 ? -11.733 -9.006  7.191   1.00 52.98  ? 241 TYR A CB  1 
ATOM   1411 C CG  . TYR A 1 241 ? -12.846 -9.858  7.759   1.00 57.51  ? 241 TYR A CG  1 
ATOM   1412 C CD1 . TYR A 1 241 ? -12.702 -10.495 8.986   1.00 59.45  ? 241 TYR A CD1 1 
ATOM   1413 C CD2 . TYR A 1 241 ? -14.043 -10.017 7.075   1.00 60.88  ? 241 TYR A CD2 1 
ATOM   1414 C CE1 . TYR A 1 241 ? -13.718 -11.273 9.511   1.00 61.18  ? 241 TYR A CE1 1 
ATOM   1415 C CE2 . TYR A 1 241 ? -15.064 -10.792 7.593   1.00 62.14  ? 241 TYR A CE2 1 
ATOM   1416 C CZ  . TYR A 1 241 ? -14.897 -11.417 8.810   1.00 61.55  ? 241 TYR A CZ  1 
ATOM   1417 O OH  . TYR A 1 241 ? -15.911 -12.188 9.327   1.00 63.86  ? 241 TYR A OH  1 
ATOM   1418 N N   . LEU A 1 242 ? -10.001 -7.810  5.008   1.00 36.71  ? 242 LEU A N   1 
ATOM   1419 C CA  . LEU A 1 242 ? -9.080  -6.727  4.701   1.00 37.96  ? 242 LEU A CA  1 
ATOM   1420 C C   . LEU A 1 242 ? -9.269  -5.637  5.747   1.00 39.38  ? 242 LEU A C   1 
ATOM   1421 O O   . LEU A 1 242 ? -10.383 -5.151  5.948   1.00 40.56  ? 242 LEU A O   1 
ATOM   1422 C CB  . LEU A 1 242 ? -9.346  -6.173  3.301   1.00 38.03  ? 242 LEU A CB  1 
ATOM   1423 C CG  . LEU A 1 242 ? -8.836  -6.972  2.099   1.00 39.41  ? 242 LEU A CG  1 
ATOM   1424 C CD1 . LEU A 1 242 ? -9.419  -8.379  2.067   1.00 43.65  ? 242 LEU A CD1 1 
ATOM   1425 C CD2 . LEU A 1 242 ? -9.156  -6.233  0.811   1.00 41.43  ? 242 LEU A CD2 1 
ATOM   1426 N N   . ARG A 1 243 ? -8.183  -5.266  6.419   1.00 36.27  ? 243 ARG A N   1 
ATOM   1427 C CA  . ARG A 1 243 ? -8.251  -4.306  7.518   1.00 32.64  ? 243 ARG A CA  1 
ATOM   1428 C C   . ARG A 1 243 ? -9.118  -3.096  7.178   1.00 33.98  ? 243 ARG A C   1 
ATOM   1429 O O   . ARG A 1 243 ? -8.924  -2.454  6.145   1.00 33.31  ? 243 ARG A O   1 
ATOM   1430 C CB  . ARG A 1 243 ? -6.848  -3.858  7.937   1.00 34.18  ? 243 ARG A CB  1 
ATOM   1431 C CG  . ARG A 1 243 ? -6.089  -3.100  6.866   1.00 31.97  ? 243 ARG A CG  1 
ATOM   1432 C CD  . ARG A 1 243 ? -4.735  -2.639  7.368   1.00 29.72  ? 243 ARG A CD  1 
ATOM   1433 N NE  . ARG A 1 243 ? -3.992  -1.930  6.332   1.00 30.50  ? 243 ARG A NE  1 
ATOM   1434 C CZ  . ARG A 1 243 ? -2.717  -1.572  6.439   1.00 33.82  ? 243 ARG A CZ  1 
ATOM   1435 N NH1 . ARG A 1 243 ? -2.037  -1.858  7.541   1.00 33.08  ? 243 ARG A NH1 1 
ATOM   1436 N NH2 . ARG A 1 243 ? -2.122  -0.929  5.444   1.00 38.70  ? 243 ARG A NH2 1 
ATOM   1437 N N   . PRO A 1 244 ? -10.090 -2.790  8.050   1.00 35.92  ? 244 PRO A N   1 
ATOM   1438 C CA  . PRO A 1 244 ? -10.967 -1.640  7.882   1.00 33.25  ? 244 PRO A CA  1 
ATOM   1439 C C   . PRO A 1 244 ? -10.279 -0.364  8.352   1.00 37.10  ? 244 PRO A C   1 
ATOM   1440 O O   . PRO A 1 244 ? -10.578 0.723   7.859   1.00 42.76  ? 244 PRO A O   1 
ATOM   1441 C CB  . PRO A 1 244 ? -12.139 -1.972  8.802   1.00 28.93  ? 244 PRO A CB  1 
ATOM   1442 C CG  . PRO A 1 244 ? -11.519 -2.754  9.902   1.00 30.02  ? 244 PRO A CG  1 
ATOM   1443 C CD  . PRO A 1 244 ? -10.406 -3.553  9.271   1.00 31.18  ? 244 PRO A CD  1 
ATOM   1444 N N   . GLU A 1 245 ? -9.364  -0.511  9.306   1.00 45.17  ? 245 GLU A N   1 
ATOM   1445 C CA  . GLU A 1 245 ? -8.586  0.604   9.825   1.00 47.04  ? 245 GLU A CA  1 
ATOM   1446 C C   . GLU A 1 245 ? -7.128  0.191   9.995   1.00 46.38  ? 245 GLU A C   1 
ATOM   1447 O O   . GLU A 1 245 ? -6.794  -0.994  9.932   1.00 41.33  ? 245 GLU A O   1 
ATOM   1448 C CB  . GLU A 1 245 ? -9.160  1.095   11.156  1.00 57.31  ? 245 GLU A CB  1 
ATOM   1449 C CG  . GLU A 1 245 ? -10.489 1.827   11.031  1.00 76.26  ? 245 GLU A CG  1 
ATOM   1450 C CD  . GLU A 1 245 ? -11.077 2.220   12.376  1.00 80.92  ? 245 GLU A CD  1 
ATOM   1451 O OE1 . GLU A 1 245 ? -10.420 1.978   13.411  1.00 86.57  ? 245 GLU A OE1 1 
ATOM   1452 O OE2 . GLU A 1 245 ? -12.199 2.769   12.395  1.00 84.08  ? 245 GLU A OE2 1 
ATOM   1453 N N   . THR A 1 246 ? -6.265  1.175   10.217  1.00 49.78  ? 246 THR A N   1 
ATOM   1454 C CA  . THR A 1 246 ? -4.831  0.937   10.303  1.00 47.93  ? 246 THR A CA  1 
ATOM   1455 C C   . THR A 1 246 ? -4.350  0.852   11.752  1.00 43.58  ? 246 THR A C   1 
ATOM   1456 O O   . THR A 1 246 ? -3.247  0.376   12.025  1.00 46.14  ? 246 THR A O   1 
ATOM   1457 C CB  . THR A 1 246 ? -4.054  2.043   9.558   1.00 54.17  ? 246 THR A CB  1 
ATOM   1458 O OG1 . THR A 1 246 ? -4.338  1.965   8.155   1.00 58.42  ? 246 THR A OG1 1 
ATOM   1459 C CG2 . THR A 1 246 ? -2.567  1.893   9.766   1.00 54.51  ? 246 THR A CG2 1 
ATOM   1460 N N   . ALA A 1 247 ? -5.192  1.297   12.678  1.00 44.37  ? 247 ALA A N   1 
ATOM   1461 C CA  . ALA A 1 247 ? -4.810  1.395   14.085  1.00 45.24  ? 247 ALA A CA  1 
ATOM   1462 C C   . ALA A 1 247 ? -4.579  0.044   14.758  1.00 43.20  ? 247 ALA A C   1 
ATOM   1463 O O   . ALA A 1 247 ? -3.764  -0.068  15.674  1.00 38.01  ? 247 ALA A O   1 
ATOM   1464 C CB  . ALA A 1 247 ? -5.850  2.197   14.856  1.00 48.13  ? 247 ALA A CB  1 
ATOM   1465 N N   . GLN A 1 248 ? -5.294  -0.977  14.299  1.00 48.37  ? 248 GLN A N   1 
ATOM   1466 C CA  . GLN A 1 248 ? -5.299  -2.273  14.971  1.00 48.46  ? 248 GLN A CA  1 
ATOM   1467 C C   . GLN A 1 248 ? -3.922  -2.934  15.003  1.00 49.59  ? 248 GLN A C   1 
ATOM   1468 O O   . GLN A 1 248 ? -3.541  -3.537  16.006  1.00 58.13  ? 248 GLN A O   1 
ATOM   1469 C CB  . GLN A 1 248 ? -6.328  -3.203  14.326  1.00 48.82  ? 248 GLN A CB  1 
ATOM   1470 C CG  . GLN A 1 248 ? -7.309  -3.801  15.318  1.00 50.91  ? 248 GLN A CG  1 
ATOM   1471 C CD  . GLN A 1 248 ? -8.182  -2.745  15.976  1.00 52.53  ? 248 GLN A CD  1 
ATOM   1472 O OE1 . GLN A 1 248 ? -8.441  -2.797  17.177  1.00 54.03  ? 248 GLN A OE1 1 
ATOM   1473 N NE2 . GLN A 1 248 ? -8.637  -1.777  15.188  1.00 55.25  ? 248 GLN A NE2 1 
ATOM   1474 N N   . GLY A 1 249 ? -3.180  -2.816  13.906  1.00 39.58  ? 249 GLY A N   1 
ATOM   1475 C CA  . GLY A 1 249 ? -1.830  -3.364  13.832  1.00 37.09  ? 249 GLY A CA  1 
ATOM   1476 C C   . GLY A 1 249 ? -0.909  -2.726  14.854  1.00 34.03  ? 249 GLY A C   1 
ATOM   1477 O O   . GLY A 1 249 ? -0.040  -3.387  15.422  1.00 40.29  ? 249 GLY A O   1 
ATOM   1478 N N   . ILE A 1 250 ? -1.105  -1.433  15.088  1.00 39.18  ? 250 ILE A N   1 
ATOM   1479 C CA  . ILE A 1 250 ? -0.329  -0.710  16.086  1.00 38.75  ? 250 ILE A CA  1 
ATOM   1480 C C   . ILE A 1 250 ? -0.647  -1.223  17.488  1.00 39.67  ? 250 ILE A C   1 
ATOM   1481 O O   . ILE A 1 250 ? 0.249   -1.371  18.321  1.00 33.70  ? 250 ILE A O   1 
ATOM   1482 C CB  . ILE A 1 250 ? -0.583  0.807   16.011  1.00 37.14  ? 250 ILE A CB  1 
ATOM   1483 C CG1 . ILE A 1 250 ? -0.211  1.337   14.625  1.00 34.63  ? 250 ILE A CG1 1 
ATOM   1484 C CG2 . ILE A 1 250 ? 0.199   1.532   17.094  1.00 36.47  ? 250 ILE A CG2 1 
ATOM   1485 C CD1 . ILE A 1 250 ? -0.433  2.824   14.451  1.00 32.74  ? 250 ILE A CD1 1 
ATOM   1486 N N   . PHE A 1 251 ? -1.922  -1.504  17.741  1.00 36.38  ? 251 PHE A N   1 
ATOM   1487 C CA  . PHE A 1 251 ? -2.326  -2.076  19.019  1.00 40.34  ? 251 PHE A CA  1 
ATOM   1488 C C   . PHE A 1 251 ? -1.691  -3.446  19.219  1.00 45.47  ? 251 PHE A C   1 
ATOM   1489 O O   . PHE A 1 251 ? -1.187  -3.755  20.300  1.00 46.49  ? 251 PHE A O   1 
ATOM   1490 C CB  . PHE A 1 251 ? -3.849  -2.184  19.117  1.00 41.18  ? 251 PHE A CB  1 
ATOM   1491 C CG  . PHE A 1 251 ? -4.546  -0.859  19.196  1.00 40.44  ? 251 PHE A CG  1 
ATOM   1492 C CD1 . PHE A 1 251 ? -4.023  0.168   19.966  1.00 39.37  ? 251 PHE A CD1 1 
ATOM   1493 C CD2 . PHE A 1 251 ? -5.732  -0.642  18.514  1.00 41.02  ? 251 PHE A CD2 1 
ATOM   1494 C CE1 . PHE A 1 251 ? -4.662  1.391   20.043  1.00 41.90  ? 251 PHE A CE1 1 
ATOM   1495 C CE2 . PHE A 1 251 ? -6.379  0.578   18.589  1.00 40.70  ? 251 PHE A CE2 1 
ATOM   1496 C CZ  . PHE A 1 251 ? -5.843  1.596   19.354  1.00 41.42  ? 251 PHE A CZ  1 
ATOM   1497 N N   . LEU A 1 252 ? -1.712  -4.258  18.167  1.00 44.67  ? 252 LEU A N   1 
ATOM   1498 C CA  . LEU A 1 252 ? -1.155  -5.606  18.216  1.00 45.87  ? 252 LEU A CA  1 
ATOM   1499 C C   . LEU A 1 252 ? 0.347   -5.602  18.482  1.00 43.22  ? 252 LEU A C   1 
ATOM   1500 O O   . LEU A 1 252 ? 0.896   -6.579  18.988  1.00 44.57  ? 252 LEU A O   1 
ATOM   1501 C CB  . LEU A 1 252 ? -1.449  -6.354  16.915  1.00 44.00  ? 252 LEU A CB  1 
ATOM   1502 C CG  . LEU A 1 252 ? -2.920  -6.658  16.630  1.00 48.45  ? 252 LEU A CG  1 
ATOM   1503 C CD1 . LEU A 1 252 ? -3.100  -7.142  15.203  1.00 51.93  ? 252 LEU A CD1 1 
ATOM   1504 C CD2 . LEU A 1 252 ? -3.465  -7.675  17.620  1.00 49.13  ? 252 LEU A CD2 1 
ATOM   1505 N N   . ASN A 1 253 ? 1.008   -4.503  18.137  1.00 41.14  ? 253 ASN A N   1 
ATOM   1506 C CA  . ASN A 1 253 ? 2.448   -4.398  18.327  1.00 47.05  ? 253 ASN A CA  1 
ATOM   1507 C C   . ASN A 1 253 ? 2.822   -3.508  19.504  1.00 47.20  ? 253 ASN A C   1 
ATOM   1508 O O   . ASN A 1 253 ? 3.947   -3.015  19.581  1.00 47.60  ? 253 ASN A O   1 
ATOM   1509 C CB  . ASN A 1 253 ? 3.126   -3.889  17.054  1.00 48.94  ? 253 ASN A CB  1 
ATOM   1510 C CG  . ASN A 1 253 ? 2.962   -4.840  15.885  1.00 48.30  ? 253 ASN A CG  1 
ATOM   1511 O OD1 . ASN A 1 253 ? 3.879   -5.587  15.547  1.00 50.05  ? 253 ASN A OD1 1 
ATOM   1512 N ND2 . ASN A 1 253 ? 1.789   -4.820  15.264  1.00 46.99  ? 253 ASN A ND2 1 
ATOM   1513 N N   . PHE A 1 254 ? 1.880   -3.309  20.420  1.00 47.10  ? 254 PHE A N   1 
ATOM   1514 C CA  . PHE A 1 254 ? 2.117   -2.448  21.574  1.00 49.04  ? 254 PHE A CA  1 
ATOM   1515 C C   . PHE A 1 254 ? 3.315   -2.901  22.407  1.00 49.11  ? 254 PHE A C   1 
ATOM   1516 O O   . PHE A 1 254 ? 4.129   -2.081  22.829  1.00 47.12  ? 254 PHE A O   1 
ATOM   1517 C CB  . PHE A 1 254 ? 0.872   -2.362  22.458  1.00 51.93  ? 254 PHE A CB  1 
ATOM   1518 C CG  . PHE A 1 254 ? 1.040   -1.457  23.642  1.00 51.57  ? 254 PHE A CG  1 
ATOM   1519 C CD1 . PHE A 1 254 ? 0.740   -0.108  23.547  1.00 50.69  ? 254 PHE A CD1 1 
ATOM   1520 C CD2 . PHE A 1 254 ? 1.513   -1.951  24.848  1.00 49.88  ? 254 PHE A CD2 1 
ATOM   1521 C CE1 . PHE A 1 254 ? 0.899   0.729   24.634  1.00 51.00  ? 254 PHE A CE1 1 
ATOM   1522 C CE2 . PHE A 1 254 ? 1.676   -1.119  25.937  1.00 48.16  ? 254 PHE A CE2 1 
ATOM   1523 C CZ  . PHE A 1 254 ? 1.367   0.222   25.830  1.00 49.11  ? 254 PHE A CZ  1 
ATOM   1524 N N   . LYS A 1 255 ? 3.413   -4.207  22.643  1.00 50.73  ? 255 LYS A N   1 
ATOM   1525 C CA  . LYS A 1 255 ? 4.495   -4.766  23.449  1.00 52.78  ? 255 LYS A CA  1 
ATOM   1526 C C   . LYS A 1 255 ? 5.863   -4.485  22.834  1.00 54.25  ? 255 LYS A C   1 
ATOM   1527 O O   . LYS A 1 255 ? 6.774   -4.015  23.516  1.00 56.88  ? 255 LYS A O   1 
ATOM   1528 C CB  . LYS A 1 255 ? 4.306   -6.274  23.632  1.00 65.05  ? 255 LYS A CB  1 
ATOM   1529 C CG  . LYS A 1 255 ? 3.017   -6.661  24.338  1.00 71.42  ? 255 LYS A CG  1 
ATOM   1530 C CD  . LYS A 1 255 ? 2.836   -8.171  24.367  1.00 73.14  ? 255 LYS A CD  1 
ATOM   1531 C CE  . LYS A 1 255 ? 1.490   -8.552  24.965  1.00 75.29  ? 255 LYS A CE  1 
ATOM   1532 N NZ  . LYS A 1 255 ? 1.234   -10.018 24.899  1.00 75.03  ? 255 LYS A NZ  1 
ATOM   1533 N N   . ARG A 1 256 ? 5.999   -4.775  21.543  1.00 52.35  ? 256 ARG A N   1 
ATOM   1534 C CA  . ARG A 1 256 ? 7.259   -4.577  20.835  1.00 53.97  ? 256 ARG A CA  1 
ATOM   1535 C C   . ARG A 1 256 ? 7.633   -3.099  20.782  1.00 52.59  ? 256 ARG A C   1 
ATOM   1536 O O   . ARG A 1 256 ? 8.798   -2.736  20.949  1.00 49.61  ? 256 ARG A O   1 
ATOM   1537 C CB  . ARG A 1 256 ? 7.173   -5.133  19.412  1.00 64.89  ? 256 ARG A CB  1 
ATOM   1538 C CG  . ARG A 1 256 ? 6.572   -6.525  19.302  1.00 67.81  ? 256 ARG A CG  1 
ATOM   1539 C CD  . ARG A 1 256 ? 6.486   -6.956  17.846  1.00 72.33  ? 256 ARG A CD  1 
ATOM   1540 N NE  . ARG A 1 256 ? 5.545   -8.054  17.643  1.00 78.46  ? 256 ARG A NE  1 
ATOM   1541 C CZ  . ARG A 1 256 ? 5.177   -8.510  16.449  1.00 78.52  ? 256 ARG A CZ  1 
ATOM   1542 N NH1 . ARG A 1 256 ? 5.667   -7.963  15.346  1.00 79.80  ? 256 ARG A NH1 1 
ATOM   1543 N NH2 . ARG A 1 256 ? 4.314   -9.512  16.358  1.00 78.85  ? 256 ARG A NH2 1 
ATOM   1544 N N   . LEU A 1 257 ? 6.634   -2.254  20.548  1.00 48.78  ? 257 LEU A N   1 
ATOM   1545 C CA  . LEU A 1 257 ? 6.845   -0.814  20.432  1.00 47.38  ? 257 LEU A CA  1 
ATOM   1546 C C   . LEU A 1 257 ? 7.224   -0.180  21.767  1.00 55.07  ? 257 LEU A C   1 
ATOM   1547 O O   . LEU A 1 257 ? 7.990   0.784   21.809  1.00 54.80  ? 257 LEU A O   1 
ATOM   1548 C CB  . LEU A 1 257 ? 5.598   -0.136  19.859  1.00 47.79  ? 257 LEU A CB  1 
ATOM   1549 C CG  . LEU A 1 257 ? 5.462   -0.051  18.335  1.00 49.08  ? 257 LEU A CG  1 
ATOM   1550 C CD1 . LEU A 1 257 ? 5.925   -1.323  17.639  1.00 52.53  ? 257 LEU A CD1 1 
ATOM   1551 C CD2 . LEU A 1 257 ? 4.029   0.279   17.954  1.00 50.08  ? 257 LEU A CD2 1 
ATOM   1552 N N   . LEU A 1 258 ? 6.683   -0.724  22.853  1.00 55.98  ? 258 LEU A N   1 
ATOM   1553 C CA  . LEU A 1 258 ? 7.005   -0.240  24.191  1.00 56.51  ? 258 LEU A CA  1 
ATOM   1554 C C   . LEU A 1 258 ? 8.456   -0.550  24.537  1.00 58.65  ? 258 LEU A C   1 
ATOM   1555 O O   . LEU A 1 258 ? 9.174   0.303   25.059  1.00 61.78  ? 258 LEU A O   1 
ATOM   1556 C CB  . LEU A 1 258 ? 6.072   -0.864  25.229  1.00 57.36  ? 258 LEU A CB  1 
ATOM   1557 C CG  . LEU A 1 258 ? 6.303   -0.448  26.684  1.00 56.27  ? 258 LEU A CG  1 
ATOM   1558 C CD1 . LEU A 1 258 ? 6.111   1.052   26.847  1.00 51.62  ? 258 LEU A CD1 1 
ATOM   1559 C CD2 . LEU A 1 258 ? 5.379   -1.218  27.615  1.00 54.77  ? 258 LEU A CD2 1 
ATOM   1560 N N   . GLU A 1 259 ? 8.881   -1.774  24.238  1.00 58.49  ? 259 GLU A N   1 
ATOM   1561 C CA  . GLU A 1 259 ? 10.256  -2.193  24.485  1.00 60.31  ? 259 GLU A CA  1 
ATOM   1562 C C   . GLU A 1 259 ? 11.227  -1.438  23.585  1.00 59.57  ? 259 GLU A C   1 
ATOM   1563 O O   . GLU A 1 259 ? 12.376  -1.202  23.959  1.00 63.50  ? 259 GLU A O   1 
ATOM   1564 C CB  . GLU A 1 259 ? 10.404  -3.701  24.271  1.00 63.65  ? 259 GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 259 ? 9.563   -4.547  25.214  1.00 66.66  ? 259 GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 259 ? 9.603   -6.023  24.867  1.00 66.64  ? 259 GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 259 ? 10.410  -6.409  23.995  1.00 70.61  ? 259 GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 259 ? 8.827   -6.797  25.467  1.00 63.44  ? 259 GLU A OE2 1 
ATOM   1569 N N   . PHE A 1 260 ? 10.759  -1.062  22.398  1.00 61.33  ? 260 PHE A N   1 
ATOM   1570 C CA  . PHE A 1 260 ? 11.570  -0.295  21.458  1.00 60.90  ? 260 PHE A CA  1 
ATOM   1571 C C   . PHE A 1 260 ? 11.803  1.116   21.987  1.00 60.08  ? 260 PHE A C   1 
ATOM   1572 O O   . PHE A 1 260 ? 12.811  1.750   21.675  1.00 64.61  ? 260 PHE A O   1 
ATOM   1573 C CB  . PHE A 1 260 ? 10.899  -0.242  20.083  1.00 56.41  ? 260 PHE A CB  1 
ATOM   1574 C CG  . PHE A 1 260 ? 11.792  0.277   18.991  1.00 54.98  ? 260 PHE A CG  1 
ATOM   1575 C CD1 . PHE A 1 260 ? 12.657  -0.576  18.324  1.00 57.50  ? 260 PHE A CD1 1 
ATOM   1576 C CD2 . PHE A 1 260 ? 11.765  1.614   18.628  1.00 57.47  ? 260 PHE A CD2 1 
ATOM   1577 C CE1 . PHE A 1 260 ? 13.482  -0.104  17.317  1.00 58.37  ? 260 PHE A CE1 1 
ATOM   1578 C CE2 . PHE A 1 260 ? 12.588  2.093   17.622  1.00 57.02  ? 260 PHE A CE2 1 
ATOM   1579 C CZ  . PHE A 1 260 ? 13.447  1.232   16.966  1.00 55.67  ? 260 PHE A CZ  1 
ATOM   1580 N N   . ASN A 1 261 ? 10.862  1.600   22.791  1.00 61.71  ? 261 ASN A N   1 
ATOM   1581 C CA  . ASN A 1 261 ? 10.978  2.916   23.401  1.00 59.86  ? 261 ASN A CA  1 
ATOM   1582 C C   . ASN A 1 261 ? 11.513  2.817   24.827  1.00 58.45  ? 261 ASN A C   1 
ATOM   1583 O O   . ASN A 1 261 ? 11.231  3.672   25.663  1.00 54.39  ? 261 ASN A O   1 
ATOM   1584 C CB  . ASN A 1 261 ? 9.624   3.630   23.391  1.00 57.97  ? 261 ASN A CB  1 
ATOM   1585 C CG  . ASN A 1 261 ? 9.760   5.141   23.407  1.00 56.90  ? 261 ASN A CG  1 
ATOM   1586 O OD1 . ASN A 1 261 ? 10.463  5.721   22.579  1.00 60.63  ? 261 ASN A OD1 1 
ATOM   1587 N ND2 . ASN A 1 261 ? 9.079   5.786   24.346  1.00 57.38  ? 261 ASN A ND2 1 
ATOM   1588 N N   . GLN A 1 262 ? 12.277  1.761   25.096  1.00 60.69  ? 262 GLN A N   1 
ATOM   1589 C CA  . GLN A 1 262 ? 12.891  1.543   26.408  1.00 69.84  ? 262 GLN A CA  1 
ATOM   1590 C C   . GLN A 1 262 ? 11.870  1.435   27.540  1.00 66.42  ? 262 GLN A C   1 
ATOM   1591 O O   . GLN A 1 262 ? 12.221  1.537   28.716  1.00 69.33  ? 262 GLN A O   1 
ATOM   1592 C CB  . GLN A 1 262 ? 13.917  2.639   26.716  1.00 78.30  ? 262 GLN A CB  1 
ATOM   1593 C CG  . GLN A 1 262 ? 15.114  2.652   25.777  1.00 83.80  ? 262 GLN A CG  1 
ATOM   1594 C CD  . GLN A 1 262 ? 16.078  3.787   26.071  1.00 86.71  ? 262 GLN A CD  1 
ATOM   1595 O OE1 . GLN A 1 262 ? 15.831  4.619   26.945  1.00 89.02  ? 262 GLN A OE1 1 
ATOM   1596 N NE2 . GLN A 1 262 ? 17.185  3.826   25.339  1.00 89.63  ? 262 GLN A NE2 1 
ATOM   1597 N N   . GLY A 1 263 ? 10.608  1.230   27.179  1.00 65.49  ? 263 GLY A N   1 
ATOM   1598 C CA  . GLY A 1 263 ? 9.545   1.064   28.161  1.00 63.95  ? 263 GLY A CA  1 
ATOM   1599 C C   . GLY A 1 263 ? 9.082   2.357   28.805  1.00 66.93  ? 263 GLY A C   1 
ATOM   1600 O O   . GLY A 1 263 ? 8.435   2.333   29.854  1.00 65.11  ? 263 GLY A O   1 
ATOM   1601 N N   . LYS A 1 264 ? 9.405   3.490   28.187  1.00 71.08  ? 264 LYS A N   1 
ATOM   1602 C CA  . LYS A 1 264 ? 8.978   4.777   28.737  1.00 77.43  ? 264 LYS A CA  1 
ATOM   1603 C C   . LYS A 1 264 ? 7.561   5.184   28.325  1.00 76.92  ? 264 LYS A C   1 
ATOM   1604 O O   . LYS A 1 264 ? 7.010   4.692   27.339  1.00 69.59  ? 264 LYS A O   1 
ATOM   1605 C CB  . LYS A 1 264 ? 10.001  5.898   28.485  1.00 81.71  ? 264 LYS A CB  1 
ATOM   1606 C CG  . LYS A 1 264 ? 10.801  5.782   27.202  1.00 86.34  ? 264 LYS A CG  1 
ATOM   1607 C CD  . LYS A 1 264 ? 11.540  7.083   26.895  1.00 87.88  ? 264 LYS A CD  1 
ATOM   1608 C CE  . LYS A 1 264 ? 12.738  7.300   27.815  1.00 88.83  ? 264 LYS A CE  1 
ATOM   1609 N NZ  . LYS A 1 264 ? 13.913  6.470   27.420  1.00 89.76  ? 264 LYS A NZ  1 
ATOM   1610 N N   . LEU A 1 265 ? 7.003   6.112   29.094  1.00 79.86  ? 265 LEU A N   1 
ATOM   1611 C CA  . LEU A 1 265 ? 5.556   6.262   29.234  1.00 76.74  ? 265 LEU A CA  1 
ATOM   1612 C C   . LEU A 1 265 ? 4.815   6.820   28.015  1.00 70.69  ? 265 LEU A C   1 
ATOM   1613 O O   . LEU A 1 265 ? 3.898   6.174   27.503  1.00 70.58  ? 265 LEU A O   1 
ATOM   1614 C CB  . LEU A 1 265 ? 5.249   7.078   30.495  1.00 89.36  ? 265 LEU A CB  1 
ATOM   1615 C CG  . LEU A 1 265 ? 6.179   6.768   31.677  1.00 93.36  ? 265 LEU A CG  1 
ATOM   1616 C CD1 . LEU A 1 265 ? 5.968   7.758   32.813  1.00 94.90  ? 265 LEU A CD1 1 
ATOM   1617 C CD2 . LEU A 1 265 ? 5.994   5.335   32.167  1.00 92.92  ? 265 LEU A CD2 1 
ATOM   1618 N N   . PRO A 1 266 ? 5.194   8.026   27.557  1.00 59.70  ? 266 PRO A N   1 
ATOM   1619 C CA  . PRO A 1 266 ? 4.592   8.580   26.352  1.00 51.44  ? 266 PRO A CA  1 
ATOM   1620 C C   . PRO A 1 266 ? 5.384   8.246   25.088  1.00 47.26  ? 266 PRO A C   1 
ATOM   1621 O O   . PRO A 1 266 ? 6.572   8.558   24.993  1.00 50.45  ? 266 PRO A O   1 
ATOM   1622 C CB  . PRO A 1 266 ? 4.630   10.087  26.615  1.00 44.94  ? 266 PRO A CB  1 
ATOM   1623 C CG  . PRO A 1 266 ? 5.802   10.290  27.547  1.00 47.20  ? 266 PRO A CG  1 
ATOM   1624 C CD  . PRO A 1 266 ? 6.174   8.952   28.149  1.00 49.70  ? 266 PRO A CD  1 
ATOM   1625 N N   . PHE A 1 267 ? 4.721   7.611   24.128  1.00 46.04  ? 267 PHE A N   1 
ATOM   1626 C CA  . PHE A 1 267 ? 5.315   7.341   22.825  1.00 43.15  ? 267 PHE A CA  1 
ATOM   1627 C C   . PHE A 1 267 ? 4.215   7.253   21.777  1.00 48.45  ? 267 PHE A C   1 
ATOM   1628 O O   . PHE A 1 267 ? 3.060   6.970   22.101  1.00 56.69  ? 267 PHE A O   1 
ATOM   1629 C CB  . PHE A 1 267 ? 6.131   6.045   22.847  1.00 49.30  ? 267 PHE A CB  1 
ATOM   1630 C CG  . PHE A 1 267 ? 5.297   4.796   22.788  1.00 50.17  ? 267 PHE A CG  1 
ATOM   1631 C CD1 . PHE A 1 267 ? 4.770   4.242   23.944  1.00 52.08  ? 267 PHE A CD1 1 
ATOM   1632 C CD2 . PHE A 1 267 ? 5.047   4.168   21.576  1.00 51.97  ? 267 PHE A CD2 1 
ATOM   1633 C CE1 . PHE A 1 267 ? 4.004   3.090   23.892  1.00 55.13  ? 267 PHE A CE1 1 
ATOM   1634 C CE2 . PHE A 1 267 ? 4.281   3.016   21.518  1.00 50.87  ? 267 PHE A CE2 1 
ATOM   1635 C CZ  . PHE A 1 267 ? 3.759   2.476   22.678  1.00 51.15  ? 267 PHE A CZ  1 
ATOM   1636 N N   . ALA A 1 268 ? 4.574   7.496   20.522  1.00 46.36  ? 268 ALA A N   1 
ATOM   1637 C CA  . ALA A 1 268 ? 3.601   7.470   19.439  1.00 36.62  ? 268 ALA A CA  1 
ATOM   1638 C C   . ALA A 1 268 ? 4.026   6.524   18.325  1.00 36.58  ? 268 ALA A C   1 
ATOM   1639 O O   . ALA A 1 268 ? 5.210   6.411   18.009  1.00 36.41  ? 268 ALA A O   1 
ATOM   1640 C CB  . ALA A 1 268 ? 3.381   8.871   18.889  1.00 43.27  ? 268 ALA A CB  1 
ATOM   1641 N N   . ALA A 1 269 ? 3.048   5.845   17.736  1.00 36.59  ? 269 ALA A N   1 
ATOM   1642 C CA  . ALA A 1 269 ? 3.298   4.960   16.608  1.00 35.32  ? 269 ALA A CA  1 
ATOM   1643 C C   . ALA A 1 269 ? 2.402   5.337   15.435  1.00 33.57  ? 269 ALA A C   1 
ATOM   1644 O O   . ALA A 1 269 ? 1.243   5.706   15.624  1.00 33.98  ? 269 ALA A O   1 
ATOM   1645 C CB  . ALA A 1 269 ? 3.075   3.518   17.007  1.00 34.44  ? 269 ALA A CB  1 
ATOM   1646 N N   . ALA A 1 270 ? 2.944   5.248   14.226  1.00 33.51  ? 270 ALA A N   1 
ATOM   1647 C CA  . ALA A 1 270 ? 2.200   5.623   13.031  1.00 31.26  ? 270 ALA A CA  1 
ATOM   1648 C C   . ALA A 1 270 ? 2.287   4.556   11.950  1.00 37.49  ? 270 ALA A C   1 
ATOM   1649 O O   . ALA A 1 270 ? 3.159   3.687   11.988  1.00 40.05  ? 270 ALA A O   1 
ATOM   1650 C CB  . ALA A 1 270 ? 2.696   6.958   12.495  1.00 32.73  ? 270 ALA A CB  1 
ATOM   1651 N N   . GLN A 1 271 ? 1.373   4.629   10.989  1.00 39.04  ? 271 GLN A N   1 
ATOM   1652 C CA  . GLN A 1 271 ? 1.386   3.732   9.840   1.00 36.50  ? 271 GLN A CA  1 
ATOM   1653 C C   . GLN A 1 271 ? 0.676   4.365   8.650   1.00 33.03  ? 271 GLN A C   1 
ATOM   1654 O O   . GLN A 1 271 ? -0.427  4.896   8.781   1.00 43.07  ? 271 GLN A O   1 
ATOM   1655 C CB  . GLN A 1 271 ? 0.746   2.387   10.187  1.00 35.37  ? 271 GLN A CB  1 
ATOM   1656 C CG  . GLN A 1 271 ? 0.748   1.394   9.031   1.00 45.71  ? 271 GLN A CG  1 
ATOM   1657 C CD  . GLN A 1 271 ? 0.360   -0.013  9.451   1.00 43.38  ? 271 GLN A CD  1 
ATOM   1658 O OE1 . GLN A 1 271 ? 0.414   -0.945  8.649   1.00 42.15  ? 271 GLN A OE1 1 
ATOM   1659 N NE2 . GLN A 1 271 ? -0.033  -0.173  10.711  1.00 40.09  ? 271 GLN A NE2 1 
ATOM   1660 N N   . ILE A 1 272 ? 1.324   4.312   7.492   1.00 33.38  ? 272 ILE A N   1 
ATOM   1661 C CA  . ILE A 1 272 ? 0.757   4.849   6.263   1.00 30.08  ? 272 ILE A CA  1 
ATOM   1662 C C   . ILE A 1 272 ? 0.477   3.707   5.297   1.00 25.18  ? 272 ILE A C   1 
ATOM   1663 O O   . ILE A 1 272 ? 1.391   2.988   4.895   1.00 39.40  ? 272 ILE A O   1 
ATOM   1664 C CB  . ILE A 1 272 ? 1.712   5.859   5.595   1.00 23.46  ? 272 ILE A CB  1 
ATOM   1665 C CG1 . ILE A 1 272 ? 2.093   6.967   6.579   1.00 21.16  ? 272 ILE A CG1 1 
ATOM   1666 C CG2 . ILE A 1 272 ? 1.083   6.442   4.336   1.00 19.37  ? 272 ILE A CG2 1 
ATOM   1667 C CD1 . ILE A 1 272 ? 3.169   7.902   6.064   1.00 27.08  ? 272 ILE A CD1 1 
ATOM   1668 N N   . GLY A 1 273 ? -0.789  3.536   4.932   1.00 20.97  ? 273 GLY A N   1 
ATOM   1669 C CA  . GLY A 1 273 ? -1.172  2.450   4.042   1.00 26.62  ? 273 GLY A CA  1 
ATOM   1670 C C   . GLY A 1 273 ? -2.641  2.447   3.674   1.00 25.40  ? 273 GLY A C   1 
ATOM   1671 O O   . GLY A 1 273 ? -3.372  3.389   3.976   1.00 34.06  ? 273 GLY A O   1 
ATOM   1672 N N   . ASN A 1 274 ? -3.071  1.375   3.019   1.00 27.89  ? 274 ASN A N   1 
ATOM   1673 C CA  . ASN A 1 274 ? -4.441  1.269   2.544   1.00 26.16  ? 274 ASN A CA  1 
ATOM   1674 C C   . ASN A 1 274 ? -5.353  0.498   3.489   1.00 36.74  ? 274 ASN A C   1 
ATOM   1675 O O   . ASN A 1 274 ? -4.979  -0.549  4.021   1.00 39.66  ? 274 ASN A O   1 
ATOM   1676 C CB  . ASN A 1 274 ? -4.477  0.635   1.152   1.00 36.92  ? 274 ASN A CB  1 
ATOM   1677 C CG  . ASN A 1 274 ? -3.967  1.569   0.072   1.00 43.72  ? 274 ASN A CG  1 
ATOM   1678 O OD1 . ASN A 1 274 ? -3.360  2.601   0.362   1.00 47.03  ? 274 ASN A OD1 1 
ATOM   1679 N ND2 . ASN A 1 274 ? -4.214  1.213   -1.182  1.00 46.61  ? 274 ASN A ND2 1 
ATOM   1680 N N   . SER A 1 275 ? -6.550  1.038   3.698   1.00 31.32  ? 275 SER A N   1 
ATOM   1681 C CA  . SER A 1 275 ? -7.600  0.341   4.423   1.00 30.50  ? 275 SER A CA  1 
ATOM   1682 C C   . SER A 1 275 ? -8.797  0.169   3.498   1.00 35.65  ? 275 SER A C   1 
ATOM   1683 O O   . SER A 1 275 ? -8.895  0.844   2.472   1.00 32.64  ? 275 SER A O   1 
ATOM   1684 C CB  . SER A 1 275 ? -7.992  1.106   5.686   1.00 41.53  ? 275 SER A CB  1 
ATOM   1685 O OG  . SER A 1 275 ? -6.976  1.014   6.670   1.00 47.34  ? 275 SER A OG  1 
ATOM   1686 N N   . PHE A 1 276 ? -9.703  -0.734  3.857   1.00 36.01  ? 276 PHE A N   1 
ATOM   1687 C CA  . PHE A 1 276 ? -10.801 -1.092  2.969   1.00 33.45  ? 276 PHE A CA  1 
ATOM   1688 C C   . PHE A 1 276 ? -12.158 -1.020  3.657   1.00 37.41  ? 276 PHE A C   1 
ATOM   1689 O O   . PHE A 1 276 ? -12.310 -1.450  4.800   1.00 40.33  ? 276 PHE A O   1 
ATOM   1690 C CB  . PHE A 1 276 ? -10.581 -2.493  2.391   1.00 36.96  ? 276 PHE A CB  1 
ATOM   1691 C CG  . PHE A 1 276 ? -9.267  -2.656  1.680   1.00 40.60  ? 276 PHE A CG  1 
ATOM   1692 C CD1 . PHE A 1 276 ? -8.106  -2.917  2.391   1.00 42.29  ? 276 PHE A CD1 1 
ATOM   1693 C CD2 . PHE A 1 276 ? -9.193  -2.550  0.301   1.00 44.33  ? 276 PHE A CD2 1 
ATOM   1694 C CE1 . PHE A 1 276 ? -6.895  -3.065  1.740   1.00 44.42  ? 276 PHE A CE1 1 
ATOM   1695 C CE2 . PHE A 1 276 ? -7.984  -2.700  -0.355  1.00 44.42  ? 276 PHE A CE2 1 
ATOM   1696 C CZ  . PHE A 1 276 ? -6.835  -2.957  0.365   1.00 44.01  ? 276 PHE A CZ  1 
ATOM   1697 N N   . ARG A 1 277 ? -13.138 -0.471  2.947   1.00 41.40  ? 277 ARG A N   1 
ATOM   1698 C CA  . ARG A 1 277 ? -14.512 -0.421  3.429   1.00 42.36  ? 277 ARG A CA  1 
ATOM   1699 C C   . ARG A 1 277 ? -15.472 -0.741  2.291   1.00 40.13  ? 277 ARG A C   1 
ATOM   1700 O O   . ARG A 1 277 ? -15.652 0.062   1.376   1.00 40.66  ? 277 ARG A O   1 
ATOM   1701 C CB  . ARG A 1 277 ? -14.832 0.952   4.025   1.00 49.42  ? 277 ARG A CB  1 
ATOM   1702 C CG  . ARG A 1 277 ? -14.145 1.232   5.353   1.00 56.99  ? 277 ARG A CG  1 
ATOM   1703 C CD  . ARG A 1 277 ? -14.629 2.537   5.962   1.00 62.20  ? 277 ARG A CD  1 
ATOM   1704 N NE  . ARG A 1 277 ? -16.065 2.513   6.225   1.00 65.25  ? 277 ARG A NE  1 
ATOM   1705 C CZ  . ARG A 1 277 ? -16.745 3.519   6.765   1.00 65.73  ? 277 ARG A CZ  1 
ATOM   1706 N NH1 . ARG A 1 277 ? -16.122 4.639   7.105   1.00 69.73  ? 277 ARG A NH1 1 
ATOM   1707 N NH2 . ARG A 1 277 ? -18.051 3.406   6.966   1.00 62.76  ? 277 ARG A NH2 1 
ATOM   1708 N N   . ASN A 1 278 ? -16.084 -1.919  2.354   1.00 36.61  ? 278 ASN A N   1 
ATOM   1709 C CA  . ASN A 1 278 ? -16.995 -2.372  1.310   1.00 42.82  ? 278 ASN A CA  1 
ATOM   1710 C C   . ASN A 1 278 ? -18.290 -1.568  1.270   1.00 49.62  ? 278 ASN A C   1 
ATOM   1711 O O   . ASN A 1 278 ? -19.347 -2.059  1.670   1.00 52.95  ? 278 ASN A O   1 
ATOM   1712 C CB  . ASN A 1 278 ? -17.307 -3.861  1.485   1.00 40.01  ? 278 ASN A CB  1 
ATOM   1713 C CG  . ASN A 1 278 ? -17.928 -4.477  0.246   1.00 40.20  ? 278 ASN A CG  1 
ATOM   1714 O OD1 . ASN A 1 278 ? -18.469 -5.582  0.291   1.00 37.92  ? 278 ASN A OD1 1 
ATOM   1715 N ND2 . ASN A 1 278 ? -17.850 -3.763  -0.871  1.00 35.76  ? 278 ASN A ND2 1 
ATOM   1716 N N   . GLU A 1 279 ? -18.201 -0.333  0.784   1.00 54.08  ? 279 GLU A N   1 
ATOM   1717 C CA  . GLU A 1 279 ? -19.369 0.534   0.668   1.00 54.22  ? 279 GLU A CA  1 
ATOM   1718 C C   . GLU A 1 279 ? -20.421 -0.101  -0.234  1.00 54.60  ? 279 GLU A C   1 
ATOM   1719 O O   . GLU A 1 279 ? -20.094 -0.855  -1.152  1.00 48.71  ? 279 GLU A O   1 
ATOM   1720 C CB  . GLU A 1 279 ? -18.972 1.912   0.133   1.00 61.69  ? 279 GLU A CB  1 
ATOM   1721 C CG  . GLU A 1 279 ? -17.945 2.650   0.987   1.00 68.79  ? 279 GLU A CG  1 
ATOM   1722 C CD  . GLU A 1 279 ? -18.524 3.198   2.281   1.00 71.17  ? 279 GLU A CD  1 
ATOM   1723 O OE1 . GLU A 1 279 ? -19.765 3.197   2.434   1.00 71.63  ? 279 GLU A OE1 1 
ATOM   1724 O OE2 . GLU A 1 279 ? -17.734 3.635   3.145   1.00 70.10  ? 279 GLU A OE2 1 
ATOM   1725 N N   . ILE A 1 280 ? -21.685 0.209   0.035   1.00 53.57  ? 280 ILE A N   1 
ATOM   1726 C CA  . ILE A 1 280 ? -22.801 -0.395  -0.686  1.00 54.05  ? 280 ILE A CA  1 
ATOM   1727 C C   . ILE A 1 280 ? -22.978 0.198   -2.081  1.00 59.77  ? 280 ILE A C   1 
ATOM   1728 O O   . ILE A 1 280 ? -22.815 -0.496  -3.085  1.00 68.92  ? 280 ILE A O   1 
ATOM   1729 C CB  . ILE A 1 280 ? -24.116 -0.259  0.108   1.00 47.42  ? 280 ILE A CB  1 
ATOM   1730 C CG1 . ILE A 1 280 ? -24.075 -1.163  1.343   1.00 46.32  ? 280 ILE A CG1 1 
ATOM   1731 C CG2 . ILE A 1 280 ? -25.312 -0.619  -0.767  1.00 45.71  ? 280 ILE A CG2 1 
ATOM   1732 C CD1 . ILE A 1 280 ? -24.993 -0.715  2.458   1.00 45.16  ? 280 ILE A CD1 1 
ATOM   1733 N N   . SER A 1 281 ? -23.312 1.483   -2.136  1.00 55.88  ? 281 SER A N   1 
ATOM   1734 C CA  . SER A 1 281 ? -23.526 2.161   -3.407  1.00 58.06  ? 281 SER A CA  1 
ATOM   1735 C C   . SER A 1 281 ? -22.882 3.542   -3.393  1.00 59.12  ? 281 SER A C   1 
ATOM   1736 O O   . SER A 1 281 ? -23.570 4.552   -3.238  1.00 62.43  ? 281 SER A O   1 
ATOM   1737 C CB  . SER A 1 281 ? -25.022 2.273   -3.707  1.00 62.24  ? 281 SER A CB  1 
ATOM   1738 O OG  . SER A 1 281 ? -25.247 2.888   -4.964  1.00 67.40  ? 281 SER A OG  1 
ATOM   1739 N N   . PRO A 1 282 ? -21.551 3.589   -3.557  1.00 56.98  ? 282 PRO A N   1 
ATOM   1740 C CA  . PRO A 1 282 ? -20.806 4.842   -3.524  1.00 55.55  ? 282 PRO A CA  1 
ATOM   1741 C C   . PRO A 1 282 ? -20.925 5.620   -4.831  1.00 55.90  ? 282 PRO A C   1 
ATOM   1742 O O   . PRO A 1 282 ? -20.598 5.100   -5.899  1.00 57.51  ? 282 PRO A O   1 
ATOM   1743 C CB  . PRO A 1 282 ? -19.364 4.379   -3.308  1.00 52.21  ? 282 PRO A CB  1 
ATOM   1744 C CG  . PRO A 1 282 ? -19.307 3.031   -3.928  1.00 50.71  ? 282 PRO A CG  1 
ATOM   1745 C CD  . PRO A 1 282 ? -20.676 2.425   -3.787  1.00 52.18  ? 282 PRO A CD  1 
ATOM   1746 N N   . ARG A 1 283 ? -21.395 6.861   -4.739  1.00 59.23  ? 283 ARG A N   1 
ATOM   1747 C CA  . ARG A 1 283 ? -21.548 7.719   -5.910  1.00 66.24  ? 283 ARG A CA  1 
ATOM   1748 C C   . ARG A 1 283 ? -21.252 9.173   -5.557  1.00 57.30  ? 283 ARG A C   1 
ATOM   1749 O O   . ARG A 1 283 ? -22.088 10.053  -5.758  1.00 64.25  ? 283 ARG A O   1 
ATOM   1750 C CB  . ARG A 1 283 ? -22.959 7.590   -6.495  1.00 75.50  ? 283 ARG A CB  1 
ATOM   1751 C CG  . ARG A 1 283 ? -23.233 6.249   -7.158  1.00 84.00  ? 283 ARG A CG  1 
ATOM   1752 C CD  . ARG A 1 283 ? -24.682 6.106   -7.587  1.00 85.45  ? 283 ARG A CD  1 
ATOM   1753 N NE  . ARG A 1 283 ? -24.947 4.779   -8.135  1.00 91.57  ? 283 ARG A NE  1 
ATOM   1754 C CZ  . ARG A 1 283 ? -26.130 4.374   -8.585  1.00 93.23  ? 283 ARG A CZ  1 
ATOM   1755 N NH1 . ARG A 1 283 ? -27.172 5.194   -8.554  1.00 93.98  ? 283 ARG A NH1 1 
ATOM   1756 N NH2 . ARG A 1 283 ? -26.273 3.146   -9.065  1.00 94.24  ? 283 ARG A NH2 1 
ATOM   1757 N N   . SER A 1 284 ? -20.056 9.417   -5.030  1.00 53.41  ? 284 SER A N   1 
ATOM   1758 C CA  . SER A 1 284 ? -19.664 10.758  -4.611  1.00 49.38  ? 284 SER A CA  1 
ATOM   1759 C C   . SER A 1 284 ? -18.157 10.979  -4.728  1.00 46.70  ? 284 SER A C   1 
ATOM   1760 O O   . SER A 1 284 ? -17.553 11.646  -3.889  1.00 42.99  ? 284 SER A O   1 
ATOM   1761 C CB  . SER A 1 284 ? -20.130 11.026  -3.178  1.00 50.60  ? 284 SER A CB  1 
ATOM   1762 O OG  . SER A 1 284 ? -19.668 10.019  -2.295  1.00 55.20  ? 284 SER A OG  1 
ATOM   1763 N N   . GLY A 1 285 ? -17.558 10.414  -5.771  1.00 39.20  ? 285 GLY A N   1 
ATOM   1764 C CA  . GLY A 1 285 ? -16.135 10.599  -6.033  1.00 41.54  ? 285 GLY A CA  1 
ATOM   1765 C C   . GLY A 1 285 ? -15.234 10.027  -4.955  1.00 40.09  ? 285 GLY A C   1 
ATOM   1766 O O   . GLY A 1 285 ? -15.500 8.952   -4.419  1.00 42.51  ? 285 GLY A O   1 
ATOM   1767 N N   . LEU A 1 286 ? -14.168 10.756  -4.635  1.00 38.71  ? 286 LEU A N   1 
ATOM   1768 C CA  . LEU A 1 286 ? -13.175 10.299  -3.667  1.00 39.99  ? 286 LEU A CA  1 
ATOM   1769 C C   . LEU A 1 286 ? -13.668 10.377  -2.224  1.00 45.54  ? 286 LEU A C   1 
ATOM   1770 O O   . LEU A 1 286 ? -12.981 9.927   -1.306  1.00 51.82  ? 286 LEU A O   1 
ATOM   1771 C CB  . LEU A 1 286 ? -11.877 11.099  -3.811  1.00 40.99  ? 286 LEU A CB  1 
ATOM   1772 C CG  . LEU A 1 286 ? -11.084 10.941  -5.109  1.00 39.59  ? 286 LEU A CG  1 
ATOM   1773 C CD1 . LEU A 1 286 ? -9.883  11.872  -5.112  1.00 39.06  ? 286 LEU A CD1 1 
ATOM   1774 C CD2 . LEU A 1 286 ? -10.647 9.498   -5.309  1.00 37.17  ? 286 LEU A CD2 1 
ATOM   1775 N N   . ILE A 1 287 ? -14.851 10.951  -2.029  1.00 42.76  ? 287 ILE A N   1 
ATOM   1776 C CA  . ILE A 1 287 ? -15.423 11.089  -0.693  1.00 48.11  ? 287 ILE A CA  1 
ATOM   1777 C C   . ILE A 1 287 ? -15.747 9.724   -0.090  1.00 48.08  ? 287 ILE A C   1 
ATOM   1778 O O   . ILE A 1 287 ? -15.255 9.378   0.983   1.00 52.57  ? 287 ILE A O   1 
ATOM   1779 C CB  . ILE A 1 287 ? -16.697 11.963  -0.705  1.00 50.72  ? 287 ILE A CB  1 
ATOM   1780 C CG1 . ILE A 1 287 ? -16.413 13.322  -1.351  1.00 47.64  ? 287 ILE A CG1 1 
ATOM   1781 C CG2 . ILE A 1 287 ? -17.247 12.134  0.706   1.00 50.06  ? 287 ILE A CG2 1 
ATOM   1782 C CD1 . ILE A 1 287 ? -15.310 14.109  -0.679  1.00 44.40  ? 287 ILE A CD1 1 
ATOM   1783 N N   . ARG A 1 288 ? -16.573 8.953   -0.788  1.00 47.36  ? 288 ARG A N   1 
ATOM   1784 C CA  . ARG A 1 288 ? -16.931 7.614   -0.338  1.00 54.52  ? 288 ARG A CA  1 
ATOM   1785 C C   . ARG A 1 288 ? -16.320 6.560   -1.253  1.00 51.25  ? 288 ARG A C   1 
ATOM   1786 O O   . ARG A 1 288 ? -16.832 6.295   -2.341  1.00 54.33  ? 288 ARG A O   1 
ATOM   1787 C CB  . ARG A 1 288 ? -18.452 7.456   -0.271  1.00 62.54  ? 288 ARG A CB  1 
ATOM   1788 C CG  . ARG A 1 288 ? -19.116 8.347   0.769   1.00 73.41  ? 288 ARG A CG  1 
ATOM   1789 C CD  . ARG A 1 288 ? -20.630 8.207   0.746   1.00 78.46  ? 288 ARG A CD  1 
ATOM   1790 N NE  . ARG A 1 288 ? -21.271 9.053   1.749   1.00 85.75  ? 288 ARG A NE  1 
ATOM   1791 C CZ  . ARG A 1 288 ? -22.586 9.154   1.915   1.00 88.26  ? 288 ARG A CZ  1 
ATOM   1792 N NH1 . ARG A 1 288 ? -23.412 8.461   1.142   1.00 88.10  ? 288 ARG A NH1 1 
ATOM   1793 N NH2 . ARG A 1 288 ? -23.078 9.951   2.854   1.00 89.17  ? 288 ARG A NH2 1 
ATOM   1794 N N   . VAL A 1 289 ? -15.217 5.967   -0.808  1.00 44.02  ? 289 VAL A N   1 
ATOM   1795 C CA  . VAL A 1 289 ? -14.506 4.970   -1.601  1.00 44.95  ? 289 VAL A CA  1 
ATOM   1796 C C   . VAL A 1 289 ? -14.372 3.644   -0.859  1.00 43.88  ? 289 VAL A C   1 
ATOM   1797 O O   . VAL A 1 289 ? -14.496 3.590   0.365   1.00 43.11  ? 289 VAL A O   1 
ATOM   1798 C CB  . VAL A 1 289 ? -13.103 5.464   -2.012  1.00 47.28  ? 289 VAL A CB  1 
ATOM   1799 C CG1 . VAL A 1 289 ? -13.205 6.490   -3.130  1.00 51.49  ? 289 VAL A CG1 1 
ATOM   1800 C CG2 . VAL A 1 289 ? -12.369 6.038   -0.812  1.00 43.82  ? 289 VAL A CG2 1 
ATOM   1801 N N   . ARG A 1 290 ? -14.114 2.578   -1.611  1.00 43.04  ? 290 ARG A N   1 
ATOM   1802 C CA  . ARG A 1 290 ? -13.970 1.245   -1.036  1.00 41.58  ? 290 ARG A CA  1 
ATOM   1803 C C   . ARG A 1 290 ? -12.512 0.921   -0.723  1.00 37.77  ? 290 ARG A C   1 
ATOM   1804 O O   . ARG A 1 290 ? -12.221 0.138   0.181   1.00 37.74  ? 290 ARG A O   1 
ATOM   1805 C CB  . ARG A 1 290 ? -14.570 0.192   -1.970  1.00 41.63  ? 290 ARG A CB  1 
ATOM   1806 C CG  . ARG A 1 290 ? -16.090 0.213   -2.012  1.00 38.50  ? 290 ARG A CG  1 
ATOM   1807 C CD  . ARG A 1 290 ? -16.629 -0.459  -3.262  1.00 39.55  ? 290 ARG A CD  1 
ATOM   1808 N NE  . ARG A 1 290 ? -18.089 -0.492  -3.273  1.00 40.53  ? 290 ARG A NE  1 
ATOM   1809 C CZ  . ARG A 1 290 ? -18.823 -0.794  -4.338  1.00 42.29  ? 290 ARG A CZ  1 
ATOM   1810 N NH1 . ARG A 1 290 ? -18.237 -1.088  -5.490  1.00 45.84  ? 290 ARG A NH1 1 
ATOM   1811 N NH2 . ARG A 1 290 ? -20.146 -0.800  -4.252  1.00 45.71  ? 290 ARG A NH2 1 
ATOM   1812 N N   . GLU A 1 291 ? -11.601 1.529   -1.477  1.00 37.96  ? 291 GLU A N   1 
ATOM   1813 C CA  . GLU A 1 291 ? -10.172 1.385   -1.227  1.00 34.54  ? 291 GLU A CA  1 
ATOM   1814 C C   . GLU A 1 291 ? -9.532  2.764   -1.111  1.00 28.10  ? 291 GLU A C   1 
ATOM   1815 O O   . GLU A 1 291 ? -9.594  3.566   -2.042  1.00 24.51  ? 291 GLU A O   1 
ATOM   1816 C CB  . GLU A 1 291 ? -9.506  0.570   -2.338  1.00 35.49  ? 291 GLU A CB  1 
ATOM   1817 C CG  . GLU A 1 291 ? -8.007  0.378   -2.157  1.00 42.45  ? 291 GLU A CG  1 
ATOM   1818 C CD  . GLU A 1 291 ? -7.407  -0.570  -3.180  1.00 43.37  ? 291 GLU A CD  1 
ATOM   1819 O OE1 . GLU A 1 291 ? -8.126  -1.475  -3.657  1.00 44.13  ? 291 GLU A OE1 1 
ATOM   1820 O OE2 . GLU A 1 291 ? -6.212  -0.413  -3.505  1.00 47.53  ? 291 GLU A OE2 1 
ATOM   1821 N N   . PHE A 1 292 ? -8.919  3.034   0.037   1.00 27.55  ? 292 PHE A N   1 
ATOM   1822 C CA  . PHE A 1 292 ? -8.376  4.358   0.323   1.00 35.26  ? 292 PHE A CA  1 
ATOM   1823 C C   . PHE A 1 292 ? -7.069  4.288   1.108   1.00 35.13  ? 292 PHE A C   1 
ATOM   1824 O O   . PHE A 1 292 ? -6.833  3.340   1.856   1.00 35.91  ? 292 PHE A O   1 
ATOM   1825 C CB  . PHE A 1 292 ? -9.404  5.193   1.094   1.00 29.77  ? 292 PHE A CB  1 
ATOM   1826 C CG  . PHE A 1 292 ? -10.034 4.465   2.251   1.00 36.08  ? 292 PHE A CG  1 
ATOM   1827 C CD1 . PHE A 1 292 ? -11.193 3.724   2.075   1.00 35.94  ? 292 PHE A CD1 1 
ATOM   1828 C CD2 . PHE A 1 292 ? -9.467  4.519   3.513   1.00 35.66  ? 292 PHE A CD2 1 
ATOM   1829 C CE1 . PHE A 1 292 ? -11.772 3.051   3.137   1.00 35.40  ? 292 PHE A CE1 1 
ATOM   1830 C CE2 . PHE A 1 292 ? -10.044 3.849   4.580   1.00 35.75  ? 292 PHE A CE2 1 
ATOM   1831 C CZ  . PHE A 1 292 ? -11.197 3.115   4.391   1.00 32.10  ? 292 PHE A CZ  1 
ATOM   1832 N N   . THR A 1 293 ? -6.225  5.300   0.932   1.00 32.47  ? 293 THR A N   1 
ATOM   1833 C CA  . THR A 1 293 ? -4.963  5.387   1.658   1.00 38.77  ? 293 THR A CA  1 
ATOM   1834 C C   . THR A 1 293 ? -5.124  6.242   2.913   1.00 38.86  ? 293 THR A C   1 
ATOM   1835 O O   . THR A 1 293 ? -5.714  7.323   2.869   1.00 41.11  ? 293 THR A O   1 
ATOM   1836 C CB  . THR A 1 293 ? -3.843  5.968   0.776   1.00 40.95  ? 293 THR A CB  1 
ATOM   1837 O OG1 . THR A 1 293 ? -3.780  5.241   -0.456  1.00 43.02  ? 293 THR A OG1 1 
ATOM   1838 C CG2 . THR A 1 293 ? -2.498  5.875   1.484   1.00 35.77  ? 293 THR A CG2 1 
ATOM   1839 N N   . MET A 1 294 ? -4.588  5.753   4.026   1.00 28.73  ? 294 MET A N   1 
ATOM   1840 C CA  . MET A 1 294 ? -4.783  6.391   5.321   1.00 31.20  ? 294 MET A CA  1 
ATOM   1841 C C   . MET A 1 294 ? -3.472  6.602   6.066   1.00 34.85  ? 294 MET A C   1 
ATOM   1842 O O   . MET A 1 294 ? -2.507  5.863   5.871   1.00 34.42  ? 294 MET A O   1 
ATOM   1843 C CB  . MET A 1 294 ? -5.722  5.540   6.178   1.00 41.66  ? 294 MET A CB  1 
ATOM   1844 C CG  . MET A 1 294 ? -7.178  5.616   5.769   1.00 46.99  ? 294 MET A CG  1 
ATOM   1845 S SD  . MET A 1 294 ? -8.142  6.708   6.828   1.00 54.93  ? 294 MET A SD  1 
ATOM   1846 C CE  . MET A 1 294 ? -8.573  5.588   8.161   1.00 58.09  ? 294 MET A CE  1 
ATOM   1847 N N   . ALA A 1 295 ? -3.450  7.613   6.927   1.00 34.91  ? 295 ALA A N   1 
ATOM   1848 C CA  . ALA A 1 295 ? -2.309  7.861   7.796   1.00 39.41  ? 295 ALA A CA  1 
ATOM   1849 C C   . ALA A 1 295 ? -2.769  7.900   9.249   1.00 42.23  ? 295 ALA A C   1 
ATOM   1850 O O   . ALA A 1 295 ? -3.402  8.861   9.681   1.00 46.38  ? 295 ALA A O   1 
ATOM   1851 C CB  . ALA A 1 295 ? -1.624  9.160   7.416   1.00 32.82  ? 295 ALA A CB  1 
ATOM   1852 N N   . GLU A 1 296 ? -2.455  6.846   9.996   1.00 44.15  ? 296 GLU A N   1 
ATOM   1853 C CA  . GLU A 1 296 ? -2.885  6.734   11.386  1.00 45.78  ? 296 GLU A CA  1 
ATOM   1854 C C   . GLU A 1 296 ? -1.758  7.047   12.361  1.00 47.11  ? 296 GLU A C   1 
ATOM   1855 O O   . GLU A 1 296 ? -0.587  6.819   12.065  1.00 55.41  ? 296 GLU A O   1 
ATOM   1856 C CB  . GLU A 1 296 ? -3.429  5.330   11.665  1.00 65.63  ? 296 GLU A CB  1 
ATOM   1857 C CG  . GLU A 1 296 ? -4.894  5.133   11.303  1.00 77.30  ? 296 GLU A CG  1 
ATOM   1858 C CD  . GLU A 1 296 ? -5.837  5.509   12.434  1.00 84.98  ? 296 GLU A CD  1 
ATOM   1859 O OE1 . GLU A 1 296 ? -5.437  6.303   13.313  1.00 88.63  ? 296 GLU A OE1 1 
ATOM   1860 O OE2 . GLU A 1 296 ? -6.983  5.010   12.442  1.00 85.46  ? 296 GLU A OE2 1 
ATOM   1861 N N   . ILE A 1 297 ? -2.126  7.576   13.523  1.00 42.27  ? 297 ILE A N   1 
ATOM   1862 C CA  . ILE A 1 297 ? -1.180  7.820   14.604  1.00 30.95  ? 297 ILE A CA  1 
ATOM   1863 C C   . ILE A 1 297 ? -1.784  7.358   15.925  1.00 35.26  ? 297 ILE A C   1 
ATOM   1864 O O   . ILE A 1 297 ? -2.937  7.659   16.224  1.00 38.65  ? 297 ILE A O   1 
ATOM   1865 C CB  . ILE A 1 297 ? -0.807  9.312   14.719  1.00 34.75  ? 297 ILE A CB  1 
ATOM   1866 C CG1 . ILE A 1 297 ? 0.040   9.751   13.524  1.00 32.62  ? 297 ILE A CG1 1 
ATOM   1867 C CG2 . ILE A 1 297 ? -0.054  9.579   16.017  1.00 33.05  ? 297 ILE A CG2 1 
ATOM   1868 C CD1 . ILE A 1 297 ? 0.476   11.199  13.588  1.00 31.03  ? 297 ILE A CD1 1 
ATOM   1869 N N   . GLU A 1 298 ? -1.007  6.617   16.708  1.00 38.05  ? 298 GLU A N   1 
ATOM   1870 C CA  . GLU A 1 298 ? -1.452  6.183   18.026  1.00 38.68  ? 298 GLU A CA  1 
ATOM   1871 C C   . GLU A 1 298 ? -0.506  6.701   19.101  1.00 41.98  ? 298 GLU A C   1 
ATOM   1872 O O   . GLU A 1 298 ? 0.565   6.139   19.327  1.00 41.76  ? 298 GLU A O   1 
ATOM   1873 C CB  . GLU A 1 298 ? -1.553  4.659   18.091  1.00 41.42  ? 298 GLU A CB  1 
ATOM   1874 C CG  . GLU A 1 298 ? -2.522  4.057   17.086  1.00 51.32  ? 298 GLU A CG  1 
ATOM   1875 C CD  . GLU A 1 298 ? -3.957  4.488   17.320  1.00 55.39  ? 298 GLU A CD  1 
ATOM   1876 O OE1 . GLU A 1 298 ? -4.391  4.510   18.491  1.00 58.17  ? 298 GLU A OE1 1 
ATOM   1877 O OE2 . GLU A 1 298 ? -4.654  4.797   16.331  1.00 56.99  ? 298 GLU A OE2 1 
ATOM   1878 N N   . HIS A 1 299 ? -0.910  7.783   19.757  1.00 40.38  ? 299 HIS A N   1 
ATOM   1879 C CA  . HIS A 1 299 ? -0.091  8.408   20.786  1.00 38.24  ? 299 HIS A CA  1 
ATOM   1880 C C   . HIS A 1 299 ? -0.564  7.989   22.170  1.00 39.06  ? 299 HIS A C   1 
ATOM   1881 O O   . HIS A 1 299 ? -1.667  8.335   22.592  1.00 46.05  ? 299 HIS A O   1 
ATOM   1882 C CB  . HIS A 1 299 ? -0.142  9.928   20.652  1.00 38.89  ? 299 HIS A CB  1 
ATOM   1883 C CG  . HIS A 1 299 ? 0.741   10.648  21.622  1.00 39.46  ? 299 HIS A CG  1 
ATOM   1884 N ND1 . HIS A 1 299 ? 1.927   11.242  21.249  1.00 41.25  ? 299 HIS A ND1 1 
ATOM   1885 C CD2 . HIS A 1 299 ? 0.612   10.867  22.951  1.00 39.76  ? 299 HIS A CD2 1 
ATOM   1886 C CE1 . HIS A 1 299 ? 2.489   11.799  22.306  1.00 42.76  ? 299 HIS A CE1 1 
ATOM   1887 N NE2 . HIS A 1 299 ? 1.712   11.585  23.353  1.00 39.09  ? 299 HIS A NE2 1 
ATOM   1888 N N   . PHE A 1 300 ? 0.286   7.253   22.877  1.00 41.13  ? 300 PHE A N   1 
ATOM   1889 C CA  . PHE A 1 300 ? -0.074  6.698   24.173  1.00 41.93  ? 300 PHE A CA  1 
ATOM   1890 C C   . PHE A 1 300 ? 0.451   7.561   25.314  1.00 44.24  ? 300 PHE A C   1 
ATOM   1891 O O   . PHE A 1 300 ? 1.608   7.977   25.307  1.00 50.27  ? 300 PHE A O   1 
ATOM   1892 C CB  . PHE A 1 300 ? 0.451   5.267   24.293  1.00 41.88  ? 300 PHE A CB  1 
ATOM   1893 C CG  . PHE A 1 300 ? -0.027  4.355   23.197  1.00 41.09  ? 300 PHE A CG  1 
ATOM   1894 C CD1 . PHE A 1 300 ? -1.223  3.667   23.324  1.00 37.34  ? 300 PHE A CD1 1 
ATOM   1895 C CD2 . PHE A 1 300 ? 0.716   4.190   22.037  1.00 39.88  ? 300 PHE A CD2 1 
ATOM   1896 C CE1 . PHE A 1 300 ? -1.668  2.827   22.317  1.00 38.69  ? 300 PHE A CE1 1 
ATOM   1897 C CE2 . PHE A 1 300 ? 0.276   3.352   21.026  1.00 37.72  ? 300 PHE A CE2 1 
ATOM   1898 C CZ  . PHE A 1 300 ? -0.917  2.670   21.167  1.00 39.15  ? 300 PHE A CZ  1 
ATOM   1899 N N   . VAL A 1 301 ? -0.410  7.826   26.291  1.00 47.80  ? 301 VAL A N   1 
ATOM   1900 C CA  . VAL A 1 301 ? -0.060  8.706   27.400  1.00 52.64  ? 301 VAL A CA  1 
ATOM   1901 C C   . VAL A 1 301 ? -0.459  8.132   28.753  1.00 56.48  ? 301 VAL A C   1 
ATOM   1902 O O   . VAL A 1 301 ? -1.458  7.423   28.870  1.00 46.60  ? 301 VAL A O   1 
ATOM   1903 C CB  . VAL A 1 301 ? -0.720  10.093  27.249  1.00 51.91  ? 301 VAL A CB  1 
ATOM   1904 C CG1 . VAL A 1 301 ? 0.170   11.022  26.437  1.00 53.70  ? 301 VAL A CG1 1 
ATOM   1905 C CG2 . VAL A 1 301 ? -2.104  9.961   26.623  1.00 49.92  ? 301 VAL A CG2 1 
ATOM   1906 N N   . ASP A 1 302 ? 0.332   8.448   29.773  1.00 61.64  ? 302 ASP A N   1 
ATOM   1907 C CA  . ASP A 1 302 ? -0.011  8.096   31.142  1.00 64.57  ? 302 ASP A CA  1 
ATOM   1908 C C   . ASP A 1 302 ? -1.043  9.094   31.656  1.00 65.33  ? 302 ASP A C   1 
ATOM   1909 O O   . ASP A 1 302 ? -0.787  10.298  31.677  1.00 70.65  ? 302 ASP A O   1 
ATOM   1910 C CB  . ASP A 1 302 ? 1.239   8.114   32.026  1.00 66.02  ? 302 ASP A CB  1 
ATOM   1911 C CG  . ASP A 1 302 ? 0.995   7.519   33.404  1.00 68.71  ? 302 ASP A CG  1 
ATOM   1912 O OD1 . ASP A 1 302 ? -0.129  7.651   33.930  1.00 67.35  ? 302 ASP A OD1 1 
ATOM   1913 O OD2 . ASP A 1 302 ? 1.937   6.922   33.966  1.00 72.83  ? 302 ASP A OD2 1 
ATOM   1914 N N   . PRO A 1 303 ? -2.222  8.594   32.059  1.00 65.75  ? 303 PRO A N   1 
ATOM   1915 C CA  . PRO A 1 303 ? -3.300  9.432   32.580  1.00 67.43  ? 303 PRO A CA  1 
ATOM   1916 C C   . PRO A 1 303 ? -2.835  10.340  33.716  1.00 67.42  ? 303 PRO A C   1 
ATOM   1917 O O   . PRO A 1 303 ? -3.349  11.447  33.870  1.00 64.89  ? 303 PRO A O   1 
ATOM   1918 C CB  . PRO A 1 303 ? -4.311  8.409   33.104  1.00 68.06  ? 303 PRO A CB  1 
ATOM   1919 C CG  . PRO A 1 303 ? -4.071  7.196   32.284  1.00 68.34  ? 303 PRO A CG  1 
ATOM   1920 C CD  . PRO A 1 303 ? -2.594  7.169   32.028  1.00 68.34  ? 303 PRO A CD  1 
ATOM   1921 N N   . SER A 1 304 ? -1.868  9.869   34.498  1.00 70.59  ? 304 SER A N   1 
ATOM   1922 C CA  . SER A 1 304 ? -1.336  10.640  35.617  1.00 75.46  ? 304 SER A CA  1 
ATOM   1923 C C   . SER A 1 304 ? -0.557  11.864  35.140  1.00 77.09  ? 304 SER A C   1 
ATOM   1924 O O   . SER A 1 304 ? -0.565  12.907  35.794  1.00 81.34  ? 304 SER A O   1 
ATOM   1925 C CB  . SER A 1 304 ? -0.444  9.762   36.496  1.00 81.62  ? 304 SER A CB  1 
ATOM   1926 O OG  . SER A 1 304 ? -1.160  8.645   36.996  1.00 86.49  ? 304 SER A OG  1 
ATOM   1927 N N   . GLU A 1 305 ? 0.113   11.729  34.000  1.00 78.88  ? 305 GLU A N   1 
ATOM   1928 C CA  . GLU A 1 305 ? 0.891   12.825  33.433  1.00 77.78  ? 305 GLU A CA  1 
ATOM   1929 C C   . GLU A 1 305 ? 0.446   13.107  32.001  1.00 70.01  ? 305 GLU A C   1 
ATOM   1930 O O   . GLU A 1 305 ? 1.135   12.755  31.043  1.00 71.31  ? 305 GLU A O   1 
ATOM   1931 C CB  . GLU A 1 305 ? 2.385   12.495  33.478  1.00 80.05  ? 305 GLU A CB  1 
ATOM   1932 C CG  . GLU A 1 305 ? 3.299   13.698  33.306  1.00 86.16  ? 305 GLU A CG  1 
ATOM   1933 C CD  . GLU A 1 305 ? 4.768   13.334  33.408  1.00 88.26  ? 305 GLU A CD  1 
ATOM   1934 O OE1 . GLU A 1 305 ? 5.083   12.126  33.440  1.00 90.79  ? 305 GLU A OE1 1 
ATOM   1935 O OE2 . GLU A 1 305 ? 5.609   14.258  33.456  1.00 89.67  ? 305 GLU A OE2 1 
ATOM   1936 N N   . LYS A 1 306 ? -0.714  13.743  31.863  1.00 63.50  ? 306 LYS A N   1 
ATOM   1937 C CA  . LYS A 1 306 ? -1.295  14.004  30.551  1.00 60.77  ? 306 LYS A CA  1 
ATOM   1938 C C   . LYS A 1 306 ? -1.200  15.480  30.175  1.00 62.06  ? 306 LYS A C   1 
ATOM   1939 O O   . LYS A 1 306 ? -2.196  16.206  30.197  1.00 58.29  ? 306 LYS A O   1 
ATOM   1940 C CB  . LYS A 1 306 ? -2.752  13.535  30.513  1.00 62.87  ? 306 LYS A CB  1 
ATOM   1941 C CG  . LYS A 1 306 ? -3.326  13.384  29.113  1.00 61.76  ? 306 LYS A CG  1 
ATOM   1942 C CD  . LYS A 1 306 ? -4.700  12.737  29.151  1.00 59.35  ? 306 LYS A CD  1 
ATOM   1943 C CE  . LYS A 1 306 ? -5.212  12.449  27.750  1.00 58.77  ? 306 LYS A CE  1 
ATOM   1944 N NZ  . LYS A 1 306 ? -6.532  11.761  27.775  1.00 57.89  ? 306 LYS A NZ  1 
ATOM   1945 N N   . ASP A 1 307 ? 0.007   15.916  29.830  1.00 61.20  ? 307 ASP A N   1 
ATOM   1946 C CA  . ASP A 1 307 ? 0.248   17.298  29.433  1.00 58.83  ? 307 ASP A CA  1 
ATOM   1947 C C   . ASP A 1 307 ? 1.407   17.364  28.444  1.00 56.73  ? 307 ASP A C   1 
ATOM   1948 O O   . ASP A 1 307 ? 2.540   17.017  28.779  1.00 58.27  ? 307 ASP A O   1 
ATOM   1949 C CB  . ASP A 1 307 ? 0.548   18.164  30.660  1.00 65.49  ? 307 ASP A CB  1 
ATOM   1950 C CG  . ASP A 1 307 ? 0.765   19.625  30.308  1.00 69.38  ? 307 ASP A CG  1 
ATOM   1951 O OD1 . ASP A 1 307 ? 0.135   20.111  29.345  1.00 69.33  ? 307 ASP A OD1 1 
ATOM   1952 O OD2 . ASP A 1 307 ? 1.563   20.290  31.000  1.00 74.44  ? 307 ASP A OD2 1 
ATOM   1953 N N   . HIS A 1 308 ? 1.118   17.809  27.224  1.00 53.82  ? 308 HIS A N   1 
ATOM   1954 C CA  . HIS A 1 308 ? 2.131   17.873  26.176  1.00 50.74  ? 308 HIS A CA  1 
ATOM   1955 C C   . HIS A 1 308 ? 3.031   19.093  26.351  1.00 49.96  ? 308 HIS A C   1 
ATOM   1956 O O   . HIS A 1 308 ? 2.548   20.225  26.389  1.00 53.87  ? 308 HIS A O   1 
ATOM   1957 C CB  . HIS A 1 308 ? 1.477   17.890  24.792  1.00 48.17  ? 308 HIS A CB  1 
ATOM   1958 C CG  . HIS A 1 308 ? 2.339   17.318  23.710  1.00 45.52  ? 308 HIS A CG  1 
ATOM   1959 N ND1 . HIS A 1 308 ? 3.412   17.997  23.175  1.00 46.59  ? 308 HIS A ND1 1 
ATOM   1960 C CD2 . HIS A 1 308 ? 2.289   16.128  23.066  1.00 44.39  ? 308 HIS A CD2 1 
ATOM   1961 C CE1 . HIS A 1 308 ? 3.985   17.251  22.248  1.00 42.89  ? 308 HIS A CE1 1 
ATOM   1962 N NE2 . HIS A 1 308 ? 3.322   16.112  22.162  1.00 44.68  ? 308 HIS A NE2 1 
ATOM   1963 N N   . PRO A 1 309 ? 4.350   18.860  26.457  1.00 51.90  ? 309 PRO A N   1 
ATOM   1964 C CA  . PRO A 1 309 ? 5.350   19.904  26.687  1.00 50.74  ? 309 PRO A CA  1 
ATOM   1965 C C   . PRO A 1 309 ? 5.502   20.866  25.511  1.00 53.12  ? 309 PRO A C   1 
ATOM   1966 O O   . PRO A 1 309 ? 5.999   21.978  25.686  1.00 57.78  ? 309 PRO A O   1 
ATOM   1967 C CB  . PRO A 1 309 ? 6.652   19.113  26.879  1.00 47.91  ? 309 PRO A CB  1 
ATOM   1968 C CG  . PRO A 1 309 ? 6.231   17.700  27.130  1.00 52.08  ? 309 PRO A CG  1 
ATOM   1969 C CD  . PRO A 1 309 ? 4.964   17.527  26.366  1.00 51.83  ? 309 PRO A CD  1 
ATOM   1970 N N   . LYS A 1 310 ? 5.077   20.438  24.326  1.00 47.45  ? 310 LYS A N   1 
ATOM   1971 C CA  . LYS A 1 310 ? 5.233   21.248  23.121  1.00 43.92  ? 310 LYS A CA  1 
ATOM   1972 C C   . LYS A 1 310 ? 3.961   22.014  22.760  1.00 44.41  ? 310 LYS A C   1 
ATOM   1973 O O   . LYS A 1 310 ? 3.875   22.615  21.689  1.00 39.65  ? 310 LYS A O   1 
ATOM   1974 C CB  . LYS A 1 310 ? 5.669   20.374  21.942  1.00 45.39  ? 310 LYS A CB  1 
ATOM   1975 C CG  . LYS A 1 310 ? 6.989   19.650  22.159  1.00 51.97  ? 310 LYS A CG  1 
ATOM   1976 C CD  . LYS A 1 310 ? 7.342   18.764  20.973  1.00 52.42  ? 310 LYS A CD  1 
ATOM   1977 C CE  . LYS A 1 310 ? 7.619   19.589  19.726  1.00 58.77  ? 310 LYS A CE  1 
ATOM   1978 N NZ  . LYS A 1 310 ? 8.052   18.740  18.583  1.00 60.69  ? 310 LYS A NZ  1 
ATOM   1979 N N   . PHE A 1 311 ? 2.981   21.994  23.659  1.00 40.87  ? 311 PHE A N   1 
ATOM   1980 C CA  . PHE A 1 311 ? 1.699   22.653  23.411  1.00 41.22  ? 311 PHE A CA  1 
ATOM   1981 C C   . PHE A 1 311 ? 1.844   24.161  23.205  1.00 41.45  ? 311 PHE A C   1 
ATOM   1982 O O   . PHE A 1 311 ? 1.124   24.754  22.402  1.00 44.41  ? 311 PHE A O   1 
ATOM   1983 C CB  . PHE A 1 311 ? 0.714   22.368  24.548  1.00 40.79  ? 311 PHE A CB  1 
ATOM   1984 C CG  . PHE A 1 311 ? -0.636  23.002  24.352  1.00 41.58  ? 311 PHE A CG  1 
ATOM   1985 C CD1 . PHE A 1 311 ? -1.567  22.429  23.500  1.00 39.48  ? 311 PHE A CD1 1 
ATOM   1986 C CD2 . PHE A 1 311 ? -0.973  24.170  25.018  1.00 38.01  ? 311 PHE A CD2 1 
ATOM   1987 C CE1 . PHE A 1 311 ? -2.809  23.011  23.315  1.00 41.42  ? 311 PHE A CE1 1 
ATOM   1988 C CE2 . PHE A 1 311 ? -2.213  24.756  24.837  1.00 36.48  ? 311 PHE A CE2 1 
ATOM   1989 C CZ  . PHE A 1 311 ? -3.131  24.177  23.984  1.00 37.75  ? 311 PHE A CZ  1 
ATOM   1990 N N   . GLN A 1 312 ? 2.776   24.771  23.930  1.00 51.74  ? 312 GLN A N   1 
ATOM   1991 C CA  . GLN A 1 312 ? 3.003   26.213  23.850  1.00 62.01  ? 312 GLN A CA  1 
ATOM   1992 C C   . GLN A 1 312 ? 3.308   26.675  22.427  1.00 54.42  ? 312 GLN A C   1 
ATOM   1993 O O   . GLN A 1 312 ? 3.127   27.847  22.095  1.00 51.43  ? 312 GLN A O   1 
ATOM   1994 C CB  . GLN A 1 312 ? 4.138   26.630  24.788  1.00 76.02  ? 312 GLN A CB  1 
ATOM   1995 C CG  . GLN A 1 312 ? 3.821   26.456  26.266  1.00 86.74  ? 312 GLN A CG  1 
ATOM   1996 C CD  . GLN A 1 312 ? 4.994   26.804  27.163  1.00 89.77  ? 312 GLN A CD  1 
ATOM   1997 O OE1 . GLN A 1 312 ? 6.085   27.121  26.686  1.00 93.20  ? 312 GLN A OE1 1 
ATOM   1998 N NE2 . GLN A 1 312 ? 4.775   26.747  28.472  1.00 92.99  ? 312 GLN A NE2 1 
ATOM   1999 N N   . ASN A 1 313 ? 3.768   25.749  21.591  1.00 52.56  ? 313 ASN A N   1 
ATOM   2000 C CA  . ASN A 1 313 ? 4.107   26.061  20.208  1.00 48.97  ? 313 ASN A CA  1 
ATOM   2001 C C   . ASN A 1 313 ? 2.877   26.215  19.320  1.00 43.13  ? 313 ASN A C   1 
ATOM   2002 O O   . ASN A 1 313 ? 2.981   26.656  18.176  1.00 50.03  ? 313 ASN A O   1 
ATOM   2003 C CB  . ASN A 1 313 ? 5.023   24.980  19.628  1.00 50.02  ? 313 ASN A CB  1 
ATOM   2004 C CG  . ASN A 1 313 ? 6.291   24.792  20.436  1.00 52.54  ? 313 ASN A CG  1 
ATOM   2005 O OD1 . ASN A 1 313 ? 6.659   25.644  21.244  1.00 58.07  ? 313 ASN A OD1 1 
ATOM   2006 N ND2 . ASN A 1 313 ? 6.968   23.670  20.220  1.00 54.66  ? 313 ASN A ND2 1 
ATOM   2007 N N   . VAL A 1 314 ? 1.715   25.852  19.852  1.00 43.32  ? 314 VAL A N   1 
ATOM   2008 C CA  . VAL A 1 314 ? 0.490   25.822  19.061  1.00 51.42  ? 314 VAL A CA  1 
ATOM   2009 C C   . VAL A 1 314 ? -0.645  26.618  19.710  1.00 50.44  ? 314 VAL A C   1 
ATOM   2010 O O   . VAL A 1 314 ? -1.637  26.946  19.058  1.00 46.63  ? 314 VAL A O   1 
ATOM   2011 C CB  . VAL A 1 314 ? 0.017   24.370  18.831  1.00 53.98  ? 314 VAL A CB  1 
ATOM   2012 C CG1 . VAL A 1 314 ? -1.021  24.320  17.735  1.00 55.97  ? 314 VAL A CG1 1 
ATOM   2013 C CG2 . VAL A 1 314 ? 1.194   23.473  18.476  1.00 57.18  ? 314 VAL A CG2 1 
ATOM   2014 N N   . ALA A 1 315 ? -0.484  26.935  20.991  1.00 49.42  ? 315 ALA A N   1 
ATOM   2015 C CA  . ALA A 1 315 ? -1.540  27.568  21.784  1.00 45.03  ? 315 ALA A CA  1 
ATOM   2016 C C   . ALA A 1 315 ? -2.057  28.889  21.212  1.00 44.26  ? 315 ALA A C   1 
ATOM   2017 O O   . ALA A 1 315 ? -3.176  29.304  21.514  1.00 47.96  ? 315 ALA A O   1 
ATOM   2018 C CB  . ALA A 1 315 ? -1.070  27.765  23.219  1.00 44.89  ? 315 ALA A CB  1 
ATOM   2019 N N   . ASP A 1 316 ? -1.246  29.543  20.386  1.00 48.97  ? 316 ASP A N   1 
ATOM   2020 C CA  . ASP A 1 316 ? -1.584  30.866  19.869  1.00 50.75  ? 316 ASP A CA  1 
ATOM   2021 C C   . ASP A 1 316 ? -2.473  30.805  18.625  1.00 47.88  ? 316 ASP A C   1 
ATOM   2022 O O   . ASP A 1 316 ? -2.931  31.834  18.129  1.00 51.13  ? 316 ASP A O   1 
ATOM   2023 C CB  . ASP A 1 316 ? -0.307  31.657  19.570  1.00 57.93  ? 316 ASP A CB  1 
ATOM   2024 C CG  . ASP A 1 316 ? -0.542  33.155  19.515  1.00 64.15  ? 316 ASP A CG  1 
ATOM   2025 O OD1 . ASP A 1 316 ? 0.331   33.872  18.984  1.00 68.58  ? 316 ASP A OD1 1 
ATOM   2026 O OD2 . ASP A 1 316 ? -1.597  33.616  20.002  1.00 67.61  ? 316 ASP A OD2 1 
ATOM   2027 N N   . LEU A 1 317 ? -2.720  29.597  18.128  1.00 50.73  ? 317 LEU A N   1 
ATOM   2028 C CA  . LEU A 1 317 ? -3.519  29.423  16.919  1.00 49.78  ? 317 LEU A CA  1 
ATOM   2029 C C   . LEU A 1 317 ? -4.993  29.747  17.133  1.00 52.05  ? 317 LEU A C   1 
ATOM   2030 O O   . LEU A 1 317 ? -5.563  29.450  18.184  1.00 50.82  ? 317 LEU A O   1 
ATOM   2031 C CB  . LEU A 1 317 ? -3.376  28.002  16.369  1.00 47.89  ? 317 LEU A CB  1 
ATOM   2032 C CG  . LEU A 1 317 ? -2.085  27.666  15.620  1.00 50.05  ? 317 LEU A CG  1 
ATOM   2033 C CD1 . LEU A 1 317 ? -2.152  26.251  15.073  1.00 47.37  ? 317 LEU A CD1 1 
ATOM   2034 C CD2 . LEU A 1 317 ? -1.829  28.660  14.498  1.00 48.98  ? 317 LEU A CD2 1 
ATOM   2035 N N   . HIS A 1 318 ? -5.601  30.358  16.123  1.00 48.17  ? 318 HIS A N   1 
ATOM   2036 C CA  . HIS A 1 318 ? -7.031  30.624  16.128  1.00 50.15  ? 318 HIS A CA  1 
ATOM   2037 C C   . HIS A 1 318 ? -7.721  29.703  15.137  1.00 53.80  ? 318 HIS A C   1 
ATOM   2038 O O   . HIS A 1 318 ? -7.405  29.710  13.947  1.00 55.75  ? 318 HIS A O   1 
ATOM   2039 C CB  . HIS A 1 318 ? -7.308  32.079  15.759  1.00 58.96  ? 318 HIS A CB  1 
ATOM   2040 C CG  . HIS A 1 318 ? -6.918  33.055  16.823  1.00 62.24  ? 318 HIS A CG  1 
ATOM   2041 N ND1 . HIS A 1 318 ? -5.668  33.631  16.883  1.00 64.43  ? 318 HIS A ND1 1 
ATOM   2042 C CD2 . HIS A 1 318 ? -7.614  33.555  17.870  1.00 63.30  ? 318 HIS A CD2 1 
ATOM   2043 C CE1 . HIS A 1 318 ? -5.611  34.446  17.921  1.00 65.07  ? 318 HIS A CE1 1 
ATOM   2044 N NE2 . HIS A 1 318 ? -6.779  34.418  18.537  1.00 66.57  ? 318 HIS A NE2 1 
ATOM   2045 N N   . LEU A 1 319 ? -8.664  28.908  15.628  1.00 52.61  ? 319 LEU A N   1 
ATOM   2046 C CA  . LEU A 1 319 ? -9.354  27.948  14.778  1.00 50.15  ? 319 LEU A CA  1 
ATOM   2047 C C   . LEU A 1 319 ? -10.807 27.750  15.195  1.00 44.52  ? 319 LEU A C   1 
ATOM   2048 O O   . LEU A 1 319 ? -11.145 27.836  16.375  1.00 44.32  ? 319 LEU A O   1 
ATOM   2049 C CB  . LEU A 1 319 ? -8.591  26.619  14.748  1.00 51.57  ? 319 LEU A CB  1 
ATOM   2050 C CG  . LEU A 1 319 ? -7.987  26.126  16.063  1.00 51.69  ? 319 LEU A CG  1 
ATOM   2051 C CD1 . LEU A 1 319 ? -8.797  24.974  16.622  1.00 55.35  ? 319 LEU A CD1 1 
ATOM   2052 C CD2 . LEU A 1 319 ? -6.544  25.701  15.855  1.00 53.26  ? 319 LEU A CD2 1 
ATOM   2053 N N   . TYR A 1 320 ? -11.660 27.492  14.208  1.00 39.36  ? 320 TYR A N   1 
ATOM   2054 C CA  . TYR A 1 320 ? -13.085 27.302  14.445  1.00 35.48  ? 320 TYR A CA  1 
ATOM   2055 C C   . TYR A 1 320 ? -13.366 25.994  15.173  1.00 37.16  ? 320 TYR A C   1 
ATOM   2056 O O   . TYR A 1 320 ? -13.083 24.910  14.663  1.00 36.85  ? 320 TYR A O   1 
ATOM   2057 C CB  . TYR A 1 320 ? -13.859 27.343  13.125  1.00 40.21  ? 320 TYR A CB  1 
ATOM   2058 C CG  . TYR A 1 320 ? -13.920 28.714  12.491  1.00 41.80  ? 320 TYR A CG  1 
ATOM   2059 C CD1 . TYR A 1 320 ? -14.994 29.564  12.730  1.00 41.02  ? 320 TYR A CD1 1 
ATOM   2060 C CD2 . TYR A 1 320 ? -12.905 29.160  11.653  1.00 39.27  ? 320 TYR A CD2 1 
ATOM   2061 C CE1 . TYR A 1 320 ? -15.056 30.819  12.152  1.00 39.53  ? 320 TYR A CE1 1 
ATOM   2062 C CE2 . TYR A 1 320 ? -12.957 30.413  11.072  1.00 43.38  ? 320 TYR A CE2 1 
ATOM   2063 C CZ  . TYR A 1 320 ? -14.034 31.238  11.325  1.00 44.46  ? 320 TYR A CZ  1 
ATOM   2064 O OH  . TYR A 1 320 ? -14.089 32.487  10.747  1.00 46.37  ? 320 TYR A OH  1 
ATOM   2065 N N   . LEU A 1 321 ? -13.924 26.108  16.373  1.00 40.61  ? 321 LEU A N   1 
ATOM   2066 C CA  . LEU A 1 321 ? -14.299 24.942  17.158  1.00 42.85  ? 321 LEU A CA  1 
ATOM   2067 C C   . LEU A 1 321 ? -15.813 24.785  17.184  1.00 46.85  ? 321 LEU A C   1 
ATOM   2068 O O   . LEU A 1 321 ? -16.541 25.729  17.496  1.00 60.57  ? 321 LEU A O   1 
ATOM   2069 C CB  . LEU A 1 321 ? -13.749 25.054  18.580  1.00 39.76  ? 321 LEU A CB  1 
ATOM   2070 C CG  . LEU A 1 321 ? -12.224 25.050  18.697  1.00 43.70  ? 321 LEU A CG  1 
ATOM   2071 C CD1 . LEU A 1 321 ? -11.800 25.262  20.138  1.00 46.89  ? 321 LEU A CD1 1 
ATOM   2072 C CD2 . LEU A 1 321 ? -11.654 23.750  18.156  1.00 43.09  ? 321 LEU A CD2 1 
ATOM   2073 N N   . TYR A 1 322 ? -16.280 23.588  16.846  1.00 47.36  ? 322 TYR A N   1 
ATOM   2074 C CA  . TYR A 1 322 ? -17.706 23.300  16.803  1.00 43.31  ? 322 TYR A CA  1 
ATOM   2075 C C   . TYR A 1 322 ? -18.033 22.211  17.816  1.00 47.80  ? 322 TYR A C   1 
ATOM   2076 O O   . TYR A 1 322 ? -18.182 21.041  17.460  1.00 50.56  ? 322 TYR A O   1 
ATOM   2077 C CB  . TYR A 1 322 ? -18.109 22.868  15.392  1.00 50.21  ? 322 TYR A CB  1 
ATOM   2078 C CG  . TYR A 1 322 ? -19.596 22.917  15.118  1.00 52.93  ? 322 TYR A CG  1 
ATOM   2079 C CD1 . TYR A 1 322 ? -20.332 24.069  15.371  1.00 54.71  ? 322 TYR A CD1 1 
ATOM   2080 C CD2 . TYR A 1 322 ? -20.258 21.820  14.582  1.00 55.40  ? 322 TYR A CD2 1 
ATOM   2081 C CE1 . TYR A 1 322 ? -21.691 24.120  15.113  1.00 52.43  ? 322 TYR A CE1 1 
ATOM   2082 C CE2 . TYR A 1 322 ? -21.616 21.864  14.318  1.00 55.49  ? 322 TYR A CE2 1 
ATOM   2083 C CZ  . TYR A 1 322 ? -22.327 23.015  14.588  1.00 53.39  ? 322 TYR A CZ  1 
ATOM   2084 O OH  . TYR A 1 322 ? -23.677 23.061  14.328  1.00 54.77  ? 322 TYR A OH  1 
ATOM   2085 N N   . SER A 1 323 ? -18.137 22.606  19.081  1.00 43.70  ? 323 SER A N   1 
ATOM   2086 C CA  . SER A 1 323 ? -18.321 21.659  20.177  1.00 46.12  ? 323 SER A CA  1 
ATOM   2087 C C   . SER A 1 323 ? -19.689 20.985  20.153  1.00 46.15  ? 323 SER A C   1 
ATOM   2088 O O   . SER A 1 323 ? -20.581 21.388  19.409  1.00 36.52  ? 323 SER A O   1 
ATOM   2089 C CB  . SER A 1 323 ? -18.107 22.355  21.523  1.00 46.70  ? 323 SER A CB  1 
ATOM   2090 O OG  . SER A 1 323 ? -19.061 23.383  21.723  1.00 51.90  ? 323 SER A OG  1 
ATOM   2091 N N   . ALA A 1 324 ? -19.838 19.955  20.981  1.00 49.45  ? 324 ALA A N   1 
ATOM   2092 C CA  . ALA A 1 324 ? -21.089 19.214  21.081  1.00 55.21  ? 324 ALA A CA  1 
ATOM   2093 C C   . ALA A 1 324 ? -22.195 20.068  21.690  1.00 58.41  ? 324 ALA A C   1 
ATOM   2094 O O   . ALA A 1 324 ? -23.353 19.978  21.283  1.00 63.19  ? 324 ALA A O   1 
ATOM   2095 C CB  . ALA A 1 324 ? -20.887 17.949  21.898  1.00 51.50  ? 324 ALA A CB  1 
ATOM   2096 N N   . LYS A 1 325 ? -21.831 20.897  22.664  1.00 65.88  ? 325 LYS A N   1 
ATOM   2097 C CA  . LYS A 1 325 ? -22.799 21.759  23.334  1.00 66.15  ? 325 LYS A CA  1 
ATOM   2098 C C   . LYS A 1 325 ? -23.346 22.819  22.389  1.00 62.87  ? 325 LYS A C   1 
ATOM   2099 O O   . LYS A 1 325 ? -24.535 23.136  22.426  1.00 66.30  ? 325 LYS A O   1 
ATOM   2100 C CB  . LYS A 1 325 ? -22.183 22.399  24.578  1.00 71.65  ? 325 LYS A CB  1 
ATOM   2101 C CG  . LYS A 1 325 ? -21.889 21.389  25.671  1.00 78.11  ? 325 LYS A CG  1 
ATOM   2102 C CD  . LYS A 1 325 ? -21.392 22.043  26.942  1.00 80.85  ? 325 LYS A CD  1 
ATOM   2103 C CE  . LYS A 1 325 ? -21.269 21.009  28.049  1.00 81.68  ? 325 LYS A CE  1 
ATOM   2104 N NZ  . LYS A 1 325 ? -20.580 21.553  29.246  1.00 83.11  ? 325 LYS A NZ  1 
ATOM   2105 N N   . ALA A 1 326 ? -22.478 23.356  21.539  1.00 60.11  ? 326 ALA A N   1 
ATOM   2106 C CA  . ALA A 1 326 ? -22.904 24.297  20.513  1.00 61.02  ? 326 ALA A CA  1 
ATOM   2107 C C   . ALA A 1 326 ? -23.864 23.618  19.540  1.00 61.43  ? 326 ALA A C   1 
ATOM   2108 O O   . ALA A 1 326 ? -24.848 24.216  19.106  1.00 63.51  ? 326 ALA A O   1 
ATOM   2109 C CB  . ALA A 1 326 ? -21.702 24.858  19.773  1.00 59.82  ? 326 ALA A CB  1 
ATOM   2110 N N   . GLN A 1 327 ? -23.574 22.363  19.207  1.00 60.56  ? 327 GLN A N   1 
ATOM   2111 C CA  . GLN A 1 327 ? -24.418 21.596  18.296  1.00 58.24  ? 327 GLN A CA  1 
ATOM   2112 C C   . GLN A 1 327 ? -25.784 21.320  18.912  1.00 62.68  ? 327 GLN A C   1 
ATOM   2113 O O   . GLN A 1 327 ? -26.801 21.336  18.220  1.00 62.83  ? 327 GLN A O   1 
ATOM   2114 C CB  . GLN A 1 327 ? -23.741 20.280  17.916  1.00 48.46  ? 327 GLN A CB  1 
ATOM   2115 C CG  . GLN A 1 327 ? -22.408 20.458  17.222  1.00 46.12  ? 327 GLN A CG  1 
ATOM   2116 C CD  . GLN A 1 327 ? -21.718 19.142  16.943  1.00 45.73  ? 327 GLN A CD  1 
ATOM   2117 O OE1 . GLN A 1 327 ? -22.283 18.251  16.309  1.00 49.63  ? 327 GLN A OE1 1 
ATOM   2118 N NE2 . GLN A 1 327 ? -20.483 19.014  17.412  1.00 41.33  ? 327 GLN A NE2 1 
ATOM   2119 N N   . VAL A 1 328 ? -25.797 21.064  20.217  1.00 67.82  ? 328 VAL A N   1 
ATOM   2120 C CA  . VAL A 1 328 ? -27.038 20.825  20.944  1.00 64.72  ? 328 VAL A CA  1 
ATOM   2121 C C   . VAL A 1 328 ? -27.858 22.109  21.050  1.00 68.15  ? 328 VAL A C   1 
ATOM   2122 O O   . VAL A 1 328 ? -29.082 22.089  20.921  1.00 69.61  ? 328 VAL A O   1 
ATOM   2123 C CB  . VAL A 1 328 ? -26.764 20.262  22.356  1.00 63.58  ? 328 VAL A CB  1 
ATOM   2124 C CG1 . VAL A 1 328 ? -27.993 20.396  23.243  1.00 65.05  ? 328 VAL A CG1 1 
ATOM   2125 C CG2 . VAL A 1 328 ? -26.315 18.810  22.272  1.00 60.95  ? 328 VAL A CG2 1 
ATOM   2126 N N   . SER A 1 329 ? -27.170 23.225  21.271  1.00 69.89  ? 329 SER A N   1 
ATOM   2127 C CA  . SER A 1 329 ? -27.824 24.521  21.415  1.00 67.45  ? 329 SER A CA  1 
ATOM   2128 C C   . SER A 1 329 ? -28.260 25.087  20.068  1.00 70.00  ? 329 SER A C   1 
ATOM   2129 O O   . SER A 1 329 ? -28.994 26.073  20.010  1.00 73.51  ? 329 SER A O   1 
ATOM   2130 C CB  . SER A 1 329 ? -26.886 25.514  22.102  1.00 68.64  ? 329 SER A CB  1 
ATOM   2131 O OG  . SER A 1 329 ? -26.237 24.915  23.213  1.00 68.51  ? 329 SER A OG  1 
ATOM   2132 N N   . GLY A 1 330 ? -27.804 24.462  18.988  1.00 74.43  ? 330 GLY A N   1 
ATOM   2133 C CA  . GLY A 1 330 ? -28.084 24.965  17.651  1.00 72.20  ? 330 GLY A CA  1 
ATOM   2134 C C   . GLY A 1 330 ? -27.311 26.240  17.373  1.00 72.42  ? 330 GLY A C   1 
ATOM   2135 O O   . GLY A 1 330 ? -27.748 27.084  16.591  1.00 69.13  ? 330 GLY A O   1 
ATOM   2136 N N   . GLN A 1 331 ? -26.163 26.383  18.029  1.00 76.45  ? 331 GLN A N   1 
ATOM   2137 C CA  . GLN A 1 331 ? -25.275 27.515  17.787  1.00 79.14  ? 331 GLN A CA  1 
ATOM   2138 C C   . GLN A 1 331 ? -24.363 27.220  16.601  1.00 75.51  ? 331 GLN A C   1 
ATOM   2139 O O   . GLN A 1 331 ? -24.220 26.068  16.189  1.00 75.59  ? 331 GLN A O   1 
ATOM   2140 C CB  . GLN A 1 331 ? -24.442 27.830  19.032  1.00 85.70  ? 331 GLN A CB  1 
ATOM   2141 C CG  . GLN A 1 331 ? -25.240 28.425  20.185  1.00 89.74  ? 331 GLN A CG  1 
ATOM   2142 C CD  . GLN A 1 331 ? -24.360 28.866  21.342  1.00 90.20  ? 331 GLN A CD  1 
ATOM   2143 O OE1 . GLN A 1 331 ? -23.158 28.598  21.363  1.00 89.99  ? 331 GLN A OE1 1 
ATOM   2144 N NE2 . GLN A 1 331 ? -24.958 29.549  22.312  1.00 92.12  ? 331 GLN A NE2 1 
ATOM   2145 N N   . SER A 1 332 ? -23.750 28.266  16.057  1.00 68.48  ? 332 SER A N   1 
ATOM   2146 C CA  . SER A 1 332 ? -22.893 28.125  14.885  1.00 72.41  ? 332 SER A CA  1 
ATOM   2147 C C   . SER A 1 332 ? -21.447 27.834  15.272  1.00 75.33  ? 332 SER A C   1 
ATOM   2148 O O   . SER A 1 332 ? -21.113 27.754  16.455  1.00 75.67  ? 332 SER A O   1 
ATOM   2149 C CB  . SER A 1 332 ? -22.957 29.389  14.024  1.00 73.80  ? 332 SER A CB  1 
ATOM   2150 O OG  . SER A 1 332 ? -24.276 29.631  13.569  1.00 78.14  ? 332 SER A OG  1 
ATOM   2151 N N   . ALA A 1 333 ? -20.594 27.672  14.263  1.00 74.15  ? 333 ALA A N   1 
ATOM   2152 C CA  . ALA A 1 333 ? -19.166 27.480  14.483  1.00 70.69  ? 333 ALA A CA  1 
ATOM   2153 C C   . ALA A 1 333 ? -18.581 28.708  15.170  1.00 70.89  ? 333 ALA A C   1 
ATOM   2154 O O   . ALA A 1 333 ? -19.031 29.831  14.941  1.00 67.99  ? 333 ALA A O   1 
ATOM   2155 C CB  . ALA A 1 333 ? -18.456 27.214  13.169  1.00 75.87  ? 333 ALA A CB  1 
ATOM   2156 N N   . ARG A 1 334 ? -17.572 28.488  16.004  1.00 68.62  ? 334 ARG A N   1 
ATOM   2157 C CA  . ARG A 1 334 ? -17.040 29.545  16.853  1.00 68.45  ? 334 ARG A CA  1 
ATOM   2158 C C   . ARG A 1 334 ? -15.512 29.532  16.885  1.00 67.73  ? 334 ARG A C   1 
ATOM   2159 O O   . ARG A 1 334 ? -14.903 28.665  17.515  1.00 71.22  ? 334 ARG A O   1 
ATOM   2160 C CB  . ARG A 1 334 ? -17.623 29.396  18.261  1.00 70.77  ? 334 ARG A CB  1 
ATOM   2161 C CG  . ARG A 1 334 ? -16.941 30.191  19.358  1.00 71.64  ? 334 ARG A CG  1 
ATOM   2162 C CD  . ARG A 1 334 ? -17.440 29.697  20.706  1.00 73.50  ? 334 ARG A CD  1 
ATOM   2163 N NE  . ARG A 1 334 ? -16.688 30.238  21.832  1.00 74.73  ? 334 ARG A NE  1 
ATOM   2164 C CZ  . ARG A 1 334 ? -16.677 29.694  23.045  1.00 74.01  ? 334 ARG A CZ  1 
ATOM   2165 N NH1 . ARG A 1 334 ? -15.967 30.249  24.018  1.00 72.67  ? 334 ARG A NH1 1 
ATOM   2166 N NH2 . ARG A 1 334 ? -17.372 28.589  23.285  1.00 72.96  ? 334 ARG A NH2 1 
ATOM   2167 N N   . LYS A 1 335 ? -14.899 30.491  16.193  1.00 59.13  ? 335 LYS A N   1 
ATOM   2168 C CA  . LYS A 1 335 ? -13.443 30.624  16.188  1.00 53.57  ? 335 LYS A CA  1 
ATOM   2169 C C   . LYS A 1 335 ? -12.941 31.008  17.572  1.00 48.35  ? 335 LYS A C   1 
ATOM   2170 O O   . LYS A 1 335 ? -13.590 31.768  18.290  1.00 53.54  ? 335 LYS A O   1 
ATOM   2171 C CB  . LYS A 1 335 ? -12.976 31.652  15.155  1.00 53.50  ? 335 LYS A CB  1 
ATOM   2172 C CG  . LYS A 1 335 ? -11.526 32.081  15.347  1.00 59.01  ? 335 LYS A CG  1 
ATOM   2173 C CD  . LYS A 1 335 ? -11.091 33.122  14.332  1.00 64.56  ? 335 LYS A CD  1 
ATOM   2174 C CE  . LYS A 1 335 ? -10.670 32.477  13.022  1.00 67.28  ? 335 LYS A CE  1 
ATOM   2175 N NZ  . LYS A 1 335 ? -10.118 33.477  12.066  1.00 68.75  ? 335 LYS A NZ  1 
ATOM   2176 N N   . MET A 1 336 ? -11.773 30.491  17.932  1.00 44.47  ? 336 MET A N   1 
ATOM   2177 C CA  . MET A 1 336 ? -11.327 30.536  19.308  1.00 44.72  ? 336 MET A CA  1 
ATOM   2178 C C   . MET A 1 336 ? -9.840  30.233  19.374  1.00 43.99  ? 336 MET A C   1 
ATOM   2179 O O   . MET A 1 336 ? -9.349  29.358  18.661  1.00 60.73  ? 336 MET A O   1 
ATOM   2180 C CB  . MET A 1 336 ? -12.104 29.485  20.096  1.00 48.40  ? 336 MET A CB  1 
ATOM   2181 C CG  . MET A 1 336 ? -12.082 29.636  21.593  1.00 48.14  ? 336 MET A CG  1 
ATOM   2182 S SD  . MET A 1 336 ? -13.310 28.530  22.306  1.00 47.36  ? 336 MET A SD  1 
ATOM   2183 C CE  . MET A 1 336 ? -12.862 28.604  24.036  1.00 53.84  ? 336 MET A CE  1 
ATOM   2184 N N   . ARG A 1 337 ? -9.120  30.957  20.225  1.00 44.59  ? 337 ARG A N   1 
ATOM   2185 C CA  . ARG A 1 337 ? -7.697  30.702  20.408  1.00 43.93  ? 337 ARG A CA  1 
ATOM   2186 C C   . ARG A 1 337 ? -7.512  29.384  21.147  1.00 46.21  ? 337 ARG A C   1 
ATOM   2187 O O   . ARG A 1 337 ? -8.186  29.124  22.144  1.00 51.63  ? 337 ARG A O   1 
ATOM   2188 C CB  . ARG A 1 337 ? -7.029  31.840  21.178  1.00 44.30  ? 337 ARG A CB  1 
ATOM   2189 C CG  . ARG A 1 337 ? -5.516  31.872  21.028  1.00 49.89  ? 337 ARG A CG  1 
ATOM   2190 C CD  . ARG A 1 337 ? -4.885  32.806  22.043  1.00 47.41  ? 337 ARG A CD  1 
ATOM   2191 N NE  . ARG A 1 337 ? -4.645  32.144  23.322  1.00 43.38  ? 337 ARG A NE  1 
ATOM   2192 C CZ  . ARG A 1 337 ? -3.436  31.910  23.823  1.00 44.26  ? 337 ARG A CZ  1 
ATOM   2193 N NH1 . ARG A 1 337 ? -2.354  32.292  23.157  1.00 42.62  ? 337 ARG A NH1 1 
ATOM   2194 N NH2 . ARG A 1 337 ? -3.307  31.300  24.993  1.00 44.66  ? 337 ARG A NH2 1 
ATOM   2195 N N   . LEU A 1 338 ? -6.598  28.554  20.651  1.00 44.05  ? 338 LEU A N   1 
ATOM   2196 C CA  . LEU A 1 338 ? -6.420  27.201  21.174  1.00 41.48  ? 338 LEU A CA  1 
ATOM   2197 C C   . LEU A 1 338 ? -6.101  27.184  22.666  1.00 41.92  ? 338 LEU A C   1 
ATOM   2198 O O   . LEU A 1 338 ? -6.665  26.390  23.419  1.00 40.48  ? 338 LEU A O   1 
ATOM   2199 C CB  . LEU A 1 338 ? -5.331  26.460  20.394  1.00 40.51  ? 338 LEU A CB  1 
ATOM   2200 C CG  . LEU A 1 338 ? -5.166  24.972  20.711  1.00 42.99  ? 338 LEU A CG  1 
ATOM   2201 C CD1 . LEU A 1 338 ? -6.403  24.192  20.297  1.00 40.66  ? 338 LEU A CD1 1 
ATOM   2202 C CD2 . LEU A 1 338 ? -3.929  24.413  20.029  1.00 43.20  ? 338 LEU A CD2 1 
ATOM   2203 N N   . GLY A 1 339 ? -5.192  28.058  23.085  1.00 42.45  ? 339 GLY A N   1 
ATOM   2204 C CA  . GLY A 1 339 ? -4.867  28.195  24.499  1.00 45.91  ? 339 GLY A CA  1 
ATOM   2205 C C   . GLY A 1 339 ? -6.127  28.428  25.309  1.00 49.75  ? 339 GLY A C   1 
ATOM   2206 O O   . GLY A 1 339 ? -6.375  27.742  26.301  1.00 49.10  ? 339 GLY A O   1 
ATOM   2207 N N   . ASP A 1 340 ? -6.929  29.394  24.867  1.00 47.98  ? 340 ASP A N   1 
ATOM   2208 C CA  . ASP A 1 340 ? -8.187  29.729  25.528  1.00 52.21  ? 340 ASP A CA  1 
ATOM   2209 C C   . ASP A 1 340 ? -9.139  28.542  25.548  1.00 55.40  ? 340 ASP A C   1 
ATOM   2210 O O   . ASP A 1 340 ? -9.847  28.318  26.529  1.00 55.36  ? 340 ASP A O   1 
ATOM   2211 C CB  . ASP A 1 340 ? -8.859  30.919  24.838  1.00 55.51  ? 340 ASP A CB  1 
ATOM   2212 C CG  . ASP A 1 340 ? -8.012  32.175  24.882  1.00 58.44  ? 340 ASP A CG  1 
ATOM   2213 O OD1 . ASP A 1 340 ? -6.982  32.180  25.589  1.00 60.54  ? 340 ASP A OD1 1 
ATOM   2214 O OD2 . ASP A 1 340 ? -8.378  33.159  24.207  1.00 60.35  ? 340 ASP A OD2 1 
ATOM   2215 N N   . ALA A 1 341 ? -9.151  27.786  24.455  1.00 58.36  ? 341 ALA A N   1 
ATOM   2216 C CA  . ALA A 1 341 ? -9.989  26.599  24.350  1.00 52.76  ? 341 ALA A CA  1 
ATOM   2217 C C   . ALA A 1 341 ? -9.725  25.632  25.499  1.00 53.55  ? 341 ALA A C   1 
ATOM   2218 O O   . ALA A 1 341 ? -10.658 25.121  26.119  1.00 54.10  ? 341 ALA A O   1 
ATOM   2219 C CB  . ALA A 1 341 ? -9.764  25.914  23.015  1.00 56.73  ? 341 ALA A CB  1 
ATOM   2220 N N   . VAL A 1 342 ? -8.449  25.386  25.779  1.00 54.57  ? 342 VAL A N   1 
ATOM   2221 C CA  . VAL A 1 342 ? -8.065  24.494  26.867  1.00 58.01  ? 342 VAL A CA  1 
ATOM   2222 C C   . VAL A 1 342 ? -8.284  25.175  28.216  1.00 59.03  ? 342 VAL A C   1 
ATOM   2223 O O   . VAL A 1 342 ? -8.616  24.517  29.204  1.00 62.55  ? 342 VAL A O   1 
ATOM   2224 C CB  . VAL A 1 342 ? -6.602  24.029  26.733  1.00 55.84  ? 342 VAL A CB  1 
ATOM   2225 C CG1 . VAL A 1 342 ? -6.287  22.951  27.762  1.00 52.37  ? 342 VAL A CG1 1 
ATOM   2226 C CG2 . VAL A 1 342 ? -6.344  23.509  25.329  1.00 54.56  ? 342 VAL A CG2 1 
ATOM   2227 N N   . GLU A 1 343 ? -8.100  26.493  28.250  1.00 60.32  ? 343 GLU A N   1 
ATOM   2228 C CA  . GLU A 1 343 ? -8.422  27.281  29.436  1.00 67.98  ? 343 GLU A CA  1 
ATOM   2229 C C   . GLU A 1 343 ? -9.858  27.009  29.842  1.00 64.30  ? 343 GLU A C   1 
ATOM   2230 O O   . GLU A 1 343 ? -10.136 26.574  30.958  1.00 60.92  ? 343 GLU A O   1 
ATOM   2231 C CB  . GLU A 1 343 ? -8.308  28.777  29.150  1.00 77.58  ? 343 GLU A CB  1 
ATOM   2232 C CG  . GLU A 1 343 ? -6.918  29.312  28.897  1.00 86.86  ? 343 GLU A CG  1 
ATOM   2233 C CD  . GLU A 1 343 ? -6.950  30.768  28.465  1.00 89.34  ? 343 GLU A CD  1 
ATOM   2234 O OE1 . GLU A 1 343 ? -8.053  31.360  28.441  1.00 92.65  ? 343 GLU A OE1 1 
ATOM   2235 O OE2 . GLU A 1 343 ? -5.876  31.322  28.150  1.00 91.01  ? 343 GLU A OE2 1 
ATOM   2236 N N   . GLN A 1 344 ? -10.766 27.279  28.909  1.00 63.40  ? 344 GLN A N   1 
ATOM   2237 C CA  . GLN A 1 344 ? -12.197 27.288  29.181  1.00 57.77  ? 344 GLN A CA  1 
ATOM   2238 C C   . GLN A 1 344 ? -12.803 25.892  29.265  1.00 60.34  ? 344 GLN A C   1 
ATOM   2239 O O   . GLN A 1 344 ? -13.963 25.734  29.648  1.00 66.27  ? 344 GLN A O   1 
ATOM   2240 C CB  . GLN A 1 344 ? -12.924 28.121  28.125  1.00 55.71  ? 344 GLN A CB  1 
ATOM   2241 C CG  . GLN A 1 344 ? -12.377 29.534  27.986  1.00 59.74  ? 344 GLN A CG  1 
ATOM   2242 C CD  . GLN A 1 344 ? -13.156 30.368  26.992  1.00 60.85  ? 344 GLN A CD  1 
ATOM   2243 O OE1 . GLN A 1 344 ? -14.253 29.996  26.576  1.00 62.35  ? 344 GLN A OE1 1 
ATOM   2244 N NE2 . GLN A 1 344 ? -12.594 31.509  26.608  1.00 60.73  ? 344 GLN A NE2 1 
ATOM   2245 N N   . GLY A 1 345 ? -12.018 24.883  28.905  1.00 58.94  ? 345 GLY A N   1 
ATOM   2246 C CA  . GLY A 1 345 ? -12.439 23.498  29.062  1.00 49.00  ? 345 GLY A CA  1 
ATOM   2247 C C   . GLY A 1 345 ? -13.203 22.921  27.886  1.00 46.01  ? 345 GLY A C   1 
ATOM   2248 O O   . GLY A 1 345 ? -13.716 21.804  27.968  1.00 39.13  ? 345 GLY A O   1 
ATOM   2249 N N   . VAL A 1 346 ? -13.285 23.671  26.791  1.00 43.24  ? 346 VAL A N   1 
ATOM   2250 C CA  . VAL A 1 346 ? -13.922 23.155  25.582  1.00 49.08  ? 346 VAL A CA  1 
ATOM   2251 C C   . VAL A 1 346 ? -13.059 22.037  24.993  1.00 52.29  ? 346 VAL A C   1 
ATOM   2252 O O   . VAL A 1 346 ? -13.555 21.159  24.289  1.00 51.51  ? 346 VAL A O   1 
ATOM   2253 C CB  . VAL A 1 346 ? -14.188 24.264  24.537  1.00 47.49  ? 346 VAL A CB  1 
ATOM   2254 C CG1 . VAL A 1 346 ? -12.921 24.614  23.788  1.00 53.77  ? 346 VAL A CG1 1 
ATOM   2255 C CG2 . VAL A 1 346 ? -15.269 23.826  23.564  1.00 51.09  ? 346 VAL A CG2 1 
ATOM   2256 N N   . ILE A 1 347 ? -11.765 22.079  25.299  1.00 52.41  ? 347 ILE A N   1 
ATOM   2257 C CA  . ILE A 1 347 ? -10.850 20.994  24.967  1.00 51.56  ? 347 ILE A CA  1 
ATOM   2258 C C   . ILE A 1 347 ? -10.264 20.419  26.255  1.00 51.55  ? 347 ILE A C   1 
ATOM   2259 O O   . ILE A 1 347 ? -9.632  21.133  27.034  1.00 53.41  ? 347 ILE A O   1 
ATOM   2260 C CB  . ILE A 1 347 ? -9.723  21.460  24.027  1.00 54.90  ? 347 ILE A CB  1 
ATOM   2261 C CG1 . ILE A 1 347 ? -10.308 21.906  22.685  1.00 55.01  ? 347 ILE A CG1 1 
ATOM   2262 C CG2 . ILE A 1 347 ? -8.703  20.346  23.819  1.00 53.95  ? 347 ILE A CG2 1 
ATOM   2263 C CD1 . ILE A 1 347 ? -9.273  22.357  21.682  1.00 57.67  ? 347 ILE A CD1 1 
ATOM   2264 N N   . ASN A 1 348 ? -10.486 19.126  26.468  1.00 52.53  ? 348 ASN A N   1 
ATOM   2265 C CA  . ASN A 1 348 ? -10.151 18.465  27.729  1.00 58.21  ? 348 ASN A CA  1 
ATOM   2266 C C   . ASN A 1 348 ? -8.705  18.643  28.198  1.00 58.83  ? 348 ASN A C   1 
ATOM   2267 O O   . ASN A 1 348 ? -8.465  19.027  29.343  1.00 59.82  ? 348 ASN A O   1 
ATOM   2268 C CB  . ASN A 1 348 ? -10.495 16.974  27.650  1.00 66.41  ? 348 ASN A CB  1 
ATOM   2269 C CG  . ASN A 1 348 ? -10.295 16.257  28.972  1.00 70.93  ? 348 ASN A CG  1 
ATOM   2270 O OD1 . ASN A 1 348 ? -9.784  15.138  29.012  1.00 74.43  ? 348 ASN A OD1 1 
ATOM   2271 N ND2 . ASN A 1 348 ? -10.697 16.901  30.063  1.00 71.11  ? 348 ASN A ND2 1 
ATOM   2272 N N   . ASN A 1 349 ? -7.749  18.362  27.319  1.00 59.30  ? 349 ASN A N   1 
ATOM   2273 C CA  . ASN A 1 349 ? -6.337  18.413  27.694  1.00 52.21  ? 349 ASN A CA  1 
ATOM   2274 C C   . ASN A 1 349 ? -5.436  18.980  26.600  1.00 48.56  ? 349 ASN A C   1 
ATOM   2275 O O   . ASN A 1 349 ? -5.855  19.129  25.452  1.00 47.63  ? 349 ASN A O   1 
ATOM   2276 C CB  . ASN A 1 349 ? -5.851  17.025  28.116  1.00 51.78  ? 349 ASN A CB  1 
ATOM   2277 C CG  . ASN A 1 349 ? -6.031  15.990  27.026  1.00 53.20  ? 349 ASN A CG  1 
ATOM   2278 O OD1 . ASN A 1 349 ? -5.239  15.916  26.088  1.00 58.90  ? 349 ASN A OD1 1 
ATOM   2279 N ND2 . ASN A 1 349 ? -7.073  15.177  27.148  1.00 52.35  ? 349 ASN A ND2 1 
ATOM   2280 N N   . THR A 1 350 ? -4.196  19.289  26.967  1.00 46.32  ? 350 THR A N   1 
ATOM   2281 C CA  . THR A 1 350 ? -3.245  19.897  26.040  1.00 50.89  ? 350 THR A CA  1 
ATOM   2282 C C   . THR A 1 350 ? -2.700  18.890  25.032  1.00 51.53  ? 350 THR A C   1 
ATOM   2283 O O   . THR A 1 350 ? -2.336  19.259  23.916  1.00 51.15  ? 350 THR A O   1 
ATOM   2284 C CB  . THR A 1 350 ? -2.063  20.551  26.782  1.00 50.07  ? 350 THR A CB  1 
ATOM   2285 O OG1 . THR A 1 350 ? -1.312  19.545  27.472  1.00 49.28  ? 350 THR A OG1 1 
ATOM   2286 C CG2 . THR A 1 350 ? -2.564  21.584  27.780  1.00 51.19  ? 350 THR A CG2 1 
ATOM   2287 N N   . VAL A 1 351 ? -2.639  17.623  25.431  1.00 43.14  ? 351 VAL A N   1 
ATOM   2288 C CA  . VAL A 1 351 ? -2.180  16.567  24.536  1.00 43.99  ? 351 VAL A CA  1 
ATOM   2289 C C   . VAL A 1 351 ? -3.125  16.454  23.345  1.00 42.15  ? 351 VAL A C   1 
ATOM   2290 O O   . VAL A 1 351 ? -2.687  16.393  22.195  1.00 45.50  ? 351 VAL A O   1 
ATOM   2291 C CB  . VAL A 1 351 ? -2.080  15.208  25.254  1.00 46.05  ? 351 VAL A CB  1 
ATOM   2292 C CG1 . VAL A 1 351 ? -1.610  14.129  24.290  1.00 43.48  ? 351 VAL A CG1 1 
ATOM   2293 C CG2 . VAL A 1 351 ? -1.139  15.306  26.444  1.00 48.11  ? 351 VAL A CG2 1 
ATOM   2294 N N   . LEU A 1 352 ? -4.423  16.438  23.630  1.00 36.60  ? 352 LEU A N   1 
ATOM   2295 C CA  . LEU A 1 352 ? -5.440  16.447  22.589  1.00 38.00  ? 352 LEU A CA  1 
ATOM   2296 C C   . LEU A 1 352 ? -5.324  17.744  21.792  1.00 39.61  ? 352 LEU A C   1 
ATOM   2297 O O   . LEU A 1 352 ? -5.306  17.731  20.562  1.00 40.95  ? 352 LEU A O   1 
ATOM   2298 C CB  . LEU A 1 352 ? -6.835  16.342  23.210  1.00 36.25  ? 352 LEU A CB  1 
ATOM   2299 C CG  . LEU A 1 352 ? -7.946  15.614  22.446  1.00 39.27  ? 352 LEU A CG  1 
ATOM   2300 C CD1 . LEU A 1 352 ? -9.285  15.837  23.136  1.00 39.84  ? 352 LEU A CD1 1 
ATOM   2301 C CD2 . LEU A 1 352 ? -8.022  16.045  20.991  1.00 36.25  ? 352 LEU A CD2 1 
ATOM   2302 N N   . GLY A 1 353 ? -5.234  18.861  22.509  1.00 36.28  ? 353 GLY A N   1 
ATOM   2303 C CA  . GLY A 1 353 ? -5.135  20.175  21.887  1.00 38.24  ? 353 GLY A CA  1 
ATOM   2304 C C   . GLY A 1 353 ? -3.930  20.320  20.979  1.00 35.77  ? 353 GLY A C   1 
ATOM   2305 O O   . GLY A 1 353 ? -4.016  20.937  19.917  1.00 36.33  ? 353 GLY A O   1 
ATOM   2306 N N   . TYR A 1 354 ? -2.804  19.747  21.395  1.00 33.62  ? 354 TYR A N   1 
ATOM   2307 C CA  . TYR A 1 354 ? -1.575  19.821  20.613  1.00 33.40  ? 354 TYR A CA  1 
ATOM   2308 C C   . TYR A 1 354 ? -1.770  19.267  19.206  1.00 32.64  ? 354 TYR A C   1 
ATOM   2309 O O   . TYR A 1 354 ? -1.508  19.955  18.219  1.00 31.24  ? 354 TYR A O   1 
ATOM   2310 C CB  . TYR A 1 354 ? -0.431  19.085  21.316  1.00 35.28  ? 354 TYR A CB  1 
ATOM   2311 C CG  . TYR A 1 354 ? 0.865   19.094  20.535  1.00 35.25  ? 354 TYR A CG  1 
ATOM   2312 C CD1 . TYR A 1 354 ? 1.601   20.263  20.389  1.00 35.27  ? 354 TYR A CD1 1 
ATOM   2313 C CD2 . TYR A 1 354 ? 1.350   17.935  19.940  1.00 34.49  ? 354 TYR A CD2 1 
ATOM   2314 C CE1 . TYR A 1 354 ? 2.784   20.279  19.672  1.00 35.46  ? 354 TYR A CE1 1 
ATOM   2315 C CE2 . TYR A 1 354 ? 2.534   17.941  19.222  1.00 31.31  ? 354 TYR A CE2 1 
ATOM   2316 C CZ  . TYR A 1 354 ? 3.246   19.115  19.092  1.00 34.29  ? 354 TYR A CZ  1 
ATOM   2317 O OH  . TYR A 1 354 ? 4.423   19.129  18.380  1.00 34.64  ? 354 TYR A OH  1 
ATOM   2318 N N   . PHE A 1 355 ? -2.232  18.023  19.120  1.00 33.82  ? 355 PHE A N   1 
ATOM   2319 C CA  . PHE A 1 355 ? -2.437  17.377  17.829  1.00 36.75  ? 355 PHE A CA  1 
ATOM   2320 C C   . PHE A 1 355 ? -3.459  18.120  16.978  1.00 38.60  ? 355 PHE A C   1 
ATOM   2321 O O   . PHE A 1 355 ? -3.286  18.244  15.767  1.00 40.48  ? 355 PHE A O   1 
ATOM   2322 C CB  . PHE A 1 355 ? -2.831  15.910  18.007  1.00 44.48  ? 355 PHE A CB  1 
ATOM   2323 C CG  . PHE A 1 355 ? -1.696  15.036  18.454  1.00 46.86  ? 355 PHE A CG  1 
ATOM   2324 C CD1 . PHE A 1 355 ? -0.724  14.628  17.554  1.00 46.71  ? 355 PHE A CD1 1 
ATOM   2325 C CD2 . PHE A 1 355 ? -1.593  14.629  19.774  1.00 48.28  ? 355 PHE A CD2 1 
ATOM   2326 C CE1 . PHE A 1 355 ? 0.327   13.829  17.962  1.00 46.83  ? 355 PHE A CE1 1 
ATOM   2327 C CE2 . PHE A 1 355 ? -0.544  13.829  20.188  1.00 48.02  ? 355 PHE A CE2 1 
ATOM   2328 C CZ  . PHE A 1 355 ? 0.416   13.429  19.280  1.00 49.17  ? 355 PHE A CZ  1 
ATOM   2329 N N   . ILE A 1 356 ? -4.514  18.620  17.615  1.00 36.74  ? 356 ILE A N   1 
ATOM   2330 C CA  . ILE A 1 356 ? -5.506  19.435  16.922  1.00 33.95  ? 356 ILE A CA  1 
ATOM   2331 C C   . ILE A 1 356 ? -4.829  20.609  16.218  1.00 34.93  ? 356 ILE A C   1 
ATOM   2332 O O   . ILE A 1 356 ? -5.073  20.862  15.038  1.00 35.15  ? 356 ILE A O   1 
ATOM   2333 C CB  . ILE A 1 356 ? -6.588  19.964  17.887  1.00 34.74  ? 356 ILE A CB  1 
ATOM   2334 C CG1 . ILE A 1 356 ? -7.397  18.803  18.466  1.00 34.11  ? 356 ILE A CG1 1 
ATOM   2335 C CG2 . ILE A 1 356 ? -7.511  20.946  17.178  1.00 32.69  ? 356 ILE A CG2 1 
ATOM   2336 C CD1 . ILE A 1 356 ? -8.554  19.238  19.341  1.00 37.94  ? 356 ILE A CD1 1 
ATOM   2337 N N   . GLY A 1 357 ? -3.970  21.314  16.946  1.00 29.81  ? 357 GLY A N   1 
ATOM   2338 C CA  . GLY A 1 357 ? -3.232  22.436  16.380  1.00 38.50  ? 357 GLY A CA  1 
ATOM   2339 C C   . GLY A 1 357 ? -2.254  21.988  15.313  1.00 37.99  ? 357 GLY A C   1 
ATOM   2340 O O   . GLY A 1 357 ? -2.104  22.643  14.281  1.00 40.86  ? 357 GLY A O   1 
ATOM   2341 N N   . ARG A 1 358 ? -1.587  20.866  15.567  1.00 40.52  ? 358 ARG A N   1 
ATOM   2342 C CA  . ARG A 1 358 ? -0.673  20.273  14.597  1.00 40.81  ? 358 ARG A CA  1 
ATOM   2343 C C   . ARG A 1 358 ? -1.416  19.869  13.327  1.00 37.23  ? 358 ARG A C   1 
ATOM   2344 O O   . ARG A 1 358 ? -0.930  20.093  12.217  1.00 36.79  ? 358 ARG A O   1 
ATOM   2345 C CB  . ARG A 1 358 ? 0.031   19.059  15.202  1.00 32.43  ? 358 ARG A CB  1 
ATOM   2346 C CG  . ARG A 1 358 ? 1.198   19.399  16.115  1.00 30.21  ? 358 ARG A CG  1 
ATOM   2347 C CD  . ARG A 1 358 ? 2.517   19.401  15.356  1.00 35.21  ? 358 ARG A CD  1 
ATOM   2348 N NE  . ARG A 1 358 ? 2.802   20.675  14.701  1.00 34.25  ? 358 ARG A NE  1 
ATOM   2349 C CZ  . ARG A 1 358 ? 3.833   20.880  13.886  1.00 30.34  ? 358 ARG A CZ  1 
ATOM   2350 N NH1 . ARG A 1 358 ? 4.674   19.892  13.611  1.00 26.84  ? 358 ARG A NH1 1 
ATOM   2351 N NH2 . ARG A 1 358 ? 4.020   22.072  13.338  1.00 31.02  ? 358 ARG A NH2 1 
ATOM   2352 N N   . ILE A 1 359 ? -2.594  19.275  13.498  1.00 29.14  ? 359 ILE A N   1 
ATOM   2353 C CA  . ILE A 1 359 ? -3.436  18.900  12.367  1.00 30.92  ? 359 ILE A CA  1 
ATOM   2354 C C   . ILE A 1 359 ? -3.833  20.134  11.566  1.00 32.86  ? 359 ILE A C   1 
ATOM   2355 O O   . ILE A 1 359 ? -3.689  20.164  10.343  1.00 32.02  ? 359 ILE A O   1 
ATOM   2356 C CB  . ILE A 1 359 ? -4.713  18.166  12.821  1.00 24.59  ? 359 ILE A CB  1 
ATOM   2357 C CG1 . ILE A 1 359 ? -4.364  16.816  13.449  1.00 23.81  ? 359 ILE A CG1 1 
ATOM   2358 C CG2 . ILE A 1 359 ? -5.662  17.970  11.649  1.00 29.74  ? 359 ILE A CG2 1 
ATOM   2359 C CD1 . ILE A 1 359 ? -5.547  16.112  14.088  1.00 16.62  ? 359 ILE A CD1 1 
ATOM   2360 N N   . TYR A 1 360 ? -4.331  21.150  12.264  1.00 31.89  ? 360 TYR A N   1 
ATOM   2361 C CA  . TYR A 1 360 ? -4.723  22.396  11.621  1.00 29.16  ? 360 TYR A CA  1 
ATOM   2362 C C   . TYR A 1 360 ? -3.575  22.955  10.789  1.00 30.69  ? 360 TYR A C   1 
ATOM   2363 O O   . TYR A 1 360 ? -3.770  23.375  9.648   1.00 22.79  ? 360 TYR A O   1 
ATOM   2364 C CB  . TYR A 1 360 ? -5.167  23.427  12.661  1.00 28.00  ? 360 TYR A CB  1 
ATOM   2365 C CG  . TYR A 1 360 ? -5.352  24.810  12.084  1.00 28.70  ? 360 TYR A CG  1 
ATOM   2366 C CD1 . TYR A 1 360 ? -6.550  25.179  11.488  1.00 22.82  ? 360 TYR A CD1 1 
ATOM   2367 C CD2 . TYR A 1 360 ? -4.323  25.744  12.123  1.00 28.30  ? 360 TYR A CD2 1 
ATOM   2368 C CE1 . TYR A 1 360 ? -6.722  26.441  10.952  1.00 21.53  ? 360 TYR A CE1 1 
ATOM   2369 C CE2 . TYR A 1 360 ? -4.485  27.007  11.590  1.00 26.96  ? 360 TYR A CE2 1 
ATOM   2370 C CZ  . TYR A 1 360 ? -5.686  27.350  11.006  1.00 29.01  ? 360 TYR A CZ  1 
ATOM   2371 O OH  . TYR A 1 360 ? -5.853  28.608  10.475  1.00 36.10  ? 360 TYR A OH  1 
ATOM   2372 N N   . LEU A 1 361 ? -2.380  22.958  11.371  1.00 29.09  ? 361 LEU A N   1 
ATOM   2373 C CA  . LEU A 1 361 ? -1.188  23.417  10.672  1.00 29.69  ? 361 LEU A CA  1 
ATOM   2374 C C   . LEU A 1 361 ? -0.919  22.569  9.439   1.00 33.25  ? 361 LEU A C   1 
ATOM   2375 O O   . LEU A 1 361 ? -0.627  23.101  8.368   1.00 33.96  ? 361 LEU A O   1 
ATOM   2376 C CB  . LEU A 1 361 ? 0.030   23.395  11.598  1.00 28.80  ? 361 LEU A CB  1 
ATOM   2377 C CG  . LEU A 1 361 ? 0.108   24.490  12.662  1.00 25.18  ? 361 LEU A CG  1 
ATOM   2378 C CD1 . LEU A 1 361 ? 1.319   24.278  13.555  1.00 24.96  ? 361 LEU A CD1 1 
ATOM   2379 C CD2 . LEU A 1 361 ? 0.146   25.870  12.019  1.00 23.68  ? 361 LEU A CD2 1 
ATOM   2380 N N   . TYR A 1 362 ? -1.017  21.251  9.588   1.00 30.54  ? 362 TYR A N   1 
ATOM   2381 C CA  . TYR A 1 362 ? -0.796  20.368  8.455   1.00 27.66  ? 362 TYR A CA  1 
ATOM   2382 C C   . TYR A 1 362 ? -1.745  20.716  7.316   1.00 33.23  ? 362 TYR A C   1 
ATOM   2383 O O   . TYR A 1 362 ? -1.310  20.985  6.197   1.00 33.52  ? 362 TYR A O   1 
ATOM   2384 C CB  . TYR A 1 362 ? -0.972  18.898  8.835   1.00 29.53  ? 362 TYR A CB  1 
ATOM   2385 C CG  . TYR A 1 362 ? -0.836  17.987  7.638   1.00 31.41  ? 362 TYR A CG  1 
ATOM   2386 C CD1 . TYR A 1 362 ? 0.385   17.851  6.988   1.00 33.69  ? 362 TYR A CD1 1 
ATOM   2387 C CD2 . TYR A 1 362 ? -1.926  17.283  7.141   1.00 30.03  ? 362 TYR A CD2 1 
ATOM   2388 C CE1 . TYR A 1 362 ? 0.520   17.033  5.884   1.00 32.50  ? 362 TYR A CE1 1 
ATOM   2389 C CE2 . TYR A 1 362 ? -1.799  16.459  6.036   1.00 29.53  ? 362 TYR A CE2 1 
ATOM   2390 C CZ  . TYR A 1 362 ? -0.574  16.338  5.414   1.00 31.13  ? 362 TYR A CZ  1 
ATOM   2391 O OH  . TYR A 1 362 ? -0.441  15.521  4.316   1.00 34.58  ? 362 TYR A OH  1 
ATOM   2392 N N   . LEU A 1 363 ? -3.040  20.717  7.614   1.00 31.42  ? 363 LEU A N   1 
ATOM   2393 C CA  . LEU A 1 363 ? -4.069  20.898  6.593   1.00 32.21  ? 363 LEU A CA  1 
ATOM   2394 C C   . LEU A 1 363 ? -3.959  22.234  5.863   1.00 32.34  ? 363 LEU A C   1 
ATOM   2395 O O   . LEU A 1 363 ? -4.129  22.298  4.646   1.00 31.64  ? 363 LEU A O   1 
ATOM   2396 C CB  . LEU A 1 363 ? -5.464  20.736  7.202   1.00 28.59  ? 363 LEU A CB  1 
ATOM   2397 C CG  . LEU A 1 363 ? -5.782  19.378  7.835   1.00 26.36  ? 363 LEU A CG  1 
ATOM   2398 C CD1 . LEU A 1 363 ? -7.149  19.408  8.496   1.00 24.04  ? 363 LEU A CD1 1 
ATOM   2399 C CD2 . LEU A 1 363 ? -5.708  18.259  6.806   1.00 23.98  ? 363 LEU A CD2 1 
ATOM   2400 N N   . THR A 1 364 ? -3.674  23.297  6.607   1.00 35.39  ? 364 THR A N   1 
ATOM   2401 C CA  . THR A 1 364 ? -3.542  24.624  6.014   1.00 35.17  ? 364 THR A CA  1 
ATOM   2402 C C   . THR A 1 364 ? -2.303  24.713  5.129   1.00 36.57  ? 364 THR A C   1 
ATOM   2403 O O   . THR A 1 364 ? -2.289  25.441  4.137   1.00 41.60  ? 364 THR A O   1 
ATOM   2404 C CB  . THR A 1 364 ? -3.493  25.728  7.088   1.00 31.81  ? 364 THR A CB  1 
ATOM   2405 O OG1 . THR A 1 364 ? -2.552  25.366  8.107   1.00 29.63  ? 364 THR A OG1 1 
ATOM   2406 C CG2 . THR A 1 364 ? -4.865  25.916  7.718   1.00 27.60  ? 364 THR A CG2 1 
ATOM   2407 N N   . LYS A 1 365 ? -1.268  23.963  5.497   1.00 37.33  ? 365 LYS A N   1 
ATOM   2408 C CA  . LYS A 1 365 ? -0.030  23.912  4.727   1.00 35.77  ? 365 LYS A CA  1 
ATOM   2409 C C   . LYS A 1 365 ? -0.248  23.202  3.394   1.00 36.49  ? 365 LYS A C   1 
ATOM   2410 O O   . LYS A 1 365 ? 0.359   23.555  2.382   1.00 39.33  ? 365 LYS A O   1 
ATOM   2411 C CB  . LYS A 1 365 ? 1.057   23.193  5.528   1.00 30.35  ? 365 LYS A CB  1 
ATOM   2412 C CG  . LYS A 1 365 ? 2.400   23.101  4.827   1.00 36.72  ? 365 LYS A CG  1 
ATOM   2413 C CD  . LYS A 1 365 ? 3.359   22.192  5.580   1.00 37.43  ? 365 LYS A CD  1 
ATOM   2414 C CE  . LYS A 1 365 ? 3.655   22.721  6.973   1.00 37.72  ? 365 LYS A CE  1 
ATOM   2415 N NZ  . LYS A 1 365 ? 4.617   21.849  7.698   1.00 39.00  ? 365 LYS A NZ  1 
ATOM   2416 N N   . VAL A 1 366 ? -1.125  22.204  3.403   1.00 37.93  ? 366 VAL A N   1 
ATOM   2417 C CA  . VAL A 1 366 ? -1.407  21.403  2.217   1.00 39.58  ? 366 VAL A CA  1 
ATOM   2418 C C   . VAL A 1 366 ? -2.255  22.161  1.192   1.00 41.18  ? 366 VAL A C   1 
ATOM   2419 O O   . VAL A 1 366 ? -2.236  21.841  0.003   1.00 45.93  ? 366 VAL A O   1 
ATOM   2420 C CB  . VAL A 1 366 ? -2.095  20.079  2.595   1.00 45.34  ? 366 VAL A CB  1 
ATOM   2421 C CG1 . VAL A 1 366 ? -2.475  19.301  1.355   1.00 47.05  ? 366 VAL A CG1 1 
ATOM   2422 C CG2 . VAL A 1 366 ? -1.182  19.248  3.480   1.00 48.65  ? 366 VAL A CG2 1 
ATOM   2423 N N   . GLY A 1 367 ? -2.999  23.161  1.655   1.00 36.35  ? 367 GLY A N   1 
ATOM   2424 C CA  . GLY A 1 367 ? -3.771  24.009  0.750   1.00 34.88  ? 367 GLY A CA  1 
ATOM   2425 C C   . GLY A 1 367 ? -5.230  24.191  1.122   1.00 38.04  ? 367 GLY A C   1 
ATOM   2426 O O   . GLY A 1 367 ? -5.990  24.814  0.380   1.00 39.33  ? 367 GLY A O   1 
ATOM   2427 N N   . ILE A 1 368 ? -5.626  23.649  2.269   1.00 33.34  ? 368 ILE A N   1 
ATOM   2428 C CA  . ILE A 1 368 ? -7.000  23.784  2.741   1.00 36.55  ? 368 ILE A CA  1 
ATOM   2429 C C   . ILE A 1 368 ? -7.227  25.154  3.378   1.00 38.98  ? 368 ILE A C   1 
ATOM   2430 O O   . ILE A 1 368 ? -6.461  25.580  4.244   1.00 46.45  ? 368 ILE A O   1 
ATOM   2431 C CB  . ILE A 1 368 ? -7.364  22.668  3.741   1.00 40.03  ? 368 ILE A CB  1 
ATOM   2432 C CG1 . ILE A 1 368 ? -7.165  21.296  3.093   1.00 39.97  ? 368 ILE A CG1 1 
ATOM   2433 C CG2 . ILE A 1 368 ? -8.798  22.831  4.229   1.00 40.53  ? 368 ILE A CG2 1 
ATOM   2434 C CD1 . ILE A 1 368 ? -7.462  20.132  4.011   1.00 37.87  ? 368 ILE A CD1 1 
ATOM   2435 N N   . SER A 1 369 ? -8.279  25.841  2.940   1.00 42.82  ? 369 SER A N   1 
ATOM   2436 C CA  . SER A 1 369 ? -8.588  27.184  3.431   1.00 47.82  ? 369 SER A CA  1 
ATOM   2437 C C   . SER A 1 369 ? -9.143  27.165  4.854   1.00 41.33  ? 369 SER A C   1 
ATOM   2438 O O   . SER A 1 369 ? -10.086 26.431  5.148   1.00 44.96  ? 369 SER A O   1 
ATOM   2439 C CB  . SER A 1 369 ? -9.568  27.889  2.488   1.00 53.22  ? 369 SER A CB  1 
ATOM   2440 O OG  . SER A 1 369 ? -8.984  28.105  1.215   1.00 58.75  ? 369 SER A OG  1 
ATOM   2441 N N   . PRO A 1 370 ? -8.554  27.985  5.741   1.00 41.75  ? 370 PRO A N   1 
ATOM   2442 C CA  . PRO A 1 370 ? -8.877  28.037  7.168   1.00 45.88  ? 370 PRO A CA  1 
ATOM   2443 C C   . PRO A 1 370 ? -10.302 28.502  7.459   1.00 38.77  ? 370 PRO A C   1 
ATOM   2444 O O   . PRO A 1 370 ? -10.858 28.162  8.503   1.00 36.44  ? 370 PRO A O   1 
ATOM   2445 C CB  . PRO A 1 370 ? -7.872  29.058  7.722   1.00 41.30  ? 370 PRO A CB  1 
ATOM   2446 C CG  . PRO A 1 370 ? -6.797  29.153  6.690   1.00 36.44  ? 370 PRO A CG  1 
ATOM   2447 C CD  . PRO A 1 370 ? -7.491  28.940  5.388   1.00 40.72  ? 370 PRO A CD  1 
ATOM   2448 N N   . ASP A 1 371 ? -10.881 29.274  6.546   1.00 44.22  ? 371 ASP A N   1 
ATOM   2449 C CA  . ASP A 1 371 ? -12.244 29.764  6.718   1.00 53.74  ? 371 ASP A CA  1 
ATOM   2450 C C   . ASP A 1 371 ? -13.262 28.749  6.209   1.00 56.43  ? 371 ASP A C   1 
ATOM   2451 O O   . ASP A 1 371 ? -14.470 28.984  6.254   1.00 63.02  ? 371 ASP A O   1 
ATOM   2452 C CB  . ASP A 1 371 ? -12.424 31.116  6.025   1.00 70.65  ? 371 ASP A CB  1 
ATOM   2453 C CG  . ASP A 1 371 ? -11.588 32.212  6.663   1.00 81.34  ? 371 ASP A CG  1 
ATOM   2454 O OD1 . ASP A 1 371 ? -11.103 32.013  7.797   1.00 84.98  ? 371 ASP A OD1 1 
ATOM   2455 O OD2 . ASP A 1 371 ? -11.418 33.276  6.031   1.00 85.12  ? 371 ASP A OD2 1 
ATOM   2456 N N   . LYS A 1 372 ? -12.757 27.619  5.723   1.00 54.86  ? 372 LYS A N   1 
ATOM   2457 C CA  . LYS A 1 372 ? -13.594 26.490  5.342   1.00 46.83  ? 372 LYS A CA  1 
ATOM   2458 C C   . LYS A 1 372 ? -13.146 25.255  6.115   1.00 46.87  ? 372 LYS A C   1 
ATOM   2459 O O   . LYS A 1 372 ? -13.440 24.123  5.731   1.00 38.62  ? 372 LYS A O   1 
ATOM   2460 C CB  . LYS A 1 372 ? -13.504 26.233  3.838   1.00 48.87  ? 372 LYS A CB  1 
ATOM   2461 C CG  . LYS A 1 372 ? -14.000 27.379  2.976   1.00 50.09  ? 372 LYS A CG  1 
ATOM   2462 C CD  . LYS A 1 372 ? -13.794 27.084  1.500   1.00 54.77  ? 372 LYS A CD  1 
ATOM   2463 C CE  . LYS A 1 372 ? -14.198 28.271  0.641   1.00 60.95  ? 372 LYS A CE  1 
ATOM   2464 N NZ  . LYS A 1 372 ? -13.993 28.001  -0.808  1.00 67.55  ? 372 LYS A NZ  1 
ATOM   2465 N N   . LEU A 1 373 ? -12.425 25.488  7.207   1.00 48.90  ? 373 LEU A N   1 
ATOM   2466 C CA  . LEU A 1 373 ? -11.908 24.411  8.040   1.00 43.28  ? 373 LEU A CA  1 
ATOM   2467 C C   . LEU A 1 373 ? -12.385 24.589  9.477   1.00 37.19  ? 373 LEU A C   1 
ATOM   2468 O O   . LEU A 1 373 ? -12.171 25.637  10.086  1.00 35.07  ? 373 LEU A O   1 
ATOM   2469 C CB  . LEU A 1 373 ? -10.377 24.393  7.989   1.00 42.17  ? 373 LEU A CB  1 
ATOM   2470 C CG  . LEU A 1 373 ? -9.639  23.104  8.365   1.00 43.27  ? 373 LEU A CG  1 
ATOM   2471 C CD1 . LEU A 1 373 ? -8.170  23.217  7.990   1.00 47.61  ? 373 LEU A CD1 1 
ATOM   2472 C CD2 . LEU A 1 373 ? -9.787  22.773  9.843   1.00 42.86  ? 373 LEU A CD2 1 
ATOM   2473 N N   . ARG A 1 374 ? -13.035 23.561  10.011  1.00 30.57  ? 374 ARG A N   1 
ATOM   2474 C CA  . ARG A 1 374 ? -13.523 23.599  11.383  1.00 34.47  ? 374 ARG A CA  1 
ATOM   2475 C C   . ARG A 1 374 ? -13.232 22.287  12.098  1.00 34.79  ? 374 ARG A C   1 
ATOM   2476 O O   . ARG A 1 374 ? -13.074 21.243  11.465  1.00 31.85  ? 374 ARG A O   1 
ATOM   2477 C CB  . ARG A 1 374 ? -15.027 23.878  11.410  1.00 41.22  ? 374 ARG A CB  1 
ATOM   2478 C CG  . ARG A 1 374 ? -15.884 22.696  10.983  1.00 42.61  ? 374 ARG A CG  1 
ATOM   2479 C CD  . ARG A 1 374 ? -17.364 23.026  11.050  1.00 48.64  ? 374 ARG A CD  1 
ATOM   2480 N NE  . ARG A 1 374 ? -18.196 21.873  10.714  1.00 51.94  ? 374 ARG A NE  1 
ATOM   2481 C CZ  . ARG A 1 374 ? -19.524 21.899  10.661  1.00 54.73  ? 374 ARG A CZ  1 
ATOM   2482 N NH1 . ARG A 1 374 ? -20.182 23.021  10.921  1.00 52.85  ? 374 ARG A NH1 1 
ATOM   2483 N NH2 . ARG A 1 374 ? -20.197 20.800  10.347  1.00 56.99  ? 374 ARG A NH2 1 
ATOM   2484 N N   . PHE A 1 375 ? -13.164 22.348  13.423  1.00 35.80  ? 375 PHE A N   1 
ATOM   2485 C CA  . PHE A 1 375 ? -12.982 21.153  14.235  1.00 37.47  ? 375 PHE A CA  1 
ATOM   2486 C C   . PHE A 1 375 ? -14.256 20.837  15.007  1.00 38.61  ? 375 PHE A C   1 
ATOM   2487 O O   . PHE A 1 375 ? -14.620 21.543  15.947  1.00 35.53  ? 375 PHE A O   1 
ATOM   2488 C CB  . PHE A 1 375 ? -11.798 21.320  15.185  1.00 24.80  ? 375 PHE A CB  1 
ATOM   2489 C CG  . PHE A 1 375 ? -10.464 21.270  14.499  1.00 28.82  ? 375 PHE A CG  1 
ATOM   2490 C CD1 . PHE A 1 375 ? -9.896  22.420  13.974  1.00 29.36  ? 375 PHE A CD1 1 
ATOM   2491 C CD2 . PHE A 1 375 ? -9.779  20.072  14.375  1.00 32.85  ? 375 PHE A CD2 1 
ATOM   2492 C CE1 . PHE A 1 375 ? -8.667  22.376  13.341  1.00 27.31  ? 375 PHE A CE1 1 
ATOM   2493 C CE2 . PHE A 1 375 ? -8.549  20.021  13.743  1.00 28.36  ? 375 PHE A CE2 1 
ATOM   2494 C CZ  . PHE A 1 375 ? -7.994  21.174  13.224  1.00 28.23  ? 375 PHE A CZ  1 
ATOM   2495 N N   . ARG A 1 376 ? -14.933 19.770  14.595  1.00 39.30  ? 376 ARG A N   1 
ATOM   2496 C CA  . ARG A 1 376 ? -16.208 19.393  15.189  1.00 41.97  ? 376 ARG A CA  1 
ATOM   2497 C C   . ARG A 1 376 ? -16.074 18.208  16.140  1.00 44.14  ? 376 ARG A C   1 
ATOM   2498 O O   . ARG A 1 376 ? -15.379 17.234  15.851  1.00 46.37  ? 376 ARG A O   1 
ATOM   2499 C CB  . ARG A 1 376 ? -17.230 19.078  14.097  1.00 41.81  ? 376 ARG A CB  1 
ATOM   2500 C CG  . ARG A 1 376 ? -18.524 18.499  14.627  1.00 40.07  ? 376 ARG A CG  1 
ATOM   2501 C CD  . ARG A 1 376 ? -19.355 17.895  13.517  1.00 43.04  ? 376 ARG A CD  1 
ATOM   2502 N NE  . ARG A 1 376 ? -20.243 16.859  14.030  1.00 42.83  ? 376 ARG A NE  1 
ATOM   2503 C CZ  . ARG A 1 376 ? -19.976 15.558  13.985  1.00 42.94  ? 376 ARG A CZ  1 
ATOM   2504 N NH1 . ARG A 1 376 ? -18.847 15.126  13.439  1.00 42.52  ? 376 ARG A NH1 1 
ATOM   2505 N NH2 . ARG A 1 376 ? -20.842 14.686  14.480  1.00 51.69  ? 376 ARG A NH2 1 
ATOM   2506 N N   . GLN A 1 377 ? -16.761 18.305  17.272  1.00 48.65  ? 377 GLN A N   1 
ATOM   2507 C CA  . GLN A 1 377 ? -16.727 17.288  18.313  1.00 50.94  ? 377 GLN A CA  1 
ATOM   2508 C C   . GLN A 1 377 ? -18.085 16.593  18.385  1.00 53.87  ? 377 GLN A C   1 
ATOM   2509 O O   . GLN A 1 377 ? -19.107 17.258  18.546  1.00 66.96  ? 377 GLN A O   1 
ATOM   2510 C CB  . GLN A 1 377 ? -16.400 17.962  19.646  1.00 47.55  ? 377 GLN A CB  1 
ATOM   2511 C CG  . GLN A 1 377 ? -16.640 17.125  20.886  1.00 48.74  ? 377 GLN A CG  1 
ATOM   2512 C CD  . GLN A 1 377 ? -16.657 17.972  22.148  1.00 50.05  ? 377 GLN A CD  1 
ATOM   2513 O OE1 . GLN A 1 377 ? -17.211 19.073  22.164  1.00 46.57  ? 377 GLN A OE1 1 
ATOM   2514 N NE2 . GLN A 1 377 ? -16.050 17.460  23.213  1.00 47.61  ? 377 GLN A NE2 1 
ATOM   2515 N N   . HIS A 1 378 ? -18.111 15.266  18.262  1.00 61.62  ? 378 HIS A N   1 
ATOM   2516 C CA  . HIS A 1 378 ? -19.396 14.563  18.273  1.00 69.37  ? 378 HIS A CA  1 
ATOM   2517 C C   . HIS A 1 378 ? -19.971 14.461  19.684  1.00 72.56  ? 378 HIS A C   1 
ATOM   2518 O O   . HIS A 1 378 ? -19.338 14.876  20.656  1.00 72.07  ? 378 HIS A O   1 
ATOM   2519 C CB  . HIS A 1 378 ? -19.337 13.162  17.644  1.00 68.66  ? 378 HIS A CB  1 
ATOM   2520 C CG  . HIS A 1 378 ? -18.000 12.773  17.095  1.00 63.33  ? 378 HIS A CG  1 
ATOM   2521 N ND1 . HIS A 1 378 ? -17.481 11.508  17.264  1.00 60.94  ? 378 HIS A ND1 1 
ATOM   2522 C CD2 . HIS A 1 378 ? -17.086 13.460  16.369  1.00 61.00  ? 378 HIS A CD2 1 
ATOM   2523 C CE1 . HIS A 1 378 ? -16.304 11.433  16.672  1.00 60.95  ? 378 HIS A CE1 1 
ATOM   2524 N NE2 . HIS A 1 378 ? -16.038 12.606  16.125  1.00 63.00  ? 378 HIS A NE2 1 
ATOM   2525 N N   . MET A 1 379 ? -21.170 13.892  19.785  1.00 78.24  ? 379 MET A N   1 
ATOM   2526 C CA  . MET A 1 379 ? -21.896 13.842  21.052  1.00 82.27  ? 379 MET A CA  1 
ATOM   2527 C C   . MET A 1 379 ? -22.589 12.502  21.311  1.00 89.44  ? 379 MET A C   1 
ATOM   2528 O O   . MET A 1 379 ? -23.571 12.158  20.651  1.00 99.80  ? 379 MET A O   1 
ATOM   2529 C CB  . MET A 1 379 ? -22.914 14.985  21.114  1.00 82.09  ? 379 MET A CB  1 
ATOM   2530 C CG  . MET A 1 379 ? -23.750 15.135  19.851  1.00 81.53  ? 379 MET A CG  1 
ATOM   2531 S SD  . MET A 1 379 ? -24.559 16.739  19.719  1.00 84.49  ? 379 MET A SD  1 
ATOM   2532 C CE  . MET A 1 379 ? -25.395 16.564  18.145  1.00 81.10  ? 379 MET A CE  1 
ATOM   2533 N N   . GLU A 1 380 ? -22.058 11.754  22.276  1.00 94.18  ? 380 GLU A N   1 
ATOM   2534 C CA  . GLU A 1 380 ? -22.664 10.508  22.769  1.00 96.18  ? 380 GLU A CA  1 
ATOM   2535 C C   . GLU A 1 380 ? -22.964 9.430   21.720  1.00 90.18  ? 380 GLU A C   1 
ATOM   2536 O O   . GLU A 1 380 ? -23.836 8.586   21.931  1.00 89.57  ? 380 GLU A O   1 
ATOM   2537 C CB  . GLU A 1 380 ? -23.927 10.807  23.587  1.00 101.74 ? 380 GLU A CB  1 
ATOM   2538 C CG  . GLU A 1 380 ? -23.652 11.422  24.952  1.00 108.27 ? 380 GLU A CG  1 
ATOM   2539 C CD  . GLU A 1 380 ? -24.899 11.531  25.812  1.00 111.64 ? 380 GLU A CD  1 
ATOM   2540 O OE1 . GLU A 1 380 ? -26.000 11.210  25.317  1.00 114.87 ? 380 GLU A OE1 1 
ATOM   2541 O OE2 . GLU A 1 380 ? -24.776 11.941  26.986  1.00 114.36 ? 380 GLU A OE2 1 
ATOM   2542 N N   . ASN A 1 381 ? -22.242 9.447   20.604  1.00 89.36  ? 381 ASN A N   1 
ATOM   2543 C CA  . ASN A 1 381 ? -22.459 8.457   19.548  1.00 83.28  ? 381 ASN A CA  1 
ATOM   2544 C C   . ASN A 1 381 ? -21.354 7.404   19.518  1.00 78.72  ? 381 ASN A C   1 
ATOM   2545 O O   . ASN A 1 381 ? -21.149 6.678   20.491  1.00 71.27  ? 381 ASN A O   1 
ATOM   2546 C CB  . ASN A 1 381 ? -22.584 9.137   18.194  1.00 83.56  ? 381 ASN A CB  1 
ATOM   2547 N N   . ALA A 1 387 ? -18.099 7.000   24.564  1.00 69.08  ? 387 ALA A N   1 
ATOM   2548 C CA  . ALA A 1 387 ? -17.012 6.233   25.160  1.00 71.98  ? 387 ALA A CA  1 
ATOM   2549 C C   . ALA A 1 387 ? -15.653 6.852   24.842  1.00 76.69  ? 387 ALA A C   1 
ATOM   2550 O O   . ALA A 1 387 ? -14.612 6.238   25.082  1.00 73.06  ? 387 ALA A O   1 
ATOM   2551 C CB  . ALA A 1 387 ? -17.063 4.785   24.688  1.00 63.67  ? 387 ALA A CB  1 
ATOM   2552 N N   . CYS A 1 388 ? -15.671 8.070   24.307  1.00 78.41  ? 388 CYS A N   1 
ATOM   2553 C CA  . CYS A 1 388 ? -14.443 8.767   23.932  1.00 76.80  ? 388 CYS A CA  1 
ATOM   2554 C C   . CYS A 1 388 ? -14.682 10.243  23.624  1.00 69.30  ? 388 CYS A C   1 
ATOM   2555 O O   . CYS A 1 388 ? -15.771 10.634  23.205  1.00 70.48  ? 388 CYS A O   1 
ATOM   2556 C CB  . CYS A 1 388 ? -13.789 8.086   22.726  1.00 84.65  ? 388 CYS A CB  1 
ATOM   2557 S SG  . CYS A 1 388 ? -14.921 7.751   21.357  1.00 93.02  ? 388 CYS A SG  1 
ATOM   2558 N N   . ASP A 1 389 ? -13.651 11.055  23.837  1.00 63.51  ? 389 ASP A N   1 
ATOM   2559 C CA  . ASP A 1 389 ? -13.697 12.472  23.500  1.00 57.99  ? 389 ASP A CA  1 
ATOM   2560 C C   . ASP A 1 389 ? -13.035 12.687  22.143  1.00 57.13  ? 389 ASP A C   1 
ATOM   2561 O O   . ASP A 1 389 ? -11.810 12.740  22.042  1.00 53.41  ? 389 ASP A O   1 
ATOM   2562 C CB  . ASP A 1 389 ? -12.988 13.298  24.576  1.00 57.45  ? 389 ASP A CB  1 
ATOM   2563 C CG  . ASP A 1 389 ? -13.118 14.793  24.349  1.00 58.94  ? 389 ASP A CG  1 
ATOM   2564 O OD1 . ASP A 1 389 ? -14.000 15.210  23.568  1.00 59.74  ? 389 ASP A OD1 1 
ATOM   2565 O OD2 . ASP A 1 389 ? -12.337 15.554  24.959  1.00 58.48  ? 389 ASP A OD2 1 
ATOM   2566 N N   . CYS A 1 390 ? -13.852 12.806  21.101  1.00 52.55  ? 390 CYS A N   1 
ATOM   2567 C CA  . CYS A 1 390 ? -13.337 12.892  19.740  1.00 49.20  ? 390 CYS A CA  1 
ATOM   2568 C C   . CYS A 1 390 ? -13.543 14.267  19.122  1.00 50.01  ? 390 CYS A C   1 
ATOM   2569 O O   . CYS A 1 390 ? -14.588 14.892  19.300  1.00 47.65  ? 390 CYS A O   1 
ATOM   2570 C CB  . CYS A 1 390 ? -13.993 11.834  18.854  1.00 53.98  ? 390 CYS A CB  1 
ATOM   2571 S SG  . CYS A 1 390 ? -13.998 10.169  19.546  1.00 71.40  ? 390 CYS A SG  1 
ATOM   2572 N N   . TRP A 1 391 ? -12.532 14.728  18.394  1.00 48.96  ? 391 TRP A N   1 
ATOM   2573 C CA  . TRP A 1 391 ? -12.623 15.962  17.631  1.00 40.05  ? 391 TRP A CA  1 
ATOM   2574 C C   . TRP A 1 391 ? -12.272 15.682  16.177  1.00 40.04  ? 391 TRP A C   1 
ATOM   2575 O O   . TRP A 1 391 ? -11.146 15.294  15.866  1.00 51.01  ? 391 TRP A O   1 
ATOM   2576 C CB  . TRP A 1 391 ? -11.682 17.022  18.205  1.00 42.33  ? 391 TRP A CB  1 
ATOM   2577 C CG  . TRP A 1 391 ? -12.193 17.672  19.451  1.00 40.25  ? 391 TRP A CG  1 
ATOM   2578 C CD1 . TRP A 1 391 ? -12.080 17.204  20.727  1.00 40.41  ? 391 TRP A CD1 1 
ATOM   2579 C CD2 . TRP A 1 391 ? -12.897 18.917  19.541  1.00 40.31  ? 391 TRP A CD2 1 
ATOM   2580 N NE1 . TRP A 1 391 ? -12.671 18.079  21.607  1.00 41.18  ? 391 TRP A NE1 1 
ATOM   2581 C CE2 . TRP A 1 391 ? -13.180 19.139  20.904  1.00 39.33  ? 391 TRP A CE2 1 
ATOM   2582 C CE3 . TRP A 1 391 ? -13.316 19.865  18.602  1.00 42.13  ? 391 TRP A CE3 1 
ATOM   2583 C CZ2 . TRP A 1 391 ? -13.863 20.268  21.350  1.00 39.40  ? 391 TRP A CZ2 1 
ATOM   2584 C CZ3 . TRP A 1 391 ? -13.993 20.987  19.048  1.00 40.75  ? 391 TRP A CZ3 1 
ATOM   2585 C CH2 . TRP A 1 391 ? -14.260 21.179  20.409  1.00 39.53  ? 391 TRP A CH2 1 
ATOM   2586 N N   . ASP A 1 392 ? -13.239 15.873  15.287  1.00 35.44  ? 392 ASP A N   1 
ATOM   2587 C CA  . ASP A 1 392 ? -13.026 15.610  13.870  1.00 37.38  ? 392 ASP A CA  1 
ATOM   2588 C C   . ASP A 1 392 ? -12.771 16.889  13.082  1.00 36.73  ? 392 ASP A C   1 
ATOM   2589 O O   . ASP A 1 392 ? -13.543 17.845  13.164  1.00 40.70  ? 392 ASP A O   1 
ATOM   2590 C CB  . ASP A 1 392 ? -14.220 14.859  13.280  1.00 46.04  ? 392 ASP A CB  1 
ATOM   2591 C CG  . ASP A 1 392 ? -14.370 13.463  13.850  1.00 51.63  ? 392 ASP A CG  1 
ATOM   2592 O OD1 . ASP A 1 392 ? -13.475 13.024  14.605  1.00 55.28  ? 392 ASP A OD1 1 
ATOM   2593 O OD2 . ASP A 1 392 ? -15.387 12.803  13.544  1.00 49.79  ? 392 ASP A OD2 1 
ATOM   2594 N N   . ALA A 1 393 ? -11.679 16.903  12.325  1.00 29.64  ? 393 ALA A N   1 
ATOM   2595 C CA  . ALA A 1 393 ? -11.378 18.021  11.442  1.00 29.57  ? 393 ALA A CA  1 
ATOM   2596 C C   . ALA A 1 393 ? -12.270 17.940  10.213  1.00 33.42  ? 393 ALA A C   1 
ATOM   2597 O O   . ALA A 1 393 ? -12.241 16.952  9.478   1.00 41.74  ? 393 ALA A O   1 
ATOM   2598 C CB  . ALA A 1 393 ? -9.917  18.005  11.042  1.00 28.62  ? 393 ALA A CB  1 
ATOM   2599 N N   . GLU A 1 394 ? -13.070 18.978  9.998   1.00 39.80  ? 394 GLU A N   1 
ATOM   2600 C CA  . GLU A 1 394 ? -14.018 18.989  8.891   1.00 37.18  ? 394 GLU A CA  1 
ATOM   2601 C C   . GLU A 1 394 ? -13.771 20.149  7.939   1.00 34.59  ? 394 GLU A C   1 
ATOM   2602 O O   . GLU A 1 394 ? -13.346 21.228  8.352   1.00 46.40  ? 394 GLU A O   1 
ATOM   2603 C CB  . GLU A 1 394 ? -15.455 19.029  9.414   1.00 40.97  ? 394 GLU A CB  1 
ATOM   2604 C CG  . GLU A 1 394 ? -15.874 17.773  10.160  1.00 47.04  ? 394 GLU A CG  1 
ATOM   2605 C CD  . GLU A 1 394 ? -17.350 17.760  10.501  1.00 53.61  ? 394 GLU A CD  1 
ATOM   2606 O OE1 . GLU A 1 394 ? -17.978 18.840  10.479  1.00 54.79  ? 394 GLU A OE1 1 
ATOM   2607 O OE2 . GLU A 1 394 ? -17.883 16.667  10.792  1.00 56.61  ? 394 GLU A OE2 1 
ATOM   2608 N N   . SER A 1 395 ? -14.043 19.917  6.660   1.00 34.18  ? 395 SER A N   1 
ATOM   2609 C CA  . SER A 1 395 ? -13.856 20.938  5.638   1.00 34.87  ? 395 SER A CA  1 
ATOM   2610 C C   . SER A 1 395 ? -15.118 21.104  4.802   1.00 37.59  ? 395 SER A C   1 
ATOM   2611 O O   . SER A 1 395 ? -15.809 20.128  4.504   1.00 30.94  ? 395 SER A O   1 
ATOM   2612 C CB  . SER A 1 395 ? -12.673 20.583  4.739   1.00 38.44  ? 395 SER A CB  1 
ATOM   2613 O OG  . SER A 1 395 ? -12.870 19.330  4.106   1.00 43.83  ? 395 SER A OG  1 
ATOM   2614 N N   . LYS A 1 396 ? -15.413 22.345  4.429   1.00 38.33  ? 396 LYS A N   1 
ATOM   2615 C CA  . LYS A 1 396 ? -16.605 22.642  3.646   1.00 43.41  ? 396 LYS A CA  1 
ATOM   2616 C C   . LYS A 1 396 ? -16.349 22.420  2.160   1.00 39.00  ? 396 LYS A C   1 
ATOM   2617 O O   . LYS A 1 396 ? -15.490 23.070  1.563   1.00 42.74  ? 396 LYS A O   1 
ATOM   2618 C CB  . LYS A 1 396 ? -17.075 24.076  3.899   1.00 48.09  ? 396 LYS A CB  1 
ATOM   2619 C CG  . LYS A 1 396 ? -18.449 24.388  3.325   1.00 55.13  ? 396 LYS A CG  1 
ATOM   2620 C CD  . LYS A 1 396 ? -18.925 25.766  3.749   1.00 58.64  ? 396 LYS A CD  1 
ATOM   2621 C CE  . LYS A 1 396 ? -20.316 26.059  3.212   1.00 62.12  ? 396 LYS A CE  1 
ATOM   2622 N NZ  . LYS A 1 396 ? -20.808 27.393  3.656   1.00 67.34  ? 396 LYS A NZ  1 
ATOM   2623 N N   . THR A 1 397 ? -17.096 21.491  1.573   1.00 33.68  ? 397 THR A N   1 
ATOM   2624 C CA  . THR A 1 397 ? -16.957 21.167  0.159   1.00 36.34  ? 397 THR A CA  1 
ATOM   2625 C C   . THR A 1 397 ? -18.301 21.285  -0.546  1.00 38.63  ? 397 THR A C   1 
ATOM   2626 O O   . THR A 1 397 ? -19.298 21.671  0.064   1.00 42.02  ? 397 THR A O   1 
ATOM   2627 C CB  . THR A 1 397 ? -16.428 19.733  -0.042  1.00 33.72  ? 397 THR A CB  1 
ATOM   2628 O OG1 . THR A 1 397 ? -17.405 18.792  0.421   1.00 29.71  ? 397 THR A OG1 1 
ATOM   2629 C CG2 . THR A 1 397 ? -15.125 19.526  0.716   1.00 33.64  ? 397 THR A CG2 1 
ATOM   2630 N N   . SER A 1 398 ? -18.325 20.948  -1.832  1.00 38.17  ? 398 SER A N   1 
ATOM   2631 C CA  . SER A 1 398 ? -19.567 20.943  -2.595  1.00 38.48  ? 398 SER A CA  1 
ATOM   2632 C C   . SER A 1 398 ? -20.481 19.818  -2.117  1.00 38.56  ? 398 SER A C   1 
ATOM   2633 O O   . SER A 1 398 ? -21.644 19.735  -2.513  1.00 47.20  ? 398 SER A O   1 
ATOM   2634 C CB  . SER A 1 398 ? -19.282 20.804  -4.091  1.00 38.15  ? 398 SER A CB  1 
ATOM   2635 O OG  . SER A 1 398 ? -18.634 19.576  -4.375  1.00 44.34  ? 398 SER A OG  1 
ATOM   2636 N N   . TYR A 1 399 ? -19.942 18.953  -1.263  1.00 37.85  ? 399 TYR A N   1 
ATOM   2637 C CA  . TYR A 1 399 ? -20.718 17.889  -0.640  1.00 37.90  ? 399 TYR A CA  1 
ATOM   2638 C C   . TYR A 1 399 ? -21.101 18.294  0.781   1.00 37.09  ? 399 TYR A C   1 
ATOM   2639 O O   . TYR A 1 399 ? -21.771 17.545  1.492   1.00 36.02  ? 399 TYR A O   1 
ATOM   2640 C CB  . TYR A 1 399 ? -19.918 16.585  -0.609  1.00 36.82  ? 399 TYR A CB  1 
ATOM   2641 C CG  . TYR A 1 399 ? -19.537 16.052  -1.974  1.00 38.37  ? 399 TYR A CG  1 
ATOM   2642 C CD1 . TYR A 1 399 ? -18.360 16.453  -2.595  1.00 37.10  ? 399 TYR A CD1 1 
ATOM   2643 C CD2 . TYR A 1 399 ? -20.350 15.141  -2.637  1.00 36.24  ? 399 TYR A CD2 1 
ATOM   2644 C CE1 . TYR A 1 399 ? -18.007 15.966  -3.842  1.00 37.92  ? 399 TYR A CE1 1 
ATOM   2645 C CE2 . TYR A 1 399 ? -20.005 14.649  -3.884  1.00 35.06  ? 399 TYR A CE2 1 
ATOM   2646 C CZ  . TYR A 1 399 ? -18.833 15.065  -4.481  1.00 36.26  ? 399 TYR A CZ  1 
ATOM   2647 O OH  . TYR A 1 399 ? -18.486 14.578  -5.720  1.00 36.23  ? 399 TYR A OH  1 
ATOM   2648 N N   . GLY A 1 400 ? -20.670 19.485  1.186   1.00 27.02  ? 400 GLY A N   1 
ATOM   2649 C CA  . GLY A 1 400 ? -20.925 19.978  2.534   1.00 32.86  ? 400 GLY A CA  1 
ATOM   2650 C C   . GLY A 1 400 ? -19.735 19.766  3.450   1.00 36.89  ? 400 GLY A C   1 
ATOM   2651 O O   . GLY A 1 400 ? -18.606 19.600  2.987   1.00 42.23  ? 400 GLY A O   1 
ATOM   2652 N N   . TRP A 1 401 ? -19.988 19.775  4.755   1.00 33.18  ? 401 TRP A N   1 
ATOM   2653 C CA  . TRP A 1 401 ? -18.937 19.544  5.739   1.00 31.74  ? 401 TRP A CA  1 
ATOM   2654 C C   . TRP A 1 401 ? -18.624 18.058  5.857   1.00 34.30  ? 401 TRP A C   1 
ATOM   2655 O O   . TRP A 1 401 ? -19.477 17.267  6.260   1.00 35.21  ? 401 TRP A O   1 
ATOM   2656 C CB  . TRP A 1 401 ? -19.339 20.104  7.104   1.00 31.80  ? 401 TRP A CB  1 
ATOM   2657 C CG  . TRP A 1 401 ? -19.424 21.597  7.136   1.00 34.95  ? 401 TRP A CG  1 
ATOM   2658 C CD1 . TRP A 1 401 ? -20.553 22.355  7.031   1.00 32.77  ? 401 TRP A CD1 1 
ATOM   2659 C CD2 . TRP A 1 401 ? -18.334 22.516  7.279   1.00 32.94  ? 401 TRP A CD2 1 
ATOM   2660 N NE1 . TRP A 1 401 ? -20.234 23.689  7.103   1.00 32.03  ? 401 TRP A NE1 1 
ATOM   2661 C CE2 . TRP A 1 401 ? -18.879 23.815  7.254   1.00 30.69  ? 401 TRP A CE2 1 
ATOM   2662 C CE3 . TRP A 1 401 ? -16.952 22.366  7.427   1.00 32.61  ? 401 TRP A CE3 1 
ATOM   2663 C CZ2 . TRP A 1 401 ? -18.089 24.959  7.371   1.00 30.07  ? 401 TRP A CZ2 1 
ATOM   2664 C CZ3 . TRP A 1 401 ? -16.169 23.504  7.542   1.00 33.60  ? 401 TRP A CZ3 1 
ATOM   2665 C CH2 . TRP A 1 401 ? -16.741 24.782  7.515   1.00 29.99  ? 401 TRP A CH2 1 
ATOM   2666 N N   . ILE A 1 402 ? -17.398 17.686  5.503   1.00 39.11  ? 402 ILE A N   1 
ATOM   2667 C CA  . ILE A 1 402 ? -16.980 16.289  5.549   1.00 41.17  ? 402 ILE A CA  1 
ATOM   2668 C C   . ILE A 1 402 ? -15.812 16.082  6.507   1.00 37.68  ? 402 ILE A C   1 
ATOM   2669 O O   . ILE A 1 402 ? -15.002 16.985  6.718   1.00 39.25  ? 402 ILE A O   1 
ATOM   2670 C CB  . ILE A 1 402 ? -16.586 15.766  4.151   1.00 45.46  ? 402 ILE A CB  1 
ATOM   2671 C CG1 . ILE A 1 402 ? -15.436 16.594  3.573   1.00 45.48  ? 402 ILE A CG1 1 
ATOM   2672 C CG2 . ILE A 1 402 ? -17.789 15.781  3.215   1.00 40.79  ? 402 ILE A CG2 1 
ATOM   2673 C CD1 . ILE A 1 402 ? -14.808 15.989  2.340   1.00 44.98  ? 402 ILE A CD1 1 
ATOM   2674 N N   . GLU A 1 403 ? -15.733 14.887  7.082   1.00 34.88  ? 403 GLU A N   1 
ATOM   2675 C CA  . GLU A 1 403 ? -14.638 14.533  7.977   1.00 39.43  ? 403 GLU A CA  1 
ATOM   2676 C C   . GLU A 1 403 ? -13.409 14.109  7.178   1.00 37.82  ? 403 GLU A C   1 
ATOM   2677 O O   . GLU A 1 403 ? -13.426 13.083  6.496   1.00 36.44  ? 403 GLU A O   1 
ATOM   2678 C CB  . GLU A 1 403 ? -15.063 13.405  8.920   1.00 37.98  ? 403 GLU A CB  1 
ATOM   2679 C CG  . GLU A 1 403 ? -13.961 12.923  9.851   1.00 44.65  ? 403 GLU A CG  1 
ATOM   2680 C CD  . GLU A 1 403 ? -14.282 11.588  10.497  1.00 51.63  ? 403 GLU A CD  1 
ATOM   2681 O OE1 . GLU A 1 403 ? -13.393 11.021  11.167  1.00 53.36  ? 403 GLU A OE1 1 
ATOM   2682 O OE2 . GLU A 1 403 ? -15.421 11.102  10.331  1.00 56.65  ? 403 GLU A OE2 1 
ATOM   2683 N N   . ILE A 1 404 ? -12.345 14.901  7.263   1.00 29.45  ? 404 ILE A N   1 
ATOM   2684 C CA  . ILE A 1 404 ? -11.107 14.586  6.557   1.00 31.11  ? 404 ILE A CA  1 
ATOM   2685 C C   . ILE A 1 404 ? -10.046 14.016  7.498   1.00 35.32  ? 404 ILE A C   1 
ATOM   2686 O O   . ILE A 1 404 ? -9.250  13.164  7.103   1.00 39.25  ? 404 ILE A O   1 
ATOM   2687 C CB  . ILE A 1 404 ? -10.547 15.811  5.800   1.00 30.82  ? 404 ILE A CB  1 
ATOM   2688 C CG1 . ILE A 1 404 ? -10.340 16.990  6.753   1.00 24.70  ? 404 ILE A CG1 1 
ATOM   2689 C CG2 . ILE A 1 404 ? -11.477 16.202  4.661   1.00 32.73  ? 404 ILE A CG2 1 
ATOM   2690 C CD1 . ILE A 1 404 ? -9.886  18.257  6.066   1.00 17.07  ? 404 ILE A CD1 1 
ATOM   2691 N N   . VAL A 1 405 ? -10.043 14.489  8.742   1.00 25.68  ? 405 VAL A N   1 
ATOM   2692 C CA  . VAL A 1 405 ? -9.125  13.980  9.756   1.00 26.15  ? 405 VAL A CA  1 
ATOM   2693 C C   . VAL A 1 405 ? -9.849  13.780  11.081  1.00 31.24  ? 405 VAL A C   1 
ATOM   2694 O O   . VAL A 1 405 ? -10.388 14.727  11.654  1.00 34.43  ? 405 VAL A O   1 
ATOM   2695 C CB  . VAL A 1 405 ? -7.926  14.925  9.979   1.00 27.59  ? 405 VAL A CB  1 
ATOM   2696 C CG1 . VAL A 1 405 ? -7.009  14.371  11.059  1.00 22.21  ? 405 VAL A CG1 1 
ATOM   2697 C CG2 . VAL A 1 405 ? -7.159  15.137  8.684   1.00 32.15  ? 405 VAL A CG2 1 
ATOM   2698 N N   . GLY A 1 406 ? -9.859  12.542  11.564  1.00 34.60  ? 406 GLY A N   1 
ATOM   2699 C CA  . GLY A 1 406 ? -10.510 12.224  12.827  1.00 34.07  ? 406 GLY A CA  1 
ATOM   2700 C C   . GLY A 1 406 ? -9.518  12.050  13.959  1.00 40.68  ? 406 GLY A C   1 
ATOM   2701 O O   . GLY A 1 406 ? -8.700  11.132  13.943  1.00 49.90  ? 406 GLY A O   1 
ATOM   2702 N N   . CYS A 1 407 ? -9.587  12.941  14.942  1.00 39.62  ? 407 CYS A N   1 
ATOM   2703 C CA  . CYS A 1 407 ? -8.738  12.844  16.122  1.00 39.87  ? 407 CYS A CA  1 
ATOM   2704 C C   . CYS A 1 407 ? -9.579  12.430  17.323  1.00 34.22  ? 407 CYS A C   1 
ATOM   2705 O O   . CYS A 1 407 ? -10.604 13.045  17.612  1.00 44.36  ? 407 CYS A O   1 
ATOM   2706 C CB  . CYS A 1 407 ? -8.039  14.177  16.394  1.00 39.61  ? 407 CYS A CB  1 
ATOM   2707 S SG  . CYS A 1 407 ? -6.887  14.140  17.783  1.00 46.32  ? 407 CYS A SG  1 
ATOM   2708 N N   . ALA A 1 408 ? -9.146  11.385  18.019  1.00 33.28  ? 408 ALA A N   1 
ATOM   2709 C CA  . ALA A 1 408 ? -9.930  10.836  19.120  1.00 44.28  ? 408 ALA A CA  1 
ATOM   2710 C C   . ALA A 1 408 ? -9.106  10.613  20.384  1.00 47.63  ? 408 ALA A C   1 
ATOM   2711 O O   . ALA A 1 408 ? -8.068  9.954   20.352  1.00 52.08  ? 408 ALA A O   1 
ATOM   2712 C CB  . ALA A 1 408 ? -10.598 9.537   18.690  1.00 35.30  ? 408 ALA A CB  1 
ATOM   2713 N N   . ASP A 1 409 ? -9.577  11.172  21.494  1.00 52.08  ? 409 ASP A N   1 
ATOM   2714 C CA  . ASP A 1 409 ? -8.987  10.898  22.797  1.00 54.82  ? 409 ASP A CA  1 
ATOM   2715 C C   . ASP A 1 409 ? -9.747  9.737   23.426  1.00 55.49  ? 409 ASP A C   1 
ATOM   2716 O O   . ASP A 1 409 ? -10.973 9.774   23.535  1.00 53.04  ? 409 ASP A O   1 
ATOM   2717 C CB  . ASP A 1 409 ? -9.052  12.135  23.694  1.00 52.40  ? 409 ASP A CB  1 
ATOM   2718 C CG  . ASP A 1 409 ? -8.176  12.010  24.927  1.00 52.43  ? 409 ASP A CG  1 
ATOM   2719 O OD1 . ASP A 1 409 ? -7.942  10.872  25.388  1.00 49.34  ? 409 ASP A OD1 1 
ATOM   2720 O OD2 . ASP A 1 409 ? -7.722  13.055  25.437  1.00 54.16  ? 409 ASP A OD2 1 
ATOM   2721 N N   . ARG A 1 410 ? -9.018  8.706   23.838  1.00 58.61  ? 410 ARG A N   1 
ATOM   2722 C CA  . ARG A 1 410 ? -9.649  7.471   24.279  1.00 59.94  ? 410 ARG A CA  1 
ATOM   2723 C C   . ARG A 1 410 ? -8.974  6.910   25.527  1.00 63.04  ? 410 ARG A C   1 
ATOM   2724 O O   . ARG A 1 410 ? -7.749  6.803   25.586  1.00 62.04  ? 410 ARG A O   1 
ATOM   2725 C CB  . ARG A 1 410 ? -9.608  6.444   23.146  1.00 66.24  ? 410 ARG A CB  1 
ATOM   2726 C CG  . ARG A 1 410 ? -10.919 5.724   22.903  1.00 72.84  ? 410 ARG A CG  1 
ATOM   2727 C CD  . ARG A 1 410 ? -11.040 5.312   21.445  1.00 77.26  ? 410 ARG A CD  1 
ATOM   2728 N NE  . ARG A 1 410 ? -12.419 5.004   21.074  1.00 86.44  ? 410 ARG A NE  1 
ATOM   2729 C CZ  . ARG A 1 410 ? -12.844 4.870   19.821  1.00 90.82  ? 410 ARG A CZ  1 
ATOM   2730 N NH1 . ARG A 1 410 ? -11.998 5.020   18.811  1.00 91.94  ? 410 ARG A NH1 1 
ATOM   2731 N NH2 . ARG A 1 410 ? -14.117 4.589   19.578  1.00 93.95  ? 410 ARG A NH2 1 
ATOM   2732 N N   . SER A 1 411 ? -9.782  6.558   26.522  1.00 70.36  ? 411 SER A N   1 
ATOM   2733 C CA  . SER A 1 411 ? -9.275  5.974   27.759  1.00 77.21  ? 411 SER A CA  1 
ATOM   2734 C C   . SER A 1 411 ? -9.445  4.456   27.750  1.00 79.23  ? 411 SER A C   1 
ATOM   2735 O O   . SER A 1 411 ? -8.482  3.712   27.942  1.00 77.47  ? 411 SER A O   1 
ATOM   2736 C CB  . SER A 1 411 ? -9.985  6.582   28.971  1.00 77.86  ? 411 SER A CB  1 
ATOM   2737 O OG  . SER A 1 411 ? -9.814  7.988   29.009  1.00 79.07  ? 411 SER A OG  1 
ATOM   2738 N N   . CYS A 1 412 ? -10.677 4.006   27.530  1.00 84.65  ? 412 CYS A N   1 
ATOM   2739 C CA  . CYS A 1 412 ? -10.973 2.582   27.401  1.00 87.37  ? 412 CYS A CA  1 
ATOM   2740 C C   . CYS A 1 412 ? -11.201 2.231   25.936  1.00 84.40  ? 412 CYS A C   1 
ATOM   2741 O O   . CYS A 1 412 ? -12.225 2.592   25.356  1.00 80.52  ? 412 CYS A O   1 
ATOM   2742 C CB  . CYS A 1 412 ? -12.207 2.206   28.225  1.00 87.83  ? 412 CYS A CB  1 
ATOM   2743 S SG  . CYS A 1 412 ? -11.987 2.307   30.015  1.00 91.06  ? 412 CYS A SG  1 
ATOM   2744 N N   . TYR A 1 413 ? -10.244 1.527   25.341  1.00 79.31  ? 413 TYR A N   1 
ATOM   2745 C CA  . TYR A 1 413 ? -10.317 1.193   23.922  1.00 73.79  ? 413 TYR A CA  1 
ATOM   2746 C C   . TYR A 1 413 ? -9.981  -0.270  23.643  1.00 70.14  ? 413 TYR A C   1 
ATOM   2747 O O   . TYR A 1 413 ? -9.989  -1.102  24.550  1.00 73.07  ? 413 TYR A O   1 
ATOM   2748 C CB  . TYR A 1 413 ? -9.426  2.129   23.098  1.00 73.27  ? 413 TYR A CB  1 
ATOM   2749 C CG  . TYR A 1 413 ? -8.031  2.307   23.653  1.00 73.10  ? 413 TYR A CG  1 
ATOM   2750 C CD1 . TYR A 1 413 ? -7.803  3.088   24.780  1.00 72.83  ? 413 TYR A CD1 1 
ATOM   2751 C CD2 . TYR A 1 413 ? -6.939  1.705   23.043  1.00 73.51  ? 413 TYR A CD2 1 
ATOM   2752 C CE1 . TYR A 1 413 ? -6.529  3.254   25.290  1.00 74.19  ? 413 TYR A CE1 1 
ATOM   2753 C CE2 . TYR A 1 413 ? -5.661  1.868   23.544  1.00 75.05  ? 413 TYR A CE2 1 
ATOM   2754 C CZ  . TYR A 1 413 ? -5.462  2.642   24.667  1.00 75.39  ? 413 TYR A CZ  1 
ATOM   2755 O OH  . TYR A 1 413 ? -4.190  2.805   25.165  1.00 77.01  ? 413 TYR A OH  1 
ATOM   2756 N N   . ASP A 1 414 ? -9.678  -0.573  22.384  1.00 70.57  ? 414 ASP A N   1 
ATOM   2757 C CA  . ASP A 1 414 ? -9.536  -1.957  21.930  1.00 74.66  ? 414 ASP A CA  1 
ATOM   2758 C C   . ASP A 1 414 ? -8.194  -2.614  22.269  1.00 72.19  ? 414 ASP A C   1 
ATOM   2759 O O   . ASP A 1 414 ? -7.983  -3.788  21.964  1.00 63.98  ? 414 ASP A O   1 
ATOM   2760 C CB  . ASP A 1 414 ? -9.805  -2.051  20.425  1.00 76.57  ? 414 ASP A CB  1 
ATOM   2761 C CG  . ASP A 1 414 ? -11.238 -1.698  20.066  1.00 80.76  ? 414 ASP A CG  1 
ATOM   2762 O OD1 . ASP A 1 414 ? -12.048 -1.472  20.990  1.00 82.51  ? 414 ASP A OD1 1 
ATOM   2763 O OD2 . ASP A 1 414 ? -11.556 -1.648  18.859  1.00 80.21  ? 414 ASP A OD2 1 
ATOM   2764 N N   . LEU A 1 415 ? -7.295  -1.865  22.899  1.00 70.52  ? 415 LEU A N   1 
ATOM   2765 C CA  . LEU A 1 415 ? -5.997  -2.410  23.292  1.00 72.39  ? 415 LEU A CA  1 
ATOM   2766 C C   . LEU A 1 415 ? -6.138  -3.353  24.483  1.00 70.87  ? 415 LEU A C   1 
ATOM   2767 O O   . LEU A 1 415 ? -5.490  -4.398  24.540  1.00 66.22  ? 415 LEU A O   1 
ATOM   2768 C CB  . LEU A 1 415 ? -5.011  -1.284  23.611  1.00 74.23  ? 415 LEU A CB  1 
ATOM   2769 C CG  . LEU A 1 415 ? -3.578  -1.653  24.004  1.00 74.81  ? 415 LEU A CG  1 
ATOM   2770 C CD1 . LEU A 1 415 ? -2.612  -0.583  23.531  1.00 77.46  ? 415 LEU A CD1 1 
ATOM   2771 C CD2 . LEU A 1 415 ? -3.450  -1.867  25.507  1.00 76.32  ? 415 LEU A CD2 1 
ATOM   2772 N N   . SER A 1 416 ? -6.991  -2.976  25.430  1.00 74.59  ? 416 SER A N   1 
ATOM   2773 C CA  . SER A 1 416 ? -7.245  -3.798  26.608  1.00 75.72  ? 416 SER A CA  1 
ATOM   2774 C C   . SER A 1 416 ? -8.103  -5.013  26.262  1.00 73.73  ? 416 SER A C   1 
ATOM   2775 O O   . SER A 1 416 ? -8.254  -5.929  27.072  1.00 71.71  ? 416 SER A O   1 
ATOM   2776 C CB  . SER A 1 416 ? -7.914  -2.967  27.705  1.00 77.05  ? 416 SER A CB  1 
ATOM   2777 O OG  . SER A 1 416 ? -9.071  -2.312  27.216  1.00 77.98  ? 416 SER A OG  1 
ATOM   2778 N N   . CYS A 1 417 ? -8.663  -5.013  25.056  1.00 71.53  ? 417 CYS A N   1 
ATOM   2779 C CA  . CYS A 1 417 ? -9.468  -6.132  24.582  1.00 71.80  ? 417 CYS A CA  1 
ATOM   2780 C C   . CYS A 1 417 ? -8.578  -7.267  24.088  1.00 72.58  ? 417 CYS A C   1 
ATOM   2781 O O   . CYS A 1 417 ? -8.847  -8.439  24.354  1.00 75.74  ? 417 CYS A O   1 
ATOM   2782 C CB  . CYS A 1 417 ? -10.413 -5.680  23.468  1.00 69.02  ? 417 CYS A CB  1 
ATOM   2783 S SG  . CYS A 1 417 ? -11.613 -4.429  23.973  1.00 67.17  ? 417 CYS A SG  1 
ATOM   2784 N N   . HIS A 1 418 ? -7.517  -6.912  23.369  1.00 73.08  ? 418 HIS A N   1 
ATOM   2785 C CA  . HIS A 1 418 ? -6.567  -7.896  22.858  1.00 71.43  ? 418 HIS A CA  1 
ATOM   2786 C C   . HIS A 1 418 ? -5.758  -8.517  23.993  1.00 74.46  ? 418 HIS A C   1 
ATOM   2787 O O   . HIS A 1 418 ? -5.174  -9.590  23.838  1.00 73.55  ? 418 HIS A O   1 
ATOM   2788 C CB  . HIS A 1 418 ? -5.637  -7.261  21.820  1.00 67.42  ? 418 HIS A CB  1 
ATOM   2789 C CG  . HIS A 1 418 ? -6.340  -6.803  20.579  1.00 69.11  ? 418 HIS A CG  1 
ATOM   2790 N ND1 . HIS A 1 418 ? -6.727  -5.495  20.382  1.00 68.46  ? 418 HIS A ND1 1 
ATOM   2791 C CD2 . HIS A 1 418 ? -6.730  -7.481  19.474  1.00 67.90  ? 418 HIS A CD2 1 
ATOM   2792 C CE1 . HIS A 1 418 ? -7.323  -5.386  19.208  1.00 66.65  ? 418 HIS A CE1 1 
ATOM   2793 N NE2 . HIS A 1 418 ? -7.339  -6.577  18.637  1.00 64.69  ? 418 HIS A NE2 1 
ATOM   2794 N N   . ALA A 1 419 ? -5.733  -7.834  25.133  1.00 77.77  ? 419 ALA A N   1 
ATOM   2795 C CA  . ALA A 1 419 ? -5.058  -8.340  26.322  1.00 77.47  ? 419 ALA A CA  1 
ATOM   2796 C C   . ALA A 1 419 ? -5.913  -9.392  27.024  1.00 81.35  ? 419 ALA A C   1 
ATOM   2797 O O   . ALA A 1 419 ? -5.397  -10.241 27.752  1.00 84.19  ? 419 ALA A O   1 
ATOM   2798 C CB  . ALA A 1 419 ? -4.732  -7.198  27.272  1.00 69.32  ? 419 ALA A CB  1 
ATOM   2799 N N   . ARG A 1 420 ? -7.222  -9.329  26.800  1.00 82.70  ? 420 ARG A N   1 
ATOM   2800 C CA  . ARG A 1 420 ? -8.152  -10.282 27.396  1.00 87.08  ? 420 ARG A CA  1 
ATOM   2801 C C   . ARG A 1 420 ? -8.696  -11.247 26.348  1.00 83.04  ? 420 ARG A C   1 
ATOM   2802 O O   . ARG A 1 420 ? -7.942  -12.009 25.743  1.00 77.50  ? 420 ARG A O   1 
ATOM   2803 C CB  . ARG A 1 420 ? -9.303  -9.549  28.089  1.00 94.84  ? 420 ARG A CB  1 
ATOM   2804 C CG  . ARG A 1 420 ? -8.873  -8.718  29.288  1.00 100.59 ? 420 ARG A CG  1 
ATOM   2805 C CD  . ARG A 1 420 ? -10.045 -7.965  29.898  1.00 103.55 ? 420 ARG A CD  1 
ATOM   2806 N NE  . ARG A 1 420 ? -9.632  -7.159  31.045  1.00 108.76 ? 420 ARG A NE  1 
ATOM   2807 C CZ  . ARG A 1 420 ? -10.439 -6.349  31.723  1.00 109.75 ? 420 ARG A CZ  1 
ATOM   2808 N NH1 . ARG A 1 420 ? -11.713 -6.230  31.374  1.00 110.88 ? 420 ARG A NH1 1 
ATOM   2809 N NH2 . ARG A 1 420 ? -9.972  -5.655  32.753  1.00 109.07 ? 420 ARG A NH2 1 
ATOM   2810 N N   . LYS A 1 505 ? -2.761  -5.145  23.892  1.00 104.54 ? 505 LYS A N   1 
ATOM   2811 C CA  . LYS A 1 505 ? -1.744  -6.180  24.037  1.00 102.98 ? 505 LYS A CA  1 
ATOM   2812 C C   . LYS A 1 505 ? -1.325  -6.341  25.494  1.00 105.60 ? 505 LYS A C   1 
ATOM   2813 O O   . LYS A 1 505 ? -1.526  -7.398  26.093  1.00 111.21 ? 505 LYS A O   1 
ATOM   2814 C CB  . LYS A 1 505 ? -0.537  -5.864  23.166  1.00 104.60 ? 505 LYS A CB  1 
ATOM   2815 N N   . ARG A 1 506 ? -0.744  -5.287  26.059  1.00 104.07 ? 506 ARG A N   1 
ATOM   2816 C CA  . ARG A 1 506 ? -0.288  -5.313  27.444  1.00 106.11 ? 506 ARG A CA  1 
ATOM   2817 C C   . ARG A 1 506 ? -0.366  -3.929  28.083  1.00 107.64 ? 506 ARG A C   1 
ATOM   2818 O O   . ARG A 1 506 ? -0.968  -3.010  27.527  1.00 108.78 ? 506 ARG A O   1 
ATOM   2819 C CB  . ARG A 1 506 ? 1.132   -5.856  27.525  1.00 105.08 ? 506 ARG A CB  1 
ATOM   2820 N N   . PHE A 1 507 ? 0.248   -3.792  29.254  1.00 106.29 ? 507 PHE A N   1 
ATOM   2821 C CA  . PHE A 1 507 ? 0.277   -2.520  29.964  1.00 100.39 ? 507 PHE A CA  1 
ATOM   2822 C C   . PHE A 1 507 ? 1.705   -2.001  30.088  1.00 96.58  ? 507 PHE A C   1 
ATOM   2823 O O   . PHE A 1 507 ? 2.634   -2.571  29.517  1.00 87.11  ? 507 PHE A O   1 
ATOM   2824 C CB  . PHE A 1 507 ? -0.356  -2.664  31.349  1.00 108.38 ? 507 PHE A CB  1 
ATOM   2825 C CG  . PHE A 1 507 ? -1.810  -3.036  31.312  1.00 111.30 ? 507 PHE A CG  1 
ATOM   2826 C CD1 . PHE A 1 507 ? -2.215  -4.339  31.556  1.00 112.02 ? 507 PHE A CD1 1 
ATOM   2827 C CD2 . PHE A 1 507 ? -2.771  -2.085  31.025  1.00 113.45 ? 507 PHE A CD2 1 
ATOM   2828 C CE1 . PHE A 1 507 ? -3.557  -4.683  31.520  1.00 112.89 ? 507 PHE A CE1 1 
ATOM   2829 C CE2 . PHE A 1 507 ? -4.112  -2.425  30.986  1.00 115.13 ? 507 PHE A CE2 1 
ATOM   2830 C CZ  . PHE A 1 507 ? -4.506  -3.723  31.235  1.00 113.85 ? 507 PHE A CZ  1 
ATOM   2831 N N   . GLN A 1 508 ? 1.871   -0.915  30.836  1.00 96.43  ? 508 GLN A N   1 
ATOM   2832 C CA  . GLN A 1 508 ? 3.186   -0.320  31.039  1.00 106.00 ? 508 GLN A CA  1 
ATOM   2833 C C   . GLN A 1 508 ? 3.514   -0.214  32.523  1.00 102.77 ? 508 GLN A C   1 
ATOM   2834 O O   . GLN A 1 508 ? 2.810   0.459   33.276  1.00 104.55 ? 508 GLN A O   1 
ATOM   2835 C CB  . GLN A 1 508 ? 3.257   1.063   30.387  1.00 114.77 ? 508 GLN A CB  1 
ATOM   2836 C CG  . GLN A 1 508 ? 2.969   1.066   28.893  1.00 120.93 ? 508 GLN A CG  1 
ATOM   2837 C CD  . GLN A 1 508 ? 3.161   2.433   28.262  1.00 123.75 ? 508 GLN A CD  1 
ATOM   2838 O OE1 . GLN A 1 508 ? 3.417   3.420   28.953  1.00 125.61 ? 508 GLN A OE1 1 
ATOM   2839 N NE2 . GLN A 1 508 ? 3.037   2.497   26.942  1.00 127.19 ? 508 GLN A NE2 1 
ATOM   2840 N N   . LYS A 1 509 ? 4.584   -0.883  32.939  1.00 100.23 ? 509 LYS A N   1 
ATOM   2841 C CA  . LYS A 1 509 ? 5.018   -0.845  34.331  1.00 100.57 ? 509 LYS A CA  1 
ATOM   2842 C C   . LYS A 1 509 ? 5.834   0.411   34.617  1.00 97.34  ? 509 LYS A C   1 
ATOM   2843 O O   . LYS A 1 509 ? 6.636   0.843   33.789  1.00 97.31  ? 509 LYS A O   1 
ATOM   2844 C CB  . LYS A 1 509 ? 5.823   -2.101  34.681  1.00 103.59 ? 509 LYS A CB  1 
ATOM   2845 C CG  . LYS A 1 509 ? 6.981   -2.390  33.737  1.00 104.97 ? 509 LYS A CG  1 
ATOM   2846 C CD  . LYS A 1 509 ? 7.680   -3.690  34.101  1.00 104.32 ? 509 LYS A CD  1 
ATOM   2847 C CE  . LYS A 1 509 ? 8.804   -4.003  33.127  1.00 104.52 ? 509 LYS A CE  1 
ATOM   2848 N NZ  . LYS A 1 509 ? 9.463   -5.302  33.437  1.00 104.43 ? 509 LYS A NZ  1 
ATOM   2849 N N   . THR A 1 510 ? 5.622   0.997   35.791  1.00 96.90  ? 510 THR A N   1 
ATOM   2850 C CA  . THR A 1 510 ? 6.326   2.217   36.172  1.00 99.45  ? 510 THR A CA  1 
ATOM   2851 C C   . THR A 1 510 ? 7.465   1.928   37.147  1.00 99.93  ? 510 THR A C   1 
ATOM   2852 O O   . THR A 1 510 ? 7.758   0.770   37.449  1.00 96.28  ? 510 THR A O   1 
ATOM   2853 C CB  . THR A 1 510 ? 5.369   3.258   36.791  1.00 100.53 ? 510 THR A CB  1 
ATOM   2854 O OG1 . THR A 1 510 ? 6.063   4.498   36.975  1.00 101.73 ? 510 THR A OG1 1 
ATOM   2855 C CG2 . THR A 1 510 ? 4.850   2.777   38.131  1.00 101.97 ? 510 THR A CG2 1 
ATOM   2856 N N   . LEU A 1 511 ? 8.105   2.988   37.631  1.00 105.32 ? 511 LEU A N   1 
ATOM   2857 C CA  . LEU A 1 511 ? 9.213   2.858   38.572  1.00 111.24 ? 511 LEU A CA  1 
ATOM   2858 C C   . LEU A 1 511 ? 8.720   2.539   39.982  1.00 110.96 ? 511 LEU A C   1 
ATOM   2859 O O   . LEU A 1 511 ? 9.457   1.977   40.793  1.00 111.41 ? 511 LEU A O   1 
ATOM   2860 C CB  . LEU A 1 511 ? 10.059  4.135   38.583  1.00 117.05 ? 511 LEU A CB  1 
ATOM   2861 C CG  . LEU A 1 511 ? 10.764  4.515   37.278  1.00 118.08 ? 511 LEU A CG  1 
ATOM   2862 C CD1 . LEU A 1 511 ? 11.406  5.890   37.395  1.00 116.49 ? 511 LEU A CD1 1 
ATOM   2863 C CD2 . LEU A 1 511 ? 11.800  3.466   36.891  1.00 118.46 ? 511 LEU A CD2 1 
ATOM   2864 N N   . TYR A 1 512 ? 7.472   2.899   40.266  1.00 112.41 ? 512 TYR A N   1 
ATOM   2865 C CA  . TYR A 1 512 ? 6.872   2.638   41.571  1.00 113.63 ? 512 TYR A CA  1 
ATOM   2866 C C   . TYR A 1 512 ? 6.051   1.350   41.566  1.00 113.71 ? 512 TYR A C   1 
ATOM   2867 O O   . TYR A 1 512 ? 5.112   1.202   42.349  1.00 115.12 ? 512 TYR A O   1 
ATOM   2868 C CB  . TYR A 1 512 ? 5.996   3.816   42.007  1.00 111.61 ? 512 TYR A CB  1 
ATOM   2869 C CG  . TYR A 1 512 ? 6.762   5.098   42.249  1.00 112.81 ? 512 TYR A CG  1 
ATOM   2870 C CD1 . TYR A 1 512 ? 6.843   6.078   41.267  1.00 113.37 ? 512 TYR A CD1 1 
ATOM   2871 C CD2 . TYR A 1 512 ? 7.405   5.328   43.460  1.00 113.03 ? 512 TYR A CD2 1 
ATOM   2872 C CE1 . TYR A 1 512 ? 7.543   7.253   41.485  1.00 113.28 ? 512 TYR A CE1 1 
ATOM   2873 C CE2 . TYR A 1 512 ? 8.108   6.499   43.687  1.00 112.49 ? 512 TYR A CE2 1 
ATOM   2874 C CZ  . TYR A 1 512 ? 8.173   7.457   42.695  1.00 112.30 ? 512 TYR A CZ  1 
ATOM   2875 O OH  . TYR A 1 512 ? 8.870   8.623   42.915  1.00 110.23 ? 512 TYR A OH  1 
ATOM   2876 N N   . VAL A 1 513 ? 6.417   0.423   40.682  1.00 112.29 ? 513 VAL A N   1 
ATOM   2877 C CA  . VAL A 1 513 ? 5.717   -0.855  40.543  1.00 109.83 ? 513 VAL A CA  1 
ATOM   2878 C C   . VAL A 1 513 ? 4.210   -0.653  40.380  1.00 105.36 ? 513 VAL A C   1 
ATOM   2879 O O   . VAL A 1 513 ? 3.422   -1.005  41.259  1.00 100.57 ? 513 VAL A O   1 
ATOM   2880 C CB  . VAL A 1 513 ? 6.004   -1.803  41.734  1.00 112.37 ? 513 VAL A CB  1 
ATOM   2881 C CG1 . VAL A 1 513 ? 5.413   -3.184  41.474  1.00 112.58 ? 513 VAL A CG1 1 
ATOM   2882 C CG2 . VAL A 1 513 ? 7.504   -1.909  41.977  1.00 112.68 ? 513 VAL A CG2 1 
ATOM   2883 N N   . GLU A 1 514 ? 3.818   -0.078  39.248  1.00 103.21 ? 514 GLU A N   1 
ATOM   2884 C CA  . GLU A 1 514 ? 2.411   0.192   38.970  1.00 101.05 ? 514 GLU A CA  1 
ATOM   2885 C C   . GLU A 1 514 ? 2.072   -0.109  37.514  1.00 99.53  ? 514 GLU A C   1 
ATOM   2886 O O   . GLU A 1 514 ? 2.679   0.445   36.597  1.00 98.94  ? 514 GLU A O   1 
ATOM   2887 C CB  . GLU A 1 514 ? 2.066   1.647   39.305  1.00 99.58  ? 514 GLU A CB  1 
ATOM   2888 C CG  . GLU A 1 514 ? 0.640   2.054   38.961  1.00 99.81  ? 514 GLU A CG  1 
ATOM   2889 C CD  . GLU A 1 514 ? 0.401   3.545   39.119  1.00 99.48  ? 514 GLU A CD  1 
ATOM   2890 O OE1 . GLU A 1 514 ? 1.389   4.303   39.225  1.00 99.64  ? 514 GLU A OE1 1 
ATOM   2891 O OE2 . GLU A 1 514 ? -0.777  3.961   39.132  1.00 98.89  ? 514 GLU A OE2 1 
ATOM   2892 N N   . GLU A 1 515 ? 1.102   -0.995  37.313  1.00 97.50  ? 515 GLU A N   1 
ATOM   2893 C CA  . GLU A 1 515 ? 0.635   -1.332  35.974  1.00 94.48  ? 515 GLU A CA  1 
ATOM   2894 C C   . GLU A 1 515 ? -0.261  -0.221  35.441  1.00 90.37  ? 515 GLU A C   1 
ATOM   2895 O O   . GLU A 1 515 ? -1.318  0.061   36.006  1.00 91.33  ? 515 GLU A O   1 
ATOM   2896 C CB  . GLU A 1 515 ? -0.120  -2.662  35.985  1.00 97.67  ? 515 GLU A CB  1 
ATOM   2897 C CG  . GLU A 1 515 ? 0.732   -3.858  36.383  1.00 100.12 ? 515 GLU A CG  1 
ATOM   2898 C CD  . GLU A 1 515 ? -0.049  -5.159  36.390  1.00 100.99 ? 515 GLU A CD  1 
ATOM   2899 O OE1 . GLU A 1 515 ? -1.287  -5.116  36.220  1.00 101.39 ? 515 GLU A OE1 1 
ATOM   2900 O OE2 . GLU A 1 515 ? 0.575   -6.227  36.565  1.00 102.50 ? 515 GLU A OE2 1 
ATOM   2901 N N   . VAL A 1 516 ? 0.169   0.409   34.352  1.00 83.96  ? 516 VAL A N   1 
ATOM   2902 C CA  . VAL A 1 516 ? -0.548  1.553   33.801  1.00 77.27  ? 516 VAL A CA  1 
ATOM   2903 C C   . VAL A 1 516 ? -1.157  1.265   32.430  1.00 72.17  ? 516 VAL A C   1 
ATOM   2904 O O   . VAL A 1 516 ? -0.451  0.911   31.486  1.00 69.12  ? 516 VAL A O   1 
ATOM   2905 C CB  . VAL A 1 516 ? 0.366   2.794   33.698  1.00 80.81  ? 516 VAL A CB  1 
ATOM   2906 C CG1 . VAL A 1 516 ? -0.400  3.975   33.119  1.00 81.21  ? 516 VAL A CG1 1 
ATOM   2907 C CG2 . VAL A 1 516 ? 0.945   3.146   35.060  1.00 82.88  ? 516 VAL A CG2 1 
ATOM   2908 N N   . VAL A 1 517 ? -2.477  1.416   32.341  1.00 73.46  ? 517 VAL A N   1 
ATOM   2909 C CA  . VAL A 1 517 ? -3.193  1.353   31.072  1.00 69.16  ? 517 VAL A CA  1 
ATOM   2910 C C   . VAL A 1 517 ? -3.177  2.745   30.463  1.00 67.06  ? 517 VAL A C   1 
ATOM   2911 O O   . VAL A 1 517 ? -3.892  3.632   30.931  1.00 73.99  ? 517 VAL A O   1 
ATOM   2912 C CB  . VAL A 1 517 ? -4.672  0.984   31.273  1.00 71.13  ? 517 VAL A CB  1 
ATOM   2913 C CG1 . VAL A 1 517 ? -5.270  0.456   29.972  1.00 72.22  ? 517 VAL A CG1 1 
ATOM   2914 C CG2 . VAL A 1 517 ? -4.837  -0.017  32.408  1.00 72.59  ? 517 VAL A CG2 1 
ATOM   2915 N N   . PRO A 1 518 ? -2.370  2.948   29.413  1.00 62.04  ? 518 PRO A N   1 
ATOM   2916 C CA  . PRO A 1 518 ? -2.228  4.293   28.870  1.00 62.38  ? 518 PRO A CA  1 
ATOM   2917 C C   . PRO A 1 518 ? -3.422  4.726   28.024  1.00 58.50  ? 518 PRO A C   1 
ATOM   2918 O O   . PRO A 1 518 ? -4.012  3.908   27.320  1.00 60.74  ? 518 PRO A O   1 
ATOM   2919 C CB  . PRO A 1 518 ? -0.977  4.181   27.997  1.00 57.98  ? 518 PRO A CB  1 
ATOM   2920 C CG  . PRO A 1 518 ? -0.954  2.762   27.561  1.00 56.22  ? 518 PRO A CG  1 
ATOM   2921 C CD  . PRO A 1 518 ? -1.561  1.959   28.680  1.00 60.02  ? 518 PRO A CD  1 
ATOM   2922 N N   . ASN A 1 519 ? -3.772  6.006   28.106  1.00 56.46  ? 519 ASN A N   1 
ATOM   2923 C CA  . ASN A 1 519 ? -4.770  6.584   27.216  1.00 54.69  ? 519 ASN A CA  1 
ATOM   2924 C C   . ASN A 1 519 ? -4.163  6.765   25.833  1.00 47.51  ? 519 ASN A C   1 
ATOM   2925 O O   . ASN A 1 519 ? -2.943  6.722   25.679  1.00 48.47  ? 519 ASN A O   1 
ATOM   2926 C CB  . ASN A 1 519 ? -5.261  7.931   27.751  1.00 62.42  ? 519 ASN A CB  1 
ATOM   2927 C CG  . ASN A 1 519 ? -6.001  7.803   29.069  1.00 64.42  ? 519 ASN A CG  1 
ATOM   2928 O OD1 . ASN A 1 519 ? -6.176  6.703   29.595  1.00 70.99  ? 519 ASN A OD1 1 
ATOM   2929 N ND2 . ASN A 1 519 ? -6.440  8.933   29.610  1.00 59.47  ? 519 ASN A ND2 1 
ATOM   2930 N N   . VAL A 1 520 ? -5.004  6.965   24.825  1.00 43.66  ? 520 VAL A N   1 
ATOM   2931 C CA  . VAL A 1 520 ? -4.502  7.102   23.463  1.00 45.16  ? 520 VAL A CA  1 
ATOM   2932 C C   . VAL A 1 520 ? -5.205  8.199   22.662  1.00 47.40  ? 520 VAL A C   1 
ATOM   2933 O O   . VAL A 1 520 ? -6.434  8.249   22.590  1.00 44.56  ? 520 VAL A O   1 
ATOM   2934 C CB  . VAL A 1 520 ? -4.560  5.759   22.695  1.00 46.42  ? 520 VAL A CB  1 
ATOM   2935 C CG1 . VAL A 1 520 ? -6.001  5.362   22.403  1.00 43.57  ? 520 VAL A CG1 1 
ATOM   2936 C CG2 . VAL A 1 520 ? -3.750  5.846   21.410  1.00 48.20  ? 520 VAL A CG2 1 
ATOM   2937 N N   . ILE A 1 521 ? -4.408  9.084   22.072  1.00 49.67  ? 521 ILE A N   1 
ATOM   2938 C CA  . ILE A 1 521 ? -4.919  10.076  21.137  1.00 45.20  ? 521 ILE A CA  1 
ATOM   2939 C C   . ILE A 1 521 ? -4.621  9.588   19.724  1.00 42.19  ? 521 ILE A C   1 
ATOM   2940 O O   . ILE A 1 521 ? -3.459  9.435   19.343  1.00 35.52  ? 521 ILE A O   1 
ATOM   2941 C CB  . ILE A 1 521 ? -4.296  11.469  21.369  1.00 41.15  ? 521 ILE A CB  1 
ATOM   2942 C CG1 . ILE A 1 521 ? -4.839  12.097  22.656  1.00 43.53  ? 521 ILE A CG1 1 
ATOM   2943 C CG2 . ILE A 1 521 ? -4.586  12.389  20.194  1.00 38.27  ? 521 ILE A CG2 1 
ATOM   2944 C CD1 . ILE A 1 521 ? -4.291  11.486  23.931  1.00 44.83  ? 521 ILE A CD1 1 
ATOM   2945 N N   . GLU A 1 522 ? -5.674  9.329   18.957  1.00 36.22  ? 522 GLU A N   1 
ATOM   2946 C CA  . GLU A 1 522 ? -5.520  8.704   17.648  1.00 35.11  ? 522 GLU A CA  1 
ATOM   2947 C C   . GLU A 1 522 ? -6.036  9.560   16.494  1.00 28.60  ? 522 GLU A C   1 
ATOM   2948 O O   . GLU A 1 522 ? -7.197  9.446   16.102  1.00 39.73  ? 522 GLU A O   1 
ATOM   2949 C CB  . GLU A 1 522 ? -6.181  7.320   17.634  1.00 40.26  ? 522 GLU A CB  1 
ATOM   2950 C CG  . GLU A 1 522 ? -7.546  7.262   18.306  1.00 49.71  ? 522 GLU A CG  1 
ATOM   2951 C CD  . GLU A 1 522 ? -8.112  5.854   18.364  1.00 53.31  ? 522 GLU A CD  1 
ATOM   2952 O OE1 . GLU A 1 522 ? -7.325  4.887   18.275  1.00 50.05  ? 522 GLU A OE1 1 
ATOM   2953 O OE2 . GLU A 1 522 ? -9.346  5.714   18.502  1.00 56.29  ? 522 GLU A OE2 1 
ATOM   2954 N N   . PRO A 1 523 ? -5.166  10.422  15.944  1.00 31.37  ? 523 PRO A N   1 
ATOM   2955 C CA  . PRO A 1 523 ? -5.493  11.211  14.761  1.00 32.23  ? 523 PRO A CA  1 
ATOM   2956 C C   . PRO A 1 523 ? -5.387  10.371  13.491  1.00 34.69  ? 523 PRO A C   1 
ATOM   2957 O O   . PRO A 1 523 ? -4.306  9.883   13.161  1.00 38.63  ? 523 PRO A O   1 
ATOM   2958 C CB  . PRO A 1 523 ? -4.418  12.311  14.754  1.00 24.84  ? 523 PRO A CB  1 
ATOM   2959 C CG  . PRO A 1 523 ? -3.606  12.121  16.012  1.00 19.62  ? 523 PRO A CG  1 
ATOM   2960 C CD  . PRO A 1 523 ? -3.809  10.709  16.432  1.00 22.63  ? 523 PRO A CD  1 
ATOM   2961 N N   . SER A 1 524 ? -6.505  10.203  12.790  1.00 29.77  ? 524 SER A N   1 
ATOM   2962 C CA  . SER A 1 524 ? -6.524  9.433   11.551  1.00 27.50  ? 524 SER A CA  1 
ATOM   2963 C C   . SER A 1 524 ? -6.756  10.336  10.343  1.00 29.22  ? 524 SER A C   1 
ATOM   2964 O O   . SER A 1 524 ? -7.768  11.033  10.262  1.00 29.01  ? 524 SER A O   1 
ATOM   2965 C CB  . SER A 1 524 ? -7.593  8.337   11.612  1.00 31.70  ? 524 SER A CB  1 
ATOM   2966 O OG  . SER A 1 524 ? -8.879  8.887   11.838  1.00 48.50  ? 524 SER A OG  1 
ATOM   2967 N N   . PHE A 1 525 ? -5.812  10.313  9.406   1.00 31.95  ? 525 PHE A N   1 
ATOM   2968 C CA  . PHE A 1 525 ? -5.861  11.175  8.227   1.00 33.64  ? 525 PHE A CA  1 
ATOM   2969 C C   . PHE A 1 525 ? -6.358  10.421  6.991   1.00 31.33  ? 525 PHE A C   1 
ATOM   2970 O O   . PHE A 1 525 ? -5.756  9.433   6.574   1.00 34.38  ? 525 PHE A O   1 
ATOM   2971 C CB  . PHE A 1 525 ? -4.478  11.773  7.951   1.00 29.49  ? 525 PHE A CB  1 
ATOM   2972 C CG  . PHE A 1 525 ? -3.905  12.549  9.108   1.00 30.37  ? 525 PHE A CG  1 
ATOM   2973 C CD1 . PHE A 1 525 ? -3.442  11.895  10.240  1.00 32.63  ? 525 PHE A CD1 1 
ATOM   2974 C CD2 . PHE A 1 525 ? -3.815  13.930  9.057   1.00 28.82  ? 525 PHE A CD2 1 
ATOM   2975 C CE1 . PHE A 1 525 ? -2.911  12.603  11.302  1.00 32.80  ? 525 PHE A CE1 1 
ATOM   2976 C CE2 . PHE A 1 525 ? -3.285  14.645  10.115  1.00 29.45  ? 525 PHE A CE2 1 
ATOM   2977 C CZ  . PHE A 1 525 ? -2.833  13.980  11.239  1.00 33.31  ? 525 PHE A CZ  1 
ATOM   2978 N N   . GLY A 1 526 ? -7.460  10.893  6.413   1.00 34.17  ? 526 GLY A N   1 
ATOM   2979 C CA  . GLY A 1 526 ? -8.023  10.299  5.197   1.00 36.10  ? 526 GLY A CA  1 
ATOM   2980 C C   . GLY A 1 526 ? -7.534  11.071  3.986   1.00 39.38  ? 526 GLY A C   1 
ATOM   2981 O O   . GLY A 1 526 ? -8.067  12.134  3.662   1.00 40.01  ? 526 GLY A O   1 
ATOM   2982 N N   . LEU A 1 527 ? -6.531  10.519  3.307   1.00 39.68  ? 527 LEU A N   1 
ATOM   2983 C CA  . LEU A 1 527 ? -5.696  11.303  2.395   1.00 38.09  ? 527 LEU A CA  1 
ATOM   2984 C C   . LEU A 1 527 ? -6.351  11.656  1.067   1.00 36.47  ? 527 LEU A C   1 
ATOM   2985 O O   . LEU A 1 527 ? -6.008  12.664  0.447   1.00 35.07  ? 527 LEU A O   1 
ATOM   2986 C CB  . LEU A 1 527 ? -4.374  10.577  2.147   1.00 39.58  ? 527 LEU A CB  1 
ATOM   2987 C CG  . LEU A 1 527 ? -3.561  10.246  3.400   1.00 41.05  ? 527 LEU A CG  1 
ATOM   2988 C CD1 . LEU A 1 527 ? -2.399  9.330   3.050   1.00 37.71  ? 527 LEU A CD1 1 
ATOM   2989 C CD2 . LEU A 1 527 ? -3.057  11.516  4.071   1.00 41.36  ? 527 LEU A CD2 1 
ATOM   2990 N N   . GLY A 1 528 ? -7.280  10.816  0.627   1.00 24.79  ? 528 GLY A N   1 
ATOM   2991 C CA  . GLY A 1 528 ? -8.026  11.083  -0.594  1.00 29.66  ? 528 GLY A CA  1 
ATOM   2992 C C   . GLY A 1 528 ? -8.957  12.261  -0.397  1.00 34.33  ? 528 GLY A C   1 
ATOM   2993 O O   . GLY A 1 528 ? -9.082  13.122  -1.270  1.00 33.54  ? 528 GLY A O   1 
ATOM   2994 N N   . ARG A 1 529 ? -9.610  12.297  0.761   1.00 28.14  ? 529 ARG A N   1 
ATOM   2995 C CA  . ARG A 1 529 ? -10.503 13.396  1.104   1.00 34.67  ? 529 ARG A CA  1 
ATOM   2996 C C   . ARG A 1 529 ? -9.724  14.685  1.320   1.00 35.90  ? 529 ARG A C   1 
ATOM   2997 O O   . ARG A 1 529 ? -10.119 15.746  0.837   1.00 37.57  ? 529 ARG A O   1 
ATOM   2998 C CB  . ARG A 1 529 ? -11.314 13.061  2.352   1.00 35.21  ? 529 ARG A CB  1 
ATOM   2999 C CG  . ARG A 1 529 ? -12.312 11.945  2.149   1.00 37.19  ? 529 ARG A CG  1 
ATOM   3000 C CD  . ARG A 1 529 ? -13.194 11.794  3.364   1.00 37.01  ? 529 ARG A CD  1 
ATOM   3001 N NE  . ARG A 1 529 ? -14.242 10.804  3.150   1.00 44.42  ? 529 ARG A NE  1 
ATOM   3002 C CZ  . ARG A 1 529 ? -15.263 10.613  3.977   1.00 46.99  ? 529 ARG A CZ  1 
ATOM   3003 N NH1 . ARG A 1 529 ? -15.374 11.349  5.074   1.00 42.04  ? 529 ARG A NH1 1 
ATOM   3004 N NH2 . ARG A 1 529 ? -16.175 9.688   3.706   1.00 48.47  ? 529 ARG A NH2 1 
ATOM   3005 N N   . ILE A 1 530 ? -8.618  14.591  2.052   1.00 27.87  ? 530 ILE A N   1 
ATOM   3006 C CA  . ILE A 1 530 ? -7.729  15.728  2.223   1.00 26.92  ? 530 ILE A CA  1 
ATOM   3007 C C   . ILE A 1 530 ? -7.359  16.274  0.852   1.00 26.76  ? 530 ILE A C   1 
ATOM   3008 O O   . ILE A 1 530 ? -7.441  17.476  0.607   1.00 26.58  ? 530 ILE A O   1 
ATOM   3009 C CB  . ILE A 1 530 ? -6.443  15.339  2.981   1.00 26.85  ? 530 ILE A CB  1 
ATOM   3010 C CG1 . ILE A 1 530 ? -6.766  14.984  4.434   1.00 25.80  ? 530 ILE A CG1 1 
ATOM   3011 C CG2 . ILE A 1 530 ? -5.424  16.470  2.927   1.00 18.86  ? 530 ILE A CG2 1 
ATOM   3012 C CD1 . ILE A 1 530 ? -5.571  14.487  5.225   1.00 28.84  ? 530 ILE A CD1 1 
ATOM   3013 N N   . MET A 1 531 ? -6.973  15.371  -0.044  1.00 32.41  ? 531 MET A N   1 
ATOM   3014 C CA  . MET A 1 531 ? -6.535  15.738  -1.384  1.00 36.68  ? 531 MET A CA  1 
ATOM   3015 C C   . MET A 1 531 ? -7.654  16.387  -2.189  1.00 34.17  ? 531 MET A C   1 
ATOM   3016 O O   . MET A 1 531 ? -7.430  17.369  -2.897  1.00 35.76  ? 531 MET A O   1 
ATOM   3017 C CB  . MET A 1 531 ? -6.015  14.504  -2.120  1.00 39.59  ? 531 MET A CB  1 
ATOM   3018 C CG  . MET A 1 531 ? -4.949  14.802  -3.155  1.00 46.05  ? 531 MET A CG  1 
ATOM   3019 S SD  . MET A 1 531 ? -4.257  13.297  -3.866  1.00 51.90  ? 531 MET A SD  1 
ATOM   3020 C CE  . MET A 1 531 ? -3.861  12.374  -2.384  1.00 45.60  ? 531 MET A CE  1 
ATOM   3021 N N   . TYR A 1 532 ? -8.857  15.833  -2.080  1.00 35.19  ? 532 TYR A N   1 
ATOM   3022 C CA  . TYR A 1 532 ? -10.001 16.367  -2.804  1.00 28.52  ? 532 TYR A CA  1 
ATOM   3023 C C   . TYR A 1 532 ? -10.390 17.736  -2.265  1.00 28.81  ? 532 TYR A C   1 
ATOM   3024 O O   . TYR A 1 532 ? -10.826 18.609  -3.015  1.00 28.77  ? 532 TYR A O   1 
ATOM   3025 C CB  . TYR A 1 532 ? -11.191 15.413  -2.729  1.00 35.81  ? 532 TYR A CB  1 
ATOM   3026 C CG  . TYR A 1 532 ? -12.370 15.887  -3.541  1.00 39.16  ? 532 TYR A CG  1 
ATOM   3027 C CD1 . TYR A 1 532 ? -12.408 15.701  -4.916  1.00 40.80  ? 532 TYR A CD1 1 
ATOM   3028 C CD2 . TYR A 1 532 ? -13.439 16.536  -2.937  1.00 37.31  ? 532 TYR A CD2 1 
ATOM   3029 C CE1 . TYR A 1 532 ? -13.480 16.140  -5.667  1.00 40.67  ? 532 TYR A CE1 1 
ATOM   3030 C CE2 . TYR A 1 532 ? -14.515 16.979  -3.679  1.00 36.88  ? 532 TYR A CE2 1 
ATOM   3031 C CZ  . TYR A 1 532 ? -14.531 16.779  -5.044  1.00 37.55  ? 532 TYR A CZ  1 
ATOM   3032 O OH  . TYR A 1 532 ? -15.602 17.217  -5.788  1.00 37.90  ? 532 TYR A OH  1 
ATOM   3033 N N   . THR A 1 533 ? -10.230 17.914  -0.958  1.00 29.26  ? 533 THR A N   1 
ATOM   3034 C CA  . THR A 1 533 ? -10.488 19.194  -0.323  1.00 27.24  ? 533 THR A CA  1 
ATOM   3035 C C   . THR A 1 533 ? -9.539  20.242  -0.888  1.00 34.49  ? 533 THR A C   1 
ATOM   3036 O O   . THR A 1 533 ? -9.932  21.383  -1.133  1.00 35.36  ? 533 THR A O   1 
ATOM   3037 C CB  . THR A 1 533 ? -10.296 19.110  1.197   1.00 30.91  ? 533 THR A CB  1 
ATOM   3038 O OG1 . THR A 1 533 ? -11.017 17.983  1.711   1.00 32.73  ? 533 THR A OG1 1 
ATOM   3039 C CG2 . THR A 1 533 ? -10.790 20.381  1.866   1.00 29.79  ? 533 THR A CG2 1 
ATOM   3040 N N   . VAL A 1 534 ? -8.287  19.843  -1.098  1.00 36.83  ? 534 VAL A N   1 
ATOM   3041 C CA  . VAL A 1 534 ? -7.293  20.732  -1.685  1.00 40.95  ? 534 VAL A CA  1 
ATOM   3042 C C   . VAL A 1 534 ? -7.677  21.079  -3.120  1.00 40.45  ? 534 VAL A C   1 
ATOM   3043 O O   . VAL A 1 534 ? -7.546  22.226  -3.541  1.00 34.01  ? 534 VAL A O   1 
ATOM   3044 C CB  . VAL A 1 534 ? -5.882  20.116  -1.657  1.00 37.00  ? 534 VAL A CB  1 
ATOM   3045 C CG1 . VAL A 1 534 ? -4.854  21.123  -2.147  1.00 35.06  ? 534 VAL A CG1 1 
ATOM   3046 C CG2 . VAL A 1 534 ? -5.538  19.656  -0.255  1.00 41.49  ? 534 VAL A CG2 1 
ATOM   3047 N N   . PHE A 1 535 ? -8.160  20.087  -3.862  1.00 37.42  ? 535 PHE A N   1 
ATOM   3048 C CA  . PHE A 1 535 ? -8.628  20.322  -5.222  1.00 35.41  ? 535 PHE A CA  1 
ATOM   3049 C C   . PHE A 1 535 ? -9.693  21.411  -5.241  1.00 38.85  ? 535 PHE A C   1 
ATOM   3050 O O   . PHE A 1 535 ? -9.656  22.314  -6.075  1.00 50.54  ? 535 PHE A O   1 
ATOM   3051 C CB  . PHE A 1 535 ? -9.207  19.046  -5.837  1.00 34.08  ? 535 PHE A CB  1 
ATOM   3052 C CG  . PHE A 1 535 ? -8.186  17.981  -6.113  1.00 34.98  ? 535 PHE A CG  1 
ATOM   3053 C CD1 . PHE A 1 535 ? -8.490  16.646  -5.910  1.00 30.29  ? 535 PHE A CD1 1 
ATOM   3054 C CD2 . PHE A 1 535 ? -6.923  18.313  -6.577  1.00 37.38  ? 535 PHE A CD2 1 
ATOM   3055 C CE1 . PHE A 1 535 ? -7.557  15.660  -6.165  1.00 32.53  ? 535 PHE A CE1 1 
ATOM   3056 C CE2 . PHE A 1 535 ? -5.984  17.331  -6.833  1.00 35.65  ? 535 PHE A CE2 1 
ATOM   3057 C CZ  . PHE A 1 535 ? -6.302  16.003  -6.626  1.00 33.79  ? 535 PHE A CZ  1 
ATOM   3058 N N   . GLU A 1 536 ? -10.638 21.320  -4.310  1.00 43.08  ? 536 GLU A N   1 
ATOM   3059 C CA  . GLU A 1 536 ? -11.800 22.208  -4.299  1.00 39.77  ? 536 GLU A CA  1 
ATOM   3060 C C   . GLU A 1 536 ? -11.513 23.603  -3.753  1.00 40.07  ? 536 GLU A C   1 
ATOM   3061 O O   . GLU A 1 536 ? -12.164 24.571  -4.143  1.00 44.37  ? 536 GLU A O   1 
ATOM   3062 C CB  . GLU A 1 536 ? -12.949 21.583  -3.508  1.00 38.07  ? 536 GLU A CB  1 
ATOM   3063 C CG  . GLU A 1 536 ? -13.801 20.614  -4.303  1.00 45.29  ? 536 GLU A CG  1 
ATOM   3064 C CD  . GLU A 1 536 ? -15.196 20.472  -3.729  1.00 52.95  ? 536 GLU A CD  1 
ATOM   3065 O OE1 . GLU A 1 536 ? -15.943 19.582  -4.187  1.00 55.01  ? 536 GLU A OE1 1 
ATOM   3066 O OE2 . GLU A 1 536 ? -15.549 21.256  -2.822  1.00 54.57  ? 536 GLU A OE2 1 
ATOM   3067 N N   . HIS A 1 537 ? -10.548 23.701  -2.848  1.00 36.87  ? 537 HIS A N   1 
ATOM   3068 C CA  . HIS A 1 537 ? -10.213 24.973  -2.219  1.00 29.78  ? 537 HIS A CA  1 
ATOM   3069 C C   . HIS A 1 537 ? -9.141  25.700  -3.007  1.00 28.49  ? 537 HIS A C   1 
ATOM   3070 O O   . HIS A 1 537 ? -8.687  26.777  -2.619  1.00 37.79  ? 537 HIS A O   1 
ATOM   3071 C CB  . HIS A 1 537 ? -9.708  24.730  -0.803  1.00 29.23  ? 537 HIS A CB  1 
ATOM   3072 C CG  . HIS A 1 537 ? -10.770 24.271  0.141   1.00 31.08  ? 537 HIS A CG  1 
ATOM   3073 N ND1 . HIS A 1 537 ? -10.629 24.348  1.509   1.00 31.77  ? 537 HIS A ND1 1 
ATOM   3074 C CD2 . HIS A 1 537 ? -11.999 23.748  -0.084  1.00 26.19  ? 537 HIS A CD2 1 
ATOM   3075 C CE1 . HIS A 1 537 ? -11.719 23.877  2.087   1.00 32.27  ? 537 HIS A CE1 1 
ATOM   3076 N NE2 . HIS A 1 537 ? -12.567 23.510  1.143   1.00 28.60  ? 537 HIS A NE2 1 
ATOM   3077 N N   . THR A 1 538 ? -8.744  25.102  -4.121  1.00 35.44  ? 538 THR A N   1 
ATOM   3078 C CA  . THR A 1 538 ? -7.578  25.557  -4.854  1.00 34.66  ? 538 THR A CA  1 
ATOM   3079 C C   . THR A 1 538 ? -7.883  25.761  -6.336  1.00 34.14  ? 538 THR A C   1 
ATOM   3080 O O   . THR A 1 538 ? -7.181  26.500  -7.028  1.00 25.34  ? 538 THR A O   1 
ATOM   3081 C CB  . THR A 1 538 ? -6.414  24.568  -4.651  1.00 36.75  ? 538 THR A CB  1 
ATOM   3082 O OG1 . THR A 1 538 ? -5.650  24.962  -3.504  1.00 37.15  ? 538 THR A OG1 1 
ATOM   3083 C CG2 . THR A 1 538 ? -5.515  24.526  -5.857  1.00 46.47  ? 538 THR A CG2 1 
ATOM   3084 N N   . PHE A 1 539 ? -8.941  25.113  -6.813  1.00 32.11  ? 539 PHE A N   1 
ATOM   3085 C CA  . PHE A 1 539 ? -9.361  25.247  -8.202  1.00 36.67  ? 539 PHE A CA  1 
ATOM   3086 C C   . PHE A 1 539 ? -9.877  26.654  -8.483  1.00 40.04  ? 539 PHE A C   1 
ATOM   3087 O O   . PHE A 1 539 ? -10.792 27.133  -7.814  1.00 50.03  ? 539 PHE A O   1 
ATOM   3088 C CB  . PHE A 1 539 ? -10.443 24.217  -8.533  1.00 43.25  ? 539 PHE A CB  1 
ATOM   3089 C CG  . PHE A 1 539 ? -10.894 24.246  -9.966  1.00 44.11  ? 539 PHE A CG  1 
ATOM   3090 C CD1 . PHE A 1 539 ? -12.037 24.937  -10.334 1.00 45.67  ? 539 PHE A CD1 1 
ATOM   3091 C CD2 . PHE A 1 539 ? -10.176 23.578  -10.944 1.00 43.09  ? 539 PHE A CD2 1 
ATOM   3092 C CE1 . PHE A 1 539 ? -12.455 24.963  -11.653 1.00 47.12  ? 539 PHE A CE1 1 
ATOM   3093 C CE2 . PHE A 1 539 ? -10.590 23.600  -12.263 1.00 41.28  ? 539 PHE A CE2 1 
ATOM   3094 C CZ  . PHE A 1 539 ? -11.728 24.293  -12.619 1.00 44.14  ? 539 PHE A CZ  1 
ATOM   3095 N N   . HIS A 1 540 ? -9.282  27.312  -9.473  1.00 45.98  ? 540 HIS A N   1 
ATOM   3096 C CA  . HIS A 1 540 ? -9.712  28.649  -9.872  1.00 48.09  ? 540 HIS A CA  1 
ATOM   3097 C C   . HIS A 1 540 ? -9.841  28.770  -11.387 1.00 53.57  ? 540 HIS A C   1 
ATOM   3098 O O   . HIS A 1 540 ? -9.200  28.033  -12.138 1.00 54.05  ? 540 HIS A O   1 
ATOM   3099 C CB  . HIS A 1 540 ? -8.743  29.713  -9.352  1.00 47.14  ? 540 HIS A CB  1 
ATOM   3100 C CG  . HIS A 1 540 ? -8.633  29.762  -7.860  1.00 49.38  ? 540 HIS A CG  1 
ATOM   3101 N ND1 . HIS A 1 540 ? -9.714  30.005  -7.041  1.00 51.12  ? 540 HIS A ND1 1 
ATOM   3102 C CD2 . HIS A 1 540 ? -7.565  29.617  -7.040  1.00 48.93  ? 540 HIS A CD2 1 
ATOM   3103 C CE1 . HIS A 1 540 ? -9.320  29.996  -5.780  1.00 53.04  ? 540 HIS A CE1 1 
ATOM   3104 N NE2 . HIS A 1 540 ? -8.020  29.763  -5.752  1.00 50.96  ? 540 HIS A NE2 1 
ATOM   3105 N N   . VAL A 1 541 ? -10.676 29.708  -11.826 1.00 58.58  ? 541 VAL A N   1 
ATOM   3106 C CA  . VAL A 1 541 ? -10.854 29.990  -13.246 1.00 59.60  ? 541 VAL A CA  1 
ATOM   3107 C C   . VAL A 1 541 ? -10.332 31.390  -13.560 1.00 59.68  ? 541 VAL A C   1 
ATOM   3108 O O   . VAL A 1 541 ? -10.624 32.345  -12.839 1.00 66.31  ? 541 VAL A O   1 
ATOM   3109 C CB  . VAL A 1 541 ? -12.334 29.884  -13.662 1.00 61.88  ? 541 VAL A CB  1 
ATOM   3110 C CG1 . VAL A 1 541 ? -12.495 30.198  -15.140 1.00 60.23  ? 541 VAL A CG1 1 
ATOM   3111 C CG2 . VAL A 1 541 ? -12.878 28.497  -13.346 1.00 62.39  ? 541 VAL A CG2 1 
ATOM   3112 N N   . ARG A 1 542 ? -9.562  31.507  -14.636 1.00 56.22  ? 542 ARG A N   1 
ATOM   3113 C CA  . ARG A 1 542 ? -8.890  32.763  -14.963 1.00 58.31  ? 542 ARG A CA  1 
ATOM   3114 C C   . ARG A 1 542 ? -9.750  33.782  -15.714 1.00 62.37  ? 542 ARG A C   1 
ATOM   3115 O O   . ARG A 1 542 ? -10.814 33.457  -16.242 1.00 59.29  ? 542 ARG A O   1 
ATOM   3116 C CB  . ARG A 1 542 ? -7.595  32.492  -15.734 1.00 52.91  ? 542 ARG A CB  1 
ATOM   3117 C CG  . ARG A 1 542 ? -6.406  32.181  -14.838 1.00 52.66  ? 542 ARG A CG  1 
ATOM   3118 C CD  . ARG A 1 542 ? -5.259  31.572  -15.628 1.00 51.40  ? 542 ARG A CD  1 
ATOM   3119 N NE  . ARG A 1 542 ? -4.037  31.389  -14.842 1.00 50.12  ? 542 ARG A NE  1 
ATOM   3120 C CZ  . ARG A 1 542 ? -3.725  32.067  -13.739 1.00 48.42  ? 542 ARG A CZ  1 
ATOM   3121 N NH1 . ARG A 1 542 ? -4.539  32.999  -13.263 1.00 48.78  ? 542 ARG A NH1 1 
ATOM   3122 N NH2 . ARG A 1 542 ? -2.585  31.813  -13.111 1.00 44.38  ? 542 ARG A NH2 1 
ATOM   3123 N N   . GLU A 1 543 ? -9.256  35.019  -15.743 1.00 73.60  ? 543 GLU A N   1 
ATOM   3124 C CA  . GLU A 1 543 ? -9.882  36.137  -16.452 1.00 79.57  ? 543 GLU A CA  1 
ATOM   3125 C C   . GLU A 1 543 ? -10.262 35.825  -17.895 1.00 81.58  ? 543 GLU A C   1 
ATOM   3126 O O   . GLU A 1 543 ? -11.218 36.392  -18.426 1.00 83.19  ? 543 GLU A O   1 
ATOM   3127 C CB  . GLU A 1 543 ? -8.936  37.337  -16.464 1.00 86.78  ? 543 GLU A CB  1 
ATOM   3128 C CG  . GLU A 1 543 ? -9.173  38.357  -15.375 1.00 91.16  ? 543 GLU A CG  1 
ATOM   3129 C CD  . GLU A 1 543 ? -8.540  39.695  -15.708 1.00 91.97  ? 543 GLU A CD  1 
ATOM   3130 O OE1 . GLU A 1 543 ? -7.584  39.719  -16.513 1.00 91.67  ? 543 GLU A OE1 1 
ATOM   3131 O OE2 . GLU A 1 543 ? -8.999  40.723  -15.168 1.00 92.17  ? 543 GLU A OE2 1 
ATOM   3132 N N   . GLY A 1 544 ? -9.495  34.941  -18.528 1.00 88.37  ? 544 GLY A N   1 
ATOM   3133 C CA  . GLY A 1 544 ? -9.706  34.571  -19.927 1.00 89.51  ? 544 GLY A CA  1 
ATOM   3134 C C   . GLY A 1 544 ? -11.029 35.038  -20.504 1.00 93.69  ? 544 GLY A C   1 
ATOM   3135 O O   . GLY A 1 544 ? -11.566 34.425  -21.427 1.00 95.10  ? 544 GLY A O   1 
ATOM   3136 N N   . GLN A 1 547 ? -11.520 30.402  -21.770 1.00 64.15  ? 547 GLN A N   1 
ATOM   3137 C CA  . GLN A 1 547 ? -11.811 29.966  -20.409 1.00 66.83  ? 547 GLN A CA  1 
ATOM   3138 C C   . GLN A 1 547 ? -10.731 29.018  -19.900 1.00 70.14  ? 547 GLN A C   1 
ATOM   3139 O O   . GLN A 1 547 ? -10.800 27.807  -20.120 1.00 62.76  ? 547 GLN A O   1 
ATOM   3140 C CB  . GLN A 1 547 ? -13.178 29.303  -20.347 1.00 68.85  ? 547 GLN A CB  1 
ATOM   3141 N N   . ARG A 1 548 ? -9.733  29.576  -19.220 1.00 71.24  ? 548 ARG A N   1 
ATOM   3142 C CA  . ARG A 1 548 ? -8.612  28.787  -18.716 1.00 61.06  ? 548 ARG A CA  1 
ATOM   3143 C C   . ARG A 1 548 ? -8.775  28.419  -17.243 1.00 55.57  ? 548 ARG A C   1 
ATOM   3144 O O   . ARG A 1 548 ? -9.623  28.972  -16.542 1.00 58.00  ? 548 ARG A O   1 
ATOM   3145 C CB  . ARG A 1 548 ? -7.289  29.522  -18.945 1.00 56.69  ? 548 ARG A CB  1 
ATOM   3146 C CG  . ARG A 1 548 ? -6.863  29.573  -20.404 1.00 56.65  ? 548 ARG A CG  1 
ATOM   3147 C CD  . ARG A 1 548 ? -5.518  30.260  -20.571 1.00 61.34  ? 548 ARG A CD  1 
ATOM   3148 N NE  . ARG A 1 548 ? -5.052  30.215  -21.954 1.00 62.20  ? 548 ARG A NE  1 
ATOM   3149 C CZ  . ARG A 1 548 ? -3.924  30.773  -22.383 1.00 64.00  ? 548 ARG A CZ  1 
ATOM   3150 N NH1 . ARG A 1 548 ? -3.138  31.424  -21.536 1.00 67.74  ? 548 ARG A NH1 1 
ATOM   3151 N NH2 . ARG A 1 548 ? -3.582  30.680  -23.661 1.00 63.49  ? 548 ARG A NH2 1 
ATOM   3152 N N   . THR A 1 549 ? -7.951  27.482  -16.784 1.00 54.60  ? 549 THR A N   1 
ATOM   3153 C CA  . THR A 1 549 ? -8.067  26.932  -15.439 1.00 47.58  ? 549 THR A CA  1 
ATOM   3154 C C   . THR A 1 549 ? -6.702  26.751  -14.783 1.00 43.15  ? 549 THR A C   1 
ATOM   3155 O O   . THR A 1 549 ? -5.721  26.432  -15.456 1.00 47.89  ? 549 THR A O   1 
ATOM   3156 C CB  . THR A 1 549 ? -8.798  25.572  -15.470 1.00 48.19  ? 549 THR A CB  1 
ATOM   3157 O OG1 . THR A 1 549 ? -10.205 25.780  -15.297 1.00 48.50  ? 549 THR A OG1 1 
ATOM   3158 C CG2 . THR A 1 549 ? -8.289  24.653  -14.370 1.00 47.96  ? 549 THR A CG2 1 
ATOM   3159 N N   . PHE A 1 550 ? -6.641  26.959  -13.470 1.00 36.96  ? 550 PHE A N   1 
ATOM   3160 C CA  . PHE A 1 550 ? -5.412  26.700  -12.723 1.00 45.80  ? 550 PHE A CA  1 
ATOM   3161 C C   . PHE A 1 550 ? -5.665  26.292  -11.271 1.00 43.49  ? 550 PHE A C   1 
ATOM   3162 O O   . PHE A 1 550 ? -6.614  26.754  -10.637 1.00 42.23  ? 550 PHE A O   1 
ATOM   3163 C CB  . PHE A 1 550 ? -4.465  27.904  -12.785 1.00 35.20  ? 550 PHE A CB  1 
ATOM   3164 C CG  . PHE A 1 550 ? -4.810  29.006  -11.823 1.00 32.67  ? 550 PHE A CG  1 
ATOM   3165 C CD1 . PHE A 1 550 ? -4.100  29.159  -10.642 1.00 29.71  ? 550 PHE A CD1 1 
ATOM   3166 C CD2 . PHE A 1 550 ? -5.837  29.894  -12.102 1.00 32.13  ? 550 PHE A CD2 1 
ATOM   3167 C CE1 . PHE A 1 550 ? -4.409  30.175  -9.754  1.00 35.57  ? 550 PHE A CE1 1 
ATOM   3168 C CE2 . PHE A 1 550 ? -6.152  30.913  -11.220 1.00 35.77  ? 550 PHE A CE2 1 
ATOM   3169 C CZ  . PHE A 1 550 ? -5.437  31.054  -10.043 1.00 35.54  ? 550 PHE A CZ  1 
ATOM   3170 N N   . PHE A 1 551 ? -4.809  25.413  -10.762 1.00 40.10  ? 551 PHE A N   1 
ATOM   3171 C CA  . PHE A 1 551 ? -4.832  25.032  -9.358  1.00 31.59  ? 551 PHE A CA  1 
ATOM   3172 C C   . PHE A 1 551 ? -3.789  25.843  -8.596  1.00 27.63  ? 551 PHE A C   1 
ATOM   3173 O O   . PHE A 1 551 ? -2.627  25.892  -8.992  1.00 29.41  ? 551 PHE A O   1 
ATOM   3174 C CB  . PHE A 1 551 ? -4.532  23.542  -9.198  1.00 26.26  ? 551 PHE A CB  1 
ATOM   3175 C CG  . PHE A 1 551 ? -5.707  22.647  -9.472  1.00 27.42  ? 551 PHE A CG  1 
ATOM   3176 C CD1 . PHE A 1 551 ? -5.784  21.924  -10.650 1.00 23.45  ? 551 PHE A CD1 1 
ATOM   3177 C CD2 . PHE A 1 551 ? -6.729  22.517  -8.544  1.00 26.56  ? 551 PHE A CD2 1 
ATOM   3178 C CE1 . PHE A 1 551 ? -6.861  21.093  -10.902 1.00 20.36  ? 551 PHE A CE1 1 
ATOM   3179 C CE2 . PHE A 1 551 ? -7.810  21.688  -8.791  1.00 19.01  ? 551 PHE A CE2 1 
ATOM   3180 C CZ  . PHE A 1 551 ? -7.875  20.976  -9.971  1.00 20.73  ? 551 PHE A CZ  1 
ATOM   3181 N N   . SER A 1 552 ? -4.205  26.472  -7.503  1.00 31.16  ? 552 SER A N   1 
ATOM   3182 C CA  . SER A 1 552 ? -3.293  27.269  -6.688  1.00 37.88  ? 552 SER A CA  1 
ATOM   3183 C C   . SER A 1 552 ? -2.682  26.450  -5.553  1.00 34.87  ? 552 SER A C   1 
ATOM   3184 O O   . SER A 1 552 ? -2.771  26.832  -4.386  1.00 35.95  ? 552 SER A O   1 
ATOM   3185 C CB  . SER A 1 552 ? -4.014  28.494  -6.123  1.00 33.17  ? 552 SER A CB  1 
ATOM   3186 O OG  . SER A 1 552 ? -5.105  28.106  -5.307  1.00 43.58  ? 552 SER A OG  1 
ATOM   3187 N N   . PHE A 1 553 ? -2.067  25.322  -5.901  1.00 33.63  ? 553 PHE A N   1 
ATOM   3188 C CA  . PHE A 1 553 ? -1.413  24.467  -4.916  1.00 33.07  ? 553 PHE A CA  1 
ATOM   3189 C C   . PHE A 1 553 ? -0.237  25.183  -4.265  1.00 29.99  ? 553 PHE A C   1 
ATOM   3190 O O   . PHE A 1 553 ? 0.492   25.911  -4.934  1.00 36.23  ? 553 PHE A O   1 
ATOM   3191 C CB  . PHE A 1 553 ? -0.898  23.181  -5.567  1.00 26.52  ? 553 PHE A CB  1 
ATOM   3192 C CG  . PHE A 1 553 ? -1.977  22.300  -6.122  1.00 26.58  ? 553 PHE A CG  1 
ATOM   3193 C CD1 . PHE A 1 553 ? -1.894  21.819  -7.419  1.00 26.00  ? 553 PHE A CD1 1 
ATOM   3194 C CD2 . PHE A 1 553 ? -3.070  21.945  -5.349  1.00 23.91  ? 553 PHE A CD2 1 
ATOM   3195 C CE1 . PHE A 1 553 ? -2.883  21.002  -7.936  1.00 24.09  ? 553 PHE A CE1 1 
ATOM   3196 C CE2 . PHE A 1 553 ? -4.064  21.130  -5.860  1.00 27.99  ? 553 PHE A CE2 1 
ATOM   3197 C CZ  . PHE A 1 553 ? -3.971  20.660  -7.156  1.00 27.65  ? 553 PHE A CZ  1 
ATOM   3198 N N   . PRO A 1 554 ? -0.052  24.984  -2.951  1.00 30.37  ? 554 PRO A N   1 
ATOM   3199 C CA  . PRO A 1 554 ? 1.182   25.437  -2.323  1.00 26.56  ? 554 PRO A CA  1 
ATOM   3200 C C   . PRO A 1 554 ? 2.360   24.696  -2.943  1.00 31.99  ? 554 PRO A C   1 
ATOM   3201 O O   . PRO A 1 554 ? 2.216   23.541  -3.346  1.00 31.80  ? 554 PRO A O   1 
ATOM   3202 C CB  . PRO A 1 554 ? 1.006   25.024  -0.858  1.00 25.54  ? 554 PRO A CB  1 
ATOM   3203 C CG  . PRO A 1 554 ? -0.467  24.859  -0.676  1.00 25.50  ? 554 PRO A CG  1 
ATOM   3204 C CD  . PRO A 1 554 ? -0.970  24.356  -1.988  1.00 25.27  ? 554 PRO A CD  1 
ATOM   3205 N N   . ALA A 1 555 ? 3.511   25.356  -3.024  1.00 39.90  ? 555 ALA A N   1 
ATOM   3206 C CA  . ALA A 1 555 ? 4.689   24.775  -3.667  1.00 36.13  ? 555 ALA A CA  1 
ATOM   3207 C C   . ALA A 1 555 ? 5.151   23.494  -2.980  1.00 38.76  ? 555 ALA A C   1 
ATOM   3208 O O   . ALA A 1 555 ? 5.856   22.679  -3.575  1.00 47.55  ? 555 ALA A O   1 
ATOM   3209 C CB  . ALA A 1 555 ? 5.821   25.790  -3.714  1.00 29.69  ? 555 ALA A CB  1 
ATOM   3210 N N   . VAL A 1 556 ? 4.744   23.320  -1.728  1.00 33.04  ? 556 VAL A N   1 
ATOM   3211 C CA  . VAL A 1 556 ? 5.156   22.167  -0.939  1.00 32.86  ? 556 VAL A CA  1 
ATOM   3212 C C   . VAL A 1 556 ? 4.366   20.918  -1.328  1.00 35.79  ? 556 VAL A C   1 
ATOM   3213 O O   . VAL A 1 556 ? 4.703   19.804  -0.923  1.00 43.31  ? 556 VAL A O   1 
ATOM   3214 C CB  . VAL A 1 556 ? 4.994   22.446  0.575   1.00 30.50  ? 556 VAL A CB  1 
ATOM   3215 C CG1 . VAL A 1 556 ? 3.541   22.262  1.005   1.00 29.83  ? 556 VAL A CG1 1 
ATOM   3216 C CG2 . VAL A 1 556 ? 5.916   21.547  1.387   1.00 31.81  ? 556 VAL A CG2 1 
ATOM   3217 N N   . VAL A 1 557 ? 3.323   21.111  -2.130  1.00 31.97  ? 557 VAL A N   1 
ATOM   3218 C CA  . VAL A 1 557 ? 2.390   20.038  -2.461  1.00 30.25  ? 557 VAL A CA  1 
ATOM   3219 C C   . VAL A 1 557 ? 2.156   19.908  -3.968  1.00 28.41  ? 557 VAL A C   1 
ATOM   3220 O O   . VAL A 1 557 ? 1.770   18.845  -4.456  1.00 29.02  ? 557 VAL A O   1 
ATOM   3221 C CB  . VAL A 1 557 ? 1.044   20.233  -1.722  1.00 33.00  ? 557 VAL A CB  1 
ATOM   3222 C CG1 . VAL A 1 557 ? -0.100  19.567  -2.473  1.00 35.53  ? 557 VAL A CG1 1 
ATOM   3223 C CG2 . VAL A 1 557 ? 1.143   19.708  -0.298  1.00 32.58  ? 557 VAL A CG2 1 
ATOM   3224 N N   . ALA A 1 558 ? 2.397   20.992  -4.700  1.00 31.95  ? 558 ALA A N   1 
ATOM   3225 C CA  . ALA A 1 558 ? 2.274   20.983  -6.154  1.00 26.31  ? 558 ALA A CA  1 
ATOM   3226 C C   . ALA A 1 558 ? 3.077   19.832  -6.756  1.00 30.18  ? 558 ALA A C   1 
ATOM   3227 O O   . ALA A 1 558 ? 4.177   19.534  -6.288  1.00 30.71  ? 558 ALA A O   1 
ATOM   3228 C CB  . ALA A 1 558 ? 2.740   22.312  -6.727  1.00 27.49  ? 558 ALA A CB  1 
ATOM   3229 N N   . PRO A 1 559 ? 2.530   19.185  -7.799  1.00 31.57  ? 559 PRO A N   1 
ATOM   3230 C CA  . PRO A 1 559 ? 3.175   18.048  -8.452  1.00 34.26  ? 559 PRO A CA  1 
ATOM   3231 C C   . PRO A 1 559 ? 4.683   18.248  -8.549  1.00 34.97  ? 559 PRO A C   1 
ATOM   3232 O O   . PRO A 1 559 ? 5.453   17.418  -8.064  1.00 30.17  ? 559 PRO A O   1 
ATOM   3233 C CB  . PRO A 1 559 ? 2.544   18.051  -9.842  1.00 30.84  ? 559 PRO A CB  1 
ATOM   3234 C CG  . PRO A 1 559 ? 1.172   18.583  -9.615  1.00 30.31  ? 559 PRO A CG  1 
ATOM   3235 C CD  . PRO A 1 559 ? 1.242   19.521  -8.433  1.00 30.97  ? 559 PRO A CD  1 
ATOM   3236 N N   . PHE A 1 560 ? 5.092   19.343  -9.182  1.00 30.22  ? 560 PHE A N   1 
ATOM   3237 C CA  . PHE A 1 560 ? 6.479   19.789  -9.128  1.00 37.70  ? 560 PHE A CA  1 
ATOM   3238 C C   . PHE A 1 560 ? 6.540   21.311  -9.028  1.00 35.11  ? 560 PHE A C   1 
ATOM   3239 O O   . PHE A 1 560 ? 5.675   22.012  -9.554  1.00 37.12  ? 560 PHE A O   1 
ATOM   3240 C CB  . PHE A 1 560 ? 7.306   19.255  -10.305 1.00 35.94  ? 560 PHE A CB  1 
ATOM   3241 C CG  . PHE A 1 560 ? 6.617   19.344  -11.637 1.00 36.95  ? 560 PHE A CG  1 
ATOM   3242 C CD1 . PHE A 1 560 ? 5.761   18.338  -12.059 1.00 36.01  ? 560 PHE A CD1 1 
ATOM   3243 C CD2 . PHE A 1 560 ? 6.846   20.420  -12.479 1.00 33.69  ? 560 PHE A CD2 1 
ATOM   3244 C CE1 . PHE A 1 560 ? 5.132   18.413  -13.289 1.00 37.27  ? 560 PHE A CE1 1 
ATOM   3245 C CE2 . PHE A 1 560 ? 6.222   20.500  -13.711 1.00 36.13  ? 560 PHE A CE2 1 
ATOM   3246 C CZ  . PHE A 1 560 ? 5.364   19.496  -14.116 1.00 36.14  ? 560 PHE A CZ  1 
ATOM   3247 N N   . LYS A 1 561 ? 7.560   21.811  -8.339  1.00 30.00  ? 561 LYS A N   1 
ATOM   3248 C CA  . LYS A 1 561 ? 7.629   23.223  -7.973  1.00 30.63  ? 561 LYS A CA  1 
ATOM   3249 C C   . LYS A 1 561 ? 7.900   24.163  -9.147  1.00 35.60  ? 561 LYS A C   1 
ATOM   3250 O O   . LYS A 1 561 ? 7.352   25.263  -9.202  1.00 36.62  ? 561 LYS A O   1 
ATOM   3251 C CB  . LYS A 1 561 ? 8.674   23.435  -6.873  1.00 26.51  ? 561 LYS A CB  1 
ATOM   3252 C CG  . LYS A 1 561 ? 8.374   22.679  -5.591  1.00 27.34  ? 561 LYS A CG  1 
ATOM   3253 C CD  . LYS A 1 561 ? 9.508   22.802  -4.590  1.00 37.44  ? 561 LYS A CD  1 
ATOM   3254 C CE  . LYS A 1 561 ? 9.202   22.029  -3.316  1.00 42.83  ? 561 LYS A CE  1 
ATOM   3255 N NZ  . LYS A 1 561 ? 10.309  22.126  -2.325  1.00 45.29  ? 561 LYS A NZ  1 
ATOM   3256 N N   . CYS A 1 562 ? 8.741   23.733  -10.082 1.00 39.40  ? 562 CYS A N   1 
ATOM   3257 C CA  . CYS A 1 562 ? 9.126   24.595  -11.195 1.00 40.57  ? 562 CYS A CA  1 
ATOM   3258 C C   . CYS A 1 562 ? 8.994   23.910  -12.551 1.00 44.14  ? 562 CYS A C   1 
ATOM   3259 O O   . CYS A 1 562 ? 8.972   22.684  -12.642 1.00 45.84  ? 562 CYS A O   1 
ATOM   3260 C CB  . CYS A 1 562 ? 10.556  25.106  -11.004 1.00 40.68  ? 562 CYS A CB  1 
ATOM   3261 S SG  . CYS A 1 562 ? 11.072  26.328  -12.230 1.00 42.93  ? 562 CYS A SG  1 
ATOM   3262 N N   . SER A 1 563 ? 8.906   24.718  -13.602 1.00 41.05  ? 563 SER A N   1 
ATOM   3263 C CA  . SER A 1 563 ? 8.819   24.206  -14.963 1.00 43.74  ? 563 SER A CA  1 
ATOM   3264 C C   . SER A 1 563 ? 9.616   25.092  -15.912 1.00 46.28  ? 563 SER A C   1 
ATOM   3265 O O   . SER A 1 563 ? 9.265   26.250  -16.132 1.00 57.60  ? 563 SER A O   1 
ATOM   3266 C CB  . SER A 1 563 ? 7.361   24.132  -15.413 1.00 46.13  ? 563 SER A CB  1 
ATOM   3267 O OG  . SER A 1 563 ? 7.265   23.674  -16.750 1.00 55.61  ? 563 SER A OG  1 
ATOM   3268 N N   . VAL A 1 564 ? 10.692  24.546  -16.471 1.00 42.53  ? 564 VAL A N   1 
ATOM   3269 C CA  . VAL A 1 564 ? 11.539  25.312  -17.379 1.00 43.60  ? 564 VAL A CA  1 
ATOM   3270 C C   . VAL A 1 564 ? 11.019  25.233  -18.814 1.00 45.09  ? 564 VAL A C   1 
ATOM   3271 O O   . VAL A 1 564 ? 10.599  24.171  -19.273 1.00 36.67  ? 564 VAL A O   1 
ATOM   3272 C CB  . VAL A 1 564 ? 13.015  24.858  -17.315 1.00 44.03  ? 564 VAL A CB  1 
ATOM   3273 C CG1 . VAL A 1 564 ? 13.443  24.655  -15.869 1.00 41.36  ? 564 VAL A CG1 1 
ATOM   3274 C CG2 . VAL A 1 564 ? 13.224  23.587  -18.111 1.00 47.59  ? 564 VAL A CG2 1 
ATOM   3275 N N   . LEU A 1 565 ? 11.037  26.366  -19.512 1.00 45.68  ? 565 LEU A N   1 
ATOM   3276 C CA  . LEU A 1 565 ? 10.527  26.428  -20.877 1.00 46.57  ? 565 LEU A CA  1 
ATOM   3277 C C   . LEU A 1 565 ? 11.574  26.921  -21.870 1.00 51.40  ? 565 LEU A C   1 
ATOM   3278 O O   . LEU A 1 565 ? 11.837  28.120  -21.957 1.00 48.60  ? 565 LEU A O   1 
ATOM   3279 C CB  . LEU A 1 565 ? 9.292   27.330  -20.960 1.00 52.56  ? 565 LEU A CB  1 
ATOM   3280 C CG  . LEU A 1 565 ? 8.034   26.978  -20.164 1.00 55.63  ? 565 LEU A CG  1 
ATOM   3281 C CD1 . LEU A 1 565 ? 6.840   27.704  -20.752 1.00 58.08  ? 565 LEU A CD1 1 
ATOM   3282 C CD2 . LEU A 1 565 ? 7.782   25.489  -20.167 1.00 57.56  ? 565 LEU A CD2 1 
ATOM   3283 N N   . PRO A 1 566 ? 12.182  25.992  -22.622 1.00 54.67  ? 566 PRO A N   1 
ATOM   3284 C CA  . PRO A 1 566 ? 13.036  26.388  -23.732 1.00 54.40  ? 566 PRO A CA  1 
ATOM   3285 C C   . PRO A 1 566 ? 12.200  26.641  -24.985 1.00 60.97  ? 566 PRO A C   1 
ATOM   3286 O O   . PRO A 1 566 ? 11.348  25.824  -25.337 1.00 60.55  ? 566 PRO A O   1 
ATOM   3287 C CB  . PRO A 1 566 ? 13.939  25.169  -23.925 1.00 52.46  ? 566 PRO A CB  1 
ATOM   3288 C CG  . PRO A 1 566 ? 13.121  24.011  -23.454 1.00 53.63  ? 566 PRO A CG  1 
ATOM   3289 C CD  . PRO A 1 566 ? 12.114  24.529  -22.458 1.00 57.02  ? 566 PRO A CD  1 
ATOM   3290 N N   . LEU A 1 567 ? 12.430  27.776  -25.638 1.00 64.08  ? 567 LEU A N   1 
ATOM   3291 C CA  . LEU A 1 567 ? 11.717  28.103  -26.866 1.00 73.50  ? 567 LEU A CA  1 
ATOM   3292 C C   . LEU A 1 567 ? 12.101  27.126  -27.962 1.00 83.21  ? 567 LEU A C   1 
ATOM   3293 O O   . LEU A 1 567 ? 11.244  26.503  -28.591 1.00 87.16  ? 567 LEU A O   1 
ATOM   3294 C CB  . LEU A 1 567 ? 12.036  29.527  -27.321 1.00 73.67  ? 567 LEU A CB  1 
ATOM   3295 C CG  . LEU A 1 567 ? 11.409  30.688  -26.550 1.00 74.13  ? 567 LEU A CG  1 
ATOM   3296 C CD1 . LEU A 1 567 ? 11.659  31.990  -27.290 1.00 74.51  ? 567 LEU A CD1 1 
ATOM   3297 C CD2 . LEU A 1 567 ? 9.918   30.464  -26.358 1.00 77.56  ? 567 LEU A CD2 1 
ATOM   3298 N N   . SER A 1 568 ? 13.404  26.997  -28.180 1.00 90.93  ? 568 SER A N   1 
ATOM   3299 C CA  . SER A 1 568 ? 13.921  26.097  -29.193 1.00 97.51  ? 568 SER A CA  1 
ATOM   3300 C C   . SER A 1 568 ? 14.234  24.725  -28.618 1.00 102.07 ? 568 SER A C   1 
ATOM   3301 O O   . SER A 1 568 ? 14.765  24.603  -27.512 1.00 101.69 ? 568 SER A O   1 
ATOM   3302 C CB  . SER A 1 568 ? 15.177  26.684  -29.839 1.00 100.52 ? 568 SER A CB  1 
ATOM   3303 O OG  . SER A 1 568 ? 14.880  27.882  -30.531 1.00 105.66 ? 568 SER A OG  1 
ATOM   3304 N N   . GLN A 1 569 ? 13.889  23.696  -29.384 1.00 107.24 ? 569 GLN A N   1 
ATOM   3305 C CA  . GLN A 1 569 ? 14.345  22.342  -29.118 1.00 106.10 ? 569 GLN A CA  1 
ATOM   3306 C C   . GLN A 1 569 ? 15.854  22.304  -29.337 1.00 104.62 ? 569 GLN A C   1 
ATOM   3307 O O   . GLN A 1 569 ? 16.539  21.386  -28.886 1.00 104.09 ? 569 GLN A O   1 
ATOM   3308 C CB  . GLN A 1 569 ? 13.673  21.364  -30.086 1.00 107.71 ? 569 GLN A CB  1 
ATOM   3309 C CG  . GLN A 1 569 ? 12.169  21.558  -30.246 1.00 110.42 ? 569 GLN A CG  1 
ATOM   3310 C CD  . GLN A 1 569 ? 11.625  20.912  -31.512 1.00 113.21 ? 569 GLN A CD  1 
ATOM   3311 O OE1 . GLN A 1 569 ? 12.351  20.721  -32.488 1.00 116.17 ? 569 GLN A OE1 1 
ATOM   3312 N NE2 . GLN A 1 569 ? 10.339  20.580  -31.501 1.00 112.40 ? 569 GLN A NE2 1 
ATOM   3313 N N   . ASN A 1 570 ? 16.353  23.324  -30.030 1.00 103.62 ? 570 ASN A N   1 
ATOM   3314 C CA  . ASN A 1 570 ? 17.741  23.400  -30.498 1.00 102.60 ? 570 ASN A CA  1 
ATOM   3315 C C   . ASN A 1 570 ? 18.831  23.253  -29.420 1.00 101.65 ? 570 ASN A C   1 
ATOM   3316 O O   . ASN A 1 570 ? 18.561  23.379  -28.226 1.00 102.41 ? 570 ASN A O   1 
ATOM   3317 C CB  . ASN A 1 570 ? 17.918  24.673  -31.346 1.00 105.68 ? 570 ASN A CB  1 
ATOM   3318 C CG  . ASN A 1 570 ? 19.317  25.250  -31.274 1.00 108.44 ? 570 ASN A CG  1 
ATOM   3319 O OD1 . ASN A 1 570 ? 20.056  25.235  -32.261 1.00 110.23 ? 570 ASN A OD1 1 
ATOM   3320 N ND2 . ASN A 1 570 ? 19.684  25.778  -30.109 1.00 108.60 ? 570 ASN A ND2 1 
ATOM   3321 N N   . GLN A 1 571 ? 20.060  22.991  -29.864 1.00 103.23 ? 571 GLN A N   1 
ATOM   3322 C CA  . GLN A 1 571 ? 21.177  22.605  -28.986 1.00 107.57 ? 571 GLN A CA  1 
ATOM   3323 C C   . GLN A 1 571 ? 21.695  23.647  -27.994 1.00 110.85 ? 571 GLN A C   1 
ATOM   3324 O O   . GLN A 1 571 ? 21.597  23.448  -26.785 1.00 114.46 ? 571 GLN A O   1 
ATOM   3325 C CB  . GLN A 1 571 ? 22.359  22.092  -29.817 1.00 106.23 ? 571 GLN A CB  1 
ATOM   3326 C CG  . GLN A 1 571 ? 22.475  22.716  -31.194 1.00 106.50 ? 571 GLN A CG  1 
ATOM   3327 C CD  . GLN A 1 571 ? 21.820  21.861  -32.258 1.00 106.44 ? 571 GLN A CD  1 
ATOM   3328 O OE1 . GLN A 1 571 ? 22.029  20.649  -32.307 1.00 105.92 ? 571 GLN A OE1 1 
ATOM   3329 N NE2 . GLN A 1 571 ? 21.026  22.487  -33.119 1.00 105.71 ? 571 GLN A NE2 1 
ATOM   3330 N N   . GLU A 1 572 ? 22.267  24.734  -28.514 1.00 113.80 ? 572 GLU A N   1 
ATOM   3331 C CA  . GLU A 1 572 ? 22.975  25.731  -27.698 1.00 112.50 ? 572 GLU A CA  1 
ATOM   3332 C C   . GLU A 1 572 ? 22.219  26.022  -26.410 1.00 104.50 ? 572 GLU A C   1 
ATOM   3333 O O   . GLU A 1 572 ? 22.750  26.606  -25.461 1.00 94.03  ? 572 GLU A O   1 
ATOM   3334 C CB  . GLU A 1 572 ? 23.152  27.014  -28.510 1.00 121.65 ? 572 GLU A CB  1 
ATOM   3335 C CG  . GLU A 1 572 ? 23.523  26.748  -29.968 1.00 126.40 ? 572 GLU A CG  1 
ATOM   3336 C CD  . GLU A 1 572 ? 23.074  27.859  -30.901 1.00 129.36 ? 572 GLU A CD  1 
ATOM   3337 O OE1 . GLU A 1 572 ? 22.664  28.929  -30.403 1.00 130.33 ? 572 GLU A OE1 1 
ATOM   3338 O OE2 . GLU A 1 572 ? 23.129  27.663  -32.134 1.00 130.80 ? 572 GLU A OE2 1 
ATOM   3339 N N   . PHE A 1 573 ? 20.965  25.582  -26.407 1.00 101.24 ? 573 PHE A N   1 
ATOM   3340 C CA  . PHE A 1 573 ? 20.037  25.751  -25.303 1.00 98.35  ? 573 PHE A CA  1 
ATOM   3341 C C   . PHE A 1 573 ? 20.132  24.623  -24.289 1.00 93.88  ? 573 PHE A C   1 
ATOM   3342 O O   . PHE A 1 573 ? 19.946  24.840  -23.092 1.00 91.80  ? 573 PHE A O   1 
ATOM   3343 C CB  . PHE A 1 573 ? 18.613  25.795  -25.848 1.00 101.19 ? 573 PHE A CB  1 
ATOM   3344 C CG  . PHE A 1 573 ? 18.185  27.153  -26.299 1.00 103.06 ? 573 PHE A CG  1 
ATOM   3345 C CD1 . PHE A 1 573 ? 17.651  28.050  -25.391 1.00 103.53 ? 573 PHE A CD1 1 
ATOM   3346 C CD2 . PHE A 1 573 ? 18.310  27.538  -27.625 1.00 104.11 ? 573 PHE A CD2 1 
ATOM   3347 C CE1 . PHE A 1 573 ? 17.250  29.308  -25.790 1.00 103.77 ? 573 PHE A CE1 1 
ATOM   3348 C CE2 . PHE A 1 573 ? 17.911  28.798  -28.033 1.00 103.65 ? 573 PHE A CE2 1 
ATOM   3349 C CZ  . PHE A 1 573 ? 17.380  29.684  -27.112 1.00 103.43 ? 573 PHE A CZ  1 
ATOM   3350 N N   . MET A 1 574 ? 20.410  23.415  -24.769 1.00 89.48  ? 574 MET A N   1 
ATOM   3351 C CA  . MET A 1 574 ? 20.491  22.258  -23.887 1.00 84.13  ? 574 MET A CA  1 
ATOM   3352 C C   . MET A 1 574 ? 21.503  22.437  -22.752 1.00 74.81  ? 574 MET A C   1 
ATOM   3353 O O   . MET A 1 574 ? 21.257  21.981  -21.639 1.00 70.80  ? 574 MET A O   1 
ATOM   3354 C CB  . MET A 1 574 ? 20.760  20.972  -24.676 1.00 88.90  ? 574 MET A CB  1 
ATOM   3355 C CG  . MET A 1 574 ? 19.682  20.644  -25.704 1.00 92.53  ? 574 MET A CG  1 
ATOM   3356 S SD  . MET A 1 574 ? 18.001  20.936  -25.106 1.00 96.53  ? 574 MET A SD  1 
ATOM   3357 C CE  . MET A 1 574 ? 17.889  19.760  -23.757 1.00 96.11  ? 574 MET A CE  1 
ATOM   3358 N N   . PRO A 1 575 ? 22.641  23.103  -23.025 1.00 68.48  ? 575 PRO A N   1 
ATOM   3359 C CA  . PRO A 1 575 ? 23.608  23.401  -21.967 1.00 67.01  ? 575 PRO A CA  1 
ATOM   3360 C C   . PRO A 1 575 ? 23.045  24.341  -20.903 1.00 66.19  ? 575 PRO A C   1 
ATOM   3361 O O   . PRO A 1 575 ? 23.415  24.240  -19.733 1.00 64.79  ? 575 PRO A O   1 
ATOM   3362 C CB  . PRO A 1 575 ? 24.757  24.089  -22.718 1.00 57.95  ? 575 PRO A CB  1 
ATOM   3363 C CG  . PRO A 1 575 ? 24.580  23.701  -24.141 1.00 61.11  ? 575 PRO A CG  1 
ATOM   3364 C CD  . PRO A 1 575 ? 23.107  23.589  -24.334 1.00 64.67  ? 575 PRO A CD  1 
ATOM   3365 N N   . PHE A 1 576 ? 22.164  25.251  -21.310 1.00 62.29  ? 576 PHE A N   1 
ATOM   3366 C CA  . PHE A 1 576 ? 21.505  26.148  -20.367 1.00 59.58  ? 576 PHE A CA  1 
ATOM   3367 C C   . PHE A 1 576 ? 20.390  25.424  -19.629 1.00 54.82  ? 576 PHE A C   1 
ATOM   3368 O O   . PHE A 1 576 ? 20.306  25.481  -18.402 1.00 51.90  ? 576 PHE A O   1 
ATOM   3369 C CB  . PHE A 1 576 ? 20.955  27.383  -21.081 1.00 60.41  ? 576 PHE A CB  1 
ATOM   3370 C CG  . PHE A 1 576 ? 21.987  28.440  -21.331 1.00 62.72  ? 576 PHE A CG  1 
ATOM   3371 C CD1 . PHE A 1 576 ? 22.606  28.546  -22.565 1.00 61.66  ? 576 PHE A CD1 1 
ATOM   3372 C CD2 . PHE A 1 576 ? 22.349  29.321  -20.325 1.00 62.35  ? 576 PHE A CD2 1 
ATOM   3373 C CE1 . PHE A 1 576 ? 23.561  29.518  -22.795 1.00 58.81  ? 576 PHE A CE1 1 
ATOM   3374 C CE2 . PHE A 1 576 ? 23.304  30.293  -20.548 1.00 59.44  ? 576 PHE A CE2 1 
ATOM   3375 C CZ  . PHE A 1 576 ? 23.911  30.391  -21.785 1.00 58.75  ? 576 PHE A CZ  1 
ATOM   3376 N N   . VAL A 1 577 ? 19.536  24.744  -20.387 1.00 49.59  ? 577 VAL A N   1 
ATOM   3377 C CA  . VAL A 1 577 ? 18.491  23.911  -19.811 1.00 49.12  ? 577 VAL A CA  1 
ATOM   3378 C C   . VAL A 1 577 ? 19.106  22.881  -18.871 1.00 52.44  ? 577 VAL A C   1 
ATOM   3379 O O   . VAL A 1 577 ? 18.618  22.669  -17.760 1.00 53.22  ? 577 VAL A O   1 
ATOM   3380 C CB  . VAL A 1 577 ? 17.687  23.179  -20.905 1.00 47.90  ? 577 VAL A CB  1 
ATOM   3381 C CG1 . VAL A 1 577 ? 16.788  22.113  -20.292 1.00 43.92  ? 577 VAL A CG1 1 
ATOM   3382 C CG2 . VAL A 1 577 ? 16.871  24.172  -21.721 1.00 48.28  ? 577 VAL A CG2 1 
ATOM   3383 N N   . LYS A 1 578 ? 20.187  22.252  -19.320 1.00 57.39  ? 578 LYS A N   1 
ATOM   3384 C CA  . LYS A 1 578 ? 20.830  21.192  -18.552 1.00 57.98  ? 578 LYS A CA  1 
ATOM   3385 C C   . LYS A 1 578 ? 21.351  21.701  -17.212 1.00 51.47  ? 578 LYS A C   1 
ATOM   3386 O O   . LYS A 1 578 ? 21.082  21.104  -16.171 1.00 53.81  ? 578 LYS A O   1 
ATOM   3387 C CB  . LYS A 1 578 ? 21.966  20.551  -19.355 1.00 67.15  ? 578 LYS A CB  1 
ATOM   3388 C CG  . LYS A 1 578 ? 22.331  19.147  -18.897 1.00 68.32  ? 578 LYS A CG  1 
ATOM   3389 C CD  . LYS A 1 578 ? 23.423  18.547  -19.770 1.00 69.68  ? 578 LYS A CD  1 
ATOM   3390 C CE  . LYS A 1 578 ? 23.719  17.112  -19.364 1.00 71.90  ? 578 LYS A CE  1 
ATOM   3391 N NZ  . LYS A 1 578 ? 24.701  16.462  -20.276 1.00 73.17  ? 578 LYS A NZ  1 
ATOM   3392 N N   . GLU A 1 579 ? 22.092  22.804  -17.240 1.00 52.66  ? 579 GLU A N   1 
ATOM   3393 C CA  . GLU A 1 579 ? 22.665  23.367  -16.020 1.00 56.94  ? 579 GLU A CA  1 
ATOM   3394 C C   . GLU A 1 579 ? 21.585  23.850  -15.055 1.00 59.09  ? 579 GLU A C   1 
ATOM   3395 O O   . GLU A 1 579 ? 21.746  23.755  -13.837 1.00 58.47  ? 579 GLU A O   1 
ATOM   3396 C CB  . GLU A 1 579 ? 23.635  24.506  -16.349 1.00 60.18  ? 579 GLU A CB  1 
ATOM   3397 C CG  . GLU A 1 579 ? 24.126  25.292  -15.135 1.00 64.65  ? 579 GLU A CG  1 
ATOM   3398 C CD  . GLU A 1 579 ? 25.044  24.485  -14.232 1.00 69.40  ? 579 GLU A CD  1 
ATOM   3399 O OE1 . GLU A 1 579 ? 25.740  23.578  -14.738 1.00 70.59  ? 579 GLU A OE1 1 
ATOM   3400 O OE2 . GLU A 1 579 ? 25.074  24.764  -13.014 1.00 71.25  ? 579 GLU A OE2 1 
ATOM   3401 N N   . LEU A 1 580 ? 20.486  24.363  -15.602 1.00 56.11  ? 580 LEU A N   1 
ATOM   3402 C CA  . LEU A 1 580 ? 19.374  24.832  -14.783 1.00 47.95  ? 580 LEU A CA  1 
ATOM   3403 C C   . LEU A 1 580 ? 18.753  23.653  -14.045 1.00 46.61  ? 580 LEU A C   1 
ATOM   3404 O O   . LEU A 1 580 ? 18.479  23.730  -12.846 1.00 50.78  ? 580 LEU A O   1 
ATOM   3405 C CB  . LEU A 1 580 ? 18.317  25.517  -15.651 1.00 43.61  ? 580 LEU A CB  1 
ATOM   3406 C CG  . LEU A 1 580 ? 17.617  26.765  -15.100 1.00 41.96  ? 580 LEU A CG  1 
ATOM   3407 C CD1 . LEU A 1 580 ? 16.377  27.072  -15.926 1.00 38.27  ? 580 LEU A CD1 1 
ATOM   3408 C CD2 . LEU A 1 580 ? 17.253  26.627  -13.627 1.00 36.65  ? 580 LEU A CD2 1 
ATOM   3409 N N   . SER A 1 581 ? 18.537  22.562  -14.774 1.00 44.89  ? 581 SER A N   1 
ATOM   3410 C CA  . SER A 1 581 ? 17.970  21.350  -14.200 1.00 45.44  ? 581 SER A CA  1 
ATOM   3411 C C   . SER A 1 581 ? 18.806  20.868  -13.021 1.00 40.65  ? 581 SER A C   1 
ATOM   3412 O O   . SER A 1 581 ? 18.277  20.576  -11.949 1.00 49.92  ? 581 SER A O   1 
ATOM   3413 C CB  . SER A 1 581 ? 17.877  20.253  -15.263 1.00 41.48  ? 581 SER A CB  1 
ATOM   3414 O OG  . SER A 1 581 ? 17.093  19.164  -14.808 1.00 37.37  ? 581 SER A OG  1 
ATOM   3415 N N   . GLU A 1 582 ? 20.116  20.799  -13.224 1.00 38.33  ? 582 GLU A N   1 
ATOM   3416 C CA  . GLU A 1 582 ? 21.023  20.276  -12.211 1.00 49.34  ? 582 GLU A CA  1 
ATOM   3417 C C   . GLU A 1 582 ? 21.106  21.174  -10.983 1.00 44.62  ? 582 GLU A C   1 
ATOM   3418 O O   . GLU A 1 582 ? 21.170  20.687  -9.855  1.00 50.84  ? 582 GLU A O   1 
ATOM   3419 C CB  . GLU A 1 582 ? 22.412  20.051  -12.807 1.00 57.37  ? 582 GLU A CB  1 
ATOM   3420 C CG  . GLU A 1 582 ? 22.422  19.064  -13.963 1.00 63.17  ? 582 GLU A CG  1 
ATOM   3421 C CD  . GLU A 1 582 ? 23.815  18.789  -14.487 1.00 67.52  ? 582 GLU A CD  1 
ATOM   3422 O OE1 . GLU A 1 582 ? 24.756  19.513  -14.097 1.00 69.78  ? 582 GLU A OE1 1 
ATOM   3423 O OE2 . GLU A 1 582 ? 23.970  17.846  -15.291 1.00 69.69  ? 582 GLU A OE2 1 
ATOM   3424 N N   . ALA A 1 583 ? 21.106  22.485  -11.206 1.00 46.64  ? 583 ALA A N   1 
ATOM   3425 C CA  . ALA A 1 583 ? 21.138  23.445  -10.110 1.00 42.00  ? 583 ALA A CA  1 
ATOM   3426 C C   . ALA A 1 583 ? 19.854  23.351  -9.293  1.00 42.14  ? 583 ALA A C   1 
ATOM   3427 O O   . ALA A 1 583 ? 19.885  23.391  -8.063  1.00 38.39  ? 583 ALA A O   1 
ATOM   3428 C CB  . ALA A 1 583 ? 21.333  24.852  -10.642 1.00 39.91  ? 583 ALA A CB  1 
ATOM   3429 N N   . LEU A 1 584 ? 18.728  23.226  -9.988  1.00 41.13  ? 584 LEU A N   1 
ATOM   3430 C CA  . LEU A 1 584 ? 17.441  23.019  -9.336  1.00 41.69  ? 584 LEU A CA  1 
ATOM   3431 C C   . LEU A 1 584 ? 17.480  21.786  -8.443  1.00 40.12  ? 584 LEU A C   1 
ATOM   3432 O O   . LEU A 1 584 ? 17.097  21.843  -7.275  1.00 42.56  ? 584 LEU A O   1 
ATOM   3433 C CB  . LEU A 1 584 ? 16.330  22.875  -10.377 1.00 41.62  ? 584 LEU A CB  1 
ATOM   3434 C CG  . LEU A 1 584 ? 15.377  24.055  -10.584 1.00 38.06  ? 584 LEU A CG  1 
ATOM   3435 C CD1 . LEU A 1 584 ? 16.035  25.375  -10.226 1.00 33.82  ? 584 LEU A CD1 1 
ATOM   3436 C CD2 . LEU A 1 584 ? 14.851  24.074  -12.014 1.00 38.61  ? 584 LEU A CD2 1 
ATOM   3437 N N   . THR A 1 585 ? 17.952  20.674  -9.002  1.00 42.64  ? 585 THR A N   1 
ATOM   3438 C CA  . THR A 1 585 ? 18.042  19.411  -8.274  1.00 42.74  ? 585 THR A CA  1 
ATOM   3439 C C   . THR A 1 585 ? 18.982  19.535  -7.080  1.00 40.79  ? 585 THR A C   1 
ATOM   3440 O O   . THR A 1 585 ? 18.721  18.985  -6.010  1.00 45.21  ? 585 THR A O   1 
ATOM   3441 C CB  . THR A 1 585 ? 18.546  18.271  -9.183  1.00 44.50  ? 585 THR A CB  1 
ATOM   3442 O OG1 . THR A 1 585 ? 17.835  18.295  -10.428 1.00 45.43  ? 585 THR A OG1 1 
ATOM   3443 C CG2 . THR A 1 585 ? 18.343  16.919  -8.513  1.00 42.68  ? 585 THR A CG2 1 
ATOM   3444 N N   . ARG A 1 586 ? 20.073  20.267  -7.276  1.00 42.46  ? 586 ARG A N   1 
ATOM   3445 C CA  . ARG A 1 586 ? 21.059  20.501  -6.232  1.00 40.28  ? 586 ARG A CA  1 
ATOM   3446 C C   . ARG A 1 586 ? 20.429  21.317  -5.108  1.00 43.49  ? 586 ARG A C   1 
ATOM   3447 O O   . ARG A 1 586 ? 20.865  21.255  -3.958  1.00 45.48  ? 586 ARG A O   1 
ATOM   3448 C CB  . ARG A 1 586 ? 22.250  21.252  -6.822  1.00 49.59  ? 586 ARG A CB  1 
ATOM   3449 C CG  . ARG A 1 586 ? 23.610  20.668  -6.486  1.00 53.55  ? 586 ARG A CG  1 
ATOM   3450 C CD  . ARG A 1 586 ? 24.565  20.899  -7.646  1.00 54.51  ? 586 ARG A CD  1 
ATOM   3451 N NE  . ARG A 1 586 ? 24.481  22.271  -8.142  1.00 57.85  ? 586 ARG A NE  1 
ATOM   3452 C CZ  . ARG A 1 586 ? 24.736  22.636  -9.394  1.00 59.65  ? 586 ARG A CZ  1 
ATOM   3453 N NH1 . ARG A 1 586 ? 25.090  21.729  -10.296 1.00 60.08  ? 586 ARG A NH1 1 
ATOM   3454 N NH2 . ARG A 1 586 ? 24.631  23.910  -9.748  1.00 59.58  ? 586 ARG A NH2 1 
ATOM   3455 N N   . HIS A 1 587 ? 19.396  22.079  -5.455  1.00 45.42  ? 587 HIS A N   1 
ATOM   3456 C CA  . HIS A 1 587 ? 18.667  22.894  -4.489  1.00 43.26  ? 587 HIS A CA  1 
ATOM   3457 C C   . HIS A 1 587 ? 17.428  22.170  -3.967  1.00 43.21  ? 587 HIS A C   1 
ATOM   3458 O O   . HIS A 1 587 ? 16.680  22.711  -3.152  1.00 43.63  ? 587 HIS A O   1 
ATOM   3459 C CB  . HIS A 1 587 ? 18.274  24.235  -5.113  1.00 47.86  ? 587 HIS A CB  1 
ATOM   3460 C CG  . HIS A 1 587 ? 19.404  25.212  -5.204  1.00 50.44  ? 587 HIS A CG  1 
ATOM   3461 N ND1 . HIS A 1 587 ? 20.400  25.115  -6.151  1.00 47.99  ? 587 HIS A ND1 1 
ATOM   3462 C CD2 . HIS A 1 587 ? 19.695  26.308  -4.463  1.00 47.19  ? 587 HIS A CD2 1 
ATOM   3463 C CE1 . HIS A 1 587 ? 21.257  26.108  -5.990  1.00 47.58  ? 587 HIS A CE1 1 
ATOM   3464 N NE2 . HIS A 1 587 ? 20.852  26.846  -4.973  1.00 46.84  ? 587 HIS A NE2 1 
ATOM   3465 N N   . GLY A 1 588 ? 17.218  20.947  -4.445  1.00 39.29  ? 588 GLY A N   1 
ATOM   3466 C CA  . GLY A 1 588 ? 16.094  20.127  -4.003  1.00 36.29  ? 588 GLY A CA  1 
ATOM   3467 C C   . GLY A 1 588 ? 14.751  20.635  -4.490  1.00 37.69  ? 588 GLY A C   1 
ATOM   3468 O O   . GLY A 1 588 ? 13.729  20.442  -3.830  1.00 40.48  ? 588 GLY A O   1 
ATOM   3469 N N   . VAL A 1 589 ? 14.752  21.284  -5.650  1.00 29.41  ? 589 VAL A N   1 
ATOM   3470 C CA  . VAL A 1 589 ? 13.528  21.826  -6.227  1.00 23.02  ? 589 VAL A CA  1 
ATOM   3471 C C   . VAL A 1 589 ? 13.007  20.941  -7.356  1.00 26.67  ? 589 VAL A C   1 
ATOM   3472 O O   . VAL A 1 589 ? 13.656  20.793  -8.392  1.00 28.56  ? 589 VAL A O   1 
ATOM   3473 C CB  . VAL A 1 589 ? 13.739  23.257  -6.755  1.00 21.81  ? 589 VAL A CB  1 
ATOM   3474 C CG1 . VAL A 1 589 ? 12.451  23.797  -7.365  1.00 22.17  ? 589 VAL A CG1 1 
ATOM   3475 C CG2 . VAL A 1 589 ? 14.228  24.166  -5.639  1.00 22.80  ? 589 VAL A CG2 1 
ATOM   3476 N N   . SER A 1 590 ? 11.833  20.353  -7.144  1.00 29.41  ? 590 SER A N   1 
ATOM   3477 C CA  . SER A 1 590 ? 11.193  19.524  -8.155  1.00 29.09  ? 590 SER A CA  1 
ATOM   3478 C C   . SER A 1 590 ? 10.929  20.351  -9.403  1.00 37.68  ? 590 SER A C   1 
ATOM   3479 O O   . SER A 1 590 ? 10.388  21.454  -9.325  1.00 42.85  ? 590 SER A O   1 
ATOM   3480 C CB  . SER A 1 590 ? 9.865   18.976  -7.635  1.00 30.34  ? 590 SER A CB  1 
ATOM   3481 O OG  . SER A 1 590 ? 9.871   18.860  -6.225  1.00 35.74  ? 590 SER A OG  1 
ATOM   3482 N N   . HIS A 1 591 ? 11.311  19.815  -10.554 1.00 37.94  ? 591 HIS A N   1 
ATOM   3483 C CA  . HIS A 1 591 ? 11.044  20.480  -11.815 1.00 33.80  ? 591 HIS A CA  1 
ATOM   3484 C C   . HIS A 1 591 ? 10.838  19.468  -12.922 1.00 30.26  ? 591 HIS A C   1 
ATOM   3485 O O   . HIS A 1 591 ? 11.085  18.274  -12.753 1.00 33.16  ? 591 HIS A O   1 
ATOM   3486 C CB  . HIS A 1 591 ? 12.199  21.402  -12.193 1.00 34.73  ? 591 HIS A CB  1 
ATOM   3487 C CG  . HIS A 1 591 ? 13.506  20.691  -12.328 1.00 29.65  ? 591 HIS A CG  1 
ATOM   3488 N ND1 . HIS A 1 591 ? 14.274  20.349  -11.238 1.00 32.19  ? 591 HIS A ND1 1 
ATOM   3489 C CD2 . HIS A 1 591 ? 14.175  20.244  -13.417 1.00 31.07  ? 591 HIS A CD2 1 
ATOM   3490 C CE1 . HIS A 1 591 ? 15.364  19.726  -11.648 1.00 31.64  ? 591 HIS A CE1 1 
ATOM   3491 N NE2 . HIS A 1 591 ? 15.329  19.651  -12.966 1.00 31.74  ? 591 HIS A NE2 1 
ATOM   3492 N N   . LYS A 1 592 ? 10.384  19.969  -14.061 1.00 39.79  ? 592 LYS A N   1 
ATOM   3493 C CA  . LYS A 1 592 ? 10.224  19.163  -15.251 1.00 41.08  ? 592 LYS A CA  1 
ATOM   3494 C C   . LYS A 1 592 ? 10.421  20.059  -16.461 1.00 43.03  ? 592 LYS A C   1 
ATOM   3495 O O   . LYS A 1 592 ? 9.827   21.136  -16.550 1.00 40.80  ? 592 LYS A O   1 
ATOM   3496 C CB  . LYS A 1 592 ? 8.839   18.515  -15.285 1.00 43.13  ? 592 LYS A CB  1 
ATOM   3497 C CG  . LYS A 1 592 ? 8.472   17.931  -16.638 1.00 48.64  ? 592 LYS A CG  1 
ATOM   3498 C CD  . LYS A 1 592 ? 7.425   16.840  -16.514 1.00 51.72  ? 592 LYS A CD  1 
ATOM   3499 C CE  . LYS A 1 592 ? 7.307   16.058  -17.813 1.00 54.99  ? 592 LYS A CE  1 
ATOM   3500 N NZ  . LYS A 1 592 ? 6.465   14.840  -17.665 1.00 59.96  ? 592 LYS A NZ  1 
ATOM   3501 N N   . VAL A 1 593 ? 11.270  19.621  -17.383 1.00 41.00  ? 593 VAL A N   1 
ATOM   3502 C CA  . VAL A 1 593 ? 11.506  20.369  -18.606 1.00 36.30  ? 593 VAL A CA  1 
ATOM   3503 C C   . VAL A 1 593 ? 10.333  20.184  -19.558 1.00 38.86  ? 593 VAL A C   1 
ATOM   3504 O O   . VAL A 1 593 ? 10.021  19.065  -19.966 1.00 45.42  ? 593 VAL A O   1 
ATOM   3505 C CB  . VAL A 1 593 ? 12.809  19.932  -19.298 1.00 28.20  ? 593 VAL A CB  1 
ATOM   3506 C CG1 . VAL A 1 593 ? 12.996  20.690  -20.602 1.00 27.97  ? 593 VAL A CG1 1 
ATOM   3507 C CG2 . VAL A 1 593 ? 13.998  20.146  -18.374 1.00 22.90  ? 593 VAL A CG2 1 
ATOM   3508 N N   . ASP A 1 594 ? 9.680   21.289  -19.899 1.00 47.55  ? 594 ASP A N   1 
ATOM   3509 C CA  . ASP A 1 594 ? 8.538   21.257  -20.799 1.00 54.16  ? 594 ASP A CA  1 
ATOM   3510 C C   . ASP A 1 594 ? 9.000   21.213  -22.249 1.00 59.26  ? 594 ASP A C   1 
ATOM   3511 O O   . ASP A 1 594 ? 9.831   22.018  -22.672 1.00 55.83  ? 594 ASP A O   1 
ATOM   3512 C CB  . ASP A 1 594 ? 7.639   22.470  -20.557 1.00 56.31  ? 594 ASP A CB  1 
ATOM   3513 C CG  . ASP A 1 594 ? 6.468   22.542  -21.522 1.00 60.54  ? 594 ASP A CG  1 
ATOM   3514 O OD1 . ASP A 1 594 ? 6.588   22.049  -22.662 1.00 64.56  ? 594 ASP A OD1 1 
ATOM   3515 O OD2 . ASP A 1 594 ? 5.422   23.105  -21.139 1.00 64.89  ? 594 ASP A OD2 1 
ATOM   3516 N N   . ASP A 1 595 ? 8.453   20.267  -23.005 1.00 65.60  ? 595 ASP A N   1 
ATOM   3517 C CA  . ASP A 1 595 ? 8.828   20.081  -24.400 1.00 74.50  ? 595 ASP A CA  1 
ATOM   3518 C C   . ASP A 1 595 ? 7.600   19.986  -25.298 1.00 74.46  ? 595 ASP A C   1 
ATOM   3519 O O   . ASP A 1 595 ? 7.603   19.256  -26.290 1.00 74.84  ? 595 ASP A O   1 
ATOM   3520 C CB  . ASP A 1 595 ? 9.679   18.819  -24.556 1.00 81.43  ? 595 ASP A CB  1 
ATOM   3521 C CG  . ASP A 1 595 ? 8.876   17.541  -24.353 1.00 86.22  ? 595 ASP A CG  1 
ATOM   3522 O OD1 . ASP A 1 595 ? 7.819   17.592  -23.688 1.00 88.74  ? 595 ASP A OD1 1 
ATOM   3523 O OD2 . ASP A 1 595 ? 9.307   16.484  -24.860 1.00 86.86  ? 595 ASP A OD2 1 
ATOM   3524 N N   . SER A 1 596 ? 6.550   20.723  -24.952 1.00 77.07  ? 596 SER A N   1 
ATOM   3525 C CA  . SER A 1 596 ? 5.307   20.651  -25.709 1.00 81.50  ? 596 SER A CA  1 
ATOM   3526 C C   . SER A 1 596 ? 5.332   21.580  -26.920 1.00 84.26  ? 596 SER A C   1 
ATOM   3527 O O   . SER A 1 596 ? 6.186   22.461  -27.024 1.00 77.28  ? 596 SER A O   1 
ATOM   3528 C CB  . SER A 1 596 ? 4.100   20.955  -24.816 1.00 82.20  ? 596 SER A CB  1 
ATOM   3529 O OG  . SER A 1 596 ? 3.848   22.352  -24.746 1.00 87.44  ? 596 SER A OG  1 
ATOM   3530 N N   . SER A 1 597 ? 4.388   21.371  -27.832 1.00 90.01  ? 597 SER A N   1 
ATOM   3531 C CA  . SER A 1 597 ? 4.328   22.139  -29.071 1.00 92.01  ? 597 SER A CA  1 
ATOM   3532 C C   . SER A 1 597 ? 3.244   23.211  -29.018 1.00 91.63  ? 597 SER A C   1 
ATOM   3533 O O   . SER A 1 597 ? 2.062   22.904  -28.856 1.00 89.85  ? 597 SER A O   1 
ATOM   3534 C CB  . SER A 1 597 ? 4.091   21.206  -30.260 1.00 90.16  ? 597 SER A CB  1 
ATOM   3535 O OG  . SER A 1 597 ? 2.919   20.431  -30.074 1.00 87.77  ? 597 SER A OG  1 
ATOM   3536 N N   . GLY A 1 598 ? 3.655   24.468  -29.155 1.00 89.15  ? 598 GLY A N   1 
ATOM   3537 C CA  . GLY A 1 598 ? 2.720   25.587  -29.134 1.00 82.29  ? 598 GLY A CA  1 
ATOM   3538 C C   . GLY A 1 598 ? 3.336   26.868  -28.604 1.00 80.17  ? 598 GLY A C   1 
ATOM   3539 O O   . GLY A 1 598 ? 4.543   26.940  -28.371 1.00 79.03  ? 598 GLY A O   1 
ATOM   3540 N N   . SER A 1 599 ? 2.497   27.882  -28.414 1.00 76.94  ? 599 SER A N   1 
ATOM   3541 C CA  . SER A 1 599 ? 2.943   29.176  -27.909 1.00 70.36  ? 599 SER A CA  1 
ATOM   3542 C C   . SER A 1 599 ? 3.387   29.082  -26.453 1.00 65.98  ? 599 SER A C   1 
ATOM   3543 O O   . SER A 1 599 ? 2.909   28.230  -25.705 1.00 68.28  ? 599 SER A O   1 
ATOM   3544 C CB  . SER A 1 599 ? 1.828   30.214  -28.050 1.00 69.50  ? 599 SER A CB  1 
ATOM   3545 O OG  . SER A 1 599 ? 2.207   31.453  -27.476 1.00 69.89  ? 599 SER A OG  1 
ATOM   3546 N N   . ILE A 1 600 ? 4.301   29.964  -26.060 1.00 61.87  ? 600 ILE A N   1 
ATOM   3547 C CA  . ILE A 1 600 ? 4.809   29.995  -24.691 1.00 59.42  ? 600 ILE A CA  1 
ATOM   3548 C C   . ILE A 1 600 ? 3.686   30.191  -23.673 1.00 57.28  ? 600 ILE A C   1 
ATOM   3549 O O   . ILE A 1 600 ? 3.647   29.518  -22.642 1.00 60.08  ? 600 ILE A O   1 
ATOM   3550 C CB  . ILE A 1 600 ? 5.890   31.087  -24.506 1.00 61.34  ? 600 ILE A CB  1 
ATOM   3551 C CG1 . ILE A 1 600 ? 6.253   31.240  -23.026 1.00 58.09  ? 600 ILE A CG1 1 
ATOM   3552 C CG2 . ILE A 1 600 ? 5.422   32.415  -25.092 1.00 68.67  ? 600 ILE A CG2 1 
ATOM   3553 C CD1 . ILE A 1 600 ? 7.379   32.217  -22.766 1.00 60.17  ? 600 ILE A CD1 1 
ATOM   3554 N N   . GLY A 1 601 ? 2.771   31.107  -23.973 1.00 55.34  ? 601 GLY A N   1 
ATOM   3555 C CA  . GLY A 1 601 ? 1.626   31.361  -23.106 1.00 54.46  ? 601 GLY A CA  1 
ATOM   3556 C C   . GLY A 1 601 ? 0.692   30.169  -23.040 1.00 51.66  ? 601 GLY A C   1 
ATOM   3557 O O   . GLY A 1 601 ? 0.068   29.914  -22.010 1.00 49.78  ? 601 GLY A O   1 
ATOM   3558 N N   . ARG A 1 602 ? 0.598   29.437  -24.146 1.00 51.48  ? 602 ARG A N   1 
ATOM   3559 C CA  . ARG A 1 602 ? -0.234  28.242  -24.207 1.00 62.31  ? 602 ARG A CA  1 
ATOM   3560 C C   . ARG A 1 602 ? 0.420   27.087  -23.456 1.00 53.99  ? 602 ARG A C   1 
ATOM   3561 O O   . ARG A 1 602 ? -0.264  26.188  -22.967 1.00 55.23  ? 602 ARG A O   1 
ATOM   3562 C CB  . ARG A 1 602 ? -0.513  27.850  -25.660 1.00 75.22  ? 602 ARG A CB  1 
ATOM   3563 C CG  . ARG A 1 602 ? -1.376  28.854  -26.413 1.00 85.10  ? 602 ARG A CG  1 
ATOM   3564 C CD  . ARG A 1 602 ? -1.590  28.442  -27.861 1.00 89.35  ? 602 ARG A CD  1 
ATOM   3565 N NE  . ARG A 1 602 ? -2.403  29.417  -28.585 1.00 96.78  ? 602 ARG A NE  1 
ATOM   3566 C CZ  . ARG A 1 602 ? -2.715  29.325  -29.874 1.00 100.07 ? 602 ARG A CZ  1 
ATOM   3567 N NH1 . ARG A 1 602 ? -2.283  28.298  -30.594 1.00 101.36 ? 602 ARG A NH1 1 
ATOM   3568 N NH2 . ARG A 1 602 ? -3.461  30.261  -30.444 1.00 100.80 ? 602 ARG A NH2 1 
ATOM   3569 N N   . ARG A 1 603 ? 1.745   27.120  -23.366 1.00 51.96  ? 603 ARG A N   1 
ATOM   3570 C CA  . ARG A 1 603 ? 2.485   26.108  -22.621 1.00 48.14  ? 603 ARG A CA  1 
ATOM   3571 C C   . ARG A 1 603 ? 2.388   26.358  -21.120 1.00 49.63  ? 603 ARG A C   1 
ATOM   3572 O O   . ARG A 1 603 ? 2.317   25.416  -20.330 1.00 50.20  ? 603 ARG A O   1 
ATOM   3573 C CB  . ARG A 1 603 ? 3.950   26.068  -23.062 1.00 45.47  ? 603 ARG A CB  1 
ATOM   3574 C CG  . ARG A 1 603 ? 4.156   25.542  -24.474 1.00 42.65  ? 603 ARG A CG  1 
ATOM   3575 C CD  . ARG A 1 603 ? 5.552   24.970  -24.656 1.00 41.58  ? 603 ARG A CD  1 
ATOM   3576 N NE  . ARG A 1 603 ? 6.585   25.999  -24.628 1.00 38.66  ? 603 ARG A NE  1 
ATOM   3577 C CZ  . ARG A 1 603 ? 7.890   25.747  -24.635 1.00 41.93  ? 603 ARG A CZ  1 
ATOM   3578 N NH1 . ARG A 1 603 ? 8.327   24.496  -24.664 1.00 39.26  ? 603 ARG A NH1 1 
ATOM   3579 N NH2 . ARG A 1 603 ? 8.761   26.747  -24.609 1.00 51.93  ? 603 ARG A NH2 1 
ATOM   3580 N N   . TYR A 1 604 ? 2.384   27.631  -20.735 1.00 51.34  ? 604 TYR A N   1 
ATOM   3581 C CA  . TYR A 1 604 ? 2.233   28.007  -19.333 1.00 48.81  ? 604 TYR A CA  1 
ATOM   3582 C C   . TYR A 1 604 ? 0.815   27.754  -18.833 1.00 50.50  ? 604 TYR A C   1 
ATOM   3583 O O   . TYR A 1 604 ? 0.603   27.502  -17.648 1.00 49.02  ? 604 TYR A O   1 
ATOM   3584 C CB  . TYR A 1 604 ? 2.617   29.471  -19.114 1.00 50.91  ? 604 TYR A CB  1 
ATOM   3585 C CG  . TYR A 1 604 ? 4.060   29.671  -18.711 1.00 52.33  ? 604 TYR A CG  1 
ATOM   3586 C CD1 . TYR A 1 604 ? 4.913   30.461  -19.471 1.00 50.35  ? 604 TYR A CD1 1 
ATOM   3587 C CD2 . TYR A 1 604 ? 4.570   29.065  -17.569 1.00 50.80  ? 604 TYR A CD2 1 
ATOM   3588 C CE1 . TYR A 1 604 ? 6.234   30.646  -19.102 1.00 51.56  ? 604 TYR A CE1 1 
ATOM   3589 C CE2 . TYR A 1 604 ? 5.887   29.242  -17.194 1.00 53.35  ? 604 TYR A CE2 1 
ATOM   3590 C CZ  . TYR A 1 604 ? 6.715   30.033  -17.963 1.00 54.12  ? 604 TYR A CZ  1 
ATOM   3591 O OH  . TYR A 1 604 ? 8.028   30.208  -17.588 1.00 55.32  ? 604 TYR A OH  1 
ATOM   3592 N N   . ALA A 1 605 ? -0.152  27.823  -19.743 1.00 46.68  ? 605 ALA A N   1 
ATOM   3593 C CA  . ALA A 1 605 ? -1.539  27.528  -19.407 1.00 43.84  ? 605 ALA A CA  1 
ATOM   3594 C C   . ALA A 1 605 ? -1.696  26.050  -19.066 1.00 46.56  ? 605 ALA A C   1 
ATOM   3595 O O   . ALA A 1 605 ? -2.546  25.676  -18.257 1.00 43.65  ? 605 ALA A O   1 
ATOM   3596 C CB  . ALA A 1 605 ? -2.457  27.911  -20.555 1.00 43.38  ? 605 ALA A CB  1 
ATOM   3597 N N   . ARG A 1 606 ? -0.867  25.216  -19.687 1.00 50.41  ? 606 ARG A N   1 
ATOM   3598 C CA  . ARG A 1 606 ? -0.881  23.780  -19.435 1.00 53.10  ? 606 ARG A CA  1 
ATOM   3599 C C   . ARG A 1 606 ? -0.299  23.452  -18.065 1.00 48.81  ? 606 ARG A C   1 
ATOM   3600 O O   . ARG A 1 606 ? -0.840  22.624  -17.332 1.00 48.84  ? 606 ARG A O   1 
ATOM   3601 C CB  . ARG A 1 606 ? -0.109  23.035  -20.525 1.00 59.99  ? 606 ARG A CB  1 
ATOM   3602 C CG  . ARG A 1 606 ? -0.772  23.065  -21.892 1.00 64.95  ? 606 ARG A CG  1 
ATOM   3603 C CD  . ARG A 1 606 ? -0.129  22.063  -22.838 1.00 70.95  ? 606 ARG A CD  1 
ATOM   3604 N NE  . ARG A 1 606 ? -0.784  22.045  -24.142 1.00 77.57  ? 606 ARG A NE  1 
ATOM   3605 C CZ  . ARG A 1 606 ? -0.359  22.724  -25.203 1.00 81.17  ? 606 ARG A CZ  1 
ATOM   3606 N NH1 . ARG A 1 606 ? 0.730   23.478  -25.119 1.00 82.80  ? 606 ARG A NH1 1 
ATOM   3607 N NH2 . ARG A 1 606 ? -1.020  22.647  -26.349 1.00 82.72  ? 606 ARG A NH2 1 
ATOM   3608 N N   . THR A 1 607 ? 0.807   24.108  -17.726 1.00 41.37  ? 607 THR A N   1 
ATOM   3609 C CA  . THR A 1 607 ? 1.464   23.898  -16.440 1.00 36.79  ? 607 THR A CA  1 
ATOM   3610 C C   . THR A 1 607 ? 0.609   24.420  -15.288 1.00 40.63  ? 607 THR A C   1 
ATOM   3611 O O   . THR A 1 607 ? 0.619   23.858  -14.193 1.00 39.15  ? 607 THR A O   1 
ATOM   3612 C CB  . THR A 1 607 ? 2.849   24.574  -16.395 1.00 38.59  ? 607 THR A CB  1 
ATOM   3613 O OG1 . THR A 1 607 ? 2.703   25.985  -16.598 1.00 36.56  ? 607 THR A OG1 1 
ATOM   3614 C CG2 . THR A 1 607 ? 3.760   23.999  -17.473 1.00 31.07  ? 607 THR A CG2 1 
ATOM   3615 N N   . ASP A 1 608 ? -0.128  25.498  -15.543 1.00 42.21  ? 608 ASP A N   1 
ATOM   3616 C CA  . ASP A 1 608 ? -1.024  26.072  -14.545 1.00 38.80  ? 608 ASP A CA  1 
ATOM   3617 C C   . ASP A 1 608 ? -2.182  25.130  -14.260 1.00 35.51  ? 608 ASP A C   1 
ATOM   3618 O O   . ASP A 1 608 ? -2.635  25.011  -13.122 1.00 39.85  ? 608 ASP A O   1 
ATOM   3619 C CB  . ASP A 1 608 ? -1.576  27.413  -15.026 1.00 42.06  ? 608 ASP A CB  1 
ATOM   3620 C CG  . ASP A 1 608 ? -0.541  28.513  -15.000 1.00 43.53  ? 608 ASP A CG  1 
ATOM   3621 O OD1 . ASP A 1 608 ? 0.640   28.218  -14.718 1.00 42.62  ? 608 ASP A OD1 1 
ATOM   3622 O OD2 . ASP A 1 608 ? -0.910  29.677  -15.265 1.00 45.26  ? 608 ASP A OD2 1 
ATOM   3623 N N   . GLU A 1 609 ? -2.654  24.465  -15.308 1.00 35.81  ? 609 GLU A N   1 
ATOM   3624 C CA  . GLU A 1 609 ? -3.797  23.569  -15.208 1.00 37.02  ? 609 GLU A CA  1 
ATOM   3625 C C   . GLU A 1 609 ? -3.543  22.456  -14.196 1.00 33.93  ? 609 GLU A C   1 
ATOM   3626 O O   . GLU A 1 609 ? -4.455  22.031  -13.490 1.00 39.25  ? 609 GLU A O   1 
ATOM   3627 C CB  . GLU A 1 609 ? -4.125  22.981  -16.582 1.00 43.04  ? 609 GLU A CB  1 
ATOM   3628 C CG  . GLU A 1 609 ? -5.531  22.422  -16.706 1.00 47.99  ? 609 GLU A CG  1 
ATOM   3629 C CD  . GLU A 1 609 ? -5.873  22.018  -18.128 1.00 50.83  ? 609 GLU A CD  1 
ATOM   3630 O OE1 . GLU A 1 609 ? -4.961  21.587  -18.864 1.00 56.32  ? 609 GLU A OE1 1 
ATOM   3631 O OE2 . GLU A 1 609 ? -7.056  22.131  -18.508 1.00 55.51  ? 609 GLU A OE2 1 
ATOM   3632 N N   . ILE A 1 610 ? -2.299  21.991  -14.125 1.00 33.97  ? 610 ILE A N   1 
ATOM   3633 C CA  . ILE A 1 610 ? -1.934  20.945  -13.174 1.00 35.22  ? 610 ILE A CA  1 
ATOM   3634 C C   . ILE A 1 610 ? -1.328  21.518  -11.893 1.00 34.15  ? 610 ILE A C   1 
ATOM   3635 O O   . ILE A 1 610 ? -0.916  20.775  -11.002 1.00 36.15  ? 610 ILE A O   1 
ATOM   3636 C CB  . ILE A 1 610 ? -0.981  19.902  -13.797 1.00 40.59  ? 610 ILE A CB  1 
ATOM   3637 C CG1 . ILE A 1 610 ? 0.310   20.563  -14.279 1.00 36.42  ? 610 ILE A CG1 1 
ATOM   3638 C CG2 . ILE A 1 610 ? -1.670  19.170  -14.941 1.00 45.02  ? 610 ILE A CG2 1 
ATOM   3639 C CD1 . ILE A 1 610 ? 1.349   19.579  -14.771 1.00 34.10  ? 610 ILE A CD1 1 
ATOM   3640 N N   . GLY A 1 611 ? -1.272  22.844  -11.813 1.00 28.02  ? 611 GLY A N   1 
ATOM   3641 C CA  . GLY A 1 611 ? -0.900  23.529  -10.581 1.00 24.15  ? 611 GLY A CA  1 
ATOM   3642 C C   . GLY A 1 611 ? 0.584   23.695  -10.312 1.00 32.26  ? 611 GLY A C   1 
ATOM   3643 O O   . GLY A 1 611 ? 0.995   23.787  -9.155  1.00 35.40  ? 611 GLY A O   1 
ATOM   3644 N N   . VAL A 1 612 ? 1.390   23.741  -11.369 1.00 34.15  ? 612 VAL A N   1 
ATOM   3645 C CA  . VAL A 1 612 ? 2.829   23.963  -11.216 1.00 30.34  ? 612 VAL A CA  1 
ATOM   3646 C C   . VAL A 1 612 ? 3.083   25.367  -10.673 1.00 35.61  ? 612 VAL A C   1 
ATOM   3647 O O   . VAL A 1 612 ? 2.615   26.356  -11.239 1.00 35.87  ? 612 VAL A O   1 
ATOM   3648 C CB  . VAL A 1 612 ? 3.589   23.765  -12.544 1.00 29.14  ? 612 VAL A CB  1 
ATOM   3649 C CG1 . VAL A 1 612 ? 5.082   23.976  -12.341 1.00 27.73  ? 612 VAL A CG1 1 
ATOM   3650 C CG2 . VAL A 1 612 ? 3.321   22.381  -13.104 1.00 23.72  ? 612 VAL A CG2 1 
ATOM   3651 N N   . ALA A 1 613 ? 3.829   25.442  -9.574  1.00 38.80  ? 613 ALA A N   1 
ATOM   3652 C CA  . ALA A 1 613 ? 3.987   26.685  -8.817  1.00 36.74  ? 613 ALA A CA  1 
ATOM   3653 C C   . ALA A 1 613 ? 4.753   27.776  -9.558  1.00 36.32  ? 613 ALA A C   1 
ATOM   3654 O O   . ALA A 1 613 ? 4.301   28.918  -9.630  1.00 46.53  ? 613 ALA A O   1 
ATOM   3655 C CB  . ALA A 1 613 ? 4.642   26.403  -7.469  1.00 38.09  ? 613 ALA A CB  1 
ATOM   3656 N N   . PHE A 1 614 ? 5.914   27.430  -10.098 1.00 36.21  ? 614 PHE A N   1 
ATOM   3657 C CA  . PHE A 1 614 ? 6.752   28.425  -10.753 1.00 32.52  ? 614 PHE A CA  1 
ATOM   3658 C C   . PHE A 1 614 ? 7.162   28.013  -12.156 1.00 37.13  ? 614 PHE A C   1 
ATOM   3659 O O   . PHE A 1 614 ? 6.947   26.876  -12.575 1.00 42.83  ? 614 PHE A O   1 
ATOM   3660 C CB  . PHE A 1 614 ? 7.979   28.738  -9.897  1.00 32.27  ? 614 PHE A CB  1 
ATOM   3661 C CG  . PHE A 1 614 ? 7.638   29.209  -8.516  1.00 38.65  ? 614 PHE A CG  1 
ATOM   3662 C CD1 . PHE A 1 614 ? 7.027   30.437  -8.322  1.00 37.57  ? 614 PHE A CD1 1 
ATOM   3663 C CD2 . PHE A 1 614 ? 7.914   28.420  -7.412  1.00 42.68  ? 614 PHE A CD2 1 
ATOM   3664 C CE1 . PHE A 1 614 ? 6.703   30.873  -7.053  1.00 41.04  ? 614 PHE A CE1 1 
ATOM   3665 C CE2 . PHE A 1 614 ? 7.593   28.851  -6.138  1.00 42.97  ? 614 PHE A CE2 1 
ATOM   3666 C CZ  . PHE A 1 614 ? 6.986   30.078  -5.959  1.00 41.75  ? 614 PHE A CZ  1 
ATOM   3667 N N   . GLY A 1 615 ? 7.751   28.957  -12.880 1.00 44.43  ? 615 GLY A N   1 
ATOM   3668 C CA  . GLY A 1 615 ? 8.155   28.724  -14.255 1.00 40.37  ? 615 GLY A CA  1 
ATOM   3669 C C   . GLY A 1 615 ? 9.343   29.578  -14.638 1.00 44.13  ? 615 GLY A C   1 
ATOM   3670 O O   . GLY A 1 615 ? 9.429   30.748  -14.266 1.00 37.04  ? 615 GLY A O   1 
ATOM   3671 N N   . VAL A 1 616 ? 10.269  28.981  -15.377 1.00 42.00  ? 616 VAL A N   1 
ATOM   3672 C CA  . VAL A 1 616 ? 11.441  29.689  -15.861 1.00 37.27  ? 616 VAL A CA  1 
ATOM   3673 C C   . VAL A 1 616 ? 11.558  29.471  -17.360 1.00 40.82  ? 616 VAL A C   1 
ATOM   3674 O O   . VAL A 1 616 ? 11.880  28.373  -17.812 1.00 34.17  ? 616 VAL A O   1 
ATOM   3675 C CB  . VAL A 1 616 ? 12.726  29.198  -15.174 1.00 40.08  ? 616 VAL A CB  1 
ATOM   3676 C CG1 . VAL A 1 616 ? 13.952  29.815  -15.832 1.00 43.94  ? 616 VAL A CG1 1 
ATOM   3677 C CG2 . VAL A 1 616 ? 12.693  29.519  -13.687 1.00 39.21  ? 616 VAL A CG2 1 
ATOM   3678 N N   . THR A 1 617 ? 11.281  30.515  -18.132 1.00 45.03  ? 617 THR A N   1 
ATOM   3679 C CA  . THR A 1 617 ? 11.335  30.407  -19.584 1.00 43.90  ? 617 THR A CA  1 
ATOM   3680 C C   . THR A 1 617 ? 12.669  30.876  -20.152 1.00 41.27  ? 617 THR A C   1 
ATOM   3681 O O   . THR A 1 617 ? 13.156  31.955  -19.814 1.00 41.57  ? 617 THR A O   1 
ATOM   3682 C CB  . THR A 1 617 ? 10.168  31.151  -20.261 1.00 41.03  ? 617 THR A CB  1 
ATOM   3683 O OG1 . THR A 1 617 ? 10.638  31.790  -21.455 1.00 38.58  ? 617 THR A OG1 1 
ATOM   3684 C CG2 . THR A 1 617 ? 9.592   32.201  -19.330 1.00 45.76  ? 617 THR A CG2 1 
ATOM   3685 N N   . ILE A 1 618 ? 13.254  30.053  -21.017 1.00 42.68  ? 618 ILE A N   1 
ATOM   3686 C CA  . ILE A 1 618 ? 14.544  30.357  -21.621 1.00 46.51  ? 618 ILE A CA  1 
ATOM   3687 C C   . ILE A 1 618 ? 14.388  30.732  -23.090 1.00 49.17  ? 618 ILE A C   1 
ATOM   3688 O O   . ILE A 1 618 ? 14.128  29.877  -23.939 1.00 46.57  ? 618 ILE A O   1 
ATOM   3689 C CB  . ILE A 1 618 ? 15.520  29.171  -21.489 1.00 45.05  ? 618 ILE A CB  1 
ATOM   3690 C CG1 . ILE A 1 618 ? 15.816  28.893  -20.013 1.00 38.93  ? 618 ILE A CG1 1 
ATOM   3691 C CG2 . ILE A 1 618 ? 16.809  29.452  -22.242 1.00 41.94  ? 618 ILE A CG2 1 
ATOM   3692 C CD1 . ILE A 1 618 ? 16.616  27.631  -19.776 1.00 38.38  ? 618 ILE A CD1 1 
ATOM   3693 N N   . ASP A 1 619 ? 14.540  32.020  -23.380 1.00 53.89  ? 619 ASP A N   1 
ATOM   3694 C CA  . ASP A 1 619 ? 14.448  32.514  -24.747 1.00 52.95  ? 619 ASP A CA  1 
ATOM   3695 C C   . ASP A 1 619 ? 15.832  32.744  -25.344 1.00 49.29  ? 619 ASP A C   1 
ATOM   3696 O O   . ASP A 1 619 ? 16.843  32.388  -24.740 1.00 55.02  ? 619 ASP A O   1 
ATOM   3697 C CB  . ASP A 1 619 ? 13.597  33.786  -24.814 1.00 54.47  ? 619 ASP A CB  1 
ATOM   3698 C CG  . ASP A 1 619 ? 13.918  34.766  -23.703 1.00 57.90  ? 619 ASP A CG  1 
ATOM   3699 O OD1 . ASP A 1 619 ? 15.094  34.840  -23.287 1.00 59.12  ? 619 ASP A OD1 1 
ATOM   3700 O OD2 . ASP A 1 619 ? 12.992  35.469  -23.247 1.00 58.38  ? 619 ASP A OD2 1 
ATOM   3701 N N   . PHE A 1 620 ? 15.871  33.341  -26.530 1.00 48.46  ? 620 PHE A N   1 
ATOM   3702 C CA  . PHE A 1 620 ? 17.122  33.513  -27.262 1.00 42.21  ? 620 PHE A CA  1 
ATOM   3703 C C   . PHE A 1 620 ? 18.099  34.465  -26.580 1.00 49.15  ? 620 PHE A C   1 
ATOM   3704 O O   . PHE A 1 620 ? 19.313  34.263  -26.640 1.00 53.12  ? 620 PHE A O   1 
ATOM   3705 C CB  . PHE A 1 620 ? 16.847  33.964  -28.696 1.00 38.19  ? 620 PHE A CB  1 
ATOM   3706 C CG  . PHE A 1 620 ? 16.267  32.885  -29.564 1.00 36.66  ? 620 PHE A CG  1 
ATOM   3707 C CD1 . PHE A 1 620 ? 14.938  32.927  -29.954 1.00 33.66  ? 620 PHE A CD1 1 
ATOM   3708 C CD2 . PHE A 1 620 ? 17.051  31.820  -29.980 1.00 34.97  ? 620 PHE A CD2 1 
ATOM   3709 C CE1 . PHE A 1 620 ? 14.404  31.931  -30.752 1.00 34.89  ? 620 PHE A CE1 1 
ATOM   3710 C CE2 . PHE A 1 620 ? 16.524  30.821  -30.776 1.00 34.11  ? 620 PHE A CE2 1 
ATOM   3711 C CZ  . PHE A 1 620 ? 15.198  30.877  -31.163 1.00 35.35  ? 620 PHE A CZ  1 
ATOM   3712 N N   . ASP A 1 621 ? 17.569  35.496  -25.931 1.00 50.85  ? 621 ASP A N   1 
ATOM   3713 C CA  . ASP A 1 621 ? 18.403  36.450  -25.209 1.00 54.02  ? 621 ASP A CA  1 
ATOM   3714 C C   . ASP A 1 621 ? 19.122  35.773  -24.048 1.00 49.75  ? 621 ASP A C   1 
ATOM   3715 O O   . ASP A 1 621 ? 20.202  36.200  -23.640 1.00 45.03  ? 621 ASP A O   1 
ATOM   3716 C CB  . ASP A 1 621 ? 17.562  37.622  -24.699 1.00 63.62  ? 621 ASP A CB  1 
ATOM   3717 C CG  . ASP A 1 621 ? 16.989  38.463  -25.823 1.00 68.62  ? 621 ASP A CG  1 
ATOM   3718 O OD1 . ASP A 1 621 ? 17.343  38.217  -26.996 1.00 72.23  ? 621 ASP A OD1 1 
ATOM   3719 O OD2 . ASP A 1 621 ? 16.184  39.372  -25.534 1.00 70.28  ? 621 ASP A OD2 1 
ATOM   3720 N N   . THR A 1 622 ? 18.517  34.712  -23.524 1.00 48.63  ? 622 THR A N   1 
ATOM   3721 C CA  . THR A 1 622 ? 19.110  33.954  -22.431 1.00 50.59  ? 622 THR A CA  1 
ATOM   3722 C C   . THR A 1 622 ? 20.415  33.291  -22.866 1.00 54.96  ? 622 THR A C   1 
ATOM   3723 O O   . THR A 1 622 ? 21.358  33.188  -22.084 1.00 53.42  ? 622 THR A O   1 
ATOM   3724 C CB  . THR A 1 622 ? 18.142  32.885  -21.887 1.00 45.73  ? 622 THR A CB  1 
ATOM   3725 O OG1 . THR A 1 622 ? 16.867  33.483  -21.619 1.00 43.59  ? 622 THR A OG1 1 
ATOM   3726 C CG2 . THR A 1 622 ? 18.687  32.265  -20.606 1.00 41.14  ? 622 THR A CG2 1 
ATOM   3727 N N   . VAL A 1 623 ? 20.464  32.853  -24.120 1.00 54.98  ? 623 VAL A N   1 
ATOM   3728 C CA  . VAL A 1 623 ? 21.653  32.198  -24.657 1.00 55.42  ? 623 VAL A CA  1 
ATOM   3729 C C   . VAL A 1 623 ? 22.625  33.196  -25.283 1.00 55.43  ? 623 VAL A C   1 
ATOM   3730 O O   . VAL A 1 623 ? 23.797  33.253  -24.908 1.00 50.57  ? 623 VAL A O   1 
ATOM   3731 C CB  . VAL A 1 623 ? 21.284  31.126  -25.700 1.00 55.73  ? 623 VAL A CB  1 
ATOM   3732 C CG1 . VAL A 1 623 ? 22.538  30.552  -26.343 1.00 54.75  ? 623 VAL A CG1 1 
ATOM   3733 C CG2 . VAL A 1 623 ? 20.467  30.027  -25.053 1.00 55.28  ? 623 VAL A CG2 1 
ATOM   3734 N N   . ASN A 1 624 ? 22.131  33.981  -26.236 1.00 52.42  ? 624 ASN A N   1 
ATOM   3735 C CA  . ASN A 1 624 ? 22.967  34.930  -26.965 1.00 55.05  ? 624 ASN A CA  1 
ATOM   3736 C C   . ASN A 1 624 ? 23.352  36.147  -26.139 1.00 55.61  ? 624 ASN A C   1 
ATOM   3737 O O   . ASN A 1 624 ? 24.516  36.318  -25.776 1.00 62.10  ? 624 ASN A O   1 
ATOM   3738 C CB  . ASN A 1 624 ? 22.261  35.396  -28.238 1.00 50.82  ? 624 ASN A CB  1 
ATOM   3739 C CG  . ASN A 1 624 ? 21.881  34.250  -29.144 1.00 50.18  ? 624 ASN A CG  1 
ATOM   3740 O OD1 . ASN A 1 624 ? 22.585  33.243  -29.222 1.00 46.30  ? 624 ASN A OD1 1 
ATOM   3741 N ND2 . ASN A 1 624 ? 20.763  34.396  -29.841 1.00 52.02  ? 624 ASN A ND2 1 
ATOM   3742 N N   . LYS A 1 625 ? 22.365  36.995  -25.853 1.00 57.35  ? 625 LYS A N   1 
ATOM   3743 C CA  . LYS A 1 625 ? 22.626  38.258  -25.164 1.00 63.27  ? 625 LYS A CA  1 
ATOM   3744 C C   . LYS A 1 625 ? 23.319  38.057  -23.817 1.00 69.60  ? 625 LYS A C   1 
ATOM   3745 O O   . LYS A 1 625 ? 22.826  37.367  -22.916 1.00 79.18  ? 625 LYS A O   1 
ATOM   3746 C CB  . LYS A 1 625 ? 21.383  39.152  -25.104 1.00 57.37  ? 625 LYS A CB  1 
ATOM   3747 C CG  . LYS A 1 625 ? 21.214  39.960  -26.390 1.00 60.05  ? 625 LYS A CG  1 
ATOM   3748 C CD  . LYS A 1 625 ? 20.045  40.926  -26.326 1.00 60.73  ? 625 LYS A CD  1 
ATOM   3749 C CE  . LYS A 1 625 ? 20.109  41.907  -27.493 1.00 64.88  ? 625 LYS A CE  1 
ATOM   3750 N NZ  . LYS A 1 625 ? 18.956  42.852  -27.479 1.00 64.88  ? 625 LYS A NZ  1 
ATOM   3751 N N   . THR A 1 626 ? 24.464  38.720  -23.707 1.00 80.44  ? 626 THR A N   1 
ATOM   3752 C CA  . THR A 1 626 ? 25.685  38.114  -23.155 1.00 89.41  ? 626 THR A CA  1 
ATOM   3753 C C   . THR A 1 626 ? 25.837  37.870  -21.635 1.00 84.80  ? 626 THR A C   1 
ATOM   3754 O O   . THR A 1 626 ? 26.583  36.973  -21.229 1.00 84.76  ? 626 THR A O   1 
ATOM   3755 C CB  . THR A 1 626 ? 26.944  38.819  -23.745 1.00 94.77  ? 626 THR A CB  1 
ATOM   3756 O OG1 . THR A 1 626 ? 26.775  38.996  -25.163 1.00 94.24  ? 626 THR A OG1 1 
ATOM   3757 C CG2 . THR A 1 626 ? 28.200  37.998  -23.484 1.00 94.81  ? 626 THR A CG2 1 
ATOM   3758 N N   . PRO A 1 627 ? 25.155  38.666  -20.795 1.00 77.48  ? 627 PRO A N   1 
ATOM   3759 C CA  . PRO A 1 627 ? 25.003  38.292  -19.392 1.00 70.18  ? 627 PRO A CA  1 
ATOM   3760 C C   . PRO A 1 627 ? 23.707  37.499  -19.227 1.00 61.34  ? 627 PRO A C   1 
ATOM   3761 O O   . PRO A 1 627 ? 22.619  38.075  -19.238 1.00 49.35  ? 627 PRO A O   1 
ATOM   3762 C CB  . PRO A 1 627 ? 24.911  39.643  -18.679 1.00 65.24  ? 627 PRO A CB  1 
ATOM   3763 C CG  . PRO A 1 627 ? 24.454  40.628  -19.736 1.00 68.38  ? 627 PRO A CG  1 
ATOM   3764 C CD  . PRO A 1 627 ? 24.521  39.962  -21.087 1.00 71.59  ? 627 PRO A CD  1 
ATOM   3765 N N   . HIS A 1 628 ? 23.831  36.185  -19.075 1.00 56.74  ? 628 HIS A N   1 
ATOM   3766 C CA  . HIS A 1 628 ? 22.696  35.275  -19.238 1.00 56.83  ? 628 HIS A CA  1 
ATOM   3767 C C   . HIS A 1 628 ? 21.591  35.371  -18.183 1.00 52.82  ? 628 HIS A C   1 
ATOM   3768 O O   . HIS A 1 628 ? 21.741  34.892  -17.060 1.00 54.30  ? 628 HIS A O   1 
ATOM   3769 C CB  . HIS A 1 628 ? 23.194  33.837  -19.365 1.00 56.90  ? 628 HIS A CB  1 
ATOM   3770 C CG  . HIS A 1 628 ? 24.194  33.652  -20.460 1.00 58.21  ? 628 HIS A CG  1 
ATOM   3771 N ND1 . HIS A 1 628 ? 25.551  33.592  -20.228 1.00 59.19  ? 628 HIS A ND1 1 
ATOM   3772 C CD2 . HIS A 1 628 ? 24.036  33.538  -21.800 1.00 58.47  ? 628 HIS A CD2 1 
ATOM   3773 C CE1 . HIS A 1 628 ? 26.185  33.435  -21.376 1.00 60.97  ? 628 HIS A CE1 1 
ATOM   3774 N NE2 . HIS A 1 628 ? 25.289  33.398  -22.345 1.00 59.64  ? 628 HIS A NE2 1 
ATOM   3775 N N   . THR A 1 629 ? 20.472  35.973  -18.574 1.00 44.37  ? 629 THR A N   1 
ATOM   3776 C CA  . THR A 1 629 ? 19.310  36.099  -17.702 1.00 42.72  ? 629 THR A CA  1 
ATOM   3777 C C   . THR A 1 629 ? 18.091  35.383  -18.283 1.00 44.25  ? 629 THR A C   1 
ATOM   3778 O O   . THR A 1 629 ? 17.865  35.400  -19.494 1.00 42.26  ? 629 THR A O   1 
ATOM   3779 C CB  . THR A 1 629 ? 18.941  37.575  -17.457 1.00 38.56  ? 629 THR A CB  1 
ATOM   3780 O OG1 . THR A 1 629 ? 18.525  38.178  -18.689 1.00 39.63  ? 629 THR A OG1 1 
ATOM   3781 C CG2 . THR A 1 629 ? 20.130  38.339  -16.894 1.00 33.29  ? 629 THR A CG2 1 
ATOM   3782 N N   . ALA A 1 630 ? 17.313  34.754  -17.409 1.00 42.30  ? 630 ALA A N   1 
ATOM   3783 C CA  . ALA A 1 630 ? 16.073  34.099  -17.808 1.00 39.87  ? 630 ALA A CA  1 
ATOM   3784 C C   . ALA A 1 630 ? 14.905  34.693  -17.029 1.00 43.22  ? 630 ALA A C   1 
ATOM   3785 O O   . ALA A 1 630 ? 15.106  35.387  -16.032 1.00 45.61  ? 630 ALA A O   1 
ATOM   3786 C CB  . ALA A 1 630 ? 16.165  32.601  -17.579 1.00 35.57  ? 630 ALA A CB  1 
ATOM   3787 N N   . THR A 1 631 ? 13.687  34.421  -17.484 1.00 35.31  ? 631 THR A N   1 
ATOM   3788 C CA  . THR A 1 631 ? 12.501  34.994  -16.854 1.00 33.10  ? 631 THR A CA  1 
ATOM   3789 C C   . THR A 1 631 ? 11.753  34.007  -15.959 1.00 38.59  ? 631 THR A C   1 
ATOM   3790 O O   . THR A 1 631 ? 11.527  32.857  -16.332 1.00 36.04  ? 631 THR A O   1 
ATOM   3791 C CB  . THR A 1 631 ? 11.537  35.605  -17.895 1.00 37.00  ? 631 THR A CB  1 
ATOM   3792 O OG1 . THR A 1 631 ? 10.199  35.577  -17.384 1.00 37.25  ? 631 THR A OG1 1 
ATOM   3793 C CG2 . THR A 1 631 ? 11.588  34.830  -19.196 1.00 40.59  ? 631 THR A CG2 1 
ATOM   3794 N N   . LEU A 1 632 ? 11.372  34.479  -14.774 1.00 39.57  ? 632 LEU A N   1 
ATOM   3795 C CA  . LEU A 1 632 ? 10.673  33.662  -13.789 1.00 31.96  ? 632 LEU A CA  1 
ATOM   3796 C C   . LEU A 1 632 ? 9.221   34.105  -13.643 1.00 28.28  ? 632 LEU A C   1 
ATOM   3797 O O   . LEU A 1 632 ? 8.951   35.263  -13.327 1.00 38.74  ? 632 LEU A O   1 
ATOM   3798 C CB  . LEU A 1 632 ? 11.384  33.749  -12.436 1.00 30.55  ? 632 LEU A CB  1 
ATOM   3799 C CG  . LEU A 1 632 ? 10.680  33.163  -11.210 1.00 33.46  ? 632 LEU A CG  1 
ATOM   3800 C CD1 . LEU A 1 632 ? 10.589  31.646  -11.304 1.00 30.36  ? 632 LEU A CD1 1 
ATOM   3801 C CD2 . LEU A 1 632 ? 11.403  33.575  -9.937  1.00 32.25  ? 632 LEU A CD2 1 
ATOM   3802 N N   . ARG A 1 633 ? 8.291   33.180  -13.866 1.00 29.60  ? 633 ARG A N   1 
ATOM   3803 C CA  . ARG A 1 633 ? 6.866   33.490  -13.775 1.00 27.76  ? 633 ARG A CA  1 
ATOM   3804 C C   . ARG A 1 633 ? 6.230   32.911  -12.513 1.00 29.70  ? 633 ARG A C   1 
ATOM   3805 O O   . ARG A 1 633 ? 6.604   31.831  -12.057 1.00 35.62  ? 633 ARG A O   1 
ATOM   3806 C CB  . ARG A 1 633 ? 6.117   32.975  -15.006 1.00 21.36  ? 633 ARG A CB  1 
ATOM   3807 C CG  . ARG A 1 633 ? 4.775   33.656  -15.222 1.00 31.09  ? 633 ARG A CG  1 
ATOM   3808 C CD  . ARG A 1 633 ? 3.892   32.910  -16.205 1.00 31.22  ? 633 ARG A CD  1 
ATOM   3809 N NE  . ARG A 1 633 ? 3.100   31.880  -15.543 1.00 39.61  ? 633 ARG A NE  1 
ATOM   3810 C CZ  . ARG A 1 633 ? 1.930   31.436  -15.989 1.00 40.34  ? 633 ARG A CZ  1 
ATOM   3811 N NH1 . ARG A 1 633 ? 1.405   31.936  -17.100 1.00 41.85  ? 633 ARG A NH1 1 
ATOM   3812 N NH2 . ARG A 1 633 ? 1.283   30.498  -15.318 1.00 40.44  ? 633 ARG A NH2 1 
ATOM   3813 N N   . ASP A 1 634 ? 5.265   33.639  -11.960 1.00 28.56  ? 634 ASP A N   1 
ATOM   3814 C CA  . ASP A 1 634 ? 4.512   33.181  -10.798 1.00 32.61  ? 634 ASP A CA  1 
ATOM   3815 C C   . ASP A 1 634 ? 3.171   32.605  -11.248 1.00 35.40  ? 634 ASP A C   1 
ATOM   3816 O O   . ASP A 1 634 ? 2.528   33.153  -12.142 1.00 35.51  ? 634 ASP A O   1 
ATOM   3817 C CB  . ASP A 1 634 ? 4.288   34.340  -9.826  1.00 36.05  ? 634 ASP A CB  1 
ATOM   3818 C CG  . ASP A 1 634 ? 3.489   33.932  -8.605  1.00 40.54  ? 634 ASP A CG  1 
ATOM   3819 O OD1 . ASP A 1 634 ? 2.363   34.446  -8.431  1.00 42.87  ? 634 ASP A OD1 1 
ATOM   3820 O OD2 . ASP A 1 634 ? 3.982   33.092  -7.823  1.00 45.56  ? 634 ASP A OD2 1 
ATOM   3821 N N   . ARG A 1 635 ? 2.750   31.504  -10.632 1.00 30.98  ? 635 ARG A N   1 
ATOM   3822 C CA  . ARG A 1 635 ? 1.506   30.848  -11.027 1.00 37.41  ? 635 ARG A CA  1 
ATOM   3823 C C   . ARG A 1 635 ? 0.281   31.722  -10.778 1.00 38.84  ? 635 ARG A C   1 
ATOM   3824 O O   . ARG A 1 635 ? -0.497  31.989  -11.693 1.00 43.78  ? 635 ARG A O   1 
ATOM   3825 C CB  . ARG A 1 635 ? 1.323   29.519  -10.294 1.00 34.67  ? 635 ARG A CB  1 
ATOM   3826 C CG  . ARG A 1 635 ? 0.132   28.722  -10.802 1.00 31.69  ? 635 ARG A CG  1 
ATOM   3827 C CD  . ARG A 1 635 ? -0.720  28.183  -9.667  1.00 35.23  ? 635 ARG A CD  1 
ATOM   3828 N NE  . ARG A 1 635 ? -0.027  27.170  -8.879  1.00 41.77  ? 635 ARG A NE  1 
ATOM   3829 C CZ  . ARG A 1 635 ? 0.404   27.355  -7.636  1.00 43.99  ? 635 ARG A CZ  1 
ATOM   3830 N NH1 . ARG A 1 635 ? 0.210   28.517  -7.027  1.00 41.53  ? 635 ARG A NH1 1 
ATOM   3831 N NH2 . ARG A 1 635 ? 1.027   26.373  -7.000  1.00 47.37  ? 635 ARG A NH2 1 
ATOM   3832 N N   . ASP A 1 636 ? 0.115   32.153  -9.531  1.00 42.56  ? 636 ASP A N   1 
ATOM   3833 C CA  . ASP A 1 636 ? -1.070  32.900  -9.119  1.00 41.53  ? 636 ASP A CA  1 
ATOM   3834 C C   . ASP A 1 636 ? -1.194  34.243  -9.831  1.00 43.80  ? 636 ASP A C   1 
ATOM   3835 O O   . ASP A 1 636 ? -2.126  34.460  -10.608 1.00 36.70  ? 636 ASP A O   1 
ATOM   3836 C CB  . ASP A 1 636 ? -1.069  33.106  -7.602  1.00 44.58  ? 636 ASP A CB  1 
ATOM   3837 C CG  . ASP A 1 636 ? -1.190  31.802  -6.835  1.00 42.31  ? 636 ASP A CG  1 
ATOM   3838 O OD1 . ASP A 1 636 ? -1.826  30.860  -7.354  1.00 41.87  ? 636 ASP A OD1 1 
ATOM   3839 O OD2 . ASP A 1 636 ? -0.652  31.722  -5.711  1.00 40.98  ? 636 ASP A OD2 1 
ATOM   3840 N N   . SER A 1 637 ? -0.250  35.139  -9.563  1.00 42.19  ? 637 SER A N   1 
ATOM   3841 C CA  . SER A 1 637 ? -0.284  36.485  -10.124 1.00 42.89  ? 637 SER A CA  1 
ATOM   3842 C C   . SER A 1 637 ? -0.085  36.480  -11.637 1.00 43.68  ? 637 SER A C   1 
ATOM   3843 O O   . SER A 1 637 ? -0.621  37.335  -12.341 1.00 48.64  ? 637 SER A O   1 
ATOM   3844 C CB  . SER A 1 637 ? 0.772   37.367  -9.459  1.00 42.30  ? 637 SER A CB  1 
ATOM   3845 O OG  . SER A 1 637 ? 2.077   36.890  -9.732  1.00 45.20  ? 637 SER A OG  1 
ATOM   3846 N N   . MET A 1 638 ? 0.692   35.517  -12.125 1.00 46.08  ? 638 MET A N   1 
ATOM   3847 C CA  . MET A 1 638 ? 0.984   35.393  -13.552 1.00 41.38  ? 638 MET A CA  1 
ATOM   3848 C C   . MET A 1 638 ? 2.041   36.415  -13.973 1.00 40.26  ? 638 MET A C   1 
ATOM   3849 O O   . MET A 1 638 ? 2.408   36.502  -15.145 1.00 36.40  ? 638 MET A O   1 
ATOM   3850 C CB  . MET A 1 638 ? -0.296  35.553  -14.378 1.00 37.32  ? 638 MET A CB  1 
ATOM   3851 C CG  . MET A 1 638 ? -0.330  34.735  -15.656 1.00 38.31  ? 638 MET A CG  1 
ATOM   3852 S SD  . MET A 1 638 ? -2.012  34.533  -16.280 1.00 44.85  ? 638 MET A SD  1 
ATOM   3853 C CE  . MET A 1 638 ? -1.739  33.394  -17.635 1.00 46.05  ? 638 MET A CE  1 
ATOM   3854 N N   . ARG A 1 639 ? 2.533   37.175  -13.000 1.00 36.00  ? 639 ARG A N   1 
ATOM   3855 C CA  . ARG A 1 639 ? 3.541   38.201  -13.244 1.00 47.43  ? 639 ARG A CA  1 
ATOM   3856 C C   . ARG A 1 639 ? 4.921   37.577  -13.429 1.00 43.93  ? 639 ARG A C   1 
ATOM   3857 O O   . ARG A 1 639 ? 5.174   36.468  -12.960 1.00 49.64  ? 639 ARG A O   1 
ATOM   3858 C CB  . ARG A 1 639 ? 3.558   39.207  -12.091 1.00 47.28  ? 639 ARG A CB  1 
ATOM   3859 C CG  . ARG A 1 639 ? 2.228   39.918  -11.878 1.00 44.24  ? 639 ARG A CG  1 
ATOM   3860 C CD  . ARG A 1 639 ? 2.157   40.583  -10.511 1.00 43.43  ? 639 ARG A CD  1 
ATOM   3861 N NE  . ARG A 1 639 ? 3.152   41.639  -10.357 1.00 43.80  ? 639 ARG A NE  1 
ATOM   3862 C CZ  . ARG A 1 639 ? 2.947   42.912  -10.677 1.00 42.30  ? 639 ARG A CZ  1 
ATOM   3863 N NH1 . ARG A 1 639 ? 1.778   43.294  -11.174 1.00 36.90  ? 639 ARG A NH1 1 
ATOM   3864 N NH2 . ARG A 1 639 ? 3.911   43.804  -10.501 1.00 43.73  ? 639 ARG A NH2 1 
ATOM   3865 N N   . GLN A 1 640 ? 5.809   38.292  -14.115 1.00 45.55  ? 640 GLN A N   1 
ATOM   3866 C CA  . GLN A 1 640 ? 7.130   37.758  -14.440 1.00 42.06  ? 640 GLN A CA  1 
ATOM   3867 C C   . GLN A 1 640 ? 8.263   38.719  -14.085 1.00 42.91  ? 640 GLN A C   1 
ATOM   3868 O O   . GLN A 1 640 ? 8.067   39.932  -14.019 1.00 46.98  ? 640 GLN A O   1 
ATOM   3869 C CB  . GLN A 1 640 ? 7.210   37.397  -15.928 1.00 42.77  ? 640 GLN A CB  1 
ATOM   3870 C CG  . GLN A 1 640 ? 5.998   36.644  -16.454 1.00 47.15  ? 640 GLN A CG  1 
ATOM   3871 C CD  . GLN A 1 640 ? 6.241   36.007  -17.808 1.00 50.22  ? 640 GLN A CD  1 
ATOM   3872 O OE1 . GLN A 1 640 ? 5.356   35.988  -18.664 1.00 54.71  ? 640 GLN A OE1 1 
ATOM   3873 N NE2 . GLN A 1 640 ? 7.442   35.480  -18.009 1.00 55.46  ? 640 GLN A NE2 1 
ATOM   3874 N N   . ILE A 1 641 ? 9.447   38.159  -13.854 1.00 47.18  ? 641 ILE A N   1 
ATOM   3875 C CA  . ILE A 1 641 ? 10.656  38.945  -13.620 1.00 43.51  ? 641 ILE A CA  1 
ATOM   3876 C C   . ILE A 1 641 ? 11.800  38.412  -14.477 1.00 45.28  ? 641 ILE A C   1 
ATOM   3877 O O   . ILE A 1 641 ? 11.687  37.349  -15.084 1.00 42.49  ? 641 ILE A O   1 
ATOM   3878 C CB  . ILE A 1 641 ? 11.106  38.895  -12.146 1.00 40.84  ? 641 ILE A CB  1 
ATOM   3879 C CG1 . ILE A 1 641 ? 11.468  37.460  -11.754 1.00 45.40  ? 641 ILE A CG1 1 
ATOM   3880 C CG2 . ILE A 1 641 ? 10.028  39.465  -11.233 1.00 42.18  ? 641 ILE A CG2 1 
ATOM   3881 C CD1 . ILE A 1 641 ? 12.637  37.364  -10.802 1.00 45.26  ? 641 ILE A CD1 1 
ATOM   3882 N N   . ARG A 1 642 ? 12.904  39.151  -14.515 1.00 41.48  ? 642 ARG A N   1 
ATOM   3883 C CA  . ARG A 1 642 ? 14.081  38.731  -15.263 1.00 37.61  ? 642 ARG A CA  1 
ATOM   3884 C C   . ARG A 1 642 ? 15.304  38.721  -14.353 1.00 38.81  ? 642 ARG A C   1 
ATOM   3885 O O   . ARG A 1 642 ? 15.670  39.747  -13.783 1.00 43.36  ? 642 ARG A O   1 
ATOM   3886 C CB  . ARG A 1 642 ? 14.320  39.665  -16.450 1.00 34.95  ? 642 ARG A CB  1 
ATOM   3887 C CG  . ARG A 1 642 ? 15.348  39.159  -17.451 1.00 36.89  ? 642 ARG A CG  1 
ATOM   3888 C CD  . ARG A 1 642 ? 14.751  38.116  -18.382 1.00 36.25  ? 642 ARG A CD  1 
ATOM   3889 N NE  . ARG A 1 642 ? 15.678  37.743  -19.447 1.00 38.12  ? 642 ARG A NE  1 
ATOM   3890 C CZ  . ARG A 1 642 ? 15.338  37.040  -20.523 1.00 40.66  ? 642 ARG A CZ  1 
ATOM   3891 N NH1 . ARG A 1 642 ? 14.086  36.632  -20.687 1.00 28.04  ? 642 ARG A NH1 1 
ATOM   3892 N NH2 . ARG A 1 642 ? 16.250  36.748  -21.440 1.00 43.92  ? 642 ARG A NH2 1 
ATOM   3893 N N   . ALA A 1 643 ? 15.932  37.557  -14.217 1.00 40.82  ? 643 ALA A N   1 
ATOM   3894 C CA  . ALA A 1 643 ? 17.099  37.422  -13.352 1.00 44.67  ? 643 ALA A CA  1 
ATOM   3895 C C   . ALA A 1 643 ? 18.146  36.486  -13.945 1.00 47.33  ? 643 ALA A C   1 
ATOM   3896 O O   . ALA A 1 643 ? 17.851  35.701  -14.846 1.00 47.50  ? 643 ALA A O   1 
ATOM   3897 C CB  . ALA A 1 643 ? 16.681  36.942  -11.970 1.00 45.34  ? 643 ALA A CB  1 
ATOM   3898 N N   . GLU A 1 644 ? 19.370  36.581  -13.433 1.00 53.11  ? 644 GLU A N   1 
ATOM   3899 C CA  . GLU A 1 644 ? 20.464  35.716  -13.861 1.00 55.96  ? 644 GLU A CA  1 
ATOM   3900 C C   . GLU A 1 644 ? 20.096  34.249  -13.662 1.00 54.92  ? 644 GLU A C   1 
ATOM   3901 O O   . GLU A 1 644 ? 19.632  33.856  -12.591 1.00 56.64  ? 644 GLU A O   1 
ATOM   3902 C CB  . GLU A 1 644 ? 21.741  36.055  -13.086 1.00 72.31  ? 644 GLU A CB  1 
ATOM   3903 C CG  . GLU A 1 644 ? 22.912  35.115  -13.345 1.00 83.54  ? 644 GLU A CG  1 
ATOM   3904 C CD  . GLU A 1 644 ? 23.580  35.351  -14.688 1.00 88.85  ? 644 GLU A CD  1 
ATOM   3905 O OE1 . GLU A 1 644 ? 23.411  36.450  -15.258 1.00 93.88  ? 644 GLU A OE1 1 
ATOM   3906 O OE2 . GLU A 1 644 ? 24.281  34.436  -15.170 1.00 88.47  ? 644 GLU A OE2 1 
ATOM   3907 N N   . ILE A 1 645 ? 20.308  33.445  -14.699 1.00 53.17  ? 645 ILE A N   1 
ATOM   3908 C CA  . ILE A 1 645 ? 19.907  32.039  -14.688 1.00 49.39  ? 645 ILE A CA  1 
ATOM   3909 C C   . ILE A 1 645 ? 20.628  31.216  -13.616 1.00 49.89  ? 645 ILE A C   1 
ATOM   3910 O O   . ILE A 1 645 ? 20.156  30.149  -13.224 1.00 50.75  ? 645 ILE A O   1 
ATOM   3911 C CB  . ILE A 1 645 ? 20.097  31.388  -16.079 1.00 46.90  ? 645 ILE A CB  1 
ATOM   3912 C CG1 . ILE A 1 645 ? 19.288  30.091  -16.184 1.00 46.52  ? 645 ILE A CG1 1 
ATOM   3913 C CG2 . ILE A 1 645 ? 21.575  31.152  -16.369 1.00 46.48  ? 645 ILE A CG2 1 
ATOM   3914 C CD1 . ILE A 1 645 ? 19.175  29.547  -17.593 1.00 46.90  ? 645 ILE A CD1 1 
ATOM   3915 N N   . SER A 1 646 ? 21.763  31.717  -13.138 1.00 46.71  ? 646 SER A N   1 
ATOM   3916 C CA  . SER A 1 646 ? 22.520  31.026  -12.099 1.00 51.95  ? 646 SER A CA  1 
ATOM   3917 C C   . SER A 1 646 ? 21.978  31.348  -10.709 1.00 53.13  ? 646 SER A C   1 
ATOM   3918 O O   . SER A 1 646 ? 22.162  30.576  -9.768  1.00 54.30  ? 646 SER A O   1 
ATOM   3919 C CB  . SER A 1 646 ? 24.005  31.386  -12.179 1.00 53.71  ? 646 SER A CB  1 
ATOM   3920 O OG  . SER A 1 646 ? 24.237  32.706  -11.717 1.00 54.26  ? 646 SER A OG  1 
ATOM   3921 N N   . GLU A 1 647 ? 21.311  32.492  -10.588 1.00 56.21  ? 647 GLU A N   1 
ATOM   3922 C CA  . GLU A 1 647 ? 20.739  32.924  -9.316  1.00 61.65  ? 647 GLU A CA  1 
ATOM   3923 C C   . GLU A 1 647 ? 19.346  32.349  -9.094  1.00 57.11  ? 647 GLU A C   1 
ATOM   3924 O O   . GLU A 1 647 ? 18.860  32.288  -7.964  1.00 52.58  ? 647 GLU A O   1 
ATOM   3925 C CB  . GLU A 1 647 ? 20.678  34.452  -9.253  1.00 65.15  ? 647 GLU A CB  1 
ATOM   3926 C CG  . GLU A 1 647 ? 22.023  35.115  -9.006  1.00 75.32  ? 647 GLU A CG  1 
ATOM   3927 C CD  . GLU A 1 647 ? 22.073  36.541  -9.526  1.00 82.41  ? 647 GLU A CD  1 
ATOM   3928 O OE1 . GLU A 1 647 ? 21.025  37.224  -9.517  1.00 84.24  ? 647 GLU A OE1 1 
ATOM   3929 O OE2 . GLU A 1 647 ? 23.167  36.979  -9.945  1.00 84.63  ? 647 GLU A OE2 1 
ATOM   3930 N N   . LEU A 1 648 ? 18.712  31.922  -10.183 1.00 49.89  ? 648 LEU A N   1 
ATOM   3931 C CA  . LEU A 1 648 ? 17.306  31.520  -10.158 1.00 45.79  ? 648 LEU A CA  1 
ATOM   3932 C C   . LEU A 1 648 ? 16.988  30.314  -9.271  1.00 52.22  ? 648 LEU A C   1 
ATOM   3933 O O   . LEU A 1 648 ? 15.960  30.304  -8.596  1.00 56.99  ? 648 LEU A O   1 
ATOM   3934 C CB  . LEU A 1 648 ? 16.784  31.287  -11.579 1.00 43.22  ? 648 LEU A CB  1 
ATOM   3935 C CG  . LEU A 1 648 ? 16.453  32.539  -12.392 1.00 43.01  ? 648 LEU A CG  1 
ATOM   3936 C CD1 . LEU A 1 648 ? 16.146  32.169  -13.831 1.00 43.27  ? 648 LEU A CD1 1 
ATOM   3937 C CD2 . LEU A 1 648 ? 15.285  33.291  -11.774 1.00 47.85  ? 648 LEU A CD2 1 
ATOM   3938 N N   . PRO A 1 649 ? 17.858  29.291  -9.274  1.00 50.25  ? 649 PRO A N   1 
ATOM   3939 C CA  . PRO A 1 649 ? 17.617  28.138  -8.411  1.00 47.28  ? 649 PRO A CA  1 
ATOM   3940 C C   . PRO A 1 649 ? 17.481  28.533  -6.944  1.00 46.47  ? 649 PRO A C   1 
ATOM   3941 O O   . PRO A 1 649 ? 16.662  27.962  -6.224  1.00 52.38  ? 649 PRO A O   1 
ATOM   3942 C CB  . PRO A 1 649 ? 18.873  27.284  -8.611  1.00 45.51  ? 649 PRO A CB  1 
ATOM   3943 C CG  . PRO A 1 649 ? 19.377  27.671  -9.951  1.00 48.58  ? 649 PRO A CG  1 
ATOM   3944 C CD  . PRO A 1 649 ? 19.086  29.132  -10.073 1.00 49.42  ? 649 PRO A CD  1 
ATOM   3945 N N   . SER A 1 650 ? 18.277  29.507  -6.514  1.00 43.98  ? 650 SER A N   1 
ATOM   3946 C CA  . SER A 1 650 ? 18.275  29.949  -5.125  1.00 45.94  ? 650 SER A CA  1 
ATOM   3947 C C   . SER A 1 650 ? 16.972  30.645  -4.742  1.00 48.39  ? 650 SER A C   1 
ATOM   3948 O O   . SER A 1 650 ? 16.377  30.337  -3.709  1.00 47.85  ? 650 SER A O   1 
ATOM   3949 C CB  . SER A 1 650 ? 19.461  30.878  -4.859  1.00 47.75  ? 650 SER A CB  1 
ATOM   3950 O OG  . SER A 1 650 ? 20.686  30.229  -5.148  1.00 58.94  ? 650 SER A OG  1 
ATOM   3951 N N   . ILE A 1 651 ? 16.531  31.582  -5.576  1.00 39.36  ? 651 ILE A N   1 
ATOM   3952 C CA  . ILE A 1 651 ? 15.330  32.354  -5.275  1.00 45.76  ? 651 ILE A CA  1 
ATOM   3953 C C   . ILE A 1 651 ? 14.055  31.525  -5.428  1.00 47.64  ? 651 ILE A C   1 
ATOM   3954 O O   . ILE A 1 651 ? 13.065  31.769  -4.738  1.00 51.56  ? 651 ILE A O   1 
ATOM   3955 C CB  . ILE A 1 651 ? 15.240  33.647  -6.119  1.00 52.48  ? 651 ILE A CB  1 
ATOM   3956 C CG1 . ILE A 1 651 ? 15.084  33.321  -7.605  1.00 56.32  ? 651 ILE A CG1 1 
ATOM   3957 C CG2 . ILE A 1 651 ? 16.463  34.524  -5.882  1.00 55.08  ? 651 ILE A CG2 1 
ATOM   3958 C CD1 . ILE A 1 651 ? 14.834  34.536  -8.468  1.00 61.17  ? 651 ILE A CD1 1 
ATOM   3959 N N   . VAL A 1 652 ? 14.084  30.545  -6.325  1.00 39.94  ? 652 VAL A N   1 
ATOM   3960 C CA  . VAL A 1 652 ? 12.953  29.638  -6.493  1.00 36.26  ? 652 VAL A CA  1 
ATOM   3961 C C   . VAL A 1 652 ? 12.835  28.729  -5.275  1.00 37.94  ? 652 VAL A C   1 
ATOM   3962 O O   . VAL A 1 652 ? 11.732  28.412  -4.829  1.00 41.49  ? 652 VAL A O   1 
ATOM   3963 C CB  . VAL A 1 652 ? 13.079  28.788  -7.773  1.00 29.99  ? 652 VAL A CB  1 
ATOM   3964 C CG1 . VAL A 1 652 ? 12.019  27.695  -7.796  1.00 26.14  ? 652 VAL A CG1 1 
ATOM   3965 C CG2 . VAL A 1 652 ? 12.965  29.668  -9.007  1.00 27.00  ? 652 VAL A CG2 1 
ATOM   3966 N N   . GLN A 1 653 ? 13.981  28.318  -4.739  1.00 35.89  ? 653 GLN A N   1 
ATOM   3967 C CA  . GLN A 1 653 ? 14.016  27.525  -3.518  1.00 38.64  ? 653 GLN A CA  1 
ATOM   3968 C C   . GLN A 1 653 ? 13.425  28.330  -2.367  1.00 38.92  ? 653 GLN A C   1 
ATOM   3969 O O   . GLN A 1 653 ? 12.601  27.826  -1.604  1.00 38.76  ? 653 GLN A O   1 
ATOM   3970 C CB  . GLN A 1 653 ? 15.452  27.113  -3.188  1.00 40.83  ? 653 GLN A CB  1 
ATOM   3971 C CG  . GLN A 1 653 ? 15.582  26.226  -1.958  1.00 44.80  ? 653 GLN A CG  1 
ATOM   3972 C CD  . GLN A 1 653 ? 17.026  26.006  -1.549  1.00 46.02  ? 653 GLN A CD  1 
ATOM   3973 O OE1 . GLN A 1 653 ? 17.909  26.789  -1.898  1.00 50.01  ? 653 GLN A OE1 1 
ATOM   3974 N NE2 . GLN A 1 653 ? 17.273  24.938  -0.800  1.00 46.15  ? 653 GLN A NE2 1 
ATOM   3975 N N   . ASP A 1 654 ? 13.850  29.586  -2.255  1.00 41.41  ? 654 ASP A N   1 
ATOM   3976 C CA  . ASP A 1 654 ? 13.356  30.481  -1.214  1.00 37.67  ? 654 ASP A CA  1 
ATOM   3977 C C   . ASP A 1 654 ? 11.868  30.768  -1.388  1.00 40.70  ? 654 ASP A C   1 
ATOM   3978 O O   . ASP A 1 654 ? 11.139  30.916  -0.407  1.00 40.50  ? 654 ASP A O   1 
ATOM   3979 C CB  . ASP A 1 654 ? 14.152  31.788  -1.208  1.00 44.61  ? 654 ASP A CB  1 
ATOM   3980 C CG  . ASP A 1 654 ? 15.603  31.587  -0.810  1.00 50.05  ? 654 ASP A CG  1 
ATOM   3981 O OD1 . ASP A 1 654 ? 15.941  30.492  -0.312  1.00 54.14  ? 654 ASP A OD1 1 
ATOM   3982 O OD2 . ASP A 1 654 ? 16.407  32.527  -0.994  1.00 50.01  ? 654 ASP A OD2 1 
ATOM   3983 N N   . LEU A 1 655 ? 11.424  30.847  -2.640  1.00 37.68  ? 655 LEU A N   1 
ATOM   3984 C CA  . LEU A 1 655 ? 10.009  31.037  -2.944  1.00 32.76  ? 655 LEU A CA  1 
ATOM   3985 C C   . LEU A 1 655 ? 9.198   29.802  -2.570  1.00 36.59  ? 655 LEU A C   1 
ATOM   3986 O O   . LEU A 1 655 ? 8.057   29.913  -2.121  1.00 45.35  ? 655 LEU A O   1 
ATOM   3987 C CB  . LEU A 1 655 ? 9.810   31.359  -4.427  1.00 34.13  ? 655 LEU A CB  1 
ATOM   3988 C CG  . LEU A 1 655 ? 10.002  32.809  -4.878  1.00 33.42  ? 655 LEU A CG  1 
ATOM   3989 C CD1 . LEU A 1 655 ? 9.998   32.897  -6.396  1.00 29.05  ? 655 LEU A CD1 1 
ATOM   3990 C CD2 . LEU A 1 655 ? 8.929   33.707  -4.283  1.00 30.34  ? 655 LEU A CD2 1 
ATOM   3991 N N   . ALA A 1 656 ? 9.794   28.628  -2.758  1.00 48.20  ? 656 ALA A N   1 
ATOM   3992 C CA  . ALA A 1 656 ? 9.136   27.366  -2.431  1.00 47.04  ? 656 ALA A CA  1 
ATOM   3993 C C   . ALA A 1 656 ? 8.940   27.230  -0.925  1.00 48.52  ? 656 ALA A C   1 
ATOM   3994 O O   . ALA A 1 656 ? 7.908   26.740  -0.465  1.00 54.36  ? 656 ALA A O   1 
ATOM   3995 C CB  . ALA A 1 656 ? 9.934   26.194  -2.974  1.00 46.81  ? 656 ALA A CB  1 
ATOM   3996 N N   . ASN A 1 657 ? 9.938   27.663  -0.163  1.00 44.45  ? 657 ASN A N   1 
ATOM   3997 C CA  . ASN A 1 657 ? 9.829   27.712  1.288   1.00 47.48  ? 657 ASN A CA  1 
ATOM   3998 C C   . ASN A 1 657 ? 9.152   29.014  1.711   1.00 57.79  ? 657 ASN A C   1 
ATOM   3999 O O   . ASN A 1 657 ? 8.745   29.811  0.864   1.00 54.68  ? 657 ASN A O   1 
ATOM   4000 C CB  . ASN A 1 657 ? 11.211  27.594  1.932   1.00 47.09  ? 657 ASN A CB  1 
ATOM   4001 C CG  . ASN A 1 657 ? 11.996  26.398  1.420   1.00 48.10  ? 657 ASN A CG  1 
ATOM   4002 O OD1 . ASN A 1 657 ? 11.444  25.508  0.773   1.00 46.11  ? 657 ASN A OD1 1 
ATOM   4003 N ND2 . ASN A 1 657 ? 13.292  26.374  1.709   1.00 46.94  ? 657 ASN A ND2 1 
ATOM   4004 N N   . GLY A 1 658 ? 9.030   29.231  3.016   1.00 62.08  ? 658 GLY A N   1 
ATOM   4005 C CA  . GLY A 1 658 ? 8.404   30.450  3.522   1.00 64.66  ? 658 GLY A CA  1 
ATOM   4006 C C   . GLY A 1 658 ? 9.393   31.585  3.712   1.00 56.55  ? 658 GLY A C   1 
ATOM   4007 O O   . GLY A 1 658 ? 9.123   32.540  4.439   1.00 59.76  ? 658 GLY A O   1 
ATOM   4008 N N   . ASN A 1 659 ? 10.538  31.482  3.044   1.00 54.93  ? 659 ASN A N   1 
ATOM   4009 C CA  . ASN A 1 659 ? 11.644  32.415  3.246   1.00 58.15  ? 659 ASN A CA  1 
ATOM   4010 C C   . ASN A 1 659 ? 11.384  33.812  2.685   1.00 59.01  ? 659 ASN A C   1 
ATOM   4011 O O   . ASN A 1 659 ? 11.329  34.788  3.434   1.00 62.23  ? 659 ASN A O   1 
ATOM   4012 C CB  . ASN A 1 659 ? 12.937  31.831  2.674   1.00 59.63  ? 659 ASN A CB  1 
ATOM   4013 C CG  . ASN A 1 659 ? 13.256  30.461  3.244   1.00 61.99  ? 659 ASN A CG  1 
ATOM   4014 O OD1 . ASN A 1 659 ? 12.632  30.018  4.209   1.00 66.81  ? 659 ASN A OD1 1 
ATOM   4015 N ND2 . ASN A 1 659 ? 14.230  29.783  2.650   1.00 63.02  ? 659 ASN A ND2 1 
ATOM   4016 N N   . ILE A 1 660 ? 11.231  33.906  1.368   1.00 51.77  ? 660 ILE A N   1 
ATOM   4017 C CA  . ILE A 1 660 ? 10.903  35.175  0.732   1.00 48.12  ? 660 ILE A CA  1 
ATOM   4018 C C   . ILE A 1 660 ? 9.579   35.055  -0.012  1.00 45.61  ? 660 ILE A C   1 
ATOM   4019 O O   . ILE A 1 660 ? 9.165   33.957  -0.385  1.00 40.74  ? 660 ILE A O   1 
ATOM   4020 C CB  . ILE A 1 660 ? 12.004  35.627  -0.251  1.00 50.14  ? 660 ILE A CB  1 
ATOM   4021 C CG1 . ILE A 1 660 ? 11.885  34.872  -1.579  1.00 51.34  ? 660 ILE A CG1 1 
ATOM   4022 C CG2 . ILE A 1 660 ? 13.386  35.436  0.366   1.00 49.00  ? 660 ILE A CG2 1 
ATOM   4023 C CD1 . ILE A 1 660 ? 13.001  35.173  -2.555  1.00 53.22  ? 660 ILE A CD1 1 
ATOM   4024 N N   . THR A 1 661 ? 8.914   36.186  -0.218  1.00 46.03  ? 661 THR A N   1 
ATOM   4025 C CA  . THR A 1 661 ? 7.659   36.203  -0.959  1.00 47.07  ? 661 THR A CA  1 
ATOM   4026 C C   . THR A 1 661 ? 7.897   36.687  -2.383  1.00 42.26  ? 661 THR A C   1 
ATOM   4027 O O   . THR A 1 661 ? 8.997   37.127  -2.721  1.00 46.56  ? 661 THR A O   1 
ATOM   4028 C CB  . THR A 1 661 ? 6.612   37.106  -0.281  1.00 44.59  ? 661 THR A CB  1 
ATOM   4029 O OG1 . THR A 1 661 ? 7.092   38.455  -0.245  1.00 47.03  ? 661 THR A OG1 1 
ATOM   4030 C CG2 . THR A 1 661 ? 6.338   36.632  1.137   1.00 45.68  ? 661 THR A CG2 1 
ATOM   4031 N N   . TRP A 1 662 ? 6.867   36.600  -3.217  1.00 39.77  ? 662 TRP A N   1 
ATOM   4032 C CA  . TRP A 1 662 ? 6.960   37.080  -4.589  1.00 44.58  ? 662 TRP A CA  1 
ATOM   4033 C C   . TRP A 1 662 ? 7.145   38.593  -4.615  1.00 50.64  ? 662 TRP A C   1 
ATOM   4034 O O   . TRP A 1 662 ? 7.842   39.126  -5.479  1.00 54.02  ? 662 TRP A O   1 
ATOM   4035 C CB  . TRP A 1 662 ? 5.718   36.685  -5.388  1.00 43.30  ? 662 TRP A CB  1 
ATOM   4036 C CG  . TRP A 1 662 ? 5.781   37.104  -6.823  1.00 45.08  ? 662 TRP A CG  1 
ATOM   4037 C CD1 . TRP A 1 662 ? 5.107   38.136  -7.406  1.00 45.48  ? 662 TRP A CD1 1 
ATOM   4038 C CD2 . TRP A 1 662 ? 6.572   36.506  -7.858  1.00 45.44  ? 662 TRP A CD2 1 
ATOM   4039 N NE1 . TRP A 1 662 ? 5.424   38.216  -8.740  1.00 44.31  ? 662 TRP A NE1 1 
ATOM   4040 C CE2 . TRP A 1 662 ? 6.322   37.227  -9.043  1.00 44.01  ? 662 TRP A CE2 1 
ATOM   4041 C CE3 . TRP A 1 662 ? 7.465   35.430  -7.898  1.00 42.93  ? 662 TRP A CE3 1 
ATOM   4042 C CZ2 . TRP A 1 662 ? 6.932   36.906  -10.254 1.00 45.74  ? 662 TRP A CZ2 1 
ATOM   4043 C CZ3 . TRP A 1 662 ? 8.069   35.113  -9.102  1.00 44.89  ? 662 TRP A CZ3 1 
ATOM   4044 C CH2 . TRP A 1 662 ? 7.800   35.849  -10.264 1.00 47.25  ? 662 TRP A CH2 1 
ATOM   4045 N N   . ALA A 1 663 ? 6.520   39.276  -3.660  1.00 55.51  ? 663 ALA A N   1 
ATOM   4046 C CA  . ALA A 1 663 ? 6.641   40.724  -3.539  1.00 53.96  ? 663 ALA A CA  1 
ATOM   4047 C C   . ALA A 1 663 ? 8.091   41.127  -3.295  1.00 54.48  ? 663 ALA A C   1 
ATOM   4048 O O   . ALA A 1 663 ? 8.521   42.207  -3.702  1.00 54.09  ? 663 ALA A O   1 
ATOM   4049 C CB  . ALA A 1 663 ? 5.749   41.241  -2.422  1.00 57.35  ? 663 ALA A CB  1 
ATOM   4050 N N   . ASP A 1 664 ? 8.838   40.252  -2.630  1.00 50.93  ? 664 ASP A N   1 
ATOM   4051 C CA  . ASP A 1 664 ? 10.255  40.481  -2.386  1.00 55.97  ? 664 ASP A CA  1 
ATOM   4052 C C   . ASP A 1 664 ? 11.056  40.286  -3.668  1.00 55.90  ? 664 ASP A C   1 
ATOM   4053 O O   . ASP A 1 664 ? 11.972  41.049  -3.960  1.00 59.16  ? 664 ASP A O   1 
ATOM   4054 C CB  . ASP A 1 664 ? 10.772  39.541  -1.295  1.00 58.01  ? 664 ASP A CB  1 
ATOM   4055 C CG  . ASP A 1 664 ? 10.030  39.705  0.017   1.00 58.70  ? 664 ASP A CG  1 
ATOM   4056 O OD1 . ASP A 1 664 ? 9.944   38.719  0.779   1.00 56.91  ? 664 ASP A OD1 1 
ATOM   4057 O OD2 . ASP A 1 664 ? 9.529   40.817  0.286   1.00 61.23  ? 664 ASP A OD2 1 
ATOM   4058 N N   . VAL A 1 665 ? 10.699  39.259  -4.434  1.00 61.26  ? 665 VAL A N   1 
ATOM   4059 C CA  . VAL A 1 665 ? 11.381  38.962  -5.689  1.00 57.97  ? 665 VAL A CA  1 
ATOM   4060 C C   . VAL A 1 665 ? 11.280  40.133  -6.663  1.00 55.61  ? 665 VAL A C   1 
ATOM   4061 O O   . VAL A 1 665 ? 12.266  40.514  -7.295  1.00 52.86  ? 665 VAL A O   1 
ATOM   4062 C CB  . VAL A 1 665 ? 10.819  37.684  -6.344  1.00 51.64  ? 665 VAL A CB  1 
ATOM   4063 C CG1 . VAL A 1 665 ? 11.385  37.503  -7.738  1.00 47.75  ? 665 VAL A CG1 1 
ATOM   4064 C CG2 . VAL A 1 665 ? 11.128  36.473  -5.483  1.00 52.96  ? 665 VAL A CG2 1 
ATOM   4065 N N   . GLU A 1 666 ? 10.084  40.704  -6.774  1.00 52.14  ? 666 GLU A N   1 
ATOM   4066 C CA  . GLU A 1 666 ? 9.868   41.868  -7.625  1.00 53.85  ? 666 GLU A CA  1 
ATOM   4067 C C   . GLU A 1 666 ? 10.618  43.074  -7.080  1.00 52.17  ? 666 GLU A C   1 
ATOM   4068 O O   . GLU A 1 666 ? 11.102  43.909  -7.842  1.00 58.22  ? 666 GLU A O   1 
ATOM   4069 C CB  . GLU A 1 666 ? 8.378   42.192  -7.737  1.00 48.96  ? 666 GLU A CB  1 
ATOM   4070 C CG  . GLU A 1 666 ? 7.561   41.116  -8.429  1.00 54.75  ? 666 GLU A CG  1 
ATOM   4071 C CD  . GLU A 1 666 ? 6.211   41.621  -8.899  1.00 57.46  ? 666 GLU A CD  1 
ATOM   4072 O OE1 . GLU A 1 666 ? 5.756   42.671  -8.399  1.00 61.85  ? 666 GLU A OE1 1 
ATOM   4073 O OE2 . GLU A 1 666 ? 5.604   40.965  -9.771  1.00 58.26  ? 666 GLU A OE2 1 
ATOM   4074 N N   . ALA A 1 667 ? 10.707  43.159  -5.757  1.00 48.28  ? 667 ALA A N   1 
ATOM   4075 C CA  . ALA A 1 667 ? 11.428  44.246  -5.111  1.00 45.81  ? 667 ALA A CA  1 
ATOM   4076 C C   . ALA A 1 667 ? 12.907  44.221  -5.484  1.00 51.30  ? 667 ALA A C   1 
ATOM   4077 O O   . ALA A 1 667 ? 13.506  45.267  -5.731  1.00 58.57  ? 667 ALA A O   1 
ATOM   4078 C CB  . ALA A 1 667 ? 11.259  44.176  -3.600  1.00 46.30  ? 667 ALA A CB  1 
ATOM   4079 N N   . ARG A 1 668 ? 13.489  43.026  -5.533  1.00 55.61  ? 668 ARG A N   1 
ATOM   4080 C CA  . ARG A 1 668 ? 14.923  42.885  -5.786  1.00 55.10  ? 668 ARG A CA  1 
ATOM   4081 C C   . ARG A 1 668 ? 15.273  42.733  -7.263  1.00 52.15  ? 668 ARG A C   1 
ATOM   4082 O O   . ARG A 1 668 ? 16.385  43.062  -7.675  1.00 49.76  ? 668 ARG A O   1 
ATOM   4083 C CB  . ARG A 1 668 ? 15.507  41.700  -5.008  1.00 63.14  ? 668 ARG A CB  1 
ATOM   4084 C CG  . ARG A 1 668 ? 15.557  41.886  -3.502  1.00 67.18  ? 668 ARG A CG  1 
ATOM   4085 C CD  . ARG A 1 668 ? 14.256  41.455  -2.859  1.00 69.15  ? 668 ARG A CD  1 
ATOM   4086 N NE  . ARG A 1 668 ? 14.254  41.649  -1.414  1.00 71.24  ? 668 ARG A NE  1 
ATOM   4087 C CZ  . ARG A 1 668 ? 14.649  40.733  -0.536  1.00 72.46  ? 668 ARG A CZ  1 
ATOM   4088 N NH1 . ARG A 1 668 ? 15.087  39.552  -0.953  1.00 70.52  ? 668 ARG A NH1 1 
ATOM   4089 N NH2 . ARG A 1 668 ? 14.609  40.999  0.762   1.00 70.83  ? 668 ARG A NH2 1 
ATOM   4090 N N   . TYR A 1 669 ? 14.335  42.228  -8.055  1.00 47.53  ? 669 TYR A N   1 
ATOM   4091 C CA  . TYR A 1 669 ? 14.625  41.921  -9.452  1.00 45.46  ? 669 TYR A CA  1 
ATOM   4092 C C   . TYR A 1 669 ? 13.715  42.670  -10.416 1.00 45.90  ? 669 TYR A C   1 
ATOM   4093 O O   . TYR A 1 669 ? 12.542  42.897  -10.120 1.00 48.92  ? 669 TYR A O   1 
ATOM   4094 C CB  . TYR A 1 669 ? 14.558  40.412  -9.691  1.00 49.90  ? 669 TYR A CB  1 
ATOM   4095 C CG  . TYR A 1 669 ? 15.568  39.655  -8.867  1.00 48.24  ? 669 TYR A CG  1 
ATOM   4096 C CD1 . TYR A 1 669 ? 15.207  39.054  -7.668  1.00 48.24  ? 669 TYR A CD1 1 
ATOM   4097 C CD2 . TYR A 1 669 ? 16.893  39.565  -9.274  1.00 48.01  ? 669 TYR A CD2 1 
ATOM   4098 C CE1 . TYR A 1 669 ? 16.136  38.370  -6.904  1.00 48.25  ? 669 TYR A CE1 1 
ATOM   4099 C CE2 . TYR A 1 669 ? 17.829  38.885  -8.518  1.00 48.71  ? 669 TYR A CE2 1 
ATOM   4100 C CZ  . TYR A 1 669 ? 17.445  38.289  -7.334  1.00 50.02  ? 669 TYR A CZ  1 
ATOM   4101 O OH  . TYR A 1 669 ? 18.373  37.610  -6.580  1.00 51.13  ? 669 TYR A OH  1 
ATOM   4102 N N   . PRO A 1 670 ? 14.262  43.055  -11.579 1.00 42.98  ? 670 PRO A N   1 
ATOM   4103 C CA  . PRO A 1 670 ? 13.518  43.827  -12.562 1.00 44.19  ? 670 PRO A CA  1 
ATOM   4104 C C   . PRO A 1 670 ? 12.313  43.061  -13.080 1.00 44.80  ? 670 PRO A C   1 
ATOM   4105 O O   . PRO A 1 670 ? 12.406  41.866  -13.361 1.00 49.98  ? 670 PRO A O   1 
ATOM   4106 C CB  . PRO A 1 670 ? 14.534  44.042  -13.689 1.00 44.63  ? 670 PRO A CB  1 
ATOM   4107 C CG  . PRO A 1 670 ? 15.550  42.976  -13.505 1.00 46.48  ? 670 PRO A CG  1 
ATOM   4108 C CD  . PRO A 1 670 ? 15.633  42.763  -12.030 1.00 46.72  ? 670 PRO A CD  1 
ATOM   4109 N N   . LEU A 1 671 ? 11.187  43.756  -13.194 1.00 50.98  ? 671 LEU A N   1 
ATOM   4110 C CA  . LEU A 1 671 ? 9.965   43.159  -13.706 1.00 48.95  ? 671 LEU A CA  1 
ATOM   4111 C C   . LEU A 1 671 ? 10.116  42.853  -15.188 1.00 47.12  ? 671 LEU A C   1 
ATOM   4112 O O   . LEU A 1 671 ? 11.023  43.363  -15.848 1.00 50.87  ? 671 LEU A O   1 
ATOM   4113 C CB  . LEU A 1 671 ? 8.775   44.090  -13.464 1.00 50.17  ? 671 LEU A CB  1 
ATOM   4114 C CG  . LEU A 1 671 ? 8.222   44.136  -12.035 1.00 52.44  ? 671 LEU A CG  1 
ATOM   4115 C CD1 . LEU A 1 671 ? 9.320   44.412  -11.012 1.00 55.64  ? 671 LEU A CD1 1 
ATOM   4116 C CD2 . LEU A 1 671 ? 7.118   45.174  -11.925 1.00 52.37  ? 671 LEU A CD2 1 
ATOM   4117 N N   . PHE A 1 672 ? 9.228   42.016  -15.709 1.00 42.61  ? 672 PHE A N   1 
ATOM   4118 C CA  . PHE A 1 672 ? 9.332   41.575  -17.088 1.00 48.82  ? 672 PHE A CA  1 
ATOM   4119 C C   . PHE A 1 672 ? 7.950   41.348  -17.680 1.00 50.23  ? 672 PHE A C   1 
ATOM   4120 O O   . PHE A 1 672 ? 7.070   40.788  -17.026 1.00 56.27  ? 672 PHE A O   1 
ATOM   4121 C CB  . PHE A 1 672 ? 10.171  40.300  -17.168 1.00 52.03  ? 672 PHE A CB  1 
ATOM   4122 C CG  . PHE A 1 672 ? 10.700  40.007  -18.540 1.00 52.97  ? 672 PHE A CG  1 
ATOM   4123 C CD1 . PHE A 1 672 ? 11.867  40.605  -18.991 1.00 51.15  ? 672 PHE A CD1 1 
ATOM   4124 C CD2 . PHE A 1 672 ? 10.033  39.129  -19.379 1.00 54.93  ? 672 PHE A CD2 1 
ATOM   4125 C CE1 . PHE A 1 672 ? 12.358  40.334  -20.256 1.00 49.24  ? 672 PHE A CE1 1 
ATOM   4126 C CE2 . PHE A 1 672 ? 10.518  38.854  -20.644 1.00 55.79  ? 672 PHE A CE2 1 
ATOM   4127 C CZ  . PHE A 1 672 ? 11.682  39.458  -21.084 1.00 52.67  ? 672 PHE A CZ  1 
ATOM   4128 N N   . GLU A 1 673 ? 7.764   41.787  -18.921 1.00 57.26  ? 673 GLU A N   1 
ATOM   4129 C CA  . GLU A 1 673 ? 6.445   41.759  -19.543 1.00 64.98  ? 673 GLU A CA  1 
ATOM   4130 C C   . GLU A 1 673 ? 6.482   41.193  -20.958 1.00 68.82  ? 673 GLU A C   1 
ATOM   4131 O O   . GLU A 1 673 ? 7.428   41.435  -21.708 1.00 72.36  ? 673 GLU A O   1 
ATOM   4132 C CB  . GLU A 1 673 ? 5.835   43.156  -19.546 1.00 62.74  ? 673 GLU A CB  1 
ATOM   4133 N N   . GLY A 1 674 ? 5.438   40.447  -21.311 1.00 69.74  ? 674 GLY A N   1 
ATOM   4134 C CA  . GLY A 1 674 ? 5.302   39.859  -22.642 1.00 75.55  ? 674 GLY A CA  1 
ATOM   4135 C C   . GLY A 1 674 ? 6.619   39.594  -23.347 1.00 82.76  ? 674 GLY A C   1 
ATOM   4136 O O   . GLY A 1 674 ? 7.460   38.838  -22.858 1.00 84.54  ? 674 GLY A O   1 
HETATM 4137 O O   . HOH B 2 .   ? 1.995   31.247  -7.403  1.00 26.73  ? 694 HOH A O   1 
HETATM 4138 O O   . HOH B 2 .   ? -21.801 12.725  15.986  1.00 33.94  ? 695 HOH A O   1 
HETATM 4139 O O   . HOH B 2 .   ? -6.570  7.504   -1.490  1.00 31.90  ? 696 HOH A O   1 
HETATM 4140 O O   . HOH B 2 .   ? -4.269  31.767  13.620  1.00 34.53  ? 697 HOH A O   1 
HETATM 4141 O O   . HOH B 2 .   ? 18.478  38.640  -21.799 1.00 34.17  ? 698 HOH A O   1 
HETATM 4142 O O   . HOH B 2 .   ? -4.007  -11.887 22.921  1.00 29.79  ? 699 HOH A O   1 
HETATM 4143 O O   . HOH B 2 .   ? -8.248  0.097   13.941  1.00 64.16  ? 700 HOH A O   1 
HETATM 4144 O O   . HOH B 2 .   ? 14.580  36.038  -27.152 1.00 54.05  ? 701 HOH A O   1 
HETATM 4145 O O   . HOH B 2 .   ? -0.889  0.522   1.318   1.00 45.34  ? 702 HOH A O   1 
HETATM 4146 O O   . HOH B 2 .   ? 4.781   30.258  -13.531 1.00 33.64  ? 703 HOH A O   1 
HETATM 4147 O O   . HOH B 2 .   ? 2.515   29.936  -5.084  1.00 25.33  ? 704 HOH A O   1 
HETATM 4148 O O   . HOH B 2 .   ? 3.663   16.872  14.463  1.00 45.53  ? 705 HOH A O   1 
HETATM 4149 O O   . HOH B 2 .   ? -16.755 -8.857  15.665  1.00 38.52  ? 706 HOH A O   1 
HETATM 4150 O O   . HOH B 2 .   ? 21.406  27.347  -16.310 1.00 55.82  ? 707 HOH A O   1 
HETATM 4151 O O   . HOH B 2 .   ? 3.646   24.262  9.996   1.00 29.43  ? 708 HOH A O   1 
HETATM 4152 O O   . HOH B 2 .   ? -0.617  -9.614  27.587  1.00 46.20  ? 709 HOH A O   1 
HETATM 4153 O O   . HOH B 2 .   ? -8.206  0.088   -13.127 1.00 30.50  ? 710 HOH A O   1 
HETATM 4154 O O   . HOH B 2 .   ? -38.432 -0.663  -8.149  1.00 54.11  ? 711 HOH A O   1 
HETATM 4155 O O   . HOH B 2 .   ? -21.866 8.210   -2.214  1.00 31.21  ? 712 HOH A O   1 
HETATM 4156 O O   . HOH B 2 .   ? 2.941   34.546  -18.985 1.00 40.87  ? 713 HOH A O   1 
HETATM 4157 O O   . HOH B 2 .   ? 20.756  37.254  -21.268 1.00 40.73  ? 714 HOH A O   1 
HETATM 4158 O O   . HOH B 2 .   ? -9.186  2.726   17.720  1.00 38.29  ? 715 HOH A O   1 
HETATM 4159 O O   . HOH B 2 .   ? -20.021 -0.709  -9.582  1.00 40.19  ? 716 HOH A O   1 
HETATM 4160 O O   . HOH B 2 .   ? -9.156  1.458   -16.751 1.00 43.53  ? 717 HOH A O   1 
HETATM 4161 O O   . HOH B 2 .   ? -13.195 32.043  -18.142 1.00 57.79  ? 718 HOH A O   1 
HETATM 4162 O O   . HOH B 2 .   ? 3.606   2.002   6.941   1.00 39.35  ? 719 HOH A O   1 
HETATM 4163 O O   . HOH B 2 .   ? 19.900  24.597  0.554   1.00 43.27  ? 720 HOH A O   1 
HETATM 4164 O O   . HOH B 2 .   ? -2.366  29.473  26.729  1.00 48.48  ? 721 HOH A O   1 
HETATM 4165 O O   . HOH B 2 .   ? 3.831   42.732  -13.786 1.00 39.06  ? 722 HOH A O   1 
HETATM 4166 O O   . HOH B 2 .   ? -8.730  -20.406 5.011   1.00 34.54  ? 723 HOH A O   1 
HETATM 4167 O O   . HOH B 2 .   ? -40.918 -0.233  2.847   1.00 36.57  ? 724 HOH A O   1 
HETATM 4168 O O   . HOH B 2 .   ? 7.597   18.978  -1.076  1.00 28.86  ? 725 HOH A O   1 
HETATM 4169 O O   . HOH B 2 .   ? -21.252 -2.806  -6.077  1.00 70.66  ? 726 HOH A O   1 
HETATM 4170 O O   . HOH B 2 .   ? -27.840 2.098   6.438   1.00 60.82  ? 727 HOH A O   1 
HETATM 4171 O O   . HOH B 2 .   ? -25.364 -1.248  12.055  1.00 50.78  ? 728 HOH A O   1 
HETATM 4172 O O   . HOH B 2 .   ? -45.458 8.865   7.621   1.00 45.15  ? 729 HOH A O   1 
HETATM 4173 O O   . HOH B 2 .   ? 7.924   8.144   20.559  1.00 50.80  ? 730 HOH A O   1 
HETATM 4174 O O   . HOH B 2 .   ? -26.338 2.498   9.044   1.00 47.66  ? 731 HOH A O   1 
HETATM 4175 O O   . HOH B 2 .   ? 10.364  35.278  -23.045 1.00 37.29  ? 732 HOH A O   1 
HETATM 4176 O O   . HOH B 2 .   ? -14.537 12.321  -8.835  1.00 50.21  ? 733 HOH A O   1 
HETATM 4177 O O   . HOH B 2 .   ? -21.390 22.963  -7.345  1.00 39.17  ? 734 HOH A O   1 
HETATM 4178 O O   . HOH B 2 .   ? -22.482 1.540   3.532   1.00 39.46  ? 735 HOH A O   1 
HETATM 4179 O O   . HOH B 2 .   ? 17.914  40.714  -20.473 1.00 29.15  ? 736 HOH A O   1 
HETATM 4180 O O   . HOH B 2 .   ? 8.572   8.886   30.432  1.00 63.22  ? 737 HOH A O   1 
HETATM 4181 O O   . HOH B 2 .   ? -28.296 1.633   -5.088  1.00 56.89  ? 738 HOH A O   1 
HETATM 4182 O O   . HOH B 2 .   ? -15.444 24.782  -2.537  1.00 63.72  ? 739 HOH A O   1 
HETATM 4183 O O   . HOH B 2 .   ? 12.057  24.093  -1.285  1.00 34.89  ? 740 HOH A O   1 
HETATM 4184 O O   . HOH B 2 .   ? 13.469  7.936   23.270  1.00 45.29  ? 741 HOH A O   1 
HETATM 4185 O O   . HOH B 2 .   ? -24.141 4.983   7.767   1.00 53.55  ? 742 HOH A O   1 
HETATM 4186 O O   . HOH B 2 .   ? -3.534  30.195  11.601  1.00 67.99  ? 743 HOH A O   1 
HETATM 4187 O O   . HOH B 2 .   ? -4.205  -13.269 26.054  1.00 29.94  ? 744 HOH A O   1 
HETATM 4188 O O   . HOH B 2 .   ? 5.588   21.641  18.004  1.00 43.50  ? 745 HOH A O   1 
HETATM 4189 O O   . HOH B 2 .   ? 10.012  17.756  11.388  1.00 59.41  ? 746 HOH A O   1 
HETATM 4190 O O   . HOH B 2 .   ? 9.677   22.126  20.428  1.00 44.03  ? 747 HOH A O   1 
HETATM 4191 O O   . HOH B 2 .   ? -12.454 5.911   26.533  1.00 47.47  ? 748 HOH A O   1 
HETATM 4192 O O   . HOH B 2 .   ? 9.867   9.564   7.680   1.00 26.31  ? 749 HOH A O   1 
HETATM 4193 O O   . HOH B 2 .   ? 10.350  9.247   3.350   1.00 34.31  ? 750 HOH A O   1 
HETATM 4194 O O   . HOH B 2 .   ? 1.467   29.062  18.682  1.00 53.71  ? 751 HOH A O   1 
HETATM 4195 O O   . HOH B 2 .   ? 13.827  5.717   21.606  1.00 52.97  ? 752 HOH A O   1 
HETATM 4196 O O   . HOH B 2 .   ? -47.921 2.749   -0.738  1.00 54.15  ? 753 HOH A O   1 
HETATM 4197 O O   . HOH B 2 .   ? -12.677 12.253  -12.047 1.00 47.34  ? 754 HOH A O   1 
HETATM 4198 O O   . HOH B 2 .   ? 2.610   25.254  2.252   1.00 53.84  ? 755 HOH A O   1 
HETATM 4199 O O   . HOH B 2 .   ? -3.210  29.541  -17.031 1.00 56.92  ? 756 HOH A O   1 
HETATM 4200 O O   . HOH B 2 .   ? 4.236   25.823  -0.166  1.00 53.48  ? 757 HOH A O   1 
HETATM 4201 O O   . HOH B 2 .   ? 10.591  15.211  3.527   1.00 65.41  ? 758 HOH A O   1 
HETATM 4202 O O   . HOH B 2 .   ? -19.061 -3.852  -14.710 1.00 35.58  ? 759 HOH A O   1 
HETATM 4203 O O   . HOH B 2 .   ? 12.721  16.937  -16.324 1.00 41.79  ? 760 HOH A O   1 
HETATM 4204 O O   . HOH B 2 .   ? 27.679  40.284  -20.340 1.00 78.54  ? 761 HOH A O   1 
HETATM 4205 O O   . HOH B 2 .   ? -25.446 9.975   20.006  1.00 48.45  ? 762 HOH A O   1 
HETATM 4206 O O   . HOH B 2 .   ? -19.699 -10.446 8.664   1.00 61.26  ? 763 HOH A O   1 
HETATM 4207 O O   . HOH B 2 .   ? -25.179 6.748   1.712   1.00 53.07  ? 764 HOH A O   1 
HETATM 4208 O O   . HOH B 2 .   ? 25.434  41.654  -24.197 1.00 54.16  ? 765 HOH A O   1 
HETATM 4209 O O   . HOH B 2 .   ? -12.186 30.155  2.987   1.00 65.67  ? 766 HOH A O   1 
HETATM 4210 O O   . HOH B 2 .   ? -13.083 0.190   12.298  1.00 57.68  ? 767 HOH A O   1 
HETATM 4211 O O   . HOH B 2 .   ? -18.141 0.889   13.177  1.00 62.41  ? 768 HOH A O   1 
HETATM 4212 O O   . HOH B 2 .   ? -18.402 -2.303  21.066  1.00 81.47  ? 769 HOH A O   1 
HETATM 4213 O O   . HOH B 2 .   ? -16.049 -2.878  15.962  1.00 87.16  ? 770 HOH A O   1 
HETATM 4214 O O   . HOH B 2 .   ? -21.595 -11.894 12.762  1.00 73.31  ? 771 HOH A O   1 
HETATM 4215 O O   . HOH B 2 .   ? 5.090   10.422  31.039  1.00 79.84  ? 772 HOH A O   1 
HETATM 4216 O O   . HOH B 2 .   ? -37.796 -13.371 -7.960  1.00 70.70  ? 773 HOH A O   1 
HETATM 4217 O O   . HOH B 2 .   ? -16.327 -0.792  14.686  1.00 51.76  ? 774 HOH A O   1 
HETATM 4218 O O   . HOH B 2 .   ? -25.660 6.798   4.947   1.00 84.22  ? 775 HOH A O   1 
HETATM 4219 O O   . HOH B 2 .   ? 3.605   23.249  27.126  1.00 70.13  ? 776 HOH A O   1 
HETATM 4220 O O   . HOH B 2 .   ? 25.344  34.471  -30.277 1.00 56.64  ? 777 HOH A O   1 
HETATM 4221 O O   . HOH B 2 .   ? -19.883 -10.161 3.294   1.00 64.39  ? 778 HOH A O   1 
HETATM 4222 O O   . HOH B 2 .   ? -19.347 25.707  10.357  1.00 59.14  ? 779 HOH A O   1 
HETATM 4223 O O   . HOH B 2 .   ? -36.907 16.184  9.452   1.00 96.72  ? 780 HOH A O   1 
HETATM 4224 O O   . HOH B 2 .   ? -21.991 7.825   5.724   1.00 57.60  ? 781 HOH A O   1 
HETATM 4225 O O   . HOH B 2 .   ? 0.370   -8.288  29.685  1.00 71.72  ? 782 HOH A O   1 
HETATM 4226 O O   . HOH B 2 .   ? 1.114   35.313  -6.160  1.00 63.45  ? 783 HOH A O   1 
HETATM 4227 O O   . HOH B 2 .   ? 2.805   9.479   36.828  1.00 79.73  ? 784 HOH A O   1 
HETATM 4228 O O   . HOH B 2 .   ? -48.949 21.684  12.141  1.00 78.27  ? 785 HOH A O   1 
HETATM 4229 O O   . HOH B 2 .   ? 23.730  39.235  -15.647 1.00 82.96  ? 786 HOH A O   1 
HETATM 4230 O O   . HOH B 2 .   ? -18.386 -8.727  5.446   1.00 82.97  ? 787 HOH A O   1 
HETATM 4231 O O   . HOH B 2 .   ? -21.407 12.728  26.991  1.00 91.25  ? 788 HOH A O   1 
HETATM 4232 O O   . HOH B 2 .   ? 2.459   26.671  -13.701 1.00 51.27  ? 789 HOH A O   1 
HETATM 4233 O O   . HOH B 2 .   ? -14.668 -8.175  11.320  1.00 98.77  ? 790 HOH A O   1 
HETATM 4234 O O   . HOH B 2 .   ? -22.314 12.174  18.137  1.00 100.53 ? 791 HOH A O   1 
HETATM 4235 O O   . HOH B 2 .   ? -20.292 5.749   2.716   1.00 87.28  ? 792 HOH A O   1 
HETATM 4236 O O   . HOH B 2 .   ? -5.716  4.682   -3.142  1.00 56.23  ? 793 HOH A O   1 
HETATM 4237 O O   . HOH B 2 .   ? 10.179  4.648   41.922  1.00 78.00  ? 794 HOH A O   1 
HETATM 4238 O O   . HOH B 2 .   ? 7.181   21.089  -17.451 1.00 59.15  ? 795 HOH A O   1 
HETATM 4239 O O   . HOH B 2 .   ? 0.732   -5.725  31.799  1.00 101.82 ? 796 HOH A O   1 
HETATM 4240 O O   . HOH B 2 .   ? -19.257 20.224  23.857  1.00 82.50  ? 797 HOH A O   1 
HETATM 4241 O O   . HOH B 2 .   ? -10.437 32.550  22.224  1.00 57.72  ? 798 HOH A O   1 
HETATM 4242 O O   . HOH B 2 .   ? -19.131 -5.133  11.219  1.00 118.78 ? 799 HOH A O   1 
HETATM 4243 O O   . HOH B 2 .   ? 6.487   19.434  6.008   1.00 56.14  ? 800 HOH A O   1 
HETATM 4244 O O   . HOH B 2 .   ? -6.789  3.097   8.180   1.00 94.16  ? 801 HOH A O   1 
HETATM 4245 O O   . HOH B 2 .   ? -2.646  -12.870 28.066  1.00 48.42  ? 802 HOH A O   1 
HETATM 4246 O O   . HOH B 2 .   ? -12.406 -4.645  4.284   1.00 66.19  ? 803 HOH A O   1 
HETATM 4247 O O   . HOH B 2 .   ? -14.440 29.516  -17.519 1.00 96.88  ? 804 HOH A O   1 
HETATM 4248 O O   . HOH B 2 .   ? -6.104  35.974  -16.176 1.00 70.62  ? 805 HOH A O   1 
HETATM 4249 O O   . HOH B 2 .   ? -12.650 18.091  24.882  1.00 58.18  ? 806 HOH A O   1 
HETATM 4250 O O   . HOH B 2 .   ? -34.957 -3.222  -9.394  1.00 74.78  ? 807 HOH A O   1 
HETATM 4251 O O   . HOH B 2 .   ? 20.211  35.102  -20.548 1.00 99.88  ? 808 HOH A O   1 
HETATM 4252 O O   . HOH B 2 .   ? -7.675  8.123   0.922   1.00 32.13  ? 809 HOH A O   1 
HETATM 4253 O O   . HOH B 2 .   ? -9.713  9.329   2.278   1.00 26.66  ? 810 HOH A O   1 
HETATM 4254 O O   . HOH B 2 .   ? -11.905 8.483   3.725   1.00 35.98  ? 811 HOH A O   1 
HETATM 4255 O O   . HOH B 2 .   ? -13.474 6.431   4.736   1.00 33.70  ? 812 HOH A O   1 
HETATM 4256 O O   . HOH B 2 .   ? -13.622 6.981   2.245   1.00 25.22  ? 813 HOH A O   1 
HETATM 4257 O O   . HOH B 2 .   ? -11.879 10.484  7.102   1.00 26.35  ? 814 HOH A O   1 
HETATM 4258 O O   . HOH B 2 .   ? -10.657 9.837   9.167   1.00 27.98  ? 815 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   ALA 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   ALA 6   6   ?   ?   ?   A . n 
A 1 7   GLU 7   7   ?   ?   ?   A . n 
A 1 8   GLU 8   8   ?   ?   ?   A . n 
A 1 9   VAL 9   9   ?   ?   ?   A . n 
A 1 10  LEU 10  10  ?   ?   ?   A . n 
A 1 11  ALA 11  11  ?   ?   ?   A . n 
A 1 12  PRO 12  12  ?   ?   ?   A . n 
A 1 13  LEU 13  13  ?   ?   ?   A . n 
A 1 14  ARG 14  14  ?   ?   ?   A . n 
A 1 15  LEU 15  15  ?   ?   ?   A . n 
A 1 16  ALA 16  16  ?   ?   ?   A . n 
A 1 17  VAL 17  17  ?   ?   ?   A . n 
A 1 18  ARG 18  18  ?   ?   ?   A . n 
A 1 19  GLN 19  19  ?   ?   ?   A . n 
A 1 20  GLN 20  20  ?   ?   ?   A . n 
A 1 21  GLY 21  21  ?   ?   ?   A . n 
A 1 22  ASP 22  22  ?   ?   ?   A . n 
A 1 23  LEU 23  23  ?   ?   ?   A . n 
A 1 24  VAL 24  24  ?   ?   ?   A . n 
A 1 25  ARG 25  25  ?   ?   ?   A . n 
A 1 26  LYS 26  26  ?   ?   ?   A . n 
A 1 27  LEU 27  27  ?   ?   ?   A . n 
A 1 28  LYS 28  28  ?   ?   ?   A . n 
A 1 29  GLU 29  29  ?   ?   ?   A . n 
A 1 30  ASP 30  30  ?   ?   ?   A . n 
A 1 31  LYS 31  31  ?   ?   ?   A . n 
A 1 32  ALA 32  32  ?   ?   ?   A . n 
A 1 33  PRO 33  33  ?   ?   ?   A . n 
A 1 34  GLN 34  34  ?   ?   ?   A . n 
A 1 35  VAL 35  35  ?   ?   ?   A . n 
A 1 36  ASP 36  36  ?   ?   ?   A . n 
A 1 37  VAL 37  37  ?   ?   ?   A . n 
A 1 38  ASP 38  38  ?   ?   ?   A . n 
A 1 39  LYS 39  39  ?   ?   ?   A . n 
A 1 40  ALA 40  40  ?   ?   ?   A . n 
A 1 41  VAL 41  41  ?   ?   ?   A . n 
A 1 42  ALA 42  42  ?   ?   ?   A . n 
A 1 43  GLU 43  43  ?   ?   ?   A . n 
A 1 44  LEU 44  44  ?   ?   ?   A . n 
A 1 45  LYS 45  45  ?   ?   ?   A . n 
A 1 46  ALA 46  46  ?   ?   ?   A . n 
A 1 47  ARG 47  47  ?   ?   ?   A . n 
A 1 48  LYS 48  48  ?   ?   ?   A . n 
A 1 49  ARG 49  49  ?   ?   ?   A . n 
A 1 50  VAL 50  50  ?   ?   ?   A . n 
A 1 51  LEU 51  51  ?   ?   ?   A . n 
A 1 52  GLU 52  52  ?   ?   ?   A . n 
A 1 53  ALA 53  53  ?   ?   ?   A . n 
A 1 54  LYS 54  54  ?   ?   ?   A . n 
A 1 55  GLU 55  55  ?   ?   ?   A . n 
A 1 56  LEU 56  56  ?   ?   ?   A . n 
A 1 57  ALA 57  57  ?   ?   ?   A . n 
A 1 58  LEU 58  58  ?   ?   ?   A . n 
A 1 59  GLN 59  59  ?   ?   ?   A . n 
A 1 60  PRO 60  60  ?   ?   ?   A . n 
A 1 61  LYS 61  61  ?   ?   ?   A . n 
A 1 62  ASP 62  62  ?   ?   ?   A . n 
A 1 63  ASP 63  63  63  ASP ASP A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  MET 70  70  70  MET MET A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  TYR 80  80  80  TYR TYR A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  GLN 82  82  82  GLN GLN A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 CYS 101 101 101 CYS CYS A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 GLN 109 109 109 GLN GLN A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 TRP 111 111 111 TRP TRP A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 GLN 113 113 113 GLN GLN A . n 
A 1 114 HIS 114 114 114 HIS HIS A . n 
A 1 115 PHE 115 115 115 PHE PHE A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 GLN 120 120 120 GLN GLN A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 ASP 125 125 125 ASP ASP A . n 
A 1 126 CYS 126 126 126 CYS CYS A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 MET 128 128 128 MET MET A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 LYS 136 136 136 LYS LYS A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 HIS 140 140 140 HIS HIS A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 ASP 151 151 151 ASP ASP A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 ASN 154 154 154 ASN ASN A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 GLU 156 156 156 GLU GLU A . n 
A 1 157 CYS 157 157 157 CYS CYS A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 LYS 165 165 165 LYS LYS A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 HIS 167 167 167 HIS HIS A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLN 169 169 169 GLN GLN A . n 
A 1 170 LYS 170 170 170 LYS LYS A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 MET 172 172 172 MET MET A . n 
A 1 173 SER 173 173 173 SER SER A . n 
A 1 174 ASP 174 174 174 ASP ASP A . n 
A 1 175 LYS 175 175 175 LYS LYS A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 CYS 177 177 177 CYS CYS A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 MET 185 185 185 MET MET A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 GLN 191 191 191 GLN GLN A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 GLN 198 198 198 GLN GLN A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 PHE 204 204 204 PHE PHE A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 ASN 206 206 206 ASN ASN A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 PRO 212 212 212 PRO PRO A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 ASN 216 216 216 ASN ASN A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 PRO 221 221 221 PRO PRO A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 PHE 224 224 224 PHE PHE A . n 
A 1 225 ASN 225 225 225 ASN ASN A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 MET 227 227 227 MET MET A . n 
A 1 228 PHE 228 228 228 PHE PHE A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 THR 230 230 230 THR THR A . n 
A 1 231 PHE 231 231 231 PHE PHE A . n 
A 1 232 ILE 232 232 232 ILE ILE A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 PRO 234 234 234 PRO PRO A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 ASN 237 237 237 ASN ASN A . n 
A 1 238 MET 238 238 238 MET MET A . n 
A 1 239 PRO 239 239 239 PRO PRO A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 TYR 241 241 241 TYR TYR A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 PRO 244 244 244 PRO PRO A . n 
A 1 245 GLU 245 245 245 GLU GLU A . n 
A 1 246 THR 246 246 246 THR THR A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 GLN 248 248 248 GLN GLN A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ILE 250 250 250 ILE ILE A . n 
A 1 251 PHE 251 251 251 PHE PHE A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 PHE 254 254 254 PHE PHE A . n 
A 1 255 LYS 255 255 255 LYS LYS A . n 
A 1 256 ARG 256 256 256 ARG ARG A . n 
A 1 257 LEU 257 257 257 LEU LEU A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 PHE 260 260 260 PHE PHE A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 GLN 262 262 262 GLN GLN A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 LYS 264 264 264 LYS LYS A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 PRO 266 266 266 PRO PRO A . n 
A 1 267 PHE 267 267 267 PHE PHE A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 ALA 270 270 270 ALA ALA A . n 
A 1 271 GLN 271 271 271 GLN GLN A . n 
A 1 272 ILE 272 272 272 ILE ILE A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 ASN 274 274 274 ASN ASN A . n 
A 1 275 SER 275 275 275 SER SER A . n 
A 1 276 PHE 276 276 276 PHE PHE A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 GLU 279 279 279 GLU GLU A . n 
A 1 280 ILE 280 280 280 ILE ILE A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 PRO 282 282 282 PRO PRO A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 GLY 285 285 285 GLY GLY A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 ARG 288 288 288 ARG ARG A . n 
A 1 289 VAL 289 289 289 VAL VAL A . n 
A 1 290 ARG 290 290 290 ARG ARG A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 THR 293 293 293 THR THR A . n 
A 1 294 MET 294 294 294 MET MET A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 ILE 297 297 297 ILE ILE A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 HIS 299 299 299 HIS HIS A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 ASP 302 302 302 ASP ASP A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 LYS 306 306 306 LYS LYS A . n 
A 1 307 ASP 307 307 307 ASP ASP A . n 
A 1 308 HIS 308 308 308 HIS HIS A . n 
A 1 309 PRO 309 309 309 PRO PRO A . n 
A 1 310 LYS 310 310 310 LYS LYS A . n 
A 1 311 PHE 311 311 311 PHE PHE A . n 
A 1 312 GLN 312 312 312 GLN GLN A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 ASP 316 316 316 ASP ASP A . n 
A 1 317 LEU 317 317 317 LEU LEU A . n 
A 1 318 HIS 318 318 318 HIS HIS A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 TYR 320 320 320 TYR TYR A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 TYR 322 322 322 TYR TYR A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 ALA 324 324 324 ALA ALA A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ALA 326 326 326 ALA ALA A . n 
A 1 327 GLN 327 327 327 GLN GLN A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 GLY 330 330 330 GLY GLY A . n 
A 1 331 GLN 331 331 331 GLN GLN A . n 
A 1 332 SER 332 332 332 SER SER A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 ARG 334 334 334 ARG ARG A . n 
A 1 335 LYS 335 335 335 LYS LYS A . n 
A 1 336 MET 336 336 336 MET MET A . n 
A 1 337 ARG 337 337 337 ARG ARG A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 GLY 339 339 339 GLY GLY A . n 
A 1 340 ASP 340 340 340 ASP ASP A . n 
A 1 341 ALA 341 341 341 ALA ALA A . n 
A 1 342 VAL 342 342 342 VAL VAL A . n 
A 1 343 GLU 343 343 343 GLU GLU A . n 
A 1 344 GLN 344 344 344 GLN GLN A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 ASN 348 348 348 ASN ASN A . n 
A 1 349 ASN 349 349 349 ASN ASN A . n 
A 1 350 THR 350 350 350 THR THR A . n 
A 1 351 VAL 351 351 351 VAL VAL A . n 
A 1 352 LEU 352 352 352 LEU LEU A . n 
A 1 353 GLY 353 353 353 GLY GLY A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 PHE 355 355 355 PHE PHE A . n 
A 1 356 ILE 356 356 356 ILE ILE A . n 
A 1 357 GLY 357 357 357 GLY GLY A . n 
A 1 358 ARG 358 358 358 ARG ARG A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 TYR 360 360 360 TYR TYR A . n 
A 1 361 LEU 361 361 361 LEU LEU A . n 
A 1 362 TYR 362 362 362 TYR TYR A . n 
A 1 363 LEU 363 363 363 LEU LEU A . n 
A 1 364 THR 364 364 364 THR THR A . n 
A 1 365 LYS 365 365 365 LYS LYS A . n 
A 1 366 VAL 366 366 366 VAL VAL A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 ILE 368 368 368 ILE ILE A . n 
A 1 369 SER 369 369 369 SER SER A . n 
A 1 370 PRO 370 370 370 PRO PRO A . n 
A 1 371 ASP 371 371 371 ASP ASP A . n 
A 1 372 LYS 372 372 372 LYS LYS A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ARG 374 374 374 ARG ARG A . n 
A 1 375 PHE 375 375 375 PHE PHE A . n 
A 1 376 ARG 376 376 376 ARG ARG A . n 
A 1 377 GLN 377 377 377 GLN GLN A . n 
A 1 378 HIS 378 378 378 HIS HIS A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 GLU 380 380 380 GLU GLU A . n 
A 1 381 ASN 381 381 381 ASN ASN A . n 
A 1 382 GLU 382 382 ?   ?   ?   A . n 
A 1 383 MET 383 383 ?   ?   ?   A . n 
A 1 384 ALA 384 384 ?   ?   ?   A . n 
A 1 385 HIS 385 385 ?   ?   ?   A . n 
A 1 386 TYR 386 386 ?   ?   ?   A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 CYS 388 388 388 CYS CYS A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 CYS 390 390 390 CYS CYS A . n 
A 1 391 TRP 391 391 391 TRP TRP A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ALA 393 393 393 ALA ALA A . n 
A 1 394 GLU 394 394 394 GLU GLU A . n 
A 1 395 SER 395 395 395 SER SER A . n 
A 1 396 LYS 396 396 396 LYS LYS A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 SER 398 398 398 SER SER A . n 
A 1 399 TYR 399 399 399 TYR TYR A . n 
A 1 400 GLY 400 400 400 GLY GLY A . n 
A 1 401 TRP 401 401 401 TRP TRP A . n 
A 1 402 ILE 402 402 402 ILE ILE A . n 
A 1 403 GLU 403 403 403 GLU GLU A . n 
A 1 404 ILE 404 404 404 ILE ILE A . n 
A 1 405 VAL 405 405 405 VAL VAL A . n 
A 1 406 GLY 406 406 406 GLY GLY A . n 
A 1 407 CYS 407 407 407 CYS CYS A . n 
A 1 408 ALA 408 408 408 ALA ALA A . n 
A 1 409 ASP 409 409 409 ASP ASP A . n 
A 1 410 ARG 410 410 410 ARG ARG A . n 
A 1 411 SER 411 411 411 SER SER A . n 
A 1 412 CYS 412 412 412 CYS CYS A . n 
A 1 413 TYR 413 413 413 TYR TYR A . n 
A 1 414 ASP 414 414 414 ASP ASP A . n 
A 1 415 LEU 415 415 415 LEU LEU A . n 
A 1 416 SER 416 416 416 SER SER A . n 
A 1 417 CYS 417 417 417 CYS CYS A . n 
A 1 418 HIS 418 418 418 HIS HIS A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ARG 420 420 420 ARG ARG A . n 
A 1 421 ALA 421 421 ?   ?   ?   A . n 
A 1 422 THR 422 422 ?   ?   ?   A . n 
A 1 423 LYS 423 423 ?   ?   ?   A . n 
A 1 424 VAL 424 424 ?   ?   ?   A . n 
A 1 425 PRO 425 425 ?   ?   ?   A . n 
A 1 426 LEU 426 426 ?   ?   ?   A . n 
A 1 427 VAL 427 427 ?   ?   ?   A . n 
A 1 428 ALA 428 428 ?   ?   ?   A . n 
A 1 429 GLU 429 429 ?   ?   ?   A . n 
A 1 430 LYS 430 430 ?   ?   ?   A . n 
A 1 431 PRO 431 431 ?   ?   ?   A . n 
A 1 432 LEU 432 432 ?   ?   ?   A . n 
A 1 433 LYS 433 433 ?   ?   ?   A . n 
A 1 434 GLU 434 434 ?   ?   ?   A . n 
A 1 435 PRO 435 435 ?   ?   ?   A . n 
A 1 436 LYS 436 436 ?   ?   ?   A . n 
A 1 437 THR 437 437 ?   ?   ?   A . n 
A 1 438 VAL 438 438 ?   ?   ?   A . n 
A 1 439 ASN 439 439 ?   ?   ?   A . n 
A 1 440 VAL 440 440 ?   ?   ?   A . n 
A 1 441 VAL 441 441 ?   ?   ?   A . n 
A 1 442 GLN 442 442 ?   ?   ?   A . n 
A 1 443 PHE 443 443 ?   ?   ?   A . n 
A 1 444 GLU 444 444 ?   ?   ?   A . n 
A 1 445 PRO 445 445 ?   ?   ?   A . n 
A 1 446 SER 446 446 ?   ?   ?   A . n 
A 1 447 LYS 447 447 ?   ?   ?   A . n 
A 1 448 GLY 448 448 ?   ?   ?   A . n 
A 1 449 ALA 449 449 ?   ?   ?   A . n 
A 1 450 ILE 450 450 ?   ?   ?   A . n 
A 1 451 GLY 451 451 ?   ?   ?   A . n 
A 1 452 LYS 452 452 ?   ?   ?   A . n 
A 1 453 ALA 453 453 ?   ?   ?   A . n 
A 1 454 TYR 454 454 ?   ?   ?   A . n 
A 1 455 LYS 455 455 ?   ?   ?   A . n 
A 1 456 LYS 456 456 ?   ?   ?   A . n 
A 1 457 ASP 457 457 ?   ?   ?   A . n 
A 1 458 ALA 458 458 ?   ?   ?   A . n 
A 1 459 LYS 459 459 ?   ?   ?   A . n 
A 1 460 LEU 460 460 ?   ?   ?   A . n 
A 1 461 VAL 461 461 ?   ?   ?   A . n 
A 1 462 MET 462 462 ?   ?   ?   A . n 
A 1 463 GLU 463 463 ?   ?   ?   A . n 
A 1 464 TYR 464 464 ?   ?   ?   A . n 
A 1 465 LEU 465 465 ?   ?   ?   A . n 
A 1 466 ALA 466 466 ?   ?   ?   A . n 
A 1 467 ILE 467 467 ?   ?   ?   A . n 
A 1 468 CYS 468 468 ?   ?   ?   A . n 
A 1 469 ASP 469 469 ?   ?   ?   A . n 
A 1 470 GLU 470 470 ?   ?   ?   A . n 
A 1 471 CYS 471 471 ?   ?   ?   A . n 
A 1 472 TYR 472 472 ?   ?   ?   A . n 
A 1 473 ILE 473 473 ?   ?   ?   A . n 
A 1 474 THR 474 474 ?   ?   ?   A . n 
A 1 475 GLU 475 475 ?   ?   ?   A . n 
A 1 476 MET 476 476 ?   ?   ?   A . n 
A 1 477 GLU 477 477 ?   ?   ?   A . n 
A 1 478 MET 478 478 ?   ?   ?   A . n 
A 1 479 LEU 479 479 ?   ?   ?   A . n 
A 1 480 LEU 480 480 ?   ?   ?   A . n 
A 1 481 ASN 481 481 ?   ?   ?   A . n 
A 1 482 GLU 482 482 ?   ?   ?   A . n 
A 1 483 LYS 483 483 ?   ?   ?   A . n 
A 1 484 GLY 484 484 ?   ?   ?   A . n 
A 1 485 GLU 485 485 ?   ?   ?   A . n 
A 1 486 PHE 486 486 ?   ?   ?   A . n 
A 1 487 THR 487 487 ?   ?   ?   A . n 
A 1 488 ILE 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 THR 490 490 ?   ?   ?   A . n 
A 1 491 GLU 491 491 ?   ?   ?   A . n 
A 1 492 GLY 492 492 ?   ?   ?   A . n 
A 1 493 LYS 493 493 ?   ?   ?   A . n 
A 1 494 THR 494 494 ?   ?   ?   A . n 
A 1 495 PHE 495 495 ?   ?   ?   A . n 
A 1 496 GLN 496 496 ?   ?   ?   A . n 
A 1 497 LEU 497 497 ?   ?   ?   A . n 
A 1 498 THR 498 498 ?   ?   ?   A . n 
A 1 499 LYS 499 499 ?   ?   ?   A . n 
A 1 500 ASP 500 500 ?   ?   ?   A . n 
A 1 501 MET 501 501 ?   ?   ?   A . n 
A 1 502 ILE 502 502 ?   ?   ?   A . n 
A 1 503 ASN 503 503 ?   ?   ?   A . n 
A 1 504 VAL 504 504 ?   ?   ?   A . n 
A 1 505 LYS 505 505 505 LYS LYS A . n 
A 1 506 ARG 506 506 506 ARG ARG A . n 
A 1 507 PHE 507 507 507 PHE PHE A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 LYS 509 509 509 LYS LYS A . n 
A 1 510 THR 510 510 510 THR THR A . n 
A 1 511 LEU 511 511 511 LEU LEU A . n 
A 1 512 TYR 512 512 512 TYR TYR A . n 
A 1 513 VAL 513 513 513 VAL VAL A . n 
A 1 514 GLU 514 514 514 GLU GLU A . n 
A 1 515 GLU 515 515 515 GLU GLU A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 VAL 517 517 517 VAL VAL A . n 
A 1 518 PRO 518 518 518 PRO PRO A . n 
A 1 519 ASN 519 519 519 ASN ASN A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 GLU 522 522 522 GLU GLU A . n 
A 1 523 PRO 523 523 523 PRO PRO A . n 
A 1 524 SER 524 524 524 SER SER A . n 
A 1 525 PHE 525 525 525 PHE PHE A . n 
A 1 526 GLY 526 526 526 GLY GLY A . n 
A 1 527 LEU 527 527 527 LEU LEU A . n 
A 1 528 GLY 528 528 528 GLY GLY A . n 
A 1 529 ARG 529 529 529 ARG ARG A . n 
A 1 530 ILE 530 530 530 ILE ILE A . n 
A 1 531 MET 531 531 531 MET MET A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 THR 533 533 533 THR THR A . n 
A 1 534 VAL 534 534 534 VAL VAL A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 GLU 536 536 536 GLU GLU A . n 
A 1 537 HIS 537 537 537 HIS HIS A . n 
A 1 538 THR 538 538 538 THR THR A . n 
A 1 539 PHE 539 539 539 PHE PHE A . n 
A 1 540 HIS 540 540 540 HIS HIS A . n 
A 1 541 VAL 541 541 541 VAL VAL A . n 
A 1 542 ARG 542 542 542 ARG ARG A . n 
A 1 543 GLU 543 543 543 GLU GLU A . n 
A 1 544 GLY 544 544 544 GLY GLY A . n 
A 1 545 ASP 545 545 ?   ?   ?   A . n 
A 1 546 GLU 546 546 ?   ?   ?   A . n 
A 1 547 GLN 547 547 547 GLN GLN A . n 
A 1 548 ARG 548 548 548 ARG ARG A . n 
A 1 549 THR 549 549 549 THR THR A . n 
A 1 550 PHE 550 550 550 PHE PHE A . n 
A 1 551 PHE 551 551 551 PHE PHE A . n 
A 1 552 SER 552 552 552 SER SER A . n 
A 1 553 PHE 553 553 553 PHE PHE A . n 
A 1 554 PRO 554 554 554 PRO PRO A . n 
A 1 555 ALA 555 555 555 ALA ALA A . n 
A 1 556 VAL 556 556 556 VAL VAL A . n 
A 1 557 VAL 557 557 557 VAL VAL A . n 
A 1 558 ALA 558 558 558 ALA ALA A . n 
A 1 559 PRO 559 559 559 PRO PRO A . n 
A 1 560 PHE 560 560 560 PHE PHE A . n 
A 1 561 LYS 561 561 561 LYS LYS A . n 
A 1 562 CYS 562 562 562 CYS CYS A . n 
A 1 563 SER 563 563 563 SER SER A . n 
A 1 564 VAL 564 564 564 VAL VAL A . n 
A 1 565 LEU 565 565 565 LEU LEU A . n 
A 1 566 PRO 566 566 566 PRO PRO A . n 
A 1 567 LEU 567 567 567 LEU LEU A . n 
A 1 568 SER 568 568 568 SER SER A . n 
A 1 569 GLN 569 569 569 GLN GLN A . n 
A 1 570 ASN 570 570 570 ASN ASN A . n 
A 1 571 GLN 571 571 571 GLN GLN A . n 
A 1 572 GLU 572 572 572 GLU GLU A . n 
A 1 573 PHE 573 573 573 PHE PHE A . n 
A 1 574 MET 574 574 574 MET MET A . n 
A 1 575 PRO 575 575 575 PRO PRO A . n 
A 1 576 PHE 576 576 576 PHE PHE A . n 
A 1 577 VAL 577 577 577 VAL VAL A . n 
A 1 578 LYS 578 578 578 LYS LYS A . n 
A 1 579 GLU 579 579 579 GLU GLU A . n 
A 1 580 LEU 580 580 580 LEU LEU A . n 
A 1 581 SER 581 581 581 SER SER A . n 
A 1 582 GLU 582 582 582 GLU GLU A . n 
A 1 583 ALA 583 583 583 ALA ALA A . n 
A 1 584 LEU 584 584 584 LEU LEU A . n 
A 1 585 THR 585 585 585 THR THR A . n 
A 1 586 ARG 586 586 586 ARG ARG A . n 
A 1 587 HIS 587 587 587 HIS HIS A . n 
A 1 588 GLY 588 588 588 GLY GLY A . n 
A 1 589 VAL 589 589 589 VAL VAL A . n 
A 1 590 SER 590 590 590 SER SER A . n 
A 1 591 HIS 591 591 591 HIS HIS A . n 
A 1 592 LYS 592 592 592 LYS LYS A . n 
A 1 593 VAL 593 593 593 VAL VAL A . n 
A 1 594 ASP 594 594 594 ASP ASP A . n 
A 1 595 ASP 595 595 595 ASP ASP A . n 
A 1 596 SER 596 596 596 SER SER A . n 
A 1 597 SER 597 597 597 SER SER A . n 
A 1 598 GLY 598 598 598 GLY GLY A . n 
A 1 599 SER 599 599 599 SER SER A . n 
A 1 600 ILE 600 600 600 ILE ILE A . n 
A 1 601 GLY 601 601 601 GLY GLY A . n 
A 1 602 ARG 602 602 602 ARG ARG A . n 
A 1 603 ARG 603 603 603 ARG ARG A . n 
A 1 604 TYR 604 604 604 TYR TYR A . n 
A 1 605 ALA 605 605 605 ALA ALA A . n 
A 1 606 ARG 606 606 606 ARG ARG A . n 
A 1 607 THR 607 607 607 THR THR A . n 
A 1 608 ASP 608 608 608 ASP ASP A . n 
A 1 609 GLU 609 609 609 GLU GLU A . n 
A 1 610 ILE 610 610 610 ILE ILE A . n 
A 1 611 GLY 611 611 611 GLY GLY A . n 
A 1 612 VAL 612 612 612 VAL VAL A . n 
A 1 613 ALA 613 613 613 ALA ALA A . n 
A 1 614 PHE 614 614 614 PHE PHE A . n 
A 1 615 GLY 615 615 615 GLY GLY A . n 
A 1 616 VAL 616 616 616 VAL VAL A . n 
A 1 617 THR 617 617 617 THR THR A . n 
A 1 618 ILE 618 618 618 ILE ILE A . n 
A 1 619 ASP 619 619 619 ASP ASP A . n 
A 1 620 PHE 620 620 620 PHE PHE A . n 
A 1 621 ASP 621 621 621 ASP ASP A . n 
A 1 622 THR 622 622 622 THR THR A . n 
A 1 623 VAL 623 623 623 VAL VAL A . n 
A 1 624 ASN 624 624 624 ASN ASN A . n 
A 1 625 LYS 625 625 625 LYS LYS A . n 
A 1 626 THR 626 626 626 THR THR A . n 
A 1 627 PRO 627 627 627 PRO PRO A . n 
A 1 628 HIS 628 628 628 HIS HIS A . n 
A 1 629 THR 629 629 629 THR THR A . n 
A 1 630 ALA 630 630 630 ALA ALA A . n 
A 1 631 THR 631 631 631 THR THR A . n 
A 1 632 LEU 632 632 632 LEU LEU A . n 
A 1 633 ARG 633 633 633 ARG ARG A . n 
A 1 634 ASP 634 634 634 ASP ASP A . n 
A 1 635 ARG 635 635 635 ARG ARG A . n 
A 1 636 ASP 636 636 636 ASP ASP A . n 
A 1 637 SER 637 637 637 SER SER A . n 
A 1 638 MET 638 638 638 MET MET A . n 
A 1 639 ARG 639 639 639 ARG ARG A . n 
A 1 640 GLN 640 640 640 GLN GLN A . n 
A 1 641 ILE 641 641 641 ILE ILE A . n 
A 1 642 ARG 642 642 642 ARG ARG A . n 
A 1 643 ALA 643 643 643 ALA ALA A . n 
A 1 644 GLU 644 644 644 GLU GLU A . n 
A 1 645 ILE 645 645 645 ILE ILE A . n 
A 1 646 SER 646 646 646 SER SER A . n 
A 1 647 GLU 647 647 647 GLU GLU A . n 
A 1 648 LEU 648 648 648 LEU LEU A . n 
A 1 649 PRO 649 649 649 PRO PRO A . n 
A 1 650 SER 650 650 650 SER SER A . n 
A 1 651 ILE 651 651 651 ILE ILE A . n 
A 1 652 VAL 652 652 652 VAL VAL A . n 
A 1 653 GLN 653 653 653 GLN GLN A . n 
A 1 654 ASP 654 654 654 ASP ASP A . n 
A 1 655 LEU 655 655 655 LEU LEU A . n 
A 1 656 ALA 656 656 656 ALA ALA A . n 
A 1 657 ASN 657 657 657 ASN ASN A . n 
A 1 658 GLY 658 658 658 GLY GLY A . n 
A 1 659 ASN 659 659 659 ASN ASN A . n 
A 1 660 ILE 660 660 660 ILE ILE A . n 
A 1 661 THR 661 661 661 THR THR A . n 
A 1 662 TRP 662 662 662 TRP TRP A . n 
A 1 663 ALA 663 663 663 ALA ALA A . n 
A 1 664 ASP 664 664 664 ASP ASP A . n 
A 1 665 VAL 665 665 665 VAL VAL A . n 
A 1 666 GLU 666 666 666 GLU GLU A . n 
A 1 667 ALA 667 667 667 ALA ALA A . n 
A 1 668 ARG 668 668 668 ARG ARG A . n 
A 1 669 TYR 669 669 669 TYR TYR A . n 
A 1 670 PRO 670 670 670 PRO PRO A . n 
A 1 671 LEU 671 671 671 LEU LEU A . n 
A 1 672 PHE 672 672 672 PHE PHE A . n 
A 1 673 GLU 673 673 673 GLU GLU A . n 
A 1 674 GLY 674 674 674 GLY GLY A . n 
A 1 675 GLN 675 675 ?   ?   ?   A . n 
A 1 676 GLU 676 676 ?   ?   ?   A . n 
A 1 677 THR 677 677 ?   ?   ?   A . n 
A 1 678 GLY 678 678 ?   ?   ?   A . n 
A 1 679 LYS 679 679 ?   ?   ?   A . n 
A 1 680 LYS 680 680 ?   ?   ?   A . n 
A 1 681 GLU 681 681 ?   ?   ?   A . n 
A 1 682 THR 682 682 ?   ?   ?   A . n 
A 1 683 ILE 683 683 ?   ?   ?   A . n 
A 1 684 GLU 684 684 ?   ?   ?   A . n 
A 1 685 GLU 685 685 ?   ?   ?   A . n 
A 1 686 LEU 686 686 ?   ?   ?   A . n 
A 1 687 GLU 687 687 ?   ?   ?   A . n 
A 1 688 HIS 688 688 ?   ?   ?   A . n 
A 1 689 HIS 689 689 ?   ?   ?   A . n 
A 1 690 HIS 690 690 ?   ?   ?   A . n 
A 1 691 HIS 691 691 ?   ?   ?   A . n 
A 1 692 HIS 692 692 ?   ?   ?   A . n 
A 1 693 HIS 693 693 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   694 2   HOH HOH A . 
B 2 HOH 2   695 3   HOH HOH A . 
B 2 HOH 3   696 4   HOH HOH A . 
B 2 HOH 4   697 5   HOH HOH A . 
B 2 HOH 5   698 6   HOH HOH A . 
B 2 HOH 6   699 7   HOH HOH A . 
B 2 HOH 7   700 9   HOH HOH A . 
B 2 HOH 8   701 11  HOH HOH A . 
B 2 HOH 9   702 12  HOH HOH A . 
B 2 HOH 10  703 13  HOH HOH A . 
B 2 HOH 11  704 14  HOH HOH A . 
B 2 HOH 12  705 15  HOH HOH A . 
B 2 HOH 13  706 16  HOH HOH A . 
B 2 HOH 14  707 17  HOH HOH A . 
B 2 HOH 15  708 19  HOH HOH A . 
B 2 HOH 16  709 20  HOH HOH A . 
B 2 HOH 17  710 22  HOH HOH A . 
B 2 HOH 18  711 23  HOH HOH A . 
B 2 HOH 19  712 24  HOH HOH A . 
B 2 HOH 20  713 25  HOH HOH A . 
B 2 HOH 21  714 26  HOH HOH A . 
B 2 HOH 22  715 27  HOH HOH A . 
B 2 HOH 23  716 28  HOH HOH A . 
B 2 HOH 24  717 29  HOH HOH A . 
B 2 HOH 25  718 30  HOH HOH A . 
B 2 HOH 26  719 31  HOH HOH A . 
B 2 HOH 27  720 32  HOH HOH A . 
B 2 HOH 28  721 33  HOH HOH A . 
B 2 HOH 29  722 34  HOH HOH A . 
B 2 HOH 30  723 35  HOH HOH A . 
B 2 HOH 31  724 36  HOH HOH A . 
B 2 HOH 32  725 37  HOH HOH A . 
B 2 HOH 33  726 38  HOH HOH A . 
B 2 HOH 34  727 39  HOH HOH A . 
B 2 HOH 35  728 40  HOH HOH A . 
B 2 HOH 36  729 41  HOH HOH A . 
B 2 HOH 37  730 42  HOH HOH A . 
B 2 HOH 38  731 43  HOH HOH A . 
B 2 HOH 39  732 44  HOH HOH A . 
B 2 HOH 40  733 45  HOH HOH A . 
B 2 HOH 41  734 46  HOH HOH A . 
B 2 HOH 42  735 47  HOH HOH A . 
B 2 HOH 43  736 48  HOH HOH A . 
B 2 HOH 44  737 49  HOH HOH A . 
B 2 HOH 45  738 50  HOH HOH A . 
B 2 HOH 46  739 51  HOH HOH A . 
B 2 HOH 47  740 52  HOH HOH A . 
B 2 HOH 48  741 53  HOH HOH A . 
B 2 HOH 49  742 54  HOH HOH A . 
B 2 HOH 50  743 55  HOH HOH A . 
B 2 HOH 51  744 57  HOH HOH A . 
B 2 HOH 52  745 58  HOH HOH A . 
B 2 HOH 53  746 59  HOH HOH A . 
B 2 HOH 54  747 60  HOH HOH A . 
B 2 HOH 55  748 61  HOH HOH A . 
B 2 HOH 56  749 62  HOH HOH A . 
B 2 HOH 57  750 63  HOH HOH A . 
B 2 HOH 58  751 64  HOH HOH A . 
B 2 HOH 59  752 66  HOH HOH A . 
B 2 HOH 60  753 67  HOH HOH A . 
B 2 HOH 61  754 68  HOH HOH A . 
B 2 HOH 62  755 69  HOH HOH A . 
B 2 HOH 63  756 70  HOH HOH A . 
B 2 HOH 64  757 71  HOH HOH A . 
B 2 HOH 65  758 72  HOH HOH A . 
B 2 HOH 66  759 73  HOH HOH A . 
B 2 HOH 67  760 74  HOH HOH A . 
B 2 HOH 68  761 75  HOH HOH A . 
B 2 HOH 69  762 76  HOH HOH A . 
B 2 HOH 70  763 77  HOH HOH A . 
B 2 HOH 71  764 78  HOH HOH A . 
B 2 HOH 72  765 79  HOH HOH A . 
B 2 HOH 73  766 80  HOH HOH A . 
B 2 HOH 74  767 81  HOH HOH A . 
B 2 HOH 75  768 82  HOH HOH A . 
B 2 HOH 76  769 83  HOH HOH A . 
B 2 HOH 77  770 84  HOH HOH A . 
B 2 HOH 78  771 85  HOH HOH A . 
B 2 HOH 79  772 86  HOH HOH A . 
B 2 HOH 80  773 87  HOH HOH A . 
B 2 HOH 81  774 88  HOH HOH A . 
B 2 HOH 82  775 89  HOH HOH A . 
B 2 HOH 83  776 90  HOH HOH A . 
B 2 HOH 84  777 91  HOH HOH A . 
B 2 HOH 85  778 92  HOH HOH A . 
B 2 HOH 86  779 93  HOH HOH A . 
B 2 HOH 87  780 94  HOH HOH A . 
B 2 HOH 88  781 95  HOH HOH A . 
B 2 HOH 89  782 96  HOH HOH A . 
B 2 HOH 90  783 97  HOH HOH A . 
B 2 HOH 91  784 98  HOH HOH A . 
B 2 HOH 92  785 99  HOH HOH A . 
B 2 HOH 93  786 100 HOH HOH A . 
B 2 HOH 94  787 101 HOH HOH A . 
B 2 HOH 95  788 102 HOH HOH A . 
B 2 HOH 96  789 103 HOH HOH A . 
B 2 HOH 97  790 104 HOH HOH A . 
B 2 HOH 98  791 105 HOH HOH A . 
B 2 HOH 99  792 106 HOH HOH A . 
B 2 HOH 100 793 107 HOH HOH A . 
B 2 HOH 101 794 108 HOH HOH A . 
B 2 HOH 102 795 109 HOH HOH A . 
B 2 HOH 103 796 110 HOH HOH A . 
B 2 HOH 104 797 111 HOH HOH A . 
B 2 HOH 105 798 112 HOH HOH A . 
B 2 HOH 106 799 113 HOH HOH A . 
B 2 HOH 107 800 114 HOH HOH A . 
B 2 HOH 108 801 115 HOH HOH A . 
B 2 HOH 109 802 116 HOH HOH A . 
B 2 HOH 110 803 117 HOH HOH A . 
B 2 HOH 111 804 118 HOH HOH A . 
B 2 HOH 112 805 120 HOH HOH A . 
B 2 HOH 113 806 121 HOH HOH A . 
B 2 HOH 114 807 122 HOH HOH A . 
B 2 HOH 115 808 123 HOH HOH A . 
B 2 HOH 116 809 124 HOH HOH A . 
B 2 HOH 117 810 125 HOH HOH A . 
B 2 HOH 118 811 126 HOH HOH A . 
B 2 HOH 119 812 127 HOH HOH A . 
B 2 HOH 120 813 128 HOH HOH A . 
B 2 HOH 121 814 129 HOH HOH A . 
B 2 HOH 122 815 130 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5310  ? 
1 MORE         -38   ? 
1 'SSA (A^2)'  47420 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-05-22 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification'       
2 4 'Structure model' '_software.contact_author'       
3 4 'Structure model' '_software.contact_author_email' 
4 4 'Structure model' '_software.date'                 
5 4 'Structure model' '_software.language'             
6 4 'Structure model' '_software.location'             
7 4 'Structure model' '_software.name'                 
8 4 'Structure model' '_software.type'                 
9 4 'Structure model' '_software.version'              
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .       ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .       ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
REFMAC      .       ?                program 'Murshudov, G.N.'    ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 3 
PDB_EXTRACT 2.000   'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 4 
ADSC        Quantum ?                ?       ?                    ?                        'data collection' ? ?          ? 5 
HKL-2000    .       ?                ?       ?                    ?                        'data reduction'  ? ?          ? 6 
PHASER      .       ?                ?       ?                    ?                        phasing           ? ?          ? 7 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD1 A ASN 225 ? ? O   A HOH 799 ? ? 1.91 
2 1 O   A HIS 140 ? ? O   A HOH 799 ? ? 2.12 
3 1 N   A THR 629 ? ? O   A HOH 808 ? ? 2.17 
4 1 O   A PHE 553 ? ? NH2 A ARG 635 ? ? 2.18 
5 1 NE2 A HIS 140 ? ? O   A HOH 767 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 153 ? ? -129.58 -69.20 
2  1 ASN A 154 ? ? -70.82  42.74  
3  1 GLU A 156 ? ? -35.28  140.09 
4  1 ASP A 193 ? ? -80.98  33.35  
5  1 SER A 211 ? ? -31.92  167.49 
6  1 THR A 214 ? ? -9.18   114.72 
7  1 PRO A 234 ? ? -60.05  88.79  
8  1 ASN A 237 ? ? -92.48  37.10  
9  1 GLN A 262 ? ? 59.70   15.49  
10 1 ASN A 278 ? ? -68.91  73.19  
11 1 ARG A 283 ? ? -144.93 56.70  
12 1 SER A 284 ? ? -150.46 37.16  
13 1 LYS A 306 ? ? -107.61 73.91  
14 1 TYR A 322 ? ? -117.91 79.43  
15 1 SER A 552 ? ? -92.75  54.26  
16 1 GLU A 572 ? ? -41.94  -14.57 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLY A 215 ? ? ASN A 216 ? ? 149.59  
2 1 LYS A 625 ? ? THR A 626 ? ? -135.06 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 63  ? CG  ? A ASP 63  CG  
2  1 Y 1 A ASP 63  ? OD1 ? A ASP 63  OD1 
3  1 Y 1 A ASP 63  ? OD2 ? A ASP 63  OD2 
4  1 Y 1 A ILE 64  ? CG1 ? A ILE 64  CG1 
5  1 Y 1 A ILE 64  ? CG2 ? A ILE 64  CG2 
6  1 Y 1 A ILE 64  ? CD1 ? A ILE 64  CD1 
7  1 Y 1 A ASN 381 ? CG  ? A ASN 381 CG  
8  1 Y 1 A ASN 381 ? OD1 ? A ASN 381 OD1 
9  1 Y 1 A ASN 381 ? ND2 ? A ASN 381 ND2 
10 1 Y 1 A LYS 505 ? CG  ? A LYS 505 CG  
11 1 Y 1 A LYS 505 ? CD  ? A LYS 505 CD  
12 1 Y 1 A LYS 505 ? CE  ? A LYS 505 CE  
13 1 Y 1 A LYS 505 ? NZ  ? A LYS 505 NZ  
14 1 Y 1 A ARG 506 ? CG  ? A ARG 506 CG  
15 1 Y 1 A ARG 506 ? CD  ? A ARG 506 CD  
16 1 Y 1 A ARG 506 ? NE  ? A ARG 506 NE  
17 1 Y 1 A ARG 506 ? CZ  ? A ARG 506 CZ  
18 1 Y 1 A ARG 506 ? NH1 ? A ARG 506 NH1 
19 1 Y 1 A ARG 506 ? NH2 ? A ARG 506 NH2 
20 1 Y 1 A GLN 547 ? CG  ? A GLN 547 CG  
21 1 Y 1 A GLN 547 ? CD  ? A GLN 547 CD  
22 1 Y 1 A GLN 547 ? OE1 ? A GLN 547 OE1 
23 1 Y 1 A GLN 547 ? NE2 ? A GLN 547 NE2 
24 1 Y 1 A GLU 673 ? CG  ? A GLU 673 CG  
25 1 Y 1 A GLU 673 ? CD  ? A GLU 673 CD  
26 1 Y 1 A GLU 673 ? OE1 ? A GLU 673 OE1 
27 1 Y 1 A GLU 673 ? OE2 ? A GLU 673 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A ASP 2   ? A ASP 2   
3   1 Y 1 A GLY 3   ? A GLY 3   
4   1 Y 1 A ALA 4   ? A ALA 4   
5   1 Y 1 A GLY 5   ? A GLY 5   
6   1 Y 1 A ALA 6   ? A ALA 6   
7   1 Y 1 A GLU 7   ? A GLU 7   
8   1 Y 1 A GLU 8   ? A GLU 8   
9   1 Y 1 A VAL 9   ? A VAL 9   
10  1 Y 1 A LEU 10  ? A LEU 10  
11  1 Y 1 A ALA 11  ? A ALA 11  
12  1 Y 1 A PRO 12  ? A PRO 12  
13  1 Y 1 A LEU 13  ? A LEU 13  
14  1 Y 1 A ARG 14  ? A ARG 14  
15  1 Y 1 A LEU 15  ? A LEU 15  
16  1 Y 1 A ALA 16  ? A ALA 16  
17  1 Y 1 A VAL 17  ? A VAL 17  
18  1 Y 1 A ARG 18  ? A ARG 18  
19  1 Y 1 A GLN 19  ? A GLN 19  
20  1 Y 1 A GLN 20  ? A GLN 20  
21  1 Y 1 A GLY 21  ? A GLY 21  
22  1 Y 1 A ASP 22  ? A ASP 22  
23  1 Y 1 A LEU 23  ? A LEU 23  
24  1 Y 1 A VAL 24  ? A VAL 24  
25  1 Y 1 A ARG 25  ? A ARG 25  
26  1 Y 1 A LYS 26  ? A LYS 26  
27  1 Y 1 A LEU 27  ? A LEU 27  
28  1 Y 1 A LYS 28  ? A LYS 28  
29  1 Y 1 A GLU 29  ? A GLU 29  
30  1 Y 1 A ASP 30  ? A ASP 30  
31  1 Y 1 A LYS 31  ? A LYS 31  
32  1 Y 1 A ALA 32  ? A ALA 32  
33  1 Y 1 A PRO 33  ? A PRO 33  
34  1 Y 1 A GLN 34  ? A GLN 34  
35  1 Y 1 A VAL 35  ? A VAL 35  
36  1 Y 1 A ASP 36  ? A ASP 36  
37  1 Y 1 A VAL 37  ? A VAL 37  
38  1 Y 1 A ASP 38  ? A ASP 38  
39  1 Y 1 A LYS 39  ? A LYS 39  
40  1 Y 1 A ALA 40  ? A ALA 40  
41  1 Y 1 A VAL 41  ? A VAL 41  
42  1 Y 1 A ALA 42  ? A ALA 42  
43  1 Y 1 A GLU 43  ? A GLU 43  
44  1 Y 1 A LEU 44  ? A LEU 44  
45  1 Y 1 A LYS 45  ? A LYS 45  
46  1 Y 1 A ALA 46  ? A ALA 46  
47  1 Y 1 A ARG 47  ? A ARG 47  
48  1 Y 1 A LYS 48  ? A LYS 48  
49  1 Y 1 A ARG 49  ? A ARG 49  
50  1 Y 1 A VAL 50  ? A VAL 50  
51  1 Y 1 A LEU 51  ? A LEU 51  
52  1 Y 1 A GLU 52  ? A GLU 52  
53  1 Y 1 A ALA 53  ? A ALA 53  
54  1 Y 1 A LYS 54  ? A LYS 54  
55  1 Y 1 A GLU 55  ? A GLU 55  
56  1 Y 1 A LEU 56  ? A LEU 56  
57  1 Y 1 A ALA 57  ? A ALA 57  
58  1 Y 1 A LEU 58  ? A LEU 58  
59  1 Y 1 A GLN 59  ? A GLN 59  
60  1 Y 1 A PRO 60  ? A PRO 60  
61  1 Y 1 A LYS 61  ? A LYS 61  
62  1 Y 1 A ASP 62  ? A ASP 62  
63  1 Y 1 A GLU 382 ? A GLU 382 
64  1 Y 1 A MET 383 ? A MET 383 
65  1 Y 1 A ALA 384 ? A ALA 384 
66  1 Y 1 A HIS 385 ? A HIS 385 
67  1 Y 1 A TYR 386 ? A TYR 386 
68  1 Y 1 A ALA 421 ? A ALA 421 
69  1 Y 1 A THR 422 ? A THR 422 
70  1 Y 1 A LYS 423 ? A LYS 423 
71  1 Y 1 A VAL 424 ? A VAL 424 
72  1 Y 1 A PRO 425 ? A PRO 425 
73  1 Y 1 A LEU 426 ? A LEU 426 
74  1 Y 1 A VAL 427 ? A VAL 427 
75  1 Y 1 A ALA 428 ? A ALA 428 
76  1 Y 1 A GLU 429 ? A GLU 429 
77  1 Y 1 A LYS 430 ? A LYS 430 
78  1 Y 1 A PRO 431 ? A PRO 431 
79  1 Y 1 A LEU 432 ? A LEU 432 
80  1 Y 1 A LYS 433 ? A LYS 433 
81  1 Y 1 A GLU 434 ? A GLU 434 
82  1 Y 1 A PRO 435 ? A PRO 435 
83  1 Y 1 A LYS 436 ? A LYS 436 
84  1 Y 1 A THR 437 ? A THR 437 
85  1 Y 1 A VAL 438 ? A VAL 438 
86  1 Y 1 A ASN 439 ? A ASN 439 
87  1 Y 1 A VAL 440 ? A VAL 440 
88  1 Y 1 A VAL 441 ? A VAL 441 
89  1 Y 1 A GLN 442 ? A GLN 442 
90  1 Y 1 A PHE 443 ? A PHE 443 
91  1 Y 1 A GLU 444 ? A GLU 444 
92  1 Y 1 A PRO 445 ? A PRO 445 
93  1 Y 1 A SER 446 ? A SER 446 
94  1 Y 1 A LYS 447 ? A LYS 447 
95  1 Y 1 A GLY 448 ? A GLY 448 
96  1 Y 1 A ALA 449 ? A ALA 449 
97  1 Y 1 A ILE 450 ? A ILE 450 
98  1 Y 1 A GLY 451 ? A GLY 451 
99  1 Y 1 A LYS 452 ? A LYS 452 
100 1 Y 1 A ALA 453 ? A ALA 453 
101 1 Y 1 A TYR 454 ? A TYR 454 
102 1 Y 1 A LYS 455 ? A LYS 455 
103 1 Y 1 A LYS 456 ? A LYS 456 
104 1 Y 1 A ASP 457 ? A ASP 457 
105 1 Y 1 A ALA 458 ? A ALA 458 
106 1 Y 1 A LYS 459 ? A LYS 459 
107 1 Y 1 A LEU 460 ? A LEU 460 
108 1 Y 1 A VAL 461 ? A VAL 461 
109 1 Y 1 A MET 462 ? A MET 462 
110 1 Y 1 A GLU 463 ? A GLU 463 
111 1 Y 1 A TYR 464 ? A TYR 464 
112 1 Y 1 A LEU 465 ? A LEU 465 
113 1 Y 1 A ALA 466 ? A ALA 466 
114 1 Y 1 A ILE 467 ? A ILE 467 
115 1 Y 1 A CYS 468 ? A CYS 468 
116 1 Y 1 A ASP 469 ? A ASP 469 
117 1 Y 1 A GLU 470 ? A GLU 470 
118 1 Y 1 A CYS 471 ? A CYS 471 
119 1 Y 1 A TYR 472 ? A TYR 472 
120 1 Y 1 A ILE 473 ? A ILE 473 
121 1 Y 1 A THR 474 ? A THR 474 
122 1 Y 1 A GLU 475 ? A GLU 475 
123 1 Y 1 A MET 476 ? A MET 476 
124 1 Y 1 A GLU 477 ? A GLU 477 
125 1 Y 1 A MET 478 ? A MET 478 
126 1 Y 1 A LEU 479 ? A LEU 479 
127 1 Y 1 A LEU 480 ? A LEU 480 
128 1 Y 1 A ASN 481 ? A ASN 481 
129 1 Y 1 A GLU 482 ? A GLU 482 
130 1 Y 1 A LYS 483 ? A LYS 483 
131 1 Y 1 A GLY 484 ? A GLY 484 
132 1 Y 1 A GLU 485 ? A GLU 485 
133 1 Y 1 A PHE 486 ? A PHE 486 
134 1 Y 1 A THR 487 ? A THR 487 
135 1 Y 1 A ILE 488 ? A ILE 488 
136 1 Y 1 A GLU 489 ? A GLU 489 
137 1 Y 1 A THR 490 ? A THR 490 
138 1 Y 1 A GLU 491 ? A GLU 491 
139 1 Y 1 A GLY 492 ? A GLY 492 
140 1 Y 1 A LYS 493 ? A LYS 493 
141 1 Y 1 A THR 494 ? A THR 494 
142 1 Y 1 A PHE 495 ? A PHE 495 
143 1 Y 1 A GLN 496 ? A GLN 496 
144 1 Y 1 A LEU 497 ? A LEU 497 
145 1 Y 1 A THR 498 ? A THR 498 
146 1 Y 1 A LYS 499 ? A LYS 499 
147 1 Y 1 A ASP 500 ? A ASP 500 
148 1 Y 1 A MET 501 ? A MET 501 
149 1 Y 1 A ILE 502 ? A ILE 502 
150 1 Y 1 A ASN 503 ? A ASN 503 
151 1 Y 1 A VAL 504 ? A VAL 504 
152 1 Y 1 A ASP 545 ? A ASP 545 
153 1 Y 1 A GLU 546 ? A GLU 546 
154 1 Y 1 A GLN 675 ? A GLN 675 
155 1 Y 1 A GLU 676 ? A GLU 676 
156 1 Y 1 A THR 677 ? A THR 677 
157 1 Y 1 A GLY 678 ? A GLY 678 
158 1 Y 1 A LYS 679 ? A LYS 679 
159 1 Y 1 A LYS 680 ? A LYS 680 
160 1 Y 1 A GLU 681 ? A GLU 681 
161 1 Y 1 A THR 682 ? A THR 682 
162 1 Y 1 A ILE 683 ? A ILE 683 
163 1 Y 1 A GLU 684 ? A GLU 684 
164 1 Y 1 A GLU 685 ? A GLU 685 
165 1 Y 1 A LEU 686 ? A LEU 686 
166 1 Y 1 A GLU 687 ? A GLU 687 
167 1 Y 1 A HIS 688 ? A HIS 688 
168 1 Y 1 A HIS 689 ? A HIS 689 
169 1 Y 1 A HIS 690 ? A HIS 690 
170 1 Y 1 A HIS 691 ? A HIS 691 
171 1 Y 1 A HIS 692 ? A HIS 692 
172 1 Y 1 A HIS 693 ? A HIS 693 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#