data_2PMF
# 
_entry.id   2PMF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2PMF         
RCSB  RCSB042538   
WWPDB D_1000042538 
# 
_pdbx_database_status.entry_id                        2PMF 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-21 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Xie, W.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Long-range structural effects of a Charcot-Marie- Tooth disease-causing mutation in human glycyl-tRNA synthetase.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            104 
_citation.page_first                9976 
_citation.page_last                 9981 
_citation.year                      2007 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17545306 
_citation.pdbx_database_id_DOI      10.1073/pnas.0703908104 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xie, W.'      1 
primary 'Nangle, L.A.' 2 
primary 'Zhang, W.'    3 
primary 'Schimmel, P.' 4 
primary 'Yang, X.L.'   5 
# 
_cell.length_a           91.412 
_cell.length_b           91.412 
_cell.length_c           246.814 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2PMF 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.entry_id                         2PMF 
_symmetry.Int_Tables_number                96 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glycyl-tRNA synthetase' 78804.969 1   6.1.1.14 G526R ? ? 
2 non-polymer syn 'CHLORIDE ION'           35.453    1   ?        ?     ? ? 
3 non-polymer syn GLYCEROL                 92.094    1   ?        ?     ? ? 
4 water       nat water                    18.015    202 ?        ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Glycine--tRNA ligase, GlyRS' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRA
DHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYG
WIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLL
NEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFRLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQ
IRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEELEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRA
DHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYG
WIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLL
NEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFRLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQ
IRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEELEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   GLY n 
1 4   ALA n 
1 5   GLY n 
1 6   ALA n 
1 7   GLU n 
1 8   GLU n 
1 9   VAL n 
1 10  LEU n 
1 11  ALA n 
1 12  PRO n 
1 13  LEU n 
1 14  ARG n 
1 15  LEU n 
1 16  ALA n 
1 17  VAL n 
1 18  ARG n 
1 19  GLN n 
1 20  GLN n 
1 21  GLY n 
1 22  ASP n 
1 23  LEU n 
1 24  VAL n 
1 25  ARG n 
1 26  LYS n 
1 27  LEU n 
1 28  LYS n 
1 29  GLU n 
1 30  ASP n 
1 31  LYS n 
1 32  ALA n 
1 33  PRO n 
1 34  GLN n 
1 35  VAL n 
1 36  ASP n 
1 37  VAL n 
1 38  ASP n 
1 39  LYS n 
1 40  ALA n 
1 41  VAL n 
1 42  ALA n 
1 43  GLU n 
1 44  LEU n 
1 45  LYS n 
1 46  ALA n 
1 47  ARG n 
1 48  LYS n 
1 49  ARG n 
1 50  VAL n 
1 51  LEU n 
1 52  GLU n 
1 53  ALA n 
1 54  LYS n 
1 55  GLU n 
1 56  LEU n 
1 57  ALA n 
1 58  LEU n 
1 59  GLN n 
1 60  PRO n 
1 61  LYS n 
1 62  ASP n 
1 63  ASP n 
1 64  ILE n 
1 65  VAL n 
1 66  ASP n 
1 67  ARG n 
1 68  ALA n 
1 69  LYS n 
1 70  MET n 
1 71  GLU n 
1 72  ASP n 
1 73  THR n 
1 74  LEU n 
1 75  LYS n 
1 76  ARG n 
1 77  ARG n 
1 78  PHE n 
1 79  PHE n 
1 80  TYR n 
1 81  ASP n 
1 82  GLN n 
1 83  ALA n 
1 84  PHE n 
1 85  ALA n 
1 86  ILE n 
1 87  TYR n 
1 88  GLY n 
1 89  GLY n 
1 90  VAL n 
1 91  SER n 
1 92  GLY n 
1 93  LEU n 
1 94  TYR n 
1 95  ASP n 
1 96  PHE n 
1 97  GLY n 
1 98  PRO n 
1 99  VAL n 
1 100 GLY n 
1 101 CYS n 
1 102 ALA n 
1 103 LEU n 
1 104 LYS n 
1 105 ASN n 
1 106 ASN n 
1 107 ILE n 
1 108 ILE n 
1 109 GLN n 
1 110 THR n 
1 111 TRP n 
1 112 ARG n 
1 113 GLN n 
1 114 HIS n 
1 115 PHE n 
1 116 ILE n 
1 117 GLN n 
1 118 GLU n 
1 119 GLU n 
1 120 GLN n 
1 121 ILE n 
1 122 LEU n 
1 123 GLU n 
1 124 ILE n 
1 125 ASP n 
1 126 CYS n 
1 127 THR n 
1 128 MET n 
1 129 LEU n 
1 130 THR n 
1 131 PRO n 
1 132 GLU n 
1 133 PRO n 
1 134 VAL n 
1 135 LEU n 
1 136 LYS n 
1 137 THR n 
1 138 SER n 
1 139 GLY n 
1 140 HIS n 
1 141 VAL n 
1 142 ASP n 
1 143 LYS n 
1 144 PHE n 
1 145 ALA n 
1 146 ASP n 
1 147 PHE n 
1 148 MET n 
1 149 VAL n 
1 150 LYS n 
1 151 ASP n 
1 152 VAL n 
1 153 LYS n 
1 154 ASN n 
1 155 GLY n 
1 156 GLU n 
1 157 CYS n 
1 158 PHE n 
1 159 ARG n 
1 160 ALA n 
1 161 ASP n 
1 162 HIS n 
1 163 LEU n 
1 164 LEU n 
1 165 LYS n 
1 166 ALA n 
1 167 HIS n 
1 168 LEU n 
1 169 GLN n 
1 170 LYS n 
1 171 LEU n 
1 172 MET n 
1 173 SER n 
1 174 ASP n 
1 175 LYS n 
1 176 LYS n 
1 177 CYS n 
1 178 SER n 
1 179 VAL n 
1 180 GLU n 
1 181 LYS n 
1 182 LYS n 
1 183 SER n 
1 184 GLU n 
1 185 MET n 
1 186 GLU n 
1 187 SER n 
1 188 VAL n 
1 189 LEU n 
1 190 ALA n 
1 191 GLN n 
1 192 LEU n 
1 193 ASP n 
1 194 ASN n 
1 195 TYR n 
1 196 GLY n 
1 197 GLN n 
1 198 GLN n 
1 199 GLU n 
1 200 LEU n 
1 201 ALA n 
1 202 ASP n 
1 203 LEU n 
1 204 PHE n 
1 205 VAL n 
1 206 ASN n 
1 207 TYR n 
1 208 ASN n 
1 209 VAL n 
1 210 LYS n 
1 211 SER n 
1 212 PRO n 
1 213 ILE n 
1 214 THR n 
1 215 GLY n 
1 216 ASN n 
1 217 ASP n 
1 218 LEU n 
1 219 SER n 
1 220 PRO n 
1 221 PRO n 
1 222 VAL n 
1 223 SER n 
1 224 PHE n 
1 225 ASN n 
1 226 LEU n 
1 227 MET n 
1 228 PHE n 
1 229 LYS n 
1 230 THR n 
1 231 PHE n 
1 232 ILE n 
1 233 GLY n 
1 234 PRO n 
1 235 GLY n 
1 236 GLY n 
1 237 ASN n 
1 238 MET n 
1 239 PRO n 
1 240 GLY n 
1 241 TYR n 
1 242 LEU n 
1 243 ARG n 
1 244 PRO n 
1 245 GLU n 
1 246 THR n 
1 247 ALA n 
1 248 GLN n 
1 249 GLY n 
1 250 ILE n 
1 251 PHE n 
1 252 LEU n 
1 253 ASN n 
1 254 PHE n 
1 255 LYS n 
1 256 ARG n 
1 257 LEU n 
1 258 LEU n 
1 259 GLU n 
1 260 PHE n 
1 261 ASN n 
1 262 GLN n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 PRO n 
1 267 PHE n 
1 268 ALA n 
1 269 ALA n 
1 270 ALA n 
1 271 GLN n 
1 272 ILE n 
1 273 GLY n 
1 274 ASN n 
1 275 SER n 
1 276 PHE n 
1 277 ARG n 
1 278 ASN n 
1 279 GLU n 
1 280 ILE n 
1 281 SER n 
1 282 PRO n 
1 283 ARG n 
1 284 SER n 
1 285 GLY n 
1 286 LEU n 
1 287 ILE n 
1 288 ARG n 
1 289 VAL n 
1 290 ARG n 
1 291 GLU n 
1 292 PHE n 
1 293 THR n 
1 294 MET n 
1 295 ALA n 
1 296 GLU n 
1 297 ILE n 
1 298 GLU n 
1 299 HIS n 
1 300 PHE n 
1 301 VAL n 
1 302 ASP n 
1 303 PRO n 
1 304 SER n 
1 305 GLU n 
1 306 LYS n 
1 307 ASP n 
1 308 HIS n 
1 309 PRO n 
1 310 LYS n 
1 311 PHE n 
1 312 GLN n 
1 313 ASN n 
1 314 VAL n 
1 315 ALA n 
1 316 ASP n 
1 317 LEU n 
1 318 HIS n 
1 319 LEU n 
1 320 TYR n 
1 321 LEU n 
1 322 TYR n 
1 323 SER n 
1 324 ALA n 
1 325 LYS n 
1 326 ALA n 
1 327 GLN n 
1 328 VAL n 
1 329 SER n 
1 330 GLY n 
1 331 GLN n 
1 332 SER n 
1 333 ALA n 
1 334 ARG n 
1 335 LYS n 
1 336 MET n 
1 337 ARG n 
1 338 LEU n 
1 339 GLY n 
1 340 ASP n 
1 341 ALA n 
1 342 VAL n 
1 343 GLU n 
1 344 GLN n 
1 345 GLY n 
1 346 VAL n 
1 347 ILE n 
1 348 ASN n 
1 349 ASN n 
1 350 THR n 
1 351 VAL n 
1 352 LEU n 
1 353 GLY n 
1 354 TYR n 
1 355 PHE n 
1 356 ILE n 
1 357 GLY n 
1 358 ARG n 
1 359 ILE n 
1 360 TYR n 
1 361 LEU n 
1 362 TYR n 
1 363 LEU n 
1 364 THR n 
1 365 LYS n 
1 366 VAL n 
1 367 GLY n 
1 368 ILE n 
1 369 SER n 
1 370 PRO n 
1 371 ASP n 
1 372 LYS n 
1 373 LEU n 
1 374 ARG n 
1 375 PHE n 
1 376 ARG n 
1 377 GLN n 
1 378 HIS n 
1 379 MET n 
1 380 GLU n 
1 381 ASN n 
1 382 GLU n 
1 383 MET n 
1 384 ALA n 
1 385 HIS n 
1 386 TYR n 
1 387 ALA n 
1 388 CYS n 
1 389 ASP n 
1 390 CYS n 
1 391 TRP n 
1 392 ASP n 
1 393 ALA n 
1 394 GLU n 
1 395 SER n 
1 396 LYS n 
1 397 THR n 
1 398 SER n 
1 399 TYR n 
1 400 GLY n 
1 401 TRP n 
1 402 ILE n 
1 403 GLU n 
1 404 ILE n 
1 405 VAL n 
1 406 GLY n 
1 407 CYS n 
1 408 ALA n 
1 409 ASP n 
1 410 ARG n 
1 411 SER n 
1 412 CYS n 
1 413 TYR n 
1 414 ASP n 
1 415 LEU n 
1 416 SER n 
1 417 CYS n 
1 418 HIS n 
1 419 ALA n 
1 420 ARG n 
1 421 ALA n 
1 422 THR n 
1 423 LYS n 
1 424 VAL n 
1 425 PRO n 
1 426 LEU n 
1 427 VAL n 
1 428 ALA n 
1 429 GLU n 
1 430 LYS n 
1 431 PRO n 
1 432 LEU n 
1 433 LYS n 
1 434 GLU n 
1 435 PRO n 
1 436 LYS n 
1 437 THR n 
1 438 VAL n 
1 439 ASN n 
1 440 VAL n 
1 441 VAL n 
1 442 GLN n 
1 443 PHE n 
1 444 GLU n 
1 445 PRO n 
1 446 SER n 
1 447 LYS n 
1 448 GLY n 
1 449 ALA n 
1 450 ILE n 
1 451 GLY n 
1 452 LYS n 
1 453 ALA n 
1 454 TYR n 
1 455 LYS n 
1 456 LYS n 
1 457 ASP n 
1 458 ALA n 
1 459 LYS n 
1 460 LEU n 
1 461 VAL n 
1 462 MET n 
1 463 GLU n 
1 464 TYR n 
1 465 LEU n 
1 466 ALA n 
1 467 ILE n 
1 468 CYS n 
1 469 ASP n 
1 470 GLU n 
1 471 CYS n 
1 472 TYR n 
1 473 ILE n 
1 474 THR n 
1 475 GLU n 
1 476 MET n 
1 477 GLU n 
1 478 MET n 
1 479 LEU n 
1 480 LEU n 
1 481 ASN n 
1 482 GLU n 
1 483 LYS n 
1 484 GLY n 
1 485 GLU n 
1 486 PHE n 
1 487 THR n 
1 488 ILE n 
1 489 GLU n 
1 490 THR n 
1 491 GLU n 
1 492 GLY n 
1 493 LYS n 
1 494 THR n 
1 495 PHE n 
1 496 GLN n 
1 497 LEU n 
1 498 THR n 
1 499 LYS n 
1 500 ASP n 
1 501 MET n 
1 502 ILE n 
1 503 ASN n 
1 504 VAL n 
1 505 LYS n 
1 506 ARG n 
1 507 PHE n 
1 508 GLN n 
1 509 LYS n 
1 510 THR n 
1 511 LEU n 
1 512 TYR n 
1 513 VAL n 
1 514 GLU n 
1 515 GLU n 
1 516 VAL n 
1 517 VAL n 
1 518 PRO n 
1 519 ASN n 
1 520 VAL n 
1 521 ILE n 
1 522 GLU n 
1 523 PRO n 
1 524 SER n 
1 525 PHE n 
1 526 ARG n 
1 527 LEU n 
1 528 GLY n 
1 529 ARG n 
1 530 ILE n 
1 531 MET n 
1 532 TYR n 
1 533 THR n 
1 534 VAL n 
1 535 PHE n 
1 536 GLU n 
1 537 HIS n 
1 538 THR n 
1 539 PHE n 
1 540 HIS n 
1 541 VAL n 
1 542 ARG n 
1 543 GLU n 
1 544 GLY n 
1 545 ASP n 
1 546 GLU n 
1 547 GLN n 
1 548 ARG n 
1 549 THR n 
1 550 PHE n 
1 551 PHE n 
1 552 SER n 
1 553 PHE n 
1 554 PRO n 
1 555 ALA n 
1 556 VAL n 
1 557 VAL n 
1 558 ALA n 
1 559 PRO n 
1 560 PHE n 
1 561 LYS n 
1 562 CYS n 
1 563 SER n 
1 564 VAL n 
1 565 LEU n 
1 566 PRO n 
1 567 LEU n 
1 568 SER n 
1 569 GLN n 
1 570 ASN n 
1 571 GLN n 
1 572 GLU n 
1 573 PHE n 
1 574 MET n 
1 575 PRO n 
1 576 PHE n 
1 577 VAL n 
1 578 LYS n 
1 579 GLU n 
1 580 LEU n 
1 581 SER n 
1 582 GLU n 
1 583 ALA n 
1 584 LEU n 
1 585 THR n 
1 586 ARG n 
1 587 HIS n 
1 588 GLY n 
1 589 VAL n 
1 590 SER n 
1 591 HIS n 
1 592 LYS n 
1 593 VAL n 
1 594 ASP n 
1 595 ASP n 
1 596 SER n 
1 597 SER n 
1 598 GLY n 
1 599 SER n 
1 600 ILE n 
1 601 GLY n 
1 602 ARG n 
1 603 ARG n 
1 604 TYR n 
1 605 ALA n 
1 606 ARG n 
1 607 THR n 
1 608 ASP n 
1 609 GLU n 
1 610 ILE n 
1 611 GLY n 
1 612 VAL n 
1 613 ALA n 
1 614 PHE n 
1 615 GLY n 
1 616 VAL n 
1 617 THR n 
1 618 ILE n 
1 619 ASP n 
1 620 PHE n 
1 621 ASP n 
1 622 THR n 
1 623 VAL n 
1 624 ASN n 
1 625 LYS n 
1 626 THR n 
1 627 PRO n 
1 628 HIS n 
1 629 THR n 
1 630 ALA n 
1 631 THR n 
1 632 LEU n 
1 633 ARG n 
1 634 ASP n 
1 635 ARG n 
1 636 ASP n 
1 637 SER n 
1 638 MET n 
1 639 ARG n 
1 640 GLN n 
1 641 ILE n 
1 642 ARG n 
1 643 ALA n 
1 644 GLU n 
1 645 ILE n 
1 646 SER n 
1 647 GLU n 
1 648 LEU n 
1 649 PRO n 
1 650 SER n 
1 651 ILE n 
1 652 VAL n 
1 653 GLN n 
1 654 ASP n 
1 655 LEU n 
1 656 ALA n 
1 657 ASN n 
1 658 GLY n 
1 659 ASN n 
1 660 ILE n 
1 661 THR n 
1 662 TRP n 
1 663 ALA n 
1 664 ASP n 
1 665 VAL n 
1 666 GLU n 
1 667 ALA n 
1 668 ARG n 
1 669 TYR n 
1 670 PRO n 
1 671 LEU n 
1 672 PHE n 
1 673 GLU n 
1 674 GLY n 
1 675 GLN n 
1 676 GLU n 
1 677 THR n 
1 678 GLY n 
1 679 LYS n 
1 680 LYS n 
1 681 GLU n 
1 682 THR n 
1 683 ILE n 
1 684 GLU n 
1 685 GLU n 
1 686 LEU n 
1 687 GLU n 
1 688 HIS n 
1 689 HIS n 
1 690 HIS n 
1 691 HIS n 
1 692 HIS n 
1 693 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 GARS 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21-DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET21a(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SYG_HUMAN 
_struct_ref.pdbx_db_accession          P41250 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRA
DHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYG
WIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLL
NEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQ
IRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEE
;
_struct_ref.pdbx_align_begin           55 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2PMF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 685 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P41250 
_struct_ref_seq.db_align_beg                  55 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  739 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       685 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2PMF ARG A 526 ? UNP P41250 GLY 580 ENGINEERED         526 1 
1 2PMF LEU A 686 ? UNP P41250 ?   ?   'CLONING ARTIFACT' 686 2 
1 2PMF GLU A 687 ? UNP P41250 ?   ?   'CLONING ARTIFACT' 687 3 
1 2PMF HIS A 688 ? UNP P41250 ?   ?   'CLONING ARTIFACT' 688 4 
1 2PMF HIS A 689 ? UNP P41250 ?   ?   'CLONING ARTIFACT' 689 5 
1 2PMF HIS A 690 ? UNP P41250 ?   ?   'CLONING ARTIFACT' 690 6 
1 2PMF HIS A 691 ? UNP P41250 ?   ?   'CLONING ARTIFACT' 691 7 
1 2PMF HIS A 692 ? UNP P41250 ?   ?   'CLONING ARTIFACT' 692 8 
1 2PMF HIS A 693 ? UNP P41250 ?   ?   'CLONING ARTIFACT' 693 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ?                               'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2PMF 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.32 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   62.90 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 325 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-07-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
# 
_reflns.entry_id                     2PMF 
_reflns.d_resolution_high            2.850 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   25080 
_reflns.pdbx_Rmerge_I_obs            0.066 
_reflns.pdbx_netI_over_sigmaI        15.000 
_reflns.pdbx_chi_squared             1.021 
_reflns.pdbx_redundancy              13.800 
_reflns.percent_possible_obs         99.100 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.85 
_reflns_shell.d_res_low              2.95 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.370 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       1.090 
_reflns_shell.pdbx_redundancy        14.00 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2419 
_reflns_shell.percent_possible_all   98.50 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2PMF 
_refine.ls_d_res_high                            2.850 
_refine.ls_d_res_low                             29.240 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    98.860 
_refine.ls_number_reflns_obs                     24999 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.233 
_refine.ls_R_factor_R_work                       0.231 
_refine.ls_R_factor_R_free                       0.271 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1272 
_refine.B_iso_mean                               60.094 
_refine.aniso_B[1][1]                            -0.050 
_refine.aniso_B[2][2]                            -0.050 
_refine.aniso_B[3][3]                            0.110 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.917 
_refine.correlation_coeff_Fo_to_Fc_free          0.876 
_refine.pdbx_overall_ESU_R                       0.559 
_refine.pdbx_overall_ESU_R_Free                  0.338 
_refine.overall_SU_ML                            0.238 
_refine.overall_SU_B                             11.878 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'The native T.thermophilus GlyRS structure' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4144 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             202 
_refine_hist.number_atoms_total               4353 
_refine_hist.d_res_high                       2.850 
_refine_hist.d_res_low                        29.240 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         4242 0.003  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      5727 0.847  1.948  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   519  6.719  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   210  29.665 23.762 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   722  15.962 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   31   14.902 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           616  0.078  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     3260 0.002  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            2037 0.229  0.300  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          2860 0.326  0.500  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    347  0.199  0.500  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   64   0.200  0.300  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 6    0.335  0.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              2651 4.783  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             4180 7.074  4.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1764 3.341  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             1547 4.904  3.000  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.851 
_refine_ls_shell.d_res_low                        2.924 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               94.530 
_refine_ls_shell.number_reflns_R_work             1614 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.288 
_refine_ls_shell.R_factor_R_free                  0.398 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             96 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                1710 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2PMF 
_struct.title                     'The crystal structure of a human glycyl-tRNA synthetase mutant' 
_struct.pdbx_descriptor           'Glycyl-tRNA synthetase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2PMF 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'classIIa aminoacyl-tRNA synthetase, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;The other monomer of the biological assembly is generated 
by the operation:  y,x+1,-z
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 66  ? ARG A 77  ? ASP A 66  ARG A 77  1 ? 12 
HELX_P HELX_P2  2  PHE A 84  ? GLY A 88  ? PHE A 84  GLY A 88  5 ? 5  
HELX_P HELX_P3  3  GLY A 97  ? PHE A 115 ? GLY A 97  PHE A 115 1 ? 19 
HELX_P HELX_P4  4  PHE A 115 ? GLN A 120 ? PHE A 115 GLN A 120 1 ? 6  
HELX_P HELX_P5  5  GLU A 132 ? THR A 137 ? GLU A 132 THR A 137 1 ? 6  
HELX_P HELX_P6  6  ALA A 160 ? SER A 173 ? ALA A 160 SER A 173 1 ? 14 
HELX_P HELX_P7  7  SER A 178 ? ALA A 190 ? SER A 178 ALA A 190 1 ? 13 
HELX_P HELX_P8  8  GLN A 191 ? TYR A 195 ? GLN A 191 TYR A 195 5 ? 5  
HELX_P HELX_P9  9  GLY A 196 ? TYR A 207 ? GLY A 196 TYR A 207 1 ? 12 
HELX_P HELX_P10 10 THR A 246 ? LEU A 252 ? THR A 246 LEU A 252 1 ? 7  
HELX_P HELX_P11 11 ASN A 253 ? ASN A 261 ? ASN A 253 ASN A 261 1 ? 9  
HELX_P HELX_P12 12 LYS A 310 ? VAL A 314 ? LYS A 310 VAL A 314 5 ? 5  
HELX_P HELX_P13 13 SER A 323 ? SER A 329 ? SER A 323 SER A 329 1 ? 7  
HELX_P HELX_P14 14 LEU A 338 ? GLN A 344 ? LEU A 338 GLN A 344 1 ? 7  
HELX_P HELX_P15 15 ASN A 349 ? GLY A 367 ? ASN A 349 GLY A 367 1 ? 19 
HELX_P HELX_P16 16 SER A 369 ? ASP A 371 ? SER A 369 ASP A 371 5 ? 3  
HELX_P HELX_P17 17 ASP A 414 ? ARG A 420 ? ASP A 414 ARG A 420 1 ? 7  
HELX_P HELX_P18 18 LEU A 527 ? THR A 538 ? LEU A 527 THR A 538 1 ? 12 
HELX_P HELX_P19 19 PHE A 573 ? HIS A 587 ? PHE A 573 HIS A 587 1 ? 15 
HELX_P HELX_P20 20 SER A 599 ? ILE A 610 ? SER A 599 ILE A 610 1 ? 12 
HELX_P HELX_P21 21 ASP A 619 ? LYS A 625 ? ASP A 619 LYS A 625 1 ? 7  
HELX_P HELX_P22 22 GLU A 647 ? ASN A 657 ? GLU A 647 ASN A 657 1 ? 11 
HELX_P HELX_P23 23 THR A 661 ? TYR A 669 ? THR A 661 TYR A 669 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          THR 
_struct_mon_prot_cis.label_seq_id           214 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           THR 
_struct_mon_prot_cis.auth_seq_id            214 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   GLY 
_struct_mon_prot_cis.pdbx_label_seq_id_2    215 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    GLY 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     215 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.72 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
C ? 3 ? 
D ? 3 ? 
E ? 2 ? 
F ? 2 ? 
G ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? parallel      
B 8 9 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 80  ? GLN A 82  ? TYR A 80  GLN A 82  
A 2 TYR A 94  ? PHE A 96  ? TYR A 94  PHE A 96  
B 1 LEU A 122 ? GLU A 123 ? LEU A 122 GLU A 123 
B 2 PRO A 266 ? PHE A 276 ? PRO A 266 PHE A 276 
B 3 GLU A 291 ? VAL A 301 ? GLU A 291 VAL A 301 
B 4 ASN A 519 ? ARG A 526 ? ASN A 519 ARG A 526 
B 5 GLY A 400 ? ARG A 410 ? GLY A 400 ARG A 410 
B 6 ASP A 389 ? THR A 397 ? ASP A 389 THR A 397 
B 7 LEU A 373 ? GLN A 377 ? LEU A 373 GLN A 377 
B 8 HIS A 318 ? TYR A 322 ? HIS A 318 TYR A 322 
B 9 ARG A 334 ? ARG A 337 ? ARG A 334 ARG A 337 
C 1 LEU A 129 ? PRO A 131 ? LEU A 129 PRO A 131 
C 2 PRO A 239 ? LEU A 242 ? PRO A 239 LEU A 242 
C 3 LYS A 229 ? PHE A 231 ? LYS A 229 PHE A 231 
D 1 PHE A 158 ? ARG A 159 ? PHE A 158 ARG A 159 
D 2 ALA A 145 ? VAL A 149 ? ALA A 145 VAL A 149 
D 3 VAL A 222 ? ASN A 225 ? VAL A 222 ASN A 225 
E 1 GLN A 508 ? THR A 510 ? GLN A 508 THR A 510 
E 2 GLU A 514 ? VAL A 516 ? GLU A 514 VAL A 516 
F 1 PHE A 539 ? VAL A 541 ? PHE A 539 VAL A 541 
F 2 THR A 549 ? PHE A 551 ? THR A 549 PHE A 551 
G 1 HIS A 591 ? VAL A 593 ? HIS A 591 VAL A 593 
G 2 CYS A 562 ? PRO A 566 ? CYS A 562 PRO A 566 
G 3 PHE A 614 ? ILE A 618 ? PHE A 614 ILE A 618 
G 4 THR A 629 ? ASP A 634 ? THR A 629 ASP A 634 
G 5 GLN A 640 ? GLU A 644 ? GLN A 640 GLU A 644 
G 6 LEU A 671 ? PHE A 672 ? LEU A 671 PHE A 672 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP A 81  ? N ASP A 81  O ASP A 95  ? O ASP A 95  
B 1 2 N LEU A 122 ? N LEU A 122 O ALA A 268 ? O ALA A 268 
B 2 3 N ALA A 269 ? N ALA A 269 O GLU A 298 ? O GLU A 298 
B 3 4 N ALA A 295 ? N ALA A 295 O PHE A 525 ? O PHE A 525 
B 4 5 O SER A 524 ? O SER A 524 N GLY A 406 ? N GLY A 406 
B 5 6 O VAL A 405 ? O VAL A 405 N ALA A 393 ? N ALA A 393 
B 6 7 O ASP A 392 ? O ASP A 392 N ARG A 376 ? N ARG A 376 
B 7 8 O PHE A 375 ? O PHE A 375 N TYR A 322 ? N TYR A 322 
B 8 9 N LEU A 321 ? N LEU A 321 O ARG A 334 ? O ARG A 334 
C 1 2 N THR A 130 ? N THR A 130 O TYR A 241 ? O TYR A 241 
C 2 3 O GLY A 240 ? O GLY A 240 N THR A 230 ? N THR A 230 
D 1 2 O PHE A 158 ? O PHE A 158 N VAL A 149 ? N VAL A 149 
D 2 3 N MET A 148 ? N MET A 148 O VAL A 222 ? O VAL A 222 
E 1 2 N GLN A 508 ? N GLN A 508 O VAL A 516 ? O VAL A 516 
F 1 2 N HIS A 540 ? N HIS A 540 O PHE A 550 ? O PHE A 550 
G 1 2 O LYS A 592 ? O LYS A 592 N CYS A 562 ? N CYS A 562 
G 2 3 N LEU A 565 ? N LEU A 565 O VAL A 616 ? O VAL A 616 
G 3 4 N GLY A 615 ? N GLY A 615 O ARG A 633 ? O ARG A 633 
G 4 5 N LEU A 632 ? N LEU A 632 O ILE A 641 ? O ILE A 641 
G 5 6 N GLN A 640 ? N GLN A 640 O PHE A 672 ? O PHE A 672 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL A 901'  
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 801' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ARG A 526 ? ARG A 526  . ? 1_555 ? 
2  AC1 4 GLY A 528 ? GLY A 528  . ? 1_555 ? 
3  AC1 4 ARG A 529 ? ARG A 529  . ? 1_555 ? 
4  AC1 4 HOH D .   ? HOH A 1103 . ? 1_555 ? 
5  AC2 7 ASP A 621 ? ASP A 621  . ? 1_555 ? 
6  AC2 7 THR A 622 ? THR A 622  . ? 1_555 ? 
7  AC2 7 LYS A 625 ? LYS A 625  . ? 1_555 ? 
8  AC2 7 PRO A 627 ? PRO A 627  . ? 1_555 ? 
9  AC2 7 THR A 629 ? THR A 629  . ? 1_555 ? 
10 AC2 7 ARG A 642 ? ARG A 642  . ? 1_555 ? 
11 AC2 7 HOH D .   ? HOH A 980  . ? 1_555 ? 
# 
_atom_sites.entry_id                    2PMF 
_atom_sites.fract_transf_matrix[1][1]   0.010939 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010939 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004052 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1 63  ? -21.016 30.108  -3.375  1.00 127.17 ? 63   ASP A N   1 
ATOM   2    C  CA  . ASP A 1 63  ? -21.062 28.860  -2.559  1.00 126.43 ? 63   ASP A CA  1 
ATOM   3    C  C   . ASP A 1 63  ? -19.760 28.066  -2.665  1.00 123.67 ? 63   ASP A C   1 
ATOM   4    O  O   . ASP A 1 63  ? -18.700 28.533  -2.241  1.00 121.65 ? 63   ASP A O   1 
ATOM   5    C  CB  . ASP A 1 63  ? -22.252 27.999  -2.970  1.00 126.74 ? 63   ASP A CB  1 
ATOM   6    N  N   . ILE A 1 64  ? -19.847 26.870  -3.241  1.00 117.72 ? 64   ILE A N   1 
ATOM   7    C  CA  . ILE A 1 64  ? -18.722 25.938  -3.264  1.00 109.22 ? 64   ILE A CA  1 
ATOM   8    C  C   . ILE A 1 64  ? -17.845 26.065  -4.509  1.00 102.83 ? 64   ILE A C   1 
ATOM   9    O  O   . ILE A 1 64  ? -17.005 26.961  -4.597  1.00 107.34 ? 64   ILE A O   1 
ATOM   10   C  CB  . ILE A 1 64  ? -19.221 24.505  -3.107  1.00 109.03 ? 64   ILE A CB  1 
ATOM   11   N  N   . VAL A 1 65  ? -18.043 25.161  -5.464  1.00 91.79  ? 65   VAL A N   1 
ATOM   12   C  CA  . VAL A 1 65  ? -17.195 25.102  -6.649  1.00 80.72  ? 65   VAL A CA  1 
ATOM   13   C  C   . VAL A 1 65  ? -17.943 24.500  -7.837  1.00 78.96  ? 65   VAL A C   1 
ATOM   14   O  O   . VAL A 1 65  ? -18.821 23.653  -7.666  1.00 80.52  ? 65   VAL A O   1 
ATOM   15   C  CB  . VAL A 1 65  ? -15.906 24.283  -6.373  1.00 76.46  ? 65   VAL A CB  1 
ATOM   16   C  CG1 . VAL A 1 65  ? -16.238 22.816  -6.128  1.00 71.56  ? 65   VAL A CG1 1 
ATOM   17   C  CG2 . VAL A 1 65  ? -14.914 24.428  -7.518  1.00 75.24  ? 65   VAL A CG2 1 
ATOM   18   N  N   . ASP A 1 66  ? -17.600 24.954  -9.039  1.00 71.84  ? 66   ASP A N   1 
ATOM   19   C  CA  . ASP A 1 66  ? -18.148 24.378  -10.259 1.00 68.42  ? 66   ASP A CA  1 
ATOM   20   C  C   . ASP A 1 66  ? -17.537 22.995  -10.455 1.00 63.61  ? 66   ASP A C   1 
ATOM   21   O  O   . ASP A 1 66  ? -16.644 22.812  -11.281 1.00 69.60  ? 66   ASP A O   1 
ATOM   22   C  CB  . ASP A 1 66  ? -17.835 25.279  -11.456 1.00 72.01  ? 66   ASP A CB  1 
ATOM   23   C  CG  . ASP A 1 66  ? -18.677 24.950  -12.676 1.00 74.41  ? 66   ASP A CG  1 
ATOM   24   O  OD1 . ASP A 1 66  ? -19.436 23.958  -12.632 1.00 70.82  ? 66   ASP A OD1 1 
ATOM   25   O  OD2 . ASP A 1 66  ? -18.579 25.687  -13.680 1.00 74.50  ? 66   ASP A OD2 1 
ATOM   26   N  N   . ARG A 1 67  ? -18.023 22.024  -9.685  1.00 53.03  ? 67   ARG A N   1 
ATOM   27   C  CA  . ARG A 1 67  ? -17.418 20.695  -9.656  1.00 57.20  ? 67   ARG A CA  1 
ATOM   28   C  C   . ARG A 1 67  ? -17.526 19.976  -10.996 1.00 61.09  ? 67   ARG A C   1 
ATOM   29   O  O   . ARG A 1 67  ? -16.700 19.121  -11.313 1.00 68.82  ? 67   ARG A O   1 
ATOM   30   C  CB  . ARG A 1 67  ? -18.019 19.833  -8.540  1.00 51.15  ? 67   ARG A CB  1 
ATOM   31   C  CG  . ARG A 1 67  ? -19.210 18.993  -8.969  1.00 54.28  ? 67   ARG A CG  1 
ATOM   32   C  CD  . ARG A 1 67  ? -19.180 17.626  -8.305  1.00 57.37  ? 67   ARG A CD  1 
ATOM   33   N  NE  . ARG A 1 67  ? -19.649 17.662  -6.924  1.00 59.58  ? 67   ARG A NE  1 
ATOM   34   C  CZ  . ARG A 1 67  ? -20.821 17.181  -6.522  1.00 63.74  ? 67   ARG A CZ  1 
ATOM   35   N  NH1 . ARG A 1 67  ? -21.645 16.620  -7.397  1.00 67.66  ? 67   ARG A NH1 1 
ATOM   36   N  NH2 . ARG A 1 67  ? -21.168 17.255  -5.245  1.00 66.23  ? 67   ARG A NH2 1 
ATOM   37   N  N   . ALA A 1 68  ? -18.544 20.324  -11.777 1.00 63.88  ? 68   ALA A N   1 
ATOM   38   C  CA  . ALA A 1 68  ? -18.716 19.751  -13.108 1.00 57.34  ? 68   ALA A CA  1 
ATOM   39   C  C   . ALA A 1 68  ? -17.507 20.081  -13.976 1.00 53.66  ? 68   ALA A C   1 
ATOM   40   O  O   . ALA A 1 68  ? -17.045 19.247  -14.753 1.00 60.41  ? 68   ALA A O   1 
ATOM   41   C  CB  . ALA A 1 68  ? -19.993 20.266  -13.750 1.00 61.27  ? 68   ALA A CB  1 
ATOM   42   N  N   . LYS A 1 69  ? -17.000 21.302  -13.833 1.00 56.17  ? 69   LYS A N   1 
ATOM   43   C  CA  . LYS A 1 69  ? -15.782 21.716  -14.518 1.00 56.11  ? 69   LYS A CA  1 
ATOM   44   C  C   . LYS A 1 69  ? -14.560 21.037  -13.916 1.00 56.68  ? 69   LYS A C   1 
ATOM   45   O  O   . LYS A 1 69  ? -13.724 20.494  -14.637 1.00 62.09  ? 69   LYS A O   1 
ATOM   46   C  CB  . LYS A 1 69  ? -15.606 23.232  -14.443 1.00 58.45  ? 69   LYS A CB  1 
ATOM   47   C  CG  . LYS A 1 69  ? -16.128 23.986  -15.647 1.00 67.65  ? 69   LYS A CG  1 
ATOM   48   C  CD  . LYS A 1 69  ? -15.606 25.410  -15.646 1.00 71.07  ? 69   LYS A CD  1 
ATOM   49   C  CE  . LYS A 1 69  ? -15.912 26.116  -16.952 1.00 74.14  ? 69   LYS A CE  1 
ATOM   50   N  NZ  . LYS A 1 69  ? -15.392 27.508  -16.940 1.00 78.69  ? 69   LYS A NZ  1 
ATOM   51   N  N   . MET A 1 70  ? -14.462 21.081  -12.591 1.00 50.66  ? 70   MET A N   1 
ATOM   52   C  CA  . MET A 1 70  ? -13.331 20.498  -11.884 1.00 46.88  ? 70   MET A CA  1 
ATOM   53   C  C   . MET A 1 70  ? -13.153 19.029  -12.250 1.00 51.96  ? 70   MET A C   1 
ATOM   54   O  O   . MET A 1 70  ? -12.057 18.601  -12.612 1.00 58.15  ? 70   MET A O   1 
ATOM   55   C  CB  . MET A 1 70  ? -13.510 20.645  -10.372 1.00 45.70  ? 70   MET A CB  1 
ATOM   56   C  CG  . MET A 1 70  ? -12.289 20.236  -9.565  1.00 43.01  ? 70   MET A CG  1 
ATOM   57   S  SD  . MET A 1 70  ? -12.653 20.028  -7.813  1.00 41.62  ? 70   MET A SD  1 
ATOM   58   C  CE  . MET A 1 70  ? -13.807 18.660  -7.870  1.00 33.92  ? 70   MET A CE  1 
ATOM   59   N  N   . GLU A 1 71  ? -14.238 18.264  -12.161 1.00 49.26  ? 71   GLU A N   1 
ATOM   60   C  CA  . GLU A 1 71  ? -14.208 16.840  -12.483 1.00 53.39  ? 71   GLU A CA  1 
ATOM   61   C  C   . GLU A 1 71  ? -13.734 16.591  -13.911 1.00 51.98  ? 71   GLU A C   1 
ATOM   62   O  O   . GLU A 1 71  ? -12.981 15.651  -14.165 1.00 56.30  ? 71   GLU A O   1 
ATOM   63   C  CB  . GLU A 1 71  ? -15.584 16.206  -12.265 1.00 51.53  ? 71   GLU A CB  1 
ATOM   64   C  CG  . GLU A 1 71  ? -15.962 16.027  -10.803 1.00 55.51  ? 71   GLU A CG  1 
ATOM   65   C  CD  . GLU A 1 71  ? -17.360 15.468  -10.625 1.00 58.31  ? 71   GLU A CD  1 
ATOM   66   O  OE1 . GLU A 1 71  ? -18.177 15.593  -11.562 1.00 61.25  ? 71   GLU A OE1 1 
ATOM   67   O  OE2 . GLU A 1 71  ? -17.645 14.904  -9.547  1.00 59.39  ? 71   GLU A OE2 1 
ATOM   68   N  N   . ASP A 1 72  ? -14.176 17.436  -14.837 1.00 53.74  ? 72   ASP A N   1 
ATOM   69   C  CA  . ASP A 1 72  ? -13.763 17.328  -16.232 1.00 58.59  ? 72   ASP A CA  1 
ATOM   70   C  C   . ASP A 1 72  ? -12.252 17.488  -16.363 1.00 53.91  ? 72   ASP A C   1 
ATOM   71   O  O   . ASP A 1 72  ? -11.600 16.728  -17.077 1.00 57.63  ? 72   ASP A O   1 
ATOM   72   C  CB  . ASP A 1 72  ? -14.479 18.372  -17.092 1.00 65.43  ? 72   ASP A CB  1 
ATOM   73   C  CG  . ASP A 1 72  ? -14.037 18.333  -18.544 1.00 70.60  ? 72   ASP A CG  1 
ATOM   74   O  OD1 . ASP A 1 72  ? -13.724 19.408  -19.098 1.00 72.90  ? 72   ASP A OD1 1 
ATOM   75   O  OD2 . ASP A 1 72  ? -13.994 17.229  -19.129 1.00 70.49  ? 72   ASP A OD2 1 
ATOM   76   N  N   . THR A 1 73  ? -11.703 18.478  -15.666 1.00 44.68  ? 73   THR A N   1 
ATOM   77   C  CA  . THR A 1 73  ? -10.267 18.732  -15.682 1.00 40.98  ? 73   THR A CA  1 
ATOM   78   C  C   . THR A 1 73  ? -9.499  17.606  -14.995 1.00 47.80  ? 73   THR A C   1 
ATOM   79   O  O   . THR A 1 73  ? -8.424  17.209  -15.447 1.00 43.58  ? 73   THR A O   1 
ATOM   80   C  CB  . THR A 1 73  ? -9.926  20.068  -14.996 1.00 39.68  ? 73   THR A CB  1 
ATOM   81   O  OG1 . THR A 1 73  ? -10.549 21.145  -15.707 1.00 46.42  ? 73   THR A OG1 1 
ATOM   82   C  CG2 . THR A 1 73  ? -8.422  20.287  -14.970 1.00 39.20  ? 73   THR A CG2 1 
ATOM   83   N  N   . LEU A 1 74  ? -10.059 17.094  -13.903 1.00 40.60  ? 74   LEU A N   1 
ATOM   84   C  CA  . LEU A 1 74  ? -9.431  16.014  -13.151 1.00 38.40  ? 74   LEU A CA  1 
ATOM   85   C  C   . LEU A 1 74  ? -9.371  14.729  -13.969 1.00 39.05  ? 74   LEU A C   1 
ATOM   86   O  O   . LEU A 1 74  ? -8.426  13.950  -13.848 1.00 40.64  ? 74   LEU A O   1 
ATOM   87   C  CB  . LEU A 1 74  ? -10.176 15.767  -11.838 1.00 41.60  ? 74   LEU A CB  1 
ATOM   88   C  CG  . LEU A 1 74  ? -10.030 16.828  -10.744 1.00 40.67  ? 74   LEU A CG  1 
ATOM   89   C  CD1 . LEU A 1 74  ? -11.027 16.581  -9.623  1.00 41.51  ? 74   LEU A CD1 1 
ATOM   90   C  CD2 . LEU A 1 74  ? -8.609  16.860  -10.205 1.00 41.17  ? 74   LEU A CD2 1 
ATOM   91   N  N   . LYS A 1 75  ? -10.385 14.513  -14.800 1.00 45.18  ? 75   LYS A N   1 
ATOM   92   C  CA  . LYS A 1 75  ? -10.453 13.317  -15.631 1.00 48.64  ? 75   LYS A CA  1 
ATOM   93   C  C   . LYS A 1 75  ? -9.603  13.479  -16.887 1.00 48.11  ? 75   LYS A C   1 
ATOM   94   O  O   . LYS A 1 75  ? -8.878  12.564  -17.282 1.00 41.89  ? 75   LYS A O   1 
ATOM   95   C  CB  . LYS A 1 75  ? -11.903 13.012  -16.010 1.00 53.75  ? 75   LYS A CB  1 
ATOM   96   C  CG  . LYS A 1 75  ? -12.090 11.705  -16.761 1.00 63.89  ? 75   LYS A CG  1 
ATOM   97   C  CD  . LYS A 1 75  ? -13.554 11.455  -17.083 1.00 71.15  ? 75   LYS A CD  1 
ATOM   98   C  CE  . LYS A 1 75  ? -13.730 10.173  -17.881 1.00 79.41  ? 75   LYS A CE  1 
ATOM   99   N  NZ  . LYS A 1 75  ? -15.156 9.927   -18.234 1.00 84.90  ? 75   LYS A NZ  1 
ATOM   100  N  N   . ARG A 1 76  ? -9.695  14.653  -17.503 1.00 45.53  ? 76   ARG A N   1 
ATOM   101  C  CA  . ARG A 1 76  ? -8.970  14.942  -18.734 1.00 40.22  ? 76   ARG A CA  1 
ATOM   102  C  C   . ARG A 1 76  ? -7.458  14.915  -18.516 1.00 41.59  ? 76   ARG A C   1 
ATOM   103  O  O   . ARG A 1 76  ? -6.715  14.385  -19.342 1.00 41.22  ? 76   ARG A O   1 
ATOM   104  C  CB  . ARG A 1 76  ? -9.415  16.294  -19.300 1.00 50.00  ? 76   ARG A CB  1 
ATOM   105  C  CG  . ARG A 1 76  ? -8.831  16.642  -20.657 1.00 59.40  ? 76   ARG A CG  1 
ATOM   106  C  CD  . ARG A 1 76  ? -9.599  17.786  -21.306 1.00 60.09  ? 76   ARG A CD  1 
ATOM   107  N  NE  . ARG A 1 76  ? -9.964  18.823  -20.344 1.00 61.91  ? 76   ARG A NE  1 
ATOM   108  C  CZ  . ARG A 1 76  ? -9.156  19.806  -19.958 1.00 62.99  ? 76   ARG A CZ  1 
ATOM   109  N  NH1 . ARG A 1 76  ? -7.927  19.893  -20.449 1.00 62.51  ? 76   ARG A NH1 1 
ATOM   110  N  NH2 . ARG A 1 76  ? -9.579  20.702  -19.076 1.00 58.49  ? 76   ARG A NH2 1 
ATOM   111  N  N   . ARG A 1 77  ? -7.008  15.481  -17.400 1.00 46.30  ? 77   ARG A N   1 
ATOM   112  C  CA  . ARG A 1 77  ? -5.586  15.485  -17.066 1.00 42.45  ? 77   ARG A CA  1 
ATOM   113  C  C   . ARG A 1 77  ? -5.170  14.211  -16.340 1.00 43.09  ? 77   ARG A C   1 
ATOM   114  O  O   . ARG A 1 77  ? -3.988  13.999  -16.066 1.00 45.93  ? 77   ARG A O   1 
ATOM   115  C  CB  . ARG A 1 77  ? -5.226  16.711  -16.229 1.00 34.36  ? 77   ARG A CB  1 
ATOM   116  C  CG  . ARG A 1 77  ? -5.112  17.990  -17.034 1.00 36.94  ? 77   ARG A CG  1 
ATOM   117  C  CD  . ARG A 1 77  ? -4.438  17.729  -18.369 1.00 34.31  ? 77   ARG A CD  1 
ATOM   118  N  NE  . ARG A 1 77  ? -3.515  18.800  -18.727 1.00 39.40  ? 77   ARG A NE  1 
ATOM   119  C  CZ  . ARG A 1 77  ? -2.198  18.730  -18.564 1.00 43.61  ? 77   ARG A CZ  1 
ATOM   120  N  NH1 . ARG A 1 77  ? -1.645  17.636  -18.058 1.00 47.19  ? 77   ARG A NH1 1 
ATOM   121  N  NH2 . ARG A 1 77  ? -1.429  19.750  -18.914 1.00 52.67  ? 77   ARG A NH2 1 
ATOM   122  N  N   . PHE A 1 78  ? -6.154  13.373  -16.031 1.00 45.86  ? 78   PHE A N   1 
ATOM   123  C  CA  . PHE A 1 78  ? -5.917  12.070  -15.417 1.00 46.14  ? 78   PHE A CA  1 
ATOM   124  C  C   . PHE A 1 78  ? -5.247  12.161  -14.045 1.00 43.49  ? 78   PHE A C   1 
ATOM   125  O  O   . PHE A 1 78  ? -4.233  11.512  -13.792 1.00 49.09  ? 78   PHE A O   1 
ATOM   126  C  CB  . PHE A 1 78  ? -5.120  11.162  -16.365 1.00 39.93  ? 78   PHE A CB  1 
ATOM   127  C  CG  . PHE A 1 78  ? -5.112  9.713   -15.962 1.00 42.81  ? 78   PHE A CG  1 
ATOM   128  C  CD1 . PHE A 1 78  ? -4.063  8.885   -16.330 1.00 42.09  ? 78   PHE A CD1 1 
ATOM   129  C  CD2 . PHE A 1 78  ? -6.146  9.180   -15.206 1.00 42.52  ? 78   PHE A CD2 1 
ATOM   130  C  CE1 . PHE A 1 78  ? -4.051  7.550   -15.963 1.00 42.29  ? 78   PHE A CE1 1 
ATOM   131  C  CE2 . PHE A 1 78  ? -6.138  7.847   -14.832 1.00 42.61  ? 78   PHE A CE2 1 
ATOM   132  C  CZ  . PHE A 1 78  ? -5.089  7.031   -15.211 1.00 44.23  ? 78   PHE A CZ  1 
ATOM   133  N  N   . PHE A 1 79  ? -5.816  12.984  -13.168 1.00 46.11  ? 79   PHE A N   1 
ATOM   134  C  CA  . PHE A 1 79  ? -5.438  12.979  -11.763 1.00 35.93  ? 79   PHE A CA  1 
ATOM   135  C  C   . PHE A 1 79  ? -5.885  11.640  -11.195 1.00 37.57  ? 79   PHE A C   1 
ATOM   136  O  O   . PHE A 1 79  ? -5.108  10.913  -10.575 1.00 32.44  ? 79   PHE A O   1 
ATOM   137  C  CB  . PHE A 1 79  ? -6.129  14.116  -11.012 1.00 28.49  ? 79   PHE A CB  1 
ATOM   138  C  CG  . PHE A 1 79  ? -5.428  15.439  -11.128 1.00 32.16  ? 79   PHE A CG  1 
ATOM   139  C  CD1 . PHE A 1 79  ? -4.617  15.899  -10.101 1.00 34.28  ? 79   PHE A CD1 1 
ATOM   140  C  CD2 . PHE A 1 79  ? -5.582  16.226  -12.258 1.00 27.32  ? 79   PHE A CD2 1 
ATOM   141  C  CE1 . PHE A 1 79  ? -3.971  17.119  -10.198 1.00 32.46  ? 79   PHE A CE1 1 
ATOM   142  C  CE2 . PHE A 1 79  ? -4.937  17.448  -12.364 1.00 29.41  ? 79   PHE A CE2 1 
ATOM   143  C  CZ  . PHE A 1 79  ? -4.131  17.895  -11.332 1.00 32.40  ? 79   PHE A CZ  1 
ATOM   144  N  N   . TYR A 1 80  ? -7.155  11.328  -11.424 1.00 37.72  ? 80   TYR A N   1 
ATOM   145  C  CA  . TYR A 1 80  ? -7.722  10.038  -11.070 1.00 40.63  ? 80   TYR A CA  1 
ATOM   146  C  C   . TYR A 1 80  ? -8.912  9.757   -11.976 1.00 45.24  ? 80   TYR A C   1 
ATOM   147  O  O   . TYR A 1 80  ? -9.478  10.675  -12.572 1.00 50.01  ? 80   TYR A O   1 
ATOM   148  C  CB  . TYR A 1 80  ? -8.145  10.008  -9.599  1.00 44.90  ? 80   TYR A CB  1 
ATOM   149  C  CG  . TYR A 1 80  ? -9.245  10.984  -9.242  1.00 41.45  ? 80   TYR A CG  1 
ATOM   150  C  CD1 . TYR A 1 80  ? -10.576 10.583  -9.218  1.00 38.24  ? 80   TYR A CD1 1 
ATOM   151  C  CD2 . TYR A 1 80  ? -8.953  12.304  -8.921  1.00 39.50  ? 80   TYR A CD2 1 
ATOM   152  C  CE1 . TYR A 1 80  ? -11.585 11.470  -8.891  1.00 39.86  ? 80   TYR A CE1 1 
ATOM   153  C  CE2 . TYR A 1 80  ? -9.955  13.199  -8.592  1.00 41.78  ? 80   TYR A CE2 1 
ATOM   154  C  CZ  . TYR A 1 80  ? -11.269 12.777  -8.578  1.00 43.87  ? 80   TYR A CZ  1 
ATOM   155  O  OH  . TYR A 1 80  ? -12.268 13.664  -8.250  1.00 45.65  ? 80   TYR A OH  1 
ATOM   156  N  N   . ASP A 1 81  ? -9.286  8.487   -12.085 1.00 48.42  ? 81   ASP A N   1 
ATOM   157  C  CA  . ASP A 1 81  ? -10.414 8.101   -12.919 1.00 47.32  ? 81   ASP A CA  1 
ATOM   158  C  C   . ASP A 1 81  ? -11.008 6.780   -12.445 1.00 50.40  ? 81   ASP A C   1 
ATOM   159  O  O   . ASP A 1 81  ? -10.415 6.080   -11.623 1.00 46.17  ? 81   ASP A O   1 
ATOM   160  C  CB  . ASP A 1 81  ? -9.986  8.006   -14.386 1.00 60.13  ? 81   ASP A CB  1 
ATOM   161  C  CG  . ASP A 1 81  ? -11.139 8.232   -15.350 1.00 64.70  ? 81   ASP A CG  1 
ATOM   162  O  OD1 . ASP A 1 81  ? -12.310 8.109   -14.931 1.00 64.14  ? 81   ASP A OD1 1 
ATOM   163  O  OD2 . ASP A 1 81  ? -10.872 8.530   -16.533 1.00 66.17  ? 81   ASP A OD2 1 
ATOM   164  N  N   . GLN A 1 82  ? -12.183 6.451   -12.971 1.00 54.64  ? 82   GLN A N   1 
ATOM   165  C  CA  . GLN A 1 82  ? -12.910 5.249   -12.580 1.00 53.60  ? 82   GLN A CA  1 
ATOM   166  C  C   . GLN A 1 82  ? -12.113 3.984   -12.876 1.00 51.99  ? 82   GLN A C   1 
ATOM   167  O  O   . GLN A 1 82  ? -11.622 3.794   -13.989 1.00 61.69  ? 82   GLN A O   1 
ATOM   168  C  CB  . GLN A 1 82  ? -14.255 5.199   -13.304 1.00 65.47  ? 82   GLN A CB  1 
ATOM   169  C  CG  . GLN A 1 82  ? -15.127 4.014   -12.934 1.00 71.90  ? 82   GLN A CG  1 
ATOM   170  C  CD  . GLN A 1 82  ? -16.359 3.912   -13.810 1.00 76.43  ? 82   GLN A CD  1 
ATOM   171  O  OE1 . GLN A 1 82  ? -16.311 4.204   -15.006 1.00 77.69  ? 82   GLN A OE1 1 
ATOM   172  N  NE2 . GLN A 1 82  ? -17.472 3.495   -13.219 1.00 79.31  ? 82   GLN A NE2 1 
ATOM   173  N  N   . ALA A 1 83  ? -11.988 3.123   -11.873 1.00 52.19  ? 83   ALA A N   1 
ATOM   174  C  CA  . ALA A 1 83  ? -11.275 1.862   -12.030 1.00 53.08  ? 83   ALA A CA  1 
ATOM   175  C  C   . ALA A 1 83  ? -12.078 0.893   -12.890 1.00 54.96  ? 83   ALA A C   1 
ATOM   176  O  O   . ALA A 1 83  ? -13.290 0.756   -12.717 1.00 52.40  ? 83   ALA A O   1 
ATOM   177  C  CB  . ALA A 1 83  ? -10.975 1.247   -10.673 1.00 41.29  ? 83   ALA A CB  1 
ATOM   178  N  N   . PHE A 1 84  ? -11.391 0.228   -13.815 1.00 51.46  ? 84   PHE A N   1 
ATOM   179  C  CA  . PHE A 1 84  ? -12.018 -0.737  -14.717 1.00 50.79  ? 84   PHE A CA  1 
ATOM   180  C  C   . PHE A 1 84  ? -13.091 -0.084  -15.584 1.00 57.55  ? 84   PHE A C   1 
ATOM   181  O  O   . PHE A 1 84  ? -14.148 -0.669  -15.824 1.00 54.97  ? 84   PHE A O   1 
ATOM   182  C  CB  . PHE A 1 84  ? -12.610 -1.911  -13.931 1.00 45.44  ? 84   PHE A CB  1 
ATOM   183  C  CG  . PHE A 1 84  ? -11.684 -2.470  -12.890 1.00 43.72  ? 84   PHE A CG  1 
ATOM   184  C  CD1 . PHE A 1 84  ? -11.893 -2.206  -11.546 1.00 45.93  ? 84   PHE A CD1 1 
ATOM   185  C  CD2 . PHE A 1 84  ? -10.600 -3.252  -13.256 1.00 41.44  ? 84   PHE A CD2 1 
ATOM   186  C  CE1 . PHE A 1 84  ? -11.041 -2.715  -10.585 1.00 46.09  ? 84   PHE A CE1 1 
ATOM   187  C  CE2 . PHE A 1 84  ? -9.744  -3.764  -12.299 1.00 44.83  ? 84   PHE A CE2 1 
ATOM   188  C  CZ  . PHE A 1 84  ? -9.964  -3.494  -10.962 1.00 46.31  ? 84   PHE A CZ  1 
ATOM   189  N  N   . ALA A 1 85  ? -12.807 1.127   -16.055 1.00 65.20  ? 85   ALA A N   1 
ATOM   190  C  CA  . ALA A 1 85  ? -13.749 1.880   -16.879 1.00 74.63  ? 85   ALA A CA  1 
ATOM   191  C  C   . ALA A 1 85  ? -14.133 1.116   -18.143 1.00 76.88  ? 85   ALA A C   1 
ATOM   192  O  O   . ALA A 1 85  ? -15.295 1.119   -18.552 1.00 71.89  ? 85   ALA A O   1 
ATOM   193  C  CB  . ALA A 1 85  ? -13.170 3.243   -17.233 1.00 76.34  ? 85   ALA A CB  1 
ATOM   194  N  N   . ILE A 1 86  ? -13.151 0.457   -18.753 1.00 82.22  ? 86   ILE A N   1 
ATOM   195  C  CA  . ILE A 1 86  ? -13.378 -0.314  -19.972 1.00 87.22  ? 86   ILE A CA  1 
ATOM   196  C  C   . ILE A 1 86  ? -14.078 -1.643  -19.686 1.00 84.44  ? 86   ILE A C   1 
ATOM   197  O  O   . ILE A 1 86  ? -14.036 -2.567  -20.498 1.00 90.29  ? 86   ILE A O   1 
ATOM   198  C  CB  . ILE A 1 86  ? -12.060 -0.571  -20.735 1.00 88.05  ? 86   ILE A CB  1 
ATOM   199  C  CG1 . ILE A 1 86  ? -11.026 -1.227  -19.815 1.00 89.32  ? 86   ILE A CG1 1 
ATOM   200  C  CG2 . ILE A 1 86  ? -11.518 0.731   -21.312 1.00 86.67  ? 86   ILE A CG2 1 
ATOM   201  C  CD1 . ILE A 1 86  ? -9.732  -1.599  -20.510 1.00 89.22  ? 86   ILE A CD1 1 
ATOM   202  N  N   . TYR A 1 87  ? -14.720 -1.726  -18.525 1.00 80.29  ? 87   TYR A N   1 
ATOM   203  C  CA  . TYR A 1 87  ? -15.477 -2.909  -18.135 1.00 76.20  ? 87   TYR A CA  1 
ATOM   204  C  C   . TYR A 1 87  ? -16.834 -2.504  -17.574 1.00 73.93  ? 87   TYR A C   1 
ATOM   205  O  O   . TYR A 1 87  ? -17.585 -3.341  -17.073 1.00 74.60  ? 87   TYR A O   1 
ATOM   206  C  CB  . TYR A 1 87  ? -14.709 -3.715  -17.086 1.00 83.92  ? 87   TYR A CB  1 
ATOM   207  C  CG  . TYR A 1 87  ? -13.666 -4.648  -17.657 1.00 85.54  ? 87   TYR A CG  1 
ATOM   208  C  CD1 . TYR A 1 87  ? -13.959 -5.987  -17.886 1.00 85.14  ? 87   TYR A CD1 1 
ATOM   209  C  CD2 . TYR A 1 87  ? -12.389 -4.193  -17.962 1.00 85.21  ? 87   TYR A CD2 1 
ATOM   210  C  CE1 . TYR A 1 87  ? -13.009 -6.848  -18.406 1.00 84.98  ? 87   TYR A CE1 1 
ATOM   211  C  CE2 . TYR A 1 87  ? -11.433 -5.047  -18.483 1.00 86.06  ? 87   TYR A CE2 1 
ATOM   212  C  CZ  . TYR A 1 87  ? -11.749 -6.373  -18.702 1.00 85.60  ? 87   TYR A CZ  1 
ATOM   213  O  OH  . TYR A 1 87  ? -10.801 -7.226  -19.220 1.00 85.45  ? 87   TYR A OH  1 
ATOM   214  N  N   . GLY A 1 88  ? -17.141 -1.215  -17.666 1.00 71.18  ? 88   GLY A N   1 
ATOM   215  C  CA  . GLY A 1 88  ? -18.353 -0.668  -17.069 1.00 73.15  ? 88   GLY A CA  1 
ATOM   216  C  C   . GLY A 1 88  ? -18.030 0.057   -15.778 1.00 72.76  ? 88   GLY A C   1 
ATOM   217  O  O   . GLY A 1 88  ? -18.807 0.888   -15.307 1.00 71.96  ? 88   GLY A O   1 
ATOM   218  N  N   . GLY A 1 89  ? -16.873 -0.264  -15.207 1.00 72.97  ? 89   GLY A N   1 
ATOM   219  C  CA  . GLY A 1 89  ? -16.409 0.377   -13.983 1.00 69.02  ? 89   GLY A CA  1 
ATOM   220  C  C   . GLY A 1 89  ? -16.972 -0.248  -12.723 1.00 70.76  ? 89   GLY A C   1 
ATOM   221  O  O   . GLY A 1 89  ? -18.018 -0.896  -12.750 1.00 75.75  ? 89   GLY A O   1 
ATOM   222  N  N   . VAL A 1 90  ? -16.266 -0.054  -11.614 1.00 63.39  ? 90   VAL A N   1 
ATOM   223  C  CA  . VAL A 1 90  ? -16.729 -0.520  -10.313 1.00 56.33  ? 90   VAL A CA  1 
ATOM   224  C  C   . VAL A 1 90  ? -16.909 0.676   -9.382  1.00 54.82  ? 90   VAL A C   1 
ATOM   225  O  O   . VAL A 1 90  ? -16.042 1.547   -9.301  1.00 54.41  ? 90   VAL A O   1 
ATOM   226  C  CB  . VAL A 1 90  ? -15.744 -1.526  -9.684  1.00 52.02  ? 90   VAL A CB  1 
ATOM   227  C  CG1 . VAL A 1 90  ? -16.265 -2.015  -8.342  1.00 50.42  ? 90   VAL A CG1 1 
ATOM   228  C  CG2 . VAL A 1 90  ? -15.511 -2.699  -10.623 1.00 51.80  ? 90   VAL A CG2 1 
ATOM   229  N  N   . SER A 1 91  ? -18.043 0.716   -8.689  1.00 49.27  ? 91   SER A N   1 
ATOM   230  C  CA  . SER A 1 91  ? -18.349 1.821   -7.788  1.00 48.48  ? 91   SER A CA  1 
ATOM   231  C  C   . SER A 1 91  ? -17.442 1.814   -6.561  1.00 49.16  ? 91   SER A C   1 
ATOM   232  O  O   . SER A 1 91  ? -17.182 0.763   -5.973  1.00 47.13  ? 91   SER A O   1 
ATOM   233  C  CB  . SER A 1 91  ? -19.816 1.769   -7.355  1.00 47.83  ? 91   SER A CB  1 
ATOM   234  O  OG  . SER A 1 91  ? -20.678 1.815   -8.478  1.00 55.50  ? 91   SER A OG  1 
ATOM   235  N  N   . GLY A 1 92  ? -16.959 2.995   -6.186  1.00 45.13  ? 92   GLY A N   1 
ATOM   236  C  CA  . GLY A 1 92  ? -16.125 3.145   -4.999  1.00 43.95  ? 92   GLY A CA  1 
ATOM   237  C  C   . GLY A 1 92  ? -14.668 2.795   -5.226  1.00 44.98  ? 92   GLY A C   1 
ATOM   238  O  O   . GLY A 1 92  ? -13.880 2.747   -4.281  1.00 52.06  ? 92   GLY A O   1 
ATOM   239  N  N   . LEU A 1 93  ? -14.306 2.549   -6.481  1.00 38.62  ? 93   LEU A N   1 
ATOM   240  C  CA  . LEU A 1 93  ? -12.929 2.215   -6.828  1.00 35.74  ? 93   LEU A CA  1 
ATOM   241  C  C   . LEU A 1 93  ? -12.397 3.148   -7.909  1.00 38.36  ? 93   LEU A C   1 
ATOM   242  O  O   . LEU A 1 93  ? -13.038 3.348   -8.940  1.00 36.75  ? 93   LEU A O   1 
ATOM   243  C  CB  . LEU A 1 93  ? -12.822 0.756   -7.280  1.00 30.90  ? 93   LEU A CB  1 
ATOM   244  C  CG  . LEU A 1 93  ? -13.124 -0.303  -6.217  1.00 30.80  ? 93   LEU A CG  1 
ATOM   245  C  CD1 . LEU A 1 93  ? -12.915 -1.700  -6.772  1.00 29.33  ? 93   LEU A CD1 1 
ATOM   246  C  CD2 . LEU A 1 93  ? -12.267 -0.086  -4.977  1.00 27.68  ? 93   LEU A CD2 1 
ATOM   247  N  N   . TYR A 1 94  ? -11.222 3.718   -7.665  1.00 45.41  ? 94   TYR A N   1 
ATOM   248  C  CA  . TYR A 1 94  ? -10.631 4.677   -8.591  1.00 44.02  ? 94   TYR A CA  1 
ATOM   249  C  C   . TYR A 1 94  ? -9.143  4.428   -8.803  1.00 44.25  ? 94   TYR A C   1 
ATOM   250  O  O   . TYR A 1 94  ? -8.446  3.950   -7.908  1.00 45.28  ? 94   TYR A O   1 
ATOM   251  C  CB  . TYR A 1 94  ? -10.857 6.108   -8.096  1.00 44.43  ? 94   TYR A CB  1 
ATOM   252  C  CG  . TYR A 1 94  ? -12.308 6.528   -8.097  1.00 45.39  ? 94   TYR A CG  1 
ATOM   253  C  CD1 . TYR A 1 94  ? -13.115 6.311   -6.987  1.00 43.96  ? 94   TYR A CD1 1 
ATOM   254  C  CD2 . TYR A 1 94  ? -12.875 7.136   -9.210  1.00 49.09  ? 94   TYR A CD2 1 
ATOM   255  C  CE1 . TYR A 1 94  ? -14.445 6.689   -6.985  1.00 44.03  ? 94   TYR A CE1 1 
ATOM   256  C  CE2 . TYR A 1 94  ? -14.204 7.518   -9.217  1.00 49.71  ? 94   TYR A CE2 1 
ATOM   257  C  CZ  . TYR A 1 94  ? -14.983 7.292   -8.101  1.00 45.72  ? 94   TYR A CZ  1 
ATOM   258  O  OH  . TYR A 1 94  ? -16.306 7.669   -8.100  1.00 48.56  ? 94   TYR A OH  1 
ATOM   259  N  N   . ASP A 1 95  ? -8.666  4.756   -10.000 1.00 41.98  ? 95   ASP A N   1 
ATOM   260  C  CA  . ASP A 1 95  ? -7.246  4.676   -10.311 1.00 39.74  ? 95   ASP A CA  1 
ATOM   261  C  C   . ASP A 1 95  ? -6.661  6.080   -10.370 1.00 38.67  ? 95   ASP A C   1 
ATOM   262  O  O   . ASP A 1 95  ? -7.265  6.987   -10.943 1.00 30.34  ? 95   ASP A O   1 
ATOM   263  C  CB  . ASP A 1 95  ? -7.024  3.964   -11.647 1.00 47.79  ? 95   ASP A CB  1 
ATOM   264  C  CG  . ASP A 1 95  ? -7.494  2.523   -11.626 1.00 56.66  ? 95   ASP A CG  1 
ATOM   265  O  OD1 . ASP A 1 95  ? -7.565  1.933   -10.527 1.00 59.56  ? 95   ASP A OD1 1 
ATOM   266  O  OD2 . ASP A 1 95  ? -7.791  1.980   -12.712 1.00 56.72  ? 95   ASP A OD2 1 
ATOM   267  N  N   . PHE A 1 96  ? -5.489  6.258   -9.772  1.00 31.83  ? 96   PHE A N   1 
ATOM   268  C  CA  . PHE A 1 96  ? -4.821  7.552   -9.787  1.00 34.90  ? 96   PHE A CA  1 
ATOM   269  C  C   . PHE A 1 96  ? -3.755  7.609   -10.875 1.00 35.37  ? 96   PHE A C   1 
ATOM   270  O  O   . PHE A 1 96  ? -2.870  6.755   -10.938 1.00 32.65  ? 96   PHE A O   1 
ATOM   271  C  CB  . PHE A 1 96  ? -4.212  7.861   -8.418  1.00 36.80  ? 96   PHE A CB  1 
ATOM   272  C  CG  . PHE A 1 96  ? -5.231  8.173   -7.359  1.00 39.68  ? 96   PHE A CG  1 
ATOM   273  C  CD1 . PHE A 1 96  ? -5.788  7.162   -6.592  1.00 40.43  ? 96   PHE A CD1 1 
ATOM   274  C  CD2 . PHE A 1 96  ? -5.637  9.479   -7.134  1.00 39.55  ? 96   PHE A CD2 1 
ATOM   275  C  CE1 . PHE A 1 96  ? -6.728  7.448   -5.618  1.00 40.84  ? 96   PHE A CE1 1 
ATOM   276  C  CE2 . PHE A 1 96  ? -6.576  9.772   -6.163  1.00 39.41  ? 96   PHE A CE2 1 
ATOM   277  C  CZ  . PHE A 1 96  ? -7.123  8.755   -5.404  1.00 41.35  ? 96   PHE A CZ  1 
ATOM   278  N  N   . GLY A 1 97  ? -3.853  8.619   -11.734 1.00 33.56  ? 97   GLY A N   1 
ATOM   279  C  CA  . GLY A 1 97  ? -2.904  8.794   -12.827 1.00 32.27  ? 97   GLY A CA  1 
ATOM   280  C  C   . GLY A 1 97  ? -1.587  9.390   -12.370 1.00 36.51  ? 97   GLY A C   1 
ATOM   281  O  O   . GLY A 1 97  ? -1.429  9.724   -11.196 1.00 37.20  ? 97   GLY A O   1 
ATOM   282  N  N   . PRO A 1 98  ? -0.632  9.526   -13.303 1.00 33.35  ? 98   PRO A N   1 
ATOM   283  C  CA  . PRO A 1 98  ? 0.701   10.062  -13.038 1.00 31.77  ? 98   PRO A CA  1 
ATOM   284  C  C   . PRO A 1 98  ? 0.661   11.347  -12.217 1.00 30.59  ? 98   PRO A C   1 
ATOM   285  O  O   . PRO A 1 98  ? 1.415   11.490  -11.254 1.00 36.92  ? 98   PRO A O   1 
ATOM   286  C  CB  . PRO A 1 98  ? 1.239   10.350  -14.440 1.00 35.02  ? 98   PRO A CB  1 
ATOM   287  C  CG  . PRO A 1 98  ? 0.571   9.341   -15.298 1.00 28.45  ? 98   PRO A CG  1 
ATOM   288  C  CD  . PRO A 1 98  ? -0.802  9.148   -14.718 1.00 28.80  ? 98   PRO A CD  1 
ATOM   289  N  N   . VAL A 1 99  ? -0.216  12.268  -12.601 1.00 31.18  ? 99   VAL A N   1 
ATOM   290  C  CA  . VAL A 1 99  ? -0.347  13.546  -11.911 1.00 35.02  ? 99   VAL A CA  1 
ATOM   291  C  C   . VAL A 1 99  ? -0.965  13.365  -10.525 1.00 34.23  ? 99   VAL A C   1 
ATOM   292  O  O   . VAL A 1 99  ? -0.575  14.037  -9.569  1.00 34.37  ? 99   VAL A O   1 
ATOM   293  C  CB  . VAL A 1 99  ? -1.185  14.547  -12.736 1.00 34.87  ? 99   VAL A CB  1 
ATOM   294  C  CG1 . VAL A 1 99  ? -1.402  15.828  -11.961 1.00 38.51  ? 99   VAL A CG1 1 
ATOM   295  C  CG2 . VAL A 1 99  ? -0.500  14.844  -14.057 1.00 33.39  ? 99   VAL A CG2 1 
ATOM   296  N  N   . GLY A 1 100 ? -1.925  12.452  -10.423 1.00 31.30  ? 100  GLY A N   1 
ATOM   297  C  CA  . GLY A 1 100 ? -2.563  12.152  -9.146  1.00 35.97  ? 100  GLY A CA  1 
ATOM   298  C  C   . GLY A 1 100 ? -1.603  11.512  -8.161  1.00 35.52  ? 100  GLY A C   1 
ATOM   299  O  O   . GLY A 1 100 ? -1.626  11.823  -6.971  1.00 35.74  ? 100  GLY A O   1 
ATOM   300  N  N   . CYS A 1 101 ? -0.757  10.617  -8.664  1.00 39.86  ? 101  CYS A N   1 
ATOM   301  C  CA  . CYS A 1 101 ? 0.241   9.943   -7.839  1.00 32.01  ? 101  CYS A CA  1 
ATOM   302  C  C   . CYS A 1 101 ? 1.257   10.925  -7.279  1.00 32.83  ? 101  CYS A C   1 
ATOM   303  O  O   . CYS A 1 101 ? 1.596   10.872  -6.097  1.00 30.39  ? 101  CYS A O   1 
ATOM   304  C  CB  . CYS A 1 101 ? 0.967   8.866   -8.643  1.00 34.34  ? 101  CYS A CB  1 
ATOM   305  S  SG  . CYS A 1 101 ? 0.034   7.350   -8.858  1.00 43.77  ? 101  CYS A SG  1 
ATOM   306  N  N   . ALA A 1 102 ? 1.746   11.814  -8.137  1.00 26.94  ? 102  ALA A N   1 
ATOM   307  C  CA  . ALA A 1 102 ? 2.711   12.822  -7.720  1.00 25.20  ? 102  ALA A CA  1 
ATOM   308  C  C   . ALA A 1 102 ? 2.141   13.630  -6.564  1.00 33.32  ? 102  ALA A C   1 
ATOM   309  O  O   . ALA A 1 102 ? 2.827   13.885  -5.575  1.00 42.41  ? 102  ALA A O   1 
ATOM   310  C  CB  . ALA A 1 102 ? 3.063   13.731  -8.883  1.00 23.77  ? 102  ALA A CB  1 
ATOM   311  N  N   . LEU A 1 103 ? 0.876   14.016  -6.695  1.00 26.56  ? 103  LEU A N   1 
ATOM   312  C  CA  . LEU A 1 103 ? 0.183   14.774  -5.665  1.00 28.57  ? 103  LEU A CA  1 
ATOM   313  C  C   . LEU A 1 103 ? 0.017   13.933  -4.402  1.00 34.13  ? 103  LEU A C   1 
ATOM   314  O  O   . LEU A 1 103 ? 0.316   14.388  -3.296  1.00 30.09  ? 103  LEU A O   1 
ATOM   315  C  CB  . LEU A 1 103 ? -1.184  15.222  -6.184  1.00 32.66  ? 103  LEU A CB  1 
ATOM   316  C  CG  . LEU A 1 103 ? -1.793  16.502  -5.609  1.00 34.48  ? 103  LEU A CG  1 
ATOM   317  C  CD1 . LEU A 1 103 ? -2.898  16.999  -6.520  1.00 37.32  ? 103  LEU A CD1 1 
ATOM   318  C  CD2 . LEU A 1 103 ? -2.319  16.282  -4.206  1.00 38.00  ? 103  LEU A CD2 1 
ATOM   319  N  N   . LYS A 1 104 ? -0.458  12.703  -4.578  1.00 27.24  ? 104  LYS A N   1 
ATOM   320  C  CA  . LYS A 1 104 ? -0.674  11.789  -3.463  1.00 26.80  ? 104  LYS A CA  1 
ATOM   321  C  C   . LYS A 1 104 ? 0.620   11.513  -2.704  1.00 31.18  ? 104  LYS A C   1 
ATOM   322  O  O   . LYS A 1 104 ? 0.648   11.557  -1.475  1.00 35.73  ? 104  LYS A O   1 
ATOM   323  C  CB  . LYS A 1 104 ? -1.285  10.479  -3.961  1.00 35.25  ? 104  LYS A CB  1 
ATOM   324  C  CG  . LYS A 1 104 ? -1.547  9.458   -2.869  1.00 42.08  ? 104  LYS A CG  1 
ATOM   325  C  CD  . LYS A 1 104 ? -2.254  8.234   -3.422  1.00 48.70  ? 104  LYS A CD  1 
ATOM   326  C  CE  . LYS A 1 104 ? -2.466  7.191   -2.341  1.00 53.45  ? 104  LYS A CE  1 
ATOM   327  N  NZ  . LYS A 1 104 ? -3.195  5.999   -2.854  1.00 59.62  ? 104  LYS A NZ  1 
ATOM   328  N  N   . ASN A 1 105 ? 1.690   11.233  -3.443  1.00 35.63  ? 105  ASN A N   1 
ATOM   329  C  CA  . ASN A 1 105 ? 2.993   10.972  -2.839  1.00 33.61  ? 105  ASN A CA  1 
ATOM   330  C  C   . ASN A 1 105 ? 3.525   12.180  -2.077  1.00 34.16  ? 105  ASN A C   1 
ATOM   331  O  O   . ASN A 1 105 ? 4.125   12.034  -1.014  1.00 42.11  ? 105  ASN A O   1 
ATOM   332  C  CB  . ASN A 1 105 ? 4.004   10.527  -3.897  1.00 39.59  ? 105  ASN A CB  1 
ATOM   333  C  CG  . ASN A 1 105 ? 3.657   9.181   -4.509  1.00 44.85  ? 105  ASN A CG  1 
ATOM   334  O  OD1 . ASN A 1 105 ? 4.112   8.852   -5.604  1.00 51.86  ? 105  ASN A OD1 1 
ATOM   335  N  ND2 . ASN A 1 105 ? 2.847   8.398   -3.806  1.00 46.84  ? 105  ASN A ND2 1 
ATOM   336  N  N   . ASN A 1 106 ? 3.300   13.371  -2.626  1.00 33.20  ? 106  ASN A N   1 
ATOM   337  C  CA  . ASN A 1 106 ? 3.707   14.610  -1.969  1.00 27.11  ? 106  ASN A CA  1 
ATOM   338  C  C   . ASN A 1 106 ? 2.928   14.850  -0.683  1.00 29.08  ? 106  ASN A C   1 
ATOM   339  O  O   . ASN A 1 106 ? 3.499   15.252  0.330   1.00 30.57  ? 106  ASN A O   1 
ATOM   340  C  CB  . ASN A 1 106 ? 3.544   15.804  -2.912  1.00 36.95  ? 106  ASN A CB  1 
ATOM   341  C  CG  . ASN A 1 106 ? 4.503   15.758  -4.086  1.00 37.20  ? 106  ASN A CG  1 
ATOM   342  O  OD1 . ASN A 1 106 ? 5.501   15.037  -4.063  1.00 40.22  ? 106  ASN A OD1 1 
ATOM   343  N  ND2 . ASN A 1 106 ? 4.203   16.531  -5.124  1.00 34.59  ? 106  ASN A ND2 1 
ATOM   344  N  N   . ILE A 1 107 ? 1.622   14.602  -0.732  1.00 31.13  ? 107  ILE A N   1 
ATOM   345  C  CA  . ILE A 1 107 ? 0.769   14.717  0.447   1.00 24.54  ? 107  ILE A CA  1 
ATOM   346  C  C   . ILE A 1 107 ? 1.240   13.768  1.546   1.00 33.85  ? 107  ILE A C   1 
ATOM   347  O  O   . ILE A 1 107 ? 1.374   14.163  2.706   1.00 38.23  ? 107  ILE A O   1 
ATOM   348  C  CB  . ILE A 1 107 ? -0.708  14.431  0.103   1.00 26.41  ? 107  ILE A CB  1 
ATOM   349  C  CG1 . ILE A 1 107 ? -1.338  15.645  -0.582  1.00 28.82  ? 107  ILE A CG1 1 
ATOM   350  C  CG2 . ILE A 1 107 ? -1.498  14.070  1.350   1.00 25.90  ? 107  ILE A CG2 1 
ATOM   351  C  CD1 . ILE A 1 107 ? -2.829  15.519  -0.797  1.00 32.86  ? 107  ILE A CD1 1 
ATOM   352  N  N   . ILE A 1 108 ? 1.504   12.520  1.167   1.00 27.37  ? 108  ILE A N   1 
ATOM   353  C  CA  . ILE A 1 108 ? 1.972   11.506  2.106   1.00 23.74  ? 108  ILE A CA  1 
ATOM   354  C  C   . ILE A 1 108 ? 3.349   11.848  2.674   1.00 30.79  ? 108  ILE A C   1 
ATOM   355  O  O   . ILE A 1 108 ? 3.603   11.660  3.865   1.00 32.69  ? 108  ILE A O   1 
ATOM   356  C  CB  . ILE A 1 108 ? 2.002   10.108  1.452   1.00 22.67  ? 108  ILE A CB  1 
ATOM   357  C  CG1 . ILE A 1 108 ? 0.575   9.623   1.185   1.00 23.73  ? 108  ILE A CG1 1 
ATOM   358  C  CG2 . ILE A 1 108 ? 2.749   9.114   2.329   1.00 21.51  ? 108  ILE A CG2 1 
ATOM   359  C  CD1 . ILE A 1 108 ? 0.495   8.300   0.451   1.00 25.13  ? 108  ILE A CD1 1 
ATOM   360  N  N   . GLN A 1 109 ? 4.232   12.361  1.823   1.00 28.10  ? 109  GLN A N   1 
ATOM   361  C  CA  . GLN A 1 109 ? 5.575   12.735  2.254   1.00 31.88  ? 109  GLN A CA  1 
ATOM   362  C  C   . GLN A 1 109 ? 5.536   13.932  3.200   1.00 35.93  ? 109  GLN A C   1 
ATOM   363  O  O   . GLN A 1 109 ? 6.263   13.973  4.192   1.00 41.61  ? 109  GLN A O   1 
ATOM   364  C  CB  . GLN A 1 109 ? 6.471   13.033  1.050   1.00 38.53  ? 109  GLN A CB  1 
ATOM   365  C  CG  . GLN A 1 109 ? 7.957   13.026  1.374   1.00 45.30  ? 109  GLN A CG  1 
ATOM   366  C  CD  . GLN A 1 109 ? 8.424   11.697  1.943   1.00 55.11  ? 109  GLN A CD  1 
ATOM   367  O  OE1 . GLN A 1 109 ? 8.048   10.629  1.455   1.00 54.05  ? 109  GLN A OE1 1 
ATOM   368  N  NE2 . GLN A 1 109 ? 9.252   11.758  2.980   1.00 56.10  ? 109  GLN A NE2 1 
ATOM   369  N  N   . THR A 1 110 ? 4.682   14.903  2.886   1.00 38.44  ? 110  THR A N   1 
ATOM   370  C  CA  . THR A 1 110 ? 4.481   16.061  3.751   1.00 35.78  ? 110  THR A CA  1 
ATOM   371  C  C   . THR A 1 110 ? 3.961   15.611  5.113   1.00 37.42  ? 110  THR A C   1 
ATOM   372  O  O   . THR A 1 110 ? 4.316   16.181  6.146   1.00 28.89  ? 110  THR A O   1 
ATOM   373  C  CB  . THR A 1 110 ? 3.492   17.063  3.125   1.00 37.35  ? 110  THR A CB  1 
ATOM   374  O  OG1 . THR A 1 110 ? 4.031   17.563  1.895   1.00 40.61  ? 110  THR A OG1 1 
ATOM   375  C  CG2 . THR A 1 110 ? 3.234   18.230  4.065   1.00 37.47  ? 110  THR A CG2 1 
ATOM   376  N  N   . TRP A 1 111 ? 3.126   14.576  5.101   1.00 28.69  ? 111  TRP A N   1 
ATOM   377  C  CA  . TRP A 1 111 ? 2.578   14.003  6.323   1.00 28.15  ? 111  TRP A CA  1 
ATOM   378  C  C   . TRP A 1 111 ? 3.669   13.342  7.159   1.00 29.34  ? 111  TRP A C   1 
ATOM   379  O  O   . TRP A 1 111 ? 3.706   13.500  8.379   1.00 35.42  ? 111  TRP A O   1 
ATOM   380  C  CB  . TRP A 1 111 ? 1.489   12.987  5.982   1.00 31.74  ? 111  TRP A CB  1 
ATOM   381  C  CG  . TRP A 1 111 ? 0.669   12.551  7.153   1.00 30.99  ? 111  TRP A CG  1 
ATOM   382  C  CD1 . TRP A 1 111 ? -0.488  13.120  7.598   1.00 32.28  ? 111  TRP A CD1 1 
ATOM   383  C  CD2 . TRP A 1 111 ? 0.933   11.443  8.022   1.00 30.22  ? 111  TRP A CD2 1 
ATOM   384  N  NE1 . TRP A 1 111 ? -0.959  12.438  8.694   1.00 31.88  ? 111  TRP A NE1 1 
ATOM   385  C  CE2 . TRP A 1 111 ? -0.106  11.404  8.975   1.00 30.96  ? 111  TRP A CE2 1 
ATOM   386  C  CE3 . TRP A 1 111 ? 1.947   10.481  8.089   1.00 23.57  ? 111  TRP A CE3 1 
ATOM   387  C  CZ2 . TRP A 1 111 ? -0.159  10.443  9.983   1.00 30.74  ? 111  TRP A CZ2 1 
ATOM   388  C  CZ3 . TRP A 1 111 ? 1.891   9.526   9.090   1.00 26.60  ? 111  TRP A CZ3 1 
ATOM   389  C  CH2 . TRP A 1 111 ? 0.846   9.515   10.023  1.00 29.84  ? 111  TRP A CH2 1 
ATOM   390  N  N   . ARG A 1 112 ? 4.554   12.602  6.497   1.00 29.01  ? 112  ARG A N   1 
ATOM   391  C  CA  . ARG A 1 112 ? 5.658   11.932  7.179   1.00 28.80  ? 112  ARG A CA  1 
ATOM   392  C  C   . ARG A 1 112 ? 6.576   12.932  7.877   1.00 27.45  ? 112  ARG A C   1 
ATOM   393  O  O   . ARG A 1 112 ? 7.084   12.666  8.965   1.00 35.78  ? 112  ARG A O   1 
ATOM   394  C  CB  . ARG A 1 112 ? 6.460   11.070  6.202   1.00 33.23  ? 112  ARG A CB  1 
ATOM   395  C  CG  . ARG A 1 112 ? 5.888   9.678   5.978   1.00 33.27  ? 112  ARG A CG  1 
ATOM   396  C  CD  . ARG A 1 112 ? 6.868   8.803   5.206   1.00 36.22  ? 112  ARG A CD  1 
ATOM   397  N  NE  . ARG A 1 112 ? 6.634   7.378   5.427   1.00 38.41  ? 112  ARG A NE  1 
ATOM   398  C  CZ  . ARG A 1 112 ? 5.995   6.580   4.577   1.00 40.67  ? 112  ARG A CZ  1 
ATOM   399  N  NH1 . ARG A 1 112 ? 5.523   7.062   3.435   1.00 41.25  ? 112  ARG A NH1 1 
ATOM   400  N  NH2 . ARG A 1 112 ? 5.831   5.297   4.867   1.00 41.77  ? 112  ARG A NH2 1 
ATOM   401  N  N   . GLN A 1 113 ? 6.780   14.083  7.245   1.00 33.95  ? 113  GLN A N   1 
ATOM   402  C  CA  . GLN A 1 113 ? 7.592   15.148  7.823   1.00 36.15  ? 113  GLN A CA  1 
ATOM   403  C  C   . GLN A 1 113 ? 6.871   15.845  8.971   1.00 40.74  ? 113  GLN A C   1 
ATOM   404  O  O   . GLN A 1 113 ? 7.481   16.185  9.985   1.00 36.40  ? 113  GLN A O   1 
ATOM   405  C  CB  . GLN A 1 113 ? 7.966   16.175  6.751   1.00 44.08  ? 113  GLN A CB  1 
ATOM   406  C  CG  . GLN A 1 113 ? 9.340   15.965  6.141   1.00 58.55  ? 113  GLN A CG  1 
ATOM   407  C  CD  . GLN A 1 113 ? 10.457  16.447  7.048   1.00 65.91  ? 113  GLN A CD  1 
ATOM   408  O  OE1 . GLN A 1 113 ? 11.554  15.887  7.052   1.00 71.16  ? 113  GLN A OE1 1 
ATOM   409  N  NE2 . GLN A 1 113 ? 10.184  17.491  7.823   1.00 67.73  ? 113  GLN A NE2 1 
ATOM   410  N  N   . HIS A 1 114 ? 5.569   16.048  8.802   1.00 41.89  ? 114  HIS A N   1 
ATOM   411  C  CA  . HIS A 1 114 ? 4.776   16.811  9.757   1.00 34.55  ? 114  HIS A CA  1 
ATOM   412  C  C   . HIS A 1 114 ? 4.514   16.046  11.052  1.00 35.65  ? 114  HIS A C   1 
ATOM   413  O  O   . HIS A 1 114 ? 4.387   16.648  12.118  1.00 37.16  ? 114  HIS A O   1 
ATOM   414  C  CB  . HIS A 1 114 ? 3.450   17.234  9.122   1.00 35.82  ? 114  HIS A CB  1 
ATOM   415  C  CG  . HIS A 1 114 ? 2.714   18.281  9.897   1.00 37.39  ? 114  HIS A CG  1 
ATOM   416  N  ND1 . HIS A 1 114 ? 2.836   19.627  9.628   1.00 37.90  ? 114  HIS A ND1 1 
ATOM   417  C  CD2 . HIS A 1 114 ? 1.846   18.181  10.931  1.00 35.84  ? 114  HIS A CD2 1 
ATOM   418  C  CE1 . HIS A 1 114 ? 2.074   20.311  10.462  1.00 39.44  ? 114  HIS A CE1 1 
ATOM   419  N  NE2 . HIS A 1 114 ? 1.463   19.457  11.264  1.00 34.83  ? 114  HIS A NE2 1 
ATOM   420  N  N   . PHE A 1 115 ? 4.439   14.722  10.961  1.00 34.06  ? 115  PHE A N   1 
ATOM   421  C  CA  . PHE A 1 115 ? 4.104   13.908  12.126  1.00 28.11  ? 115  PHE A CA  1 
ATOM   422  C  C   . PHE A 1 115 ? 5.210   12.941  12.544  1.00 31.11  ? 115  PHE A C   1 
ATOM   423  O  O   . PHE A 1 115 ? 5.738   13.041  13.650  1.00 41.99  ? 115  PHE A O   1 
ATOM   424  C  CB  . PHE A 1 115 ? 2.787   13.164  11.897  1.00 27.11  ? 115  PHE A CB  1 
ATOM   425  C  CG  . PHE A 1 115 ? 1.600   14.074  11.759  1.00 28.92  ? 115  PHE A CG  1 
ATOM   426  C  CD1 . PHE A 1 115 ? 1.113   14.415  10.508  1.00 29.15  ? 115  PHE A CD1 1 
ATOM   427  C  CD2 . PHE A 1 115 ? 0.982   14.603  12.881  1.00 29.58  ? 115  PHE A CD2 1 
ATOM   428  C  CE1 . PHE A 1 115 ? 0.023   15.259  10.379  1.00 32.59  ? 115  PHE A CE1 1 
ATOM   429  C  CE2 . PHE A 1 115 ? -0.106  15.447  12.759  1.00 29.30  ? 115  PHE A CE2 1 
ATOM   430  C  CZ  . PHE A 1 115 ? -0.586  15.777  11.507  1.00 30.79  ? 115  PHE A CZ  1 
ATOM   431  N  N   . ILE A 1 116 ? 5.558   12.011  11.662  1.00 33.70  ? 116  ILE A N   1 
ATOM   432  C  CA  . ILE A 1 116 ? 6.532   10.970  11.993  1.00 41.17  ? 116  ILE A CA  1 
ATOM   433  C  C   . ILE A 1 116 ? 7.902   11.533  12.381  1.00 42.05  ? 116  ILE A C   1 
ATOM   434  O  O   . ILE A 1 116 ? 8.479   11.133  13.392  1.00 50.43  ? 116  ILE A O   1 
ATOM   435  C  CB  . ILE A 1 116 ? 6.682   9.944   10.849  1.00 36.77  ? 116  ILE A CB  1 
ATOM   436  C  CG1 . ILE A 1 116 ? 5.337   9.271   10.565  1.00 34.38  ? 116  ILE A CG1 1 
ATOM   437  C  CG2 . ILE A 1 116 ? 7.734   8.900   11.196  1.00 38.73  ? 116  ILE A CG2 1 
ATOM   438  C  CD1 . ILE A 1 116 ? 5.396   8.203   9.495   1.00 40.80  ? 116  ILE A CD1 1 
ATOM   439  N  N   . GLN A 1 117 ? 8.412   12.465  11.582  1.00 45.95  ? 117  GLN A N   1 
ATOM   440  C  CA  . GLN A 1 117 ? 9.717   13.067  11.844  1.00 44.14  ? 117  GLN A CA  1 
ATOM   441  C  C   . GLN A 1 117 ? 9.664   14.051  13.009  1.00 44.81  ? 117  GLN A C   1 
ATOM   442  O  O   . GLN A 1 117 ? 10.602  14.141  13.800  1.00 48.13  ? 117  GLN A O   1 
ATOM   443  C  CB  . GLN A 1 117 ? 10.244  13.779  10.595  1.00 51.35  ? 117  GLN A CB  1 
ATOM   444  C  CG  . GLN A 1 117 ? 10.356  12.898  9.358   1.00 63.01  ? 117  GLN A CG  1 
ATOM   445  C  CD  . GLN A 1 117 ? 11.554  11.967  9.395   1.00 67.99  ? 117  GLN A CD  1 
ATOM   446  O  OE1 . GLN A 1 117 ? 11.939  11.467  10.452  1.00 69.73  ? 117  GLN A OE1 1 
ATOM   447  N  NE2 . GLN A 1 117 ? 12.147  11.724  8.232   1.00 73.71  ? 117  GLN A NE2 1 
ATOM   448  N  N   . GLU A 1 118 ? 8.560   14.786  13.106  1.00 45.34  ? 118  GLU A N   1 
ATOM   449  C  CA  . GLU A 1 118 ? 8.414   15.836  14.110  1.00 43.82  ? 118  GLU A CA  1 
ATOM   450  C  C   . GLU A 1 118 ? 8.183   15.281  15.513  1.00 37.02  ? 118  GLU A C   1 
ATOM   451  O  O   . GLU A 1 118 ? 8.659   15.846  16.497  1.00 45.87  ? 118  GLU A O   1 
ATOM   452  C  CB  . GLU A 1 118 ? 7.270   16.779  13.725  1.00 49.44  ? 118  GLU A CB  1 
ATOM   453  C  CG  . GLU A 1 118 ? 7.127   17.998  14.626  1.00 51.97  ? 118  GLU A CG  1 
ATOM   454  C  CD  . GLU A 1 118 ? 8.212   19.033  14.393  1.00 55.87  ? 118  GLU A CD  1 
ATOM   455  O  OE1 . GLU A 1 118 ? 8.698   19.146  13.247  1.00 52.74  ? 118  GLU A OE1 1 
ATOM   456  O  OE2 . GLU A 1 118 ? 8.572   19.740  15.358  1.00 56.37  ? 118  GLU A OE2 1 
ATOM   457  N  N   . GLU A 1 119 ? 7.456   14.172  15.600  1.00 34.02  ? 119  GLU A N   1 
ATOM   458  C  CA  . GLU A 1 119 ? 7.085   13.593  16.889  1.00 32.97  ? 119  GLU A CA  1 
ATOM   459  C  C   . GLU A 1 119 ? 7.879   12.337  17.241  1.00 31.99  ? 119  GLU A C   1 
ATOM   460  O  O   . GLU A 1 119 ? 7.649   11.726  18.286  1.00 31.72  ? 119  GLU A O   1 
ATOM   461  C  CB  . GLU A 1 119 ? 5.583   13.287  16.921  1.00 31.96  ? 119  GLU A CB  1 
ATOM   462  C  CG  . GLU A 1 119 ? 4.745   14.308  17.675  1.00 40.86  ? 119  GLU A CG  1 
ATOM   463  C  CD  . GLU A 1 119 ? 5.069   15.738  17.299  1.00 38.67  ? 119  GLU A CD  1 
ATOM   464  O  OE1 . GLU A 1 119 ? 4.818   16.125  16.140  1.00 42.34  ? 119  GLU A OE1 1 
ATOM   465  O  OE2 . GLU A 1 119 ? 5.565   16.479  18.172  1.00 39.90  ? 119  GLU A OE2 1 
ATOM   466  N  N   . GLN A 1 120 ? 8.811   11.958  16.369  1.00 27.88  ? 120  GLN A N   1 
ATOM   467  C  CA  . GLN A 1 120 ? 9.609   10.747  16.561  1.00 30.40  ? 120  GLN A CA  1 
ATOM   468  C  C   . GLN A 1 120 ? 8.723   9.510   16.652  1.00 33.10  ? 120  GLN A C   1 
ATOM   469  O  O   . GLN A 1 120 ? 8.909   8.659   17.523  1.00 41.79  ? 120  GLN A O   1 
ATOM   470  C  CB  . GLN A 1 120 ? 10.489  10.864  17.808  1.00 47.43  ? 120  GLN A CB  1 
ATOM   471  C  CG  . GLN A 1 120 ? 11.506  11.990  17.751  1.00 54.30  ? 120  GLN A CG  1 
ATOM   472  C  CD  . GLN A 1 120 ? 12.428  11.877  16.555  1.00 60.98  ? 120  GLN A CD  1 
ATOM   473  O  OE1 . GLN A 1 120 ? 11.992  11.968  15.406  1.00 66.65  ? 120  GLN A OE1 1 
ATOM   474  N  NE2 . GLN A 1 120 ? 13.715  11.685  16.818  1.00 64.76  ? 120  GLN A NE2 1 
ATOM   475  N  N   . ILE A 1 121 ? 7.761   9.420   15.741  1.00 27.04  ? 121  ILE A N   1 
ATOM   476  C  CA  . ILE A 1 121 ? 6.787   8.337   15.747  1.00 29.67  ? 121  ILE A CA  1 
ATOM   477  C  C   . ILE A 1 121 ? 7.390   7.031   15.234  1.00 31.09  ? 121  ILE A C   1 
ATOM   478  O  O   . ILE A 1 121 ? 8.200   7.030   14.307  1.00 38.63  ? 121  ILE A O   1 
ATOM   479  C  CB  . ILE A 1 121 ? 5.550   8.705   14.903  1.00 30.12  ? 121  ILE A CB  1 
ATOM   480  C  CG1 . ILE A 1 121 ? 4.982   10.052  15.355  1.00 28.41  ? 121  ILE A CG1 1 
ATOM   481  C  CG2 . ILE A 1 121 ? 4.496   7.620   14.996  1.00 26.99  ? 121  ILE A CG2 1 
ATOM   482  C  CD1 . ILE A 1 121 ? 3.689   10.438  14.670  1.00 28.22  ? 121  ILE A CD1 1 
ATOM   483  N  N   . LEU A 1 122 ? 6.993   5.922   15.850  1.00 31.59  ? 122  LEU A N   1 
ATOM   484  C  CA  . LEU A 1 122 ? 7.452   4.603   15.435  1.00 34.75  ? 122  LEU A CA  1 
ATOM   485  C  C   . LEU A 1 122 ? 6.546   4.045   14.343  1.00 37.27  ? 122  LEU A C   1 
ATOM   486  O  O   . LEU A 1 122 ? 5.435   3.593   14.620  1.00 41.93  ? 122  LEU A O   1 
ATOM   487  C  CB  . LEU A 1 122 ? 7.477   3.647   16.629  1.00 34.55  ? 122  LEU A CB  1 
ATOM   488  C  CG  . LEU A 1 122 ? 8.274   4.096   17.855  1.00 37.10  ? 122  LEU A CG  1 
ATOM   489  C  CD1 . LEU A 1 122 ? 8.154   3.071   18.973  1.00 30.48  ? 122  LEU A CD1 1 
ATOM   490  C  CD2 . LEU A 1 122 ? 9.733   4.337   17.491  1.00 35.48  ? 122  LEU A CD2 1 
ATOM   491  N  N   . GLU A 1 123 ? 7.021   4.080   13.102  1.00 35.78  ? 123  GLU A N   1 
ATOM   492  C  CA  . GLU A 1 123 ? 6.231   3.594   11.977  1.00 41.00  ? 123  GLU A CA  1 
ATOM   493  C  C   . GLU A 1 123 ? 6.187   2.070   11.947  1.00 41.67  ? 123  GLU A C   1 
ATOM   494  O  O   . GLU A 1 123 ? 7.133   1.403   12.360  1.00 54.29  ? 123  GLU A O   1 
ATOM   495  C  CB  . GLU A 1 123 ? 6.770   4.136   10.651  1.00 45.43  ? 123  GLU A CB  1 
ATOM   496  C  CG  . GLU A 1 123 ? 5.888   3.802   9.454   1.00 54.98  ? 123  GLU A CG  1 
ATOM   497  C  CD  . GLU A 1 123 ? 6.435   4.336   8.145   1.00 58.63  ? 123  GLU A CD  1 
ATOM   498  O  OE1 . GLU A 1 123 ? 7.370   5.164   8.177   1.00 65.42  ? 123  GLU A OE1 1 
ATOM   499  O  OE2 . GLU A 1 123 ? 5.924   3.928   7.081   1.00 58.15  ? 123  GLU A OE2 1 
ATOM   500  N  N   . ILE A 1 124 ? 5.078   1.528   11.455  1.00 36.64  ? 124  ILE A N   1 
ATOM   501  C  CA  . ILE A 1 124 ? 4.883   0.087   11.397  1.00 39.24  ? 124  ILE A CA  1 
ATOM   502  C  C   . ILE A 1 124 ? 4.226   -0.296  10.072  1.00 44.05  ? 124  ILE A C   1 
ATOM   503  O  O   . ILE A 1 124 ? 3.528   0.514   9.462   1.00 41.34  ? 124  ILE A O   1 
ATOM   504  C  CB  . ILE A 1 124 ? 4.029   -0.403  12.590  1.00 49.57  ? 124  ILE A CB  1 
ATOM   505  C  CG1 . ILE A 1 124 ? 4.136   -1.918  12.756  1.00 53.57  ? 124  ILE A CG1 1 
ATOM   506  C  CG2 . ILE A 1 124 ? 2.576   0.033   12.436  1.00 50.95  ? 124  ILE A CG2 1 
ATOM   507  C  CD1 . ILE A 1 124 ? 3.490   -2.427  14.019  1.00 54.51  ? 124  ILE A CD1 1 
ATOM   508  N  N   . ASP A 1 125 ? 4.466   -1.522  9.618   1.00 42.15  ? 125  ASP A N   1 
ATOM   509  C  CA  . ASP A 1 125 ? 3.883   -1.998  8.369   1.00 45.71  ? 125  ASP A CA  1 
ATOM   510  C  C   . ASP A 1 125 ? 3.260   -3.377  8.551   1.00 43.82  ? 125  ASP A C   1 
ATOM   511  O  O   . ASP A 1 125 ? 3.939   -4.398  8.439   1.00 48.40  ? 125  ASP A O   1 
ATOM   512  C  CB  . ASP A 1 125 ? 4.940   -2.031  7.263   1.00 58.72  ? 125  ASP A CB  1 
ATOM   513  C  CG  . ASP A 1 125 ? 4.332   -2.121  5.874   1.00 63.66  ? 125  ASP A CG  1 
ATOM   514  O  OD1 . ASP A 1 125 ? 3.199   -2.632  5.742   1.00 64.53  ? 125  ASP A OD1 1 
ATOM   515  O  OD2 . ASP A 1 125 ? 4.993   -1.681  4.909   1.00 67.06  ? 125  ASP A OD2 1 
ATOM   516  N  N   . CYS A 1 126 ? 1.960   -3.398  8.831   1.00 44.85  ? 126  CYS A N   1 
ATOM   517  C  CA  . CYS A 1 126 ? 1.244   -4.648  9.059   1.00 38.03  ? 126  CYS A CA  1 
ATOM   518  C  C   . CYS A 1 126 ? 0.450   -5.066  7.828   1.00 34.25  ? 126  CYS A C   1 
ATOM   519  O  O   . CYS A 1 126 ? 0.302   -4.294  6.881   1.00 43.06  ? 126  CYS A O   1 
ATOM   520  C  CB  . CYS A 1 126 ? 0.322   -4.521  10.271  1.00 44.69  ? 126  CYS A CB  1 
ATOM   521  S  SG  . CYS A 1 126 ? 1.177   -4.067  11.797  1.00 48.95  ? 126  CYS A SG  1 
ATOM   522  N  N   . THR A 1 127 ? -0.058  -6.294  7.848   1.00 42.74  ? 127  THR A N   1 
ATOM   523  C  CA  . THR A 1 127 ? -0.771  -6.849  6.703   1.00 46.68  ? 127  THR A CA  1 
ATOM   524  C  C   . THR A 1 127 ? -2.215  -6.363  6.639   1.00 47.63  ? 127  THR A C   1 
ATOM   525  O  O   . THR A 1 127 ? -2.750  -5.840  7.616   1.00 55.79  ? 127  THR A O   1 
ATOM   526  C  CB  . THR A 1 127 ? -0.755  -8.393  6.718   1.00 43.55  ? 127  THR A CB  1 
ATOM   527  O  OG1 . THR A 1 127 ? -1.578  -8.875  7.787   1.00 47.38  ? 127  THR A OG1 1 
ATOM   528  C  CG2 . THR A 1 127 ? 0.663   -8.910  6.903   1.00 47.01  ? 127  THR A CG2 1 
ATOM   529  N  N   . MET A 1 128 ? -2.836  -6.538  5.477   1.00 53.56  ? 128  MET A N   1 
ATOM   530  C  CA  . MET A 1 128 ? -4.237  -6.186  5.289   1.00 51.82  ? 128  MET A CA  1 
ATOM   531  C  C   . MET A 1 128 ? -5.110  -7.417  5.491   1.00 52.65  ? 128  MET A C   1 
ATOM   532  O  O   . MET A 1 128 ? -6.314  -7.309  5.722   1.00 59.20  ? 128  MET A O   1 
ATOM   533  C  CB  . MET A 1 128 ? -4.455  -5.599  3.895   1.00 48.07  ? 128  MET A CB  1 
ATOM   534  C  CG  . MET A 1 128 ? -3.557  -4.413  3.594   1.00 52.03  ? 128  MET A CG  1 
ATOM   535  S  SD  . MET A 1 128 ? -3.500  -3.983  1.847   1.00 49.02  ? 128  MET A SD  1 
ATOM   536  C  CE  . MET A 1 128 ? -2.244  -2.707  1.866   1.00 52.63  ? 128  MET A CE  1 
ATOM   537  N  N   . LEU A 1 129 ? -4.487  -8.588  5.399   1.00 52.33  ? 129  LEU A N   1 
ATOM   538  C  CA  . LEU A 1 129 ? -5.166  -9.849  5.660   1.00 52.04  ? 129  LEU A CA  1 
ATOM   539  C  C   . LEU A 1 129 ? -5.211  -10.114 7.156   1.00 52.04  ? 129  LEU A C   1 
ATOM   540  O  O   . LEU A 1 129 ? -4.173  -10.239 7.804   1.00 54.59  ? 129  LEU A O   1 
ATOM   541  C  CB  . LEU A 1 129 ? -4.451  -11.000 4.952   1.00 59.09  ? 129  LEU A CB  1 
ATOM   542  C  CG  . LEU A 1 129 ? -4.879  -11.358 3.527   1.00 61.28  ? 129  LEU A CG  1 
ATOM   543  C  CD1 . LEU A 1 129 ? -5.245  -10.125 2.716   1.00 66.17  ? 129  LEU A CD1 1 
ATOM   544  C  CD2 . LEU A 1 129 ? -3.783  -12.157 2.839   1.00 60.74  ? 129  LEU A CD2 1 
ATOM   545  N  N   . THR A 1 130 ? -6.421  -10.189 7.701   1.00 52.83  ? 130  THR A N   1 
ATOM   546  C  CA  . THR A 1 130 ? -6.613  -10.463 9.120   1.00 55.95  ? 130  THR A CA  1 
ATOM   547  C  C   . THR A 1 130 ? -7.612  -11.601 9.304   1.00 51.66  ? 130  THR A C   1 
ATOM   548  O  O   . THR A 1 130 ? -8.699  -11.573 8.727   1.00 49.82  ? 130  THR A O   1 
ATOM   549  C  CB  . THR A 1 130 ? -7.127  -9.220  9.876   1.00 56.27  ? 130  THR A CB  1 
ATOM   550  O  OG1 . THR A 1 130 ? -8.389  -8.816  9.331   1.00 58.94  ? 130  THR A OG1 1 
ATOM   551  C  CG2 . THR A 1 130 ? -6.143  -8.065  9.759   1.00 59.88  ? 130  THR A CG2 1 
ATOM   552  N  N   . PRO A 1 131 ? -7.246  -12.611 10.108  1.00 48.74  ? 131  PRO A N   1 
ATOM   553  C  CA  . PRO A 1 131 ? -8.146  -13.729 10.386  1.00 54.76  ? 131  PRO A CA  1 
ATOM   554  C  C   . PRO A 1 131 ? -9.389  -13.290 11.159  1.00 57.47  ? 131  PRO A C   1 
ATOM   555  O  O   . PRO A 1 131 ? -9.416  -12.194 11.720  1.00 60.75  ? 131  PRO A O   1 
ATOM   556  C  CB  . PRO A 1 131 ? -7.288  -14.673 11.236  1.00 54.55  ? 131  PRO A CB  1 
ATOM   557  C  CG  . PRO A 1 131 ? -6.216  -13.817 11.806  1.00 50.66  ? 131  PRO A CG  1 
ATOM   558  C  CD  . PRO A 1 131 ? -5.951  -12.752 10.793  1.00 47.15  ? 131  PRO A CD  1 
ATOM   559  N  N   . GLU A 1 132 ? -10.405 -14.148 11.184  1.00 60.51  ? 132  GLU A N   1 
ATOM   560  C  CA  . GLU A 1 132 ? -11.691 -13.821 11.800  1.00 66.18  ? 132  GLU A CA  1 
ATOM   561  C  C   . GLU A 1 132 ? -11.599 -13.531 13.303  1.00 65.33  ? 132  GLU A C   1 
ATOM   562  O  O   . GLU A 1 132 ? -12.115 -12.513 13.766  1.00 61.76  ? 132  GLU A O   1 
ATOM   563  C  CB  . GLU A 1 132 ? -12.712 -14.932 11.527  1.00 69.28  ? 132  GLU A CB  1 
ATOM   564  C  CG  . GLU A 1 132 ? -14.160 -14.521 11.733  1.00 74.22  ? 132  GLU A CG  1 
ATOM   565  C  CD  . GLU A 1 132 ? -15.139 -15.532 11.165  1.00 76.82  ? 132  GLU A CD  1 
ATOM   566  O  OE1 . GLU A 1 132 ? -14.962 -16.743 11.415  1.00 77.85  ? 132  GLU A OE1 1 
ATOM   567  O  OE2 . GLU A 1 132 ? -16.089 -15.114 10.470  1.00 81.95  ? 132  GLU A OE2 1 
ATOM   568  N  N   . PRO A 1 133 ? -10.944 -14.423 14.068  1.00 65.96  ? 133  PRO A N   1 
ATOM   569  C  CA  . PRO A 1 133 ? -10.842 -14.273 15.521  1.00 71.15  ? 133  PRO A CA  1 
ATOM   570  C  C   . PRO A 1 133 ? -10.320 -12.910 15.973  1.00 70.39  ? 133  PRO A C   1 
ATOM   571  O  O   . PRO A 1 133 ? -10.778 -12.381 16.986  1.00 77.26  ? 133  PRO A O   1 
ATOM   572  C  CB  . PRO A 1 133 ? -9.847  -15.368 15.914  1.00 69.21  ? 133  PRO A CB  1 
ATOM   573  C  CG  . PRO A 1 133 ? -10.002 -16.401 14.866  1.00 68.06  ? 133  PRO A CG  1 
ATOM   574  C  CD  . PRO A 1 133 ? -10.262 -15.643 13.599  1.00 66.60  ? 133  PRO A CD  1 
ATOM   575  N  N   . VAL A 1 134 ? -9.371  -12.351 15.229  1.00 70.12  ? 134  VAL A N   1 
ATOM   576  C  CA  . VAL A 1 134 ? -8.766  -11.072 15.592  1.00 76.18  ? 134  VAL A CA  1 
ATOM   577  C  C   . VAL A 1 134 ? -9.767  -9.921  15.486  1.00 78.35  ? 134  VAL A C   1 
ATOM   578  O  O   . VAL A 1 134 ? -9.794  -9.031  16.337  1.00 83.73  ? 134  VAL A O   1 
ATOM   579  C  CB  . VAL A 1 134 ? -7.523  -10.769 14.728  1.00 76.80  ? 134  VAL A CB  1 
ATOM   580  C  CG1 . VAL A 1 134 ? -6.874  -9.468  15.163  1.00 74.63  ? 134  VAL A CG1 1 
ATOM   581  C  CG2 . VAL A 1 134 ? -6.525  -11.911 14.824  1.00 76.74  ? 134  VAL A CG2 1 
ATOM   582  N  N   . LEU A 1 135 ? -10.594 -9.950  14.444  1.00 80.85  ? 135  LEU A N   1 
ATOM   583  C  CA  . LEU A 1 135 ? -11.594 -8.908  14.231  1.00 87.54  ? 135  LEU A CA  1 
ATOM   584  C  C   . LEU A 1 135 ? -12.884 -9.190  14.997  1.00 93.16  ? 135  LEU A C   1 
ATOM   585  O  O   . LEU A 1 135 ? -13.858 -8.444  14.886  1.00 94.67  ? 135  LEU A O   1 
ATOM   586  C  CB  . LEU A 1 135 ? -11.896 -8.743  12.740  1.00 87.60  ? 135  LEU A CB  1 
ATOM   587  C  CG  . LEU A 1 135 ? -10.727 -8.367  11.828  1.00 89.35  ? 135  LEU A CG  1 
ATOM   588  C  CD1 . LEU A 1 135 ? -11.237 -8.062  10.435  1.00 89.59  ? 135  LEU A CD1 1 
ATOM   589  C  CD2 . LEU A 1 135 ? -9.978  -7.170  12.375  1.00 88.51  ? 135  LEU A CD2 1 
ATOM   590  N  N   . LYS A 1 136 ? -12.886 -10.272 15.768  1.00 97.09  ? 136  LYS A N   1 
ATOM   591  C  CA  . LYS A 1 136 ? -14.021 -10.604 16.616  1.00 102.87 ? 136  LYS A CA  1 
ATOM   592  C  C   . LYS A 1 136 ? -13.855 -9.916  17.966  1.00 105.78 ? 136  LYS A C   1 
ATOM   593  O  O   . LYS A 1 136 ? -14.825 -9.708  18.696  1.00 110.62 ? 136  LYS A O   1 
ATOM   594  C  CB  . LYS A 1 136 ? -14.133 -12.119 16.795  1.00 105.81 ? 136  LYS A CB  1 
ATOM   595  C  CG  . LYS A 1 136 ? -15.470 -12.589 17.345  1.00 108.28 ? 136  LYS A CG  1 
ATOM   596  C  CD  . LYS A 1 136 ? -15.553 -14.107 17.370  1.00 110.94 ? 136  LYS A CD  1 
ATOM   597  C  CE  . LYS A 1 136 ? -16.917 -14.578 17.848  1.00 110.91 ? 136  LYS A CE  1 
ATOM   598  N  NZ  . LYS A 1 136 ? -17.025 -16.063 17.842  1.00 108.95 ? 136  LYS A NZ  1 
ATOM   599  N  N   . THR A 1 137 ? -12.614 -9.559  18.284  1.00 106.13 ? 137  THR A N   1 
ATOM   600  C  CA  . THR A 1 137 ? -12.302 -8.891  19.540  1.00 106.68 ? 137  THR A CA  1 
ATOM   601  C  C   . THR A 1 137 ? -12.300 -7.376  19.348  1.00 106.30 ? 137  THR A C   1 
ATOM   602  O  O   . THR A 1 137 ? -11.875 -6.625  20.226  1.00 109.89 ? 137  THR A O   1 
ATOM   603  C  CB  . THR A 1 137 ? -10.937 -9.342  20.090  1.00 105.62 ? 137  THR A CB  1 
ATOM   604  O  OG1 . THR A 1 137 ? -10.583 -10.611 19.526  1.00 105.62 ? 137  THR A OG1 1 
ATOM   605  C  CG2 . THR A 1 137 ? -10.990 -9.462  21.602  1.00 106.18 ? 137  THR A CG2 1 
ATOM   606  N  N   . SER A 1 138 ? -12.780 -6.937  18.190  1.00 104.91 ? 138  SER A N   1 
ATOM   607  C  CA  . SER A 1 138 ? -12.868 -5.518  17.879  1.00 102.17 ? 138  SER A CA  1 
ATOM   608  C  C   . SER A 1 138 ? -14.285 -5.169  17.448  1.00 101.39 ? 138  SER A C   1 
ATOM   609  O  O   . SER A 1 138 ? -14.990 -4.427  18.133  1.00 95.34  ? 138  SER A O   1 
ATOM   610  C  CB  . SER A 1 138 ? -11.882 -5.154  16.770  1.00 99.98  ? 138  SER A CB  1 
ATOM   611  O  OG  . SER A 1 138 ? -10.565 -5.539  17.116  1.00 100.05 ? 138  SER A OG  1 
ATOM   612  N  N   . GLY A 1 139 ? -14.697 -5.714  16.308  1.00 104.01 ? 139  GLY A N   1 
ATOM   613  C  CA  . GLY A 1 139 ? -16.030 -5.465  15.788  1.00 108.02 ? 139  GLY A CA  1 
ATOM   614  C  C   . GLY A 1 139 ? -16.338 -6.215  14.508  1.00 114.61 ? 139  GLY A C   1 
ATOM   615  O  O   . GLY A 1 139 ? -16.138 -5.694  13.411  1.00 112.94 ? 139  GLY A O   1 
ATOM   616  N  N   . HIS A 1 140 ? -16.821 -7.446  14.649  1.00 121.13 ? 140  HIS A N   1 
ATOM   617  C  CA  . HIS A 1 140 ? -17.382 -8.178  13.522  1.00 126.73 ? 140  HIS A CA  1 
ATOM   618  C  C   . HIS A 1 140 ? -18.745 -7.566  13.225  1.00 129.04 ? 140  HIS A C   1 
ATOM   619  O  O   . HIS A 1 140 ? -19.475 -8.013  12.339  1.00 130.53 ? 140  HIS A O   1 
ATOM   620  C  CB  . HIS A 1 140 ? -17.510 -9.668  13.852  1.00 132.77 ? 140  HIS A CB  1 
ATOM   621  C  CG  . HIS A 1 140 ? -18.091 -10.488 12.741  1.00 136.70 ? 140  HIS A CG  1 
ATOM   622  N  ND1 . HIS A 1 140 ? -17.410 -10.747 11.571  1.00 137.91 ? 140  HIS A ND1 1 
ATOM   623  C  CD2 . HIS A 1 140 ? -19.287 -11.112 12.625  1.00 138.04 ? 140  HIS A CD2 1 
ATOM   624  C  CE1 . HIS A 1 140 ? -18.164 -11.491 10.781  1.00 138.62 ? 140  HIS A CE1 1 
ATOM   625  N  NE2 . HIS A 1 140 ? -19.308 -11.727 11.397  1.00 138.28 ? 140  HIS A NE2 1 
ATOM   626  N  N   . VAL A 1 141 ? -19.068 -6.522  13.983  1.00 129.14 ? 141  VAL A N   1 
ATOM   627  C  CA  . VAL A 1 141 ? -20.303 -5.776  13.814  1.00 125.92 ? 141  VAL A CA  1 
ATOM   628  C  C   . VAL A 1 141 ? -20.015 -4.281  13.692  1.00 126.58 ? 141  VAL A C   1 
ATOM   629  O  O   . VAL A 1 141 ? -20.614 -3.593  12.864  1.00 128.49 ? 141  VAL A O   1 
ATOM   630  C  CB  . VAL A 1 141 ? -21.266 -6.004  15.002  1.00 124.13 ? 141  VAL A CB  1 
ATOM   631  C  CG1 . VAL A 1 141 ? -22.528 -5.168  14.840  1.00 124.01 ? 141  VAL A CG1 1 
ATOM   632  C  CG2 . VAL A 1 141 ? -21.614 -7.479  15.135  1.00 124.23 ? 141  VAL A CG2 1 
ATOM   633  N  N   . ASP A 1 142 ? -19.086 -3.784  14.505  1.00 128.82 ? 142  ASP A N   1 
ATOM   634  C  CA  . ASP A 1 142 ? -18.908 -2.338  14.644  1.00 131.41 ? 142  ASP A CA  1 
ATOM   635  C  C   . ASP A 1 142 ? -17.524 -1.781  14.276  1.00 128.62 ? 142  ASP A C   1 
ATOM   636  O  O   . ASP A 1 142 ? -17.063 -0.809  14.877  1.00 123.67 ? 142  ASP A O   1 
ATOM   637  C  CB  . ASP A 1 142 ? -19.301 -1.888  16.055  1.00 135.31 ? 142  ASP A CB  1 
ATOM   638  C  CG  . ASP A 1 142 ? -19.967 -0.524  16.067  1.00 135.80 ? 142  ASP A CG  1 
ATOM   639  O  OD1 . ASP A 1 142 ? -20.702 -0.209  15.106  1.00 135.91 ? 142  ASP A OD1 1 
ATOM   640  O  OD2 . ASP A 1 142 ? -19.766 0.229   17.044  1.00 135.63 ? 142  ASP A OD2 1 
ATOM   641  N  N   . LYS A 1 143 ? -16.863 -2.401  13.304  1.00 129.19 ? 143  LYS A N   1 
ATOM   642  C  CA  . LYS A 1 143 ? -15.812 -1.719  12.554  1.00 127.52 ? 143  LYS A CA  1 
ATOM   643  C  C   . LYS A 1 143 ? -16.566 -1.236  11.337  1.00 120.90 ? 143  LYS A C   1 
ATOM   644  O  O   . LYS A 1 143 ? -16.201 -0.251  10.689  1.00 119.60 ? 143  LYS A O   1 
ATOM   645  C  CB  . LYS A 1 143 ? -14.667 -2.661  12.203  1.00 129.59 ? 143  LYS A CB  1 
ATOM   646  C  CG  . LYS A 1 143 ? -13.849 -3.066  13.421  1.00 130.51 ? 143  LYS A CG  1 
ATOM   647  C  CD  . LYS A 1 143 ? -13.380 -1.835  14.190  1.00 133.14 ? 143  LYS A CD  1 
ATOM   648  C  CE  . LYS A 1 143 ? -13.394 -2.073  15.692  1.00 135.16 ? 143  LYS A CE  1 
ATOM   649  N  NZ  . LYS A 1 143 ? -14.781 -2.232  16.216  1.00 135.79 ? 143  LYS A NZ  1 
ATOM   650  N  N   . PHE A 1 144 ? -17.621 -1.991  11.037  1.00 112.68 ? 144  PHE A N   1 
ATOM   651  C  CA  . PHE A 1 144 ? -18.903 -1.410  10.633  1.00 109.68 ? 144  PHE A CA  1 
ATOM   652  C  C   . PHE A 1 144 ? -19.879 -2.251  9.822   1.00 99.94  ? 144  PHE A C   1 
ATOM   653  O  O   . PHE A 1 144 ? -19.514 -2.980  8.900   1.00 93.12  ? 144  PHE A O   1 
ATOM   654  C  CB  . PHE A 1 144 ? -18.782 0.024   10.110  1.00 119.90 ? 144  PHE A CB  1 
ATOM   655  C  CG  . PHE A 1 144 ? -18.676 1.040   11.209  1.00 122.55 ? 144  PHE A CG  1 
ATOM   656  C  CD1 . PHE A 1 144 ? -18.321 2.351   10.943  1.00 123.80 ? 144  PHE A CD1 1 
ATOM   657  C  CD2 . PHE A 1 144 ? -18.906 0.665   12.527  1.00 123.35 ? 144  PHE A CD2 1 
ATOM   658  C  CE1 . PHE A 1 144 ? -18.219 3.275   11.971  1.00 124.14 ? 144  PHE A CE1 1 
ATOM   659  C  CE2 . PHE A 1 144 ? -18.801 1.579   13.555  1.00 123.65 ? 144  PHE A CE2 1 
ATOM   660  C  CZ  . PHE A 1 144 ? -18.459 2.886   13.279  1.00 123.05 ? 144  PHE A CZ  1 
ATOM   661  N  N   . ALA A 1 145 ? -21.137 -2.132  10.231  1.00 90.27  ? 145  ALA A N   1 
ATOM   662  C  CA  . ALA A 1 145 ? -22.262 -2.711  9.536   1.00 83.15  ? 145  ALA A CA  1 
ATOM   663  C  C   . ALA A 1 145 ? -23.317 -1.627  9.380   1.00 73.41  ? 145  ALA A C   1 
ATOM   664  O  O   . ALA A 1 145 ? -23.717 -0.987  10.355  1.00 76.83  ? 145  ALA A O   1 
ATOM   665  C  CB  . ALA A 1 145 ? -22.817 -3.888  10.316  1.00 85.46  ? 145  ALA A CB  1 
ATOM   666  N  N   . ASP A 1 146 ? -23.746 -1.407  8.144   1.00 64.93  ? 146  ASP A N   1 
ATOM   667  C  CA  . ASP A 1 146 ? -24.820 -0.470  7.866   1.00 58.96  ? 146  ASP A CA  1 
ATOM   668  C  C   . ASP A 1 146 ? -26.089 -1.256  7.592   1.00 57.48  ? 146  ASP A C   1 
ATOM   669  O  O   . ASP A 1 146 ? -26.037 -2.359  7.047   1.00 60.22  ? 146  ASP A O   1 
ATOM   670  C  CB  . ASP A 1 146 ? -24.474 0.401   6.659   1.00 62.01  ? 146  ASP A CB  1 
ATOM   671  C  CG  . ASP A 1 146 ? -23.279 1.297   6.910   1.00 63.04  ? 146  ASP A CG  1 
ATOM   672  O  OD1 . ASP A 1 146 ? -22.586 1.647   5.932   1.00 65.78  ? 146  ASP A OD1 1 
ATOM   673  O  OD2 . ASP A 1 146 ? -23.033 1.653   8.081   1.00 65.75  ? 146  ASP A OD2 1 
ATOM   674  N  N   . PHE A 1 147 ? -27.229 -0.695  7.978   1.00 54.25  ? 147  PHE A N   1 
ATOM   675  C  CA  . PHE A 1 147 ? -28.503 -1.341  7.708   1.00 48.14  ? 147  PHE A CA  1 
ATOM   676  C  C   . PHE A 1 147 ? -28.807 -1.272  6.218   1.00 48.49  ? 147  PHE A C   1 
ATOM   677  O  O   . PHE A 1 147 ? -28.675 -0.219  5.592   1.00 38.77  ? 147  PHE A O   1 
ATOM   678  C  CB  . PHE A 1 147 ? -29.623 -0.707  8.532   1.00 51.09  ? 147  PHE A CB  1 
ATOM   679  C  CG  . PHE A 1 147 ? -29.459 -0.890  10.013  1.00 53.11  ? 147  PHE A CG  1 
ATOM   680  C  CD1 . PHE A 1 147 ? -29.032 0.159   10.811  1.00 55.94  ? 147  PHE A CD1 1 
ATOM   681  C  CD2 . PHE A 1 147 ? -29.722 -2.115  10.607  1.00 55.29  ? 147  PHE A CD2 1 
ATOM   682  C  CE1 . PHE A 1 147 ? -28.878 -0.007  12.177  1.00 55.44  ? 147  PHE A CE1 1 
ATOM   683  C  CE2 . PHE A 1 147 ? -29.568 -2.289  11.972  1.00 54.14  ? 147  PHE A CE2 1 
ATOM   684  C  CZ  . PHE A 1 147 ? -29.145 -1.233  12.758  1.00 53.37  ? 147  PHE A CZ  1 
ATOM   685  N  N   . MET A 1 148 ? -29.199 -2.408  5.653   1.00 50.86  ? 148  MET A N   1 
ATOM   686  C  CA  . MET A 1 148 ? -29.426 -2.508  4.221   1.00 57.75  ? 148  MET A CA  1 
ATOM   687  C  C   . MET A 1 148 ? -30.831 -3.014  3.924   1.00 60.30  ? 148  MET A C   1 
ATOM   688  O  O   . MET A 1 148 ? -31.261 -4.035  4.461   1.00 62.94  ? 148  MET A O   1 
ATOM   689  C  CB  . MET A 1 148 ? -28.385 -3.434  3.590   1.00 58.37  ? 148  MET A CB  1 
ATOM   690  C  CG  . MET A 1 148 ? -28.543 -3.632  2.095   1.00 62.19  ? 148  MET A CG  1 
ATOM   691  S  SD  . MET A 1 148 ? -27.275 -4.721  1.427   1.00 66.49  ? 148  MET A SD  1 
ATOM   692  C  CE  . MET A 1 148 ? -27.529 -6.193  2.417   1.00 69.11  ? 148  MET A CE  1 
ATOM   693  N  N   . VAL A 1 149 ? -31.544 -2.288  3.070   1.00 63.56  ? 149  VAL A N   1 
ATOM   694  C  CA  . VAL A 1 149 ? -32.887 -2.682  2.665   1.00 65.19  ? 149  VAL A CA  1 
ATOM   695  C  C   . VAL A 1 149 ? -32.898 -3.168  1.219   1.00 72.88  ? 149  VAL A C   1 
ATOM   696  O  O   . VAL A 1 149 ? -32.448 -2.466  0.312   1.00 71.85  ? 149  VAL A O   1 
ATOM   697  C  CB  . VAL A 1 149 ? -33.905 -1.531  2.845   1.00 63.01  ? 149  VAL A CB  1 
ATOM   698  C  CG1 . VAL A 1 149 ? -34.198 -1.307  4.319   1.00 60.49  ? 149  VAL A CG1 1 
ATOM   699  C  CG2 . VAL A 1 149 ? -33.395 -0.250  2.196   1.00 60.96  ? 149  VAL A CG2 1 
ATOM   700  N  N   . LYS A 1 150 ? -33.403 -4.380  1.013   1.00 86.11  ? 150  LYS A N   1 
ATOM   701  C  CA  . LYS A 1 150 ? -33.479 -4.954  -0.325  1.00 96.79  ? 150  LYS A CA  1 
ATOM   702  C  C   . LYS A 1 150 ? -34.866 -4.757  -0.934  1.00 102.23 ? 150  LYS A C   1 
ATOM   703  O  O   . LYS A 1 150 ? -35.803 -4.343  -0.251  1.00 105.09 ? 150  LYS A O   1 
ATOM   704  C  CB  . LYS A 1 150 ? -33.095 -6.436  -0.306  1.00 101.61 ? 150  LYS A CB  1 
ATOM   705  C  CG  . LYS A 1 150 ? -31.651 -6.687  0.105   1.00 105.19 ? 150  LYS A CG  1 
ATOM   706  C  CD  . LYS A 1 150 ? -31.227 -8.118  -0.183  1.00 107.38 ? 150  LYS A CD  1 
ATOM   707  C  CE  . LYS A 1 150 ? -29.777 -8.348  0.211   1.00 110.78 ? 150  LYS A CE  1 
ATOM   708  N  NZ  . LYS A 1 150 ? -29.298 -9.699  -0.194  1.00 111.40 ? 150  LYS A NZ  1 
ATOM   709  N  N   . ASP A 1 151 ? -34.984 -5.068  -2.220  1.00 107.68 ? 151  ASP A N   1 
ATOM   710  C  CA  . ASP A 1 151 ? -36.191 -4.790  -2.992  1.00 109.38 ? 151  ASP A CA  1 
ATOM   711  C  C   . ASP A 1 151 ? -36.736 -6.086  -3.598  1.00 115.07 ? 151  ASP A C   1 
ATOM   712  O  O   . ASP A 1 151 ? -36.045 -6.747  -4.371  1.00 120.05 ? 151  ASP A O   1 
ATOM   713  C  CB  . ASP A 1 151 ? -35.853 -3.778  -4.090  1.00 105.86 ? 151  ASP A CB  1 
ATOM   714  C  CG  . ASP A 1 151 ? -37.076 -3.277  -4.827  1.00 106.23 ? 151  ASP A CG  1 
ATOM   715  O  OD1 . ASP A 1 151 ? -36.905 -2.544  -5.824  1.00 103.97 ? 151  ASP A OD1 1 
ATOM   716  O  OD2 . ASP A 1 151 ? -38.205 -3.614  -4.415  1.00 108.76 ? 151  ASP A OD2 1 
ATOM   717  N  N   . VAL A 1 152 ? -37.974 -6.445  -3.254  1.00 120.06 ? 152  VAL A N   1 
ATOM   718  C  CA  . VAL A 1 152 ? -38.519 -7.770  -3.609  1.00 124.04 ? 152  VAL A CA  1 
ATOM   719  C  C   . VAL A 1 152 ? -38.845 -8.005  -5.092  1.00 125.64 ? 152  VAL A C   1 
ATOM   720  O  O   . VAL A 1 152 ? -39.615 -8.901  -5.445  1.00 128.20 ? 152  VAL A O   1 
ATOM   721  C  CB  . VAL A 1 152 ? -39.707 -8.188  -2.706  1.00 125.18 ? 152  VAL A CB  1 
ATOM   722  C  CG1 . VAL A 1 152 ? -39.215 -9.091  -1.572  1.00 125.11 ? 152  VAL A CG1 1 
ATOM   723  C  CG2 . VAL A 1 152 ? -40.431 -6.962  -2.155  1.00 124.20 ? 152  VAL A CG2 1 
ATOM   724  N  N   . LYS A 1 153 ? -38.260 -7.167  -5.935  1.00 127.47 ? 153  LYS A N   1 
ATOM   725  C  CA  . LYS A 1 153 ? -37.980 -7.485  -7.326  1.00 128.46 ? 153  LYS A CA  1 
ATOM   726  C  C   . LYS A 1 153 ? -36.987 -6.398  -7.677  1.00 127.26 ? 153  LYS A C   1 
ATOM   727  O  O   . LYS A 1 153 ? -36.964 -5.359  -7.015  1.00 132.65 ? 153  LYS A O   1 
ATOM   728  C  CB  . LYS A 1 153 ? -39.223 -7.410  -8.214  1.00 132.49 ? 153  LYS A CB  1 
ATOM   729  C  CG  . LYS A 1 153 ? -39.174 -8.414  -9.368  1.00 133.85 ? 153  LYS A CG  1 
ATOM   730  C  CD  . LYS A 1 153 ? -40.162 -8.081  -10.478 1.00 133.82 ? 153  LYS A CD  1 
ATOM   731  C  CE  . LYS A 1 153 ? -40.077 -9.119  -11.594 1.00 133.71 ? 153  LYS A CE  1 
ATOM   732  N  NZ  . LYS A 1 153 ? -40.902 -8.738  -12.779 1.00 134.44 ? 153  LYS A NZ  1 
ATOM   733  N  N   . ASN A 1 154 ? -36.150 -6.622  -8.682  1.00 120.45 ? 154  ASN A N   1 
ATOM   734  C  CA  . ASN A 1 154 ? -35.109 -5.652  -8.976  1.00 115.02 ? 154  ASN A CA  1 
ATOM   735  C  C   . ASN A 1 154 ? -34.055 -5.701  -7.867  1.00 111.38 ? 154  ASN A C   1 
ATOM   736  O  O   . ASN A 1 154 ? -33.113 -4.911  -7.857  1.00 113.92 ? 154  ASN A O   1 
ATOM   737  C  CB  . ASN A 1 154 ? -35.726 -4.251  -9.079  1.00 117.41 ? 154  ASN A CB  1 
ATOM   738  C  CG  . ASN A 1 154 ? -34.858 -3.275  -9.851  1.00 118.80 ? 154  ASN A CG  1 
ATOM   739  O  OD1 . ASN A 1 154 ? -35.355 -2.293  -10.402 1.00 119.59 ? 154  ASN A OD1 1 
ATOM   740  N  ND2 . ASN A 1 154 ? -33.557 -3.538  -9.895  1.00 119.91 ? 154  ASN A ND2 1 
ATOM   741  N  N   . GLY A 1 155 ? -34.239 -6.641  -6.940  1.00 105.57 ? 155  GLY A N   1 
ATOM   742  C  CA  . GLY A 1 155 ? -33.309 -6.925  -5.838  1.00 98.12  ? 155  GLY A CA  1 
ATOM   743  C  C   . GLY A 1 155 ? -32.334 -5.863  -5.354  1.00 92.05  ? 155  GLY A C   1 
ATOM   744  O  O   . GLY A 1 155 ? -31.619 -6.080  -4.375  1.00 87.82  ? 155  GLY A O   1 
ATOM   745  N  N   . GLU A 1 156 ? -32.301 -4.721  -6.034  1.00 87.38  ? 156  GLU A N   1 
ATOM   746  C  CA  . GLU A 1 156 ? -31.346 -3.655  -5.730  1.00 83.07  ? 156  GLU A CA  1 
ATOM   747  C  C   . GLU A 1 156 ? -31.237 -3.357  -4.236  1.00 77.98  ? 156  GLU A C   1 
ATOM   748  O  O   . GLU A 1 156 ? -32.246 -3.210  -3.545  1.00 79.39  ? 156  GLU A O   1 
ATOM   749  C  CB  . GLU A 1 156 ? -31.711 -2.379  -6.494  1.00 84.37  ? 156  GLU A CB  1 
ATOM   750  C  CG  . GLU A 1 156 ? -30.731 -1.234  -6.300  1.00 89.00  ? 156  GLU A CG  1 
ATOM   751  C  CD  . GLU A 1 156 ? -31.119 0.006   -7.083  1.00 90.70  ? 156  GLU A CD  1 
ATOM   752  O  OE1 . GLU A 1 156 ? -32.109 -0.051  -7.842  1.00 93.93  ? 156  GLU A OE1 1 
ATOM   753  O  OE2 . GLU A 1 156 ? -30.431 1.039   -6.937  1.00 91.36  ? 156  GLU A OE2 1 
ATOM   754  N  N   . CYS A 1 157 ? -30.002 -3.270  -3.749  1.00 71.80  ? 157  CYS A N   1 
ATOM   755  C  CA  . CYS A 1 157 ? -29.744 -2.985  -2.342  1.00 65.30  ? 157  CYS A CA  1 
ATOM   756  C  C   . CYS A 1 157 ? -29.579 -1.491  -2.093  1.00 61.68  ? 157  CYS A C   1 
ATOM   757  O  O   . CYS A 1 157 ? -29.060 -0.763  -2.939  1.00 57.94  ? 157  CYS A O   1 
ATOM   758  C  CB  . CYS A 1 157 ? -28.499 -3.733  -1.865  1.00 66.95  ? 157  CYS A CB  1 
ATOM   759  S  SG  . CYS A 1 157 ? -28.666 -5.530  -1.865  1.00 72.41  ? 157  CYS A SG  1 
ATOM   760  N  N   . PHE A 1 158 ? -30.022 -1.043  -0.923  1.00 59.92  ? 158  PHE A N   1 
ATOM   761  C  CA  . PHE A 1 158 ? -29.929 0.363   -0.553  1.00 57.12  ? 158  PHE A CA  1 
ATOM   762  C  C   . PHE A 1 158 ? -29.420 0.529   0.872   1.00 53.22  ? 158  PHE A C   1 
ATOM   763  O  O   . PHE A 1 158 ? -29.535 -0.378  1.695   1.00 50.41  ? 158  PHE A O   1 
ATOM   764  C  CB  . PHE A 1 158 ? -31.294 1.042   -0.672  1.00 55.67  ? 158  PHE A CB  1 
ATOM   765  C  CG  . PHE A 1 158 ? -31.847 1.064   -2.067  1.00 55.64  ? 158  PHE A CG  1 
ATOM   766  C  CD1 . PHE A 1 158 ? -31.542 2.105   -2.930  1.00 53.91  ? 158  PHE A CD1 1 
ATOM   767  C  CD2 . PHE A 1 158 ? -32.685 0.054   -2.511  1.00 53.95  ? 158  PHE A CD2 1 
ATOM   768  C  CE1 . PHE A 1 158 ? -32.055 2.132   -4.212  1.00 52.69  ? 158  PHE A CE1 1 
ATOM   769  C  CE2 . PHE A 1 158 ? -33.201 0.075   -3.792  1.00 55.79  ? 158  PHE A CE2 1 
ATOM   770  C  CZ  . PHE A 1 158 ? -32.887 1.116   -4.642  1.00 53.92  ? 158  PHE A CZ  1 
ATOM   771  N  N   . ARG A 1 159 ? -28.857 1.698   1.155   1.00 58.56  ? 159  ARG A N   1 
ATOM   772  C  CA  . ARG A 1 159 ? -28.469 2.054   2.511   1.00 67.38  ? 159  ARG A CA  1 
ATOM   773  C  C   . ARG A 1 159 ? -29.688 2.615   3.237   1.00 65.10  ? 159  ARG A C   1 
ATOM   774  O  O   . ARG A 1 159 ? -30.279 3.603   2.798   1.00 62.48  ? 159  ARG A O   1 
ATOM   775  C  CB  . ARG A 1 159 ? -27.336 3.082   2.485   1.00 74.73  ? 159  ARG A CB  1 
ATOM   776  C  CG  . ARG A 1 159 ? -26.823 3.487   3.856   1.00 81.30  ? 159  ARG A CG  1 
ATOM   777  C  CD  . ARG A 1 159 ? -25.778 4.586   3.746   1.00 85.20  ? 159  ARG A CD  1 
ATOM   778  N  NE  . ARG A 1 159 ? -25.445 5.155   5.049   1.00 90.27  ? 159  ARG A NE  1 
ATOM   779  C  CZ  . ARG A 1 159 ? -24.397 4.789   5.779   1.00 92.02  ? 159  ARG A CZ  1 
ATOM   780  N  NH1 . ARG A 1 159 ? -23.568 3.856   5.332   1.00 94.67  ? 159  ARG A NH1 1 
ATOM   781  N  NH2 . ARG A 1 159 ? -24.172 5.361   6.955   1.00 90.76  ? 159  ARG A NH2 1 
ATOM   782  N  N   . ALA A 1 160 ? -30.067 1.976   4.340   1.00 60.14  ? 160  ALA A N   1 
ATOM   783  C  CA  . ALA A 1 160 ? -31.280 2.348   5.068   1.00 62.05  ? 160  ALA A CA  1 
ATOM   784  C  C   . ALA A 1 160 ? -31.254 3.795   5.552   1.00 64.25  ? 160  ALA A C   1 
ATOM   785  O  O   . ALA A 1 160 ? -32.154 4.575   5.239   1.00 65.76  ? 160  ALA A O   1 
ATOM   786  C  CB  . ALA A 1 160 ? -31.516 1.399   6.233   1.00 58.83  ? 160  ALA A CB  1 
ATOM   787  N  N   . ASP A 1 161 ? -30.222 4.146   6.315   1.00 65.12  ? 161  ASP A N   1 
ATOM   788  C  CA  . ASP A 1 161 ? -30.069 5.505   6.828   1.00 68.64  ? 161  ASP A CA  1 
ATOM   789  C  C   . ASP A 1 161 ? -30.219 6.538   5.718   1.00 69.36  ? 161  ASP A C   1 
ATOM   790  O  O   . ASP A 1 161 ? -30.765 7.619   5.934   1.00 70.62  ? 161  ASP A O   1 
ATOM   791  C  CB  . ASP A 1 161 ? -28.711 5.674   7.513   1.00 74.71  ? 161  ASP A CB  1 
ATOM   792  C  CG  . ASP A 1 161 ? -28.645 4.982   8.860   1.00 78.48  ? 161  ASP A CG  1 
ATOM   793  O  OD1 . ASP A 1 161 ? -29.654 4.368   9.268   1.00 81.18  ? 161  ASP A OD1 1 
ATOM   794  O  OD2 . ASP A 1 161 ? -27.583 5.055   9.513   1.00 80.30  ? 161  ASP A OD2 1 
ATOM   795  N  N   . HIS A 1 162 ? -29.733 6.192   4.530   1.00 71.93  ? 162  HIS A N   1 
ATOM   796  C  CA  . HIS A 1 162 ? -29.776 7.089   3.382   1.00 71.18  ? 162  HIS A CA  1 
ATOM   797  C  C   . HIS A 1 162 ? -31.196 7.280   2.856   1.00 66.93  ? 162  HIS A C   1 
ATOM   798  O  O   . HIS A 1 162 ? -31.653 8.410   2.688   1.00 61.35  ? 162  HIS A O   1 
ATOM   799  C  CB  . HIS A 1 162 ? -28.862 6.572   2.269   1.00 81.84  ? 162  HIS A CB  1 
ATOM   800  C  CG  . HIS A 1 162 ? -28.869 7.422   1.037   1.00 85.19  ? 162  HIS A CG  1 
ATOM   801  N  ND1 . HIS A 1 162 ? -29.494 7.037   -0.129  1.00 85.86  ? 162  HIS A ND1 1 
ATOM   802  C  CD2 . HIS A 1 162 ? -28.330 8.639   0.792   1.00 86.24  ? 162  HIS A CD2 1 
ATOM   803  C  CE1 . HIS A 1 162 ? -29.338 7.980   -1.041  1.00 87.81  ? 162  HIS A CE1 1 
ATOM   804  N  NE2 . HIS A 1 162 ? -28.635 8.963   -0.508  1.00 87.83  ? 162  HIS A NE2 1 
ATOM   805  N  N   . LEU A 1 163 ? -31.888 6.173   2.598   1.00 66.70  ? 163  LEU A N   1 
ATOM   806  C  CA  . LEU A 1 163 ? -33.249 6.227   2.070   1.00 62.97  ? 163  LEU A CA  1 
ATOM   807  C  C   . LEU A 1 163 ? -34.203 6.933   3.022   1.00 60.43  ? 163  LEU A C   1 
ATOM   808  O  O   . LEU A 1 163 ? -34.950 7.822   2.615   1.00 59.78  ? 163  LEU A O   1 
ATOM   809  C  CB  . LEU A 1 163 ? -33.777 4.825   1.758   1.00 63.01  ? 163  LEU A CB  1 
ATOM   810  C  CG  . LEU A 1 163 ? -33.233 4.135   0.509   1.00 64.86  ? 163  LEU A CG  1 
ATOM   811  C  CD1 . LEU A 1 163 ? -34.172 3.018   0.088   1.00 63.55  ? 163  LEU A CD1 1 
ATOM   812  C  CD2 . LEU A 1 163 ? -33.056 5.136   -0.619  1.00 65.13  ? 163  LEU A CD2 1 
ATOM   813  N  N   . LEU A 1 164 ? -34.174 6.533   4.290   1.00 54.29  ? 164  LEU A N   1 
ATOM   814  C  CA  . LEU A 1 164 ? -35.058 7.112   5.291   1.00 57.62  ? 164  LEU A CA  1 
ATOM   815  C  C   . LEU A 1 164 ? -34.854 8.621   5.366   1.00 57.34  ? 164  LEU A C   1 
ATOM   816  O  O   . LEU A 1 164 ? -35.816 9.385   5.334   1.00 54.42  ? 164  LEU A O   1 
ATOM   817  C  CB  . LEU A 1 164 ? -34.814 6.479   6.663   1.00 62.08  ? 164  LEU A CB  1 
ATOM   818  C  CG  . LEU A 1 164 ? -36.038 6.184   7.538   1.00 63.50  ? 164  LEU A CG  1 
ATOM   819  C  CD1 . LEU A 1 164 ? -35.621 5.995   8.986   1.00 64.02  ? 164  LEU A CD1 1 
ATOM   820  C  CD2 . LEU A 1 164 ? -37.092 7.273   7.436   1.00 63.42  ? 164  LEU A CD2 1 
ATOM   821  N  N   . LYS A 1 165 ? -33.596 9.044   5.456   1.00 63.76  ? 165  LYS A N   1 
ATOM   822  C  CA  . LYS A 1 165 ? -33.266 10.463  5.543   1.00 69.22  ? 165  LYS A CA  1 
ATOM   823  C  C   . LYS A 1 165 ? -33.745 11.226  4.313   1.00 69.07  ? 165  LYS A C   1 
ATOM   824  O  O   . LYS A 1 165 ? -34.412 12.253  4.433   1.00 71.01  ? 165  LYS A O   1 
ATOM   825  C  CB  . LYS A 1 165 ? -31.759 10.658  5.726   1.00 74.70  ? 165  LYS A CB  1 
ATOM   826  C  CG  . LYS A 1 165 ? -31.343 12.103  5.944   1.00 79.35  ? 165  LYS A CG  1 
ATOM   827  C  CD  . LYS A 1 165 ? -29.842 12.221  6.153   1.00 82.86  ? 165  LYS A CD  1 
ATOM   828  C  CE  . LYS A 1 165 ? -29.428 13.668  6.366   1.00 84.00  ? 165  LYS A CE  1 
ATOM   829  N  NZ  . LYS A 1 165 ? -27.954 13.804  6.531   1.00 83.53  ? 165  LYS A NZ  1 
ATOM   830  N  N   . ALA A 1 166 ? -33.402 10.717  3.134   1.00 71.25  ? 166  ALA A N   1 
ATOM   831  C  CA  . ALA A 1 166 ? -33.788 11.353  1.879   1.00 74.00  ? 166  ALA A CA  1 
ATOM   832  C  C   . ALA A 1 166 ? -35.305 11.421  1.732   1.00 76.40  ? 166  ALA A C   1 
ATOM   833  O  O   . ALA A 1 166 ? -35.850 12.441  1.311   1.00 75.72  ? 166  ALA A O   1 
ATOM   834  C  CB  . ALA A 1 166 ? -33.170 10.620  0.697   1.00 70.11  ? 166  ALA A CB  1 
ATOM   835  N  N   . HIS A 1 167 ? -35.980 10.332  2.088   1.00 77.57  ? 167  HIS A N   1 
ATOM   836  C  CA  . HIS A 1 167 ? -37.433 10.261  1.982   1.00 79.50  ? 167  HIS A CA  1 
ATOM   837  C  C   . HIS A 1 167 ? -38.129 11.123  3.032   1.00 77.76  ? 167  HIS A C   1 
ATOM   838  O  O   . HIS A 1 167 ? -39.229 11.625  2.801   1.00 75.96  ? 167  HIS A O   1 
ATOM   839  C  CB  . HIS A 1 167 ? -37.914 8.811   2.076   1.00 85.59  ? 167  HIS A CB  1 
ATOM   840  C  CG  . HIS A 1 167 ? -39.404 8.669   2.081   1.00 89.62  ? 167  HIS A CG  1 
ATOM   841  N  ND1 . HIS A 1 167 ? -40.204 9.182   1.083   1.00 91.48  ? 167  HIS A ND1 1 
ATOM   842  C  CD2 . HIS A 1 167 ? -40.239 8.066   2.960   1.00 90.07  ? 167  HIS A CD2 1 
ATOM   843  C  CE1 . HIS A 1 167 ? -41.468 8.905   1.349   1.00 92.85  ? 167  HIS A CE1 1 
ATOM   844  N  NE2 . HIS A 1 167 ? -41.517 8.228   2.481   1.00 90.65  ? 167  HIS A NE2 1 
ATOM   845  N  N   . LEU A 1 168 ? -37.489 11.288  4.186   1.00 81.31  ? 168  LEU A N   1 
ATOM   846  C  CA  . LEU A 1 168 ? -38.012 12.184  5.211   1.00 81.34  ? 168  LEU A CA  1 
ATOM   847  C  C   . LEU A 1 168 ? -37.929 13.624  4.731   1.00 86.02  ? 168  LEU A C   1 
ATOM   848  O  O   . LEU A 1 168 ? -38.863 14.397  4.919   1.00 91.98  ? 168  LEU A O   1 
ATOM   849  C  CB  . LEU A 1 168 ? -37.261 12.021  6.534   1.00 79.09  ? 168  LEU A CB  1 
ATOM   850  C  CG  . LEU A 1 168 ? -37.682 10.845  7.419   1.00 76.93  ? 168  LEU A CG  1 
ATOM   851  C  CD1 . LEU A 1 168 ? -36.911 10.857  8.728   1.00 78.45  ? 168  LEU A CD1 1 
ATOM   852  C  CD2 . LEU A 1 168 ? -39.177 10.874  7.680   1.00 75.87  ? 168  LEU A CD2 1 
ATOM   853  N  N   . GLN A 1 169 ? -36.810 13.973  4.101   1.00 92.26  ? 169  GLN A N   1 
ATOM   854  C  CA  . GLN A 1 169 ? -36.621 15.313  3.554   1.00 99.16  ? 169  GLN A CA  1 
ATOM   855  C  C   . GLN A 1 169 ? -37.558 15.569  2.375   1.00 103.21 ? 169  GLN A C   1 
ATOM   856  O  O   . GLN A 1 169 ? -37.864 16.718  2.055   1.00 105.39 ? 169  GLN A O   1 
ATOM   857  C  CB  . GLN A 1 169 ? -35.163 15.531  3.141   1.00 100.12 ? 169  GLN A CB  1 
ATOM   858  C  CG  . GLN A 1 169 ? -34.175 15.447  4.297   1.00 103.28 ? 169  GLN A CG  1 
ATOM   859  C  CD  . GLN A 1 169 ? -32.756 15.786  3.885   1.00 103.46 ? 169  GLN A CD  1 
ATOM   860  O  OE1 . GLN A 1 169 ? -31.813 15.065  4.213   1.00 103.31 ? 169  GLN A OE1 1 
ATOM   861  N  NE2 . GLN A 1 169 ? -32.597 16.888  3.160   1.00 106.23 ? 169  GLN A NE2 1 
ATOM   862  N  N   . LYS A 1 170 ? -38.006 14.493  1.733   1.00 106.79 ? 170  LYS A N   1 
ATOM   863  C  CA  . LYS A 1 170 ? -39.004 14.589  0.673   1.00 111.24 ? 170  LYS A CA  1 
ATOM   864  C  C   . LYS A 1 170 ? -40.326 15.080  1.246   1.00 110.84 ? 170  LYS A C   1 
ATOM   865  O  O   . LYS A 1 170 ? -40.842 16.120  0.841   1.00 109.99 ? 170  LYS A O   1 
ATOM   866  C  CB  . LYS A 1 170 ? -39.223 13.230  0.003   1.00 113.98 ? 170  LYS A CB  1 
ATOM   867  C  CG  . LYS A 1 170 ? -38.120 12.788  -0.941  1.00 117.26 ? 170  LYS A CG  1 
ATOM   868  C  CD  . LYS A 1 170 ? -38.447 11.429  -1.544  1.00 117.27 ? 170  LYS A CD  1 
ATOM   869  C  CE  . LYS A 1 170 ? -37.341 10.939  -2.463  1.00 117.87 ? 170  LYS A CE  1 
ATOM   870  N  NZ  . LYS A 1 170 ? -37.649 9.596   -3.028  1.00 117.30 ? 170  LYS A NZ  1 
ATOM   871  N  N   . LEU A 1 171 ? -40.867 14.320  2.194   1.00 111.09 ? 171  LEU A N   1 
ATOM   872  C  CA  . LEU A 1 171 ? -42.148 14.650  2.810   1.00 110.19 ? 171  LEU A CA  1 
ATOM   873  C  C   . LEU A 1 171 ? -41.998 15.725  3.881   1.00 111.38 ? 171  LEU A C   1 
ATOM   874  O  O   . LEU A 1 171 ? -42.986 16.291  4.346   1.00 115.82 ? 171  LEU A O   1 
ATOM   875  C  CB  . LEU A 1 171 ? -42.802 13.397  3.397   1.00 109.02 ? 171  LEU A CB  1 
ATOM   876  C  CG  . LEU A 1 171 ? -43.165 12.295  2.398   1.00 110.88 ? 171  LEU A CG  1 
ATOM   877  C  CD1 . LEU A 1 171 ? -43.772 11.100  3.117   1.00 110.21 ? 171  LEU A CD1 1 
ATOM   878  C  CD2 . LEU A 1 171 ? -44.114 12.820  1.328   1.00 111.48 ? 171  LEU A CD2 1 
ATOM   879  N  N   . MET A 1 172 ? -40.756 16.000  4.268   1.00 113.80 ? 172  MET A N   1 
ATOM   880  C  CA  . MET A 1 172 ? -40.468 17.093  5.185   1.00 116.47 ? 172  MET A CA  1 
ATOM   881  C  C   . MET A 1 172 ? -40.634 18.410  4.440   1.00 118.03 ? 172  MET A C   1 
ATOM   882  O  O   . MET A 1 172 ? -40.946 19.441  5.035   1.00 116.45 ? 172  MET A O   1 
ATOM   883  C  CB  . MET A 1 172 ? -39.046 16.970  5.726   1.00 117.17 ? 172  MET A CB  1 
ATOM   884  C  CG  . MET A 1 172 ? -38.796 17.727  7.010   1.00 117.42 ? 172  MET A CG  1 
ATOM   885  S  SD  . MET A 1 172 ? -37.285 17.165  7.810   1.00 119.53 ? 172  MET A SD  1 
ATOM   886  C  CE  . MET A 1 172 ? -37.301 18.177  9.280   1.00 117.66 ? 172  MET A CE  1 
ATOM   887  N  N   . SER A 1 173 ? -40.421 18.359  3.127   1.00 121.46 ? 173  SER A N   1 
ATOM   888  C  CA  . SER A 1 173 ? -40.605 19.521  2.264   1.00 123.87 ? 173  SER A CA  1 
ATOM   889  C  C   . SER A 1 173 ? -41.457 19.173  1.047   1.00 125.73 ? 173  SER A C   1 
ATOM   890  O  O   . SER A 1 173 ? -40.955 18.952  -0.056  1.00 123.87 ? 173  SER A O   1 
ATOM   891  C  CB  . SER A 1 173 ? -39.257 20.105  1.841   1.00 124.39 ? 173  SER A CB  1 
ATOM   892  O  OG  . SER A 1 173 ? -38.561 20.627  2.961   1.00 124.56 ? 173  SER A OG  1 
ATOM   893  N  N   . ASP A 1 174 ? -42.759 19.131  1.287   1.00 129.01 ? 174  ASP A N   1 
ATOM   894  C  CA  . ASP A 1 174 ? -43.771 18.801  0.310   1.00 130.79 ? 174  ASP A CA  1 
ATOM   895  C  C   . ASP A 1 174 ? -44.946 19.335  1.090   1.00 129.26 ? 174  ASP A C   1 
ATOM   896  O  O   . ASP A 1 174 ? -45.362 18.710  2.077   1.00 128.51 ? 174  ASP A O   1 
ATOM   897  C  CB  . ASP A 1 174 ? -43.897 17.279  0.206   1.00 131.02 ? 174  ASP A CB  1 
ATOM   898  C  CG  . ASP A 1 174 ? -43.758 16.769  -1.217  1.00 131.32 ? 174  ASP A CG  1 
ATOM   899  O  OD1 . ASP A 1 174 ? -44.445 17.297  -2.119  1.00 131.48 ? 174  ASP A OD1 1 
ATOM   900  O  OD2 . ASP A 1 174 ? -42.962 15.825  -1.429  1.00 130.80 ? 174  ASP A OD2 1 
ATOM   901  N  N   . LYS A 1 175 ? -45.476 20.496  0.716   1.00 129.09 ? 175  LYS A N   1 
ATOM   902  C  CA  . LYS A 1 175 ? -46.347 21.154  1.683   1.00 130.56 ? 175  LYS A CA  1 
ATOM   903  C  C   . LYS A 1 175 ? -47.808 21.442  1.353   1.00 129.98 ? 175  LYS A C   1 
ATOM   904  O  O   . LYS A 1 175 ? -48.228 22.588  1.182   1.00 129.78 ? 175  LYS A O   1 
ATOM   905  C  CB  . LYS A 1 175 ? -45.648 22.341  2.351   1.00 131.60 ? 175  LYS A CB  1 
ATOM   906  C  CG  . LYS A 1 175 ? -44.521 21.885  3.271   1.00 132.82 ? 175  LYS A CG  1 
ATOM   907  C  CD  . LYS A 1 175 ? -44.537 22.622  4.590   1.00 133.62 ? 175  LYS A CD  1 
ATOM   908  C  CE  . LYS A 1 175 ? -44.131 24.073  4.415   1.00 134.84 ? 175  LYS A CE  1 
ATOM   909  N  NZ  . LYS A 1 175 ? -42.743 24.199  3.887   1.00 134.60 ? 175  LYS A NZ  1 
ATOM   910  N  N   . LYS A 1 176 ? -48.556 20.350  1.268   1.00 130.82 ? 176  LYS A N   1 
ATOM   911  C  CA  . LYS A 1 176 ? -49.937 20.324  1.691   1.00 130.27 ? 176  LYS A CA  1 
ATOM   912  C  C   . LYS A 1 176 ? -49.829 19.672  3.068   1.00 129.67 ? 176  LYS A C   1 
ATOM   913  O  O   . LYS A 1 176 ? -50.823 19.255  3.664   1.00 133.01 ? 176  LYS A O   1 
ATOM   914  C  CB  . LYS A 1 176 ? -50.780 19.467  0.750   1.00 129.05 ? 176  LYS A CB  1 
ATOM   915  C  CG  . LYS A 1 176 ? -50.551 17.970  0.896   1.00 127.87 ? 176  LYS A CG  1 
ATOM   916  C  CD  . LYS A 1 176 ? -51.317 17.183  -0.153  1.00 128.21 ? 176  LYS A CD  1 
ATOM   917  C  CE  . LYS A 1 176 ? -50.589 17.185  -1.487  1.00 127.67 ? 176  LYS A CE  1 
ATOM   918  N  NZ  . LYS A 1 176 ? -51.229 16.265  -2.468  1.00 127.05 ? 176  LYS A NZ  1 
ATOM   919  N  N   . CYS A 1 177 ? -48.590 19.600  3.558   1.00 126.64 ? 177  CYS A N   1 
ATOM   920  C  CA  . CYS A 1 177 ? -48.244 18.883  4.785   1.00 122.83 ? 177  CYS A CA  1 
ATOM   921  C  C   . CYS A 1 177 ? -48.311 19.766  6.031   1.00 118.67 ? 177  CYS A C   1 
ATOM   922  O  O   . CYS A 1 177 ? -48.520 20.976  5.938   1.00 122.75 ? 177  CYS A O   1 
ATOM   923  C  CB  . CYS A 1 177 ? -46.846 18.269  4.654   1.00 125.92 ? 177  CYS A CB  1 
ATOM   924  S  SG  . CYS A 1 177 ? -46.213 17.471  6.149   1.00 127.05 ? 177  CYS A SG  1 
ATOM   925  N  N   . SER A 1 178 ? -48.121 19.150  7.196   1.00 111.64 ? 178  SER A N   1 
ATOM   926  C  CA  . SER A 1 178 ? -48.297 19.843  8.473   1.00 106.05 ? 178  SER A CA  1 
ATOM   927  C  C   . SER A 1 178 ? -46.995 20.305  9.128   1.00 100.68 ? 178  SER A C   1 
ATOM   928  O  O   . SER A 1 178 ? -45.907 19.830  8.798   1.00 103.73 ? 178  SER A O   1 
ATOM   929  C  CB  . SER A 1 178 ? -49.095 18.976  9.454   1.00 106.02 ? 178  SER A CB  1 
ATOM   930  O  OG  . SER A 1 178 ? -48.422 17.761  9.736   1.00 108.91 ? 178  SER A OG  1 
ATOM   931  N  N   . VAL A 1 179 ? -47.135 21.240  10.064  1.00 93.34  ? 179  VAL A N   1 
ATOM   932  C  CA  . VAL A 1 179 ? -46.011 21.798  10.806  1.00 90.59  ? 179  VAL A CA  1 
ATOM   933  C  C   . VAL A 1 179 ? -45.608 20.870  11.947  1.00 87.03  ? 179  VAL A C   1 
ATOM   934  O  O   . VAL A 1 179 ? -44.437 20.800  12.323  1.00 94.08  ? 179  VAL A O   1 
ATOM   935  C  CB  . VAL A 1 179 ? -46.362 23.188  11.380  1.00 90.66  ? 179  VAL A CB  1 
ATOM   936  C  CG1 . VAL A 1 179 ? -45.170 23.788  12.113  1.00 89.78  ? 179  VAL A CG1 1 
ATOM   937  C  CG2 . VAL A 1 179 ? -46.835 24.118  10.271  1.00 89.38  ? 179  VAL A CG2 1 
ATOM   938  N  N   . GLU A 1 180 ? -46.586 20.156  12.494  1.00 84.44  ? 180  GLU A N   1 
ATOM   939  C  CA  . GLU A 1 180 ? -46.335 19.221  13.583  1.00 82.06  ? 180  GLU A CA  1 
ATOM   940  C  C   . GLU A 1 180 ? -45.635 17.961  13.080  1.00 80.02  ? 180  GLU A C   1 
ATOM   941  O  O   . GLU A 1 180 ? -44.987 17.251  13.850  1.00 80.09  ? 180  GLU A O   1 
ATOM   942  C  CB  . GLU A 1 180 ? -47.638 18.867  14.306  1.00 85.41  ? 180  GLU A CB  1 
ATOM   943  C  CG  . GLU A 1 180 ? -48.164 19.954  15.238  1.00 86.71  ? 180  GLU A CG  1 
ATOM   944  C  CD  . GLU A 1 180 ? -48.840 21.101  14.505  1.00 88.70  ? 180  GLU A CD  1 
ATOM   945  O  OE1 . GLU A 1 180 ? -48.991 21.023  13.267  1.00 88.26  ? 180  GLU A OE1 1 
ATOM   946  O  OE2 . GLU A 1 180 ? -49.226 22.084  15.173  1.00 89.87  ? 180  GLU A OE2 1 
ATOM   947  N  N   . LYS A 1 181 ? -45.769 17.688  11.784  1.00 74.56  ? 181  LYS A N   1 
ATOM   948  C  CA  . LYS A 1 181 ? -45.036 16.596  11.150  1.00 73.55  ? 181  LYS A CA  1 
ATOM   949  C  C   . LYS A 1 181 ? -43.572 16.964  10.945  1.00 78.51  ? 181  LYS A C   1 
ATOM   950  O  O   . LYS A 1 181 ? -42.685 16.134  11.146  1.00 84.81  ? 181  LYS A O   1 
ATOM   951  C  CB  . LYS A 1 181 ? -45.671 16.208  9.814   1.00 62.17  ? 181  LYS A CB  1 
ATOM   952  C  CG  . LYS A 1 181 ? -46.467 14.917  9.858   1.00 59.26  ? 181  LYS A CG  1 
ATOM   953  C  CD  . LYS A 1 181 ? -45.547 13.709  9.964   1.00 58.31  ? 181  LYS A CD  1 
ATOM   954  C  CE  . LYS A 1 181 ? -46.333 12.410  9.911   1.00 58.67  ? 181  LYS A CE  1 
ATOM   955  N  NZ  . LYS A 1 181 ? -45.452 11.212  9.946   1.00 57.62  ? 181  LYS A NZ  1 
ATOM   956  N  N   . LYS A 1 182 ? -43.326 18.208  10.540  1.00 80.98  ? 182  LYS A N   1 
ATOM   957  C  CA  . LYS A 1 182 ? -41.963 18.707  10.387  1.00 82.49  ? 182  LYS A CA  1 
ATOM   958  C  C   . LYS A 1 182 ? -41.172 18.416  11.651  1.00 79.64  ? 182  LYS A C   1 
ATOM   959  O  O   . LYS A 1 182 ? -40.094 17.824  11.604  1.00 83.02  ? 182  LYS A O   1 
ATOM   960  C  CB  . LYS A 1 182 ? -41.956 20.217  10.150  1.00 92.80  ? 182  LYS A CB  1 
ATOM   961  C  CG  . LYS A 1 182 ? -42.638 20.687  8.884   1.00 98.25  ? 182  LYS A CG  1 
ATOM   962  C  CD  . LYS A 1 182 ? -42.500 22.197  8.760   1.00 102.81 ? 182  LYS A CD  1 
ATOM   963  C  CE  . LYS A 1 182 ? -43.369 22.757  7.653   1.00 106.07 ? 182  LYS A CE  1 
ATOM   964  N  NZ  . LYS A 1 182 ? -44.820 22.537  7.903   1.00 107.85 ? 182  LYS A NZ  1 
ATOM   965  N  N   . SER A 1 183 ? -41.726 18.843  12.782  1.00 74.67  ? 183  SER A N   1 
ATOM   966  C  CA  . SER A 1 183 ? -41.083 18.681  14.079  1.00 75.61  ? 183  SER A CA  1 
ATOM   967  C  C   . SER A 1 183 ? -40.901 17.212  14.445  1.00 75.59  ? 183  SER A C   1 
ATOM   968  O  O   . SER A 1 183 ? -39.923 16.845  15.096  1.00 73.34  ? 183  SER A O   1 
ATOM   969  C  CB  . SER A 1 183 ? -41.892 19.394  15.164  1.00 74.37  ? 183  SER A CB  1 
ATOM   970  O  OG  . SER A 1 183 ? -41.285 19.239  16.435  1.00 73.84  ? 183  SER A OG  1 
ATOM   971  N  N   . GLU A 1 184 ? -41.848 16.377  14.028  1.00 74.83  ? 184  GLU A N   1 
ATOM   972  C  CA  . GLU A 1 184 ? -41.769 14.943  14.280  1.00 70.70  ? 184  GLU A CA  1 
ATOM   973  C  C   . GLU A 1 184 ? -40.628 14.312  13.490  1.00 69.10  ? 184  GLU A C   1 
ATOM   974  O  O   . GLU A 1 184 ? -39.858 13.513  14.024  1.00 65.17  ? 184  GLU A O   1 
ATOM   975  C  CB  . GLU A 1 184 ? -43.091 14.257  13.929  1.00 69.66  ? 184  GLU A CB  1 
ATOM   976  C  CG  . GLU A 1 184 ? -43.018 12.736  13.931  1.00 71.54  ? 184  GLU A CG  1 
ATOM   977  C  CD  . GLU A 1 184 ? -44.287 12.085  13.420  1.00 70.98  ? 184  GLU A CD  1 
ATOM   978  O  OE1 . GLU A 1 184 ? -45.368 12.367  13.976  1.00 72.59  ? 184  GLU A OE1 1 
ATOM   979  O  OE2 . GLU A 1 184 ? -44.200 11.283  12.467  1.00 70.62  ? 184  GLU A OE2 1 
ATOM   980  N  N   . MET A 1 185 ? -40.524 14.681  12.217  1.00 65.76  ? 185  MET A N   1 
ATOM   981  C  CA  . MET A 1 185 ? -39.493 14.135  11.341  1.00 70.95  ? 185  MET A CA  1 
ATOM   982  C  C   . MET A 1 185 ? -38.104 14.658  11.705  1.00 77.42  ? 185  MET A C   1 
ATOM   983  O  O   . MET A 1 185 ? -37.107 13.957  11.535  1.00 78.17  ? 185  MET A O   1 
ATOM   984  C  CB  . MET A 1 185 ? -39.825 14.428  9.876   1.00 68.83  ? 185  MET A CB  1 
ATOM   985  C  CG  . MET A 1 185 ? -41.043 13.669  9.366   1.00 66.35  ? 185  MET A CG  1 
ATOM   986  S  SD  . MET A 1 185 ? -41.568 14.193  7.723   1.00 73.36  ? 185  MET A SD  1 
ATOM   987  C  CE  . MET A 1 185 ? -42.834 12.979  7.362   1.00 71.28  ? 185  MET A CE  1 
ATOM   988  N  N   . GLU A 1 186 ? -38.047 15.888  12.209  1.00 79.36  ? 186  GLU A N   1 
ATOM   989  C  CA  . GLU A 1 186 ? -36.804 16.438  12.742  1.00 84.02  ? 186  GLU A CA  1 
ATOM   990  C  C   . GLU A 1 186 ? -36.373 15.647  13.969  1.00 81.26  ? 186  GLU A C   1 
ATOM   991  O  O   . GLU A 1 186 ? -35.196 15.323  14.130  1.00 83.42  ? 186  GLU A O   1 
ATOM   992  C  CB  . GLU A 1 186 ? -36.972 17.913  13.109  1.00 91.40  ? 186  GLU A CB  1 
ATOM   993  C  CG  . GLU A 1 186 ? -36.741 18.872  11.956  1.00 96.21  ? 186  GLU A CG  1 
ATOM   994  C  CD  . GLU A 1 186 ? -36.958 20.323  12.339  1.00 98.70  ? 186  GLU A CD  1 
ATOM   995  O  OE1 . GLU A 1 186 ? -37.380 20.583  13.486  1.00 101.95 ? 186  GLU A OE1 1 
ATOM   996  O  OE2 . GLU A 1 186 ? -36.708 21.204  11.489  1.00 100.63 ? 186  GLU A OE2 1 
ATOM   997  N  N   . SER A 1 187 ? -37.339 15.340  14.830  1.00 81.53  ? 187  SER A N   1 
ATOM   998  C  CA  . SER A 1 187 ? -37.087 14.550  16.028  1.00 82.72  ? 187  SER A CA  1 
ATOM   999  C  C   . SER A 1 187 ? -36.554 13.168  15.665  1.00 85.41  ? 187  SER A C   1 
ATOM   1000 O  O   . SER A 1 187 ? -35.795 12.565  16.425  1.00 89.01  ? 187  SER A O   1 
ATOM   1001 C  CB  . SER A 1 187 ? -38.363 14.420  16.861  1.00 84.87  ? 187  SER A CB  1 
ATOM   1002 O  OG  . SER A 1 187 ? -38.157 13.581  17.984  1.00 86.55  ? 187  SER A OG  1 
ATOM   1003 N  N   . VAL A 1 188 ? -36.956 12.673  14.498  1.00 82.73  ? 188  VAL A N   1 
ATOM   1004 C  CA  . VAL A 1 188 ? -36.490 11.381  14.008  1.00 79.55  ? 188  VAL A CA  1 
ATOM   1005 C  C   . VAL A 1 188 ? -35.091 11.497  13.408  1.00 75.43  ? 188  VAL A C   1 
ATOM   1006 O  O   . VAL A 1 188 ? -34.219 10.673  13.687  1.00 72.05  ? 188  VAL A O   1 
ATOM   1007 C  CB  . VAL A 1 188 ? -37.457 10.785  12.961  1.00 77.25  ? 188  VAL A CB  1 
ATOM   1008 C  CG1 . VAL A 1 188 ? -36.852 9.549   12.313  1.00 75.74  ? 188  VAL A CG1 1 
ATOM   1009 C  CG2 . VAL A 1 188 ? -38.794 10.449  13.602  1.00 78.46  ? 188  VAL A CG2 1 
ATOM   1010 N  N   . LEU A 1 189 ? -34.883 12.526  12.590  1.00 78.58  ? 189  LEU A N   1 
ATOM   1011 C  CA  . LEU A 1 189 ? -33.590 12.758  11.944  1.00 78.04  ? 189  LEU A CA  1 
ATOM   1012 C  C   . LEU A 1 189 ? -32.462 12.952  12.954  1.00 79.51  ? 189  LEU A C   1 
ATOM   1013 O  O   . LEU A 1 189 ? -31.312 12.604  12.685  1.00 82.23  ? 189  LEU A O   1 
ATOM   1014 C  CB  . LEU A 1 189 ? -33.658 13.969  11.010  1.00 74.40  ? 189  LEU A CB  1 
ATOM   1015 C  CG  . LEU A 1 189 ? -34.393 13.807  9.678   1.00 73.86  ? 189  LEU A CG  1 
ATOM   1016 C  CD1 . LEU A 1 189 ? -34.404 15.124  8.919   1.00 72.04  ? 189  LEU A CD1 1 
ATOM   1017 C  CD2 . LEU A 1 189 ? -33.756 12.715  8.838   1.00 75.43  ? 189  LEU A CD2 1 
ATOM   1018 N  N   . ALA A 1 190 ? -32.798 13.509  14.114  1.00 77.06  ? 190  ALA A N   1 
ATOM   1019 C  CA  . ALA A 1 190 ? -31.814 13.753  15.163  1.00 75.09  ? 190  ALA A CA  1 
ATOM   1020 C  C   . ALA A 1 190 ? -31.523 12.490  15.971  1.00 72.74  ? 190  ALA A C   1 
ATOM   1021 O  O   . ALA A 1 190 ? -30.856 12.544  17.005  1.00 76.25  ? 190  ALA A O   1 
ATOM   1022 C  CB  . ALA A 1 190 ? -32.284 14.875  16.079  1.00 75.58  ? 190  ALA A CB  1 
ATOM   1023 N  N   . GLN A 1 191 ? -32.024 11.354  15.493  1.00 70.11  ? 191  GLN A N   1 
ATOM   1024 C  CA  . GLN A 1 191 ? -31.830 10.078  16.175  1.00 75.02  ? 191  GLN A CA  1 
ATOM   1025 C  C   . GLN A 1 191 ? -31.504 8.955   15.191  1.00 72.12  ? 191  GLN A C   1 
ATOM   1026 O  O   . GLN A 1 191 ? -31.294 7.811   15.594  1.00 73.81  ? 191  GLN A O   1 
ATOM   1027 C  CB  . GLN A 1 191 ? -33.074 9.711   16.990  1.00 81.25  ? 191  GLN A CB  1 
ATOM   1028 C  CG  . GLN A 1 191 ? -33.404 10.681  18.115  1.00 82.44  ? 191  GLN A CG  1 
ATOM   1029 C  CD  . GLN A 1 191 ? -34.748 10.394  18.759  1.00 82.95  ? 191  GLN A CD  1 
ATOM   1030 O  OE1 . GLN A 1 191 ? -35.446 9.455   18.377  1.00 84.78  ? 191  GLN A OE1 1 
ATOM   1031 N  NE2 . GLN A 1 191 ? -35.117 11.207  19.742  1.00 85.56  ? 191  GLN A NE2 1 
ATOM   1032 N  N   . LEU A 1 192 ? -31.459 9.292   13.904  1.00 73.01  ? 192  LEU A N   1 
ATOM   1033 C  CA  . LEU A 1 192 ? -31.207 8.313   12.845  1.00 79.64  ? 192  LEU A CA  1 
ATOM   1034 C  C   . LEU A 1 192 ? -30.053 7.363   13.144  1.00 86.62  ? 192  LEU A C   1 
ATOM   1035 O  O   . LEU A 1 192 ? -30.227 6.144   13.148  1.00 89.24  ? 192  LEU A O   1 
ATOM   1036 C  CB  . LEU A 1 192 ? -30.946 9.017   11.512  1.00 74.81  ? 192  LEU A CB  1 
ATOM   1037 C  CG  . LEU A 1 192 ? -32.102 9.083   10.515  1.00 73.92  ? 192  LEU A CG  1 
ATOM   1038 C  CD1 . LEU A 1 192 ? -31.672 9.842   9.275   1.00 76.13  ? 192  LEU A CD1 1 
ATOM   1039 C  CD2 . LEU A 1 192 ? -32.568 7.684   10.148  1.00 70.26  ? 192  LEU A CD2 1 
ATOM   1040 N  N   . ASP A 1 193 ? -28.877 7.931   13.392  1.00 95.35  ? 193  ASP A N   1 
ATOM   1041 C  CA  . ASP A 1 193 ? -27.657 7.149   13.576  1.00 101.33 ? 193  ASP A CA  1 
ATOM   1042 C  C   . ASP A 1 193 ? -27.716 6.194   14.767  1.00 98.46  ? 193  ASP A C   1 
ATOM   1043 O  O   . ASP A 1 193 ? -26.869 5.309   14.899  1.00 101.27 ? 193  ASP A O   1 
ATOM   1044 C  CB  . ASP A 1 193 ? -26.445 8.078   13.709  1.00 108.76 ? 193  ASP A CB  1 
ATOM   1045 C  CG  . ASP A 1 193 ? -26.585 9.066   14.856  1.00 112.06 ? 193  ASP A CG  1 
ATOM   1046 O  OD1 . ASP A 1 193 ? -25.580 9.726   15.194  1.00 111.85 ? 193  ASP A OD1 1 
ATOM   1047 O  OD2 . ASP A 1 193 ? -27.694 9.186   15.418  1.00 113.08 ? 193  ASP A OD2 1 
ATOM   1048 N  N   . ASN A 1 194 ? -28.714 6.368   15.627  1.00 95.26  ? 194  ASN A N   1 
ATOM   1049 C  CA  . ASN A 1 194 ? -28.802 5.578   16.852  1.00 96.63  ? 194  ASN A CA  1 
ATOM   1050 C  C   . ASN A 1 194 ? -30.080 4.756   16.997  1.00 91.43  ? 194  ASN A C   1 
ATOM   1051 O  O   . ASN A 1 194 ? -30.403 4.289   18.090  1.00 92.13  ? 194  ASN A O   1 
ATOM   1052 C  CB  . ASN A 1 194 ? -28.600 6.471   18.079  1.00 106.00 ? 194  ASN A CB  1 
ATOM   1053 C  CG  . ASN A 1 194 ? -27.156 6.904   18.253  1.00 110.24 ? 194  ASN A CG  1 
ATOM   1054 O  OD1 . ASN A 1 194 ? -26.238 6.274   17.726  1.00 112.30 ? 194  ASN A OD1 1 
ATOM   1055 N  ND2 . ASN A 1 194 ? -26.948 7.984   18.998  1.00 110.49 ? 194  ASN A ND2 1 
ATOM   1056 N  N   . TYR A 1 195 ? -30.804 4.576   15.898  1.00 86.86  ? 195  TYR A N   1 
ATOM   1057 C  CA  . TYR A 1 195 ? -31.955 3.683   15.903  1.00 81.67  ? 195  TYR A CA  1 
ATOM   1058 C  C   . TYR A 1 195 ? -31.510 2.245   15.713  1.00 78.18  ? 195  TYR A C   1 
ATOM   1059 O  O   . TYR A 1 195 ? -30.735 1.934   14.807  1.00 84.06  ? 195  TYR A O   1 
ATOM   1060 C  CB  . TYR A 1 195 ? -32.960 4.054   14.814  1.00 80.00  ? 195  TYR A CB  1 
ATOM   1061 C  CG  . TYR A 1 195 ? -33.902 5.168   15.196  1.00 78.15  ? 195  TYR A CG  1 
ATOM   1062 C  CD1 . TYR A 1 195 ? -33.878 6.380   14.522  1.00 76.82  ? 195  TYR A CD1 1 
ATOM   1063 C  CD2 . TYR A 1 195 ? -34.815 5.010   16.231  1.00 78.43  ? 195  TYR A CD2 1 
ATOM   1064 C  CE1 . TYR A 1 195 ? -34.736 7.406   14.864  1.00 77.85  ? 195  TYR A CE1 1 
ATOM   1065 C  CE2 . TYR A 1 195 ? -35.679 6.031   16.583  1.00 79.31  ? 195  TYR A CE2 1 
ATOM   1066 C  CZ  . TYR A 1 195 ? -35.635 7.227   15.896  1.00 79.22  ? 195  TYR A CZ  1 
ATOM   1067 O  OH  . TYR A 1 195 ? -36.491 8.248   16.239  1.00 79.60  ? 195  TYR A OH  1 
ATOM   1068 N  N   . GLY A 1 196 ? -32.010 1.373   16.580  1.00 71.91  ? 196  GLY A N   1 
ATOM   1069 C  CA  . GLY A 1 196 ? -31.764 -0.051  16.458  1.00 69.54  ? 196  GLY A CA  1 
ATOM   1070 C  C   . GLY A 1 196 ? -32.501 -0.629  15.263  1.00 71.07  ? 196  GLY A C   1 
ATOM   1071 O  O   . GLY A 1 196 ? -33.090 0.097   14.458  1.00 72.65  ? 196  GLY A O   1 
ATOM   1072 N  N   . GLN A 1 197 ? -32.484 -1.953  15.169  1.00 70.09  ? 197  GLN A N   1 
ATOM   1073 C  CA  . GLN A 1 197 ? -32.947 -2.651  13.982  1.00 74.82  ? 197  GLN A CA  1 
ATOM   1074 C  C   . GLN A 1 197 ? -34.464 -2.649  13.827  1.00 78.86  ? 197  GLN A C   1 
ATOM   1075 O  O   . GLN A 1 197 ? -34.981 -2.218  12.796  1.00 79.98  ? 197  GLN A O   1 
ATOM   1076 C  CB  . GLN A 1 197 ? -32.410 -4.083  13.982  1.00 73.92  ? 197  GLN A CB  1 
ATOM   1077 C  CG  . GLN A 1 197 ? -32.687 -4.863  12.711  1.00 76.28  ? 197  GLN A CG  1 
ATOM   1078 C  CD  . GLN A 1 197 ? -34.124 -5.345  12.613  1.00 78.67  ? 197  GLN A CD  1 
ATOM   1079 O  OE1 . GLN A 1 197 ? -34.882 -5.302  13.588  1.00 81.59  ? 197  GLN A OE1 1 
ATOM   1080 N  NE2 . GLN A 1 197 ? -34.501 -5.818  11.430  1.00 79.61  ? 197  GLN A NE2 1 
ATOM   1081 N  N   . GLN A 1 198 ? -35.169 -3.160  14.834  1.00 84.04  ? 198  GLN A N   1 
ATOM   1082 C  CA  . GLN A 1 198 ? -36.626 -3.182  14.801  1.00 88.66  ? 198  GLN A CA  1 
ATOM   1083 C  C   . GLN A 1 198 ? -37.097 -1.782  14.463  1.00 89.28  ? 198  GLN A C   1 
ATOM   1084 O  O   . GLN A 1 198 ? -37.233 -1.414  13.298  1.00 91.87  ? 198  GLN A O   1 
ATOM   1085 C  CB  . GLN A 1 198 ? -37.178 -3.590  16.167  1.00 91.19  ? 198  GLN A CB  1 
ATOM   1086 C  CG  . GLN A 1 198 ? -38.688 -3.720  16.200  1.00 91.31  ? 198  GLN A CG  1 
ATOM   1087 C  CD  . GLN A 1 198 ? -39.168 -4.937  15.445  1.00 89.63  ? 198  GLN A CD  1 
ATOM   1088 O  OE1 . GLN A 1 198 ? -38.906 -6.071  15.848  1.00 88.53  ? 198  GLN A OE1 1 
ATOM   1089 N  NE2 . GLN A 1 198 ? -39.878 -4.714  14.344  1.00 88.35  ? 198  GLN A NE2 1 
ATOM   1090 N  N   . GLU A 1 199 ? -37.384 -1.029  15.519  1.00 86.55  ? 199  GLU A N   1 
ATOM   1091 C  CA  . GLU A 1 199 ? -37.325 0.424   15.500  1.00 82.97  ? 199  GLU A CA  1 
ATOM   1092 C  C   . GLU A 1 199 ? -37.157 1.051   14.116  1.00 76.92  ? 199  GLU A C   1 
ATOM   1093 O  O   . GLU A 1 199 ? -37.996 1.843   13.684  1.00 73.26  ? 199  GLU A O   1 
ATOM   1094 C  CB  . GLU A 1 199 ? -36.167 0.855   16.400  1.00 86.49  ? 199  GLU A CB  1 
ATOM   1095 C  CG  . GLU A 1 199 ? -36.414 2.136   17.152  1.00 90.85  ? 199  GLU A CG  1 
ATOM   1096 C  CD  . GLU A 1 199 ? -35.832 2.086   18.550  1.00 93.51  ? 199  GLU A CD  1 
ATOM   1097 O  OE1 . GLU A 1 199 ? -34.635 1.745   18.693  1.00 94.32  ? 199  GLU A OE1 1 
ATOM   1098 O  OE2 . GLU A 1 199 ? -36.577 2.390   19.509  1.00 93.83  ? 199  GLU A OE2 1 
ATOM   1099 N  N   . LEU A 1 200 ? -36.068 0.710   13.431  1.00 75.02  ? 200  LEU A N   1 
ATOM   1100 C  CA  . LEU A 1 200 ? -35.815 1.243   12.096  1.00 66.97  ? 200  LEU A CA  1 
ATOM   1101 C  C   . LEU A 1 200 ? -36.795 0.632   11.099  1.00 65.73  ? 200  LEU A C   1 
ATOM   1102 O  O   . LEU A 1 200 ? -37.347 1.330   10.248  1.00 62.28  ? 200  LEU A O   1 
ATOM   1103 C  CB  . LEU A 1 200 ? -34.378 0.953   11.660  1.00 68.43  ? 200  LEU A CB  1 
ATOM   1104 C  CG  . LEU A 1 200 ? -33.644 2.042   10.870  1.00 67.05  ? 200  LEU A CG  1 
ATOM   1105 C  CD1 . LEU A 1 200 ? -32.529 1.426   10.036  1.00 64.79  ? 200  LEU A CD1 1 
ATOM   1106 C  CD2 . LEU A 1 200 ? -34.592 2.830   9.981   1.00 68.17  ? 200  LEU A CD2 1 
ATOM   1107 N  N   . ALA A 1 201 ? -37.006 -0.677  11.214  1.00 66.07  ? 201  ALA A N   1 
ATOM   1108 C  CA  . ALA A 1 201 ? -37.955 -1.384  10.359  1.00 64.84  ? 201  ALA A CA  1 
ATOM   1109 C  C   . ALA A 1 201 ? -39.353 -0.798  10.498  1.00 63.48  ? 201  ALA A C   1 
ATOM   1110 O  O   . ALA A 1 201 ? -40.074 -0.653  9.512   1.00 69.64  ? 201  ALA A O   1 
ATOM   1111 C  CB  . ALA A 1 201 ? -37.965 -2.870  10.689  1.00 61.83  ? 201  ALA A CB  1 
ATOM   1112 N  N   . ASP A 1 202 ? -39.729 -0.462  11.729  1.00 64.35  ? 202  ASP A N   1 
ATOM   1113 C  CA  . ASP A 1 202 ? -41.015 0.169   11.990  1.00 64.00  ? 202  ASP A CA  1 
ATOM   1114 C  C   . ASP A 1 202 ? -41.079 1.535   11.319  1.00 63.18  ? 202  ASP A C   1 
ATOM   1115 O  O   . ASP A 1 202 ? -42.054 1.854   10.639  1.00 61.49  ? 202  ASP A O   1 
ATOM   1116 C  CB  . ASP A 1 202 ? -41.256 0.303   13.494  1.00 66.02  ? 202  ASP A CB  1 
ATOM   1117 C  CG  . ASP A 1 202 ? -41.392 -1.040  14.187  1.00 68.70  ? 202  ASP A CG  1 
ATOM   1118 O  OD1 . ASP A 1 202 ? -41.533 -2.064  13.485  1.00 68.66  ? 202  ASP A OD1 1 
ATOM   1119 O  OD2 . ASP A 1 202 ? -41.358 -1.071  15.435  1.00 69.16  ? 202  ASP A OD2 1 
ATOM   1120 N  N   . LEU A 1 203 ? -40.029 2.331   11.508  1.00 59.57  ? 203  LEU A N   1 
ATOM   1121 C  CA  . LEU A 1 203 ? -39.940 3.657   10.903  1.00 54.68  ? 203  LEU A CA  1 
ATOM   1122 C  C   . LEU A 1 203 ? -40.050 3.591   9.383   1.00 56.89  ? 203  LEU A C   1 
ATOM   1123 O  O   . LEU A 1 203 ? -40.595 4.497   8.753   1.00 58.26  ? 203  LEU A O   1 
ATOM   1124 C  CB  . LEU A 1 203 ? -38.637 4.350   11.310  1.00 54.78  ? 203  LEU A CB  1 
ATOM   1125 C  CG  . LEU A 1 203 ? -38.554 4.873   12.746  1.00 56.96  ? 203  LEU A CG  1 
ATOM   1126 C  CD1 . LEU A 1 203 ? -37.123 5.244   13.099  1.00 55.46  ? 203  LEU A CD1 1 
ATOM   1127 C  CD2 . LEU A 1 203 ? -39.486 6.059   12.949  1.00 57.30  ? 203  LEU A CD2 1 
ATOM   1128 N  N   . PHE A 1 204 ? -39.526 2.517   8.798   1.00 56.53  ? 204  PHE A N   1 
ATOM   1129 C  CA  . PHE A 1 204 ? -39.658 2.289   7.363   1.00 62.63  ? 204  PHE A CA  1 
ATOM   1130 C  C   . PHE A 1 204 ? -41.116 2.070   6.975   1.00 65.48  ? 204  PHE A C   1 
ATOM   1131 O  O   . PHE A 1 204 ? -41.597 2.633   5.991   1.00 68.28  ? 204  PHE A O   1 
ATOM   1132 C  CB  . PHE A 1 204 ? -38.806 1.098   6.920   1.00 63.69  ? 204  PHE A CB  1 
ATOM   1133 C  CG  . PHE A 1 204 ? -37.520 1.489   6.251   1.00 64.35  ? 204  PHE A CG  1 
ATOM   1134 C  CD1 . PHE A 1 204 ? -36.427 1.897   6.997   1.00 64.78  ? 204  PHE A CD1 1 
ATOM   1135 C  CD2 . PHE A 1 204 ? -37.406 1.449   4.871   1.00 66.39  ? 204  PHE A CD2 1 
ATOM   1136 C  CE1 . PHE A 1 204 ? -35.244 2.259   6.379   1.00 63.13  ? 204  PHE A CE1 1 
ATOM   1137 C  CE2 . PHE A 1 204 ? -36.227 1.810   4.246   1.00 64.35  ? 204  PHE A CE2 1 
ATOM   1138 C  CZ  . PHE A 1 204 ? -35.144 2.216   5.002   1.00 64.62  ? 204  PHE A CZ  1 
ATOM   1139 N  N   . VAL A 1 205 ? -41.812 1.250   7.756   1.00 62.72  ? 205  VAL A N   1 
ATOM   1140 C  CA  . VAL A 1 205 ? -43.226 0.983   7.519   1.00 68.39  ? 205  VAL A CA  1 
ATOM   1141 C  C   . VAL A 1 205 ? -44.071 2.202   7.882   1.00 62.13  ? 205  VAL A C   1 
ATOM   1142 O  O   . VAL A 1 205 ? -45.002 2.560   7.158   1.00 61.75  ? 205  VAL A O   1 
ATOM   1143 C  CB  . VAL A 1 205 ? -43.716 -0.242  8.323   1.00 73.07  ? 205  VAL A CB  1 
ATOM   1144 C  CG1 . VAL A 1 205 ? -45.193 -0.501  8.058   1.00 73.03  ? 205  VAL A CG1 1 
ATOM   1145 C  CG2 . VAL A 1 205 ? -42.889 -1.473  7.979   1.00 72.21  ? 205  VAL A CG2 1 
ATOM   1146 N  N   . ASN A 1 206 ? -43.730 2.842   8.997   1.00 56.55  ? 206  ASN A N   1 
ATOM   1147 C  CA  . ASN A 1 206 ? -44.489 3.987   9.500   1.00 58.16  ? 206  ASN A CA  1 
ATOM   1148 C  C   . ASN A 1 206 ? -44.370 5.242   8.638   1.00 58.78  ? 206  ASN A C   1 
ATOM   1149 O  O   . ASN A 1 206 ? -45.171 6.169   8.769   1.00 63.95  ? 206  ASN A O   1 
ATOM   1150 C  CB  . ASN A 1 206 ? -44.102 4.303   10.948  1.00 57.68  ? 206  ASN A CB  1 
ATOM   1151 C  CG  . ASN A 1 206 ? -44.644 3.284   11.935  1.00 62.73  ? 206  ASN A CG  1 
ATOM   1152 O  OD1 . ASN A 1 206 ? -44.382 3.367   13.135  1.00 63.61  ? 206  ASN A OD1 1 
ATOM   1153 N  ND2 . ASN A 1 206 ? -45.406 2.316   11.435  1.00 61.61  ? 206  ASN A ND2 1 
ATOM   1154 N  N   . TYR A 1 207 ? -43.371 5.273   7.763   1.00 57.90  ? 207  TYR A N   1 
ATOM   1155 C  CA  . TYR A 1 207 ? -43.223 6.380   6.824   1.00 54.60  ? 207  TYR A CA  1 
ATOM   1156 C  C   . TYR A 1 207 ? -43.409 5.908   5.387   1.00 55.45  ? 207  TYR A C   1 
ATOM   1157 O  O   . TYR A 1 207 ? -43.197 6.668   4.441   1.00 54.16  ? 207  TYR A O   1 
ATOM   1158 C  CB  . TYR A 1 207 ? -41.873 7.077   7.003   1.00 50.40  ? 207  TYR A CB  1 
ATOM   1159 C  CG  . TYR A 1 207 ? -41.812 7.944   8.239   1.00 51.31  ? 207  TYR A CG  1 
ATOM   1160 C  CD1 . TYR A 1 207 ? -41.196 7.493   9.399   1.00 52.59  ? 207  TYR A CD1 1 
ATOM   1161 C  CD2 . TYR A 1 207 ? -42.385 9.210   8.250   1.00 48.30  ? 207  TYR A CD2 1 
ATOM   1162 C  CE1 . TYR A 1 207 ? -41.144 8.282   10.533  1.00 52.02  ? 207  TYR A CE1 1 
ATOM   1163 C  CE2 . TYR A 1 207 ? -42.339 10.005  9.379   1.00 48.99  ? 207  TYR A CE2 1 
ATOM   1164 C  CZ  . TYR A 1 207 ? -41.717 9.536   10.518  1.00 52.37  ? 207  TYR A CZ  1 
ATOM   1165 O  OH  . TYR A 1 207 ? -41.670 10.326  11.644  1.00 55.26  ? 207  TYR A OH  1 
ATOM   1166 N  N   . ASN A 1 208 ? -43.812 4.648   5.242   1.00 55.43  ? 208  ASN A N   1 
ATOM   1167 C  CA  . ASN A 1 208 ? -44.100 4.057   3.939   1.00 67.79  ? 208  ASN A CA  1 
ATOM   1168 C  C   . ASN A 1 208 ? -42.963 4.275   2.942   1.00 65.51  ? 208  ASN A C   1 
ATOM   1169 O  O   . ASN A 1 208 ? -43.185 4.726   1.818   1.00 66.44  ? 208  ASN A O   1 
ATOM   1170 C  CB  . ASN A 1 208 ? -45.416 4.611   3.383   1.00 72.87  ? 208  ASN A CB  1 
ATOM   1171 C  CG  . ASN A 1 208 ? -46.137 3.620   2.490   1.00 75.47  ? 208  ASN A CG  1 
ATOM   1172 O  OD1 . ASN A 1 208 ? -46.035 2.407   2.678   1.00 78.40  ? 208  ASN A OD1 1 
ATOM   1173 N  ND2 . ASN A 1 208 ? -46.878 4.134   1.515   1.00 74.33  ? 208  ASN A ND2 1 
ATOM   1174 N  N   . VAL A 1 209 ? -41.745 3.955   3.367   1.00 69.56  ? 209  VAL A N   1 
ATOM   1175 C  CA  . VAL A 1 209 ? -40.562 4.152   2.536   1.00 68.87  ? 209  VAL A CA  1 
ATOM   1176 C  C   . VAL A 1 209 ? -40.459 3.074   1.461   1.00 71.56  ? 209  VAL A C   1 
ATOM   1177 O  O   . VAL A 1 209 ? -40.423 1.881   1.764   1.00 69.61  ? 209  VAL A O   1 
ATOM   1178 C  CB  . VAL A 1 209 ? -39.270 4.150   3.378   1.00 63.54  ? 209  VAL A CB  1 
ATOM   1179 C  CG1 . VAL A 1 209 ? -38.077 4.553   2.523   1.00 59.26  ? 209  VAL A CG1 1 
ATOM   1180 C  CG2 . VAL A 1 209 ? -39.411 5.080   4.573   1.00 61.86  ? 209  VAL A CG2 1 
ATOM   1181 N  N   . LYS A 1 210 ? -40.418 3.506   0.206   1.00 73.94  ? 210  LYS A N   1 
ATOM   1182 C  CA  . LYS A 1 210 ? -40.295 2.590   -0.920  1.00 81.38  ? 210  LYS A CA  1 
ATOM   1183 C  C   . LYS A 1 210 ? -39.055 2.937   -1.735  1.00 85.68  ? 210  LYS A C   1 
ATOM   1184 O  O   . LYS A 1 210 ? -38.465 4.003   -1.552  1.00 83.95  ? 210  LYS A O   1 
ATOM   1185 C  CB  . LYS A 1 210 ? -41.548 2.655   -1.798  1.00 84.45  ? 210  LYS A CB  1 
ATOM   1186 C  CG  . LYS A 1 210 ? -42.841 2.363   -1.051  1.00 87.26  ? 210  LYS A CG  1 
ATOM   1187 C  CD  . LYS A 1 210 ? -44.058 2.556   -1.940  1.00 91.80  ? 210  LYS A CD  1 
ATOM   1188 C  CE  . LYS A 1 210 ? -45.347 2.313   -1.168  1.00 95.21  ? 210  LYS A CE  1 
ATOM   1189 N  NZ  . LYS A 1 210 ? -46.555 2.492   -2.021  1.00 95.51  ? 210  LYS A NZ  1 
ATOM   1190 N  N   . SER A 1 211 ? -38.657 2.032   -2.626  1.00 86.56  ? 211  SER A N   1 
ATOM   1191 C  CA  . SER A 1 211 ? -37.496 2.259   -3.483  1.00 86.92  ? 211  SER A CA  1 
ATOM   1192 C  C   . SER A 1 211 ? -37.611 3.597   -4.207  1.00 86.83  ? 211  SER A C   1 
ATOM   1193 O  O   . SER A 1 211 ? -38.614 3.859   -4.869  1.00 87.78  ? 211  SER A O   1 
ATOM   1194 C  CB  . SER A 1 211 ? -37.340 1.121   -4.495  1.00 88.21  ? 211  SER A CB  1 
ATOM   1195 O  OG  . SER A 1 211 ? -37.042 -0.103  -3.848  1.00 89.52  ? 211  SER A OG  1 
ATOM   1196 N  N   . PRO A 1 212 ? -36.578 4.448   -4.076  1.00 89.94  ? 212  PRO A N   1 
ATOM   1197 C  CA  . PRO A 1 212 ? -36.545 5.791   -4.658  1.00 94.55  ? 212  PRO A CA  1 
ATOM   1198 C  C   . PRO A 1 212 ? -36.785 5.746   -6.161  1.00 100.59 ? 212  PRO A C   1 
ATOM   1199 O  O   . PRO A 1 212 ? -37.872 6.098   -6.622  1.00 105.27 ? 212  PRO A O   1 
ATOM   1200 C  CB  . PRO A 1 212 ? -35.120 6.277   -4.355  1.00 92.01  ? 212  PRO A CB  1 
ATOM   1201 C  CG  . PRO A 1 212 ? -34.348 5.048   -3.987  1.00 91.36  ? 212  PRO A CG  1 
ATOM   1202 C  CD  . PRO A 1 212 ? -35.339 4.137   -3.347  1.00 90.87  ? 212  PRO A CD  1 
ATOM   1203 N  N   . ILE A 1 213 ? -35.774 5.329   -6.917  1.00 106.36 ? 213  ILE A N   1 
ATOM   1204 C  CA  . ILE A 1 213 ? -35.987 4.974   -8.312  1.00 108.24 ? 213  ILE A CA  1 
ATOM   1205 C  C   . ILE A 1 213 ? -36.892 3.745   -8.335  1.00 108.87 ? 213  ILE A C   1 
ATOM   1206 O  O   . ILE A 1 213 ? -36.521 2.674   -7.853  1.00 101.47 ? 213  ILE A O   1 
ATOM   1207 C  CB  . ILE A 1 213 ? -34.665 4.744   -9.078  1.00 109.79 ? 213  ILE A CB  1 
ATOM   1208 C  CG1 . ILE A 1 213 ? -33.494 4.564   -8.107  1.00 109.86 ? 213  ILE A CG1 1 
ATOM   1209 C  CG2 . ILE A 1 213 ? -34.373 5.927   -9.988  1.00 109.12 ? 213  ILE A CG2 1 
ATOM   1210 C  CD1 . ILE A 1 213 ? -33.349 3.162   -7.561  1.00 109.63 ? 213  ILE A CD1 1 
ATOM   1211 N  N   . THR A 1 214 ? -38.089 3.930   -8.889  1.00 111.71 ? 214  THR A N   1 
ATOM   1212 C  CA  . THR A 1 214 ? -39.223 3.013   -8.705  1.00 115.91 ? 214  THR A CA  1 
ATOM   1213 C  C   . THR A 1 214 ? -38.878 1.523   -8.615  1.00 115.22 ? 214  THR A C   1 
ATOM   1214 O  O   . THR A 1 214 ? -38.030 1.026   -9.357  1.00 116.79 ? 214  THR A O   1 
ATOM   1215 C  CB  . THR A 1 214 ? -40.299 3.224   -9.795  1.00 120.19 ? 214  THR A CB  1 
ATOM   1216 O  OG1 . THR A 1 214 ? -39.727 2.996   -11.088 1.00 122.22 ? 214  THR A OG1 1 
ATOM   1217 C  CG2 . THR A 1 214 ? -40.855 4.640   -9.730  1.00 120.54 ? 214  THR A CG2 1 
ATOM   1218 N  N   . GLY A 1 215 ? -39.556 0.813   -7.715  1.00 112.01 ? 215  GLY A N   1 
ATOM   1219 C  CA  . GLY A 1 215 ? -40.601 1.405   -6.881  1.00 109.00 ? 215  GLY A CA  1 
ATOM   1220 C  C   . GLY A 1 215 ? -41.304 0.410   -5.972  1.00 107.90 ? 215  GLY A C   1 
ATOM   1221 O  O   . GLY A 1 215 ? -42.130 0.794   -5.143  1.00 103.54 ? 215  GLY A O   1 
ATOM   1222 N  N   . ASN A 1 216 ? -40.976 -0.871  -6.125  1.00 109.49 ? 216  ASN A N   1 
ATOM   1223 C  CA  . ASN A 1 216 ? -41.575 -1.925  -5.304  1.00 113.84 ? 216  ASN A CA  1 
ATOM   1224 C  C   . ASN A 1 216 ? -41.312 -1.782  -3.806  1.00 110.64 ? 216  ASN A C   1 
ATOM   1225 O  O   . ASN A 1 216 ? -40.404 -1.062  -3.387  1.00 110.11 ? 216  ASN A O   1 
ATOM   1226 C  CB  . ASN A 1 216 ? -41.130 -3.312  -5.779  1.00 123.34 ? 216  ASN A CB  1 
ATOM   1227 C  CG  . ASN A 1 216 ? -42.268 -4.116  -6.381  1.00 127.62 ? 216  ASN A CG  1 
ATOM   1228 O  OD1 . ASN A 1 216 ? -42.651 -5.161  -5.851  1.00 130.10 ? 216  ASN A OD1 1 
ATOM   1229 N  ND2 . ASN A 1 216 ? -42.822 -3.628  -7.485  1.00 128.67 ? 216  ASN A ND2 1 
ATOM   1230 N  N   . ASP A 1 217 ? -42.117 -2.480  -3.010  1.00 108.65 ? 217  ASP A N   1 
ATOM   1231 C  CA  . ASP A 1 217 ? -42.024 -2.422  -1.553  1.00 105.63 ? 217  ASP A CA  1 
ATOM   1232 C  C   . ASP A 1 217 ? -40.681 -2.944  -1.044  1.00 101.69 ? 217  ASP A C   1 
ATOM   1233 O  O   . ASP A 1 217 ? -39.980 -3.669  -1.750  1.00 102.07 ? 217  ASP A O   1 
ATOM   1234 C  CB  . ASP A 1 217 ? -43.181 -3.195  -0.913  1.00 107.56 ? 217  ASP A CB  1 
ATOM   1235 C  CG  . ASP A 1 217 ? -44.540 -2.622  -1.280  1.00 109.04 ? 217  ASP A CG  1 
ATOM   1236 O  OD1 . ASP A 1 217 ? -44.586 -1.590  -1.983  1.00 110.66 ? 217  ASP A OD1 1 
ATOM   1237 O  OD2 . ASP A 1 217 ? -45.563 -3.206  -0.863  1.00 108.11 ? 217  ASP A OD2 1 
ATOM   1238 N  N   . LEU A 1 218 ? -40.330 -2.574  0.184   1.00 97.27  ? 218  LEU A N   1 
ATOM   1239 C  CA  . LEU A 1 218 ? -39.005 -2.875  0.723   1.00 87.15  ? 218  LEU A CA  1 
ATOM   1240 C  C   . LEU A 1 218 ? -39.007 -3.910  1.846   1.00 87.05  ? 218  LEU A C   1 
ATOM   1241 O  O   . LEU A 1 218 ? -40.049 -4.224  2.422   1.00 92.80  ? 218  LEU A O   1 
ATOM   1242 C  CB  . LEU A 1 218 ? -38.316 -1.590  1.194   1.00 81.80  ? 218  LEU A CB  1 
ATOM   1243 C  CG  . LEU A 1 218 ? -37.844 -0.633  0.097   1.00 80.66  ? 218  LEU A CG  1 
ATOM   1244 C  CD1 . LEU A 1 218 ? -37.377 0.684   0.698   1.00 78.47  ? 218  LEU A CD1 1 
ATOM   1245 C  CD2 . LEU A 1 218 ? -36.737 -1.267  -0.731  1.00 81.12  ? 218  LEU A CD2 1 
ATOM   1246 N  N   . SER A 1 219 ? -37.820 -4.428  2.150   1.00 80.24  ? 219  SER A N   1 
ATOM   1247 C  CA  . SER A 1 219 ? -37.656 -5.471  3.156   1.00 82.82  ? 219  SER A CA  1 
ATOM   1248 C  C   . SER A 1 219 ? -37.060 -4.921  4.450   1.00 82.07  ? 219  SER A C   1 
ATOM   1249 O  O   . SER A 1 219 ? -36.280 -3.969  4.420   1.00 80.65  ? 219  SER A O   1 
ATOM   1250 C  CB  . SER A 1 219 ? -36.775 -6.596  2.605   1.00 84.21  ? 219  SER A CB  1 
ATOM   1251 O  OG  . SER A 1 219 ? -35.599 -6.076  2.007   1.00 84.66  ? 219  SER A OG  1 
ATOM   1252 N  N   . PRO A 1 220 ? -37.434 -5.522  5.592   1.00 83.55  ? 220  PRO A N   1 
ATOM   1253 C  CA  . PRO A 1 220 ? -36.928 -5.124  6.903   1.00 85.82  ? 220  PRO A CA  1 
ATOM   1254 C  C   . PRO A 1 220 ? -35.412 -4.955  6.898   1.00 86.48  ? 220  PRO A C   1 
ATOM   1255 O  O   . PRO A 1 220 ? -34.689 -5.892  6.555   1.00 87.76  ? 220  PRO A O   1 
ATOM   1256 C  CB  . PRO A 1 220 ? -37.326 -6.300  7.796   1.00 86.91  ? 220  PRO A CB  1 
ATOM   1257 C  CG  . PRO A 1 220 ? -38.560 -6.834  7.168   1.00 88.01  ? 220  PRO A CG  1 
ATOM   1258 C  CD  . PRO A 1 220 ? -38.390 -6.640  5.685   1.00 87.61  ? 220  PRO A CD  1 
ATOM   1259 N  N   . PRO A 1 221 ? -34.934 -3.757  7.269   1.00 84.59  ? 221  PRO A N   1 
ATOM   1260 C  CA  . PRO A 1 221 ? -33.512 -3.423  7.289   1.00 82.63  ? 221  PRO A CA  1 
ATOM   1261 C  C   . PRO A 1 221 ? -32.686 -4.407  8.109   1.00 82.79  ? 221  PRO A C   1 
ATOM   1262 O  O   . PRO A 1 221 ? -32.846 -4.493  9.326   1.00 84.12  ? 221  PRO A O   1 
ATOM   1263 C  CB  . PRO A 1 221 ? -33.479 -2.031  7.939   1.00 82.29  ? 221  PRO A CB  1 
ATOM   1264 C  CG  . PRO A 1 221 ? -34.830 -1.836  8.547   1.00 79.37  ? 221  PRO A CG  1 
ATOM   1265 C  CD  . PRO A 1 221 ? -35.766 -2.622  7.698   1.00 82.06  ? 221  PRO A CD  1 
ATOM   1266 N  N   . VAL A 1 222 ? -31.812 -5.144  7.432   1.00 84.67  ? 222  VAL A N   1 
ATOM   1267 C  CA  . VAL A 1 222 ? -30.919 -6.083  8.097   1.00 80.21  ? 222  VAL A CA  1 
ATOM   1268 C  C   . VAL A 1 222 ? -29.496 -5.534  8.139   1.00 73.37  ? 222  VAL A C   1 
ATOM   1269 O  O   . VAL A 1 222 ? -29.097 -4.746  7.281   1.00 70.89  ? 222  VAL A O   1 
ATOM   1270 C  CB  . VAL A 1 222 ? -30.927 -7.465  7.410   1.00 80.97  ? 222  VAL A CB  1 
ATOM   1271 C  CG1 . VAL A 1 222 ? -32.235 -8.191  7.695   1.00 81.59  ? 222  VAL A CG1 1 
ATOM   1272 C  CG2 . VAL A 1 222 ? -30.702 -7.322  5.911   1.00 81.05  ? 222  VAL A CG2 1 
ATOM   1273 N  N   . SER A 1 223 ? -28.739 -5.952  9.148   1.00 73.06  ? 223  SER A N   1 
ATOM   1274 C  CA  . SER A 1 223 ? -27.362 -5.503  9.317   1.00 69.60  ? 223  SER A CA  1 
ATOM   1275 C  C   . SER A 1 223 ? -26.457 -6.084  8.234   1.00 65.99  ? 223  SER A C   1 
ATOM   1276 O  O   . SER A 1 223 ? -26.541 -7.269  7.914   1.00 66.17  ? 223  SER A O   1 
ATOM   1277 C  CB  . SER A 1 223 ? -26.845 -5.893  10.702  1.00 69.63  ? 223  SER A CB  1 
ATOM   1278 O  OG  . SER A 1 223 ? -25.530 -5.412  10.911  1.00 70.00  ? 223  SER A OG  1 
ATOM   1279 N  N   . PHE A 1 224 ? -25.597 -5.242  7.671   1.00 64.73  ? 224  PHE A N   1 
ATOM   1280 C  CA  . PHE A 1 224 ? -24.679 -5.670  6.620   1.00 59.00  ? 224  PHE A CA  1 
ATOM   1281 C  C   . PHE A 1 224 ? -23.244 -5.271  6.944   1.00 57.30  ? 224  PHE A C   1 
ATOM   1282 O  O   . PHE A 1 224 ? -22.899 -4.090  6.918   1.00 55.72  ? 224  PHE A O   1 
ATOM   1283 C  CB  . PHE A 1 224 ? -25.100 -5.084  5.270   1.00 57.80  ? 224  PHE A CB  1 
ATOM   1284 C  CG  . PHE A 1 224 ? -24.118 -5.343  4.163   1.00 62.18  ? 224  PHE A CG  1 
ATOM   1285 C  CD1 . PHE A 1 224 ? -23.962 -6.618  3.641   1.00 64.03  ? 224  PHE A CD1 1 
ATOM   1286 C  CD2 . PHE A 1 224 ? -23.358 -4.310  3.636   1.00 64.12  ? 224  PHE A CD2 1 
ATOM   1287 C  CE1 . PHE A 1 224 ? -23.060 -6.859  2.619   1.00 64.25  ? 224  PHE A CE1 1 
ATOM   1288 C  CE2 . PHE A 1 224 ? -22.455 -4.545  2.614   1.00 64.07  ? 224  PHE A CE2 1 
ATOM   1289 C  CZ  . PHE A 1 224 ? -22.306 -5.821  2.104   1.00 61.73  ? 224  PHE A CZ  1 
ATOM   1290 N  N   . ASN A 1 225 ? -22.411 -6.264  7.246   1.00 55.61  ? 225  ASN A N   1 
ATOM   1291 C  CA  . ASN A 1 225 ? -21.014 -6.019  7.587   1.00 55.98  ? 225  ASN A CA  1 
ATOM   1292 C  C   . ASN A 1 225 ? -20.232 -5.469  6.395   1.00 54.39  ? 225  ASN A C   1 
ATOM   1293 O  O   . ASN A 1 225 ? -20.276 -6.032  5.301   1.00 52.47  ? 225  ASN A O   1 
ATOM   1294 C  CB  . ASN A 1 225 ? -20.359 -7.299  8.110   1.00 58.00  ? 225  ASN A CB  1 
ATOM   1295 C  CG  . ASN A 1 225 ? -19.161 -7.019  8.997   1.00 61.73  ? 225  ASN A CG  1 
ATOM   1296 O  OD1 . ASN A 1 225 ? -19.176 -6.091  9.805   1.00 63.74  ? 225  ASN A OD1 1 
ATOM   1297 N  ND2 . ASN A 1 225 ? -18.117 -7.828  8.854   1.00 65.77  ? 225  ASN A ND2 1 
ATOM   1298 N  N   . LEU A 1 226 ? -19.518 -4.369  6.615   1.00 50.51  ? 226  LEU A N   1 
ATOM   1299 C  CA  . LEU A 1 226 ? -18.808 -3.681  5.539   1.00 49.12  ? 226  LEU A CA  1 
ATOM   1300 C  C   . LEU A 1 226 ? -17.401 -4.229  5.310   1.00 49.97  ? 226  LEU A C   1 
ATOM   1301 O  O   . LEU A 1 226 ? -16.588 -3.606  4.627   1.00 49.99  ? 226  LEU A O   1 
ATOM   1302 C  CB  . LEU A 1 226 ? -18.737 -2.178  5.820   1.00 45.34  ? 226  LEU A CB  1 
ATOM   1303 C  CG  . LEU A 1 226 ? -20.056 -1.441  6.059   1.00 46.54  ? 226  LEU A CG  1 
ATOM   1304 C  CD1 . LEU A 1 226 ? -19.785 0.001   6.453   1.00 48.08  ? 226  LEU A CD1 1 
ATOM   1305 C  CD2 . LEU A 1 226 ? -20.953 -1.507  4.832   1.00 50.47  ? 226  LEU A CD2 1 
ATOM   1306 N  N   . MET A 1 227 ? -17.112 -5.391  5.885   1.00 44.98  ? 227  MET A N   1 
ATOM   1307 C  CA  . MET A 1 227 ? -15.811 -6.018  5.703   1.00 41.41  ? 227  MET A CA  1 
ATOM   1308 C  C   . MET A 1 227 ? -15.811 -6.953  4.502   1.00 44.65  ? 227  MET A C   1 
ATOM   1309 O  O   . MET A 1 227 ? -16.786 -7.665  4.256   1.00 40.21  ? 227  MET A O   1 
ATOM   1310 C  CB  . MET A 1 227 ? -15.407 -6.796  6.953   1.00 44.72  ? 227  MET A CB  1 
ATOM   1311 C  CG  . MET A 1 227 ? -15.011 -5.932  8.132   1.00 44.32  ? 227  MET A CG  1 
ATOM   1312 S  SD  . MET A 1 227 ? -14.436 -6.951  9.499   1.00 50.20  ? 227  MET A SD  1 
ATOM   1313 C  CE  . MET A 1 227 ? -14.051 -5.703  10.720  1.00 52.74  ? 227  MET A CE  1 
ATOM   1314 N  N   . PHE A 1 228 ? -14.712 -6.944  3.754   1.00 42.11  ? 228  PHE A N   1 
ATOM   1315 C  CA  . PHE A 1 228 ? -14.531 -7.878  2.653   1.00 36.93  ? 228  PHE A CA  1 
ATOM   1316 C  C   . PHE A 1 228 ? -14.111 -9.237  3.198   1.00 38.53  ? 228  PHE A C   1 
ATOM   1317 O  O   . PHE A 1 228 ? -13.054 -9.366  3.816   1.00 41.35  ? 228  PHE A O   1 
ATOM   1318 C  CB  . PHE A 1 228 ? -13.479 -7.360  1.671   1.00 30.29  ? 228  PHE A CB  1 
ATOM   1319 C  CG  . PHE A 1 228 ? -13.958 -6.228  0.809   1.00 28.97  ? 228  PHE A CG  1 
ATOM   1320 C  CD1 . PHE A 1 228 ? -14.614 -6.479  -0.385  1.00 28.70  ? 228  PHE A CD1 1 
ATOM   1321 C  CD2 . PHE A 1 228 ? -13.745 -4.912  1.187   1.00 30.09  ? 228  PHE A CD2 1 
ATOM   1322 C  CE1 . PHE A 1 228 ? -15.054 -5.440  -1.184  1.00 28.36  ? 228  PHE A CE1 1 
ATOM   1323 C  CE2 . PHE A 1 228 ? -14.180 -3.868  0.391   1.00 28.84  ? 228  PHE A CE2 1 
ATOM   1324 C  CZ  . PHE A 1 228 ? -14.837 -4.132  -0.795  1.00 28.69  ? 228  PHE A CZ  1 
ATOM   1325 N  N   . LYS A 1 229 ? -14.947 -10.245 2.975   1.00 45.90  ? 229  LYS A N   1 
ATOM   1326 C  CA  . LYS A 1 229 ? -14.662 -11.595 3.445   1.00 47.20  ? 229  LYS A CA  1 
ATOM   1327 C  C   . LYS A 1 229 ? -13.715 -12.311 2.490   1.00 44.98  ? 229  LYS A C   1 
ATOM   1328 O  O   . LYS A 1 229 ? -13.740 -12.072 1.283   1.00 49.49  ? 229  LYS A O   1 
ATOM   1329 C  CB  . LYS A 1 229 ? -15.955 -12.401 3.581   1.00 62.55  ? 229  LYS A CB  1 
ATOM   1330 C  CG  . LYS A 1 229 ? -17.032 -11.741 4.424   1.00 66.52  ? 229  LYS A CG  1 
ATOM   1331 C  CD  . LYS A 1 229 ? -18.305 -12.573 4.418   1.00 71.67  ? 229  LYS A CD  1 
ATOM   1332 C  CE  . LYS A 1 229 ? -19.440 -11.864 5.134   1.00 74.49  ? 229  LYS A CE  1 
ATOM   1333 N  NZ  . LYS A 1 229 ? -20.706 -12.645 5.068   1.00 75.45  ? 229  LYS A NZ  1 
ATOM   1334 N  N   . THR A 1 230 ? -12.885 -13.192 3.040   1.00 41.51  ? 230  THR A N   1 
ATOM   1335 C  CA  . THR A 1 230 ? -11.972 -14.002 2.239   1.00 47.59  ? 230  THR A CA  1 
ATOM   1336 C  C   . THR A 1 230 ? -11.509 -15.225 3.028   1.00 48.74  ? 230  THR A C   1 
ATOM   1337 O  O   . THR A 1 230 ? -11.812 -15.358 4.214   1.00 49.10  ? 230  THR A O   1 
ATOM   1338 C  CB  . THR A 1 230 ? -10.743 -13.188 1.774   1.00 53.48  ? 230  THR A CB  1 
ATOM   1339 O  OG1 . THR A 1 230 ? -9.971  -13.966 0.850   1.00 56.54  ? 230  THR A OG1 1 
ATOM   1340 C  CG2 . THR A 1 230 ? -9.871  -12.797 2.961   1.00 51.03  ? 230  THR A CG2 1 
ATOM   1341 N  N   . PHE A 1 231 ? -10.779 -16.117 2.365   1.00 46.95  ? 231  PHE A N   1 
ATOM   1342 C  CA  . PHE A 1 231 ? -10.241 -17.302 3.025   1.00 47.52  ? 231  PHE A CA  1 
ATOM   1343 C  C   . PHE A 1 231 ? -8.720  -17.351 2.926   1.00 46.57  ? 231  PHE A C   1 
ATOM   1344 O  O   . PHE A 1 231 ? -8.163  -17.477 1.836   1.00 54.09  ? 231  PHE A O   1 
ATOM   1345 C  CB  . PHE A 1 231 ? -10.860 -18.575 2.444   1.00 52.88  ? 231  PHE A CB  1 
ATOM   1346 C  CG  . PHE A 1 231 ? -12.306 -18.761 2.804   1.00 54.36  ? 231  PHE A CG  1 
ATOM   1347 C  CD1 . PHE A 1 231 ? -12.663 -19.296 4.033   1.00 53.39  ? 231  PHE A CD1 1 
ATOM   1348 C  CD2 . PHE A 1 231 ? -13.308 -18.398 1.919   1.00 54.62  ? 231  PHE A CD2 1 
ATOM   1349 C  CE1 . PHE A 1 231 ? -13.993 -19.466 4.371   1.00 53.70  ? 231  PHE A CE1 1 
ATOM   1350 C  CE2 . PHE A 1 231 ? -14.641 -18.566 2.251   1.00 55.58  ? 231  PHE A CE2 1 
ATOM   1351 C  CZ  . PHE A 1 231 ? -14.984 -19.101 3.479   1.00 56.36  ? 231  PHE A CZ  1 
ATOM   1352 N  N   . ILE A 1 232 ? -8.058  -17.247 4.073   1.00 49.73  ? 232  ILE A N   1 
ATOM   1353 C  CA  . ILE A 1 232 ? -6.601  -17.216 4.123   1.00 57.29  ? 232  ILE A CA  1 
ATOM   1354 C  C   . ILE A 1 232 ? -6.023  -18.626 4.207   1.00 64.32  ? 232  ILE A C   1 
ATOM   1355 O  O   . ILE A 1 232 ? -5.737  -19.127 5.294   1.00 74.46  ? 232  ILE A O   1 
ATOM   1356 C  CB  . ILE A 1 232 ? -6.093  -16.388 5.323   1.00 52.83  ? 232  ILE A CB  1 
ATOM   1357 C  CG1 . ILE A 1 232 ? -6.853  -15.063 5.424   1.00 51.81  ? 232  ILE A CG1 1 
ATOM   1358 C  CG2 . ILE A 1 232 ? -4.593  -16.151 5.216   1.00 52.80  ? 232  ILE A CG2 1 
ATOM   1359 C  CD1 . ILE A 1 232 ? -6.476  -14.235 6.634   1.00 52.78  ? 232  ILE A CD1 1 
ATOM   1360 N  N   . GLY A 1 233 ? -5.858  -19.263 3.052   1.00 68.58  ? 233  GLY A N   1 
ATOM   1361 C  CA  . GLY A 1 233 ? -5.280  -20.601 2.992   1.00 65.40  ? 233  GLY A CA  1 
ATOM   1362 C  C   . GLY A 1 233 ? -6.094  -21.553 2.139   1.00 66.02  ? 233  GLY A C   1 
ATOM   1363 O  O   . GLY A 1 233 ? -7.083  -21.153 1.524   1.00 63.86  ? 233  GLY A O   1 
ATOM   1364 N  N   . PRO A 1 234 ? -5.677  -22.827 2.091   1.00 68.65  ? 234  PRO A N   1 
ATOM   1365 C  CA  . PRO A 1 234 ? -6.411  -23.848 1.359   1.00 68.16  ? 234  PRO A CA  1 
ATOM   1366 C  C   . PRO A 1 234 ? -7.582  -24.379 2.181   1.00 73.01  ? 234  PRO A C   1 
ATOM   1367 O  O   . PRO A 1 234 ? -7.476  -24.504 3.401   1.00 76.72  ? 234  PRO A O   1 
ATOM   1368 C  CB  . PRO A 1 234 ? -5.366  -24.942 1.151   1.00 67.44  ? 234  PRO A CB  1 
ATOM   1369 C  CG  . PRO A 1 234 ? -4.444  -24.807 2.313   1.00 68.63  ? 234  PRO A CG  1 
ATOM   1370 C  CD  . PRO A 1 234 ? -4.465  -23.363 2.738   1.00 69.25  ? 234  PRO A CD  1 
ATOM   1371 N  N   . GLY A 1 235 ? -8.692  -24.678 1.514   1.00 76.91  ? 235  GLY A N   1 
ATOM   1372 C  CA  . GLY A 1 235 ? -9.877  -25.190 2.196   1.00 81.27  ? 235  GLY A CA  1 
ATOM   1373 C  C   . GLY A 1 235 ? -10.815 -24.088 2.650   1.00 82.98  ? 235  GLY A C   1 
ATOM   1374 O  O   . GLY A 1 235 ? -11.360 -23.348 1.830   1.00 86.67  ? 235  GLY A O   1 
ATOM   1375 N  N   . GLY A 1 236 ? -11.006 -23.979 3.962   1.00 77.88  ? 236  GLY A N   1 
ATOM   1376 C  CA  . GLY A 1 236 ? -11.891 -22.964 4.520   1.00 73.23  ? 236  GLY A CA  1 
ATOM   1377 C  C   . GLY A 1 236 ? -12.007 -23.013 6.031   1.00 74.08  ? 236  GLY A C   1 
ATOM   1378 O  O   . GLY A 1 236 ? -13.105 -22.918 6.579   1.00 74.92  ? 236  GLY A O   1 
ATOM   1379 N  N   . ASN A 1 237 ? -10.872 -23.159 6.708   1.00 74.72  ? 237  ASN A N   1 
ATOM   1380 C  CA  . ASN A 1 237 ? -10.848 -23.170 8.169   1.00 77.68  ? 237  ASN A CA  1 
ATOM   1381 C  C   . ASN A 1 237 ? -10.277 -21.890 8.763   1.00 77.42  ? 237  ASN A C   1 
ATOM   1382 O  O   . ASN A 1 237 ? -10.334 -21.679 9.975   1.00 79.21  ? 237  ASN A O   1 
ATOM   1383 C  CB  . ASN A 1 237 ? -10.079 -24.384 8.694   1.00 84.61  ? 237  ASN A CB  1 
ATOM   1384 C  CG  . ASN A 1 237 ? -10.923 -25.642 8.719   1.00 87.79  ? 237  ASN A CG  1 
ATOM   1385 O  OD1 . ASN A 1 237 ? -12.054 -25.658 8.233   1.00 87.07  ? 237  ASN A OD1 1 
ATOM   1386 N  ND2 . ASN A 1 237 ? -10.375 -26.708 9.292   1.00 87.06  ? 237  ASN A ND2 1 
ATOM   1387 N  N   . MET A 1 238 ? -9.724  -21.039 7.906   1.00 70.87  ? 238  MET A N   1 
ATOM   1388 C  CA  . MET A 1 238 ? -9.242  -19.736 8.340   1.00 65.11  ? 238  MET A CA  1 
ATOM   1389 C  C   . MET A 1 238 ? -9.890  -18.618 7.527   1.00 63.34  ? 238  MET A C   1 
ATOM   1390 O  O   . MET A 1 238 ? -9.238  -17.989 6.692   1.00 59.96  ? 238  MET A O   1 
ATOM   1391 C  CB  . MET A 1 238 ? -7.714  -19.663 8.263   1.00 64.11  ? 238  MET A CB  1 
ATOM   1392 C  CG  . MET A 1 238 ? -7.127  -18.362 8.792   1.00 68.14  ? 238  MET A CG  1 
ATOM   1393 S  SD  . MET A 1 238 ? -5.482  -18.552 9.506   1.00 70.45  ? 238  MET A SD  1 
ATOM   1394 C  CE  . MET A 1 238 ? -4.607  -19.359 8.169   1.00 74.39  ? 238  MET A CE  1 
ATOM   1395 N  N   . PRO A 1 239 ? -11.192 -18.378 7.760   1.00 64.78  ? 239  PRO A N   1 
ATOM   1396 C  CA  . PRO A 1 239 ? -11.868 -17.255 7.124   1.00 63.50  ? 239  PRO A CA  1 
ATOM   1397 C  C   . PRO A 1 239 ? -11.275 -15.942 7.616   1.00 61.23  ? 239  PRO A C   1 
ATOM   1398 O  O   . PRO A 1 239 ? -11.211 -15.701 8.821   1.00 65.48  ? 239  PRO A O   1 
ATOM   1399 C  CB  . PRO A 1 239 ? -13.318 -17.400 7.598   1.00 58.99  ? 239  PRO A CB  1 
ATOM   1400 C  CG  . PRO A 1 239 ? -13.239 -18.213 8.841   1.00 59.26  ? 239  PRO A CG  1 
ATOM   1401 C  CD  . PRO A 1 239 ? -12.098 -19.150 8.627   1.00 60.51  ? 239  PRO A CD  1 
ATOM   1402 N  N   . GLY A 1 240 ? -10.830 -15.108 6.686   1.00 60.29  ? 240  GLY A N   1 
ATOM   1403 C  CA  . GLY A 1 240 ? -10.180 -13.857 7.041   1.00 58.53  ? 240  GLY A CA  1 
ATOM   1404 C  C   . GLY A 1 240 ? -10.942 -12.638 6.572   1.00 53.50  ? 240  GLY A C   1 
ATOM   1405 O  O   . GLY A 1 240 ? -11.957 -12.750 5.883   1.00 48.67  ? 240  GLY A O   1 
ATOM   1406 N  N   . TYR A 1 241 ? -10.446 -11.466 6.949   1.00 54.48  ? 241  TYR A N   1 
ATOM   1407 C  CA  . TYR A 1 241 ? -11.061 -10.209 6.553   1.00 55.14  ? 241  TYR A CA  1 
ATOM   1408 C  C   . TYR A 1 241 ? -10.015 -9.217  6.071   1.00 55.82  ? 241  TYR A C   1 
ATOM   1409 O  O   . TYR A 1 241 ? -8.881  -9.211  6.550   1.00 59.38  ? 241  TYR A O   1 
ATOM   1410 C  CB  . TYR A 1 241 ? -11.839 -9.600  7.720   1.00 67.22  ? 241  TYR A CB  1 
ATOM   1411 C  CG  . TYR A 1 241 ? -13.118 -10.328 8.055   1.00 72.12  ? 241  TYR A CG  1 
ATOM   1412 C  CD1 . TYR A 1 241 ? -13.194 -11.174 9.154   1.00 73.19  ? 241  TYR A CD1 1 
ATOM   1413 C  CD2 . TYR A 1 241 ? -14.251 -10.170 7.268   1.00 72.93  ? 241  TYR A CD2 1 
ATOM   1414 C  CE1 . TYR A 1 241 ? -14.365 -11.842 9.459   1.00 74.16  ? 241  TYR A CE1 1 
ATOM   1415 C  CE2 . TYR A 1 241 ? -15.425 -10.833 7.565   1.00 72.10  ? 241  TYR A CE2 1 
ATOM   1416 C  CZ  . TYR A 1 241 ? -15.476 -11.667 8.660   1.00 73.21  ? 241  TYR A CZ  1 
ATOM   1417 O  OH  . TYR A 1 241 ? -16.644 -12.329 8.954   1.00 75.15  ? 241  TYR A OH  1 
ATOM   1418 N  N   . LEU A 1 242 ? -10.404 -8.383  5.113   1.00 47.76  ? 242  LEU A N   1 
ATOM   1419 C  CA  . LEU A 1 242 ? -9.576  -7.261  4.699   1.00 44.09  ? 242  LEU A CA  1 
ATOM   1420 C  C   . LEU A 1 242 ? -9.752  -6.136  5.710   1.00 43.11  ? 242  LEU A C   1 
ATOM   1421 O  O   . LEU A 1 242 ? -10.869 -5.668  5.936   1.00 43.12  ? 242  LEU A O   1 
ATOM   1422 C  CB  . LEU A 1 242 ? -9.968  -6.783  3.301   1.00 48.59  ? 242  LEU A CB  1 
ATOM   1423 C  CG  . LEU A 1 242 ? -9.420  -7.551  2.095   1.00 51.27  ? 242  LEU A CG  1 
ATOM   1424 C  CD1 . LEU A 1 242 ? -9.948  -8.978  2.051   1.00 56.81  ? 242  LEU A CD1 1 
ATOM   1425 C  CD2 . LEU A 1 242 ? -9.760  -6.818  0.806   1.00 47.41  ? 242  LEU A CD2 1 
ATOM   1426 N  N   . ARG A 1 243 ? -8.651  -5.711  6.323   1.00 36.37  ? 243  ARG A N   1 
ATOM   1427 C  CA  . ARG A 1 243 ? -8.703  -4.697  7.372   1.00 35.37  ? 243  ARG A CA  1 
ATOM   1428 C  C   . ARG A 1 243 ? -9.506  -3.473  6.939   1.00 38.39  ? 243  ARG A C   1 
ATOM   1429 O  O   . ARG A 1 243 ? -9.254  -2.901  5.877   1.00 39.19  ? 243  ARG A O   1 
ATOM   1430 C  CB  . ARG A 1 243 ? -7.292  -4.287  7.806   1.00 32.59  ? 243  ARG A CB  1 
ATOM   1431 C  CG  . ARG A 1 243 ? -6.526  -3.487  6.769   1.00 30.47  ? 243  ARG A CG  1 
ATOM   1432 C  CD  . ARG A 1 243 ? -5.153  -3.082  7.273   1.00 30.43  ? 243  ARG A CD  1 
ATOM   1433 N  NE  . ARG A 1 243 ? -4.440  -2.280  6.283   1.00 37.82  ? 243  ARG A NE  1 
ATOM   1434 C  CZ  . ARG A 1 243 ? -3.154  -1.955  6.365   1.00 37.66  ? 243  ARG A CZ  1 
ATOM   1435 N  NH1 . ARG A 1 243 ? -2.426  -2.365  7.394   1.00 37.02  ? 243  ARG A NH1 1 
ATOM   1436 N  NH2 . ARG A 1 243 ? -2.594  -1.220  5.414   1.00 39.00  ? 243  ARG A NH2 1 
ATOM   1437 N  N   . PRO A 1 244 ? -10.489 -3.075  7.761   1.00 38.53  ? 244  PRO A N   1 
ATOM   1438 C  CA  . PRO A 1 244 ? -11.310 -1.903  7.494   1.00 39.45  ? 244  PRO A CA  1 
ATOM   1439 C  C   . PRO A 1 244 ? -10.624 -0.644  8.004   1.00 37.62  ? 244  PRO A C   1 
ATOM   1440 O  O   . PRO A 1 244 ? -11.052 0.469   7.697   1.00 43.61  ? 244  PRO A O   1 
ATOM   1441 C  CB  . PRO A 1 244 ? -12.562 -2.175  8.321   1.00 33.00  ? 244  PRO A CB  1 
ATOM   1442 C  CG  . PRO A 1 244 ? -12.051 -2.922  9.503   1.00 29.21  ? 244  PRO A CG  1 
ATOM   1443 C  CD  . PRO A 1 244 ? -10.878 -3.743  9.016   1.00 36.44  ? 244  PRO A CD  1 
ATOM   1444 N  N   . GLU A 1 245 ? -9.564  -0.837  8.780   1.00 42.95  ? 245  GLU A N   1 
ATOM   1445 C  CA  . GLU A 1 245 ? -8.838  0.260   9.399   1.00 45.19  ? 245  GLU A CA  1 
ATOM   1446 C  C   . GLU A 1 245 ? -7.442  -0.184  9.838   1.00 50.23  ? 245  GLU A C   1 
ATOM   1447 O  O   . GLU A 1 245 ? -7.196  -1.369  10.064  1.00 47.42  ? 245  GLU A O   1 
ATOM   1448 C  CB  . GLU A 1 245 ? -9.655  0.852   10.556  1.00 55.82  ? 245  GLU A CB  1 
ATOM   1449 C  CG  . GLU A 1 245 ? -8.897  1.103   11.844  1.00 62.07  ? 245  GLU A CG  1 
ATOM   1450 C  CD  . GLU A 1 245 ? -9.106  -0.003  12.859  1.00 67.23  ? 245  GLU A CD  1 
ATOM   1451 O  OE1 . GLU A 1 245 ? -9.567  0.303   13.980  1.00 74.95  ? 245  GLU A OE1 1 
ATOM   1452 O  OE2 . GLU A 1 245 ? -8.826  -1.176  12.535  1.00 66.36  ? 245  GLU A OE2 1 
ATOM   1453 N  N   . THR A 1 246 ? -6.532  0.778   9.945   1.00 56.45  ? 246  THR A N   1 
ATOM   1454 C  CA  . THR A 1 246 ? -5.119  0.496   10.175  1.00 53.31  ? 246  THR A CA  1 
ATOM   1455 C  C   . THR A 1 246 ? -4.731  0.459   11.656  1.00 53.69  ? 246  THR A C   1 
ATOM   1456 O  O   . THR A 1 246 ? -3.710  -0.124  12.024  1.00 56.26  ? 246  THR A O   1 
ATOM   1457 C  CB  . THR A 1 246 ? -4.243  1.529   9.436   1.00 56.81  ? 246  THR A CB  1 
ATOM   1458 O  OG1 . THR A 1 246 ? -4.071  1.123   8.072   1.00 62.48  ? 246  THR A OG1 1 
ATOM   1459 C  CG2 . THR A 1 246 ? -2.889  1.657   10.091  1.00 59.62  ? 246  THR A CG2 1 
ATOM   1460 N  N   . ALA A 1 247 ? -5.559  1.068   12.499  1.00 54.82  ? 247  ALA A N   1 
ATOM   1461 C  CA  . ALA A 1 247 ? -5.246  1.242   13.918  1.00 53.00  ? 247  ALA A CA  1 
ATOM   1462 C  C   . ALA A 1 247 ? -5.056  -0.067  14.682  1.00 57.45  ? 247  ALA A C   1 
ATOM   1463 O  O   . ALA A 1 247 ? -4.258  -0.140  15.618  1.00 48.29  ? 247  ALA A O   1 
ATOM   1464 C  CB  . ALA A 1 247 ? -6.319  2.089   14.587  1.00 61.00  ? 247  ALA A CB  1 
ATOM   1465 N  N   . GLN A 1 248 ? -5.794  -1.094  14.279  1.00 61.74  ? 248  GLN A N   1 
ATOM   1466 C  CA  . GLN A 1 248 ? -5.794  -2.373  14.981  1.00 62.36  ? 248  GLN A CA  1 
ATOM   1467 C  C   . GLN A 1 248 ? -4.437  -3.074  14.936  1.00 57.49  ? 248  GLN A C   1 
ATOM   1468 O  O   . GLN A 1 248 ? -4.005  -3.671  15.924  1.00 56.54  ? 248  GLN A O   1 
ATOM   1469 C  CB  . GLN A 1 248 ? -6.881  -3.279  14.406  1.00 74.06  ? 248  GLN A CB  1 
ATOM   1470 C  CG  . GLN A 1 248 ? -6.954  -4.649  15.041  1.00 83.90  ? 248  GLN A CG  1 
ATOM   1471 C  CD  . GLN A 1 248 ? -8.247  -5.363  14.717  1.00 91.44  ? 248  GLN A CD  1 
ATOM   1472 O  OE1 . GLN A 1 248 ? -9.255  -4.731  14.396  1.00 96.47  ? 248  GLN A OE1 1 
ATOM   1473 N  NE2 . GLN A 1 248 ? -8.228  -6.687  14.802  1.00 94.06  ? 248  GLN A NE2 1 
ATOM   1474 N  N   . GLY A 1 249 ? -3.771  -2.998  13.788  1.00 47.85  ? 249  GLY A N   1 
ATOM   1475 C  CA  . GLY A 1 249 ? -2.457  -3.610  13.618  1.00 43.16  ? 249  GLY A CA  1 
ATOM   1476 C  C   . GLY A 1 249 ? -1.430  -3.055  14.586  1.00 43.38  ? 249  GLY A C   1 
ATOM   1477 O  O   . GLY A 1 249 ? -0.508  -3.757  15.000  1.00 47.36  ? 249  GLY A O   1 
ATOM   1478 N  N   . ILE A 1 250 ? -1.595  -1.787  14.949  1.00 45.93  ? 250  ILE A N   1 
ATOM   1479 C  CA  . ILE A 1 250 ? -0.702  -1.134  15.898  1.00 46.71  ? 250  ILE A CA  1 
ATOM   1480 C  C   . ILE A 1 250 ? -0.913  -1.666  17.313  1.00 48.85  ? 250  ILE A C   1 
ATOM   1481 O  O   . ILE A 1 250 ? 0.050   -1.901  18.046  1.00 53.82  ? 250  ILE A O   1 
ATOM   1482 C  CB  . ILE A 1 250 ? -0.892  0.395   15.885  1.00 42.96  ? 250  ILE A CB  1 
ATOM   1483 C  CG1 . ILE A 1 250 ? -0.492  0.966   14.522  1.00 39.86  ? 250  ILE A CG1 1 
ATOM   1484 C  CG2 . ILE A 1 250 ? -0.083  1.042   16.997  1.00 46.72  ? 250  ILE A CG2 1 
ATOM   1485 C  CD1 . ILE A 1 250 ? -0.655  2.464   14.407  1.00 37.40  ? 250  ILE A CD1 1 
ATOM   1486 N  N   . PHE A 1 251 ? -2.174  -1.859  17.688  1.00 47.87  ? 251  PHE A N   1 
ATOM   1487 C  CA  . PHE A 1 251 ? -2.509  -2.388  19.006  1.00 42.65  ? 251  PHE A CA  1 
ATOM   1488 C  C   . PHE A 1 251 ? -1.885  -3.762  19.231  1.00 49.45  ? 251  PHE A C   1 
ATOM   1489 O  O   . PHE A 1 251 ? -1.224  -3.992  20.242  1.00 52.94  ? 251  PHE A O   1 
ATOM   1490 C  CB  . PHE A 1 251 ? -4.027  -2.460  19.195  1.00 44.43  ? 251  PHE A CB  1 
ATOM   1491 C  CG  . PHE A 1 251 ? -4.705  -1.118  19.192  1.00 45.56  ? 251  PHE A CG  1 
ATOM   1492 C  CD1 . PHE A 1 251 ? -4.189  -0.063  19.929  1.00 43.94  ? 251  PHE A CD1 1 
ATOM   1493 C  CD2 . PHE A 1 251 ? -5.866  -0.916  18.464  1.00 48.77  ? 251  PHE A CD2 1 
ATOM   1494 C  CE1 . PHE A 1 251 ? -4.813  1.172   19.931  1.00 47.09  ? 251  PHE A CE1 1 
ATOM   1495 C  CE2 . PHE A 1 251 ? -6.497  0.317   18.462  1.00 49.80  ? 251  PHE A CE2 1 
ATOM   1496 C  CZ  . PHE A 1 251 ? -5.969  1.362   19.196  1.00 49.02  ? 251  PHE A CZ  1 
ATOM   1497 N  N   . LEU A 1 252 ? -2.088  -4.665  18.276  1.00 49.26  ? 252  LEU A N   1 
ATOM   1498 C  CA  . LEU A 1 252 ? -1.546  -6.020  18.363  1.00 46.93  ? 252  LEU A CA  1 
ATOM   1499 C  C   . LEU A 1 252 ? -0.027  -6.028  18.531  1.00 47.02  ? 252  LEU A C   1 
ATOM   1500 O  O   . LEU A 1 252 ? 0.551   -7.027  18.960  1.00 53.22  ? 252  LEU A O   1 
ATOM   1501 C  CB  . LEU A 1 252 ? -1.936  -6.831  17.124  1.00 50.89  ? 252  LEU A CB  1 
ATOM   1502 C  CG  . LEU A 1 252 ? -3.432  -7.035  16.871  1.00 52.52  ? 252  LEU A CG  1 
ATOM   1503 C  CD1 . LEU A 1 252 ? -3.665  -7.642  15.497  1.00 53.12  ? 252  LEU A CD1 1 
ATOM   1504 C  CD2 . LEU A 1 252 ? -4.050  -7.900  17.956  1.00 50.84  ? 252  LEU A CD2 1 
ATOM   1505 N  N   . ASN A 1 253 ? 0.611   -4.912  18.194  1.00 40.37  ? 253  ASN A N   1 
ATOM   1506 C  CA  . ASN A 1 253 ? 2.063   -4.795  18.288  1.00 48.62  ? 253  ASN A CA  1 
ATOM   1507 C  C   . ASN A 1 253 ? 2.520   -3.868  19.414  1.00 50.08  ? 253  ASN A C   1 
ATOM   1508 O  O   . ASN A 1 253 ? 3.639   -3.352  19.383  1.00 45.55  ? 253  ASN A O   1 
ATOM   1509 C  CB  . ASN A 1 253 ? 2.643   -4.317  16.954  1.00 47.99  ? 253  ASN A CB  1 
ATOM   1510 C  CG  . ASN A 1 253 ? 2.684   -5.415  15.908  1.00 46.15  ? 253  ASN A CG  1 
ATOM   1511 O  OD1 . ASN A 1 253 ? 3.436   -6.382  16.035  1.00 47.18  ? 253  ASN A OD1 1 
ATOM   1512 N  ND2 . ASN A 1 253 ? 1.883   -5.264  14.860  1.00 42.83  ? 253  ASN A ND2 1 
ATOM   1513 N  N   . PHE A 1 254 ? 1.658   -3.668  20.407  1.00 49.27  ? 254  PHE A N   1 
ATOM   1514 C  CA  . PHE A 1 254 ? 1.942   -2.734  21.496  1.00 50.02  ? 254  PHE A CA  1 
ATOM   1515 C  C   . PHE A 1 254 ? 3.167   -3.124  22.319  1.00 50.74  ? 254  PHE A C   1 
ATOM   1516 O  O   . PHE A 1 254 ? 3.955   -2.265  22.710  1.00 46.80  ? 254  PHE A O   1 
ATOM   1517 C  CB  . PHE A 1 254 ? 0.727   -2.582  22.413  1.00 52.90  ? 254  PHE A CB  1 
ATOM   1518 C  CG  . PHE A 1 254 ? 0.937   -1.614  23.544  1.00 53.23  ? 254  PHE A CG  1 
ATOM   1519 C  CD1 . PHE A 1 254 ? 0.899   -0.246  23.319  1.00 54.26  ? 254  PHE A CD1 1 
ATOM   1520 C  CD2 . PHE A 1 254 ? 1.168   -2.070  24.831  1.00 52.28  ? 254  PHE A CD2 1 
ATOM   1521 C  CE1 . PHE A 1 254 ? 1.091   0.649   24.357  1.00 55.05  ? 254  PHE A CE1 1 
ATOM   1522 C  CE2 . PHE A 1 254 ? 1.362   -1.181  25.874  1.00 54.06  ? 254  PHE A CE2 1 
ATOM   1523 C  CZ  . PHE A 1 254 ? 1.323   0.180   25.637  1.00 54.54  ? 254  PHE A CZ  1 
ATOM   1524 N  N   . LYS A 1 255 ? 3.320   -4.419  22.581  1.00 55.69  ? 255  LYS A N   1 
ATOM   1525 C  CA  . LYS A 1 255 ? 4.429   -4.905  23.398  1.00 62.98  ? 255  LYS A CA  1 
ATOM   1526 C  C   . LYS A 1 255 ? 5.780   -4.715  22.714  1.00 58.96  ? 255  LYS A C   1 
ATOM   1527 O  O   . LYS A 1 255 ? 6.727   -4.225  23.329  1.00 57.34  ? 255  LYS A O   1 
ATOM   1528 C  CB  . LYS A 1 255 ? 4.230   -6.376  23.775  1.00 76.85  ? 255  LYS A CB  1 
ATOM   1529 C  CG  . LYS A 1 255 ? 3.138   -6.611  24.804  1.00 82.85  ? 255  LYS A CG  1 
ATOM   1530 C  CD  . LYS A 1 255 ? 3.137   -8.052  25.285  1.00 88.75  ? 255  LYS A CD  1 
ATOM   1531 C  CE  . LYS A 1 255 ? 2.108   -8.266  26.383  1.00 93.42  ? 255  LYS A CE  1 
ATOM   1532 N  NZ  . LYS A 1 255 ? 2.139   -9.656  26.916  1.00 94.78  ? 255  LYS A NZ  1 
ATOM   1533 N  N   . ARG A 1 256 ? 5.865   -5.101  21.445  1.00 52.06  ? 256  ARG A N   1 
ATOM   1534 C  CA  . ARG A 1 256 ? 7.106   -4.956  20.692  1.00 53.95  ? 256  ARG A CA  1 
ATOM   1535 C  C   . ARG A 1 256 ? 7.452   -3.480  20.535  1.00 51.75  ? 256  ARG A C   1 
ATOM   1536 O  O   . ARG A 1 256 ? 8.619   -3.096  20.598  1.00 52.31  ? 256  ARG A O   1 
ATOM   1537 C  CB  . ARG A 1 256 ? 6.993   -5.616  19.316  1.00 62.69  ? 256  ARG A CB  1 
ATOM   1538 C  CG  . ARG A 1 256 ? 5.973   -6.739  19.237  1.00 65.22  ? 256  ARG A CG  1 
ATOM   1539 C  CD  . ARG A 1 256 ? 6.302   -7.701  18.110  1.00 64.97  ? 256  ARG A CD  1 
ATOM   1540 N  NE  . ARG A 1 256 ? 5.108   -8.119  17.382  1.00 68.52  ? 256  ARG A NE  1 
ATOM   1541 C  CZ  . ARG A 1 256 ? 4.972   -9.294  16.775  1.00 69.23  ? 256  ARG A CZ  1 
ATOM   1542 N  NH1 . ARG A 1 256 ? 5.949   -10.186 16.826  1.00 69.07  ? 256  ARG A NH1 1 
ATOM   1543 N  NH2 . ARG A 1 256 ? 3.849   -9.584  16.132  1.00 71.69  ? 256  ARG A NH2 1 
ATOM   1544 N  N   . LEU A 1 257 ? 6.423   -2.661  20.332  1.00 49.82  ? 257  LEU A N   1 
ATOM   1545 C  CA  . LEU A 1 257 ? 6.588   -1.215  20.222  1.00 46.44  ? 257  LEU A CA  1 
ATOM   1546 C  C   . LEU A 1 257 ? 7.011   -0.613  21.555  1.00 48.44  ? 257  LEU A C   1 
ATOM   1547 O  O   . LEU A 1 257 ? 7.833   0.303   21.599  1.00 47.66  ? 257  LEU A O   1 
ATOM   1548 C  CB  . LEU A 1 257 ? 5.289   -0.563  19.740  1.00 45.86  ? 257  LEU A CB  1 
ATOM   1549 C  CG  . LEU A 1 257 ? 5.097   -0.345  18.235  1.00 44.80  ? 257  LEU A CG  1 
ATOM   1550 C  CD1 . LEU A 1 257 ? 5.695   -1.469  17.409  1.00 48.25  ? 257  LEU A CD1 1 
ATOM   1551 C  CD2 . LEU A 1 257 ? 3.622   -0.159  17.906  1.00 43.51  ? 257  LEU A CD2 1 
ATOM   1552 N  N   . LEU A 1 258 ? 6.442   -1.133  22.638  1.00 52.28  ? 258  LEU A N   1 
ATOM   1553 C  CA  . LEU A 1 258 ? 6.785   -0.679  23.978  1.00 50.63  ? 258  LEU A CA  1 
ATOM   1554 C  C   . LEU A 1 258 ? 8.221   -1.063  24.313  1.00 48.47  ? 258  LEU A C   1 
ATOM   1555 O  O   . LEU A 1 258 ? 8.985   -0.250  24.832  1.00 44.38  ? 258  LEU A O   1 
ATOM   1556 C  CB  . LEU A 1 258 ? 5.824   -1.273  25.008  1.00 53.96  ? 258  LEU A CB  1 
ATOM   1557 C  CG  . LEU A 1 258 ? 5.939   -0.767  26.447  1.00 55.82  ? 258  LEU A CG  1 
ATOM   1558 C  CD1 . LEU A 1 258 ? 5.676   0.730   26.517  1.00 52.20  ? 258  LEU A CD1 1 
ATOM   1559 C  CD2 . LEU A 1 258 ? 4.977   -1.527  27.346  1.00 57.02  ? 258  LEU A CD2 1 
ATOM   1560 N  N   . GLU A 1 259 ? 8.583   -2.306  24.005  1.00 52.31  ? 259  GLU A N   1 
ATOM   1561 C  CA  . GLU A 1 259 ? 9.945   -2.782  24.219  1.00 65.51  ? 259  GLU A CA  1 
ATOM   1562 C  C   . GLU A 1 259 ? 10.939  -1.992  23.376  1.00 58.23  ? 259  GLU A C   1 
ATOM   1563 O  O   . GLU A 1 259 ? 12.056  -1.719  23.816  1.00 60.81  ? 259  GLU A O   1 
ATOM   1564 C  CB  . GLU A 1 259 ? 10.060  -4.276  23.904  1.00 71.70  ? 259  GLU A CB  1 
ATOM   1565 C  CG  . GLU A 1 259 ? 9.414   -5.182  24.941  1.00 80.73  ? 259  GLU A CG  1 
ATOM   1566 C  CD  . GLU A 1 259 ? 9.680   -6.653  24.678  1.00 83.05  ? 259  GLU A CD  1 
ATOM   1567 O  OE1 . GLU A 1 259 ? 10.488  -6.963  23.777  1.00 83.98  ? 259  GLU A OE1 1 
ATOM   1568 O  OE2 . GLU A 1 259 ? 9.081   -7.498  25.376  1.00 85.95  ? 259  GLU A OE2 1 
ATOM   1569 N  N   . PHE A 1 260 ? 10.528  -1.626  22.165  1.00 51.91  ? 260  PHE A N   1 
ATOM   1570 C  CA  . PHE A 1 260 ? 11.375  -0.833  21.282  1.00 50.17  ? 260  PHE A CA  1 
ATOM   1571 C  C   . PHE A 1 260 ? 11.595  0.559   21.862  1.00 50.95  ? 260  PHE A C   1 
ATOM   1572 O  O   . PHE A 1 260 ? 12.677  1.132   21.729  1.00 51.32  ? 260  PHE A O   1 
ATOM   1573 C  CB  . PHE A 1 260 ? 10.769  -0.731  19.882  1.00 44.12  ? 260  PHE A CB  1 
ATOM   1574 C  CG  . PHE A 1 260 ? 11.670  -0.065  18.884  1.00 37.60  ? 260  PHE A CG  1 
ATOM   1575 C  CD1 . PHE A 1 260 ? 12.633  -0.796  18.209  1.00 38.44  ? 260  PHE A CD1 1 
ATOM   1576 C  CD2 . PHE A 1 260 ? 11.562  1.292   18.627  1.00 37.86  ? 260  PHE A CD2 1 
ATOM   1577 C  CE1 . PHE A 1 260 ? 13.471  -0.187  17.293  1.00 40.80  ? 260  PHE A CE1 1 
ATOM   1578 C  CE2 . PHE A 1 260 ? 12.397  1.908   17.712  1.00 40.33  ? 260  PHE A CE2 1 
ATOM   1579 C  CZ  . PHE A 1 260 ? 13.352  1.167   17.043  1.00 40.97  ? 260  PHE A CZ  1 
ATOM   1580 N  N   . ASN A 1 261 ? 10.563  1.098   22.504  1.00 58.48  ? 261  ASN A N   1 
ATOM   1581 C  CA  . ASN A 1 261 ? 10.675  2.380   23.189  1.00 57.00  ? 261  ASN A CA  1 
ATOM   1582 C  C   . ASN A 1 261 ? 11.201  2.194   24.609  1.00 58.23  ? 261  ASN A C   1 
ATOM   1583 O  O   . ASN A 1 261 ? 11.130  3.106   25.436  1.00 56.95  ? 261  ASN A O   1 
ATOM   1584 C  CB  . ASN A 1 261 ? 9.331   3.110   23.208  1.00 52.56  ? 261  ASN A CB  1 
ATOM   1585 C  CG  . ASN A 1 261 ? 9.482   4.602   23.451  1.00 51.70  ? 261  ASN A CG  1 
ATOM   1586 O  OD1 . ASN A 1 261 ? 10.233  5.284   22.753  1.00 54.31  ? 261  ASN A OD1 1 
ATOM   1587 N  ND2 . ASN A 1 261 ? 8.764   5.116   24.442  1.00 51.90  ? 261  ASN A ND2 1 
ATOM   1588 N  N   . GLN A 1 262 ? 11.720  1.000   24.881  1.00 55.38  ? 262  GLN A N   1 
ATOM   1589 C  CA  . GLN A 1 262 ? 12.408  0.705   26.135  1.00 60.26  ? 262  GLN A CA  1 
ATOM   1590 C  C   . GLN A 1 262 ? 11.473  0.757   27.343  1.00 55.93  ? 262  GLN A C   1 
ATOM   1591 O  O   . GLN A 1 262 ? 11.922  0.878   28.482  1.00 53.83  ? 262  GLN A O   1 
ATOM   1592 C  CB  . GLN A 1 262 ? 13.592  1.657   26.320  1.00 69.01  ? 262  GLN A CB  1 
ATOM   1593 C  CG  . GLN A 1 262 ? 14.141  2.192   25.002  1.00 78.15  ? 262  GLN A CG  1 
ATOM   1594 C  CD  . GLN A 1 262 ? 15.588  2.617   25.094  1.00 82.79  ? 262  GLN A CD  1 
ATOM   1595 O  OE1 . GLN A 1 262 ? 15.940  3.744   24.742  1.00 83.10  ? 262  GLN A OE1 1 
ATOM   1596 N  NE2 . GLN A 1 262 ? 16.441  1.714   25.567  1.00 85.23  ? 262  GLN A NE2 1 
ATOM   1597 N  N   . GLY A 1 263 ? 10.172  0.664   27.084  1.00 57.55  ? 263  GLY A N   1 
ATOM   1598 C  CA  . GLY A 1 263 ? 9.173   0.625   28.146  1.00 54.69  ? 263  GLY A CA  1 
ATOM   1599 C  C   . GLY A 1 263 ? 8.771   1.986   28.686  1.00 59.56  ? 263  GLY A C   1 
ATOM   1600 O  O   . GLY A 1 263 ? 8.046   2.076   29.676  1.00 61.37  ? 263  GLY A O   1 
ATOM   1601 N  N   . LYS A 1 264 ? 9.240   3.049   28.037  1.00 59.48  ? 264  LYS A N   1 
ATOM   1602 C  CA  . LYS A 1 264 ? 8.924   4.417   28.459  1.00 61.54  ? 264  LYS A CA  1 
ATOM   1603 C  C   . LYS A 1 264 ? 7.578   4.862   27.888  1.00 59.24  ? 264  LYS A C   1 
ATOM   1604 O  O   . LYS A 1 264 ? 7.125   4.313   26.883  1.00 53.17  ? 264  LYS A O   1 
ATOM   1605 C  CB  . LYS A 1 264 ? 10.041  5.376   28.044  1.00 70.74  ? 264  LYS A CB  1 
ATOM   1606 C  CG  . LYS A 1 264 ? 11.391  5.040   28.663  1.00 77.34  ? 264  LYS A CG  1 
ATOM   1607 C  CD  . LYS A 1 264 ? 12.460  6.039   28.254  1.00 83.02  ? 264  LYS A CD  1 
ATOM   1608 C  CE  . LYS A 1 264 ? 13.798  5.713   28.901  1.00 86.32  ? 264  LYS A CE  1 
ATOM   1609 N  NZ  . LYS A 1 264 ? 14.323  4.385   28.474  1.00 90.83  ? 264  LYS A NZ  1 
ATOM   1610 N  N   . LEU A 1 265 ? 6.933   5.851   28.510  1.00 59.89  ? 265  LEU A N   1 
ATOM   1611 C  CA  . LEU A 1 265 ? 5.518   6.083   28.189  1.00 53.86  ? 265  LEU A CA  1 
ATOM   1612 C  C   . LEU A 1 265 ? 4.892   7.470   27.986  1.00 63.72  ? 265  LEU A C   1 
ATOM   1613 O  O   . LEU A 1 265 ? 3.937   7.826   28.684  1.00 80.39  ? 265  LEU A O   1 
ATOM   1614 C  CB  . LEU A 1 265 ? 4.609   5.282   29.128  1.00 58.83  ? 265  LEU A CB  1 
ATOM   1615 C  CG  . LEU A 1 265 ? 3.717   4.242   28.446  1.00 61.18  ? 265  LEU A CG  1 
ATOM   1616 C  CD1 . LEU A 1 265 ? 2.466   4.019   29.279  1.00 59.71  ? 265  LEU A CD1 1 
ATOM   1617 C  CD2 . LEU A 1 265 ? 3.337   4.676   27.039  1.00 61.14  ? 265  LEU A CD2 1 
ATOM   1618 N  N   . PRO A 1 266 ? 5.448   8.273   27.076  1.00 64.41  ? 266  PRO A N   1 
ATOM   1619 C  CA  . PRO A 1 266 ? 4.642   8.759   25.982  1.00 54.15  ? 266  PRO A CA  1 
ATOM   1620 C  C   . PRO A 1 266 ? 5.286   8.274   24.677  1.00 53.46  ? 266  PRO A C   1 
ATOM   1621 O  O   . PRO A 1 266 ? 6.423   8.647   24.387  1.00 56.54  ? 266  PRO A O   1 
ATOM   1622 C  CB  . PRO A 1 266 ? 4.823   10.273  26.102  1.00 53.42  ? 266  PRO A CB  1 
ATOM   1623 C  CG  . PRO A 1 266 ? 6.250   10.433  26.755  1.00 58.46  ? 266  PRO A CG  1 
ATOM   1624 C  CD  . PRO A 1 266 ? 6.712   9.020   27.143  1.00 63.00  ? 266  PRO A CD  1 
ATOM   1625 N  N   . PHE A 1 267 ? 4.601   7.438   23.901  1.00 53.34  ? 267  PHE A N   1 
ATOM   1626 C  CA  . PHE A 1 267 ? 5.120   7.088   22.571  1.00 46.29  ? 267  PHE A CA  1 
ATOM   1627 C  C   . PHE A 1 267 ? 4.023   6.998   21.515  1.00 44.14  ? 267  PHE A C   1 
ATOM   1628 O  O   . PHE A 1 267 ? 2.894   6.605   21.808  1.00 41.97  ? 267  PHE A O   1 
ATOM   1629 C  CB  . PHE A 1 267 ? 5.994   5.822   22.599  1.00 44.75  ? 267  PHE A CB  1 
ATOM   1630 C  CG  . PHE A 1 267 ? 5.220   4.532   22.570  1.00 47.14  ? 267  PHE A CG  1 
ATOM   1631 C  CD1 . PHE A 1 267 ? 4.863   3.946   21.364  1.00 46.60  ? 267  PHE A CD1 1 
ATOM   1632 C  CD2 . PHE A 1 267 ? 4.873   3.893   23.748  1.00 44.99  ? 267  PHE A CD2 1 
ATOM   1633 C  CE1 . PHE A 1 267 ? 4.157   2.755   21.336  1.00 45.17  ? 267  PHE A CE1 1 
ATOM   1634 C  CE2 . PHE A 1 267 ? 4.168   2.701   23.727  1.00 46.55  ? 267  PHE A CE2 1 
ATOM   1635 C  CZ  . PHE A 1 267 ? 3.810   2.132   22.520  1.00 45.03  ? 267  PHE A CZ  1 
ATOM   1636 N  N   . ALA A 1 268 ? 4.367   7.367   20.286  1.00 44.61  ? 268  ALA A N   1 
ATOM   1637 C  CA  . ALA A 1 268 ? 3.415   7.331   19.186  1.00 40.35  ? 268  ALA A CA  1 
ATOM   1638 C  C   . ALA A 1 268 ? 3.805   6.277   18.159  1.00 38.92  ? 268  ALA A C   1 
ATOM   1639 O  O   . ALA A 1 268 ? 4.986   6.078   17.874  1.00 35.72  ? 268  ALA A O   1 
ATOM   1640 C  CB  . ALA A 1 268 ? 3.306   8.698   18.531  1.00 37.46  ? 268  ALA A CB  1 
ATOM   1641 N  N   . ALA A 1 269 ? 2.801   5.603   17.613  1.00 37.85  ? 269  ALA A N   1 
ATOM   1642 C  CA  . ALA A 1 269 ? 3.015   4.607   16.576  1.00 36.23  ? 269  ALA A CA  1 
ATOM   1643 C  C   . ALA A 1 269 ? 2.120   4.919   15.384  1.00 34.48  ? 269  ALA A C   1 
ATOM   1644 O  O   . ALA A 1 269 ? 0.943   5.237   15.552  1.00 34.99  ? 269  ALA A O   1 
ATOM   1645 C  CB  . ALA A 1 269 ? 2.732   3.216   17.111  1.00 29.61  ? 269  ALA A CB  1 
ATOM   1646 N  N   . ALA A 1 270 ? 2.681   4.836   14.183  1.00 33.14  ? 270  ALA A N   1 
ATOM   1647 C  CA  . ALA A 1 270 ? 1.941   5.186   12.977  1.00 30.47  ? 270  ALA A CA  1 
ATOM   1648 C  C   . ALA A 1 270 ? 2.011   4.100   11.915  1.00 35.30  ? 270  ALA A C   1 
ATOM   1649 O  O   . ALA A 1 270 ? 2.882   3.231   11.950  1.00 32.69  ? 270  ALA A O   1 
ATOM   1650 C  CB  . ALA A 1 270 ? 2.439   6.507   12.411  1.00 31.77  ? 270  ALA A CB  1 
ATOM   1651 N  N   . GLN A 1 271 ? 1.080   4.163   10.969  1.00 35.62  ? 271  GLN A N   1 
ATOM   1652 C  CA  . GLN A 1 271 ? 1.062   3.250   9.838   1.00 33.60  ? 271  GLN A CA  1 
ATOM   1653 C  C   . GLN A 1 271 ? 0.328   3.890   8.666   1.00 35.84  ? 271  GLN A C   1 
ATOM   1654 O  O   . GLN A 1 271 ? -0.779  4.406   8.822   1.00 45.66  ? 271  GLN A O   1 
ATOM   1655 C  CB  . GLN A 1 271 ? 0.406   1.924   10.223  1.00 27.76  ? 271  GLN A CB  1 
ATOM   1656 C  CG  . GLN A 1 271 ? 0.386   0.892   9.107   1.00 40.78  ? 271  GLN A CG  1 
ATOM   1657 C  CD  . GLN A 1 271 ? -0.047  -0.485  9.580   1.00 44.15  ? 271  GLN A CD  1 
ATOM   1658 O  OE1 . GLN A 1 271 ? 0.044   -1.463  8.838   1.00 48.12  ? 271  GLN A OE1 1 
ATOM   1659 N  NE2 . GLN A 1 271 ? -0.517  -0.568  10.820  1.00 39.15  ? 271  GLN A NE2 1 
ATOM   1660 N  N   . ILE A 1 272 ? 0.959   3.867   7.498   1.00 38.04  ? 272  ILE A N   1 
ATOM   1661 C  CA  . ILE A 1 272 ? 0.361   4.416   6.290   1.00 29.55  ? 272  ILE A CA  1 
ATOM   1662 C  C   . ILE A 1 272 ? 0.106   3.296   5.290   1.00 30.60  ? 272  ILE A C   1 
ATOM   1663 O  O   . ILE A 1 272 ? 1.043   2.740   4.717   1.00 39.29  ? 272  ILE A O   1 
ATOM   1664 C  CB  . ILE A 1 272 ? 1.270   5.477   5.644   1.00 33.41  ? 272  ILE A CB  1 
ATOM   1665 C  CG1 . ILE A 1 272 ? 1.733   6.495   6.689   1.00 29.96  ? 272  ILE A CG1 1 
ATOM   1666 C  CG2 . ILE A 1 272 ? 0.551   6.170   4.492   1.00 38.25  ? 272  ILE A CG2 1 
ATOM   1667 C  CD1 . ILE A 1 272 ? 2.838   7.407   6.204   1.00 33.81  ? 272  ILE A CD1 1 
ATOM   1668 N  N   . GLY A 1 273 ? -1.164  2.962   5.089   1.00 36.59  ? 273  GLY A N   1 
ATOM   1669 C  CA  . GLY A 1 273 ? -1.531  1.887   4.175   1.00 32.72  ? 273  GLY A CA  1 
ATOM   1670 C  C   . GLY A 1 273 ? -2.982  1.941   3.747   1.00 32.95  ? 273  GLY A C   1 
ATOM   1671 O  O   . GLY A 1 273 ? -3.716  2.858   4.118   1.00 37.26  ? 273  GLY A O   1 
ATOM   1672 N  N   . ASN A 1 274 ? -3.398  0.951   2.965   1.00 39.14  ? 274  ASN A N   1 
ATOM   1673 C  CA  . ASN A 1 274 ? -4.764  0.898   2.460   1.00 32.89  ? 274  ASN A CA  1 
ATOM   1674 C  C   . ASN A 1 274 ? -5.718  0.132   3.368   1.00 35.26  ? 274  ASN A C   1 
ATOM   1675 O  O   . ASN A 1 274 ? -5.342  -0.862  3.991   1.00 32.18  ? 274  ASN A O   1 
ATOM   1676 C  CB  . ASN A 1 274 ? -4.795  0.306   1.049   1.00 36.14  ? 274  ASN A CB  1 
ATOM   1677 C  CG  . ASN A 1 274 ? -4.309  1.282   -0.003  1.00 37.36  ? 274  ASN A CG  1 
ATOM   1678 O  OD1 . ASN A 1 274 ? -3.769  2.340   0.318   1.00 37.20  ? 274  ASN A OD1 1 
ATOM   1679 N  ND2 . ASN A 1 274 ? -4.502  0.932   -1.270  1.00 38.96  ? 274  ASN A ND2 1 
ATOM   1680 N  N   . SER A 1 275 ? -6.955  0.613   3.438   1.00 35.61  ? 275  SER A N   1 
ATOM   1681 C  CA  . SER A 1 275 ? -8.014  -0.065  4.173   1.00 34.39  ? 275  SER A CA  1 
ATOM   1682 C  C   . SER A 1 275 ? -9.208  -0.281  3.253   1.00 40.35  ? 275  SER A C   1 
ATOM   1683 O  O   . SER A 1 275 ? -9.338  0.384   2.224   1.00 41.15  ? 275  SER A O   1 
ATOM   1684 C  CB  . SER A 1 275 ? -8.423  0.743   5.403   1.00 44.41  ? 275  SER A CB  1 
ATOM   1685 O  OG  . SER A 1 275 ? -7.378  0.770   6.360   1.00 51.15  ? 275  SER A OG  1 
ATOM   1686 N  N   . PHE A 1 276 ? -10.080 -1.212  3.626   1.00 37.97  ? 276  PHE A N   1 
ATOM   1687 C  CA  . PHE A 1 276 ? -11.183 -1.606  2.760   1.00 39.44  ? 276  PHE A CA  1 
ATOM   1688 C  C   . PHE A 1 276 ? -12.528 -1.533  3.471   1.00 42.27  ? 276  PHE A C   1 
ATOM   1689 O  O   . PHE A 1 276 ? -12.684 -2.045  4.579   1.00 52.00  ? 276  PHE A O   1 
ATOM   1690 C  CB  . PHE A 1 276 ? -10.955 -3.024  2.229   1.00 43.62  ? 276  PHE A CB  1 
ATOM   1691 C  CG  . PHE A 1 276 ? -9.607  -3.227  1.596   1.00 43.43  ? 276  PHE A CG  1 
ATOM   1692 C  CD1 . PHE A 1 276 ? -8.499  -3.528  2.374   1.00 42.98  ? 276  PHE A CD1 1 
ATOM   1693 C  CD2 . PHE A 1 276 ? -9.447  -3.122  0.225   1.00 39.96  ? 276  PHE A CD2 1 
ATOM   1694 C  CE1 . PHE A 1 276 ? -7.256  -3.716  1.797   1.00 41.05  ? 276  PHE A CE1 1 
ATOM   1695 C  CE2 . PHE A 1 276 ? -8.207  -3.310  -0.358  1.00 43.06  ? 276  PHE A CE2 1 
ATOM   1696 C  CZ  . PHE A 1 276 ? -7.111  -3.607  0.429   1.00 41.97  ? 276  PHE A CZ  1 
ATOM   1697 N  N   . ARG A 1 277 ? -13.499 -0.894  2.826   1.00 46.35  ? 277  ARG A N   1 
ATOM   1698 C  CA  . ARG A 1 277 ? -14.855 -0.819  3.358   1.00 47.41  ? 277  ARG A CA  1 
ATOM   1699 C  C   . ARG A 1 277 ? -15.876 -1.122  2.266   1.00 44.32  ? 277  ARG A C   1 
ATOM   1700 O  O   . ARG A 1 277 ? -16.079 -0.324  1.352   1.00 43.05  ? 277  ARG A O   1 
ATOM   1701 C  CB  . ARG A 1 277 ? -15.117 0.552   3.988   1.00 55.11  ? 277  ARG A CB  1 
ATOM   1702 C  CG  . ARG A 1 277 ? -14.228 0.849   5.188   1.00 60.72  ? 277  ARG A CG  1 
ATOM   1703 C  CD  . ARG A 1 277 ? -14.540 2.197   5.812   1.00 65.35  ? 277  ARG A CD  1 
ATOM   1704 N  NE  . ARG A 1 277 ? -13.603 2.518   6.886   1.00 74.28  ? 277  ARG A NE  1 
ATOM   1705 C  CZ  . ARG A 1 277 ? -13.677 3.606   7.646   1.00 78.41  ? 277  ARG A CZ  1 
ATOM   1706 N  NH1 . ARG A 1 277 ? -14.650 4.488   7.458   1.00 79.98  ? 277  ARG A NH1 1 
ATOM   1707 N  NH2 . ARG A 1 277 ? -12.775 3.811   8.597   1.00 78.57  ? 277  ARG A NH2 1 
ATOM   1708 N  N   . ASN A 1 278 ? -16.509 -2.286  2.370   1.00 46.47  ? 278  ASN A N   1 
ATOM   1709 C  CA  . ASN A 1 278 ? -17.462 -2.751  1.367   1.00 49.77  ? 278  ASN A CA  1 
ATOM   1710 C  C   . ASN A 1 278 ? -18.754 -1.937  1.366   1.00 53.84  ? 278  ASN A C   1 
ATOM   1711 O  O   . ASN A 1 278 ? -19.775 -2.376  1.895   1.00 57.44  ? 278  ASN A O   1 
ATOM   1712 C  CB  . ASN A 1 278 ? -17.769 -4.237  1.585   1.00 44.10  ? 278  ASN A CB  1 
ATOM   1713 C  CG  . ASN A 1 278 ? -18.320 -4.910  0.342   1.00 45.55  ? 278  ASN A CG  1 
ATOM   1714 O  OD1 . ASN A 1 278 ? -18.888 -6.000  0.413   1.00 46.13  ? 278  ASN A OD1 1 
ATOM   1715 N  ND2 . ASN A 1 278 ? -18.151 -4.265  -0.806  1.00 42.15  ? 278  ASN A ND2 1 
ATOM   1716 N  N   . GLU A 1 279 ? -18.700 -0.752  0.764   1.00 55.55  ? 279  GLU A N   1 
ATOM   1717 C  CA  . GLU A 1 279 ? -19.845 0.154   0.731   1.00 55.80  ? 279  GLU A CA  1 
ATOM   1718 C  C   . GLU A 1 279 ? -21.011 -0.434  -0.057  1.00 57.53  ? 279  GLU A C   1 
ATOM   1719 O  O   . GLU A 1 279 ? -20.811 -1.111  -1.065  1.00 58.62  ? 279  GLU A O   1 
ATOM   1720 C  CB  . GLU A 1 279 ? -19.444 1.508   0.141   1.00 57.41  ? 279  GLU A CB  1 
ATOM   1721 C  CG  . GLU A 1 279 ? -18.366 2.244   0.927   1.00 60.07  ? 279  GLU A CG  1 
ATOM   1722 C  CD  . GLU A 1 279 ? -18.869 2.801   2.247   1.00 62.36  ? 279  GLU A CD  1 
ATOM   1723 O  OE1 . GLU A 1 279 ? -20.100 2.911   2.426   1.00 63.59  ? 279  GLU A OE1 1 
ATOM   1724 O  OE2 . GLU A 1 279 ? -18.027 3.137   3.107   1.00 65.70  ? 279  GLU A OE2 1 
ATOM   1725 N  N   . ILE A 1 280 ? -22.226 -0.166  0.414   1.00 56.74  ? 280  ILE A N   1 
ATOM   1726 C  CA  . ILE A 1 280 ? -23.436 -0.688  -0.214  1.00 59.95  ? 280  ILE A CA  1 
ATOM   1727 C  C   . ILE A 1 280 ? -23.624 -0.131  -1.623  1.00 61.70  ? 280  ILE A C   1 
ATOM   1728 O  O   . ILE A 1 280 ? -23.756 -0.888  -2.585  1.00 68.65  ? 280  ILE A O   1 
ATOM   1729 C  CB  . ILE A 1 280 ? -24.689 -0.391  0.637   1.00 60.74  ? 280  ILE A CB  1 
ATOM   1730 C  CG1 . ILE A 1 280 ? -24.576 -1.073  2.003   1.00 61.57  ? 280  ILE A CG1 1 
ATOM   1731 C  CG2 . ILE A 1 280 ? -25.949 -0.847  -0.086  1.00 61.40  ? 280  ILE A CG2 1 
ATOM   1732 C  CD1 . ILE A 1 280 ? -25.721 -0.763  2.946   1.00 59.61  ? 280  ILE A CD1 1 
ATOM   1733 N  N   . SER A 1 281 ? -23.633 1.194   -1.738  1.00 59.66  ? 281  SER A N   1 
ATOM   1734 C  CA  . SER A 1 281 ? -23.776 1.844   -3.036  1.00 62.83  ? 281  SER A CA  1 
ATOM   1735 C  C   . SER A 1 281 ? -23.091 3.208   -3.059  1.00 62.46  ? 281  SER A C   1 
ATOM   1736 O  O   . SER A 1 281 ? -23.754 4.241   -2.951  1.00 65.79  ? 281  SER A O   1 
ATOM   1737 C  CB  . SER A 1 281 ? -25.254 1.987   -3.405  1.00 69.19  ? 281  SER A CB  1 
ATOM   1738 O  OG  . SER A 1 281 ? -25.404 2.548   -4.697  1.00 76.25  ? 281  SER A OG  1 
ATOM   1739 N  N   . PRO A 1 282 ? -21.755 3.212   -3.200  1.00 59.98  ? 282  PRO A N   1 
ATOM   1740 C  CA  . PRO A 1 282 ? -20.973 4.444   -3.269  1.00 57.37  ? 282  PRO A CA  1 
ATOM   1741 C  C   . PRO A 1 282 ? -21.255 5.211   -4.557  1.00 57.55  ? 282  PRO A C   1 
ATOM   1742 O  O   . PRO A 1 282 ? -21.188 4.641   -5.647  1.00 59.18  ? 282  PRO A O   1 
ATOM   1743 C  CB  . PRO A 1 282 ? -19.526 3.943   -3.247  1.00 56.05  ? 282  PRO A CB  1 
ATOM   1744 C  CG  . PRO A 1 282 ? -19.594 2.551   -3.753  1.00 54.63  ? 282  PRO A CG  1 
ATOM   1745 C  CD  . PRO A 1 282 ? -20.910 2.009   -3.299  1.00 56.56  ? 282  PRO A CD  1 
ATOM   1746 N  N   . ARG A 1 283 ? -21.572 6.495   -4.425  1.00 60.54  ? 283  ARG A N   1 
ATOM   1747 C  CA  . ARG A 1 283 ? -21.960 7.305   -5.570  1.00 61.69  ? 283  ARG A CA  1 
ATOM   1748 C  C   . ARG A 1 283 ? -21.651 8.774   -5.296  1.00 55.87  ? 283  ARG A C   1 
ATOM   1749 O  O   . ARG A 1 283 ? -22.430 9.660   -5.647  1.00 53.62  ? 283  ARG A O   1 
ATOM   1750 C  CB  . ARG A 1 283 ? -23.452 7.114   -5.854  1.00 77.16  ? 283  ARG A CB  1 
ATOM   1751 C  CG  . ARG A 1 283 ? -23.803 6.876   -7.316  1.00 84.43  ? 283  ARG A CG  1 
ATOM   1752 C  CD  . ARG A 1 283 ? -24.105 8.167   -8.055  1.00 91.76  ? 283  ARG A CD  1 
ATOM   1753 N  NE  . ARG A 1 283 ? -24.731 7.908   -9.349  1.00 99.24  ? 283  ARG A NE  1 
ATOM   1754 C  CZ  . ARG A 1 283 ? -25.236 8.849   -10.140 1.00 102.56 ? 283  ARG A CZ  1 
ATOM   1755 N  NH1 . ARG A 1 283 ? -25.193 10.122  -9.772  1.00 106.00 ? 283  ARG A NH1 1 
ATOM   1756 N  NH2 . ARG A 1 283 ? -25.787 8.517   -11.300 1.00 103.31 ? 283  ARG A NH2 1 
ATOM   1757 N  N   . SER A 1 284 ? -20.509 9.023   -4.662  1.00 55.04  ? 284  SER A N   1 
ATOM   1758 C  CA  . SER A 1 284 ? -20.109 10.380  -4.304  1.00 54.07  ? 284  SER A CA  1 
ATOM   1759 C  C   . SER A 1 284 ? -18.619 10.614  -4.542  1.00 51.06  ? 284  SER A C   1 
ATOM   1760 O  O   . SER A 1 284 ? -17.941 11.233  -3.722  1.00 46.81  ? 284  SER A O   1 
ATOM   1761 C  CB  . SER A 1 284 ? -20.465 10.674  -2.844  1.00 58.71  ? 284  SER A CB  1 
ATOM   1762 O  OG  . SER A 1 284 ? -19.869 9.729   -1.973  1.00 63.21  ? 284  SER A OG  1 
ATOM   1763 N  N   . GLY A 1 285 ? -18.119 10.115  -5.668  1.00 46.03  ? 285  GLY A N   1 
ATOM   1764 C  CA  . GLY A 1 285 ? -16.721 10.307  -6.044  1.00 38.43  ? 285  GLY A CA  1 
ATOM   1765 C  C   . GLY A 1 285 ? -15.739 9.685   -5.070  1.00 43.09  ? 285  GLY A C   1 
ATOM   1766 O  O   . GLY A 1 285 ? -15.887 8.526   -4.681  1.00 43.24  ? 285  GLY A O   1 
ATOM   1767 N  N   . LEU A 1 286 ? -14.737 10.463  -4.672  1.00 41.35  ? 286  LEU A N   1 
ATOM   1768 C  CA  . LEU A 1 286 ? -13.689 9.982   -3.776  1.00 30.76  ? 286  LEU A CA  1 
ATOM   1769 C  C   . LEU A 1 286 ? -14.090 10.030  -2.303  1.00 37.88  ? 286  LEU A C   1 
ATOM   1770 O  O   . LEU A 1 286 ? -13.327 9.604   -1.437  1.00 37.62  ? 286  LEU A O   1 
ATOM   1771 C  CB  . LEU A 1 286 ? -12.397 10.777  -3.987  1.00 30.49  ? 286  LEU A CB  1 
ATOM   1772 C  CG  . LEU A 1 286 ? -11.615 10.525  -5.278  1.00 33.22  ? 286  LEU A CG  1 
ATOM   1773 C  CD1 . LEU A 1 286 ? -10.386 11.417  -5.339  1.00 28.05  ? 286  LEU A CD1 1 
ATOM   1774 C  CD2 . LEU A 1 286 ? -11.218 9.061   -5.396  1.00 31.28  ? 286  LEU A CD2 1 
ATOM   1775 N  N   . ILE A 1 287 ? -15.281 10.551  -2.019  1.00 38.25  ? 287  ILE A N   1 
ATOM   1776 C  CA  . ILE A 1 287 ? -15.761 10.649  -0.642  1.00 38.20  ? 287  ILE A CA  1 
ATOM   1777 C  C   . ILE A 1 287 ? -16.044 9.267   -0.062  1.00 40.06  ? 287  ILE A C   1 
ATOM   1778 O  O   . ILE A 1 287 ? -15.406 8.845   0.903   1.00 41.64  ? 287  ILE A O   1 
ATOM   1779 C  CB  . ILE A 1 287 ? -17.034 11.518  -0.535  1.00 39.55  ? 287  ILE A CB  1 
ATOM   1780 C  CG1 . ILE A 1 287 ? -16.817 12.883  -1.194  1.00 40.77  ? 287  ILE A CG1 1 
ATOM   1781 C  CG2 . ILE A 1 287 ? -17.452 11.676  0.921   1.00 37.14  ? 287  ILE A CG2 1 
ATOM   1782 C  CD1 . ILE A 1 287 ? -15.622 13.645  -0.665  1.00 38.85  ? 287  ILE A CD1 1 
ATOM   1783 N  N   . ARG A 1 288 ? -17.004 8.566   -0.656  1.00 39.30  ? 288  ARG A N   1 
ATOM   1784 C  CA  . ARG A 1 288 ? -17.339 7.215   -0.226  1.00 45.97  ? 288  ARG A CA  1 
ATOM   1785 C  C   . ARG A 1 288 ? -16.715 6.193   -1.169  1.00 42.98  ? 288  ARG A C   1 
ATOM   1786 O  O   . ARG A 1 288 ? -17.212 5.962   -2.271  1.00 42.37  ? 288  ARG A O   1 
ATOM   1787 C  CB  . ARG A 1 288 ? -18.856 7.034   -0.149  1.00 64.73  ? 288  ARG A CB  1 
ATOM   1788 C  CG  . ARG A 1 288 ? -19.518 7.883   0.928   1.00 78.41  ? 288  ARG A CG  1 
ATOM   1789 C  CD  . ARG A 1 288 ? -21.034 7.806   0.854   1.00 88.13  ? 288  ARG A CD  1 
ATOM   1790 N  NE  . ARG A 1 288 ? -21.671 8.549   1.939   1.00 96.03  ? 288  ARG A NE  1 
ATOM   1791 C  CZ  . ARG A 1 288 ? -22.986 8.636   2.116   1.00 101.28 ? 288  ARG A CZ  1 
ATOM   1792 N  NH1 . ARG A 1 288 ? -23.814 8.026   1.279   1.00 103.29 ? 288  ARG A NH1 1 
ATOM   1793 N  NH2 . ARG A 1 288 ? -23.473 9.336   3.132   1.00 101.24 ? 288  ARG A NH2 1 
ATOM   1794 N  N   . VAL A 1 289 ? -15.615 5.591   -0.727  1.00 35.33  ? 289  VAL A N   1 
ATOM   1795 C  CA  . VAL A 1 289 ? -14.871 4.640   -1.544  1.00 34.68  ? 289  VAL A CA  1 
ATOM   1796 C  C   . VAL A 1 289 ? -14.672 3.311   -0.820  1.00 36.38  ? 289  VAL A C   1 
ATOM   1797 O  O   . VAL A 1 289 ? -14.777 3.239   0.405   1.00 36.27  ? 289  VAL A O   1 
ATOM   1798 C  CB  . VAL A 1 289 ? -13.499 5.209   -1.961  1.00 35.97  ? 289  VAL A CB  1 
ATOM   1799 C  CG1 . VAL A 1 289 ? -13.661 6.208   -3.097  1.00 34.86  ? 289  VAL A CG1 1 
ATOM   1800 C  CG2 . VAL A 1 289 ? -12.801 5.850   -0.769  1.00 27.00  ? 289  VAL A CG2 1 
ATOM   1801 N  N   . ARG A 1 290 ? -14.381 2.264   -1.585  1.00 38.25  ? 290  ARG A N   1 
ATOM   1802 C  CA  . ARG A 1 290 ? -14.234 0.921   -1.032  1.00 39.13  ? 290  ARG A CA  1 
ATOM   1803 C  C   . ARG A 1 290 ? -12.779 0.565   -0.749  1.00 40.33  ? 290  ARG A C   1 
ATOM   1804 O  O   . ARG A 1 290 ? -12.494 -0.355  0.017   1.00 40.00  ? 290  ARG A O   1 
ATOM   1805 C  CB  . ARG A 1 290 ? -14.868 -0.111  -1.965  1.00 47.81  ? 290  ARG A CB  1 
ATOM   1806 C  CG  . ARG A 1 290 ? -16.386 -0.062  -1.979  1.00 48.86  ? 290  ARG A CG  1 
ATOM   1807 C  CD  . ARG A 1 290 ? -16.964 -0.879  -3.118  1.00 48.93  ? 290  ARG A CD  1 
ATOM   1808 N  NE  . ARG A 1 290 ? -18.415 -0.999  -3.011  1.00 50.22  ? 290  ARG A NE  1 
ATOM   1809 C  CZ  . ARG A 1 290 ? -19.209 -1.382  -4.004  1.00 53.11  ? 290  ARG A CZ  1 
ATOM   1810 N  NH1 . ARG A 1 290 ? -18.696 -1.678  -5.191  1.00 58.09  ? 290  ARG A NH1 1 
ATOM   1811 N  NH2 . ARG A 1 290 ? -20.519 -1.464  -3.814  1.00 54.58  ? 290  ARG A NH2 1 
ATOM   1812 N  N   . GLU A 1 291 ? -11.864 1.296   -1.376  1.00 39.80  ? 291  GLU A N   1 
ATOM   1813 C  CA  . GLU A 1 291 ? -10.441 1.141   -1.109  1.00 29.13  ? 291  GLU A CA  1 
ATOM   1814 C  C   . GLU A 1 291 ? -9.800  2.518   -1.038  1.00 34.80  ? 291  GLU A C   1 
ATOM   1815 O  O   . GLU A 1 291 ? -9.982  3.341   -1.934  1.00 31.38  ? 291  GLU A O   1 
ATOM   1816 C  CB  . GLU A 1 291 ? -9.767  0.306   -2.197  1.00 43.44  ? 291  GLU A CB  1 
ATOM   1817 C  CG  . GLU A 1 291 ? -8.393  -0.209  -1.807  1.00 50.57  ? 291  GLU A CG  1 
ATOM   1818 C  CD  . GLU A 1 291 ? -7.593  -0.695  -2.996  1.00 55.95  ? 291  GLU A CD  1 
ATOM   1819 O  OE1 . GLU A 1 291 ? -7.602  -1.915  -3.263  1.00 58.60  ? 291  GLU A OE1 1 
ATOM   1820 O  OE2 . GLU A 1 291 ? -6.960  0.145   -3.669  1.00 63.19  ? 291  GLU A OE2 1 
ATOM   1821 N  N   . PHE A 1 292 ? -9.050  2.765   0.030   1.00 35.07  ? 292  PHE A N   1 
ATOM   1822 C  CA  . PHE A 1 292 ? -8.464  4.079   0.255   1.00 30.63  ? 292  PHE A CA  1 
ATOM   1823 C  C   . PHE A 1 292 ? -7.206  3.999   1.109   1.00 34.85  ? 292  PHE A C   1 
ATOM   1824 O  O   . PHE A 1 292 ? -7.080  3.126   1.967   1.00 38.61  ? 292  PHE A O   1 
ATOM   1825 C  CB  . PHE A 1 292 ? -9.486  5.010   0.914   1.00 31.02  ? 292  PHE A CB  1 
ATOM   1826 C  CG  . PHE A 1 292 ? -10.130 4.431   2.143   1.00 31.74  ? 292  PHE A CG  1 
ATOM   1827 C  CD1 . PHE A 1 292 ? -11.291 3.678   2.045   1.00 33.15  ? 292  PHE A CD1 1 
ATOM   1828 C  CD2 . PHE A 1 292 ? -9.578  4.641   3.396   1.00 30.29  ? 292  PHE A CD2 1 
ATOM   1829 C  CE1 . PHE A 1 292 ? -11.885 3.143   3.174   1.00 35.41  ? 292  PHE A CE1 1 
ATOM   1830 C  CE2 . PHE A 1 292 ? -10.167 4.109   4.529   1.00 35.71  ? 292  PHE A CE2 1 
ATOM   1831 C  CZ  . PHE A 1 292 ? -11.322 3.359   4.418   1.00 33.35  ? 292  PHE A CZ  1 
ATOM   1832 N  N   . THR A 1 293 ? -6.277  4.917   0.865   1.00 34.28  ? 293  THR A N   1 
ATOM   1833 C  CA  . THR A 1 293 ? -5.058  5.000   1.655   1.00 39.62  ? 293  THR A CA  1 
ATOM   1834 C  C   . THR A 1 293 ? -5.325  5.808   2.917   1.00 36.61  ? 293  THR A C   1 
ATOM   1835 O  O   . THR A 1 293 ? -5.958  6.862   2.868   1.00 37.11  ? 293  THR A O   1 
ATOM   1836 C  CB  . THR A 1 293 ? -3.913  5.649   0.857   1.00 37.07  ? 293  THR A CB  1 
ATOM   1837 O  OG1 . THR A 1 293 ? -3.786  4.997   -0.412  1.00 36.56  ? 293  THR A OG1 1 
ATOM   1838 C  CG2 . THR A 1 293 ? -2.597  5.534   1.613   1.00 33.63  ? 293  THR A CG2 1 
ATOM   1839 N  N   . MET A 1 294 ? -4.840  5.308   4.048   1.00 35.80  ? 294  MET A N   1 
ATOM   1840 C  CA  . MET A 1 294 ? -5.102  5.943   5.329   1.00 44.01  ? 294  MET A CA  1 
ATOM   1841 C  C   . MET A 1 294 ? -3.834  6.066   6.168   1.00 48.14  ? 294  MET A C   1 
ATOM   1842 O  O   . MET A 1 294 ? -2.991  5.168   6.178   1.00 50.89  ? 294  MET A O   1 
ATOM   1843 C  CB  . MET A 1 294 ? -6.174  5.160   6.089   1.00 52.61  ? 294  MET A CB  1 
ATOM   1844 C  CG  . MET A 1 294 ? -6.806  5.917   7.242   1.00 64.74  ? 294  MET A CG  1 
ATOM   1845 S  SD  . MET A 1 294 ? -8.319  5.137   7.830   1.00 66.63  ? 294  MET A SD  1 
ATOM   1846 C  CE  . MET A 1 294 ? -7.697  3.531   8.315   1.00 66.51  ? 294  MET A CE  1 
ATOM   1847 N  N   . ALA A 1 295 ? -3.706  7.192   6.862   1.00 45.55  ? 295  ALA A N   1 
ATOM   1848 C  CA  . ALA A 1 295 ? -2.592  7.417   7.773   1.00 36.31  ? 295  ALA A CA  1 
ATOM   1849 C  C   . ALA A 1 295 ? -3.103  7.445   9.209   1.00 39.21  ? 295  ALA A C   1 
ATOM   1850 O  O   . ALA A 1 295 ? -3.949  8.269   9.559   1.00 39.92  ? 295  ALA A O   1 
ATOM   1851 C  CB  . ALA A 1 295 ? -1.882  8.713   7.429   1.00 30.95  ? 295  ALA A CB  1 
ATOM   1852 N  N   . GLU A 1 296 ? -2.591  6.537   10.033  1.00 41.61  ? 296  GLU A N   1 
ATOM   1853 C  CA  . GLU A 1 296 ? -3.061  6.386   11.407  1.00 38.90  ? 296  GLU A CA  1 
ATOM   1854 C  C   . GLU A 1 296 ? -1.945  6.639   12.411  1.00 39.11  ? 296  GLU A C   1 
ATOM   1855 O  O   . GLU A 1 296 ? -0.812  6.206   12.211  1.00 46.98  ? 296  GLU A O   1 
ATOM   1856 C  CB  . GLU A 1 296 ? -3.617  4.978   11.617  1.00 49.14  ? 296  GLU A CB  1 
ATOM   1857 C  CG  . GLU A 1 296 ? -4.952  4.714   10.941  1.00 59.94  ? 296  GLU A CG  1 
ATOM   1858 C  CD  . GLU A 1 296 ? -6.127  4.847   11.890  1.00 62.74  ? 296  GLU A CD  1 
ATOM   1859 O  OE1 . GLU A 1 296 ? -5.912  5.228   13.060  1.00 62.50  ? 296  GLU A OE1 1 
ATOM   1860 O  OE2 . GLU A 1 296 ? -7.266  4.564   11.466  1.00 66.82  ? 296  GLU A OE2 1 
ATOM   1861 N  N   . ILE A 1 297 ? -2.274  7.339   13.492  1.00 37.34  ? 297  ILE A N   1 
ATOM   1862 C  CA  . ILE A 1 297 ? -1.338  7.542   14.592  1.00 36.43  ? 297  ILE A CA  1 
ATOM   1863 C  C   . ILE A 1 297 ? -1.954  7.060   15.900  1.00 41.49  ? 297  ILE A C   1 
ATOM   1864 O  O   . ILE A 1 297 ? -3.090  7.405   16.221  1.00 45.56  ? 297  ILE A O   1 
ATOM   1865 C  CB  . ILE A 1 297 ? -0.948  9.025   14.749  1.00 32.63  ? 297  ILE A CB  1 
ATOM   1866 C  CG1 . ILE A 1 297 ? -0.164  9.512   13.530  1.00 32.52  ? 297  ILE A CG1 1 
ATOM   1867 C  CG2 . ILE A 1 297 ? -0.134  9.234   16.021  1.00 31.93  ? 297  ILE A CG2 1 
ATOM   1868 C  CD1 . ILE A 1 297 ? 0.116   10.999  13.542  1.00 32.73  ? 297  ILE A CD1 1 
ATOM   1869 N  N   . GLU A 1 298 ? -1.207  6.255   16.647  1.00 41.55  ? 298  GLU A N   1 
ATOM   1870 C  CA  . GLU A 1 298 ? -1.637  5.837   17.976  1.00 35.32  ? 298  GLU A CA  1 
ATOM   1871 C  C   . GLU A 1 298 ? -0.698  6.408   19.031  1.00 40.64  ? 298  GLU A C   1 
ATOM   1872 O  O   . GLU A 1 298 ? 0.383   5.870   19.273  1.00 33.68  ? 298  GLU A O   1 
ATOM   1873 C  CB  . GLU A 1 298 ? -1.694  4.311   18.084  1.00 38.75  ? 298  GLU A CB  1 
ATOM   1874 C  CG  . GLU A 1 298 ? -2.725  3.655   17.175  1.00 50.25  ? 298  GLU A CG  1 
ATOM   1875 C  CD  . GLU A 1 298 ? -4.154  4.006   17.544  1.00 54.08  ? 298  GLU A CD  1 
ATOM   1876 O  OE1 . GLU A 1 298 ? -4.426  4.253   18.737  1.00 56.53  ? 298  GLU A OE1 1 
ATOM   1877 O  OE2 . GLU A 1 298 ? -5.010  4.030   16.637  1.00 59.45  ? 298  GLU A OE2 1 
ATOM   1878 N  N   . HIS A 1 299 ? -1.114  7.510   19.646  1.00 38.33  ? 299  HIS A N   1 
ATOM   1879 C  CA  . HIS A 1 299 ? -0.323  8.152   20.687  1.00 34.66  ? 299  HIS A CA  1 
ATOM   1880 C  C   . HIS A 1 299 ? -0.714  7.613   22.059  1.00 38.22  ? 299  HIS A C   1 
ATOM   1881 O  O   . HIS A 1 299 ? -1.872  7.710   22.464  1.00 44.62  ? 299  HIS A O   1 
ATOM   1882 C  CB  . HIS A 1 299 ? -0.506  9.669   20.635  1.00 31.57  ? 299  HIS A CB  1 
ATOM   1883 C  CG  . HIS A 1 299 ? 0.302   10.409  21.653  1.00 39.68  ? 299  HIS A CG  1 
ATOM   1884 N  ND1 . HIS A 1 299 ? 1.610   10.787  21.435  1.00 41.14  ? 299  HIS A ND1 1 
ATOM   1885 C  CD2 . HIS A 1 299 ? -0.012  10.841  22.897  1.00 42.88  ? 299  HIS A CD2 1 
ATOM   1886 C  CE1 . HIS A 1 299 ? 2.067   11.419  22.500  1.00 39.83  ? 299  HIS A CE1 1 
ATOM   1887 N  NE2 . HIS A 1 299 ? 1.103   11.467  23.402  1.00 43.42  ? 299  HIS A NE2 1 
ATOM   1888 N  N   . PHE A 1 300 ? 0.257   7.048   22.770  1.00 45.66  ? 300  PHE A N   1 
ATOM   1889 C  CA  . PHE A 1 300 ? 0.003   6.423   24.067  1.00 43.79  ? 300  PHE A CA  1 
ATOM   1890 C  C   . PHE A 1 300 ? 0.516   7.277   25.223  1.00 47.00  ? 300  PHE A C   1 
ATOM   1891 O  O   . PHE A 1 300 ? 1.703   7.595   25.290  1.00 51.64  ? 300  PHE A O   1 
ATOM   1892 C  CB  . PHE A 1 300 ? 0.642   5.033   24.121  1.00 46.96  ? 300  PHE A CB  1 
ATOM   1893 C  CG  . PHE A 1 300 ? 0.102   4.075   23.095  1.00 48.16  ? 300  PHE A CG  1 
ATOM   1894 C  CD1 . PHE A 1 300 ? -1.061  3.363   23.338  1.00 49.22  ? 300  PHE A CD1 1 
ATOM   1895 C  CD2 . PHE A 1 300 ? 0.761   3.881   21.891  1.00 47.07  ? 300  PHE A CD2 1 
ATOM   1896 C  CE1 . PHE A 1 300 ? -1.561  2.478   22.399  1.00 48.29  ? 300  PHE A CE1 1 
ATOM   1897 C  CE2 . PHE A 1 300 ? 0.267   2.998   20.947  1.00 47.35  ? 300  PHE A CE2 1 
ATOM   1898 C  CZ  . PHE A 1 300 ? -0.896  2.295   21.202  1.00 48.16  ? 300  PHE A CZ  1 
ATOM   1899 N  N   . VAL A 1 301 ? -0.383  7.638   26.133  1.00 48.99  ? 301  VAL A N   1 
ATOM   1900 C  CA  . VAL A 1 301 ? -0.027  8.485   27.270  1.00 49.01  ? 301  VAL A CA  1 
ATOM   1901 C  C   . VAL A 1 301 ? -0.458  7.912   28.615  1.00 52.76  ? 301  VAL A C   1 
ATOM   1902 O  O   . VAL A 1 301 ? -1.495  7.257   28.725  1.00 42.87  ? 301  VAL A O   1 
ATOM   1903 C  CB  . VAL A 1 301 ? -0.628  9.902   27.140  1.00 50.47  ? 301  VAL A CB  1 
ATOM   1904 C  CG1 . VAL A 1 301 ? 0.357   10.843  26.470  1.00 54.45  ? 301  VAL A CG1 1 
ATOM   1905 C  CG2 . VAL A 1 301 ? -1.954  9.858   26.392  1.00 53.60  ? 301  VAL A CG2 1 
ATOM   1906 N  N   . ASP A 1 302 ? 0.354   8.171   29.636  1.00 57.86  ? 302  ASP A N   1 
ATOM   1907 C  CA  . ASP A 1 302 ? 0.004   7.839   31.008  1.00 59.99  ? 302  ASP A CA  1 
ATOM   1908 C  C   . ASP A 1 302 ? -1.049  8.835   31.486  1.00 61.30  ? 302  ASP A C   1 
ATOM   1909 O  O   . ASP A 1 302 ? -0.809  10.043  31.480  1.00 63.59  ? 302  ASP A O   1 
ATOM   1910 C  CB  . ASP A 1 302 ? 1.247   7.908   31.899  1.00 64.36  ? 302  ASP A CB  1 
ATOM   1911 C  CG  . ASP A 1 302 ? 1.012   7.336   33.286  1.00 67.64  ? 302  ASP A CG  1 
ATOM   1912 O  OD1 . ASP A 1 302 ? -0.070  7.572   33.865  1.00 67.57  ? 302  ASP A OD1 1 
ATOM   1913 O  OD2 . ASP A 1 302 ? 1.921   6.655   33.805  1.00 69.49  ? 302  ASP A OD2 1 
ATOM   1914 N  N   . PRO A 1 303 ? -2.223  8.327   31.894  1.00 60.13  ? 303  PRO A N   1 
ATOM   1915 C  CA  . PRO A 1 303 ? -3.342  9.159   32.336  1.00 55.92  ? 303  PRO A CA  1 
ATOM   1916 C  C   . PRO A 1 303 ? -2.939  10.190  33.389  1.00 59.43  ? 303  PRO A C   1 
ATOM   1917 O  O   . PRO A 1 303 ? -3.630  11.192  33.565  1.00 60.91  ? 303  PRO A O   1 
ATOM   1918 C  CB  . PRO A 1 303 ? -4.313  8.140   32.937  1.00 58.60  ? 303  PRO A CB  1 
ATOM   1919 C  CG  . PRO A 1 303 ? -4.028  6.881   32.201  1.00 57.08  ? 303  PRO A CG  1 
ATOM   1920 C  CD  . PRO A 1 303 ? -2.548  6.890   31.948  1.00 56.94  ? 303  PRO A CD  1 
ATOM   1921 N  N   . SER A 1 304 ? -1.826  9.943   34.075  1.00 67.35  ? 304  SER A N   1 
ATOM   1922 C  CA  . SER A 1 304 ? -1.328  10.858  35.095  1.00 74.85  ? 304  SER A CA  1 
ATOM   1923 C  C   . SER A 1 304 ? -0.702  12.101  34.471  1.00 81.21  ? 304  SER A C   1 
ATOM   1924 O  O   . SER A 1 304 ? -0.988  13.226  34.882  1.00 85.67  ? 304  SER A O   1 
ATOM   1925 C  CB  . SER A 1 304 ? -0.307  10.155  35.991  1.00 79.27  ? 304  SER A CB  1 
ATOM   1926 O  OG  . SER A 1 304 ? -0.860  8.989   36.576  1.00 86.29  ? 304  SER A OG  1 
ATOM   1927 N  N   . GLU A 1 305 ? 0.154   11.891  33.476  1.00 90.70  ? 305  GLU A N   1 
ATOM   1928 C  CA  . GLU A 1 305 ? 0.827   12.991  32.796  1.00 94.03  ? 305  GLU A CA  1 
ATOM   1929 C  C   . GLU A 1 305 ? 0.131   13.326  31.480  1.00 85.80  ? 305  GLU A C   1 
ATOM   1930 O  O   . GLU A 1 305 ? 0.606   12.971  30.401  1.00 81.37  ? 305  GLU A O   1 
ATOM   1931 C  CB  . GLU A 1 305 ? 2.301   12.653  32.563  1.00 99.32  ? 305  GLU A CB  1 
ATOM   1932 C  CG  . GLU A 1 305 ? 3.090   12.454  33.849  1.00 103.60 ? 305  GLU A CG  1 
ATOM   1933 C  CD  . GLU A 1 305 ? 4.515   11.998  33.603  1.00 106.27 ? 305  GLU A CD  1 
ATOM   1934 O  OE1 . GLU A 1 305 ? 4.830   11.604  32.460  1.00 109.02 ? 305  GLU A OE1 1 
ATOM   1935 O  OE2 . GLU A 1 305 ? 5.321   12.030  34.557  1.00 108.81 ? 305  GLU A OE2 1 
ATOM   1936 N  N   . LYS A 1 306 ? -1.001  14.016  31.585  1.00 82.90  ? 306  LYS A N   1 
ATOM   1937 C  CA  . LYS A 1 306 ? -1.815  14.356  30.426  1.00 77.75  ? 306  LYS A CA  1 
ATOM   1938 C  C   . LYS A 1 306 ? -1.499  15.761  29.914  1.00 76.54  ? 306  LYS A C   1 
ATOM   1939 O  O   . LYS A 1 306 ? -2.399  16.522  29.557  1.00 72.45  ? 306  LYS A O   1 
ATOM   1940 C  CB  . LYS A 1 306 ? -3.300  14.239  30.775  1.00 90.27  ? 306  LYS A CB  1 
ATOM   1941 C  CG  . LYS A 1 306 ? -4.225  14.182  29.573  1.00 95.16  ? 306  LYS A CG  1 
ATOM   1942 C  CD  . LYS A 1 306 ? -3.997  12.920  28.763  1.00 97.07  ? 306  LYS A CD  1 
ATOM   1943 C  CE  . LYS A 1 306 ? -4.888  12.893  27.539  1.00 98.84  ? 306  LYS A CE  1 
ATOM   1944 N  NZ  . LYS A 1 306 ? -4.901  11.551  26.900  1.00 103.32 ? 306  LYS A NZ  1 
ATOM   1945 N  N   . ASP A 1 307 ? -0.215  16.098  29.887  1.00 77.96  ? 307  ASP A N   1 
ATOM   1946 C  CA  . ASP A 1 307 ? 0.236   17.379  29.358  1.00 76.96  ? 307  ASP A CA  1 
ATOM   1947 C  C   . ASP A 1 307 ? 1.227   17.168  28.225  1.00 74.14  ? 307  ASP A C   1 
ATOM   1948 O  O   . ASP A 1 307 ? 2.130   16.337  28.327  1.00 75.76  ? 307  ASP A O   1 
ATOM   1949 C  CB  . ASP A 1 307 ? 0.884   18.221  30.459  1.00 89.75  ? 307  ASP A CB  1 
ATOM   1950 C  CG  . ASP A 1 307 ? -0.121  19.058  31.224  1.00 94.56  ? 307  ASP A CG  1 
ATOM   1951 O  OD1 . ASP A 1 307 ? -0.980  19.695  30.580  1.00 96.99  ? 307  ASP A OD1 1 
ATOM   1952 O  OD2 . ASP A 1 307 ? -0.045  19.086  32.471  1.00 96.92  ? 307  ASP A OD2 1 
ATOM   1953 N  N   . HIS A 1 308 ? 1.056   17.919  27.142  1.00 60.62  ? 308  HIS A N   1 
ATOM   1954 C  CA  . HIS A 1 308 ? 2.010   17.875  26.045  1.00 52.83  ? 308  HIS A CA  1 
ATOM   1955 C  C   . HIS A 1 308 ? 2.960   19.060  26.150  1.00 44.71  ? 308  HIS A C   1 
ATOM   1956 O  O   . HIS A 1 308 ? 2.528   20.212  26.096  1.00 49.18  ? 308  HIS A O   1 
ATOM   1957 C  CB  . HIS A 1 308 ? 1.298   17.877  24.691  1.00 52.15  ? 308  HIS A CB  1 
ATOM   1958 C  CG  . HIS A 1 308 ? 2.069   17.190  23.607  1.00 50.44  ? 308  HIS A CG  1 
ATOM   1959 N  ND1 . HIS A 1 308 ? 3.285   17.649  23.151  1.00 52.37  ? 308  HIS A ND1 1 
ATOM   1960 C  CD2 . HIS A 1 308 ? 1.798   16.072  22.893  1.00 49.40  ? 308  HIS A CD2 1 
ATOM   1961 C  CE1 . HIS A 1 308 ? 3.730   16.845  22.202  1.00 50.75  ? 308  HIS A CE1 1 
ATOM   1962 N  NE2 . HIS A 1 308 ? 2.845   15.880  22.026  1.00 50.49  ? 308  HIS A NE2 1 
ATOM   1963 N  N   . PRO A 1 309 ? 4.262   18.777  26.305  1.00 47.56  ? 309  PRO A N   1 
ATOM   1964 C  CA  . PRO A 1 309 ? 5.293   19.799  26.476  1.00 49.46  ? 309  PRO A CA  1 
ATOM   1965 C  C   . PRO A 1 309 ? 5.385   20.752  25.287  1.00 51.86  ? 309  PRO A C   1 
ATOM   1966 O  O   . PRO A 1 309 ? 5.937   21.846  25.414  1.00 54.52  ? 309  PRO A O   1 
ATOM   1967 C  CB  . PRO A 1 309 ? 6.585   18.979  26.589  1.00 48.49  ? 309  PRO A CB  1 
ATOM   1968 C  CG  . PRO A 1 309 ? 6.145   17.612  26.992  1.00 47.54  ? 309  PRO A CG  1 
ATOM   1969 C  CD  . PRO A 1 309 ? 4.823   17.416  26.327  1.00 46.68  ? 309  PRO A CD  1 
ATOM   1970 N  N   . LYS A 1 310 ? 4.841   20.341  24.146  1.00 49.17  ? 310  LYS A N   1 
ATOM   1971 C  CA  . LYS A 1 310 ? 4.951   21.124  22.919  1.00 46.30  ? 310  LYS A CA  1 
ATOM   1972 C  C   . LYS A 1 310 ? 3.646   21.823  22.541  1.00 42.62  ? 310  LYS A C   1 
ATOM   1973 O  O   . LYS A 1 310 ? 3.509   22.325  21.425  1.00 42.88  ? 310  LYS A O   1 
ATOM   1974 C  CB  . LYS A 1 310 ? 5.424   20.235  21.766  1.00 49.96  ? 310  LYS A CB  1 
ATOM   1975 C  CG  . LYS A 1 310 ? 6.751   19.540  22.032  1.00 54.17  ? 310  LYS A CG  1 
ATOM   1976 C  CD  . LYS A 1 310 ? 7.016   18.424  21.032  1.00 53.11  ? 310  LYS A CD  1 
ATOM   1977 C  CE  . LYS A 1 310 ? 7.294   18.970  19.644  1.00 53.15  ? 310  LYS A CE  1 
ATOM   1978 N  NZ  . LYS A 1 310 ? 7.751   17.895  18.722  1.00 53.37  ? 310  LYS A NZ  1 
ATOM   1979 N  N   . PHE A 1 311 ? 2.696   21.862  23.471  1.00 40.38  ? 311  PHE A N   1 
ATOM   1980 C  CA  . PHE A 1 311 ? 1.394   22.472  23.205  1.00 39.18  ? 311  PHE A CA  1 
ATOM   1981 C  C   . PHE A 1 311 ? 1.491   23.972  22.935  1.00 40.74  ? 311  PHE A C   1 
ATOM   1982 O  O   . PHE A 1 311 ? 0.701   24.524  22.169  1.00 42.15  ? 311  PHE A O   1 
ATOM   1983 C  CB  . PHE A 1 311 ? 0.422   22.209  24.357  1.00 42.92  ? 311  PHE A CB  1 
ATOM   1984 C  CG  . PHE A 1 311 ? -0.930  22.840  24.163  1.00 43.95  ? 311  PHE A CG  1 
ATOM   1985 C  CD1 . PHE A 1 311 ? -1.856  22.274  23.302  1.00 43.50  ? 311  PHE A CD1 1 
ATOM   1986 C  CD2 . PHE A 1 311 ? -1.273  24.001  24.839  1.00 43.57  ? 311  PHE A CD2 1 
ATOM   1987 C  CE1 . PHE A 1 311 ? -3.100  22.852  23.118  1.00 45.55  ? 311  PHE A CE1 1 
ATOM   1988 C  CE2 . PHE A 1 311 ? -2.515  24.584  24.661  1.00 44.16  ? 311  PHE A CE2 1 
ATOM   1989 C  CZ  . PHE A 1 311 ? -3.429  24.010  23.798  1.00 47.17  ? 311  PHE A CZ  1 
ATOM   1990 N  N   . GLN A 1 312 ? 2.464   24.626  23.564  1.00 52.15  ? 312  GLN A N   1 
ATOM   1991 C  CA  . GLN A 1 312 ? 2.635   26.071  23.426  1.00 58.83  ? 312  GLN A CA  1 
ATOM   1992 C  C   . GLN A 1 312 ? 2.958   26.489  21.993  1.00 59.65  ? 312  GLN A C   1 
ATOM   1993 O  O   . GLN A 1 312 ? 2.794   27.653  21.628  1.00 62.74  ? 312  GLN A O   1 
ATOM   1994 C  CB  . GLN A 1 312 ? 3.711   26.583  24.388  1.00 67.82  ? 312  GLN A CB  1 
ATOM   1995 C  CG  . GLN A 1 312 ? 3.332   26.463  25.858  1.00 76.74  ? 312  GLN A CG  1 
ATOM   1996 C  CD  . GLN A 1 312 ? 2.065   27.229  26.202  1.00 81.43  ? 312  GLN A CD  1 
ATOM   1997 O  OE1 . GLN A 1 312 ? 1.846   28.342  25.721  1.00 81.44  ? 312  GLN A OE1 1 
ATOM   1998 N  NE2 . GLN A 1 312 ? 1.225   26.634  27.041  1.00 81.73  ? 312  GLN A NE2 1 
ATOM   1999 N  N   . ASN A 1 313 ? 3.414   25.535  21.187  1.00 58.37  ? 313  ASN A N   1 
ATOM   2000 C  CA  . ASN A 1 313 ? 3.710   25.792  19.783  1.00 51.03  ? 313  ASN A CA  1 
ATOM   2001 C  C   . ASN A 1 313 ? 2.441   25.921  18.948  1.00 50.46  ? 313  ASN A C   1 
ATOM   2002 O  O   . ASN A 1 313 ? 2.477   26.405  17.817  1.00 52.78  ? 313  ASN A O   1 
ATOM   2003 C  CB  . ASN A 1 313 ? 4.587   24.677  19.209  1.00 53.67  ? 313  ASN A CB  1 
ATOM   2004 C  CG  . ASN A 1 313 ? 5.875   24.486  19.987  1.00 56.03  ? 313  ASN A CG  1 
ATOM   2005 O  OD1 . ASN A 1 313 ? 6.263   25.336  20.788  1.00 62.01  ? 313  ASN A OD1 1 
ATOM   2006 N  ND2 . ASN A 1 313 ? 6.546   23.365  19.750  1.00 52.41  ? 313  ASN A ND2 1 
ATOM   2007 N  N   . VAL A 1 314 ? 1.319   25.491  19.517  1.00 52.22  ? 314  VAL A N   1 
ATOM   2008 C  CA  . VAL A 1 314 ? 0.059   25.431  18.785  1.00 52.47  ? 314  VAL A CA  1 
ATOM   2009 C  C   . VAL A 1 314 ? -1.058  26.201  19.491  1.00 51.76  ? 314  VAL A C   1 
ATOM   2010 O  O   . VAL A 1 314 ? -2.084  26.519  18.886  1.00 47.46  ? 314  VAL A O   1 
ATOM   2011 C  CB  . VAL A 1 314 ? -0.382  23.967  18.577  1.00 52.97  ? 314  VAL A CB  1 
ATOM   2012 C  CG1 . VAL A 1 314 ? -1.626  23.906  17.726  1.00 55.50  ? 314  VAL A CG1 1 
ATOM   2013 C  CG2 . VAL A 1 314 ? 0.735   23.160  17.931  1.00 52.89  ? 314  VAL A CG2 1 
ATOM   2014 N  N   . ALA A 1 315 ? -0.845  26.509  20.767  1.00 48.13  ? 315  ALA A N   1 
ATOM   2015 C  CA  . ALA A 1 315 ? -1.860  27.164  21.594  1.00 46.31  ? 315  ALA A CA  1 
ATOM   2016 C  C   . ALA A 1 315 ? -2.372  28.482  21.017  1.00 46.37  ? 315  ALA A C   1 
ATOM   2017 O  O   . ALA A 1 315 ? -3.452  28.948  21.383  1.00 50.33  ? 315  ALA A O   1 
ATOM   2018 C  CB  . ALA A 1 315 ? -1.326  27.382  23.003  1.00 35.23  ? 315  ALA A CB  1 
ATOM   2019 N  N   . ASP A 1 316 ? -1.604  29.077  20.111  1.00 52.81  ? 316  ASP A N   1 
ATOM   2020 C  CA  . ASP A 1 316 ? -1.911  30.416  19.619  1.00 52.75  ? 316  ASP A CA  1 
ATOM   2021 C  C   . ASP A 1 316 ? -2.663  30.415  18.286  1.00 48.77  ? 316  ASP A C   1 
ATOM   2022 O  O   . ASP A 1 316 ? -2.895  31.471  17.698  1.00 49.79  ? 316  ASP A O   1 
ATOM   2023 C  CB  . ASP A 1 316 ? -0.623  31.235  19.500  1.00 68.26  ? 316  ASP A CB  1 
ATOM   2024 C  CG  . ASP A 1 316 ? -0.794  32.662  19.976  1.00 75.83  ? 316  ASP A CG  1 
ATOM   2025 O  OD1 . ASP A 1 316 ? 0.169   33.214  20.549  1.00 80.17  ? 316  ASP A OD1 1 
ATOM   2026 O  OD2 . ASP A 1 316 ? -1.890  33.230  19.789  1.00 79.95  ? 316  ASP A OD2 1 
ATOM   2027 N  N   . LEU A 1 317 ? -3.045  29.232  17.814  1.00 46.84  ? 317  LEU A N   1 
ATOM   2028 C  CA  . LEU A 1 317 ? -3.776  29.115  16.554  1.00 40.20  ? 317  LEU A CA  1 
ATOM   2029 C  C   . LEU A 1 317 ? -5.255  29.458  16.715  1.00 43.43  ? 317  LEU A C   1 
ATOM   2030 O  O   . LEU A 1 317 ? -5.834  29.270  17.784  1.00 39.35  ? 317  LEU A O   1 
ATOM   2031 C  CB  . LEU A 1 317 ? -3.634  27.706  15.974  1.00 41.38  ? 317  LEU A CB  1 
ATOM   2032 C  CG  . LEU A 1 317 ? -2.283  27.310  15.376  1.00 40.53  ? 317  LEU A CG  1 
ATOM   2033 C  CD1 . LEU A 1 317 ? -2.314  25.855  14.946  1.00 37.29  ? 317  LEU A CD1 1 
ATOM   2034 C  CD2 . LEU A 1 317 ? -1.918  28.207  14.203  1.00 34.97  ? 317  LEU A CD2 1 
ATOM   2035 N  N   . HIS A 1 318 ? -5.857  29.960  15.641  1.00 40.06  ? 318  HIS A N   1 
ATOM   2036 C  CA  . HIS A 1 318 ? -7.284  30.259  15.627  1.00 40.09  ? 318  HIS A CA  1 
ATOM   2037 C  C   . HIS A 1 318 ? -8.017  29.334  14.665  1.00 46.47  ? 318  HIS A C   1 
ATOM   2038 O  O   . HIS A 1 318 ? -7.796  29.379  13.454  1.00 56.54  ? 318  HIS A O   1 
ATOM   2039 C  CB  . HIS A 1 318 ? -7.526  31.720  15.244  1.00 51.67  ? 318  HIS A CB  1 
ATOM   2040 C  CG  . HIS A 1 318 ? -7.320  32.682  16.372  1.00 57.31  ? 318  HIS A CG  1 
ATOM   2041 N  ND1 . HIS A 1 318 ? -6.068  33.072  16.798  1.00 59.08  ? 318  HIS A ND1 1 
ATOM   2042 C  CD2 . HIS A 1 318 ? -8.206  33.333  17.161  1.00 59.92  ? 318  HIS A CD2 1 
ATOM   2043 C  CE1 . HIS A 1 318 ? -6.193  33.921  17.802  1.00 62.95  ? 318  HIS A CE1 1 
ATOM   2044 N  NE2 . HIS A 1 318 ? -7.480  34.097  18.042  1.00 64.37  ? 318  HIS A NE2 1 
ATOM   2045 N  N   . LEU A 1 319 ? -8.889  28.494  15.210  1.00 46.93  ? 319  LEU A N   1 
ATOM   2046 C  CA  . LEU A 1 319 ? -9.618  27.523  14.404  1.00 48.98  ? 319  LEU A CA  1 
ATOM   2047 C  C   . LEU A 1 319 ? -11.084 27.432  14.820  1.00 47.19  ? 319  LEU A C   1 
ATOM   2048 O  O   . LEU A 1 319 ? -11.438 27.743  15.957  1.00 46.81  ? 319  LEU A O   1 
ATOM   2049 C  CB  . LEU A 1 319 ? -8.950  26.145  14.485  1.00 52.43  ? 319  LEU A CB  1 
ATOM   2050 C  CG  . LEU A 1 319 ? -8.848  25.450  15.846  1.00 51.67  ? 319  LEU A CG  1 
ATOM   2051 C  CD1 . LEU A 1 319 ? -8.322  24.037  15.675  1.00 54.81  ? 319  LEU A CD1 1 
ATOM   2052 C  CD2 . LEU A 1 319 ? -7.966  26.228  16.811  1.00 57.79  ? 319  LEU A CD2 1 
ATOM   2053 N  N   . TYR A 1 320 ? -11.931 27.011  13.887  1.00 45.01  ? 320  TYR A N   1 
ATOM   2054 C  CA  . TYR A 1 320 ? -13.353 26.849  14.156  1.00 39.21  ? 320  TYR A CA  1 
ATOM   2055 C  C   . TYR A 1 320 ? -13.616 25.552  14.908  1.00 40.46  ? 320  TYR A C   1 
ATOM   2056 O  O   . TYR A 1 320 ? -13.281 24.468  14.432  1.00 46.19  ? 320  TYR A O   1 
ATOM   2057 C  CB  . TYR A 1 320 ? -14.155 26.870  12.854  1.00 44.51  ? 320  TYR A CB  1 
ATOM   2058 C  CG  . TYR A 1 320 ? -14.172 28.214  12.160  1.00 48.14  ? 320  TYR A CG  1 
ATOM   2059 C  CD1 . TYR A 1 320 ? -15.146 29.159  12.459  1.00 47.24  ? 320  TYR A CD1 1 
ATOM   2060 C  CD2 . TYR A 1 320 ? -13.218 28.536  11.203  1.00 46.49  ? 320  TYR A CD2 1 
ATOM   2061 C  CE1 . TYR A 1 320 ? -15.167 30.388  11.826  1.00 45.28  ? 320  TYR A CE1 1 
ATOM   2062 C  CE2 . TYR A 1 320 ? -13.231 29.763  10.566  1.00 46.03  ? 320  TYR A CE2 1 
ATOM   2063 C  CZ  . TYR A 1 320 ? -14.208 30.685  10.882  1.00 47.65  ? 320  TYR A CZ  1 
ATOM   2064 O  OH  . TYR A 1 320 ? -14.225 31.907  10.250  1.00 52.47  ? 320  TYR A OH  1 
ATOM   2065 N  N   . LEU A 1 321 ? -14.214 25.670  16.088  1.00 44.95  ? 321  LEU A N   1 
ATOM   2066 C  CA  . LEU A 1 321 ? -14.556 24.504  16.889  1.00 39.72  ? 321  LEU A CA  1 
ATOM   2067 C  C   . LEU A 1 321 ? -16.067 24.338  16.971  1.00 44.47  ? 321  LEU A C   1 
ATOM   2068 O  O   . LEU A 1 321 ? -16.796 25.299  17.218  1.00 56.61  ? 321  LEU A O   1 
ATOM   2069 C  CB  . LEU A 1 321 ? -13.951 24.612  18.289  1.00 32.97  ? 321  LEU A CB  1 
ATOM   2070 C  CG  . LEU A 1 321 ? -12.427 24.738  18.344  1.00 33.63  ? 321  LEU A CG  1 
ATOM   2071 C  CD1 . LEU A 1 321 ? -11.949 24.785  19.783  1.00 32.56  ? 321  LEU A CD1 1 
ATOM   2072 C  CD2 . LEU A 1 321 ? -11.764 23.592  17.595  1.00 31.06  ? 321  LEU A CD2 1 
ATOM   2073 N  N   . TYR A 1 322 ? -16.528 23.112  16.754  1.00 45.75  ? 322  TYR A N   1 
ATOM   2074 C  CA  . TYR A 1 322 ? -17.951 22.811  16.744  1.00 43.25  ? 322  TYR A CA  1 
ATOM   2075 C  C   . TYR A 1 322 ? -18.247 21.743  17.788  1.00 50.75  ? 322  TYR A C   1 
ATOM   2076 O  O   . TYR A 1 322 ? -18.384 20.561  17.465  1.00 53.70  ? 322  TYR A O   1 
ATOM   2077 C  CB  . TYR A 1 322 ? -18.368 22.340  15.349  1.00 52.97  ? 322  TYR A CB  1 
ATOM   2078 C  CG  . TYR A 1 322 ? -19.855 22.392  15.080  1.00 57.56  ? 322  TYR A CG  1 
ATOM   2079 C  CD1 . TYR A 1 322 ? -20.648 23.397  15.622  1.00 59.04  ? 322  TYR A CD1 1 
ATOM   2080 C  CD2 . TYR A 1 322 ? -20.461 21.453  14.255  1.00 58.12  ? 322  TYR A CD2 1 
ATOM   2081 C  CE1 . TYR A 1 322 ? -22.007 23.449  15.367  1.00 58.97  ? 322  TYR A CE1 1 
ATOM   2082 C  CE2 . TYR A 1 322 ? -21.817 21.498  13.994  1.00 57.86  ? 322  TYR A CE2 1 
ATOM   2083 C  CZ  . TYR A 1 322 ? -22.585 22.497  14.552  1.00 55.78  ? 322  TYR A CZ  1 
ATOM   2084 O  OH  . TYR A 1 322 ? -23.934 22.541  14.292  1.00 57.07  ? 322  TYR A OH  1 
ATOM   2085 N  N   . SER A 1 323 ? -18.337 22.172  19.044  1.00 49.16  ? 323  SER A N   1 
ATOM   2086 C  CA  . SER A 1 323 ? -18.485 21.257  20.173  1.00 52.87  ? 323  SER A CA  1 
ATOM   2087 C  C   . SER A 1 323 ? -19.820 20.519  20.172  1.00 50.34  ? 323  SER A C   1 
ATOM   2088 O  O   . SER A 1 323 ? -20.744 20.878  19.441  1.00 42.36  ? 323  SER A O   1 
ATOM   2089 C  CB  . SER A 1 323 ? -18.311 22.011  21.494  1.00 51.05  ? 323  SER A CB  1 
ATOM   2090 O  OG  . SER A 1 323 ? -19.361 22.943  21.689  1.00 54.16  ? 323  SER A OG  1 
ATOM   2091 N  N   . ALA A 1 324 ? -19.904 19.484  21.002  1.00 47.93  ? 324  ALA A N   1 
ATOM   2092 C  CA  . ALA A 1 324 ? -21.119 18.693  21.145  1.00 53.50  ? 324  ALA A CA  1 
ATOM   2093 C  C   . ALA A 1 324 ? -22.270 19.538  21.679  1.00 58.71  ? 324  ALA A C   1 
ATOM   2094 O  O   . ALA A 1 324 ? -23.401 19.429  21.208  1.00 61.97  ? 324  ALA A O   1 
ATOM   2095 C  CB  . ALA A 1 324 ? -20.865 17.511  22.064  1.00 54.00  ? 324  ALA A CB  1 
ATOM   2096 N  N   . LYS A 1 325 ? -21.969 20.382  22.662  1.00 63.22  ? 325  LYS A N   1 
ATOM   2097 C  CA  . LYS A 1 325 ? -22.977 21.233  23.289  1.00 63.52  ? 325  LYS A CA  1 
ATOM   2098 C  C   . LYS A 1 325 ? -23.488 22.312  22.340  1.00 63.61  ? 325  LYS A C   1 
ATOM   2099 O  O   . LYS A 1 325 ? -24.631 22.755  22.452  1.00 77.08  ? 325  LYS A O   1 
ATOM   2100 C  CB  . LYS A 1 325 ? -22.425 21.865  24.569  1.00 71.78  ? 325  LYS A CB  1 
ATOM   2101 C  CG  . LYS A 1 325 ? -22.235 20.872  25.706  1.00 78.03  ? 325  LYS A CG  1 
ATOM   2102 C  CD  . LYS A 1 325 ? -21.436 21.470  26.851  1.00 79.22  ? 325  LYS A CD  1 
ATOM   2103 C  CE  . LYS A 1 325 ? -21.205 20.442  27.949  1.00 80.48  ? 325  LYS A CE  1 
ATOM   2104 N  NZ  . LYS A 1 325 ? -20.232 20.918  28.970  1.00 77.18  ? 325  LYS A NZ  1 
ATOM   2105 N  N   . ALA A 1 326 ? -22.639 22.730  21.407  1.00 59.52  ? 326  ALA A N   1 
ATOM   2106 C  CA  . ALA A 1 326 ? -23.036 23.704  20.399  1.00 56.62  ? 326  ALA A CA  1 
ATOM   2107 C  C   . ALA A 1 326 ? -23.974 23.068  19.377  1.00 64.46  ? 326  ALA A C   1 
ATOM   2108 O  O   . ALA A 1 326 ? -24.703 23.765  18.672  1.00 69.89  ? 326  ALA A O   1 
ATOM   2109 C  CB  . ALA A 1 326 ? -21.813 24.285  19.711  1.00 61.69  ? 326  ALA A CB  1 
ATOM   2110 N  N   . GLN A 1 327 ? -23.949 21.740  19.305  1.00 64.21  ? 327  GLN A N   1 
ATOM   2111 C  CA  . GLN A 1 327 ? -24.808 21.003  18.385  1.00 66.10  ? 327  GLN A CA  1 
ATOM   2112 C  C   . GLN A 1 327 ? -26.158 20.690  19.020  1.00 70.40  ? 327  GLN A C   1 
ATOM   2113 O  O   . GLN A 1 327 ? -27.196 20.777  18.362  1.00 68.88  ? 327  GLN A O   1 
ATOM   2114 C  CB  . GLN A 1 327 ? -24.128 19.711  17.927  1.00 57.87  ? 327  GLN A CB  1 
ATOM   2115 C  CG  . GLN A 1 327 ? -22.851 19.932  17.134  1.00 53.78  ? 327  GLN A CG  1 
ATOM   2116 C  CD  . GLN A 1 327 ? -22.100 18.643  16.867  1.00 47.15  ? 327  GLN A CD  1 
ATOM   2117 O  OE1 . GLN A 1 327 ? -22.624 17.723  16.240  1.00 48.80  ? 327  GLN A OE1 1 
ATOM   2118 N  NE2 . GLN A 1 327 ? -20.863 18.573  17.341  1.00 42.25  ? 327  GLN A NE2 1 
ATOM   2119 N  N   . VAL A 1 328 ? -26.137 20.324  20.299  1.00 74.94  ? 328  VAL A N   1 
ATOM   2120 C  CA  . VAL A 1 328 ? -27.361 20.032  21.035  1.00 78.51  ? 328  VAL A CA  1 
ATOM   2121 C  C   . VAL A 1 328 ? -28.257 21.266  21.087  1.00 78.68  ? 328  VAL A C   1 
ATOM   2122 O  O   . VAL A 1 328 ? -29.475 21.168  20.929  1.00 77.50  ? 328  VAL A O   1 
ATOM   2123 C  CB  . VAL A 1 328 ? -27.058 19.550  22.471  1.00 84.04  ? 328  VAL A CB  1 
ATOM   2124 C  CG1 . VAL A 1 328 ? -28.350 19.324  23.244  1.00 87.80  ? 328  VAL A CG1 1 
ATOM   2125 C  CG2 . VAL A 1 328 ? -26.227 18.275  22.439  1.00 85.49  ? 328  VAL A CG2 1 
ATOM   2126 N  N   . SER A 1 329 ? -27.642 22.427  21.292  1.00 80.36  ? 329  SER A N   1 
ATOM   2127 C  CA  . SER A 1 329 ? -28.378 23.684  21.388  1.00 78.72  ? 329  SER A CA  1 
ATOM   2128 C  C   . SER A 1 329 ? -28.205 24.559  20.146  1.00 78.36  ? 329  SER A C   1 
ATOM   2129 O  O   . SER A 1 329 ? -27.952 25.760  20.253  1.00 82.59  ? 329  SER A O   1 
ATOM   2130 C  CB  . SER A 1 329 ? -27.956 24.455  22.642  1.00 82.64  ? 329  SER A CB  1 
ATOM   2131 O  OG  . SER A 1 329 ? -26.564 24.721  22.632  1.00 79.12  ? 329  SER A OG  1 
ATOM   2132 N  N   . GLY A 1 330 ? -28.344 23.940  18.976  1.00 77.69  ? 330  GLY A N   1 
ATOM   2133 C  CA  . GLY A 1 330 ? -28.303 24.633  17.684  1.00 71.03  ? 330  GLY A CA  1 
ATOM   2134 C  C   . GLY A 1 330 ? -27.534 25.940  17.565  1.00 70.53  ? 330  GLY A C   1 
ATOM   2135 O  O   . GLY A 1 330 ? -27.998 26.877  16.915  1.00 62.36  ? 330  GLY A O   1 
ATOM   2136 N  N   . GLN A 1 331 ? -26.357 26.008  18.181  1.00 73.89  ? 331  GLN A N   1 
ATOM   2137 C  CA  . GLN A 1 331 ? -25.466 27.149  17.992  1.00 80.57  ? 331  GLN A CA  1 
ATOM   2138 C  C   . GLN A 1 331 ? -24.694 26.964  16.689  1.00 79.94  ? 331  GLN A C   1 
ATOM   2139 O  O   . GLN A 1 331 ? -24.874 25.964  15.992  1.00 83.79  ? 331  GLN A O   1 
ATOM   2140 C  CB  . GLN A 1 331 ? -24.492 27.281  19.164  1.00 87.15  ? 331  GLN A CB  1 
ATOM   2141 C  CG  . GLN A 1 331 ? -25.150 27.581  20.503  1.00 90.41  ? 331  GLN A CG  1 
ATOM   2142 C  CD  . GLN A 1 331 ? -24.142 27.740  21.626  1.00 91.25  ? 331  GLN A CD  1 
ATOM   2143 O  OE1 . GLN A 1 331 ? -22.991 28.114  21.397  1.00 92.74  ? 331  GLN A OE1 1 
ATOM   2144 N  NE2 . GLN A 1 331 ? -24.572 27.457  22.850  1.00 94.21  ? 331  GLN A NE2 1 
ATOM   2145 N  N   . SER A 1 332 ? -23.835 27.922  16.359  1.00 77.73  ? 332  SER A N   1 
ATOM   2146 C  CA  . SER A 1 332 ? -23.012 27.815  15.159  1.00 71.75  ? 332  SER A CA  1 
ATOM   2147 C  C   . SER A 1 332 ? -21.568 27.473  15.506  1.00 69.48  ? 332  SER A C   1 
ATOM   2148 O  O   . SER A 1 332 ? -21.145 27.619  16.654  1.00 65.33  ? 332  SER A O   1 
ATOM   2149 C  CB  . SER A 1 332 ? -23.063 29.115  14.352  1.00 70.11  ? 332  SER A CB  1 
ATOM   2150 O  OG  . SER A 1 332 ? -24.338 29.302  13.765  1.00 70.94  ? 332  SER A OG  1 
ATOM   2151 N  N   . ALA A 1 333 ? -20.820 27.011  14.508  1.00 66.98  ? 333  ALA A N   1 
ATOM   2152 C  CA  . ALA A 1 333 ? -19.393 26.772  14.672  1.00 61.24  ? 333  ALA A CA  1 
ATOM   2153 C  C   . ALA A 1 333 ? -18.723 28.072  15.096  1.00 60.92  ? 333  ALA A C   1 
ATOM   2154 O  O   . ALA A 1 333 ? -19.033 29.141  14.568  1.00 61.00  ? 333  ALA A O   1 
ATOM   2155 C  CB  . ALA A 1 333 ? -18.786 26.253  13.381  1.00 63.19  ? 333  ALA A CB  1 
ATOM   2156 N  N   . ARG A 1 334 ? -17.808 27.978  16.051  1.00 53.52  ? 334  ARG A N   1 
ATOM   2157 C  CA  . ARG A 1 334 ? -17.223 29.167  16.655  1.00 57.52  ? 334  ARG A CA  1 
ATOM   2158 C  C   . ARG A 1 334 ? -15.702 29.184  16.549  1.00 54.45  ? 334  ARG A C   1 
ATOM   2159 O  O   . ARG A 1 334 ? -15.024 28.287  17.051  1.00 52.68  ? 334  ARG A O   1 
ATOM   2160 C  CB  . ARG A 1 334 ? -17.685 29.280  18.112  1.00 64.91  ? 334  ARG A CB  1 
ATOM   2161 C  CG  . ARG A 1 334 ? -16.841 30.166  19.010  1.00 66.55  ? 334  ARG A CG  1 
ATOM   2162 C  CD  . ARG A 1 334 ? -17.666 30.633  20.200  1.00 70.67  ? 334  ARG A CD  1 
ATOM   2163 N  NE  . ARG A 1 334 ? -16.985 30.420  21.474  1.00 69.42  ? 334  ARG A NE  1 
ATOM   2164 C  CZ  . ARG A 1 334 ? -17.190 29.366  22.258  1.00 70.18  ? 334  ARG A CZ  1 
ATOM   2165 N  NH1 . ARG A 1 334 ? -16.532 29.250  23.403  1.00 70.26  ? 334  ARG A NH1 1 
ATOM   2166 N  NH2 . ARG A 1 334 ? -18.057 28.428  21.899  1.00 68.10  ? 334  ARG A NH2 1 
ATOM   2167 N  N   . LYS A 1 335 ? -15.175 30.205  15.878  1.00 52.09  ? 335  LYS A N   1 
ATOM   2168 C  CA  . LYS A 1 335 ? -13.733 30.392  15.783  1.00 52.98  ? 335  LYS A CA  1 
ATOM   2169 C  C   . LYS A 1 335 ? -13.199 30.740  17.163  1.00 53.03  ? 335  LYS A C   1 
ATOM   2170 O  O   . LYS A 1 335 ? -13.837 31.477  17.915  1.00 62.51  ? 335  LYS A O   1 
ATOM   2171 C  CB  . LYS A 1 335 ? -13.383 31.488  14.777  1.00 51.75  ? 335  LYS A CB  1 
ATOM   2172 C  CG  . LYS A 1 335 ? -11.920 31.493  14.366  1.00 54.48  ? 335  LYS A CG  1 
ATOM   2173 C  CD  . LYS A 1 335 ? -11.665 32.452  13.219  1.00 58.05  ? 335  LYS A CD  1 
ATOM   2174 C  CE  . LYS A 1 335 ? -10.231 32.343  12.729  1.00 60.06  ? 335  LYS A CE  1 
ATOM   2175 N  NZ  . LYS A 1 335 ? -9.951  33.275  11.603  1.00 64.58  ? 335  LYS A NZ  1 
ATOM   2176 N  N   . MET A 1 336 ? -12.026 30.214  17.492  1.00 48.78  ? 336  MET A N   1 
ATOM   2177 C  CA  . MET A 1 336 ? -11.560 30.239  18.865  1.00 44.82  ? 336  MET A CA  1 
ATOM   2178 C  C   . MET A 1 336 ? -10.061 29.983  18.930  1.00 48.24  ? 336  MET A C   1 
ATOM   2179 O  O   . MET A 1 336 ? -9.529  29.180  18.163  1.00 53.24  ? 336  MET A O   1 
ATOM   2180 C  CB  . MET A 1 336 ? -12.304 29.158  19.648  1.00 47.80  ? 336  MET A CB  1 
ATOM   2181 C  CG  . MET A 1 336 ? -12.388 29.375  21.138  1.00 50.01  ? 336  MET A CG  1 
ATOM   2182 S  SD  . MET A 1 336 ? -13.553 28.208  21.868  1.00 51.29  ? 336  MET A SD  1 
ATOM   2183 C  CE  . MET A 1 336 ? -13.272 28.508  23.608  1.00 49.01  ? 336  MET A CE  1 
ATOM   2184 N  N   . ARG A 1 337 ? -9.380  30.670  19.843  1.00 48.13  ? 337  ARG A N   1 
ATOM   2185 C  CA  . ARG A 1 337 ? -7.961  30.424  20.067  1.00 45.94  ? 337  ARG A CA  1 
ATOM   2186 C  C   . ARG A 1 337 ? -7.806  29.075  20.756  1.00 48.87  ? 337  ARG A C   1 
ATOM   2187 O  O   . ARG A 1 337 ? -8.520  28.777  21.715  1.00 51.95  ? 337  ARG A O   1 
ATOM   2188 C  CB  . ARG A 1 337 ? -7.340  31.530  20.920  1.00 43.31  ? 337  ARG A CB  1 
ATOM   2189 C  CG  . ARG A 1 337 ? -5.833  31.666  20.753  1.00 46.04  ? 337  ARG A CG  1 
ATOM   2190 C  CD  . ARG A 1 337 ? -5.236  32.592  21.800  1.00 43.64  ? 337  ARG A CD  1 
ATOM   2191 N  NE  . ARG A 1 337 ? -4.953  31.894  23.051  1.00 40.99  ? 337  ARG A NE  1 
ATOM   2192 C  CZ  . ARG A 1 337 ? -3.730  31.597  23.482  1.00 39.67  ? 337  ARG A CZ  1 
ATOM   2193 N  NH1 . ARG A 1 337 ? -2.668  31.945  22.767  1.00 38.89  ? 337  ARG A NH1 1 
ATOM   2194 N  NH2 . ARG A 1 337 ? -3.568  30.958  24.632  1.00 39.21  ? 337  ARG A NH2 1 
ATOM   2195 N  N   . LEU A 1 338 ? -6.880  28.261  20.262  1.00 45.35  ? 338  LEU A N   1 
ATOM   2196 C  CA  . LEU A 1 338 ? -6.713  26.900  20.761  1.00 39.93  ? 338  LEU A CA  1 
ATOM   2197 C  C   . LEU A 1 338 ? -6.341  26.874  22.242  1.00 40.43  ? 338  LEU A C   1 
ATOM   2198 O  O   . LEU A 1 338 ? -6.786  25.999  22.985  1.00 38.77  ? 338  LEU A O   1 
ATOM   2199 C  CB  . LEU A 1 338 ? -5.673  26.144  19.932  1.00 45.48  ? 338  LEU A CB  1 
ATOM   2200 C  CG  . LEU A 1 338 ? -5.652  24.625  20.112  1.00 47.59  ? 338  LEU A CG  1 
ATOM   2201 C  CD1 . LEU A 1 338 ? -7.013  24.028  19.795  1.00 48.86  ? 338  LEU A CD1 1 
ATOM   2202 C  CD2 . LEU A 1 338 ? -4.583  23.999  19.242  1.00 43.36  ? 338  LEU A CD2 1 
ATOM   2203 N  N   . GLY A 1 339 ? -5.527  27.838  22.663  1.00 44.60  ? 339  GLY A N   1 
ATOM   2204 C  CA  . GLY A 1 339 ? -5.147  27.965  24.066  1.00 43.11  ? 339  GLY A CA  1 
ATOM   2205 C  C   . GLY A 1 339 ? -6.346  28.287  24.935  1.00 44.64  ? 339  GLY A C   1 
ATOM   2206 O  O   . GLY A 1 339 ? -6.499  27.737  26.026  1.00 48.06  ? 339  GLY A O   1 
ATOM   2207 N  N   . ASP A 1 340 ? -7.199  29.182  24.443  1.00 46.01  ? 340  ASP A N   1 
ATOM   2208 C  CA  . ASP A 1 340 ? -8.436  29.531  25.131  1.00 44.55  ? 340  ASP A CA  1 
ATOM   2209 C  C   . ASP A 1 340 ? -9.350  28.317  25.217  1.00 49.11  ? 340  ASP A C   1 
ATOM   2210 O  O   . ASP A 1 340 ? -9.983  28.076  26.244  1.00 47.83  ? 340  ASP A O   1 
ATOM   2211 C  CB  . ASP A 1 340 ? -9.158  30.668  24.404  1.00 43.74  ? 340  ASP A CB  1 
ATOM   2212 C  CG  . ASP A 1 340 ? -8.366  31.961  24.405  1.00 48.01  ? 340  ASP A CG  1 
ATOM   2213 O  OD1 . ASP A 1 340 ? -7.359  32.046  25.138  1.00 53.85  ? 340  ASP A OD1 1 
ATOM   2214 O  OD2 . ASP A 1 340 ? -8.753  32.894  23.671  1.00 49.08  ? 340  ASP A OD2 1 
ATOM   2215 N  N   . ALA A 1 341 ? -9.408  27.556  24.127  1.00 52.83  ? 341  ALA A N   1 
ATOM   2216 C  CA  . ALA A 1 341 ? -10.264 26.378  24.041  1.00 48.19  ? 341  ALA A CA  1 
ATOM   2217 C  C   . ALA A 1 341 ? -10.002 25.390  25.173  1.00 50.98  ? 341  ALA A C   1 
ATOM   2218 O  O   . ALA A 1 341 ? -10.936 24.885  25.796  1.00 49.42  ? 341  ALA A O   1 
ATOM   2219 C  CB  . ALA A 1 341 ? -10.092 25.699  22.694  1.00 54.89  ? 341  ALA A CB  1 
ATOM   2220 N  N   . VAL A 1 342 ? -8.729  25.114  25.435  1.00 47.20  ? 342  VAL A N   1 
ATOM   2221 C  CA  . VAL A 1 342 ? -8.359  24.212  26.518  1.00 49.78  ? 342  VAL A CA  1 
ATOM   2222 C  C   . VAL A 1 342 ? -8.666  24.851  27.871  1.00 50.90  ? 342  VAL A C   1 
ATOM   2223 O  O   . VAL A 1 342 ? -9.123  24.178  28.796  1.00 48.18  ? 342  VAL A O   1 
ATOM   2224 C  CB  . VAL A 1 342 ? -6.871  23.807  26.437  1.00 44.30  ? 342  VAL A CB  1 
ATOM   2225 C  CG1 . VAL A 1 342 ? -6.470  22.979  27.651  1.00 40.79  ? 342  VAL A CG1 1 
ATOM   2226 C  CG2 . VAL A 1 342 ? -6.607  23.034  25.154  1.00 39.14  ? 342  VAL A CG2 1 
ATOM   2227 N  N   . GLU A 1 343 ? -8.428  26.156  27.971  1.00 57.58  ? 343  GLU A N   1 
ATOM   2228 C  CA  . GLU A 1 343 ? -8.703  26.900  29.195  1.00 58.20  ? 343  GLU A CA  1 
ATOM   2229 C  C   . GLU A 1 343 ? -10.192 26.879  29.531  1.00 54.56  ? 343  GLU A C   1 
ATOM   2230 O  O   . GLU A 1 343 ? -10.576 26.665  30.681  1.00 50.96  ? 343  GLU A O   1 
ATOM   2231 C  CB  . GLU A 1 343 ? -8.220  28.346  29.062  1.00 66.57  ? 343  GLU A CB  1 
ATOM   2232 C  CG  . GLU A 1 343 ? -8.362  29.169  30.334  1.00 74.46  ? 343  GLU A CG  1 
ATOM   2233 C  CD  . GLU A 1 343 ? -8.197  30.658  30.093  1.00 76.66  ? 343  GLU A CD  1 
ATOM   2234 O  OE1 . GLU A 1 343 ? -8.508  31.121  28.975  1.00 77.16  ? 343  GLU A OE1 1 
ATOM   2235 O  OE2 . GLU A 1 343 ? -7.764  31.367  31.025  1.00 79.25  ? 343  GLU A OE2 1 
ATOM   2236 N  N   . GLN A 1 344 ? -11.025 27.094  28.517  1.00 52.11  ? 344  GLN A N   1 
ATOM   2237 C  CA  . GLN A 1 344 ? -12.472 27.147  28.707  1.00 43.54  ? 344  GLN A CA  1 
ATOM   2238 C  C   . GLN A 1 344 ? -13.100 25.762  28.838  1.00 48.81  ? 344  GLN A C   1 
ATOM   2239 O  O   . GLN A 1 344 ? -14.301 25.641  29.068  1.00 60.63  ? 344  GLN A O   1 
ATOM   2240 C  CB  . GLN A 1 344 ? -13.139 27.924  27.570  1.00 39.81  ? 344  GLN A CB  1 
ATOM   2241 C  CG  . GLN A 1 344 ? -12.770 29.397  27.523  1.00 39.28  ? 344  GLN A CG  1 
ATOM   2242 C  CD  . GLN A 1 344 ? -13.651 30.186  26.576  1.00 48.18  ? 344  GLN A CD  1 
ATOM   2243 O  OE1 . GLN A 1 344 ? -14.771 29.776  26.263  1.00 48.21  ? 344  GLN A OE1 1 
ATOM   2244 N  NE2 . GLN A 1 344 ? -13.151 31.327  26.115  1.00 50.50  ? 344  GLN A NE2 1 
ATOM   2245 N  N   . GLY A 1 345 ? -12.289 24.721  28.680  1.00 47.62  ? 345  GLY A N   1 
ATOM   2246 C  CA  . GLY A 1 345 ? -12.751 23.355  28.902  1.00 45.41  ? 345  GLY A CA  1 
ATOM   2247 C  C   . GLY A 1 345 ? -13.470 22.696  27.738  1.00 44.95  ? 345  GLY A C   1 
ATOM   2248 O  O   . GLY A 1 345 ? -13.865 21.533  27.833  1.00 46.62  ? 345  GLY A O   1 
ATOM   2249 N  N   . VAL A 1 346 ? -13.648 23.425  26.640  1.00 47.35  ? 346  VAL A N   1 
ATOM   2250 C  CA  . VAL A 1 346 ? -14.282 22.852  25.452  1.00 50.33  ? 346  VAL A CA  1 
ATOM   2251 C  C   . VAL A 1 346 ? -13.421 21.725  24.876  1.00 48.18  ? 346  VAL A C   1 
ATOM   2252 O  O   . VAL A 1 346 ? -13.940 20.703  24.424  1.00 53.39  ? 346  VAL A O   1 
ATOM   2253 C  CB  . VAL A 1 346 ? -14.603 23.924  24.380  1.00 46.97  ? 346  VAL A CB  1 
ATOM   2254 C  CG1 . VAL A 1 346 ? -13.402 24.803  24.119  1.00 54.99  ? 346  VAL A CG1 1 
ATOM   2255 C  CG2 . VAL A 1 346 ? -15.087 23.274  23.091  1.00 48.05  ? 346  VAL A CG2 1 
ATOM   2256 N  N   . ILE A 1 347 ? -12.105 21.914  24.909  1.00 42.39  ? 347  ILE A N   1 
ATOM   2257 C  CA  . ILE A 1 347 ? -11.169 20.845  24.584  1.00 40.72  ? 347  ILE A CA  1 
ATOM   2258 C  C   . ILE A 1 347 ? -10.553 20.313  25.874  1.00 42.13  ? 347  ILE A C   1 
ATOM   2259 O  O   . ILE A 1 347 ? -9.886  21.048  26.604  1.00 43.33  ? 347  ILE A O   1 
ATOM   2260 C  CB  . ILE A 1 347 ? -10.064 21.313  23.615  1.00 40.74  ? 347  ILE A CB  1 
ATOM   2261 C  CG1 . ILE A 1 347 ? -10.670 21.655  22.253  1.00 40.02  ? 347  ILE A CG1 1 
ATOM   2262 C  CG2 . ILE A 1 347 ? -8.995  20.239  23.461  1.00 38.45  ? 347  ILE A CG2 1 
ATOM   2263 C  CD1 . ILE A 1 347 ? -9.651  22.040  21.208  1.00 45.26  ? 347  ILE A CD1 1 
ATOM   2264 N  N   . ASN A 1 348 ? -10.788 19.033  26.144  1.00 44.51  ? 348  ASN A N   1 
ATOM   2265 C  CA  . ASN A 1 348 ? -10.431 18.418  27.421  1.00 47.76  ? 348  ASN A CA  1 
ATOM   2266 C  C   . ASN A 1 348 ? -9.010  18.708  27.903  1.00 51.02  ? 348  ASN A C   1 
ATOM   2267 O  O   . ASN A 1 348 ? -8.819  19.340  28.942  1.00 56.41  ? 348  ASN A O   1 
ATOM   2268 C  CB  . ASN A 1 348 ? -10.664 16.906  27.365  1.00 57.36  ? 348  ASN A CB  1 
ATOM   2269 C  CG  . ASN A 1 348 ? -10.519 16.242  28.720  1.00 62.25  ? 348  ASN A CG  1 
ATOM   2270 O  OD1 . ASN A 1 348 ? -9.945  15.160  28.835  1.00 64.55  ? 348  ASN A OD1 1 
ATOM   2271 N  ND2 . ASN A 1 348 ? -11.038 16.892  29.756  1.00 65.52  ? 348  ASN A ND2 1 
ATOM   2272 N  N   . ASN A 1 349 ? -8.019  18.248  27.148  1.00 52.98  ? 349  ASN A N   1 
ATOM   2273 C  CA  . ASN A 1 349 ? -6.626  18.356  27.568  1.00 49.21  ? 349  ASN A CA  1 
ATOM   2274 C  C   . ASN A 1 349 ? -5.705  18.896  26.478  1.00 47.30  ? 349  ASN A C   1 
ATOM   2275 O  O   . ASN A 1 349 ? -6.130  19.112  25.344  1.00 48.98  ? 349  ASN A O   1 
ATOM   2276 C  CB  . ASN A 1 349 ? -6.115  16.998  28.046  1.00 49.49  ? 349  ASN A CB  1 
ATOM   2277 C  CG  . ASN A 1 349 ? -6.282  15.918  27.000  1.00 49.52  ? 349  ASN A CG  1 
ATOM   2278 O  OD1 . ASN A 1 349 ? -5.363  15.638  26.233  1.00 56.51  ? 349  ASN A OD1 1 
ATOM   2279 N  ND2 . ASN A 1 349 ? -7.465  15.317  26.951  1.00 49.35  ? 349  ASN A ND2 1 
ATOM   2280 N  N   . THR A 1 350 ? -4.438  19.101  26.831  1.00 47.55  ? 350  THR A N   1 
ATOM   2281 C  CA  . THR A 1 350 ? -3.462  19.675  25.908  1.00 46.75  ? 350  THR A CA  1 
ATOM   2282 C  C   . THR A 1 350 ? -2.867  18.642  24.955  1.00 45.86  ? 350  THR A C   1 
ATOM   2283 O  O   . THR A 1 350 ? -2.396  18.993  23.873  1.00 45.60  ? 350  THR A O   1 
ATOM   2284 C  CB  . THR A 1 350 ? -2.320  20.394  26.654  1.00 50.13  ? 350  THR A CB  1 
ATOM   2285 O  OG1 . THR A 1 350 ? -1.743  19.509  27.621  1.00 52.24  ? 350  THR A OG1 1 
ATOM   2286 C  CG2 . THR A 1 350 ? -2.844  21.637  27.358  1.00 53.38  ? 350  THR A CG2 1 
ATOM   2287 N  N   . VAL A 1 351 ? -2.881  17.374  25.358  1.00 45.21  ? 351  VAL A N   1 
ATOM   2288 C  CA  . VAL A 1 351 ? -2.418  16.298  24.487  1.00 45.85  ? 351  VAL A CA  1 
ATOM   2289 C  C   . VAL A 1 351 ? -3.349  16.178  23.285  1.00 48.09  ? 351  VAL A C   1 
ATOM   2290 O  O   . VAL A 1 351 ? -2.897  16.099  22.143  1.00 49.37  ? 351  VAL A O   1 
ATOM   2291 C  CB  . VAL A 1 351 ? -2.343  14.948  25.227  1.00 47.97  ? 351  VAL A CB  1 
ATOM   2292 C  CG1 . VAL A 1 351 ? -1.924  13.840  24.271  1.00 54.08  ? 351  VAL A CG1 1 
ATOM   2293 C  CG2 . VAL A 1 351 ? -1.374  15.038  26.394  1.00 48.69  ? 351  VAL A CG2 1 
ATOM   2294 N  N   . LEU A 1 352 ? -4.652  16.176  23.552  1.00 43.53  ? 352  LEU A N   1 
ATOM   2295 C  CA  . LEU A 1 352 ? -5.654  16.200  22.497  1.00 43.13  ? 352  LEU A CA  1 
ATOM   2296 C  C   . LEU A 1 352 ? -5.511  17.504  21.717  1.00 46.26  ? 352  LEU A C   1 
ATOM   2297 O  O   . LEU A 1 352 ? -5.532  17.512  20.486  1.00 53.27  ? 352  LEU A O   1 
ATOM   2298 C  CB  . LEU A 1 352 ? -7.057  16.111  23.100  1.00 44.02  ? 352  LEU A CB  1 
ATOM   2299 C  CG  . LEU A 1 352 ? -8.171  15.396  22.327  1.00 47.62  ? 352  LEU A CG  1 
ATOM   2300 C  CD1 . LEU A 1 352 ? -9.522  15.730  22.942  1.00 51.70  ? 352  LEU A CD1 1 
ATOM   2301 C  CD2 . LEU A 1 352 ? -8.165  15.740  20.846  1.00 46.42  ? 352  LEU A CD2 1 
ATOM   2302 N  N   . GLY A 1 353 ? -5.355  18.604  22.449  1.00 44.53  ? 353  GLY A N   1 
ATOM   2303 C  CA  . GLY A 1 353 ? -5.233  19.927  21.850  1.00 41.26  ? 353  GLY A CA  1 
ATOM   2304 C  C   . GLY A 1 353 ? -4.055  20.065  20.904  1.00 34.41  ? 353  GLY A C   1 
ATOM   2305 O  O   . GLY A 1 353 ? -4.180  20.654  19.831  1.00 30.06  ? 353  GLY A O   1 
ATOM   2306 N  N   . TYR A 1 354 ? -2.909  19.520  21.301  1.00 30.61  ? 354  TYR A N   1 
ATOM   2307 C  CA  . TYR A 1 354 ? -1.708  19.596  20.475  1.00 33.96  ? 354  TYR A CA  1 
ATOM   2308 C  C   . TYR A 1 354 ? -1.930  18.969  19.102  1.00 37.79  ? 354  TYR A C   1 
ATOM   2309 O  O   . TYR A 1 354 ? -1.634  19.585  18.078  1.00 34.85  ? 354  TYR A O   1 
ATOM   2310 C  CB  . TYR A 1 354 ? -0.517  18.934  21.171  1.00 39.28  ? 354  TYR A CB  1 
ATOM   2311 C  CG  . TYR A 1 354 ? 0.739   18.910  20.329  1.00 40.84  ? 354  TYR A CG  1 
ATOM   2312 C  CD1 . TYR A 1 354 ? 1.460   20.074  20.089  1.00 41.61  ? 354  TYR A CD1 1 
ATOM   2313 C  CD2 . TYR A 1 354 ? 1.203   17.725  19.771  1.00 41.08  ? 354  TYR A CD2 1 
ATOM   2314 C  CE1 . TYR A 1 354 ? 2.607   20.058  19.317  1.00 41.56  ? 354  TYR A CE1 1 
ATOM   2315 C  CE2 . TYR A 1 354 ? 2.351   17.700  18.998  1.00 39.30  ? 354  TYR A CE2 1 
ATOM   2316 C  CZ  . TYR A 1 354 ? 3.048   18.869  18.775  1.00 41.95  ? 354  TYR A CZ  1 
ATOM   2317 O  OH  . TYR A 1 354 ? 4.190   18.851  18.006  1.00 43.60  ? 354  TYR A OH  1 
ATOM   2318 N  N   . PHE A 1 355 ? -2.457  17.748  19.085  1.00 35.84  ? 355  PHE A N   1 
ATOM   2319 C  CA  . PHE A 1 355 ? -2.697  17.044  17.830  1.00 38.87  ? 355  PHE A CA  1 
ATOM   2320 C  C   . PHE A 1 355 ? -3.733  17.748  16.954  1.00 41.24  ? 355  PHE A C   1 
ATOM   2321 O  O   . PHE A 1 355 ? -3.569  17.819  15.737  1.00 43.90  ? 355  PHE A O   1 
ATOM   2322 C  CB  . PHE A 1 355 ? -3.082  15.584  18.079  1.00 34.19  ? 355  PHE A CB  1 
ATOM   2323 C  CG  . PHE A 1 355 ? -1.917  14.713  18.457  1.00 36.86  ? 355  PHE A CG  1 
ATOM   2324 C  CD1 . PHE A 1 355 ? -0.965  14.361  17.512  1.00 37.85  ? 355  PHE A CD1 1 
ATOM   2325 C  CD2 . PHE A 1 355 ? -1.768  14.252  19.754  1.00 37.08  ? 355  PHE A CD2 1 
ATOM   2326 C  CE1 . PHE A 1 355 ? 0.113   13.563  17.854  1.00 33.51  ? 355  PHE A CE1 1 
ATOM   2327 C  CE2 . PHE A 1 355 ? -0.693  13.452  20.102  1.00 34.92  ? 355  PHE A CE2 1 
ATOM   2328 C  CZ  . PHE A 1 355 ? 0.248   13.108  19.151  1.00 35.97  ? 355  PHE A CZ  1 
ATOM   2329 N  N   . ILE A 1 356 ? -4.789  18.273  17.571  1.00 33.88  ? 356  ILE A N   1 
ATOM   2330 C  CA  . ILE A 1 356 ? -5.798  19.032  16.834  1.00 34.68  ? 356  ILE A CA  1 
ATOM   2331 C  C   . ILE A 1 356 ? -5.154  20.190  16.074  1.00 40.48  ? 356  ILE A C   1 
ATOM   2332 O  O   . ILE A 1 356 ? -5.476  20.440  14.912  1.00 43.01  ? 356  ILE A O   1 
ATOM   2333 C  CB  . ILE A 1 356 ? -6.905  19.574  17.762  1.00 32.06  ? 356  ILE A CB  1 
ATOM   2334 C  CG1 . ILE A 1 356 ? -7.818  18.438  18.227  1.00 31.03  ? 356  ILE A CG1 1 
ATOM   2335 C  CG2 . ILE A 1 356 ? -7.728  20.639  17.053  1.00 29.02  ? 356  ILE A CG2 1 
ATOM   2336 C  CD1 . ILE A 1 356 ? -8.997  18.901  19.055  1.00 24.70  ? 356  ILE A CD1 1 
ATOM   2337 N  N   . GLY A 1 357 ? -4.234  20.884  16.737  1.00 38.34  ? 357  GLY A N   1 
ATOM   2338 C  CA  . GLY A 1 357 ? -3.532  22.006  16.126  1.00 36.38  ? 357  GLY A CA  1 
ATOM   2339 C  C   . GLY A 1 357 ? -2.524  21.579  15.078  1.00 36.25  ? 357  GLY A C   1 
ATOM   2340 O  O   . GLY A 1 357 ? -2.324  22.272  14.080  1.00 45.96  ? 357  GLY A O   1 
ATOM   2341 N  N   . ARG A 1 358 ? -1.883  20.437  15.307  1.00 40.05  ? 358  ARG A N   1 
ATOM   2342 C  CA  . ARG A 1 358 ? -0.945  19.873  14.341  1.00 28.36  ? 358  ARG A CA  1 
ATOM   2343 C  C   . ARG A 1 358 ? -1.684  19.406  13.096  1.00 29.81  ? 358  ARG A C   1 
ATOM   2344 O  O   . ARG A 1 358 ? -1.191  19.552  11.978  1.00 37.09  ? 358  ARG A O   1 
ATOM   2345 C  CB  . ARG A 1 358 ? -0.177  18.708  14.962  1.00 30.01  ? 358  ARG A CB  1 
ATOM   2346 C  CG  . ARG A 1 358 ? 0.926   19.127  15.920  1.00 34.45  ? 358  ARG A CG  1 
ATOM   2347 C  CD  . ARG A 1 358 ? 2.279   19.164  15.228  1.00 33.41  ? 358  ARG A CD  1 
ATOM   2348 N  NE  . ARG A 1 358 ? 2.490   20.378  14.446  1.00 29.66  ? 358  ARG A NE  1 
ATOM   2349 C  CZ  . ARG A 1 358 ? 3.481   20.538  13.575  1.00 30.62  ? 358  ARG A CZ  1 
ATOM   2350 N  NH1 . ARG A 1 358 ? 4.346   19.555  13.362  1.00 27.27  ? 358  ARG A NH1 1 
ATOM   2351 N  NH2 . ARG A 1 358 ? 3.604   21.677  12.910  1.00 33.44  ? 358  ARG A NH2 1 
ATOM   2352 N  N   . ILE A 1 359 ? -2.871  18.843  13.299  1.00 31.06  ? 359  ILE A N   1 
ATOM   2353 C  CA  . ILE A 1 359 ? -3.729  18.437  12.193  1.00 26.93  ? 359  ILE A CA  1 
ATOM   2354 C  C   . ILE A 1 359 ? -4.160  19.663  11.393  1.00 28.43  ? 359  ILE A C   1 
ATOM   2355 O  O   . ILE A 1 359 ? -4.140  19.648  10.163  1.00 39.91  ? 359  ILE A O   1 
ATOM   2356 C  CB  . ILE A 1 359 ? -4.966  17.664  12.691  1.00 23.73  ? 359  ILE A CB  1 
ATOM   2357 C  CG1 . ILE A 1 359 ? -4.549  16.302  13.253  1.00 26.78  ? 359  ILE A CG1 1 
ATOM   2358 C  CG2 . ILE A 1 359 ? -5.975  17.480  11.570  1.00 26.77  ? 359  ILE A CG2 1 
ATOM   2359 C  CD1 . ILE A 1 359 ? -5.636  15.604  14.049  1.00 23.78  ? 359  ILE A CD1 1 
ATOM   2360 N  N   . TYR A 1 360 ? -4.533  20.727  12.098  1.00 25.43  ? 360  TYR A N   1 
ATOM   2361 C  CA  . TYR A 1 360 ? -4.921  21.975  11.450  1.00 31.96  ? 360  TYR A CA  1 
ATOM   2362 C  C   . TYR A 1 360 ? -3.781  22.526  10.602  1.00 35.92  ? 360  TYR A C   1 
ATOM   2363 O  O   . TYR A 1 360 ? -3.986  22.928  9.456   1.00 33.02  ? 360  TYR A O   1 
ATOM   2364 C  CB  . TYR A 1 360 ? -5.348  23.018  12.487  1.00 33.22  ? 360  TYR A CB  1 
ATOM   2365 C  CG  . TYR A 1 360 ? -5.552  24.400  11.904  1.00 29.31  ? 360  TYR A CG  1 
ATOM   2366 C  CD1 . TYR A 1 360 ? -6.737  24.736  11.262  1.00 27.94  ? 360  TYR A CD1 1 
ATOM   2367 C  CD2 . TYR A 1 360 ? -4.559  25.368  11.993  1.00 29.57  ? 360  TYR A CD2 1 
ATOM   2368 C  CE1 . TYR A 1 360 ? -6.929  25.996  10.724  1.00 27.20  ? 360  TYR A CE1 1 
ATOM   2369 C  CE2 . TYR A 1 360 ? -4.742  26.631  11.458  1.00 33.45  ? 360  TYR A CE2 1 
ATOM   2370 C  CZ  . TYR A 1 360 ? -5.929  26.939  10.825  1.00 31.84  ? 360  TYR A CZ  1 
ATOM   2371 O  OH  . TYR A 1 360 ? -6.116  28.194  10.292  1.00 34.31  ? 360  TYR A OH  1 
ATOM   2372 N  N   . LEU A 1 361 ? -2.581  22.547  11.176  1.00 36.52  ? 361  LEU A N   1 
ATOM   2373 C  CA  . LEU A 1 361 ? -1.401  23.034  10.473  1.00 29.25  ? 361  LEU A CA  1 
ATOM   2374 C  C   . LEU A 1 361 ? -1.124  22.211  9.221   1.00 36.46  ? 361  LEU A C   1 
ATOM   2375 O  O   . LEU A 1 361 ? -0.824  22.764  8.164   1.00 40.51  ? 361  LEU A O   1 
ATOM   2376 C  CB  . LEU A 1 361 ? -0.178  23.027  11.394  1.00 29.10  ? 361  LEU A CB  1 
ATOM   2377 C  CG  . LEU A 1 361 ? -0.135  24.116  12.471  1.00 27.73  ? 361  LEU A CG  1 
ATOM   2378 C  CD1 . LEU A 1 361 ? 1.045   23.907  13.404  1.00 23.80  ? 361  LEU A CD1 1 
ATOM   2379 C  CD2 . LEU A 1 361 ? -0.085  25.501  11.841  1.00 26.20  ? 361  LEU A CD2 1 
ATOM   2380 N  N   . TYR A 1 362 ? -1.234  20.892  9.342   1.00 35.44  ? 362  TYR A N   1 
ATOM   2381 C  CA  . TYR A 1 362 ? -0.996  20.005  8.209   1.00 30.08  ? 362  TYR A CA  1 
ATOM   2382 C  C   . TYR A 1 362 ? -2.000  20.229  7.082   1.00 39.84  ? 362  TYR A C   1 
ATOM   2383 O  O   . TYR A 1 362 ? -1.623  20.307  5.911   1.00 37.99  ? 362  TYR A O   1 
ATOM   2384 C  CB  . TYR A 1 362 ? -1.029  18.539  8.640   1.00 31.32  ? 362  TYR A CB  1 
ATOM   2385 C  CG  . TYR A 1 362 ? -0.989  17.587  7.468   1.00 33.33  ? 362  TYR A CG  1 
ATOM   2386 C  CD1 . TYR A 1 362 ? 0.207   17.306  6.820   1.00 33.32  ? 362  TYR A CD1 1 
ATOM   2387 C  CD2 . TYR A 1 362 ? -2.149  16.983  6.998   1.00 29.15  ? 362  TYR A CD2 1 
ATOM   2388 C  CE1 . TYR A 1 362 ? 0.248   16.444  5.742   1.00 32.26  ? 362  TYR A CE1 1 
ATOM   2389 C  CE2 . TYR A 1 362 ? -2.117  16.118  5.921   1.00 29.48  ? 362  TYR A CE2 1 
ATOM   2390 C  CZ  . TYR A 1 362 ? -0.915  15.853  5.298   1.00 30.99  ? 362  TYR A CZ  1 
ATOM   2391 O  OH  . TYR A 1 362 ? -0.876  14.993  4.227   1.00 32.56  ? 362  TYR A OH  1 
ATOM   2392 N  N   . LEU A 1 363 ? -3.277  20.324  7.442   1.00 38.47  ? 363  LEU A N   1 
ATOM   2393 C  CA  . LEU A 1 363 ? -4.346  20.459  6.455   1.00 34.89  ? 363  LEU A CA  1 
ATOM   2394 C  C   . LEU A 1 363 ? -4.258  21.764  5.668   1.00 37.11  ? 363  LEU A C   1 
ATOM   2395 O  O   . LEU A 1 363 ? -4.479  21.780  4.457   1.00 37.40  ? 363  LEU A O   1 
ATOM   2396 C  CB  . LEU A 1 363 ? -5.719  20.325  7.121   1.00 37.46  ? 363  LEU A CB  1 
ATOM   2397 C  CG  . LEU A 1 363 ? -6.052  18.958  7.729   1.00 39.40  ? 363  LEU A CG  1 
ATOM   2398 C  CD1 . LEU A 1 363 ? -7.398  18.995  8.437   1.00 36.76  ? 363  LEU A CD1 1 
ATOM   2399 C  CD2 . LEU A 1 363 ? -6.030  17.865  6.671   1.00 36.68  ? 363  LEU A CD2 1 
ATOM   2400 N  N   . THR A 1 364 ? -3.930  22.854  6.355   1.00 32.82  ? 364  THR A N   1 
ATOM   2401 C  CA  . THR A 1 364 ? -3.795  24.151  5.699   1.00 35.74  ? 364  THR A CA  1 
ATOM   2402 C  C   . THR A 1 364 ? -2.520  24.206  4.864   1.00 40.44  ? 364  THR A C   1 
ATOM   2403 O  O   . THR A 1 364 ? -2.470  24.876  3.832   1.00 42.19  ? 364  THR A O   1 
ATOM   2404 C  CB  . THR A 1 364 ? -3.794  25.310  6.713   1.00 31.09  ? 364  THR A CB  1 
ATOM   2405 O  OG1 . THR A 1 364 ? -2.747  25.113  7.671   1.00 33.64  ? 364  THR A OG1 1 
ATOM   2406 C  CG2 . THR A 1 364 ? -5.130  25.387  7.435   1.00 29.16  ? 364  THR A CG2 1 
ATOM   2407 N  N   . LYS A 1 365 ? -1.493  23.493  5.319   1.00 39.77  ? 365  LYS A N   1 
ATOM   2408 C  CA  . LYS A 1 365 ? -0.223  23.419  4.607   1.00 42.34  ? 365  LYS A CA  1 
ATOM   2409 C  C   . LYS A 1 365 ? -0.391  22.690  3.277   1.00 41.27  ? 365  LYS A C   1 
ATOM   2410 O  O   . LYS A 1 365 ? 0.238   23.040  2.279   1.00 43.95  ? 365  LYS A O   1 
ATOM   2411 C  CB  . LYS A 1 365 ? 0.821   22.704  5.469   1.00 39.27  ? 365  LYS A CB  1 
ATOM   2412 C  CG  . LYS A 1 365 ? 2.153   22.464  4.779   1.00 38.51  ? 365  LYS A CG  1 
ATOM   2413 C  CD  . LYS A 1 365 ? 3.056   21.568  5.613   1.00 37.99  ? 365  LYS A CD  1 
ATOM   2414 C  CE  . LYS A 1 365 ? 3.518   22.263  6.881   1.00 40.62  ? 365  LYS A CE  1 
ATOM   2415 N  NZ  . LYS A 1 365 ? 4.508   21.440  7.631   1.00 44.43  ? 365  LYS A NZ  1 
ATOM   2416 N  N   . VAL A 1 366 ? -1.254  21.679  3.275   1.00 39.19  ? 366  VAL A N   1 
ATOM   2417 C  CA  . VAL A 1 366 ? -1.480  20.848  2.095   1.00 28.16  ? 366  VAL A CA  1 
ATOM   2418 C  C   . VAL A 1 366 ? -2.419  21.506  1.076   1.00 27.26  ? 366  VAL A C   1 
ATOM   2419 O  O   . VAL A 1 366 ? -2.518  21.057  -0.066  1.00 27.79  ? 366  VAL A O   1 
ATOM   2420 C  CB  . VAL A 1 366 ? -1.990  19.442  2.498   1.00 33.60  ? 366  VAL A CB  1 
ATOM   2421 C  CG1 . VAL A 1 366 ? -2.711  18.767  1.347   1.00 37.33  ? 366  VAL A CG1 1 
ATOM   2422 C  CG2 . VAL A 1 366 ? -0.832  18.583  2.983   1.00 31.51  ? 366  VAL A CG2 1 
ATOM   2423 N  N   . GLY A 1 367 ? -3.102  22.571  1.488   1.00 30.45  ? 367  GLY A N   1 
ATOM   2424 C  CA  . GLY A 1 367 ? -3.907  23.358  0.554   1.00 34.03  ? 367  GLY A CA  1 
ATOM   2425 C  C   . GLY A 1 367 ? -5.371  23.535  0.909   1.00 40.88  ? 367  GLY A C   1 
ATOM   2426 O  O   . GLY A 1 367 ? -6.153  24.037  0.101   1.00 39.75  ? 367  GLY A O   1 
ATOM   2427 N  N   . ILE A 1 368 ? -5.750  23.129  2.116   1.00 39.79  ? 368  ILE A N   1 
ATOM   2428 C  CA  . ILE A 1 368 ? -7.132  23.272  2.562   1.00 37.73  ? 368  ILE A CA  1 
ATOM   2429 C  C   . ILE A 1 368 ? -7.379  24.652  3.167   1.00 35.62  ? 368  ILE A C   1 
ATOM   2430 O  O   . ILE A 1 368 ? -6.589  25.138  3.976   1.00 40.31  ? 368  ILE A O   1 
ATOM   2431 C  CB  . ILE A 1 368 ? -7.521  22.165  3.561   1.00 35.00  ? 368  ILE A CB  1 
ATOM   2432 C  CG1 . ILE A 1 368 ? -7.455  20.798  2.872   1.00 30.24  ? 368  ILE A CG1 1 
ATOM   2433 C  CG2 . ILE A 1 368 ? -8.910  22.417  4.134   1.00 28.30  ? 368  ILE A CG2 1 
ATOM   2434 C  CD1 . ILE A 1 368 ? -7.754  19.629  3.780   1.00 28.98  ? 368  ILE A CD1 1 
ATOM   2435 N  N   . SER A 1 369 ? -8.480  25.278  2.761   1.00 38.00  ? 369  SER A N   1 
ATOM   2436 C  CA  . SER A 1 369 ? -8.819  26.623  3.211   1.00 39.15  ? 369  SER A CA  1 
ATOM   2437 C  C   . SER A 1 369 ? -9.277  26.647  4.667   1.00 40.81  ? 369  SER A C   1 
ATOM   2438 O  O   . SER A 1 369 ? -10.167 25.889  5.053   1.00 43.72  ? 369  SER A O   1 
ATOM   2439 C  CB  . SER A 1 369 ? -9.899  27.223  2.310   1.00 42.51  ? 369  SER A CB  1 
ATOM   2440 O  OG  . SER A 1 369 ? -9.440  27.345  0.975   1.00 51.28  ? 369  SER A OG  1 
ATOM   2441 N  N   . PRO A 1 370 ? -8.664  27.524  5.479   1.00 41.76  ? 370  PRO A N   1 
ATOM   2442 C  CA  . PRO A 1 370 ? -8.988  27.686  6.895   1.00 40.52  ? 370  PRO A CA  1 
ATOM   2443 C  C   . PRO A 1 370 ? -10.440 28.099  7.121   1.00 44.09  ? 370  PRO A C   1 
ATOM   2444 O  O   . PRO A 1 370 ? -11.024 27.766  8.152   1.00 44.10  ? 370  PRO A O   1 
ATOM   2445 C  CB  . PRO A 1 370 ? -8.052  28.817  7.341   1.00 38.77  ? 370  PRO A CB  1 
ATOM   2446 C  CG  . PRO A 1 370 ? -6.948  28.820  6.349   1.00 37.20  ? 370  PRO A CG  1 
ATOM   2447 C  CD  . PRO A 1 370 ? -7.581  28.427  5.055   1.00 39.68  ? 370  PRO A CD  1 
ATOM   2448 N  N   . ASP A 1 371 ? -11.010 28.821  6.162   1.00 51.43  ? 371  ASP A N   1 
ATOM   2449 C  CA  . ASP A 1 371 ? -12.386 29.298  6.267   1.00 55.30  ? 371  ASP A CA  1 
ATOM   2450 C  C   . ASP A 1 371 ? -13.403 28.183  6.031   1.00 53.73  ? 371  ASP A C   1 
ATOM   2451 O  O   . ASP A 1 371 ? -14.569 28.309  6.404   1.00 56.94  ? 371  ASP A O   1 
ATOM   2452 C  CB  . ASP A 1 371 ? -12.630 30.457  5.294   1.00 68.83  ? 371  ASP A CB  1 
ATOM   2453 C  CG  . ASP A 1 371 ? -12.136 30.157  3.891   1.00 74.35  ? 371  ASP A CG  1 
ATOM   2454 O  OD1 . ASP A 1 371 ? -11.556 29.071  3.680   1.00 79.13  ? 371  ASP A OD1 1 
ATOM   2455 O  OD2 . ASP A 1 371 ? -12.324 31.010  2.997   1.00 72.97  ? 371  ASP A OD2 1 
ATOM   2456 N  N   . LYS A 1 372 ? -12.956 27.097  5.409   1.00 49.55  ? 372  LYS A N   1 
ATOM   2457 C  CA  . LYS A 1 372 ? -13.819 25.948  5.156   1.00 40.17  ? 372  LYS A CA  1 
ATOM   2458 C  C   . LYS A 1 372 ? -13.325 24.723  5.918   1.00 42.54  ? 372  LYS A C   1 
ATOM   2459 O  O   . LYS A 1 372 ? -13.495 23.589  5.470   1.00 48.04  ? 372  LYS A O   1 
ATOM   2460 C  CB  . LYS A 1 372 ? -13.889 25.646  3.659   1.00 43.45  ? 372  LYS A CB  1 
ATOM   2461 C  CG  . LYS A 1 372 ? -14.258 26.841  2.797   1.00 47.74  ? 372  LYS A CG  1 
ATOM   2462 C  CD  . LYS A 1 372 ? -14.138 26.510  1.319   1.00 50.31  ? 372  LYS A CD  1 
ATOM   2463 C  CE  . LYS A 1 372 ? -14.299 27.753  0.460   1.00 56.33  ? 372  LYS A CE  1 
ATOM   2464 N  NZ  . LYS A 1 372 ? -14.105 27.459  -0.986  1.00 57.46  ? 372  LYS A NZ  1 
ATOM   2465 N  N   . LEU A 1 373 ? -12.712 24.964  7.073   1.00 43.74  ? 373  LEU A N   1 
ATOM   2466 C  CA  . LEU A 1 373 ? -12.193 23.894  7.916   1.00 38.36  ? 373  LEU A CA  1 
ATOM   2467 C  C   . LEU A 1 373 ? -12.721 24.072  9.336   1.00 40.52  ? 373  LEU A C   1 
ATOM   2468 O  O   . LEU A 1 373 ? -12.593 25.146  9.924   1.00 42.45  ? 373  LEU A O   1 
ATOM   2469 C  CB  . LEU A 1 373 ? -10.663 23.927  7.929   1.00 31.21  ? 373  LEU A CB  1 
ATOM   2470 C  CG  . LEU A 1 373 ? -9.863  22.626  8.070   1.00 36.45  ? 373  LEU A CG  1 
ATOM   2471 C  CD1 . LEU A 1 373 ? -8.430  22.946  8.472   1.00 34.30  ? 373  LEU A CD1 1 
ATOM   2472 C  CD2 . LEU A 1 373 ? -10.484 21.654  9.062   1.00 33.36  ? 373  LEU A CD2 1 
ATOM   2473 N  N   . ARG A 1 374 ? -13.314 23.016  9.883   1.00 32.99  ? 374  ARG A N   1 
ATOM   2474 C  CA  . ARG A 1 374 ? -13.804 23.047  11.254  1.00 42.38  ? 374  ARG A CA  1 
ATOM   2475 C  C   . ARG A 1 374 ? -13.470 21.748  11.976  1.00 40.27  ? 374  ARG A C   1 
ATOM   2476 O  O   . ARG A 1 374 ? -13.137 20.744  11.346  1.00 39.57  ? 374  ARG A O   1 
ATOM   2477 C  CB  . ARG A 1 374 ? -15.316 23.273  11.281  1.00 40.99  ? 374  ARG A CB  1 
ATOM   2478 C  CG  . ARG A 1 374 ? -16.126 22.013  11.030  1.00 38.94  ? 374  ARG A CG  1 
ATOM   2479 C  CD  . ARG A 1 374 ? -17.607 22.312  10.935  1.00 41.61  ? 374  ARG A CD  1 
ATOM   2480 N  NE  . ARG A 1 374 ? -18.383 21.101  10.687  1.00 43.21  ? 374  ARG A NE  1 
ATOM   2481 C  CZ  . ARG A 1 374 ? -19.675 21.090  10.380  1.00 46.22  ? 374  ARG A CZ  1 
ATOM   2482 N  NH1 . ARG A 1 374 ? -20.346 22.230  10.278  1.00 45.10  ? 374  ARG A NH1 1 
ATOM   2483 N  NH2 . ARG A 1 374 ? -20.299 19.939  10.172  1.00 49.97  ? 374  ARG A NH2 1 
ATOM   2484 N  N   . PHE A 1 375 ? -13.566 21.775  13.300  1.00 42.72  ? 375  PHE A N   1 
ATOM   2485 C  CA  . PHE A 1 375 ? -13.357 20.582  14.106  1.00 39.65  ? 375  PHE A CA  1 
ATOM   2486 C  C   . PHE A 1 375 ? -14.617 20.256  14.897  1.00 40.24  ? 375  PHE A C   1 
ATOM   2487 O  O   . PHE A 1 375 ? -15.008 21.004  15.792  1.00 41.12  ? 375  PHE A O   1 
ATOM   2488 C  CB  . PHE A 1 375 ? -12.165 20.768  15.043  1.00 40.19  ? 375  PHE A CB  1 
ATOM   2489 C  CG  . PHE A 1 375 ? -10.835 20.654  14.356  1.00 43.68  ? 375  PHE A CG  1 
ATOM   2490 C  CD1 . PHE A 1 375 ? -10.306 21.724  13.652  1.00 40.77  ? 375  PHE A CD1 1 
ATOM   2491 C  CD2 . PHE A 1 375 ? -10.114 19.472  14.412  1.00 44.49  ? 375  PHE A CD2 1 
ATOM   2492 C  CE1 . PHE A 1 375 ? -9.082  21.618  13.018  1.00 40.48  ? 375  PHE A CE1 1 
ATOM   2493 C  CE2 . PHE A 1 375 ? -8.888  19.359  13.781  1.00 41.49  ? 375  PHE A CE2 1 
ATOM   2494 C  CZ  . PHE A 1 375 ? -8.372  20.434  13.083  1.00 40.70  ? 375  PHE A CZ  1 
ATOM   2495 N  N   . ARG A 1 376 ? -15.252 19.140  14.555  1.00 45.20  ? 376  ARG A N   1 
ATOM   2496 C  CA  . ARG A 1 376 ? -16.512 18.761  15.184  1.00 46.80  ? 376  ARG A CA  1 
ATOM   2497 C  C   . ARG A 1 376 ? -16.332 17.674  16.235  1.00 49.13  ? 376  ARG A C   1 
ATOM   2498 O  O   . ARG A 1 376 ? -15.828 16.588  15.948  1.00 43.27  ? 376  ARG A O   1 
ATOM   2499 C  CB  . ARG A 1 376 ? -17.527 18.299  14.136  1.00 43.45  ? 376  ARG A CB  1 
ATOM   2500 C  CG  . ARG A 1 376 ? -18.968 18.489  14.572  1.00 41.34  ? 376  ARG A CG  1 
ATOM   2501 C  CD  . ARG A 1 376 ? -19.948 17.739  13.686  1.00 41.51  ? 376  ARG A CD  1 
ATOM   2502 N  NE  . ARG A 1 376 ? -20.300 16.437  14.245  1.00 44.34  ? 376  ARG A NE  1 
ATOM   2503 C  CZ  . ARG A 1 376 ? -19.844 15.276  13.788  1.00 45.14  ? 376  ARG A CZ  1 
ATOM   2504 N  NH1 . ARG A 1 376 ? -19.016 15.246  12.755  1.00 51.56  ? 376  ARG A NH1 1 
ATOM   2505 N  NH2 . ARG A 1 376 ? -20.220 14.142  14.363  1.00 46.55  ? 376  ARG A NH2 1 
ATOM   2506 N  N   . GLN A 1 377 ? -16.750 17.982  17.456  1.00 53.68  ? 377  GLN A N   1 
ATOM   2507 C  CA  . GLN A 1 377 ? -16.770 17.015  18.539  1.00 53.22  ? 377  GLN A CA  1 
ATOM   2508 C  C   . GLN A 1 377 ? -18.098 16.282  18.478  1.00 49.91  ? 377  GLN A C   1 
ATOM   2509 O  O   . GLN A 1 377 ? -19.144 16.925  18.411  1.00 54.72  ? 377  GLN A O   1 
ATOM   2510 C  CB  . GLN A 1 377 ? -16.654 17.752  19.874  1.00 52.30  ? 377  GLN A CB  1 
ATOM   2511 C  CG  . GLN A 1 377 ? -16.776 16.885  21.114  1.00 51.24  ? 377  GLN A CG  1 
ATOM   2512 C  CD  . GLN A 1 377 ? -16.865 17.711  22.387  1.00 50.17  ? 377  GLN A CD  1 
ATOM   2513 O  OE1 . GLN A 1 377 ? -17.554 18.732  22.431  1.00 47.15  ? 377  GLN A OE1 1 
ATOM   2514 N  NE2 . GLN A 1 377 ? -16.169 17.272  23.428  1.00 49.77  ? 377  GLN A NE2 1 
ATOM   2515 N  N   . HIS A 1 378 ? -18.090 14.951  18.485  1.00 55.89  ? 378  HIS A N   1 
ATOM   2516 C  CA  . HIS A 1 378 ? -19.384 14.279  18.590  1.00 69.54  ? 378  HIS A CA  1 
ATOM   2517 C  C   . HIS A 1 378 ? -19.858 13.913  19.991  1.00 80.86  ? 378  HIS A C   1 
ATOM   2518 O  O   . HIS A 1 378 ? -19.123 14.021  20.977  1.00 88.39  ? 378  HIS A O   1 
ATOM   2519 C  CB  . HIS A 1 378 ? -19.642 13.157  17.566  1.00 71.35  ? 378  HIS A CB  1 
ATOM   2520 C  CG  . HIS A 1 378 ? -18.416 12.476  17.049  1.00 70.80  ? 378  HIS A CG  1 
ATOM   2521 N  ND1 . HIS A 1 378 ? -17.958 11.282  17.561  1.00 68.49  ? 378  HIS A ND1 1 
ATOM   2522 C  CD2 . HIS A 1 378 ? -17.594 12.786  16.020  1.00 68.80  ? 378  HIS A CD2 1 
ATOM   2523 C  CE1 . HIS A 1 378 ? -16.887 10.901  16.889  1.00 65.10  ? 378  HIS A CE1 1 
ATOM   2524 N  NE2 . HIS A 1 378 ? -16.644 11.797  15.949  1.00 66.32  ? 378  HIS A NE2 1 
ATOM   2525 N  N   . MET A 1 379 ? -21.113 13.472  20.036  1.00 91.20  ? 379  MET A N   1 
ATOM   2526 C  CA  . MET A 1 379 ? -21.953 13.722  21.205  1.00 98.67  ? 379  MET A CA  1 
ATOM   2527 C  C   . MET A 1 379 ? -22.960 12.598  21.424  1.00 105.55 ? 379  MET A C   1 
ATOM   2528 O  O   . MET A 1 379 ? -24.069 12.618  20.881  1.00 112.56 ? 379  MET A O   1 
ATOM   2529 C  CB  . MET A 1 379 ? -22.706 15.061  21.000  1.00 98.85  ? 379  MET A CB  1 
ATOM   2530 C  CG  . MET A 1 379 ? -24.135 14.841  20.366  1.00 99.06  ? 379  MET A CG  1 
ATOM   2531 S  SD  . MET A 1 379 ? -24.545 16.115  19.125  1.00 96.31  ? 379  MET A SD  1 
ATOM   2532 C  CE  . MET A 1 379 ? -26.295 15.711  18.843  1.00 97.97  ? 379  MET A CE  1 
ATOM   2533 N  N   . GLU A 1 380 ? -22.563 11.616  22.227  1.00 110.21 ? 380  GLU A N   1 
ATOM   2534 C  CA  . GLU A 1 380 ? -23.428 10.488  22.550  1.00 109.92 ? 380  GLU A CA  1 
ATOM   2535 C  C   . GLU A 1 380 ? -23.945 9.816   21.279  1.00 108.10 ? 380  GLU A C   1 
ATOM   2536 O  O   . GLU A 1 380 ? -25.137 9.529   21.155  1.00 102.90 ? 380  GLU A O   1 
ATOM   2537 C  CB  . GLU A 1 380 ? -24.597 10.941  23.433  1.00 114.30 ? 380  GLU A CB  1 
ATOM   2538 C  CG  . GLU A 1 380 ? -24.222 11.974  24.497  1.00 116.43 ? 380  GLU A CG  1 
ATOM   2539 C  CD  . GLU A 1 380 ? -23.132 11.491  25.437  1.00 117.02 ? 380  GLU A CD  1 
ATOM   2540 O  OE1 . GLU A 1 380 ? -22.310 12.326  25.871  1.00 116.43 ? 380  GLU A OE1 1 
ATOM   2541 O  OE2 . GLU A 1 380 ? -23.095 10.280  25.744  1.00 118.19 ? 380  GLU A OE2 1 
ATOM   2542 N  N   . ASN A 1 381 ? -23.037 9.575   20.336  1.00 109.51 ? 381  ASN A N   1 
ATOM   2543 C  CA  . ASN A 1 381 ? -23.393 8.936   19.073  1.00 106.94 ? 381  ASN A CA  1 
ATOM   2544 C  C   . ASN A 1 381 ? -22.275 8.045   18.539  1.00 101.43 ? 381  ASN A C   1 
ATOM   2545 O  O   . ASN A 1 381 ? -21.389 7.630   19.286  1.00 94.77  ? 381  ASN A O   1 
ATOM   2546 C  CB  . ASN A 1 381 ? -23.801 9.985   18.028  1.00 109.32 ? 381  ASN A CB  1 
ATOM   2547 C  CG  . ASN A 1 381 ? -22.635 10.452  17.169  1.00 108.98 ? 381  ASN A CG  1 
ATOM   2548 O  OD1 . ASN A 1 381 ? -22.245 11.619  17.215  1.00 106.70 ? 381  ASN A OD1 1 
ATOM   2549 N  ND2 . ASN A 1 381 ? -22.081 9.544   16.373  1.00 110.17 ? 381  ASN A ND2 1 
ATOM   2550 N  N   . ALA A 1 387 ? -17.150 6.711   26.670  1.00 114.29 ? 387  ALA A N   1 
ATOM   2551 C  CA  . ALA A 1 387 ? -16.851 5.925   25.479  1.00 112.02 ? 387  ALA A CA  1 
ATOM   2552 C  C   . ALA A 1 387 ? -15.645 6.490   24.735  1.00 108.74 ? 387  ALA A C   1 
ATOM   2553 O  O   . ALA A 1 387 ? -14.602 5.841   24.645  1.00 111.06 ? 387  ALA A O   1 
ATOM   2554 C  CB  . ALA A 1 387 ? -18.066 5.863   24.564  1.00 111.01 ? 387  ALA A CB  1 
ATOM   2555 N  N   . CYS A 1 388 ? -15.794 7.702   24.208  1.00 100.32 ? 388  CYS A N   1 
ATOM   2556 C  CA  . CYS A 1 388 ? -14.721 8.350   23.461  1.00 88.53  ? 388  CYS A CA  1 
ATOM   2557 C  C   . CYS A 1 388 ? -14.973 9.841   23.256  1.00 78.88  ? 388  CYS A C   1 
ATOM   2558 O  O   . CYS A 1 388 ? -16.090 10.260  22.949  1.00 73.50  ? 388  CYS A O   1 
ATOM   2559 C  CB  . CYS A 1 388 ? -14.520 7.662   22.108  1.00 96.70  ? 388  CYS A CB  1 
ATOM   2560 S  SG  . CYS A 1 388 ? -16.044 7.421   21.165  1.00 109.33 ? 388  CYS A SG  1 
ATOM   2561 N  N   . ASP A 1 389 ? -13.922 10.634  23.435  1.00 73.42  ? 389  ASP A N   1 
ATOM   2562 C  CA  . ASP A 1 389 ? -13.972 12.064  23.164  1.00 57.52  ? 389  ASP A CA  1 
ATOM   2563 C  C   . ASP A 1 389 ? -13.297 12.326  21.823  1.00 54.54  ? 389  ASP A C   1 
ATOM   2564 O  O   . ASP A 1 389 ? -12.078 12.479  21.750  1.00 49.55  ? 389  ASP A O   1 
ATOM   2565 C  CB  . ASP A 1 389 ? -13.266 12.841  24.276  1.00 54.91  ? 389  ASP A CB  1 
ATOM   2566 C  CG  . ASP A 1 389 ? -13.489 14.339  24.178  1.00 55.98  ? 389  ASP A CG  1 
ATOM   2567 O  OD1 . ASP A 1 389 ? -14.408 14.764  23.446  1.00 55.28  ? 389  ASP A OD1 1 
ATOM   2568 O  OD2 . ASP A 1 389 ? -12.745 15.093  24.841  1.00 55.87  ? 389  ASP A OD2 1 
ATOM   2569 N  N   . CYS A 1 390 ? -14.096 12.370  20.762  1.00 48.98  ? 390  CYS A N   1 
ATOM   2570 C  CA  . CYS A 1 390 ? -13.560 12.497  19.415  1.00 50.86  ? 390  CYS A CA  1 
ATOM   2571 C  C   . CYS A 1 390 ? -13.819 13.873  18.821  1.00 49.96  ? 390  CYS A C   1 
ATOM   2572 O  O   . CYS A 1 390 ? -14.929 14.398  18.905  1.00 53.90  ? 390  CYS A O   1 
ATOM   2573 C  CB  . CYS A 1 390 ? -14.162 11.430  18.499  1.00 58.86  ? 390  CYS A CB  1 
ATOM   2574 S  SG  . CYS A 1 390 ? -14.356 9.802   19.258  1.00 75.02  ? 390  CYS A SG  1 
ATOM   2575 N  N   . TRP A 1 391 ? -12.782 14.452  18.225  1.00 45.40  ? 391  TRP A N   1 
ATOM   2576 C  CA  . TRP A 1 391 ? -12.928 15.657  17.422  1.00 44.13  ? 391  TRP A CA  1 
ATOM   2577 C  C   . TRP A 1 391 ? -12.582 15.323  15.980  1.00 42.13  ? 391  TRP A C   1 
ATOM   2578 O  O   . TRP A 1 391 ? -11.477 14.867  15.691  1.00 56.36  ? 391  TRP A O   1 
ATOM   2579 C  CB  . TRP A 1 391 ? -12.014 16.771  17.933  1.00 39.02  ? 391  TRP A CB  1 
ATOM   2580 C  CG  . TRP A 1 391 ? -12.486 17.413  19.200  1.00 40.11  ? 391  TRP A CG  1 
ATOM   2581 C  CD1 . TRP A 1 391 ? -12.254 16.979  20.473  1.00 41.65  ? 391  TRP A CD1 1 
ATOM   2582 C  CD2 . TRP A 1 391 ? -13.265 18.611  19.320  1.00 38.19  ? 391  TRP A CD2 1 
ATOM   2583 N  NE1 . TRP A 1 391 ? -12.842 17.830  21.377  1.00 40.80  ? 391  TRP A NE1 1 
ATOM   2584 C  CE2 . TRP A 1 391 ? -13.468 18.840  20.695  1.00 38.25  ? 391  TRP A CE2 1 
ATOM   2585 C  CE3 . TRP A 1 391 ? -13.810 19.510  18.398  1.00 39.44  ? 391  TRP A CE3 1 
ATOM   2586 C  CZ2 . TRP A 1 391 ? -14.193 19.932  21.172  1.00 36.74  ? 391  TRP A CZ2 1 
ATOM   2587 C  CZ3 . TRP A 1 391 ? -14.530 20.594  18.874  1.00 40.80  ? 391  TRP A CZ3 1 
ATOM   2588 C  CH2 . TRP A 1 391 ? -14.715 20.794  20.248  1.00 39.57  ? 391  TRP A CH2 1 
ATOM   2589 N  N   . ASP A 1 392 ? -13.531 15.541  15.077  1.00 41.25  ? 392  ASP A N   1 
ATOM   2590 C  CA  . ASP A 1 392 ? -13.313 15.244  13.668  1.00 34.75  ? 392  ASP A CA  1 
ATOM   2591 C  C   . ASP A 1 392 ? -13.001 16.501  12.873  1.00 37.50  ? 392  ASP A C   1 
ATOM   2592 O  O   . ASP A 1 392 ? -13.769 17.463  12.889  1.00 35.39  ? 392  ASP A O   1 
ATOM   2593 C  CB  . ASP A 1 392 ? -14.534 14.541  13.067  1.00 42.22  ? 392  ASP A CB  1 
ATOM   2594 C  CG  . ASP A 1 392 ? -14.640 13.091  13.493  1.00 47.30  ? 392  ASP A CG  1 
ATOM   2595 O  OD1 . ASP A 1 392 ? -13.722 12.601  14.183  1.00 50.46  ? 392  ASP A OD1 1 
ATOM   2596 O  OD2 . ASP A 1 392 ? -15.643 12.439  13.134  1.00 48.67  ? 392  ASP A OD2 1 
ATOM   2597 N  N   . ALA A 1 393 ? -11.865 16.492  12.184  1.00 36.90  ? 393  ALA A N   1 
ATOM   2598 C  CA  . ALA A 1 393 ? -11.550 17.557  11.249  1.00 32.83  ? 393  ALA A CA  1 
ATOM   2599 C  C   . ALA A 1 393 ? -12.473 17.411  10.051  1.00 34.06  ? 393  ALA A C   1 
ATOM   2600 O  O   . ALA A 1 393 ? -12.451 16.395  9.358   1.00 45.43  ? 393  ALA A O   1 
ATOM   2601 C  CB  . ALA A 1 393 ? -10.099 17.481  10.819  1.00 35.58  ? 393  ALA A CB  1 
ATOM   2602 N  N   . GLU A 1 394 ? -13.302 18.422  9.827   1.00 35.96  ? 394  GLU A N   1 
ATOM   2603 C  CA  . GLU A 1 394 ? -14.248 18.398  8.722   1.00 39.90  ? 394  GLU A CA  1 
ATOM   2604 C  C   . GLU A 1 394 ? -14.000 19.553  7.765   1.00 36.80  ? 394  GLU A C   1 
ATOM   2605 O  O   . GLU A 1 394 ? -13.711 20.673  8.188   1.00 45.02  ? 394  GLU A O   1 
ATOM   2606 C  CB  . GLU A 1 394 ? -15.686 18.444  9.240   1.00 39.98  ? 394  GLU A CB  1 
ATOM   2607 C  CG  . GLU A 1 394 ? -16.107 17.204  10.010  1.00 47.83  ? 394  GLU A CG  1 
ATOM   2608 C  CD  . GLU A 1 394 ? -17.545 17.273  10.486  1.00 53.78  ? 394  GLU A CD  1 
ATOM   2609 O  OE1 . GLU A 1 394 ? -18.042 18.393  10.728  1.00 54.98  ? 394  GLU A OE1 1 
ATOM   2610 O  OE2 . GLU A 1 394 ? -18.178 16.204  10.621  1.00 58.52  ? 394  GLU A OE2 1 
ATOM   2611 N  N   . SER A 1 395 ? -14.110 19.270  6.473   1.00 33.23  ? 395  SER A N   1 
ATOM   2612 C  CA  . SER A 1 395 ? -13.940 20.290  5.450   1.00 37.14  ? 395  SER A CA  1 
ATOM   2613 C  C   . SER A 1 395 ? -15.239 20.468  4.681   1.00 44.10  ? 395  SER A C   1 
ATOM   2614 O  O   . SER A 1 395 ? -15.990 19.510  4.489   1.00 37.33  ? 395  SER A O   1 
ATOM   2615 C  CB  . SER A 1 395 ? -12.818 19.900  4.489   1.00 42.96  ? 395  SER A CB  1 
ATOM   2616 O  OG  . SER A 1 395 ? -13.166 18.746  3.743   1.00 43.59  ? 395  SER A OG  1 
ATOM   2617 N  N   . LYS A 1 396 ? -15.505 21.695  4.246   1.00 46.75  ? 396  LYS A N   1 
ATOM   2618 C  CA  . LYS A 1 396 ? -16.720 21.979  3.494   1.00 51.67  ? 396  LYS A CA  1 
ATOM   2619 C  C   . LYS A 1 396 ? -16.493 21.835  1.994   1.00 46.68  ? 396  LYS A C   1 
ATOM   2620 O  O   . LYS A 1 396 ? -15.654 22.523  1.413   1.00 39.49  ? 396  LYS A O   1 
ATOM   2621 C  CB  . LYS A 1 396 ? -17.255 23.374  3.819   1.00 52.94  ? 396  LYS A CB  1 
ATOM   2622 C  CG  . LYS A 1 396 ? -18.660 23.616  3.290   1.00 62.23  ? 396  LYS A CG  1 
ATOM   2623 C  CD  . LYS A 1 396 ? -19.121 25.041  3.536   1.00 64.02  ? 396  LYS A CD  1 
ATOM   2624 C  CE  . LYS A 1 396 ? -20.540 25.243  3.025   1.00 67.71  ? 396  LYS A CE  1 
ATOM   2625 N  NZ  . LYS A 1 396 ? -21.017 26.637  3.241   1.00 72.26  ? 396  LYS A NZ  1 
ATOM   2626 N  N   . THR A 1 397 ? -17.250 20.935  1.375   1.00 46.22  ? 397  THR A N   1 
ATOM   2627 C  CA  . THR A 1 397 ? -17.144 20.689  -0.058  1.00 49.11  ? 397  THR A CA  1 
ATOM   2628 C  C   . THR A 1 397 ? -18.507 20.822  -0.731  1.00 50.87  ? 397  THR A C   1 
ATOM   2629 O  O   . THR A 1 397 ? -19.485 21.218  -0.096  1.00 51.00  ? 397  THR A O   1 
ATOM   2630 C  CB  . THR A 1 397 ? -16.579 19.283  -0.347  1.00 46.25  ? 397  THR A CB  1 
ATOM   2631 O  OG1 . THR A 1 397 ? -17.433 18.291  0.236   1.00 43.80  ? 397  THR A OG1 1 
ATOM   2632 C  CG2 . THR A 1 397 ? -15.176 19.138  0.227   1.00 44.50  ? 397  THR A CG2 1 
ATOM   2633 N  N   . SER A 1 398 ? -18.564 20.489  -2.017  1.00 45.61  ? 398  SER A N   1 
ATOM   2634 C  CA  . SER A 1 398 ? -19.819 20.520  -2.762  1.00 44.66  ? 398  SER A CA  1 
ATOM   2635 C  C   . SER A 1 398 ? -20.765 19.428  -2.271  1.00 42.78  ? 398  SER A C   1 
ATOM   2636 O  O   . SER A 1 398 ? -21.952 19.427  -2.600  1.00 45.99  ? 398  SER A O   1 
ATOM   2637 C  CB  . SER A 1 398 ? -19.560 20.360  -4.261  1.00 42.18  ? 398  SER A CB  1 
ATOM   2638 O  OG  . SER A 1 398 ? -19.019 19.083  -4.552  1.00 50.75  ? 398  SER A OG  1 
ATOM   2639 N  N   . TYR A 1 399 ? -20.228 18.501  -1.484  1.00 40.35  ? 399  TYR A N   1 
ATOM   2640 C  CA  . TYR A 1 399 ? -21.023 17.439  -0.880  1.00 45.52  ? 399  TYR A CA  1 
ATOM   2641 C  C   . TYR A 1 399 ? -21.435 17.825  0.537   1.00 49.58  ? 399  TYR A C   1 
ATOM   2642 O  O   . TYR A 1 399 ? -22.109 17.060  1.227   1.00 49.46  ? 399  TYR A O   1 
ATOM   2643 C  CB  . TYR A 1 399 ? -20.230 16.132  -0.841  1.00 45.15  ? 399  TYR A CB  1 
ATOM   2644 C  CG  . TYR A 1 399 ? -19.808 15.612  -2.197  1.00 46.54  ? 399  TYR A CG  1 
ATOM   2645 C  CD1 . TYR A 1 399 ? -18.609 16.014  -2.776  1.00 45.81  ? 399  TYR A CD1 1 
ATOM   2646 C  CD2 . TYR A 1 399 ? -20.602 14.710  -2.894  1.00 39.77  ? 399  TYR A CD2 1 
ATOM   2647 C  CE1 . TYR A 1 399 ? -18.217 15.537  -4.012  1.00 44.10  ? 399  TYR A CE1 1 
ATOM   2648 C  CE2 . TYR A 1 399 ? -20.218 14.228  -4.131  1.00 42.35  ? 399  TYR A CE2 1 
ATOM   2649 C  CZ  . TYR A 1 399 ? -19.026 14.644  -4.685  1.00 44.55  ? 399  TYR A CZ  1 
ATOM   2650 O  OH  . TYR A 1 399 ? -18.640 14.166  -5.917  1.00 45.21  ? 399  TYR A OH  1 
ATOM   2651 N  N   . GLY A 1 400 ? -21.022 19.014  0.965   1.00 43.25  ? 400  GLY A N   1 
ATOM   2652 C  CA  . GLY A 1 400 ? -21.269 19.466  2.328   1.00 43.11  ? 400  GLY A CA  1 
ATOM   2653 C  C   . GLY A 1 400 ? -20.050 19.246  3.202   1.00 44.72  ? 400  GLY A C   1 
ATOM   2654 O  O   . GLY A 1 400 ? -18.933 19.117  2.700   1.00 49.14  ? 400  GLY A O   1 
ATOM   2655 N  N   . TRP A 1 401 ? -20.260 19.205  4.513   1.00 36.62  ? 401  TRP A N   1 
ATOM   2656 C  CA  . TRP A 1 401 ? -19.169 18.968  5.448   1.00 38.00  ? 401  TRP A CA  1 
ATOM   2657 C  C   . TRP A 1 401 ? -18.825 17.483  5.520   1.00 43.75  ? 401  TRP A C   1 
ATOM   2658 O  O   . TRP A 1 401 ? -19.660 16.659  5.891   1.00 43.62  ? 401  TRP A O   1 
ATOM   2659 C  CB  . TRP A 1 401 ? -19.514 19.510  6.837   1.00 38.42  ? 401  TRP A CB  1 
ATOM   2660 C  CG  . TRP A 1 401 ? -19.552 21.008  6.899   1.00 40.94  ? 401  TRP A CG  1 
ATOM   2661 C  CD1 . TRP A 1 401 ? -20.644 21.809  6.727   1.00 42.33  ? 401  TRP A CD1 1 
ATOM   2662 C  CD2 . TRP A 1 401 ? -18.446 21.886  7.146   1.00 41.80  ? 401  TRP A CD2 1 
ATOM   2663 N  NE1 . TRP A 1 401 ? -20.288 23.130  6.852   1.00 38.57  ? 401  TRP A NE1 1 
ATOM   2664 C  CE2 . TRP A 1 401 ? -18.944 23.205  7.110   1.00 41.15  ? 401  TRP A CE2 1 
ATOM   2665 C  CE3 . TRP A 1 401 ? -17.084 21.686  7.394   1.00 41.96  ? 401  TRP A CE3 1 
ATOM   2666 C  CZ2 . TRP A 1 401 ? -18.128 24.318  7.313   1.00 39.18  ? 401  TRP A CZ2 1 
ATOM   2667 C  CZ3 . TRP A 1 401 ? -16.275 22.793  7.595   1.00 41.78  ? 401  TRP A CZ3 1 
ATOM   2668 C  CH2 . TRP A 1 401 ? -16.801 24.091  7.555   1.00 39.72  ? 401  TRP A CH2 1 
ATOM   2669 N  N   . ILE A 1 402 ? -17.590 17.152  5.155   1.00 43.88  ? 402  ILE A N   1 
ATOM   2670 C  CA  . ILE A 1 402 ? -17.130 15.768  5.160   1.00 34.60  ? 402  ILE A CA  1 
ATOM   2671 C  C   . ILE A 1 402 ? -16.023 15.552  6.190   1.00 32.92  ? 402  ILE A C   1 
ATOM   2672 O  O   . ILE A 1 402 ? -15.186 16.426  6.409   1.00 36.36  ? 402  ILE A O   1 
ATOM   2673 C  CB  . ILE A 1 402 ? -16.621 15.337  3.770   1.00 35.72  ? 402  ILE A CB  1 
ATOM   2674 C  CG1 . ILE A 1 402 ? -15.491 16.261  3.305   1.00 39.01  ? 402  ILE A CG1 1 
ATOM   2675 C  CG2 . ILE A 1 402 ? -17.761 15.338  2.762   1.00 32.56  ? 402  ILE A CG2 1 
ATOM   2676 C  CD1 . ILE A 1 402 ? -14.738 15.753  2.098   1.00 39.70  ? 402  ILE A CD1 1 
ATOM   2677 N  N   . GLU A 1 403 ? -16.029 14.381  6.818   1.00 37.03  ? 403  GLU A N   1 
ATOM   2678 C  CA  . GLU A 1 403 ? -15.012 14.026  7.802   1.00 39.89  ? 403  GLU A CA  1 
ATOM   2679 C  C   . GLU A 1 403 ? -13.731 13.576  7.104   1.00 40.29  ? 403  GLU A C   1 
ATOM   2680 O  O   . GLU A 1 403 ? -13.701 12.523  6.465   1.00 41.50  ? 403  GLU A O   1 
ATOM   2681 C  CB  . GLU A 1 403 ? -15.539 12.929  8.733   1.00 37.50  ? 403  GLU A CB  1 
ATOM   2682 C  CG  . GLU A 1 403 ? -14.597 12.546  9.865   1.00 49.73  ? 403  GLU A CG  1 
ATOM   2683 C  CD  . GLU A 1 403 ? -13.644 11.429  9.486   1.00 59.18  ? 403  GLU A CD  1 
ATOM   2684 O  OE1 . GLU A 1 403 ? -12.503 11.423  9.993   1.00 66.85  ? 403  GLU A OE1 1 
ATOM   2685 O  OE2 . GLU A 1 403 ? -14.035 10.556  8.683   1.00 66.70  ? 403  GLU A OE2 1 
ATOM   2686 N  N   . ILE A 1 404 ? -12.675 14.375  7.228   1.00 36.61  ? 404  ILE A N   1 
ATOM   2687 C  CA  . ILE A 1 404 ? -11.411 14.077  6.555   1.00 37.04  ? 404  ILE A CA  1 
ATOM   2688 C  C   . ILE A 1 404 ? -10.331 13.554  7.503   1.00 35.03  ? 404  ILE A C   1 
ATOM   2689 O  O   . ILE A 1 404 ? -9.461  12.786  7.094   1.00 36.41  ? 404  ILE A O   1 
ATOM   2690 C  CB  . ILE A 1 404 ? -10.876 15.294  5.765   1.00 34.39  ? 404  ILE A CB  1 
ATOM   2691 C  CG1 . ILE A 1 404 ? -10.639 16.484  6.699   1.00 28.66  ? 404  ILE A CG1 1 
ATOM   2692 C  CG2 . ILE A 1 404 ? -11.839 15.665  4.645   1.00 30.04  ? 404  ILE A CG2 1 
ATOM   2693 C  CD1 . ILE A 1 404 ? -10.115 17.718  6.001   1.00 22.52  ? 404  ILE A CD1 1 
ATOM   2694 N  N   . VAL A 1 405 ? -10.385 13.973  8.764   1.00 31.48  ? 405  VAL A N   1 
ATOM   2695 C  CA  . VAL A 1 405 ? -9.444  13.489  9.772   1.00 30.70  ? 405  VAL A CA  1 
ATOM   2696 C  C   . VAL A 1 405 ? -10.132 13.299  11.121  1.00 33.75  ? 405  VAL A C   1 
ATOM   2697 O  O   . VAL A 1 405 ? -10.646 14.253  11.705  1.00 40.27  ? 405  VAL A O   1 
ATOM   2698 C  CB  . VAL A 1 405 ? -8.244  14.445  9.958   1.00 29.55  ? 405  VAL A CB  1 
ATOM   2699 C  CG1 . VAL A 1 405 ? -7.279  13.891  10.997  1.00 24.28  ? 405  VAL A CG1 1 
ATOM   2700 C  CG2 . VAL A 1 405 ? -7.528  14.678  8.639   1.00 38.09  ? 405  VAL A CG2 1 
ATOM   2701 N  N   . GLY A 1 406 ? -10.142 12.063  11.608  1.00 31.17  ? 406  GLY A N   1 
ATOM   2702 C  CA  . GLY A 1 406 ? -10.693 11.769  12.924  1.00 35.97  ? 406  GLY A CA  1 
ATOM   2703 C  C   . GLY A 1 406 ? -9.618  11.827  13.990  1.00 44.38  ? 406  GLY A C   1 
ATOM   2704 O  O   . GLY A 1 406 ? -8.502  11.354  13.780  1.00 51.24  ? 406  GLY A O   1 
ATOM   2705 N  N   . CYS A 1 407 ? -9.948  12.417  15.134  1.00 38.16  ? 407  CYS A N   1 
ATOM   2706 C  CA  . CYS A 1 407 ? -9.012  12.498  16.251  1.00 38.05  ? 407  CYS A CA  1 
ATOM   2707 C  C   . CYS A 1 407 ? -9.726  12.176  17.558  1.00 41.66  ? 407  CYS A C   1 
ATOM   2708 O  O   . CYS A 1 407 ? -10.414 13.024  18.128  1.00 39.67  ? 407  CYS A O   1 
ATOM   2709 C  CB  . CYS A 1 407 ? -8.367  13.884  16.320  1.00 38.17  ? 407  CYS A CB  1 
ATOM   2710 S  SG  . CYS A 1 407 ? -6.977  13.998  17.470  1.00 43.65  ? 407  CYS A SG  1 
ATOM   2711 N  N   . ALA A 1 408 ? -9.554  10.946  18.028  1.00 36.49  ? 408  ALA A N   1 
ATOM   2712 C  CA  . ALA A 1 408 ? -10.281 10.466  19.194  1.00 34.86  ? 408  ALA A CA  1 
ATOM   2713 C  C   . ALA A 1 408 ? -9.409  10.385  20.442  1.00 38.53  ? 408  ALA A C   1 
ATOM   2714 O  O   . ALA A 1 408 ? -8.297  9.860   20.403  1.00 36.29  ? 408  ALA A O   1 
ATOM   2715 C  CB  . ALA A 1 408 ? -10.904 9.110   18.900  1.00 38.23  ? 408  ALA A CB  1 
ATOM   2716 N  N   . ASP A 1 409 ? -9.925  10.917  21.546  1.00 45.84  ? 409  ASP A N   1 
ATOM   2717 C  CA  . ASP A 1 409 ? -9.303  10.739  22.850  1.00 50.28  ? 409  ASP A CA  1 
ATOM   2718 C  C   . ASP A 1 409 ? -10.044 9.613   23.560  1.00 57.79  ? 409  ASP A C   1 
ATOM   2719 O  O   . ASP A 1 409 ? -11.258 9.686   23.754  1.00 59.00  ? 409  ASP A O   1 
ATOM   2720 C  CB  . ASP A 1 409 ? -9.374  12.030  23.666  1.00 52.92  ? 409  ASP A CB  1 
ATOM   2721 C  CG  . ASP A 1 409 ? -8.563  11.959  24.947  1.00 57.28  ? 409  ASP A CG  1 
ATOM   2722 O  OD1 . ASP A 1 409 ? -8.029  10.874  25.264  1.00 54.31  ? 409  ASP A OD1 1 
ATOM   2723 O  OD2 . ASP A 1 409 ? -8.459  12.993  25.640  1.00 62.90  ? 409  ASP A OD2 1 
ATOM   2724 N  N   . ARG A 1 410 ? -9.315  8.573   23.947  1.00 66.14  ? 410  ARG A N   1 
ATOM   2725 C  CA  . ARG A 1 410 ? -9.951  7.354   24.427  1.00 74.30  ? 410  ARG A CA  1 
ATOM   2726 C  C   . ARG A 1 410 ? -9.338  6.834   25.724  1.00 77.80  ? 410  ARG A C   1 
ATOM   2727 O  O   . ARG A 1 410 ? -8.139  6.562   25.792  1.00 73.88  ? 410  ARG A O   1 
ATOM   2728 C  CB  . ARG A 1 410 ? -9.878  6.278   23.341  1.00 82.24  ? 410  ARG A CB  1 
ATOM   2729 C  CG  . ARG A 1 410 ? -11.013 5.273   23.369  1.00 89.83  ? 410  ARG A CG  1 
ATOM   2730 C  CD  . ARG A 1 410 ? -11.009 4.430   22.106  1.00 95.12  ? 410  ARG A CD  1 
ATOM   2731 N  NE  . ARG A 1 410 ? -11.146 5.251   20.906  1.00 99.90  ? 410  ARG A NE  1 
ATOM   2732 C  CZ  . ARG A 1 410 ? -10.927 4.814   19.670  1.00 102.22 ? 410  ARG A CZ  1 
ATOM   2733 N  NH1 . ARG A 1 410 ? -10.552 3.558   19.463  1.00 103.10 ? 410  ARG A NH1 1 
ATOM   2734 N  NH2 . ARG A 1 410 ? -11.079 5.634   18.639  1.00 102.53 ? 410  ARG A NH2 1 
ATOM   2735 N  N   . SER A 1 411 ? -10.174 6.698   26.749  1.00 88.12  ? 411  SER A N   1 
ATOM   2736 C  CA  . SER A 1 411 ? -9.748  6.136   28.025  1.00 96.73  ? 411  SER A CA  1 
ATOM   2737 C  C   . SER A 1 411 ? -9.760  4.611   27.952  1.00 103.00 ? 411  SER A C   1 
ATOM   2738 O  O   . SER A 1 411 ? -8.728  3.964   28.134  1.00 103.65 ? 411  SER A O   1 
ATOM   2739 C  CB  . SER A 1 411 ? -10.654 6.622   29.158  1.00 96.76  ? 411  SER A CB  1 
ATOM   2740 O  OG  . SER A 1 411 ? -10.638 8.036   29.252  1.00 97.65  ? 411  SER A OG  1 
ATOM   2741 N  N   . CYS A 1 412 ? -10.934 4.046   27.685  1.00 112.06 ? 412  CYS A N   1 
ATOM   2742 C  CA  . CYS A 1 412 ? -11.068 2.609   27.466  1.00 118.19 ? 412  CYS A CA  1 
ATOM   2743 C  C   . CYS A 1 412 ? -11.028 2.315   25.971  1.00 121.80 ? 412  CYS A C   1 
ATOM   2744 O  O   . CYS A 1 412 ? -11.915 2.731   25.225  1.00 120.09 ? 412  CYS A O   1 
ATOM   2745 C  CB  . CYS A 1 412 ? -12.369 2.087   28.078  1.00 118.29 ? 412  CYS A CB  1 
ATOM   2746 S  SG  . CYS A 1 412 ? -12.442 2.206   29.879  1.00 120.32 ? 412  CYS A SG  1 
ATOM   2747 N  N   . TYR A 1 413 ? -9.999  1.593   25.540  1.00 126.45 ? 413  TYR A N   1 
ATOM   2748 C  CA  . TYR A 1 413 ? -9.739  1.407   24.114  1.00 128.62 ? 413  TYR A CA  1 
ATOM   2749 C  C   . TYR A 1 413 ? -9.820  -0.049  23.653  1.00 127.31 ? 413  TYR A C   1 
ATOM   2750 O  O   . TYR A 1 413 ? -10.439 -0.884  24.313  1.00 127.17 ? 413  TYR A O   1 
ATOM   2751 C  CB  . TYR A 1 413 ? -8.388  2.025   23.737  1.00 132.83 ? 413  TYR A CB  1 
ATOM   2752 C  CG  . TYR A 1 413 ? -7.241  1.580   24.615  1.00 133.84 ? 413  TYR A CG  1 
ATOM   2753 C  CD1 . TYR A 1 413 ? -7.157  1.982   25.943  1.00 133.66 ? 413  TYR A CD1 1 
ATOM   2754 C  CD2 . TYR A 1 413 ? -6.238  0.766   24.114  1.00 134.74 ? 413  TYR A CD2 1 
ATOM   2755 C  CE1 . TYR A 1 413 ? -6.111  1.575   26.747  1.00 135.24 ? 413  TYR A CE1 1 
ATOM   2756 C  CE2 . TYR A 1 413 ? -5.186  0.357   24.911  1.00 135.69 ? 413  TYR A CE2 1 
ATOM   2757 C  CZ  . TYR A 1 413 ? -5.127  0.763   26.225  1.00 135.46 ? 413  TYR A CZ  1 
ATOM   2758 O  OH  . TYR A 1 413 ? -4.078  0.353   27.015  1.00 135.48 ? 413  TYR A OH  1 
ATOM   2759 N  N   . ASP A 1 414 ? -9.189  -0.344  22.519  1.00 125.95 ? 414  ASP A N   1 
ATOM   2760 C  CA  . ASP A 1 414 ? -9.367  -1.637  21.859  1.00 124.52 ? 414  ASP A CA  1 
ATOM   2761 C  C   . ASP A 1 414 ? -8.157  -2.572  21.964  1.00 124.38 ? 414  ASP A C   1 
ATOM   2762 O  O   . ASP A 1 414 ? -8.185  -3.689  21.446  1.00 122.10 ? 414  ASP A O   1 
ATOM   2763 C  CB  . ASP A 1 414 ? -9.764  -1.435  20.394  1.00 124.54 ? 414  ASP A CB  1 
ATOM   2764 C  CG  . ASP A 1 414 ? -10.759 -2.474  19.910  1.00 124.75 ? 414  ASP A CG  1 
ATOM   2765 O  OD1 . ASP A 1 414 ? -11.030 -3.438  20.656  1.00 126.74 ? 414  ASP A OD1 1 
ATOM   2766 O  OD2 . ASP A 1 414 ? -11.276 -2.322  18.783  1.00 123.42 ? 414  ASP A OD2 1 
ATOM   2767 N  N   . LEU A 1 415 ? -7.098  -2.114  22.626  1.00 125.45 ? 415  LEU A N   1 
ATOM   2768 C  CA  . LEU A 1 415 ? -5.987  -2.993  22.981  1.00 126.09 ? 415  LEU A CA  1 
ATOM   2769 C  C   . LEU A 1 415 ? -6.413  -3.905  24.117  1.00 125.00 ? 415  LEU A C   1 
ATOM   2770 O  O   . LEU A 1 415 ? -6.044  -5.080  24.162  1.00 126.73 ? 415  LEU A O   1 
ATOM   2771 C  CB  . LEU A 1 415 ? -4.771  -2.183  23.425  1.00 127.49 ? 415  LEU A CB  1 
ATOM   2772 C  CG  . LEU A 1 415 ? -3.505  -2.237  22.576  1.00 127.95 ? 415  LEU A CG  1 
ATOM   2773 C  CD1 . LEU A 1 415 ? -2.536  -1.152  23.007  1.00 127.64 ? 415  LEU A CD1 1 
ATOM   2774 C  CD2 . LEU A 1 415 ? -2.866  -3.611  22.683  1.00 128.38 ? 415  LEU A CD2 1 
ATOM   2775 N  N   . SER A 1 416 ? -7.192  -3.343  25.036  1.00 121.62 ? 416  SER A N   1 
ATOM   2776 C  CA  . SER A 1 416 ? -7.667  -4.062  26.210  1.00 118.59 ? 416  SER A CA  1 
ATOM   2777 C  C   . SER A 1 416 ? -8.452  -5.311  25.830  1.00 115.62 ? 416  SER A C   1 
ATOM   2778 O  O   . SER A 1 416 ? -8.322  -6.353  26.469  1.00 113.39 ? 416  SER A O   1 
ATOM   2779 C  CB  . SER A 1 416 ? -8.526  -3.145  27.085  1.00 120.35 ? 416  SER A CB  1 
ATOM   2780 O  OG  . SER A 1 416 ? -9.598  -2.589  26.345  1.00 121.01 ? 416  SER A OG  1 
ATOM   2781 N  N   . CYS A 1 417 ? -9.269  -5.199  24.788  1.00 111.93 ? 417  CYS A N   1 
ATOM   2782 C  CA  . CYS A 1 417 ? -10.028 -6.338  24.295  1.00 107.91 ? 417  CYS A CA  1 
ATOM   2783 C  C   . CYS A 1 417 ? -9.105  -7.322  23.586  1.00 107.96 ? 417  CYS A C   1 
ATOM   2784 O  O   . CYS A 1 417 ? -9.180  -8.530  23.812  1.00 106.13 ? 417  CYS A O   1 
ATOM   2785 C  CB  . CYS A 1 417 ? -11.134 -5.875  23.347  1.00 104.65 ? 417  CYS A CB  1 
ATOM   2786 S  SG  . CYS A 1 417 ? -12.296 -4.698  24.072  1.00 103.92 ? 417  CYS A SG  1 
ATOM   2787 N  N   . HIS A 1 418 ? -8.227  -6.793  22.738  1.00 110.73 ? 418  HIS A N   1 
ATOM   2788 C  CA  . HIS A 1 418 ? -7.322  -7.616  21.937  1.00 112.93 ? 418  HIS A CA  1 
ATOM   2789 C  C   . HIS A 1 418 ? -6.387  -8.497  22.761  1.00 116.07 ? 418  HIS A C   1 
ATOM   2790 O  O   . HIS A 1 418 ? -6.512  -9.722  22.753  1.00 117.81 ? 418  HIS A O   1 
ATOM   2791 C  CB  . HIS A 1 418 ? -6.502  -6.746  20.981  1.00 107.78 ? 418  HIS A CB  1 
ATOM   2792 C  CG  . HIS A 1 418 ? -7.081  -6.655  19.606  1.00 106.01 ? 418  HIS A CG  1 
ATOM   2793 N  ND1 . HIS A 1 418 ? -7.253  -5.458  18.945  1.00 105.52 ? 418  HIS A ND1 1 
ATOM   2794 C  CD2 . HIS A 1 418 ? -7.536  -7.617  18.769  1.00 105.19 ? 418  HIS A CD2 1 
ATOM   2795 C  CE1 . HIS A 1 418 ? -7.784  -5.687  17.758  1.00 105.25 ? 418  HIS A CE1 1 
ATOM   2796 N  NE2 . HIS A 1 418 ? -7.966  -6.989  17.626  1.00 105.00 ? 418  HIS A NE2 1 
ATOM   2797 N  N   . ALA A 1 419 ? -5.450  -7.869  23.463  1.00 119.91 ? 419  ALA A N   1 
ATOM   2798 C  CA  . ALA A 1 419 ? -4.430  -8.598  24.210  1.00 122.81 ? 419  ALA A CA  1 
ATOM   2799 C  C   . ALA A 1 419 ? -5.008  -9.373  25.391  1.00 125.03 ? 419  ALA A C   1 
ATOM   2800 O  O   . ALA A 1 419 ? -4.470  -10.408 25.787  1.00 128.79 ? 419  ALA A O   1 
ATOM   2801 C  CB  . ALA A 1 419 ? -3.339  -7.646  24.683  1.00 122.33 ? 419  ALA A CB  1 
ATOM   2802 N  N   . ARG A 1 420 ? -6.106  -8.871  25.947  1.00 127.06 ? 420  ARG A N   1 
ATOM   2803 C  CA  . ARG A 1 420 ? -6.699  -9.458  27.144  1.00 127.45 ? 420  ARG A CA  1 
ATOM   2804 C  C   . ARG A 1 420 ? -8.073  -10.051 26.851  1.00 123.27 ? 420  ARG A C   1 
ATOM   2805 O  O   . ARG A 1 420 ? -8.219  -11.265 26.711  1.00 116.82 ? 420  ARG A O   1 
ATOM   2806 C  CB  . ARG A 1 420 ? -6.804  -8.401  28.245  1.00 132.63 ? 420  ARG A CB  1 
ATOM   2807 C  CG  . ARG A 1 420 ? -5.592  -7.485  28.320  1.00 135.37 ? 420  ARG A CG  1 
ATOM   2808 C  CD  . ARG A 1 420 ? -5.959  -6.108  28.842  1.00 137.13 ? 420  ARG A CD  1 
ATOM   2809 N  NE  . ARG A 1 420 ? -5.078  -5.078  28.294  1.00 139.91 ? 420  ARG A NE  1 
ATOM   2810 C  CZ  . ARG A 1 420 ? -5.183  -3.781  28.563  1.00 141.21 ? 420  ARG A CZ  1 
ATOM   2811 N  NH1 . ARG A 1 420 ? -6.129  -3.343  29.382  1.00 141.56 ? 420  ARG A NH1 1 
ATOM   2812 N  NH2 . ARG A 1 420 ? -4.337  -2.919  28.014  1.00 141.80 ? 420  ARG A NH2 1 
ATOM   2813 N  N   . ARG A 1 506 ? -1.997  -3.960  25.816  1.00 99.58  ? 506  ARG A N   1 
ATOM   2814 C  CA  . ARG A 1 506 ? -1.295  -4.415  27.009  1.00 97.27  ? 506  ARG A CA  1 
ATOM   2815 C  C   . ARG A 1 506 ? -1.073  -3.270  27.993  1.00 96.54  ? 506  ARG A C   1 
ATOM   2816 O  O   . ARG A 1 506 ? -1.748  -2.241  27.927  1.00 91.24  ? 506  ARG A O   1 
ATOM   2817 C  CB  . ARG A 1 506 ? 0.029   -5.064  26.632  1.00 100.50 ? 506  ARG A CB  1 
ATOM   2818 N  N   . PHE A 1 507 ? -0.123  -3.455  28.903  1.00 95.32  ? 507  PHE A N   1 
ATOM   2819 C  CA  . PHE A 1 507 ? 0.159   -2.461  29.930  1.00 93.25  ? 507  PHE A CA  1 
ATOM   2820 C  C   . PHE A 1 507 ? 1.632   -2.074  29.910  1.00 90.44  ? 507  PHE A C   1 
ATOM   2821 O  O   . PHE A 1 507 ? 2.464   -2.790  29.353  1.00 87.06  ? 507  PHE A O   1 
ATOM   2822 C  CB  . PHE A 1 507 ? -0.203  -3.003  31.315  1.00 101.37 ? 507  PHE A CB  1 
ATOM   2823 C  CG  . PHE A 1 507 ? -1.334  -3.993  31.307  1.00 102.98 ? 507  PHE A CG  1 
ATOM   2824 C  CD1 . PHE A 1 507 ? -1.082  -5.349  31.162  1.00 105.89 ? 507  PHE A CD1 1 
ATOM   2825 C  CD2 . PHE A 1 507 ? -2.646  -3.572  31.455  1.00 103.61 ? 507  PHE A CD2 1 
ATOM   2826 C  CE1 . PHE A 1 507 ? -2.118  -6.266  31.156  1.00 107.46 ? 507  PHE A CE1 1 
ATOM   2827 C  CE2 . PHE A 1 507 ? -3.686  -4.485  31.452  1.00 105.07 ? 507  PHE A CE2 1 
ATOM   2828 C  CZ  . PHE A 1 507 ? -3.421  -5.834  31.302  1.00 105.73 ? 507  PHE A CZ  1 
ATOM   2829 N  N   . GLN A 1 508 ? 1.949   -0.938  30.523  1.00 91.47  ? 508  GLN A N   1 
ATOM   2830 C  CA  . GLN A 1 508 ? 3.332   -0.501  30.655  1.00 96.11  ? 508  GLN A CA  1 
ATOM   2831 C  C   . GLN A 1 508 ? 3.702   -0.380  32.127  1.00 98.98  ? 508  GLN A C   1 
ATOM   2832 O  O   . GLN A 1 508 ? 3.027   0.310   32.890  1.00 100.35 ? 508  GLN A O   1 
ATOM   2833 C  CB  . GLN A 1 508 ? 3.542   0.818   29.943  1.00 92.70  ? 508  GLN A CB  1 
ATOM   2834 N  N   . LYS A 1 509 ? 4.776   -1.056  32.521  1.00 105.14 ? 509  LYS A N   1 
ATOM   2835 C  CA  . LYS A 1 509 ? 5.187   -1.069  33.920  1.00 109.39 ? 509  LYS A CA  1 
ATOM   2836 C  C   . LYS A 1 509 ? 5.989   0.165   34.317  1.00 111.30 ? 509  LYS A C   1 
ATOM   2837 O  O   . LYS A 1 509 ? 7.219   0.129   34.389  1.00 112.92 ? 509  LYS A O   1 
ATOM   2838 C  CB  . LYS A 1 509 ? 5.959   -2.352  34.255  1.00 111.11 ? 509  LYS A CB  1 
ATOM   2839 C  CG  . LYS A 1 509 ? 7.169   -2.623  33.370  1.00 112.63 ? 509  LYS A CG  1 
ATOM   2840 C  CD  . LYS A 1 509 ? 7.943   -3.842  33.855  1.00 111.80 ? 509  LYS A CD  1 
ATOM   2841 C  CE  . LYS A 1 509 ? 8.464   -3.645  35.271  1.00 110.22 ? 509  LYS A CE  1 
ATOM   2842 N  NZ  . LYS A 1 509 ? 9.205   -4.839  35.764  1.00 108.58 ? 509  LYS A NZ  1 
ATOM   2843 N  N   . THR A 1 510 ? 5.280   1.263   34.568  1.00 115.12 ? 510  THR A N   1 
ATOM   2844 C  CA  . THR A 1 510 ? 5.893   2.448   35.149  1.00 117.86 ? 510  THR A CA  1 
ATOM   2845 C  C   . THR A 1 510 ? 6.443   2.056   36.514  1.00 119.34 ? 510  THR A C   1 
ATOM   2846 O  O   . THR A 1 510 ? 5.767   1.382   37.292  1.00 120.83 ? 510  THR A O   1 
ATOM   2847 C  CB  . THR A 1 510 ? 4.876   3.566   35.280  1.00 116.91 ? 510  THR A CB  1 
ATOM   2848 N  N   . LEU A 1 511 ? 7.673   2.480   36.792  1.00 120.46 ? 511  LEU A N   1 
ATOM   2849 C  CA  . LEU A 1 511 ? 8.428   2.028   37.966  1.00 123.45 ? 511  LEU A CA  1 
ATOM   2850 C  C   . LEU A 1 511 ? 7.636   1.979   39.276  1.00 127.13 ? 511  LEU A C   1 
ATOM   2851 O  O   . LEU A 1 511 ? 6.695   2.748   39.478  1.00 131.14 ? 511  LEU A O   1 
ATOM   2852 C  CB  . LEU A 1 511 ? 9.689   2.872   38.139  1.00 120.61 ? 511  LEU A CB  1 
ATOM   2853 N  N   . TYR A 1 512 ? 8.044   1.069   40.159  1.00 128.57 ? 512  TYR A N   1 
ATOM   2854 C  CA  . TYR A 1 512 ? 7.414   0.872   41.468  1.00 126.49 ? 512  TYR A CA  1 
ATOM   2855 C  C   . TYR A 1 512 ? 6.288   -0.161  41.425  1.00 124.92 ? 512  TYR A C   1 
ATOM   2856 O  O   . TYR A 1 512 ? 5.404   -0.164  42.283  1.00 125.51 ? 512  TYR A O   1 
ATOM   2857 C  CB  . TYR A 1 512 ? 6.916   2.197   42.044  1.00 124.63 ? 512  TYR A CB  1 
ATOM   2858 N  N   . VAL A 1 513 ? 6.335   -1.032  40.420  1.00 121.68 ? 513  VAL A N   1 
ATOM   2859 C  CA  . VAL A 1 513 ? 5.392   -2.145  40.289  1.00 117.98 ? 513  VAL A CA  1 
ATOM   2860 C  C   . VAL A 1 513 ? 3.944   -1.705  40.067  1.00 115.18 ? 513  VAL A C   1 
ATOM   2861 O  O   . VAL A 1 513 ? 3.018   -2.275  40.646  1.00 112.86 ? 513  VAL A O   1 
ATOM   2862 C  CB  . VAL A 1 513 ? 5.493   -3.081  41.494  1.00 117.96 ? 513  VAL A CB  1 
ATOM   2863 N  N   . GLU A 1 514 ? 3.754   -0.692  39.227  1.00 111.04 ? 514  GLU A N   1 
ATOM   2864 C  CA  . GLU A 1 514 ? 2.412   -0.262  38.851  1.00 110.01 ? 514  GLU A CA  1 
ATOM   2865 C  C   . GLU A 1 514 ? 2.166   -0.497  37.366  1.00 109.23 ? 514  GLU A C   1 
ATOM   2866 O  O   . GLU A 1 514 ? 2.920   -0.017  36.518  1.00 109.80 ? 514  GLU A O   1 
ATOM   2867 C  CB  . GLU A 1 514 ? 2.188   1.214   39.192  1.00 110.12 ? 514  GLU A CB  1 
ATOM   2868 C  CG  . GLU A 1 514 ? 0.783   1.709   38.862  1.00 110.72 ? 514  GLU A CG  1 
ATOM   2869 C  CD  . GLU A 1 514 ? 0.621   3.206   39.048  1.00 111.01 ? 514  GLU A CD  1 
ATOM   2870 O  OE1 . GLU A 1 514 ? 1.567   3.856   39.541  1.00 111.00 ? 514  GLU A OE1 1 
ATOM   2871 O  OE2 . GLU A 1 514 ? -0.457  3.735   38.701  1.00 110.78 ? 514  GLU A OE2 1 
ATOM   2872 N  N   . GLU A 1 515 ? 1.110   -1.242  37.058  1.00 107.94 ? 515  GLU A N   1 
ATOM   2873 C  CA  . GLU A 1 515 ? 0.727   -1.490  35.674  1.00 106.27 ? 515  GLU A CA  1 
ATOM   2874 C  C   . GLU A 1 515 ? -0.185  -0.376  35.177  1.00 102.06 ? 515  GLU A C   1 
ATOM   2875 O  O   . GLU A 1 515 ? -1.247  -0.128  35.750  1.00 104.49 ? 515  GLU A O   1 
ATOM   2876 C  CB  . GLU A 1 515 ? 0.032   -2.845  35.540  1.00 108.97 ? 515  GLU A CB  1 
ATOM   2877 C  CG  . GLU A 1 515 ? 0.928   -4.035  35.846  1.00 112.53 ? 515  GLU A CG  1 
ATOM   2878 C  CD  . GLU A 1 515 ? 0.206   -5.361  35.705  1.00 114.00 ? 515  GLU A CD  1 
ATOM   2879 O  OE1 . GLU A 1 515 ? -1.021  -5.352  35.466  1.00 116.27 ? 515  GLU A OE1 1 
ATOM   2880 O  OE2 . GLU A 1 515 ? 0.865   -6.413  35.834  1.00 116.36 ? 515  GLU A OE2 1 
ATOM   2881 N  N   . VAL A 1 516 ? 0.238   0.295   34.111  1.00 94.87  ? 516  VAL A N   1 
ATOM   2882 C  CA  . VAL A 1 516 ? -0.509  1.426   33.576  1.00 84.87  ? 516  VAL A CA  1 
ATOM   2883 C  C   . VAL A 1 516 ? -1.231  1.067   32.282  1.00 84.01  ? 516  VAL A C   1 
ATOM   2884 O  O   . VAL A 1 516 ? -0.610  0.619   31.318  1.00 81.43  ? 516  VAL A O   1 
ATOM   2885 C  CB  . VAL A 1 516 ? 0.411   2.637   33.320  1.00 82.19  ? 516  VAL A CB  1 
ATOM   2886 C  CG1 . VAL A 1 516 ? -0.384  3.802   32.751  1.00 81.99  ? 516  VAL A CG1 1 
ATOM   2887 C  CG2 . VAL A 1 516 ? 1.120   3.047   34.601  1.00 85.51  ? 516  VAL A CG2 1 
ATOM   2888 N  N   . VAL A 1 517 ? -2.547  1.254   32.278  1.00 82.83  ? 517  VAL A N   1 
ATOM   2889 C  CA  . VAL A 1 517 ? -3.339  1.140   31.062  1.00 77.13  ? 517  VAL A CA  1 
ATOM   2890 C  C   . VAL A 1 517 ? -3.372  2.519   30.413  1.00 73.72  ? 517  VAL A C   1 
ATOM   2891 O  O   . VAL A 1 517 ? -4.112  3.399   30.856  1.00 80.89  ? 517  VAL A O   1 
ATOM   2892 C  CB  . VAL A 1 517 ? -4.776  0.676   31.361  1.00 77.49  ? 517  VAL A CB  1 
ATOM   2893 C  CG1 . VAL A 1 517 ? -5.551  0.479   30.070  1.00 77.68  ? 517  VAL A CG1 1 
ATOM   2894 C  CG2 . VAL A 1 517 ? -4.760  -0.608  32.177  1.00 78.81  ? 517  VAL A CG2 1 
ATOM   2895 N  N   . PRO A 1 518 ? -2.561  2.714   29.363  1.00 66.39  ? 518  PRO A N   1 
ATOM   2896 C  CA  . PRO A 1 518 ? -2.367  4.040   28.786  1.00 58.23  ? 518  PRO A CA  1 
ATOM   2897 C  C   . PRO A 1 518 ? -3.576  4.552   28.011  1.00 51.00  ? 518  PRO A C   1 
ATOM   2898 O  O   . PRO A 1 518 ? -4.208  3.796   27.276  1.00 54.13  ? 518  PRO A O   1 
ATOM   2899 C  CB  . PRO A 1 518 ? -1.185  3.834   27.834  1.00 57.25  ? 518  PRO A CB  1 
ATOM   2900 C  CG  . PRO A 1 518 ? -1.261  2.402   27.449  1.00 57.80  ? 518  PRO A CG  1 
ATOM   2901 C  CD  . PRO A 1 518 ? -1.782  1.680   28.657  1.00 61.85  ? 518  PRO A CD  1 
ATOM   2902 N  N   . ASN A 1 519 ? -3.894  5.831   28.190  1.00 52.23  ? 519  ASN A N   1 
ATOM   2903 C  CA  . ASN A 1 519 ? -4.873  6.495   27.342  1.00 57.23  ? 519  ASN A CA  1 
ATOM   2904 C  C   . ASN A 1 519 ? -4.305  6.625   25.937  1.00 59.69  ? 519  ASN A C   1 
ATOM   2905 O  O   . ASN A 1 519 ? -3.087  6.668   25.757  1.00 60.05  ? 519  ASN A O   1 
ATOM   2906 C  CB  . ASN A 1 519 ? -5.220  7.880   27.890  1.00 63.33  ? 519  ASN A CB  1 
ATOM   2907 C  CG  . ASN A 1 519 ? -6.198  7.825   29.046  1.00 64.94  ? 519  ASN A CG  1 
ATOM   2908 O  OD1 . ASN A 1 519 ? -6.619  6.749   29.469  1.00 68.68  ? 519  ASN A OD1 1 
ATOM   2909 N  ND2 . ASN A 1 519 ? -6.567  8.991   29.564  1.00 62.56  ? 519  ASN A ND2 1 
ATOM   2910 N  N   . VAL A 1 520 ? -5.179  6.684   24.941  1.00 52.29  ? 520  VAL A N   1 
ATOM   2911 C  CA  . VAL A 1 520 ? -4.717  6.745   23.561  1.00 49.45  ? 520  VAL A CA  1 
ATOM   2912 C  C   . VAL A 1 520 ? -5.411  7.832   22.739  1.00 50.68  ? 520  VAL A C   1 
ATOM   2913 O  O   . VAL A 1 520 ? -6.639  7.878   22.649  1.00 44.93  ? 520  VAL A O   1 
ATOM   2914 C  CB  . VAL A 1 520 ? -4.849  5.374   22.859  1.00 44.25  ? 520  VAL A CB  1 
ATOM   2915 C  CG1 . VAL A 1 520 ? -6.312  4.990   22.694  1.00 47.37  ? 520  VAL A CG1 1 
ATOM   2916 C  CG2 . VAL A 1 520 ? -4.140  5.395   21.518  1.00 43.38  ? 520  VAL A CG2 1 
ATOM   2917 N  N   . ILE A 1 521 ? -4.609  8.715   22.152  1.00 48.33  ? 521  ILE A N   1 
ATOM   2918 C  CA  . ILE A 1 521 ? -5.112  9.676   21.181  1.00 46.63  ? 521  ILE A CA  1 
ATOM   2919 C  C   . ILE A 1 521 ? -4.770  9.158   19.793  1.00 43.71  ? 521  ILE A C   1 
ATOM   2920 O  O   . ILE A 1 521 ? -3.602  8.914   19.486  1.00 42.98  ? 521  ILE A O   1 
ATOM   2921 C  CB  . ILE A 1 521 ? -4.504  11.080  21.378  1.00 40.39  ? 521  ILE A CB  1 
ATOM   2922 C  CG1 . ILE A 1 521 ? -5.136  11.778  22.584  1.00 41.05  ? 521  ILE A CG1 1 
ATOM   2923 C  CG2 . ILE A 1 521 ? -4.712  11.933  20.138  1.00 42.87  ? 521  ILE A CG2 1 
ATOM   2924 C  CD1 . ILE A 1 521 ? -4.706  11.218  23.915  1.00 40.55  ? 521  ILE A CD1 1 
ATOM   2925 N  N   . GLU A 1 522 ? -5.788  8.970   18.960  1.00 38.61  ? 522  GLU A N   1 
ATOM   2926 C  CA  . GLU A 1 522 ? -5.567  8.420   17.629  1.00 41.99  ? 522  GLU A CA  1 
ATOM   2927 C  C   . GLU A 1 522 ? -6.105  9.305   16.506  1.00 34.70  ? 522  GLU A C   1 
ATOM   2928 O  O   . GLU A 1 522 ? -7.276  9.210   16.137  1.00 34.35  ? 522  GLU A O   1 
ATOM   2929 C  CB  . GLU A 1 522 ? -6.136  7.000   17.520  1.00 56.48  ? 522  GLU A CB  1 
ATOM   2930 C  CG  . GLU A 1 522 ? -7.649  6.907   17.611  1.00 68.99  ? 522  GLU A CG  1 
ATOM   2931 C  CD  . GLU A 1 522 ? -8.182  5.595   17.068  1.00 76.55  ? 522  GLU A CD  1 
ATOM   2932 O  OE1 . GLU A 1 522 ? -7.702  4.528   17.507  1.00 79.68  ? 522  GLU A OE1 1 
ATOM   2933 O  OE2 . GLU A 1 522 ? -9.086  5.631   16.206  1.00 76.66  ? 522  GLU A OE2 1 
ATOM   2934 N  N   . PRO A 1 523 ? -5.247  10.182  15.966  1.00 31.08  ? 523  PRO A N   1 
ATOM   2935 C  CA  . PRO A 1 523 ? -5.593  10.906  14.749  1.00 32.10  ? 523  PRO A CA  1 
ATOM   2936 C  C   . PRO A 1 523 ? -5.507  9.999   13.521  1.00 33.66  ? 523  PRO A C   1 
ATOM   2937 O  O   . PRO A 1 523 ? -4.457  9.414   13.252  1.00 38.35  ? 523  PRO A O   1 
ATOM   2938 C  CB  . PRO A 1 523 ? -4.537  12.013  14.681  1.00 25.71  ? 523  PRO A CB  1 
ATOM   2939 C  CG  . PRO A 1 523 ? -3.384  11.498  15.452  1.00 32.64  ? 523  PRO A CG  1 
ATOM   2940 C  CD  . PRO A 1 523 ? -3.922  10.555  16.490  1.00 29.79  ? 523  PRO A CD  1 
ATOM   2941 N  N   . SER A 1 524 ? -6.615  9.880   12.795  1.00 30.96  ? 524  SER A N   1 
ATOM   2942 C  CA  . SER A 1 524 ? -6.678  9.042   11.603  1.00 30.08  ? 524  SER A CA  1 
ATOM   2943 C  C   . SER A 1 524 ? -6.995  9.885   10.373  1.00 31.31  ? 524  SER A C   1 
ATOM   2944 O  O   . SER A 1 524 ? -7.993  10.604  10.344  1.00 33.88  ? 524  SER A O   1 
ATOM   2945 C  CB  . SER A 1 524 ? -7.735  7.952   11.776  1.00 34.92  ? 524  SER A CB  1 
ATOM   2946 O  OG  . SER A 1 524 ? -9.002  8.519   12.057  1.00 43.79  ? 524  SER A OG  1 
ATOM   2947 N  N   . PHE A 1 525 ? -6.148  9.782   9.353   1.00 35.43  ? 525  PHE A N   1 
ATOM   2948 C  CA  . PHE A 1 525 ? -6.246  10.650  8.184   1.00 30.93  ? 525  PHE A CA  1 
ATOM   2949 C  C   . PHE A 1 525 ? -6.836  9.947   6.966   1.00 26.12  ? 525  PHE A C   1 
ATOM   2950 O  O   . PHE A 1 525 ? -6.323  8.921   6.524   1.00 33.04  ? 525  PHE A O   1 
ATOM   2951 C  CB  . PHE A 1 525 ? -4.867  11.217  7.836   1.00 27.49  ? 525  PHE A CB  1 
ATOM   2952 C  CG  . PHE A 1 525 ? -4.268  12.063  8.921   1.00 28.03  ? 525  PHE A CG  1 
ATOM   2953 C  CD1 . PHE A 1 525 ? -3.770  11.482  10.078  1.00 29.81  ? 525  PHE A CD1 1 
ATOM   2954 C  CD2 . PHE A 1 525 ? -4.199  13.440  8.785   1.00 22.81  ? 525  PHE A CD2 1 
ATOM   2955 C  CE1 . PHE A 1 525 ? -3.220  12.259  11.080  1.00 30.41  ? 525  PHE A CE1 1 
ATOM   2956 C  CE2 . PHE A 1 525 ? -3.649  14.222  9.782   1.00 27.97  ? 525  PHE A CE2 1 
ATOM   2957 C  CZ  . PHE A 1 525 ? -3.159  13.630  10.932  1.00 27.95  ? 525  PHE A CZ  1 
ATOM   2958 N  N   . ARG A 1 526 ? -7.916  10.507  6.428   1.00 27.33  ? 526  ARG A N   1 
ATOM   2959 C  CA  . ARG A 1 526 ? -8.499  10.017  5.183   1.00 31.01  ? 526  ARG A CA  1 
ATOM   2960 C  C   . ARG A 1 526 ? -7.825  10.715  4.006   1.00 32.87  ? 526  ARG A C   1 
ATOM   2961 O  O   . ARG A 1 526 ? -8.341  11.701  3.475   1.00 26.21  ? 526  ARG A O   1 
ATOM   2962 C  CB  . ARG A 1 526 ? -10.009 10.266  5.155   1.00 37.54  ? 526  ARG A CB  1 
ATOM   2963 C  CG  . ARG A 1 526 ? -10.799 9.459   6.173   1.00 43.91  ? 526  ARG A CG  1 
ATOM   2964 C  CD  . ARG A 1 526 ? -10.743 7.970   5.866   1.00 50.61  ? 526  ARG A CD  1 
ATOM   2965 N  NE  . ARG A 1 526 ? -11.318 7.655   4.561   1.00 55.90  ? 526  ARG A NE  1 
ATOM   2966 C  CZ  . ARG A 1 526 ? -12.581 7.290   4.366   1.00 56.67  ? 526  ARG A CZ  1 
ATOM   2967 N  NH1 . ARG A 1 526 ? -13.415 7.191   5.393   1.00 57.59  ? 526  ARG A NH1 1 
ATOM   2968 N  NH2 . ARG A 1 526 ? -13.012 7.024   3.141   1.00 55.51  ? 526  ARG A NH2 1 
ATOM   2969 N  N   . LEU A 1 527 ? -6.673  10.186  3.601   1.00 28.27  ? 527  LEU A N   1 
ATOM   2970 C  CA  . LEU A 1 527 ? -5.803  10.843  2.623   1.00 26.15  ? 527  LEU A CA  1 
ATOM   2971 C  C   . LEU A 1 527 ? -6.476  11.181  1.292   1.00 26.92  ? 527  LEU A C   1 
ATOM   2972 O  O   . LEU A 1 527 ? -6.220  12.236  0.711   1.00 33.13  ? 527  LEU A O   1 
ATOM   2973 C  CB  . LEU A 1 527 ? -4.539  10.011  2.386   1.00 24.02  ? 527  LEU A CB  1 
ATOM   2974 C  CG  . LEU A 1 527 ? -3.575  9.930   3.572   1.00 25.72  ? 527  LEU A CG  1 
ATOM   2975 C  CD1 . LEU A 1 527 ? -2.432  8.976   3.277   1.00 23.31  ? 527  LEU A CD1 1 
ATOM   2976 C  CD2 . LEU A 1 527 ? -3.044  11.311  3.929   1.00 26.31  ? 527  LEU A CD2 1 
ATOM   2977 N  N   . GLY A 1 528 ? -7.330  10.282  0.812   1.00 26.20  ? 528  GLY A N   1 
ATOM   2978 C  CA  . GLY A 1 528 ? -8.030  10.488  -0.453  1.00 24.17  ? 528  GLY A CA  1 
ATOM   2979 C  C   . GLY A 1 528 ? -9.034  11.622  -0.390  1.00 31.71  ? 528  GLY A C   1 
ATOM   2980 O  O   . GLY A 1 528 ? -9.150  12.413  -1.328  1.00 29.16  ? 528  GLY A O   1 
ATOM   2981 N  N   . ARG A 1 529 ? -9.767  11.698  0.719   1.00 27.26  ? 529  ARG A N   1 
ATOM   2982 C  CA  . ARG A 1 529 ? -10.707 12.794  0.944   1.00 33.62  ? 529  ARG A CA  1 
ATOM   2983 C  C   . ARG A 1 529 ? -9.960  14.107  1.144   1.00 34.00  ? 529  ARG A C   1 
ATOM   2984 O  O   . ARG A 1 529 ? -10.384 15.153  0.654   1.00 33.56  ? 529  ARG A O   1 
ATOM   2985 C  CB  . ARG A 1 529 ? -11.586 12.510  2.160   1.00 35.54  ? 529  ARG A CB  1 
ATOM   2986 C  CG  . ARG A 1 529 ? -12.595 11.400  1.957   1.00 35.69  ? 529  ARG A CG  1 
ATOM   2987 C  CD  . ARG A 1 529 ? -13.411 11.188  3.216   1.00 38.16  ? 529  ARG A CD  1 
ATOM   2988 N  NE  . ARG A 1 529 ? -14.414 10.143  3.049   1.00 45.59  ? 529  ARG A NE  1 
ATOM   2989 C  CZ  . ARG A 1 529 ? -15.205 9.706   4.023   1.00 47.06  ? 529  ARG A CZ  1 
ATOM   2990 N  NH1 . ARG A 1 529 ? -15.111 10.225  5.241   1.00 43.19  ? 529  ARG A NH1 1 
ATOM   2991 N  NH2 . ARG A 1 529 ? -16.090 8.748   3.781   1.00 48.73  ? 529  ARG A NH2 1 
ATOM   2992 N  N   . ILE A 1 530 ? -8.851  14.043  1.876   1.00 26.05  ? 530  ILE A N   1 
ATOM   2993 C  CA  . ILE A 1 530 ? -7.980  15.195  2.051   1.00 30.33  ? 530  ILE A CA  1 
ATOM   2994 C  C   . ILE A 1 530 ? -7.533  15.695  0.684   1.00 36.77  ? 530  ILE A C   1 
ATOM   2995 O  O   . ILE A 1 530 ? -7.571  16.894  0.404   1.00 40.80  ? 530  ILE A O   1 
ATOM   2996 C  CB  . ILE A 1 530 ? -6.739  14.845  2.898   1.00 29.41  ? 530  ILE A CB  1 
ATOM   2997 C  CG1 . ILE A 1 530 ? -7.142  14.547  4.343   1.00 27.50  ? 530  ILE A CG1 1 
ATOM   2998 C  CG2 . ILE A 1 530 ? -5.724  15.980  2.860   1.00 28.40  ? 530  ILE A CG2 1 
ATOM   2999 C  CD1 . ILE A 1 530 ? -6.008  14.015  5.194   1.00 26.59  ? 530  ILE A CD1 1 
ATOM   3000 N  N   . MET A 1 531 ? -7.125  14.761  -0.168  1.00 42.07  ? 531  MET A N   1 
ATOM   3001 C  CA  . MET A 1 531 ? -6.681  15.087  -1.516  1.00 42.05  ? 531  MET A CA  1 
ATOM   3002 C  C   . MET A 1 531 ? -7.801  15.735  -2.323  1.00 37.84  ? 531  MET A C   1 
ATOM   3003 O  O   . MET A 1 531 ? -7.581  16.733  -3.009  1.00 30.96  ? 531  MET A O   1 
ATOM   3004 C  CB  . MET A 1 531 ? -6.182  13.832  -2.229  1.00 44.48  ? 531  MET A CB  1 
ATOM   3005 C  CG  . MET A 1 531 ? -5.260  14.109  -3.403  1.00 51.96  ? 531  MET A CG  1 
ATOM   3006 S  SD  . MET A 1 531 ? -4.727  12.591  -4.213  1.00 58.79  ? 531  MET A SD  1 
ATOM   3007 C  CE  . MET A 1 531 ? -4.472  11.532  -2.791  1.00 58.43  ? 531  MET A CE  1 
ATOM   3008 N  N   . TYR A 1 532 ? -9.000  15.166  -2.237  1.00 38.35  ? 532  TYR A N   1 
ATOM   3009 C  CA  . TYR A 1 532 ? -10.143 15.701  -2.970  1.00 32.34  ? 532  TYR A CA  1 
ATOM   3010 C  C   . TYR A 1 532 ? -10.539 17.084  -2.466  1.00 33.73  ? 532  TYR A C   1 
ATOM   3011 O  O   . TYR A 1 532 ? -10.933 17.951  -3.247  1.00 28.73  ? 532  TYR A O   1 
ATOM   3012 C  CB  . TYR A 1 532 ? -11.343 14.758  -2.897  1.00 36.82  ? 532  TYR A CB  1 
ATOM   3013 C  CG  . TYR A 1 532 ? -12.533 15.273  -3.673  1.00 37.15  ? 532  TYR A CG  1 
ATOM   3014 C  CD1 . TYR A 1 532 ? -12.581 15.162  -5.057  1.00 36.91  ? 532  TYR A CD1 1 
ATOM   3015 C  CD2 . TYR A 1 532 ? -13.600 15.885  -3.026  1.00 32.26  ? 532  TYR A CD2 1 
ATOM   3016 C  CE1 . TYR A 1 532 ? -13.661 15.638  -5.776  1.00 38.18  ? 532  TYR A CE1 1 
ATOM   3017 C  CE2 . TYR A 1 532 ? -14.684 16.365  -3.737  1.00 38.18  ? 532  TYR A CE2 1 
ATOM   3018 C  CZ  . TYR A 1 532 ? -14.710 16.239  -5.112  1.00 39.49  ? 532  TYR A CZ  1 
ATOM   3019 O  OH  . TYR A 1 532 ? -15.786 16.713  -5.827  1.00 39.46  ? 532  TYR A OH  1 
ATOM   3020 N  N   . THR A 1 533 ? -10.438 17.281  -1.156  1.00 32.63  ? 533  THR A N   1 
ATOM   3021 C  CA  . THR A 1 533 ? -10.742 18.571  -0.555  1.00 28.68  ? 533  THR A CA  1 
ATOM   3022 C  C   . THR A 1 533 ? -9.817  19.638  -1.121  1.00 33.95  ? 533  THR A C   1 
ATOM   3023 O  O   . THR A 1 533 ? -10.245 20.760  -1.395  1.00 35.86  ? 533  THR A O   1 
ATOM   3024 C  CB  . THR A 1 533 ? -10.598 18.529  0.974   1.00 34.24  ? 533  THR A CB  1 
ATOM   3025 O  OG1 . THR A 1 533 ? -11.490 17.544  1.510   1.00 33.90  ? 533  THR A OG1 1 
ATOM   3026 C  CG2 . THR A 1 533 ? -10.924 19.890  1.576   1.00 27.56  ? 533  THR A CG2 1 
ATOM   3027 N  N   . VAL A 1 534 ? -8.549  19.278  -1.303  1.00 36.10  ? 534  VAL A N   1 
ATOM   3028 C  CA  . VAL A 1 534 ? -7.581  20.181  -1.915  1.00 36.69  ? 534  VAL A CA  1 
ATOM   3029 C  C   . VAL A 1 534 ? -8.021  20.570  -3.325  1.00 35.51  ? 534  VAL A C   1 
ATOM   3030 O  O   . VAL A 1 534 ? -7.918  21.732  -3.709  1.00 46.65  ? 534  VAL A O   1 
ATOM   3031 C  CB  . VAL A 1 534 ? -6.163  19.571  -1.953  1.00 32.69  ? 534  VAL A CB  1 
ATOM   3032 C  CG1 . VAL A 1 534 ? -5.205  20.495  -2.685  1.00 26.97  ? 534  VAL A CG1 1 
ATOM   3033 C  CG2 . VAL A 1 534 ? -5.664  19.307  -0.544  1.00 29.72  ? 534  VAL A CG2 1 
ATOM   3034 N  N   . PHE A 1 535 ? -8.523  19.602  -4.087  1.00 33.97  ? 535  PHE A N   1 
ATOM   3035 C  CA  . PHE A 1 535 ? -9.013  19.884  -5.433  1.00 40.38  ? 535  PHE A CA  1 
ATOM   3036 C  C   . PHE A 1 535 ? -10.059 20.994  -5.412  1.00 38.38  ? 535  PHE A C   1 
ATOM   3037 O  O   . PHE A 1 535 ? -9.908  22.008  -6.089  1.00 47.68  ? 535  PHE A O   1 
ATOM   3038 C  CB  . PHE A 1 535 ? -9.600  18.632  -6.093  1.00 37.68  ? 535  PHE A CB  1 
ATOM   3039 C  CG  . PHE A 1 535 ? -8.597  17.541  -6.339  1.00 33.62  ? 535  PHE A CG  1 
ATOM   3040 C  CD1 . PHE A 1 535 ? -8.967  16.210  -6.236  1.00 32.75  ? 535  PHE A CD1 1 
ATOM   3041 C  CD2 . PHE A 1 535 ? -7.287  17.843  -6.670  1.00 34.58  ? 535  PHE A CD2 1 
ATOM   3042 C  CE1 . PHE A 1 535 ? -8.050  15.200  -6.461  1.00 31.81  ? 535  PHE A CE1 1 
ATOM   3043 C  CE2 . PHE A 1 535 ? -6.366  16.836  -6.896  1.00 35.29  ? 535  PHE A CE2 1 
ATOM   3044 C  CZ  . PHE A 1 535 ? -6.749  15.512  -6.792  1.00 31.59  ? 535  PHE A CZ  1 
ATOM   3045 N  N   . GLU A 1 536 ? -11.111 20.799  -4.622  1.00 45.57  ? 536  GLU A N   1 
ATOM   3046 C  CA  . GLU A 1 536 ? -12.221 21.751  -4.568  1.00 40.23  ? 536  GLU A CA  1 
ATOM   3047 C  C   . GLU A 1 536 ? -11.814 23.124  -4.038  1.00 35.61  ? 536  GLU A C   1 
ATOM   3048 O  O   . GLU A 1 536 ? -12.263 24.150  -4.549  1.00 44.10  ? 536  GLU A O   1 
ATOM   3049 C  CB  . GLU A 1 536 ? -13.378 21.194  -3.735  1.00 39.21  ? 536  GLU A CB  1 
ATOM   3050 C  CG  . GLU A 1 536 ? -14.121 20.045  -4.394  1.00 47.07  ? 536  GLU A CG  1 
ATOM   3051 C  CD  . GLU A 1 536 ? -15.581 19.983  -3.985  1.00 52.25  ? 536  GLU A CD  1 
ATOM   3052 O  OE1 . GLU A 1 536 ? -16.298 19.084  -4.473  1.00 51.62  ? 536  GLU A OE1 1 
ATOM   3053 O  OE2 . GLU A 1 536 ? -16.014 20.837  -3.184  1.00 55.67  ? 536  GLU A OE2 1 
ATOM   3054 N  N   . HIS A 1 537 ? -10.962 23.137  -3.019  1.00 34.17  ? 537  HIS A N   1 
ATOM   3055 C  CA  . HIS A 1 537 ? -10.561 24.378  -2.360  1.00 38.31  ? 537  HIS A CA  1 
ATOM   3056 C  C   . HIS A 1 537 ? -9.502  25.134  -3.149  1.00 39.35  ? 537  HIS A C   1 
ATOM   3057 O  O   . HIS A 1 537 ? -9.244  26.311  -2.896  1.00 47.30  ? 537  HIS A O   1 
ATOM   3058 C  CB  . HIS A 1 537 ? -10.019 24.073  -0.965  1.00 32.24  ? 537  HIS A CB  1 
ATOM   3059 C  CG  . HIS A 1 537 ? -11.069 23.656  0.013   1.00 34.05  ? 537  HIS A CG  1 
ATOM   3060 N  ND1 . HIS A 1 537 ? -10.910 23.795  1.375   1.00 35.94  ? 537  HIS A ND1 1 
ATOM   3061 C  CD2 . HIS A 1 537 ? -12.299 23.119  -0.170  1.00 30.70  ? 537  HIS A CD2 1 
ATOM   3062 C  CE1 . HIS A 1 537 ? -11.991 23.348  1.989   1.00 38.05  ? 537  HIS A CE1 1 
ATOM   3063 N  NE2 . HIS A 1 537 ? -12.850 22.935  1.074   1.00 33.86  ? 537  HIS A NE2 1 
ATOM   3064 N  N   . THR A 1 538 ? -8.893  24.448  -4.107  1.00 40.67  ? 538  THR A N   1 
ATOM   3065 C  CA  . THR A 1 538 ? -7.729  24.969  -4.807  1.00 37.67  ? 538  THR A CA  1 
ATOM   3066 C  C   . THR A 1 538 ? -8.021  25.264  -6.280  1.00 42.10  ? 538  THR A C   1 
ATOM   3067 O  O   . THR A 1 538 ? -7.277  25.990  -6.942  1.00 33.68  ? 538  THR A O   1 
ATOM   3068 C  CB  . THR A 1 538 ? -6.548  23.989  -4.659  1.00 33.64  ? 538  THR A CB  1 
ATOM   3069 O  OG1 . THR A 1 538 ? -5.717  24.407  -3.569  1.00 34.48  ? 538  THR A OG1 1 
ATOM   3070 C  CG2 . THR A 1 538 ? -5.728  23.926  -5.920  1.00 43.64  ? 538  THR A CG2 1 
ATOM   3071 N  N   . PHE A 1 539 ? -9.123  24.710  -6.775  1.00 40.43  ? 539  PHE A N   1 
ATOM   3072 C  CA  . PHE A 1 539 ? -9.522  24.872  -8.169  1.00 41.16  ? 539  PHE A CA  1 
ATOM   3073 C  C   . PHE A 1 539 ? -10.052 26.274  -8.467  1.00 47.07  ? 539  PHE A C   1 
ATOM   3074 O  O   . PHE A 1 539 ? -10.928 26.779  -7.764  1.00 53.37  ? 539  PHE A O   1 
ATOM   3075 C  CB  . PHE A 1 539 ? -10.579 23.825  -8.525  1.00 42.67  ? 539  PHE A CB  1 
ATOM   3076 C  CG  . PHE A 1 539 ? -11.077 23.916  -9.936  1.00 47.43  ? 539  PHE A CG  1 
ATOM   3077 C  CD1 . PHE A 1 539 ? -12.292 24.520  -10.217 1.00 47.48  ? 539  PHE A CD1 1 
ATOM   3078 C  CD2 . PHE A 1 539 ? -10.335 23.392  -10.983 1.00 48.64  ? 539  PHE A CD2 1 
ATOM   3079 C  CE1 . PHE A 1 539 ? -12.757 24.603  -11.517 1.00 44.41  ? 539  PHE A CE1 1 
ATOM   3080 C  CE2 . PHE A 1 539 ? -10.796 23.471  -12.284 1.00 44.32  ? 539  PHE A CE2 1 
ATOM   3081 C  CZ  . PHE A 1 539 ? -12.007 24.078  -12.551 1.00 45.28  ? 539  PHE A CZ  1 
ATOM   3082 N  N   . HIS A 1 540 ? -9.518  26.896  -9.515  1.00 50.95  ? 540  HIS A N   1 
ATOM   3083 C  CA  . HIS A 1 540 ? -9.975  28.216  -9.947  1.00 47.43  ? 540  HIS A CA  1 
ATOM   3084 C  C   . HIS A 1 540 ? -10.143 28.284  -11.462 1.00 46.52  ? 540  HIS A C   1 
ATOM   3085 O  O   . HIS A 1 540 ? -9.650  27.425  -12.193 1.00 51.46  ? 540  HIS A O   1 
ATOM   3086 C  CB  . HIS A 1 540 ? -9.002  29.309  -9.499  1.00 42.83  ? 540  HIS A CB  1 
ATOM   3087 C  CG  . HIS A 1 540 ? -8.712  29.304  -8.032  1.00 43.15  ? 540  HIS A CG  1 
ATOM   3088 N  ND1 . HIS A 1 540 ? -9.694  29.461  -7.078  1.00 45.87  ? 540  HIS A ND1 1 
ATOM   3089 C  CD2 . HIS A 1 540 ? -7.546  29.179  -7.355  1.00 42.52  ? 540  HIS A CD2 1 
ATOM   3090 C  CE1 . HIS A 1 540 ? -9.147  29.422  -5.876  1.00 43.79  ? 540  HIS A CE1 1 
ATOM   3091 N  NE2 . HIS A 1 540 ? -7.844  29.253  -6.016  1.00 43.13  ? 540  HIS A NE2 1 
ATOM   3092 N  N   . VAL A 1 541 ? -10.840 29.319  -11.923 1.00 47.44  ? 541  VAL A N   1 
ATOM   3093 C  CA  . VAL A 1 541 ? -11.023 29.556  -13.350 1.00 51.03  ? 541  VAL A CA  1 
ATOM   3094 C  C   . VAL A 1 541 ? -10.505 30.944  -13.718 1.00 52.02  ? 541  VAL A C   1 
ATOM   3095 O  O   . VAL A 1 541 ? -10.847 31.932  -13.068 1.00 55.53  ? 541  VAL A O   1 
ATOM   3096 C  CB  . VAL A 1 541 ? -12.507 29.443  -13.757 1.00 49.12  ? 541  VAL A CB  1 
ATOM   3097 C  CG1 . VAL A 1 541 ? -12.677 29.716  -15.245 1.00 50.68  ? 541  VAL A CG1 1 
ATOM   3098 C  CG2 . VAL A 1 541 ? -13.058 28.070  -13.398 1.00 47.49  ? 541  VAL A CG2 1 
ATOM   3099 N  N   . ARG A 1 542 ? -9.677  31.014  -14.756 1.00 56.84  ? 542  ARG A N   1 
ATOM   3100 C  CA  . ARG A 1 542 ? -9.133  32.291  -15.214 1.00 63.89  ? 542  ARG A CA  1 
ATOM   3101 C  C   . ARG A 1 542 ? -10.184 33.120  -15.962 1.00 69.94  ? 542  ARG A C   1 
ATOM   3102 O  O   . ARG A 1 542 ? -11.327 32.688  -16.116 1.00 75.94  ? 542  ARG A O   1 
ATOM   3103 C  CB  . ARG A 1 542 ? -7.869  32.074  -16.051 1.00 56.78  ? 542  ARG A CB  1 
ATOM   3104 C  CG  . ARG A 1 542 ? -6.638  31.758  -15.204 1.00 56.94  ? 542  ARG A CG  1 
ATOM   3105 C  CD  . ARG A 1 542 ? -5.559  31.052  -16.008 1.00 57.98  ? 542  ARG A CD  1 
ATOM   3106 N  NE  . ARG A 1 542 ? -4.340  30.765  -15.243 1.00 56.69  ? 542  ARG A NE  1 
ATOM   3107 C  CZ  . ARG A 1 542 ? -3.964  31.389  -14.129 1.00 55.56  ? 542  ARG A CZ  1 
ATOM   3108 N  NH1 . ARG A 1 542 ? -4.703  32.362  -13.614 1.00 58.41  ? 542  ARG A NH1 1 
ATOM   3109 N  NH2 . ARG A 1 542 ? -2.835  31.039  -13.528 1.00 50.25  ? 542  ARG A NH2 1 
ATOM   3110 N  N   . GLU A 1 543 ? -9.797  34.305  -16.423 1.00 81.18  ? 543  GLU A N   1 
ATOM   3111 C  CA  . GLU A 1 543 ? -10.768 35.300  -16.896 1.00 92.09  ? 543  GLU A CA  1 
ATOM   3112 C  C   . GLU A 1 543 ? -11.387 35.058  -18.279 1.00 97.41  ? 543  GLU A C   1 
ATOM   3113 O  O   . GLU A 1 543 ? -12.610 35.013  -18.411 1.00 101.47 ? 543  GLU A O   1 
ATOM   3114 C  CB  . GLU A 1 543 ? -10.174 36.710  -16.817 1.00 93.78  ? 543  GLU A CB  1 
ATOM   3115 C  CG  . GLU A 1 543 ? -10.116 37.272  -15.403 1.00 97.45  ? 543  GLU A CG  1 
ATOM   3116 C  CD  . GLU A 1 543 ? -9.487  38.651  -15.340 1.00 99.01  ? 543  GLU A CD  1 
ATOM   3117 O  OE1 . GLU A 1 543 ? -9.096  39.181  -16.402 1.00 99.15  ? 543  GLU A OE1 1 
ATOM   3118 O  OE2 . GLU A 1 543 ? -9.384  39.206  -14.225 1.00 100.77 ? 543  GLU A OE2 1 
ATOM   3119 N  N   . GLY A 1 544 ? -10.545 34.915  -19.300 1.00 100.54 ? 544  GLY A N   1 
ATOM   3120 C  CA  . GLY A 1 544 ? -11.000 34.845  -20.693 1.00 106.68 ? 544  GLY A CA  1 
ATOM   3121 C  C   . GLY A 1 544 ? -12.118 33.861  -20.996 1.00 111.45 ? 544  GLY A C   1 
ATOM   3122 O  O   . GLY A 1 544 ? -12.331 32.898  -20.258 1.00 111.21 ? 544  GLY A O   1 
ATOM   3123 N  N   . ASP A 1 545 ? -12.825 34.103  -22.098 1.00 117.44 ? 545  ASP A N   1 
ATOM   3124 C  CA  . ASP A 1 545 ? -13.950 33.260  -22.501 1.00 122.72 ? 545  ASP A CA  1 
ATOM   3125 C  C   . ASP A 1 545 ? -13.498 31.902  -23.034 1.00 123.40 ? 545  ASP A C   1 
ATOM   3126 O  O   . ASP A 1 545 ? -14.318 31.018  -23.290 1.00 121.83 ? 545  ASP A O   1 
ATOM   3127 C  CB  . ASP A 1 545 ? -14.841 33.991  -23.508 1.00 126.22 ? 545  ASP A CB  1 
ATOM   3128 C  CG  . ASP A 1 545 ? -15.521 35.208  -22.903 1.00 128.00 ? 545  ASP A CG  1 
ATOM   3129 O  OD1 . ASP A 1 545 ? -16.181 35.061  -21.851 1.00 128.03 ? 545  ASP A OD1 1 
ATOM   3130 O  OD2 . ASP A 1 545 ? -15.399 36.311  -23.482 1.00 128.85 ? 545  ASP A OD2 1 
ATOM   3131 N  N   . GLU A 1 546 ? -12.188 31.748  -23.208 1.00 125.62 ? 546  GLU A N   1 
ATOM   3132 C  CA  . GLU A 1 546 ? -11.592 30.423  -23.260 1.00 125.38 ? 546  GLU A CA  1 
ATOM   3133 C  C   . GLU A 1 546 ? -11.373 29.999  -21.818 1.00 121.15 ? 546  GLU A C   1 
ATOM   3134 O  O   . GLU A 1 546 ? -10.250 29.706  -21.407 1.00 127.26 ? 546  GLU A O   1 
ATOM   3135 C  CB  . GLU A 1 546 ? -10.272 30.424  -24.032 1.00 128.72 ? 546  GLU A CB  1 
ATOM   3136 C  CG  . GLU A 1 546 ? -10.338 29.696  -25.367 1.00 130.55 ? 546  GLU A CG  1 
ATOM   3137 C  CD  . GLU A 1 546 ? -10.622 28.207  -25.213 1.00 131.57 ? 546  GLU A CD  1 
ATOM   3138 O  OE1 . GLU A 1 546 ? -11.442 27.834  -24.347 1.00 131.83 ? 546  GLU A OE1 1 
ATOM   3139 O  OE2 . GLU A 1 546 ? -10.028 27.408  -25.967 1.00 131.58 ? 546  GLU A OE2 1 
ATOM   3140 N  N   . GLN A 1 547 ? -12.466 29.983  -21.057 1.00 114.37 ? 547  GLN A N   1 
ATOM   3141 C  CA  . GLN A 1 547 ? -12.424 29.787  -19.609 1.00 106.93 ? 547  GLN A CA  1 
ATOM   3142 C  C   . GLN A 1 547 ? -11.384 28.762  -19.177 1.00 101.50 ? 547  GLN A C   1 
ATOM   3143 O  O   . GLN A 1 547 ? -11.682 27.576  -19.030 1.00 102.03 ? 547  GLN A O   1 
ATOM   3144 C  CB  . GLN A 1 547 ? -13.812 29.426  -19.072 1.00 108.21 ? 547  GLN A CB  1 
ATOM   3145 C  CG  . GLN A 1 547 ? -14.765 30.613  -19.004 1.00 109.78 ? 547  GLN A CG  1 
ATOM   3146 C  CD  . GLN A 1 547 ? -16.111 30.258  -18.402 1.00 109.79 ? 547  GLN A CD  1 
ATOM   3147 O  OE1 . GLN A 1 547 ? -16.751 29.288  -18.810 1.00 107.63 ? 547  GLN A OE1 1 
ATOM   3148 N  NE2 . GLN A 1 547 ? -16.551 31.049  -17.430 1.00 111.15 ? 547  GLN A NE2 1 
ATOM   3149 N  N   . ARG A 1 548 ? -10.158 29.240  -18.975 1.00 89.54  ? 548  ARG A N   1 
ATOM   3150 C  CA  . ARG A 1 548 ? -9.034  28.374  -18.638 1.00 77.51  ? 548  ARG A CA  1 
ATOM   3151 C  C   . ARG A 1 548 ? -9.028  27.956  -17.174 1.00 74.07  ? 548  ARG A C   1 
ATOM   3152 O  O   . ARG A 1 548 ? -9.579  28.641  -16.312 1.00 80.47  ? 548  ARG A O   1 
ATOM   3153 C  CB  . ARG A 1 548 ? -7.707  29.037  -19.010 1.00 74.95  ? 548  ARG A CB  1 
ATOM   3154 C  CG  . ARG A 1 548 ? -7.301  28.814  -20.455 1.00 75.02  ? 548  ARG A CG  1 
ATOM   3155 C  CD  . ARG A 1 548 ? -6.035  29.574  -20.800 1.00 79.55  ? 548  ARG A CD  1 
ATOM   3156 N  NE  . ARG A 1 548 ? -5.631  29.352  -22.185 1.00 80.21  ? 548  ARG A NE  1 
ATOM   3157 C  CZ  . ARG A 1 548 ? -4.704  30.064  -22.818 1.00 79.43  ? 548  ARG A CZ  1 
ATOM   3158 N  NH1 . ARG A 1 548 ? -4.081  31.054  -22.194 1.00 75.67  ? 548  ARG A NH1 1 
ATOM   3159 N  NH2 . ARG A 1 548 ? -4.402  29.790  -24.080 1.00 80.98  ? 548  ARG A NH2 1 
ATOM   3160 N  N   . THR A 1 549 ? -8.386  26.824  -16.909 1.00 64.77  ? 549  THR A N   1 
ATOM   3161 C  CA  . THR A 1 549 ? -8.400  26.206  -15.591 1.00 57.83  ? 549  THR A CA  1 
ATOM   3162 C  C   . THR A 1 549 ? -7.006  26.117  -14.982 1.00 51.62  ? 549  THR A C   1 
ATOM   3163 O  O   . THR A 1 549 ? -6.019  25.918  -15.690 1.00 53.96  ? 549  THR A O   1 
ATOM   3164 C  CB  . THR A 1 549 ? -9.005  24.789  -15.666 1.00 57.23  ? 549  THR A CB  1 
ATOM   3165 O  OG1 . THR A 1 549 ? -10.430 24.871  -15.546 1.00 59.74  ? 549  THR A OG1 1 
ATOM   3166 C  CG2 . THR A 1 549 ? -8.462  23.906  -14.556 1.00 59.30  ? 549  THR A CG2 1 
ATOM   3167 N  N   . PHE A 1 550 ? -6.933  26.268  -13.662 1.00 48.78  ? 550  PHE A N   1 
ATOM   3168 C  CA  . PHE A 1 550 ? -5.688  26.044  -12.937 1.00 48.08  ? 550  PHE A CA  1 
ATOM   3169 C  C   . PHE A 1 550 ? -5.928  25.682  -11.474 1.00 49.74  ? 550  PHE A C   1 
ATOM   3170 O  O   . PHE A 1 550 ? -6.874  26.162  -10.849 1.00 49.12  ? 550  PHE A O   1 
ATOM   3171 C  CB  . PHE A 1 550 ? -4.759  27.258  -13.045 1.00 38.42  ? 550  PHE A CB  1 
ATOM   3172 C  CG  . PHE A 1 550 ? -5.116  28.388  -12.122 1.00 36.20  ? 550  PHE A CG  1 
ATOM   3173 C  CD1 . PHE A 1 550 ? -4.429  28.568  -10.931 1.00 36.41  ? 550  PHE A CD1 1 
ATOM   3174 C  CD2 . PHE A 1 550 ? -6.125  29.280  -12.450 1.00 38.88  ? 550  PHE A CD2 1 
ATOM   3175 C  CE1 . PHE A 1 550 ? -4.748  29.613  -10.079 1.00 37.16  ? 550  PHE A CE1 1 
ATOM   3176 C  CE2 . PHE A 1 550 ? -6.448  30.328  -11.604 1.00 33.42  ? 550  PHE A CE2 1 
ATOM   3177 C  CZ  . PHE A 1 550 ? -5.758  30.494  -10.416 1.00 33.07  ? 550  PHE A CZ  1 
ATOM   3178 N  N   . PHE A 1 551 ? -5.068  24.819  -10.943 1.00 48.29  ? 551  PHE A N   1 
ATOM   3179 C  CA  . PHE A 1 551 ? -5.096  24.470  -9.529  1.00 37.63  ? 551  PHE A CA  1 
ATOM   3180 C  C   . PHE A 1 551 ? -4.020  25.253  -8.788  1.00 33.80  ? 551  PHE A C   1 
ATOM   3181 O  O   . PHE A 1 551 ? -2.864  25.276  -9.205  1.00 39.29  ? 551  PHE A O   1 
ATOM   3182 C  CB  . PHE A 1 551 ? -4.861  22.971  -9.334  1.00 33.56  ? 551  PHE A CB  1 
ATOM   3183 C  CG  . PHE A 1 551 ? -6.057  22.117  -9.647  1.00 32.12  ? 551  PHE A CG  1 
ATOM   3184 C  CD1 . PHE A 1 551 ? -6.127  21.408  -10.835 1.00 33.56  ? 551  PHE A CD1 1 
ATOM   3185 C  CD2 . PHE A 1 551 ? -7.106  22.013  -8.748  1.00 29.35  ? 551  PHE A CD2 1 
ATOM   3186 C  CE1 . PHE A 1 551 ? -7.225  20.617  -11.125 1.00 31.71  ? 551  PHE A CE1 1 
ATOM   3187 C  CE2 . PHE A 1 551 ? -8.206  21.222  -9.031  1.00 26.09  ? 551  PHE A CE2 1 
ATOM   3188 C  CZ  . PHE A 1 551 ? -8.266  20.525  -10.221 1.00 29.78  ? 551  PHE A CZ  1 
ATOM   3189 N  N   . SER A 1 552 ? -4.399  25.891  -7.687  1.00 34.16  ? 552  SER A N   1 
ATOM   3190 C  CA  . SER A 1 552 ? -3.446  26.647  -6.884  1.00 40.68  ? 552  SER A CA  1 
ATOM   3191 C  C   . SER A 1 552 ? -2.873  25.807  -5.744  1.00 34.54  ? 552  SER A C   1 
ATOM   3192 O  O   . SER A 1 552 ? -2.944  26.201  -4.580  1.00 40.37  ? 552  SER A O   1 
ATOM   3193 C  CB  . SER A 1 552 ? -4.100  27.914  -6.329  1.00 38.84  ? 552  SER A CB  1 
ATOM   3194 O  OG  . SER A 1 552 ? -5.196  27.593  -5.491  1.00 45.66  ? 552  SER A OG  1 
ATOM   3195 N  N   . PHE A 1 553 ? -2.311  24.649  -6.081  1.00 37.53  ? 553  PHE A N   1 
ATOM   3196 C  CA  . PHE A 1 553 ? -1.661  23.798  -5.089  1.00 31.77  ? 553  PHE A CA  1 
ATOM   3197 C  C   . PHE A 1 553 ? -0.488  24.531  -4.447  1.00 28.61  ? 553  PHE A C   1 
ATOM   3198 O  O   . PHE A 1 553 ? 0.252   25.236  -5.130  1.00 38.28  ? 553  PHE A O   1 
ATOM   3199 C  CB  . PHE A 1 553 ? -1.132  22.510  -5.728  1.00 29.75  ? 553  PHE A CB  1 
ATOM   3200 C  CG  . PHE A 1 553 ? -2.188  21.657  -6.371  1.00 28.83  ? 553  PHE A CG  1 
ATOM   3201 C  CD1 . PHE A 1 553 ? -1.991  21.133  -7.639  1.00 28.44  ? 553  PHE A CD1 1 
ATOM   3202 C  CD2 . PHE A 1 553 ? -3.367  21.365  -5.708  1.00 30.72  ? 553  PHE A CD2 1 
ATOM   3203 C  CE1 . PHE A 1 553 ? -2.952  20.338  -8.235  1.00 27.87  ? 553  PHE A CE1 1 
ATOM   3204 C  CE2 . PHE A 1 553 ? -4.335  20.573  -6.301  1.00 31.19  ? 553  PHE A CE2 1 
ATOM   3205 C  CZ  . PHE A 1 553 ? -4.127  20.060  -7.566  1.00 29.35  ? 553  PHE A CZ  1 
ATOM   3206 N  N   . PRO A 1 554 ? -0.318  24.373  -3.126  1.00 29.45  ? 554  PRO A N   1 
ATOM   3207 C  CA  . PRO A 1 554 ? 0.920   24.811  -2.490  1.00 31.11  ? 554  PRO A CA  1 
ATOM   3208 C  C   . PRO A 1 554 ? 2.112   24.102  -3.129  1.00 31.37  ? 554  PRO A C   1 
ATOM   3209 O  O   . PRO A 1 554 ? 1.995   22.945  -3.535  1.00 28.76  ? 554  PRO A O   1 
ATOM   3210 C  CB  . PRO A 1 554 ? 0.750   24.350  -1.040  1.00 25.93  ? 554  PRO A CB  1 
ATOM   3211 C  CG  . PRO A 1 554 ? -0.718  24.251  -0.842  1.00 21.97  ? 554  PRO A CG  1 
ATOM   3212 C  CD  . PRO A 1 554 ? -1.272  23.806  -2.158  1.00 25.70  ? 554  PRO A CD  1 
ATOM   3213 N  N   . ALA A 1 555 ? 3.244   24.792  -3.217  1.00 34.26  ? 555  ALA A N   1 
ATOM   3214 C  CA  . ALA A 1 555 ? 4.427   24.254  -3.888  1.00 33.84  ? 555  ALA A CA  1 
ATOM   3215 C  C   . ALA A 1 555 ? 4.886   22.923  -3.302  1.00 33.77  ? 555  ALA A C   1 
ATOM   3216 O  O   . ALA A 1 555 ? 5.481   22.101  -3.998  1.00 46.29  ? 555  ALA A O   1 
ATOM   3217 C  CB  . ALA A 1 555 ? 5.560   25.266  -3.851  1.00 23.52  ? 555  ALA A CB  1 
ATOM   3218 N  N   . VAL A 1 556 ? 4.602   22.713  -2.022  1.00 30.56  ? 556  VAL A N   1 
ATOM   3219 C  CA  . VAL A 1 556 ? 5.052   21.516  -1.322  1.00 35.38  ? 556  VAL A CA  1 
ATOM   3220 C  C   . VAL A 1 556 ? 4.209   20.290  -1.686  1.00 34.21  ? 556  VAL A C   1 
ATOM   3221 O  O   . VAL A 1 556 ? 4.558   19.160  -1.341  1.00 30.92  ? 556  VAL A O   1 
ATOM   3222 C  CB  . VAL A 1 556 ? 5.047   21.737  0.213   1.00 30.12  ? 556  VAL A CB  1 
ATOM   3223 C  CG1 . VAL A 1 556 ? 3.622   21.733  0.753   1.00 30.47  ? 556  VAL A CG1 1 
ATOM   3224 C  CG2 . VAL A 1 556 ? 5.898   20.688  0.916   1.00 31.49  ? 556  VAL A CG2 1 
ATOM   3225 N  N   . VAL A 1 557 ? 3.109   20.518  -2.401  1.00 38.63  ? 557  VAL A N   1 
ATOM   3226 C  CA  . VAL A 1 557 ? 2.158   19.452  -2.714  1.00 36.10  ? 557  VAL A CA  1 
ATOM   3227 C  C   . VAL A 1 557 ? 1.943   19.257  -4.218  1.00 32.19  ? 557  VAL A C   1 
ATOM   3228 O  O   . VAL A 1 557 ? 1.627   18.154  -4.668  1.00 35.20  ? 557  VAL A O   1 
ATOM   3229 C  CB  . VAL A 1 557 ? 0.802   19.695  -2.007  1.00 37.09  ? 557  VAL A CB  1 
ATOM   3230 C  CG1 . VAL A 1 557 ? -0.288  18.825  -2.604  1.00 45.75  ? 557  VAL A CG1 1 
ATOM   3231 C  CG2 . VAL A 1 557 ? 0.933   19.434  -0.518  1.00 43.20  ? 557  VAL A CG2 1 
ATOM   3232 N  N   . ALA A 1 558 ? 2.122   20.327  -4.988  1.00 31.98  ? 558  ALA A N   1 
ATOM   3233 C  CA  . ALA A 1 558 ? 1.951   20.283  -6.441  1.00 28.16  ? 558  ALA A CA  1 
ATOM   3234 C  C   . ALA A 1 558 ? 2.746   19.141  -7.075  1.00 32.88  ? 558  ALA A C   1 
ATOM   3235 O  O   . ALA A 1 558 ? 3.834   18.810  -6.605  1.00 33.04  ? 558  ALA A O   1 
ATOM   3236 C  CB  . ALA A 1 558 ? 2.356   21.614  -7.055  1.00 24.62  ? 558  ALA A CB  1 
ATOM   3237 N  N   . PRO A 1 559 ? 2.203   18.537  -8.148  1.00 31.73  ? 559  PRO A N   1 
ATOM   3238 C  CA  . PRO A 1 559 ? 2.847   17.419  -8.833  1.00 34.63  ? 559  PRO A CA  1 
ATOM   3239 C  C   . PRO A 1 559 ? 4.350   17.632  -8.939  1.00 39.23  ? 559  PRO A C   1 
ATOM   3240 O  O   . PRO A 1 559 ? 5.131   16.815  -8.447  1.00 47.95  ? 559  PRO A O   1 
ATOM   3241 C  CB  . PRO A 1 559 ? 2.205   17.453  -10.217 1.00 27.43  ? 559  PRO A CB  1 
ATOM   3242 C  CG  . PRO A 1 559 ? 0.835   17.965  -9.963  1.00 26.16  ? 559  PRO A CG  1 
ATOM   3243 C  CD  . PRO A 1 559 ? 0.922   18.900  -8.782  1.00 28.69  ? 559  PRO A CD  1 
ATOM   3244 N  N   . PHE A 1 560 ? 4.743   18.723  -9.585  1.00 34.52  ? 560  PHE A N   1 
ATOM   3245 C  CA  . PHE A 1 560 ? 6.121   19.192  -9.534  1.00 33.78  ? 560  PHE A CA  1 
ATOM   3246 C  C   . PHE A 1 560 ? 6.136   20.713  -9.408  1.00 35.87  ? 560  PHE A C   1 
ATOM   3247 O  O   . PHE A 1 560 ? 5.185   21.387  -9.804  1.00 37.44  ? 560  PHE A O   1 
ATOM   3248 C  CB  . PHE A 1 560 ? 6.949   18.695  -10.729 1.00 32.92  ? 560  PHE A CB  1 
ATOM   3249 C  CG  . PHE A 1 560 ? 6.280   18.873  -12.065 1.00 31.27  ? 560  PHE A CG  1 
ATOM   3250 C  CD1 . PHE A 1 560 ? 5.346   17.954  -12.517 1.00 30.62  ? 560  PHE A CD1 1 
ATOM   3251 C  CD2 . PHE A 1 560 ? 6.610   19.944  -12.882 1.00 32.11  ? 560  PHE A CD2 1 
ATOM   3252 C  CE1 . PHE A 1 560 ? 4.736   18.111  -13.752 1.00 30.51  ? 560  PHE A CE1 1 
ATOM   3253 C  CE2 . PHE A 1 560 ? 6.007   20.105  -14.118 1.00 30.91  ? 560  PHE A CE2 1 
ATOM   3254 C  CZ  . PHE A 1 560 ? 5.069   19.187  -14.554 1.00 30.33  ? 560  PHE A CZ  1 
ATOM   3255 N  N   . LYS A 1 561 ? 7.212   21.246  -8.840  1.00 34.59  ? 561  LYS A N   1 
ATOM   3256 C  CA  . LYS A 1 561 ? 7.261   22.655  -8.464  1.00 34.66  ? 561  LYS A CA  1 
ATOM   3257 C  C   . LYS A 1 561 ? 7.562   23.595  -9.629  1.00 39.70  ? 561  LYS A C   1 
ATOM   3258 O  O   . LYS A 1 561 ? 7.109   24.740  -9.639  1.00 41.89  ? 561  LYS A O   1 
ATOM   3259 C  CB  . LYS A 1 561 ? 8.289   22.868  -7.351  1.00 29.68  ? 561  LYS A CB  1 
ATOM   3260 C  CG  . LYS A 1 561 ? 8.041   22.028  -6.111  1.00 31.36  ? 561  LYS A CG  1 
ATOM   3261 C  CD  . LYS A 1 561 ? 9.206   22.124  -5.143  1.00 35.11  ? 561  LYS A CD  1 
ATOM   3262 C  CE  . LYS A 1 561 ? 8.963   21.287  -3.902  1.00 37.49  ? 561  LYS A CE  1 
ATOM   3263 N  NZ  . LYS A 1 561 ? 10.189  21.189  -3.064  1.00 37.69  ? 561  LYS A NZ  1 
ATOM   3264 N  N   . CYS A 1 562 ? 8.325   23.118  -10.606 1.00 30.06  ? 562  CYS A N   1 
ATOM   3265 C  CA  . CYS A 1 562 ? 8.785   23.991  -11.679 1.00 30.12  ? 562  CYS A CA  1 
ATOM   3266 C  C   . CYS A 1 562 ? 8.683   23.357  -13.062 1.00 34.65  ? 562  CYS A C   1 
ATOM   3267 O  O   . CYS A 1 562 ? 8.887   22.156  -13.229 1.00 31.99  ? 562  CYS A O   1 
ATOM   3268 C  CB  . CYS A 1 562 ? 10.225  24.437  -11.417 1.00 28.72  ? 562  CYS A CB  1 
ATOM   3269 S  SG  . CYS A 1 562 ? 10.759  25.844  -12.415 1.00 32.75  ? 562  CYS A SG  1 
ATOM   3270 N  N   . SER A 1 563 ? 8.366   24.180  -14.053 1.00 33.45  ? 563  SER A N   1 
ATOM   3271 C  CA  . SER A 1 563 ? 8.330   23.731  -15.434 1.00 38.39  ? 563  SER A CA  1 
ATOM   3272 C  C   . SER A 1 563 ? 9.275   24.587  -16.263 1.00 38.92  ? 563  SER A C   1 
ATOM   3273 O  O   . SER A 1 563 ? 9.125   25.807  -16.319 1.00 46.85  ? 563  SER A O   1 
ATOM   3274 C  CB  . SER A 1 563 ? 6.908   23.827  -15.988 1.00 37.23  ? 563  SER A CB  1 
ATOM   3275 O  OG  . SER A 1 563 ? 6.863   23.444  -17.352 1.00 36.65  ? 563  SER A OG  1 
ATOM   3276 N  N   . VAL A 1 564 ? 10.257  23.954  -16.895 1.00 32.10  ? 564  VAL A N   1 
ATOM   3277 C  CA  . VAL A 1 564 ? 11.165  24.683  -17.772 1.00 40.18  ? 564  VAL A CA  1 
ATOM   3278 C  C   . VAL A 1 564 ? 10.639  24.656  -19.206 1.00 37.17  ? 564  VAL A C   1 
ATOM   3279 O  O   . VAL A 1 564 ? 10.342  23.590  -19.749 1.00 31.10  ? 564  VAL A O   1 
ATOM   3280 C  CB  . VAL A 1 564 ? 12.619  24.148  -17.702 1.00 40.03  ? 564  VAL A CB  1 
ATOM   3281 C  CG1 . VAL A 1 564 ? 12.995  23.817  -16.262 1.00 34.26  ? 564  VAL A CG1 1 
ATOM   3282 C  CG2 . VAL A 1 564 ? 12.796  22.932  -18.589 1.00 43.16  ? 564  VAL A CG2 1 
ATOM   3283 N  N   . LEU A 1 565 ? 10.498  25.835  -19.803 1.00 40.74  ? 565  LEU A N   1 
ATOM   3284 C  CA  . LEU A 1 565 ? 9.977   25.940  -21.161 1.00 46.83  ? 565  LEU A CA  1 
ATOM   3285 C  C   . LEU A 1 565 ? 11.004  26.523  -22.121 1.00 46.51  ? 565  LEU A C   1 
ATOM   3286 O  O   . LEU A 1 565 ? 11.226  27.732  -22.135 1.00 55.62  ? 565  LEU A O   1 
ATOM   3287 C  CB  . LEU A 1 565 ? 8.711   26.802  -21.205 1.00 56.94  ? 565  LEU A CB  1 
ATOM   3288 C  CG  . LEU A 1 565 ? 7.478   26.448  -20.371 1.00 62.17  ? 565  LEU A CG  1 
ATOM   3289 C  CD1 . LEU A 1 565 ? 6.244   27.043  -21.027 1.00 63.81  ? 565  LEU A CD1 1 
ATOM   3290 C  CD2 . LEU A 1 565 ? 7.313   24.952  -20.223 1.00 66.01  ? 565  LEU A CD2 1 
ATOM   3291 N  N   . PRO A 1 566 ? 11.643  25.663  -22.924 1.00 52.47  ? 566  PRO A N   1 
ATOM   3292 C  CA  . PRO A 1 566 ? 12.451  26.159  -24.025 1.00 49.94  ? 566  PRO A CA  1 
ATOM   3293 C  C   . PRO A 1 566 ? 11.585  26.335  -25.268 1.00 50.49  ? 566  PRO A C   1 
ATOM   3294 O  O   . PRO A 1 566 ? 10.634  25.578  -25.465 1.00 55.92  ? 566  PRO A O   1 
ATOM   3295 C  CB  . PRO A 1 566 ? 13.462  25.034  -24.241 1.00 47.56  ? 566  PRO A CB  1 
ATOM   3296 C  CG  . PRO A 1 566 ? 12.745  23.791  -23.810 1.00 48.10  ? 566  PRO A CG  1 
ATOM   3297 C  CD  . PRO A 1 566 ? 11.661  24.192  -22.837 1.00 51.16  ? 566  PRO A CD  1 
ATOM   3298 N  N   . LEU A 1 567 ? 11.900  27.331  -26.090 1.00 61.59  ? 567  LEU A N   1 
ATOM   3299 C  CA  . LEU A 1 567 ? 11.195  27.517  -27.356 1.00 68.76  ? 567  LEU A CA  1 
ATOM   3300 C  C   . LEU A 1 567 ? 11.411  26.296  -28.248 1.00 70.50  ? 567  LEU A C   1 
ATOM   3301 O  O   . LEU A 1 567 ? 12.334  25.514  -28.018 1.00 66.41  ? 567  LEU A O   1 
ATOM   3302 C  CB  . LEU A 1 567 ? 11.662  28.793  -28.060 1.00 74.01  ? 567  LEU A CB  1 
ATOM   3303 C  CG  . LEU A 1 567 ? 11.330  30.119  -27.368 1.00 72.56  ? 567  LEU A CG  1 
ATOM   3304 C  CD1 . LEU A 1 567 ? 11.958  31.286  -28.112 1.00 72.44  ? 567  LEU A CD1 1 
ATOM   3305 C  CD2 . LEU A 1 567 ? 9.825   30.308  -27.248 1.00 73.47  ? 567  LEU A CD2 1 
ATOM   3306 N  N   . SER A 1 568 ? 10.559  26.135  -29.259 1.00 81.52  ? 568  SER A N   1 
ATOM   3307 C  CA  . SER A 1 568 ? 10.565  24.932  -30.099 1.00 98.38  ? 568  SER A CA  1 
ATOM   3308 C  C   . SER A 1 568 ? 11.922  24.227  -30.137 1.00 102.79 ? 568  SER A C   1 
ATOM   3309 O  O   . SER A 1 568 ? 12.945  24.830  -30.466 1.00 108.04 ? 568  SER A O   1 
ATOM   3310 C  CB  . SER A 1 568 ? 10.084  25.246  -31.518 1.00 103.39 ? 568  SER A CB  1 
ATOM   3311 O  OG  . SER A 1 568 ? 9.898   24.053  -32.263 1.00 105.79 ? 568  SER A OG  1 
ATOM   3312 N  N   . GLN A 1 569 ? 11.901  22.937  -29.817 1.00 103.39 ? 569  GLN A N   1 
ATOM   3313 C  CA  . GLN A 1 569 ? 13.107  22.144  -29.573 1.00 101.86 ? 569  GLN A CA  1 
ATOM   3314 C  C   . GLN A 1 569 ? 14.262  22.399  -30.542 1.00 99.51  ? 569  GLN A C   1 
ATOM   3315 O  O   . GLN A 1 569 ? 14.204  22.035  -31.717 1.00 101.73 ? 569  GLN A O   1 
ATOM   3316 C  CB  . GLN A 1 569 ? 12.753  20.653  -29.517 1.00 104.31 ? 569  GLN A CB  1 
ATOM   3317 C  CG  . GLN A 1 569 ? 11.946  20.262  -28.280 1.00 106.05 ? 569  GLN A CG  1 
ATOM   3318 C  CD  . GLN A 1 569 ? 10.675  21.084  -28.114 1.00 108.30 ? 569  GLN A CD  1 
ATOM   3319 O  OE1 . GLN A 1 569 ? 9.642   20.780  -28.717 1.00 109.41 ? 569  GLN A OE1 1 
ATOM   3320 N  NE2 . GLN A 1 569 ? 10.746  22.125  -27.280 1.00 108.20 ? 569  GLN A NE2 1 
ATOM   3321 N  N   . ASN A 1 570 ? 15.310  23.029  -30.020 1.00 96.10  ? 570  ASN A N   1 
ATOM   3322 C  CA  . ASN A 1 570 ? 16.496  23.366  -30.793 1.00 91.50  ? 570  ASN A CA  1 
ATOM   3323 C  C   . ASN A 1 570 ? 17.744  22.884  -30.062 1.00 89.98  ? 570  ASN A C   1 
ATOM   3324 O  O   . ASN A 1 570 ? 17.823  22.975  -28.836 1.00 95.77  ? 570  ASN A O   1 
ATOM   3325 C  CB  . ASN A 1 570 ? 16.562  24.883  -30.999 1.00 95.79  ? 570  ASN A CB  1 
ATOM   3326 C  CG  . ASN A 1 570 ? 17.357  25.279  -32.232 1.00 97.16  ? 570  ASN A CG  1 
ATOM   3327 O  OD1 . ASN A 1 570 ? 16.836  25.945  -33.128 1.00 94.62  ? 570  ASN A OD1 1 
ATOM   3328 N  ND2 . ASN A 1 570 ? 18.622  24.876  -32.284 1.00 97.97  ? 570  ASN A ND2 1 
ATOM   3329 N  N   . GLN A 1 571 ? 18.712  22.366  -30.812 1.00 91.28  ? 571  GLN A N   1 
ATOM   3330 C  CA  . GLN A 1 571 ? 19.994  21.945  -30.247 1.00 92.83  ? 571  GLN A CA  1 
ATOM   3331 C  C   . GLN A 1 571 ? 20.653  23.093  -29.487 1.00 89.84  ? 571  GLN A C   1 
ATOM   3332 O  O   . GLN A 1 571 ? 21.704  22.925  -28.867 1.00 84.89  ? 571  GLN A O   1 
ATOM   3333 C  CB  . GLN A 1 571 ? 20.929  21.460  -31.358 1.00 104.92 ? 571  GLN A CB  1 
ATOM   3334 C  CG  . GLN A 1 571 ? 20.668  20.038  -31.830 1.00 110.65 ? 571  GLN A CG  1 
ATOM   3335 C  CD  . GLN A 1 571 ? 21.424  19.003  -31.017 1.00 113.31 ? 571  GLN A CD  1 
ATOM   3336 O  OE1 . GLN A 1 571 ? 22.468  19.296  -30.433 1.00 115.27 ? 571  GLN A OE1 1 
ATOM   3337 N  NE2 . GLN A 1 571 ? 20.903  17.782  -30.982 1.00 112.98 ? 571  GLN A NE2 1 
ATOM   3338 N  N   . GLU A 1 572 ? 20.014  24.256  -29.539 1.00 84.94  ? 572  GLU A N   1 
ATOM   3339 C  CA  . GLU A 1 572 ? 20.558  25.481  -28.974 1.00 83.80  ? 572  GLU A CA  1 
ATOM   3340 C  C   . GLU A 1 572 ? 20.295  25.581  -27.476 1.00 78.51  ? 572  GLU A C   1 
ATOM   3341 O  O   . GLU A 1 572 ? 21.190  25.917  -26.699 1.00 73.76  ? 572  GLU A O   1 
ATOM   3342 C  CB  . GLU A 1 572 ? 19.939  26.681  -29.687 1.00 88.94  ? 572  GLU A CB  1 
ATOM   3343 C  CG  . GLU A 1 572 ? 20.881  27.845  -29.899 1.00 90.20  ? 572  GLU A CG  1 
ATOM   3344 C  CD  . GLU A 1 572 ? 20.315  28.863  -30.865 1.00 91.04  ? 572  GLU A CD  1 
ATOM   3345 O  OE1 . GLU A 1 572 ? 19.317  29.525  -30.513 1.00 87.61  ? 572  GLU A OE1 1 
ATOM   3346 O  OE2 . GLU A 1 572 ? 20.870  28.999  -31.975 1.00 94.90  ? 572  GLU A OE2 1 
ATOM   3347 N  N   . PHE A 1 573 ? 19.060  25.289  -27.079 1.00 71.81  ? 573  PHE A N   1 
ATOM   3348 C  CA  . PHE A 1 573 ? 18.637  25.438  -25.691 1.00 64.86  ? 573  PHE A CA  1 
ATOM   3349 C  C   . PHE A 1 573 ? 19.128  24.306  -24.795 1.00 67.61  ? 573  PHE A C   1 
ATOM   3350 O  O   . PHE A 1 573 ? 19.309  24.495  -23.592 1.00 70.82  ? 573  PHE A O   1 
ATOM   3351 C  CB  . PHE A 1 573 ? 17.110  25.518  -25.602 1.00 58.02  ? 573  PHE A CB  1 
ATOM   3352 C  CG  . PHE A 1 573 ? 16.500  26.556  -26.500 1.00 57.90  ? 573  PHE A CG  1 
ATOM   3353 C  CD1 . PHE A 1 573 ? 16.821  27.896  -26.352 1.00 56.46  ? 573  PHE A CD1 1 
ATOM   3354 C  CD2 . PHE A 1 573 ? 15.592  26.193  -27.480 1.00 58.44  ? 573  PHE A CD2 1 
ATOM   3355 C  CE1 . PHE A 1 573 ? 16.257  28.854  -27.173 1.00 54.68  ? 573  PHE A CE1 1 
ATOM   3356 C  CE2 . PHE A 1 573 ? 15.022  27.147  -28.305 1.00 60.66  ? 573  PHE A CE2 1 
ATOM   3357 C  CZ  . PHE A 1 573 ? 15.356  28.479  -28.151 1.00 59.31  ? 573  PHE A CZ  1 
ATOM   3358 N  N   . MET A 1 574 ? 19.342  23.134  -25.386 1.00 68.95  ? 574  MET A N   1 
ATOM   3359 C  CA  . MET A 1 574 ? 19.624  21.915  -24.623 1.00 73.51  ? 574  MET A CA  1 
ATOM   3360 C  C   . MET A 1 574 ? 20.653  22.064  -23.494 1.00 65.84  ? 574  MET A C   1 
ATOM   3361 O  O   . MET A 1 574 ? 20.380  21.671  -22.360 1.00 66.66  ? 574  MET A O   1 
ATOM   3362 C  CB  . MET A 1 574 ? 20.003  20.756  -25.555 1.00 84.95  ? 574  MET A CB  1 
ATOM   3363 C  CG  . MET A 1 574 ? 20.251  19.436  -24.835 1.00 93.60  ? 574  MET A CG  1 
ATOM   3364 S  SD  . MET A 1 574 ? 18.864  18.904  -23.806 1.00 102.11 ? 574  MET A SD  1 
ATOM   3365 C  CE  . MET A 1 574 ? 17.702  18.341  -25.048 1.00 101.66 ? 574  MET A CE  1 
ATOM   3366 N  N   . PRO A 1 575 ? 21.837  22.629  -23.794 1.00 59.42  ? 575  PRO A N   1 
ATOM   3367 C  CA  . PRO A 1 575 ? 22.835  22.802  -22.736 1.00 56.73  ? 575  PRO A CA  1 
ATOM   3368 C  C   . PRO A 1 575 ? 22.340  23.675  -21.580 1.00 55.19  ? 575  PRO A C   1 
ATOM   3369 O  O   . PRO A 1 575 ? 22.724  23.450  -20.432 1.00 59.16  ? 575  PRO A O   1 
ATOM   3370 C  CB  . PRO A 1 575 ? 24.010  23.476  -23.458 1.00 51.67  ? 575  PRO A CB  1 
ATOM   3371 C  CG  . PRO A 1 575 ? 23.432  24.041  -24.710 1.00 52.96  ? 575  PRO A CG  1 
ATOM   3372 C  CD  . PRO A 1 575 ? 22.325  23.118  -25.095 1.00 53.52  ? 575  PRO A CD  1 
ATOM   3373 N  N   . PHE A 1 576 ? 21.498  24.660  -21.883 1.00 48.23  ? 576  PHE A N   1 
ATOM   3374 C  CA  . PHE A 1 576 ? 20.931  25.527  -20.853 1.00 50.70  ? 576  PHE A CA  1 
ATOM   3375 C  C   . PHE A 1 576 ? 19.809  24.823  -20.097 1.00 45.96  ? 576  PHE A C   1 
ATOM   3376 O  O   . PHE A 1 576 ? 19.678  24.969  -18.882 1.00 38.82  ? 576  PHE A O   1 
ATOM   3377 C  CB  . PHE A 1 576 ? 20.418  26.834  -21.463 1.00 50.11  ? 576  PHE A CB  1 
ATOM   3378 C  CG  . PHE A 1 576 ? 21.510  27.761  -21.912 1.00 48.18  ? 576  PHE A CG  1 
ATOM   3379 C  CD1 . PHE A 1 576 ? 21.976  27.724  -23.216 1.00 46.84  ? 576  PHE A CD1 1 
ATOM   3380 C  CD2 . PHE A 1 576 ? 22.072  28.669  -21.029 1.00 47.67  ? 576  PHE A CD2 1 
ATOM   3381 C  CE1 . PHE A 1 576 ? 22.983  28.577  -23.631 1.00 48.99  ? 576  PHE A CE1 1 
ATOM   3382 C  CE2 . PHE A 1 576 ? 23.079  29.525  -21.438 1.00 47.51  ? 576  PHE A CE2 1 
ATOM   3383 C  CZ  . PHE A 1 576 ? 23.535  29.479  -22.740 1.00 48.19  ? 576  PHE A CZ  1 
ATOM   3384 N  N   . VAL A 1 577 ? 19.001  24.063  -20.829 1.00 36.90  ? 577  VAL A N   1 
ATOM   3385 C  CA  . VAL A 1 577 ? 17.950  23.252  -20.228 1.00 42.66  ? 577  VAL A CA  1 
ATOM   3386 C  C   . VAL A 1 577 ? 18.555  22.204  -19.298 1.00 43.47  ? 577  VAL A C   1 
ATOM   3387 O  O   . VAL A 1 577 ? 18.091  22.013  -18.174 1.00 41.80  ? 577  VAL A O   1 
ATOM   3388 C  CB  . VAL A 1 577 ? 17.101  22.547  -21.307 1.00 38.65  ? 577  VAL A CB  1 
ATOM   3389 C  CG1 . VAL A 1 577 ? 16.152  21.539  -20.672 1.00 35.05  ? 577  VAL A CG1 1 
ATOM   3390 C  CG2 . VAL A 1 577 ? 16.331  23.570  -22.131 1.00 42.24  ? 577  VAL A CG2 1 
ATOM   3391 N  N   . LYS A 1 578 ? 19.602  21.537  -19.777 1.00 49.50  ? 578  LYS A N   1 
ATOM   3392 C  CA  . LYS A 1 578 ? 20.266  20.486  -19.015 1.00 52.14  ? 578  LYS A CA  1 
ATOM   3393 C  C   . LYS A 1 578 ? 20.885  21.029  -17.732 1.00 49.98  ? 578  LYS A C   1 
ATOM   3394 O  O   . LYS A 1 578 ? 20.779  20.410  -16.674 1.00 55.70  ? 578  LYS A O   1 
ATOM   3395 C  CB  . LYS A 1 578 ? 21.338  19.804  -19.870 1.00 56.14  ? 578  LYS A CB  1 
ATOM   3396 C  CG  . LYS A 1 578 ? 21.938  18.555  -19.246 1.00 62.68  ? 578  LYS A CG  1 
ATOM   3397 C  CD  . LYS A 1 578 ? 22.959  17.915  -20.173 1.00 66.74  ? 578  LYS A CD  1 
ATOM   3398 C  CE  . LYS A 1 578 ? 23.489  16.612  -19.597 1.00 68.32  ? 578  LYS A CE  1 
ATOM   3399 N  NZ  . LYS A 1 578 ? 24.496  15.980  -20.494 1.00 71.69  ? 578  LYS A NZ  1 
ATOM   3400 N  N   . GLU A 1 579 ? 21.526  22.189  -17.829 1.00 44.03  ? 579  GLU A N   1 
ATOM   3401 C  CA  . GLU A 1 579 ? 22.164  22.803  -16.670 1.00 46.23  ? 579  GLU A CA  1 
ATOM   3402 C  C   . GLU A 1 579 ? 21.132  23.261  -15.645 1.00 49.46  ? 579  GLU A C   1 
ATOM   3403 O  O   . GLU A 1 579 ? 21.336  23.109  -14.441 1.00 51.61  ? 579  GLU A O   1 
ATOM   3404 C  CB  . GLU A 1 579 ? 23.060  23.970  -17.097 1.00 48.06  ? 579  GLU A CB  1 
ATOM   3405 C  CG  . GLU A 1 579 ? 23.688  24.739  -15.940 1.00 53.45  ? 579  GLU A CG  1 
ATOM   3406 C  CD  . GLU A 1 579 ? 24.482  23.852  -14.995 1.00 59.20  ? 579  GLU A CD  1 
ATOM   3407 O  OE1 . GLU A 1 579 ? 24.605  24.215  -13.806 1.00 60.30  ? 579  GLU A OE1 1 
ATOM   3408 O  OE2 . GLU A 1 579 ? 24.982  22.795  -15.437 1.00 62.95  ? 579  GLU A OE2 1 
ATOM   3409 N  N   . LEU A 1 580 ? 20.022  23.815  -16.127 1.00 44.94  ? 580  LEU A N   1 
ATOM   3410 C  CA  . LEU A 1 580 ? 18.946  24.259  -15.249 1.00 41.58  ? 580  LEU A CA  1 
ATOM   3411 C  C   . LEU A 1 580 ? 18.344  23.060  -14.526 1.00 42.99  ? 580  LEU A C   1 
ATOM   3412 O  O   . LEU A 1 580 ? 18.165  23.086  -13.309 1.00 37.99  ? 580  LEU A O   1 
ATOM   3413 C  CB  . LEU A 1 580 ? 17.859  24.980  -16.048 1.00 38.40  ? 580  LEU A CB  1 
ATOM   3414 C  CG  . LEU A 1 580 ? 17.154  26.182  -15.407 1.00 35.86  ? 580  LEU A CG  1 
ATOM   3415 C  CD1 . LEU A 1 580 ? 15.762  26.335  -15.996 1.00 32.93  ? 580  LEU A CD1 1 
ATOM   3416 C  CD2 . LEU A 1 580 ? 17.076  26.074  -13.892 1.00 32.66  ? 580  LEU A CD2 1 
ATOM   3417 N  N   . SER A 1 581 ? 18.036  22.013  -15.285 1.00 44.33  ? 581  SER A N   1 
ATOM   3418 C  CA  . SER A 1 581 ? 17.462  20.796  -14.724 1.00 43.03  ? 581  SER A CA  1 
ATOM   3419 C  C   . SER A 1 581 ? 18.372  20.195  -13.655 1.00 44.35  ? 581  SER A C   1 
ATOM   3420 O  O   . SER A 1 581 ? 17.920  19.869  -12.558 1.00 41.14  ? 581  SER A O   1 
ATOM   3421 C  CB  . SER A 1 581 ? 17.194  19.772  -15.827 1.00 43.12  ? 581  SER A CB  1 
ATOM   3422 O  OG  . SER A 1 581 ? 16.568  18.614  -15.305 1.00 44.61  ? 581  SER A OG  1 
ATOM   3423 N  N   . GLU A 1 582 ? 19.655  20.061  -13.979 1.00 42.05  ? 582  GLU A N   1 
ATOM   3424 C  CA  . GLU A 1 582 ? 20.626  19.496  -13.047 1.00 45.53  ? 582  GLU A CA  1 
ATOM   3425 C  C   . GLU A 1 582 ? 20.803  20.365  -11.807 1.00 43.53  ? 582  GLU A C   1 
ATOM   3426 O  O   . GLU A 1 582 ? 20.872  19.855  -10.689 1.00 52.89  ? 582  GLU A O   1 
ATOM   3427 C  CB  . GLU A 1 582 ? 21.976  19.274  -13.732 1.00 50.67  ? 582  GLU A CB  1 
ATOM   3428 C  CG  . GLU A 1 582 ? 21.989  18.119  -14.722 1.00 53.00  ? 582  GLU A CG  1 
ATOM   3429 C  CD  . GLU A 1 582 ? 23.373  17.840  -15.274 1.00 54.59  ? 582  GLU A CD  1 
ATOM   3430 O  OE1 . GLU A 1 582 ? 24.354  18.406  -14.748 1.00 54.47  ? 582  GLU A OE1 1 
ATOM   3431 O  OE2 . GLU A 1 582 ? 23.480  17.049  -16.234 1.00 61.94  ? 582  GLU A OE2 1 
ATOM   3432 N  N   . ALA A 1 583 ? 20.877  21.677  -12.009 1.00 45.61  ? 583  ALA A N   1 
ATOM   3433 C  CA  . ALA A 1 583 ? 21.017  22.615  -10.899 1.00 43.82  ? 583  ALA A CA  1 
ATOM   3434 C  C   . ALA A 1 583 ? 19.749  22.639  -10.056 1.00 44.84  ? 583  ALA A C   1 
ATOM   3435 O  O   . ALA A 1 583 ? 19.794  22.876  -8.849  1.00 41.89  ? 583  ALA A O   1 
ATOM   3436 C  CB  . ALA A 1 583 ? 21.335  24.009  -11.415 1.00 42.91  ? 583  ALA A CB  1 
ATOM   3437 N  N   . LEU A 1 584 ? 18.619  22.385  -10.707 1.00 46.82  ? 584  LEU A N   1 
ATOM   3438 C  CA  . LEU A 1 584 ? 17.318  22.423  -10.055 1.00 40.20  ? 584  LEU A CA  1 
ATOM   3439 C  C   . LEU A 1 584 ? 17.129  21.206  -9.153  1.00 46.91  ? 584  LEU A C   1 
ATOM   3440 O  O   . LEU A 1 584 ? 16.503  21.296  -8.097  1.00 51.24  ? 584  LEU A O   1 
ATOM   3441 C  CB  . LEU A 1 584 ? 16.213  22.485  -11.113 1.00 42.04  ? 584  LEU A CB  1 
ATOM   3442 C  CG  . LEU A 1 584 ? 14.949  23.300  -10.835 1.00 38.92  ? 584  LEU A CG  1 
ATOM   3443 C  CD1 . LEU A 1 584 ? 15.281  24.662  -10.246 1.00 32.58  ? 584  LEU A CD1 1 
ATOM   3444 C  CD2 . LEU A 1 584 ? 14.151  23.456  -12.118 1.00 35.47  ? 584  LEU A CD2 1 
ATOM   3445 N  N   . THR A 1 585 ? 17.677  20.070  -9.577  1.00 47.65  ? 585  THR A N   1 
ATOM   3446 C  CA  . THR A 1 585 ? 17.642  18.845  -8.783  1.00 43.50  ? 585  THR A CA  1 
ATOM   3447 C  C   . THR A 1 585 ? 18.575  18.973  -7.583  1.00 48.74  ? 585  THR A C   1 
ATOM   3448 O  O   . THR A 1 585 ? 18.350  18.367  -6.533  1.00 52.77  ? 585  THR A O   1 
ATOM   3449 C  CB  . THR A 1 585 ? 18.058  17.618  -9.623  1.00 44.58  ? 585  THR A CB  1 
ATOM   3450 O  OG1 . THR A 1 585 ? 17.120  17.424  -10.688 1.00 46.66  ? 585  THR A OG1 1 
ATOM   3451 C  CG2 . THR A 1 585 ? 18.101  16.363  -8.765  1.00 44.96  ? 585  THR A CG2 1 
ATOM   3452 N  N   . ARG A 1 586 ? 19.618  19.779  -7.749  1.00 46.38  ? 586  ARG A N   1 
ATOM   3453 C  CA  . ARG A 1 586 ? 20.631  19.969  -6.722  1.00 49.50  ? 586  ARG A CA  1 
ATOM   3454 C  C   . ARG A 1 586 ? 20.087  20.817  -5.574  1.00 55.00  ? 586  ARG A C   1 
ATOM   3455 O  O   . ARG A 1 586 ? 20.601  20.771  -4.456  1.00 52.05  ? 586  ARG A O   1 
ATOM   3456 C  CB  . ARG A 1 586 ? 21.857  20.637  -7.340  1.00 54.81  ? 586  ARG A CB  1 
ATOM   3457 C  CG  . ARG A 1 586 ? 23.179  19.960  -7.029  1.00 57.22  ? 586  ARG A CG  1 
ATOM   3458 C  CD  . ARG A 1 586 ? 24.120  20.101  -8.214  1.00 54.88  ? 586  ARG A CD  1 
ATOM   3459 N  NE  . ARG A 1 586 ? 24.187  21.483  -8.683  1.00 53.94  ? 586  ARG A NE  1 
ATOM   3460 C  CZ  . ARG A 1 586 ? 24.418  21.839  -9.942  1.00 53.65  ? 586  ARG A CZ  1 
ATOM   3461 N  NH1 . ARG A 1 586 ? 24.599  20.914  -10.876 1.00 54.69  ? 586  ARG A NH1 1 
ATOM   3462 N  NH2 . ARG A 1 586 ? 24.460  23.123  -10.272 1.00 48.08  ? 586  ARG A NH2 1 
ATOM   3463 N  N   . HIS A 1 587 ? 19.047  21.594  -5.862  1.00 55.21  ? 587  HIS A N   1 
ATOM   3464 C  CA  . HIS A 1 587 ? 18.381  22.400  -4.845  1.00 51.33  ? 587  HIS A CA  1 
ATOM   3465 C  C   . HIS A 1 587 ? 17.088  21.733  -4.382  1.00 51.62  ? 587  HIS A C   1 
ATOM   3466 O  O   . HIS A 1 587 ? 16.297  22.327  -3.648  1.00 56.65  ? 587  HIS A O   1 
ATOM   3467 C  CB  . HIS A 1 587 ? 18.104  23.811  -5.368  1.00 52.93  ? 587  HIS A CB  1 
ATOM   3468 C  CG  . HIS A 1 587 ? 19.335  24.649  -5.522  1.00 55.33  ? 587  HIS A CG  1 
ATOM   3469 N  ND1 . HIS A 1 587 ? 20.119  24.620  -6.655  1.00 56.57  ? 587  HIS A ND1 1 
ATOM   3470 C  CD2 . HIS A 1 587 ? 19.919  25.537  -4.683  1.00 54.43  ? 587  HIS A CD2 1 
ATOM   3471 C  CE1 . HIS A 1 587 ? 21.133  25.454  -6.508  1.00 53.44  ? 587  HIS A CE1 1 
ATOM   3472 N  NE2 . HIS A 1 587 ? 21.035  26.024  -5.321  1.00 53.18  ? 587  HIS A NE2 1 
ATOM   3473 N  N   . GLY A 1 588 ? 16.886  20.493  -4.818  1.00 43.23  ? 588  GLY A N   1 
ATOM   3474 C  CA  . GLY A 1 588 ? 15.738  19.696  -4.394  1.00 48.72  ? 588  GLY A CA  1 
ATOM   3475 C  C   . GLY A 1 588 ? 14.406  20.215  -4.896  1.00 50.07  ? 588  GLY A C   1 
ATOM   3476 O  O   . GLY A 1 588 ? 13.400  20.149  -4.190  1.00 59.41  ? 588  GLY A O   1 
ATOM   3477 N  N   . VAL A 1 589 ? 14.398  20.736  -6.118  1.00 42.44  ? 589  VAL A N   1 
ATOM   3478 C  CA  . VAL A 1 589 ? 13.175  21.248  -6.723  1.00 30.35  ? 589  VAL A CA  1 
ATOM   3479 C  C   . VAL A 1 589 ? 12.736  20.353  -7.876  1.00 32.69  ? 589  VAL A C   1 
ATOM   3480 O  O   . VAL A 1 589 ? 13.472  20.170  -8.845  1.00 41.78  ? 589  VAL A O   1 
ATOM   3481 C  CB  . VAL A 1 589 ? 13.358  22.689  -7.238  1.00 31.35  ? 589  VAL A CB  1 
ATOM   3482 C  CG1 . VAL A 1 589 ? 12.083  23.182  -7.909  1.00 33.64  ? 589  VAL A CG1 1 
ATOM   3483 C  CG2 . VAL A 1 589 ? 13.762  23.614  -6.099  1.00 29.78  ? 589  VAL A CG2 1 
ATOM   3484 N  N   . SER A 1 590 ? 11.535  19.795  -7.763  1.00 25.90  ? 590  SER A N   1 
ATOM   3485 C  CA  . SER A 1 590 ? 10.992  18.936  -8.806  1.00 29.20  ? 590  SER A CA  1 
ATOM   3486 C  C   . SER A 1 590 ? 10.643  19.742  -10.054 1.00 34.73  ? 590  SER A C   1 
ATOM   3487 O  O   . SER A 1 590 ? 10.240  20.903  -9.962  1.00 36.73  ? 590  SER A O   1 
ATOM   3488 C  CB  . SER A 1 590 ? 9.765   18.178  -8.294  1.00 24.80  ? 590  SER A CB  1 
ATOM   3489 O  OG  . SER A 1 590 ? 8.894   19.038  -7.582  1.00 33.15  ? 590  SER A OG  1 
ATOM   3490 N  N   . HIS A 1 591 ? 10.805  19.120  -11.218 1.00 25.37  ? 591  HIS A N   1 
ATOM   3491 C  CA  . HIS A 1 591 ? 10.555  19.793  -12.484 1.00 30.09  ? 591  HIS A CA  1 
ATOM   3492 C  C   . HIS A 1 591 ? 10.357  18.808  -13.628 1.00 33.45  ? 591  HIS A C   1 
ATOM   3493 O  O   . HIS A 1 591 ? 10.768  17.650  -13.549 1.00 35.83  ? 591  HIS A O   1 
ATOM   3494 C  CB  . HIS A 1 591 ? 11.717  20.725  -12.824 1.00 33.82  ? 591  HIS A CB  1 
ATOM   3495 C  CG  . HIS A 1 591 ? 13.033  20.024  -12.933 1.00 36.34  ? 591  HIS A CG  1 
ATOM   3496 N  ND1 . HIS A 1 591 ? 13.865  19.836  -11.850 1.00 37.73  ? 591  HIS A ND1 1 
ATOM   3497 C  CD2 . HIS A 1 591 ? 13.655  19.450  -13.990 1.00 31.11  ? 591  HIS A CD2 1 
ATOM   3498 C  CE1 . HIS A 1 591 ? 14.946  19.183  -12.237 1.00 35.39  ? 591  HIS A CE1 1 
ATOM   3499 N  NE2 . HIS A 1 591 ? 14.843  18.937  -13.531 1.00 31.13  ? 591  HIS A NE2 1 
ATOM   3500 N  N   . LYS A 1 592 ? 9.724   19.285  -14.692 1.00 41.35  ? 592  LYS A N   1 
ATOM   3501 C  CA  . LYS A 1 592 ? 9.589   18.516  -15.917 1.00 46.66  ? 592  LYS A CA  1 
ATOM   3502 C  C   . LYS A 1 592 ? 9.817   19.443  -17.105 1.00 46.43  ? 592  LYS A C   1 
ATOM   3503 O  O   . LYS A 1 592 ? 9.221   20.518  -17.186 1.00 47.18  ? 592  LYS A O   1 
ATOM   3504 C  CB  . LYS A 1 592 ? 8.207   17.866  -16.002 1.00 49.12  ? 592  LYS A CB  1 
ATOM   3505 C  CG  . LYS A 1 592 ? 8.046   16.909  -17.172 1.00 61.07  ? 592  LYS A CG  1 
ATOM   3506 C  CD  . LYS A 1 592 ? 6.652   16.303  -17.214 1.00 62.67  ? 592  LYS A CD  1 
ATOM   3507 C  CE  . LYS A 1 592 ? 6.519   15.310  -18.359 1.00 68.96  ? 592  LYS A CE  1 
ATOM   3508 N  NZ  . LYS A 1 592 ? 5.164   14.694  -18.415 1.00 73.29  ? 592  LYS A NZ  1 
ATOM   3509 N  N   . VAL A 1 593 ? 10.695  19.031  -18.013 1.00 40.99  ? 593  VAL A N   1 
ATOM   3510 C  CA  . VAL A 1 593 ? 10.957  19.804  -19.219 1.00 39.92  ? 593  VAL A CA  1 
ATOM   3511 C  C   . VAL A 1 593 ? 9.774   19.669  -20.168 1.00 37.71  ? 593  VAL A C   1 
ATOM   3512 O  O   . VAL A 1 593 ? 9.361   18.558  -20.502 1.00 41.89  ? 593  VAL A O   1 
ATOM   3513 C  CB  . VAL A 1 593 ? 12.244  19.339  -19.924 1.00 35.83  ? 593  VAL A CB  1 
ATOM   3514 C  CG1 . VAL A 1 593 ? 12.491  20.163  -21.178 1.00 37.76  ? 593  VAL A CG1 1 
ATOM   3515 C  CG2 . VAL A 1 593 ? 13.432  19.433  -18.977 1.00 27.83  ? 593  VAL A CG2 1 
ATOM   3516 N  N   . ASP A 1 594 ? 9.222   20.802  -20.588 1.00 38.43  ? 594  ASP A N   1 
ATOM   3517 C  CA  . ASP A 1 594 ? 8.055   20.796  -21.457 1.00 48.98  ? 594  ASP A CA  1 
ATOM   3518 C  C   . ASP A 1 594 ? 8.449   20.617  -22.920 1.00 54.67  ? 594  ASP A C   1 
ATOM   3519 O  O   . ASP A 1 594 ? 8.811   21.578  -23.600 1.00 51.92  ? 594  ASP A O   1 
ATOM   3520 C  CB  . ASP A 1 594 ? 7.244   22.078  -21.278 1.00 50.67  ? 594  ASP A CB  1 
ATOM   3521 C  CG  . ASP A 1 594 ? 5.813   21.935  -21.755 1.00 55.78  ? 594  ASP A CG  1 
ATOM   3522 O  OD1 . ASP A 1 594 ? 5.289   20.802  -21.739 1.00 64.00  ? 594  ASP A OD1 1 
ATOM   3523 O  OD2 . ASP A 1 594 ? 5.207   22.957  -22.137 1.00 58.27  ? 594  ASP A OD2 1 
ATOM   3524 N  N   . ASP A 1 595 ? 8.385   19.377  -23.392 1.00 64.62  ? 595  ASP A N   1 
ATOM   3525 C  CA  . ASP A 1 595 ? 8.619   19.074  -24.797 1.00 80.16  ? 595  ASP A CA  1 
ATOM   3526 C  C   . ASP A 1 595 ? 7.275   18.982  -25.509 1.00 79.65  ? 595  ASP A C   1 
ATOM   3527 O  O   . ASP A 1 595 ? 6.959   17.978  -26.147 1.00 84.41  ? 595  ASP A O   1 
ATOM   3528 C  CB  . ASP A 1 595 ? 9.394   17.762  -24.942 1.00 92.00  ? 595  ASP A CB  1 
ATOM   3529 C  CG  . ASP A 1 595 ? 10.759  17.813  -24.277 1.00 99.10  ? 595  ASP A CG  1 
ATOM   3530 O  OD1 . ASP A 1 595 ? 11.395  18.888  -24.299 1.00 100.69 ? 595  ASP A OD1 1 
ATOM   3531 O  OD2 . ASP A 1 595 ? 11.196  16.775  -23.737 1.00 101.26 ? 595  ASP A OD2 1 
ATOM   3532 N  N   . SER A 1 596 ? 6.488   20.047  -25.385 1.00 77.61  ? 596  SER A N   1 
ATOM   3533 C  CA  . SER A 1 596 ? 5.131   20.078  -25.916 1.00 78.89  ? 596  SER A CA  1 
ATOM   3534 C  C   . SER A 1 596 ? 5.010   21.038  -27.094 1.00 81.42  ? 596  SER A C   1 
ATOM   3535 O  O   . SER A 1 596 ? 5.800   21.973  -27.230 1.00 81.35  ? 596  SER A O   1 
ATOM   3536 C  CB  . SER A 1 596 ? 4.144   20.472  -24.816 1.00 79.26  ? 596  SER A CB  1 
ATOM   3537 O  OG  . SER A 1 596 ? 2.828   20.579  -25.327 1.00 83.79  ? 596  SER A OG  1 
ATOM   3538 N  N   . SER A 1 597 ? 4.012   20.802  -27.940 1.00 83.44  ? 597  SER A N   1 
ATOM   3539 C  CA  . SER A 1 597 ? 3.822   21.602  -29.146 1.00 87.89  ? 597  SER A CA  1 
ATOM   3540 C  C   . SER A 1 597 ? 2.669   22.593  -29.007 1.00 82.84  ? 597  SER A C   1 
ATOM   3541 O  O   . SER A 1 597 ? 1.527   22.206  -28.749 1.00 85.15  ? 597  SER A O   1 
ATOM   3542 C  CB  . SER A 1 597 ? 3.604   20.696  -30.362 1.00 91.24  ? 597  SER A CB  1 
ATOM   3543 O  OG  . SER A 1 597 ? 2.513   19.816  -30.157 1.00 92.74  ? 597  SER A OG  1 
ATOM   3544 N  N   . GLY A 1 598 ? 2.982   23.874  -29.182 1.00 76.08  ? 598  GLY A N   1 
ATOM   3545 C  CA  . GLY A 1 598 ? 1.987   24.936  -29.081 1.00 65.35  ? 598  GLY A CA  1 
ATOM   3546 C  C   . GLY A 1 598 ? 2.612   26.269  -28.718 1.00 64.76  ? 598  GLY A C   1 
ATOM   3547 O  O   . GLY A 1 598 ? 3.832   26.377  -28.581 1.00 64.33  ? 598  GLY A O   1 
ATOM   3548 N  N   . SER A 1 599 ? 1.773   27.288  -28.563 1.00 63.85  ? 599  SER A N   1 
ATOM   3549 C  CA  . SER A 1 599 ? 2.234   28.616  -28.169 1.00 66.41  ? 599  SER A CA  1 
ATOM   3550 C  C   . SER A 1 599 ? 2.838   28.590  -26.769 1.00 69.84  ? 599  SER A C   1 
ATOM   3551 O  O   . SER A 1 599 ? 2.568   27.681  -25.986 1.00 78.71  ? 599  SER A O   1 
ATOM   3552 C  CB  . SER A 1 599 ? 1.076   29.616  -28.223 1.00 65.05  ? 599  SER A CB  1 
ATOM   3553 O  OG  . SER A 1 599 ? 1.450   30.863  -27.665 1.00 67.56  ? 599  SER A OG  1 
ATOM   3554 N  N   . ILE A 1 600 ? 3.654   29.592  -26.455 1.00 69.59  ? 600  ILE A N   1 
ATOM   3555 C  CA  . ILE A 1 600 ? 4.286   29.680  -25.141 1.00 71.14  ? 600  ILE A CA  1 
ATOM   3556 C  C   . ILE A 1 600 ? 3.255   29.960  -24.047 1.00 68.78  ? 600  ILE A C   1 
ATOM   3557 O  O   . ILE A 1 600 ? 3.498   29.696  -22.869 1.00 74.31  ? 600  ILE A O   1 
ATOM   3558 C  CB  . ILE A 1 600 ? 5.403   30.752  -25.115 1.00 72.44  ? 600  ILE A CB  1 
ATOM   3559 C  CG1 . ILE A 1 600 ? 6.247   30.622  -23.844 1.00 72.92  ? 600  ILE A CG1 1 
ATOM   3560 C  CG2 . ILE A 1 600 ? 4.815   32.152  -25.249 1.00 75.35  ? 600  ILE A CG2 1 
ATOM   3561 C  CD1 . ILE A 1 600 ? 7.456   31.533  -23.814 1.00 75.88  ? 600  ILE A CD1 1 
ATOM   3562 N  N   . GLY A 1 601 ? 2.101   30.486  -24.447 1.00 70.24  ? 601  GLY A N   1 
ATOM   3563 C  CA  . GLY A 1 601 ? 1.017   30.766  -23.513 1.00 63.05  ? 601  GLY A CA  1 
ATOM   3564 C  C   . GLY A 1 601 ? 0.114   29.564  -23.314 1.00 61.87  ? 601  GLY A C   1 
ATOM   3565 O  O   . GLY A 1 601 ? -0.408  29.344  -22.221 1.00 60.62  ? 601  GLY A O   1 
ATOM   3566 N  N   . ARG A 1 602 ? -0.069  28.785  -24.376 1.00 62.63  ? 602  ARG A N   1 
ATOM   3567 C  CA  . ARG A 1 602 ? -0.892  27.581  -24.318 1.00 68.93  ? 602  ARG A CA  1 
ATOM   3568 C  C   . ARG A 1 602 ? -0.198  26.483  -23.522 1.00 61.16  ? 602  ARG A C   1 
ATOM   3569 O  O   . ARG A 1 602 ? -0.852  25.660  -22.882 1.00 62.43  ? 602  ARG A O   1 
ATOM   3570 C  CB  . ARG A 1 602 ? -1.208  27.071  -25.725 1.00 80.21  ? 602  ARG A CB  1 
ATOM   3571 C  CG  . ARG A 1 602 ? -2.119  27.976  -26.537 1.00 90.94  ? 602  ARG A CG  1 
ATOM   3572 C  CD  . ARG A 1 602 ? -2.371  27.388  -27.917 1.00 97.82  ? 602  ARG A CD  1 
ATOM   3573 N  NE  . ARG A 1 602 ? -3.212  28.251  -28.742 1.00 101.90 ? 602  ARG A NE  1 
ATOM   3574 C  CZ  . ARG A 1 602 ? -3.549  27.983  -29.999 1.00 105.18 ? 602  ARG A CZ  1 
ATOM   3575 N  NH1 . ARG A 1 602 ? -3.117  26.873  -30.584 1.00 106.21 ? 602  ARG A NH1 1 
ATOM   3576 N  NH2 . ARG A 1 602 ? -4.319  28.826  -30.675 1.00 107.03 ? 602  ARG A NH2 1 
ATOM   3577 N  N   . ARG A 1 603 ? 1.131   26.476  -23.570 1.00 52.49  ? 603  ARG A N   1 
ATOM   3578 C  CA  . ARG A 1 603 ? 1.918   25.473  -22.864 1.00 51.14  ? 603  ARG A CA  1 
ATOM   3579 C  C   . ARG A 1 603 ? 1.872   25.690  -21.356 1.00 50.25  ? 603  ARG A C   1 
ATOM   3580 O  O   . ARG A 1 603 ? 1.794   24.732  -20.586 1.00 55.57  ? 603  ARG A O   1 
ATOM   3581 C  CB  . ARG A 1 603 ? 3.364   25.464  -23.364 1.00 50.78  ? 603  ARG A CB  1 
ATOM   3582 C  CG  . ARG A 1 603 ? 3.517   24.951  -24.788 1.00 50.35  ? 603  ARG A CG  1 
ATOM   3583 C  CD  . ARG A 1 603 ? 4.933   24.469  -25.062 1.00 53.78  ? 603  ARG A CD  1 
ATOM   3584 N  NE  . ARG A 1 603 ? 5.882   25.566  -25.225 1.00 51.20  ? 603  ARG A NE  1 
ATOM   3585 C  CZ  . ARG A 1 603 ? 7.203   25.412  -25.222 1.00 49.53  ? 603  ARG A CZ  1 
ATOM   3586 N  NH1 . ARG A 1 603 ? 7.731   24.207  -25.055 1.00 47.13  ? 603  ARG A NH1 1 
ATOM   3587 N  NH2 . ARG A 1 603 ? 7.995   26.462  -25.380 1.00 52.71  ? 603  ARG A NH2 1 
ATOM   3588 N  N   . TYR A 1 604 ? 1.918   26.953  -20.941 1.00 46.85  ? 604  TYR A N   1 
ATOM   3589 C  CA  . TYR A 1 604 ? 1.803   27.295  -19.528 1.00 45.28  ? 604  TYR A CA  1 
ATOM   3590 C  C   . TYR A 1 604 ? 0.401   27.026  -18.999 1.00 47.93  ? 604  TYR A C   1 
ATOM   3591 O  O   . TYR A 1 604 ? 0.232   26.635  -17.846 1.00 55.01  ? 604  TYR A O   1 
ATOM   3592 C  CB  . TYR A 1 604 ? 2.187   28.754  -19.281 1.00 39.85  ? 604  TYR A CB  1 
ATOM   3593 C  CG  . TYR A 1 604 ? 3.644   28.941  -18.936 1.00 41.82  ? 604  TYR A CG  1 
ATOM   3594 C  CD1 . TYR A 1 604 ? 4.413   29.908  -19.569 1.00 37.74  ? 604  TYR A CD1 1 
ATOM   3595 C  CD2 . TYR A 1 604 ? 4.254   28.141  -17.978 1.00 41.94  ? 604  TYR A CD2 1 
ATOM   3596 C  CE1 . TYR A 1 604 ? 5.747   30.077  -19.251 1.00 36.55  ? 604  TYR A CE1 1 
ATOM   3597 C  CE2 . TYR A 1 604 ? 5.584   28.301  -17.656 1.00 39.52  ? 604  TYR A CE2 1 
ATOM   3598 C  CZ  . TYR A 1 604 ? 6.327   29.269  -18.294 1.00 38.34  ? 604  TYR A CZ  1 
ATOM   3599 O  OH  . TYR A 1 604 ? 7.654   29.423  -17.968 1.00 41.82  ? 604  TYR A OH  1 
ATOM   3600 N  N   . ALA A 1 605 ? -0.599  27.237  -19.849 1.00 44.81  ? 605  ALA A N   1 
ATOM   3601 C  CA  . ALA A 1 605 ? -1.981  26.950  -19.491 1.00 39.38  ? 605  ALA A CA  1 
ATOM   3602 C  C   . ALA A 1 605 ? -2.136  25.475  -19.142 1.00 40.34  ? 605  ALA A C   1 
ATOM   3603 O  O   . ALA A 1 605 ? -2.880  25.118  -18.229 1.00 41.43  ? 605  ALA A O   1 
ATOM   3604 C  CB  . ALA A 1 605 ? -2.916  27.331  -20.629 1.00 39.09  ? 605  ALA A CB  1 
ATOM   3605 N  N   . ARG A 1 606 ? -1.421  24.624  -19.873 1.00 45.41  ? 606  ARG A N   1 
ATOM   3606 C  CA  . ARG A 1 606 ? -1.439  23.187  -19.623 1.00 51.18  ? 606  ARG A CA  1 
ATOM   3607 C  C   . ARG A 1 606 ? -0.791  22.818  -18.288 1.00 49.87  ? 606  ARG A C   1 
ATOM   3608 O  O   . ARG A 1 606 ? -1.301  21.967  -17.560 1.00 46.86  ? 606  ARG A O   1 
ATOM   3609 C  CB  . ARG A 1 606 ? -0.781  22.423  -20.778 1.00 56.96  ? 606  ARG A CB  1 
ATOM   3610 C  CG  . ARG A 1 606 ? -1.780  21.803  -21.747 1.00 65.68  ? 606  ARG A CG  1 
ATOM   3611 C  CD  . ARG A 1 606 ? -1.099  20.988  -22.840 1.00 67.92  ? 606  ARG A CD  1 
ATOM   3612 N  NE  . ARG A 1 606 ? -1.166  21.643  -24.145 1.00 76.19  ? 606  ARG A NE  1 
ATOM   3613 C  CZ  . ARG A 1 606 ? -0.148  22.267  -24.729 1.00 78.94  ? 606  ARG A CZ  1 
ATOM   3614 N  NH1 . ARG A 1 606 ? 1.033   22.329  -24.128 1.00 81.45  ? 606  ARG A NH1 1 
ATOM   3615 N  NH2 . ARG A 1 606 ? -0.311  22.830  -25.919 1.00 79.54  ? 606  ARG A NH2 1 
ATOM   3616 N  N   . THR A 1 607 ? 0.327   23.464  -17.969 1.00 41.85  ? 607  THR A N   1 
ATOM   3617 C  CA  . THR A 1 607 ? 1.017   23.211  -16.707 1.00 38.93  ? 607  THR A CA  1 
ATOM   3618 C  C   . THR A 1 607 ? 0.264   23.816  -15.523 1.00 43.67  ? 607  THR A C   1 
ATOM   3619 O  O   . THR A 1 607 ? 0.312   23.286  -14.413 1.00 42.34  ? 607  THR A O   1 
ATOM   3620 C  CB  . THR A 1 607 ? 2.463   23.745  -16.723 1.00 39.85  ? 607  THR A CB  1 
ATOM   3621 O  OG1 . THR A 1 607 ? 2.455   25.150  -17.006 1.00 40.52  ? 607  THR A OG1 1 
ATOM   3622 C  CG2 . THR A 1 607 ? 3.287   23.023  -17.776 1.00 36.11  ? 607  THR A CG2 1 
ATOM   3623 N  N   . ASP A 1 608 ? -0.426  24.928  -15.763 1.00 40.58  ? 608  ASP A N   1 
ATOM   3624 C  CA  . ASP A 1 608 ? -1.267  25.542  -14.740 1.00 38.77  ? 608  ASP A CA  1 
ATOM   3625 C  C   . ASP A 1 608 ? -2.423  24.616  -14.409 1.00 29.78  ? 608  ASP A C   1 
ATOM   3626 O  O   . ASP A 1 608 ? -2.871  24.542  -13.266 1.00 32.40  ? 608  ASP A O   1 
ATOM   3627 C  CB  . ASP A 1 608 ? -1.820  26.881  -15.225 1.00 40.50  ? 608  ASP A CB  1 
ATOM   3628 C  CG  . ASP A 1 608 ? -0.749  27.935  -15.373 1.00 44.88  ? 608  ASP A CG  1 
ATOM   3629 O  OD1 . ASP A 1 608 ? 0.402   27.680  -14.959 1.00 47.04  ? 608  ASP A OD1 1 
ATOM   3630 O  OD2 . ASP A 1 608 ? -1.058  29.022  -15.906 1.00 48.65  ? 608  ASP A OD2 1 
ATOM   3631 N  N   . GLU A 1 609 ? -2.896  23.909  -15.428 1.00 37.39  ? 609  GLU A N   1 
ATOM   3632 C  CA  . GLU A 1 609 ? -4.052  23.035  -15.303 1.00 36.77  ? 609  GLU A CA  1 
ATOM   3633 C  C   . GLU A 1 609 ? -3.805  21.910  -14.305 1.00 36.84  ? 609  GLU A C   1 
ATOM   3634 O  O   . GLU A 1 609 ? -4.735  21.437  -13.655 1.00 48.15  ? 609  GLU A O   1 
ATOM   3635 C  CB  . GLU A 1 609 ? -4.421  22.462  -16.671 1.00 41.94  ? 609  GLU A CB  1 
ATOM   3636 C  CG  . GLU A 1 609 ? -5.859  22.006  -16.787 1.00 47.64  ? 609  GLU A CG  1 
ATOM   3637 C  CD  . GLU A 1 609 ? -6.257  21.708  -18.217 1.00 51.27  ? 609  GLU A CD  1 
ATOM   3638 O  OE1 . GLU A 1 609 ? -5.427  21.149  -18.965 1.00 49.40  ? 609  GLU A OE1 1 
ATOM   3639 O  OE2 . GLU A 1 609 ? -7.404  22.032  -18.592 1.00 51.83  ? 609  GLU A OE2 1 
ATOM   3640 N  N   . ILE A 1 610 ? -2.551  21.484  -14.185 1.00 36.92  ? 610  ILE A N   1 
ATOM   3641 C  CA  . ILE A 1 610 ? -2.193  20.443  -13.226 1.00 35.03  ? 610  ILE A CA  1 
ATOM   3642 C  C   . ILE A 1 610 ? -1.583  21.017  -11.949 1.00 38.66  ? 610  ILE A C   1 
ATOM   3643 O  O   . ILE A 1 610 ? -1.212  20.277  -11.038 1.00 47.10  ? 610  ILE A O   1 
ATOM   3644 C  CB  . ILE A 1 610 ? -1.260  19.377  -13.840 1.00 33.46  ? 610  ILE A CB  1 
ATOM   3645 C  CG1 . ILE A 1 610 ? -0.054  20.034  -14.516 1.00 30.58  ? 610  ILE A CG1 1 
ATOM   3646 C  CG2 . ILE A 1 610 ? -2.028  18.513  -14.828 1.00 31.86  ? 610  ILE A CG2 1 
ATOM   3647 C  CD1 . ILE A 1 610 ? 0.984   19.046  -15.006 1.00 25.89  ? 610  ILE A CD1 1 
ATOM   3648 N  N   . GLY A 1 611 ? -1.482  22.342  -11.892 1.00 33.90  ? 611  GLY A N   1 
ATOM   3649 C  CA  . GLY A 1 611 ? -1.117  23.035  -10.662 1.00 28.68  ? 611  GLY A CA  1 
ATOM   3650 C  C   . GLY A 1 611 ? 0.363   23.268  -10.424 1.00 29.31  ? 611  GLY A C   1 
ATOM   3651 O  O   . GLY A 1 611 ? 0.776   23.519  -9.293  1.00 36.59  ? 611  GLY A O   1 
ATOM   3652 N  N   . VAL A 1 612 ? 1.164   23.192  -11.482 1.00 29.67  ? 612  VAL A N   1 
ATOM   3653 C  CA  . VAL A 1 612 ? 2.600   23.434  -11.364 1.00 24.14  ? 612  VAL A CA  1 
ATOM   3654 C  C   . VAL A 1 612 ? 2.849   24.844  -10.837 1.00 28.56  ? 612  VAL A C   1 
ATOM   3655 O  O   . VAL A 1 612 ? 2.379   25.825  -11.413 1.00 28.60  ? 612  VAL A O   1 
ATOM   3656 C  CB  . VAL A 1 612 ? 3.329   23.230  -12.706 1.00 25.47  ? 612  VAL A CB  1 
ATOM   3657 C  CG1 . VAL A 1 612 ? 4.827   23.432  -12.536 1.00 21.88  ? 612  VAL A CG1 1 
ATOM   3658 C  CG2 . VAL A 1 612 ? 3.040   21.844  -13.255 1.00 22.35  ? 612  VAL A CG2 1 
ATOM   3659 N  N   . ALA A 1 613 ? 3.589   24.932  -9.736  1.00 31.07  ? 613  ALA A N   1 
ATOM   3660 C  CA  . ALA A 1 613 ? 3.754   26.184  -9.003  1.00 29.07  ? 613  ALA A CA  1 
ATOM   3661 C  C   . ALA A 1 613 ? 4.482   27.273  -9.788  1.00 36.50  ? 613  ALA A C   1 
ATOM   3662 O  O   . ALA A 1 613 ? 4.038   28.421  -9.820  1.00 40.29  ? 613  ALA A O   1 
ATOM   3663 C  CB  . ALA A 1 613 ? 4.455   25.927  -7.674  1.00 31.52  ? 613  ALA A CB  1 
ATOM   3664 N  N   . PHE A 1 614 ? 5.599   26.920  -10.413 1.00 39.95  ? 614  PHE A N   1 
ATOM   3665 C  CA  . PHE A 1 614 ? 6.410   27.910  -11.115 1.00 37.05  ? 614  PHE A CA  1 
ATOM   3666 C  C   . PHE A 1 614 ? 6.792   27.470  -12.522 1.00 37.73  ? 614  PHE A C   1 
ATOM   3667 O  O   . PHE A 1 614 ? 6.591   26.317  -12.902 1.00 47.42  ? 614  PHE A O   1 
ATOM   3668 C  CB  . PHE A 1 614 ? 7.663   28.246  -10.304 1.00 28.85  ? 614  PHE A CB  1 
ATOM   3669 C  CG  . PHE A 1 614 ? 7.368   28.740  -8.919  1.00 35.80  ? 614  PHE A CG  1 
ATOM   3670 C  CD1 . PHE A 1 614 ? 7.010   30.061  -8.702  1.00 34.74  ? 614  PHE A CD1 1 
ATOM   3671 C  CD2 . PHE A 1 614 ? 7.441   27.882  -7.834  1.00 34.59  ? 614  PHE A CD2 1 
ATOM   3672 C  CE1 . PHE A 1 614 ? 6.735   30.518  -7.428  1.00 31.87  ? 614  PHE A CE1 1 
ATOM   3673 C  CE2 . PHE A 1 614 ? 7.166   28.332  -6.557  1.00 32.56  ? 614  PHE A CE2 1 
ATOM   3674 C  CZ  . PHE A 1 614 ? 6.812   29.652  -6.354  1.00 34.25  ? 614  PHE A CZ  1 
ATOM   3675 N  N   . GLY A 1 615 ? 7.342   28.404  -13.289 1.00 42.59  ? 615  GLY A N   1 
ATOM   3676 C  CA  . GLY A 1 615 ? 7.763   28.128  -14.655 1.00 40.71  ? 615  GLY A CA  1 
ATOM   3677 C  C   . GLY A 1 615 ? 8.947   28.975  -15.072 1.00 44.92  ? 615  GLY A C   1 
ATOM   3678 O  O   . GLY A 1 615 ? 9.026   30.157  -14.738 1.00 47.49  ? 615  GLY A O   1 
ATOM   3679 N  N   . VAL A 1 616 ? 9.877   28.364  -15.798 1.00 45.89  ? 616  VAL A N   1 
ATOM   3680 C  CA  . VAL A 1 616 ? 11.028  29.080  -16.334 1.00 35.92  ? 616  VAL A CA  1 
ATOM   3681 C  C   . VAL A 1 616 ? 11.089  28.892  -17.843 1.00 36.68  ? 616  VAL A C   1 
ATOM   3682 O  O   . VAL A 1 616 ? 11.268  27.777  -18.329 1.00 34.47  ? 616  VAL A O   1 
ATOM   3683 C  CB  . VAL A 1 616 ? 12.347  28.593  -15.705 1.00 32.72  ? 616  VAL A CB  1 
ATOM   3684 C  CG1 . VAL A 1 616 ? 13.536  29.239  -16.399 1.00 27.41  ? 616  VAL A CG1 1 
ATOM   3685 C  CG2 . VAL A 1 616 ? 12.368  28.887  -14.213 1.00 29.08  ? 616  VAL A CG2 1 
ATOM   3686 N  N   . THR A 1 617 ? 10.930  29.985  -18.584 1.00 43.67  ? 617  THR A N   1 
ATOM   3687 C  CA  . THR A 1 617 ? 10.975  29.919  -20.038 1.00 44.86  ? 617  THR A CA  1 
ATOM   3688 C  C   . THR A 1 617 ? 12.351  30.331  -20.546 1.00 45.71  ? 617  THR A C   1 
ATOM   3689 O  O   . THR A 1 617 ? 12.871  31.383  -20.173 1.00 47.92  ? 617  THR A O   1 
ATOM   3690 C  CB  . THR A 1 617 ? 9.921   30.829  -20.693 1.00 49.69  ? 617  THR A CB  1 
ATOM   3691 O  OG1 . THR A 1 617 ? 10.571  31.924  -21.349 1.00 54.33  ? 617  THR A OG1 1 
ATOM   3692 C  CG2 . THR A 1 617 ? 8.945   31.357  -19.658 1.00 50.80  ? 617  THR A CG2 1 
ATOM   3693 N  N   . ILE A 1 618 ? 12.935  29.494  -21.396 1.00 42.94  ? 618  ILE A N   1 
ATOM   3694 C  CA  . ILE A 1 618 ? 14.233  29.784  -21.989 1.00 43.25  ? 618  ILE A CA  1 
ATOM   3695 C  C   . ILE A 1 618 ? 14.066  30.182  -23.451 1.00 37.56  ? 618  ILE A C   1 
ATOM   3696 O  O   . ILE A 1 618 ? 13.562  29.404  -24.260 1.00 42.12  ? 618  ILE A O   1 
ATOM   3697 C  CB  . ILE A 1 618 ? 15.186  28.578  -21.880 1.00 44.77  ? 618  ILE A CB  1 
ATOM   3698 C  CG1 . ILE A 1 618 ? 15.419  28.218  -20.410 1.00 43.98  ? 618  ILE A CG1 1 
ATOM   3699 C  CG2 . ILE A 1 618 ? 16.507  28.874  -22.578 1.00 40.97  ? 618  ILE A CG2 1 
ATOM   3700 C  CD1 . ILE A 1 618 ? 16.246  26.967  -20.203 1.00 47.31  ? 618  ILE A CD1 1 
ATOM   3701 N  N   . ASP A 1 619 ? 14.485  31.400  -23.781 1.00 44.87  ? 619  ASP A N   1 
ATOM   3702 C  CA  . ASP A 1 619 ? 14.349  31.918  -25.140 1.00 48.24  ? 619  ASP A CA  1 
ATOM   3703 C  C   . ASP A 1 619 ? 15.705  32.150  -25.805 1.00 52.88  ? 619  ASP A C   1 
ATOM   3704 O  O   . ASP A 1 619 ? 16.749  31.816  -25.243 1.00 45.75  ? 619  ASP A O   1 
ATOM   3705 C  CB  . ASP A 1 619 ? 13.516  33.205  -25.147 1.00 45.12  ? 619  ASP A CB  1 
ATOM   3706 C  CG  . ASP A 1 619 ? 14.060  34.261  -24.201 1.00 47.21  ? 619  ASP A CG  1 
ATOM   3707 O  OD1 . ASP A 1 619 ? 15.294  34.336  -24.023 1.00 49.52  ? 619  ASP A OD1 1 
ATOM   3708 O  OD2 . ASP A 1 619 ? 13.247  35.024  -23.638 1.00 48.08  ? 619  ASP A OD2 1 
ATOM   3709 N  N   . PHE A 1 620 ? 15.679  32.727  -27.004 1.00 52.61  ? 620  PHE A N   1 
ATOM   3710 C  CA  . PHE A 1 620 ? 16.898  32.973  -27.769 1.00 46.88  ? 620  PHE A CA  1 
ATOM   3711 C  C   . PHE A 1 620 ? 17.823  33.972  -27.081 1.00 46.01  ? 620  PHE A C   1 
ATOM   3712 O  O   . PHE A 1 620 ? 19.047  33.834  -27.134 1.00 48.66  ? 620  PHE A O   1 
ATOM   3713 C  CB  . PHE A 1 620 ? 16.563  33.448  -29.186 1.00 42.73  ? 620  PHE A CB  1 
ATOM   3714 C  CG  . PHE A 1 620 ? 16.025  32.364  -30.077 1.00 38.28  ? 620  PHE A CG  1 
ATOM   3715 C  CD1 . PHE A 1 620 ? 14.725  32.417  -30.550 1.00 35.94  ? 620  PHE A CD1 1 
ATOM   3716 C  CD2 . PHE A 1 620 ? 16.820  31.288  -30.437 1.00 38.78  ? 620  PHE A CD2 1 
ATOM   3717 C  CE1 . PHE A 1 620 ? 14.228  31.418  -31.371 1.00 36.43  ? 620  PHE A CE1 1 
ATOM   3718 C  CE2 . PHE A 1 620 ? 16.330  30.286  -31.256 1.00 36.25  ? 620  PHE A CE2 1 
ATOM   3719 C  CZ  . PHE A 1 620 ? 15.033  30.351  -31.724 1.00 35.57  ? 620  PHE A CZ  1 
ATOM   3720 N  N   . ASP A 1 621 ? 17.234  34.974  -26.437 1.00 46.77  ? 621  ASP A N   1 
ATOM   3721 C  CA  . ASP A 1 621 ? 18.006  35.970  -25.702 1.00 48.34  ? 621  ASP A CA  1 
ATOM   3722 C  C   . ASP A 1 621 ? 18.764  35.332  -24.543 1.00 45.19  ? 621  ASP A C   1 
ATOM   3723 O  O   . ASP A 1 621 ? 19.863  35.766  -24.195 1.00 46.59  ? 621  ASP A O   1 
ATOM   3724 C  CB  . ASP A 1 621 ? 17.096  37.085  -25.184 1.00 60.04  ? 621  ASP A CB  1 
ATOM   3725 C  CG  . ASP A 1 621 ? 16.655  38.038  -26.278 1.00 66.00  ? 621  ASP A CG  1 
ATOM   3726 O  OD1 . ASP A 1 621 ? 16.566  37.610  -27.448 1.00 69.80  ? 621  ASP A OD1 1 
ATOM   3727 O  OD2 . ASP A 1 621 ? 16.394  39.219  -25.964 1.00 68.45  ? 621  ASP A OD2 1 
ATOM   3728 N  N   . THR A 1 622 ? 18.169  34.301  -23.951 1.00 47.67  ? 622  THR A N   1 
ATOM   3729 C  CA  . THR A 1 622 ? 18.796  33.569  -22.856 1.00 44.80  ? 622  THR A CA  1 
ATOM   3730 C  C   . THR A 1 622 ? 20.090  32.909  -23.318 1.00 45.31  ? 622  THR A C   1 
ATOM   3731 O  O   . THR A 1 622 ? 21.075  32.872  -22.584 1.00 42.65  ? 622  THR A O   1 
ATOM   3732 C  CB  . THR A 1 622 ? 17.854  32.487  -22.286 1.00 39.39  ? 622  THR A CB  1 
ATOM   3733 O  OG1 . THR A 1 622 ? 16.627  33.092  -21.861 1.00 31.25  ? 622  THR A OG1 1 
ATOM   3734 C  CG2 . THR A 1 622 ? 18.500  31.779  -21.103 1.00 35.37  ? 622  THR A CG2 1 
ATOM   3735 N  N   . VAL A 1 623 ? 20.080  32.396  -24.544 1.00 42.12  ? 623  VAL A N   1 
ATOM   3736 C  CA  . VAL A 1 623 ? 21.238  31.704  -25.095 1.00 47.08  ? 623  VAL A CA  1 
ATOM   3737 C  C   . VAL A 1 623 ? 22.286  32.677  -25.633 1.00 52.69  ? 623  VAL A C   1 
ATOM   3738 O  O   . VAL A 1 623 ? 23.488  32.441  -25.499 1.00 49.07  ? 623  VAL A O   1 
ATOM   3739 C  CB  . VAL A 1 623 ? 20.820  30.738  -26.228 1.00 41.93  ? 623  VAL A CB  1 
ATOM   3740 C  CG1 . VAL A 1 623 ? 22.036  30.037  -26.818 1.00 41.43  ? 623  VAL A CG1 1 
ATOM   3741 C  CG2 . VAL A 1 623 ? 19.813  29.723  -25.714 1.00 42.14  ? 623  VAL A CG2 1 
ATOM   3742 N  N   . ASN A 1 624 ? 21.827  33.779  -26.221 1.00 56.98  ? 624  ASN A N   1 
ATOM   3743 C  CA  . ASN A 1 624 ? 22.698  34.632  -27.034 1.00 58.17  ? 624  ASN A CA  1 
ATOM   3744 C  C   . ASN A 1 624 ? 23.072  36.013  -26.476 1.00 59.15  ? 624  ASN A C   1 
ATOM   3745 O  O   . ASN A 1 624 ? 23.698  36.808  -27.177 1.00 69.41  ? 624  ASN A O   1 
ATOM   3746 C  CB  . ASN A 1 624 ? 22.105  34.782  -28.440 1.00 52.44  ? 624  ASN A CB  1 
ATOM   3747 C  CG  . ASN A 1 624 ? 22.002  33.458  -29.174 1.00 52.40  ? 624  ASN A CG  1 
ATOM   3748 O  OD1 . ASN A 1 624 ? 22.975  32.711  -29.271 1.00 51.37  ? 624  ASN A OD1 1 
ATOM   3749 N  ND2 . ASN A 1 624 ? 20.819  33.164  -29.701 1.00 51.14  ? 624  ASN A ND2 1 
ATOM   3750 N  N   . LYS A 1 625 ? 22.696  36.306  -25.233 1.00 57.93  ? 625  LYS A N   1 
ATOM   3751 C  CA  . LYS A 1 625 ? 23.071  37.580  -24.599 1.00 56.33  ? 625  LYS A CA  1 
ATOM   3752 C  C   . LYS A 1 625 ? 23.700  37.327  -23.229 1.00 57.15  ? 625  LYS A C   1 
ATOM   3753 O  O   . LYS A 1 625 ? 23.340  36.359  -22.559 1.00 62.10  ? 625  LYS A O   1 
ATOM   3754 C  CB  . LYS A 1 625 ? 21.864  38.515  -24.499 1.00 52.57  ? 625  LYS A CB  1 
ATOM   3755 C  CG  . LYS A 1 625 ? 21.319  38.948  -25.851 1.00 52.90  ? 625  LYS A CG  1 
ATOM   3756 C  CD  . LYS A 1 625 ? 20.298  40.063  -25.718 1.00 56.17  ? 625  LYS A CD  1 
ATOM   3757 C  CE  . LYS A 1 625 ? 19.909  40.608  -27.084 1.00 58.31  ? 625  LYS A CE  1 
ATOM   3758 N  NZ  . LYS A 1 625 ? 18.963  41.753  -26.978 1.00 63.97  ? 625  LYS A NZ  1 
ATOM   3759 N  N   . THR A 1 626 ? 24.628  38.183  -22.799 1.00 64.13  ? 626  THR A N   1 
ATOM   3760 C  CA  . THR A 1 626 ? 25.577  37.733  -21.768 1.00 73.20  ? 626  THR A CA  1 
ATOM   3761 C  C   . THR A 1 626 ? 25.516  38.158  -20.289 1.00 80.63  ? 626  THR A C   1 
ATOM   3762 O  O   . THR A 1 626 ? 26.542  38.149  -19.588 1.00 92.79  ? 626  THR A O   1 
ATOM   3763 C  CB  . THR A 1 626 ? 27.038  37.677  -22.293 1.00 73.57  ? 626  THR A CB  1 
ATOM   3764 O  OG1 . THR A 1 626 ? 27.117  36.710  -23.350 1.00 73.98  ? 626  THR A OG1 1 
ATOM   3765 C  CG2 . THR A 1 626 ? 27.995  37.251  -21.190 1.00 74.08  ? 626  THR A CG2 1 
ATOM   3766 N  N   . PRO A 1 627 ? 24.331  38.575  -19.819 1.00 80.64  ? 627  PRO A N   1 
ATOM   3767 C  CA  . PRO A 1 627 ? 23.941  37.919  -18.593 1.00 68.41  ? 627  PRO A CA  1 
ATOM   3768 C  C   . PRO A 1 627 ? 22.897  36.893  -19.035 1.00 59.78  ? 627  PRO A C   1 
ATOM   3769 O  O   . PRO A 1 627 ? 21.793  37.284  -19.412 1.00 60.71  ? 627  PRO A O   1 
ATOM   3770 C  CB  . PRO A 1 627 ? 23.289  39.047  -17.787 1.00 77.54  ? 627  PRO A CB  1 
ATOM   3771 C  CG  . PRO A 1 627 ? 22.888  40.114  -18.831 1.00 82.98  ? 627  PRO A CG  1 
ATOM   3772 C  CD  . PRO A 1 627 ? 23.384  39.642  -20.185 1.00 83.70  ? 627  PRO A CD  1 
ATOM   3773 N  N   . HIS A 1 628 ? 23.233  35.607  -19.051 1.00 55.08  ? 628  HIS A N   1 
ATOM   3774 C  CA  . HIS A 1 628 ? 22.251  34.619  -19.498 1.00 43.17  ? 628  HIS A CA  1 
ATOM   3775 C  C   . HIS A 1 628 ? 21.067  34.578  -18.540 1.00 42.00  ? 628  HIS A C   1 
ATOM   3776 O  O   . HIS A 1 628 ? 21.158  34.025  -17.444 1.00 37.15  ? 628  HIS A O   1 
ATOM   3777 C  CB  . HIS A 1 628 ? 22.874  33.233  -19.665 1.00 44.57  ? 628  HIS A CB  1 
ATOM   3778 C  CG  . HIS A 1 628 ? 23.812  33.132  -20.825 1.00 43.03  ? 628  HIS A CG  1 
ATOM   3779 N  ND1 . HIS A 1 628 ? 25.180  33.209  -20.680 1.00 41.19  ? 628  HIS A ND1 1 
ATOM   3780 C  CD2 . HIS A 1 628 ? 23.583  32.971  -22.150 1.00 44.62  ? 628  HIS A CD2 1 
ATOM   3781 C  CE1 . HIS A 1 628 ? 25.754  33.093  -21.864 1.00 39.40  ? 628  HIS A CE1 1 
ATOM   3782 N  NE2 . HIS A 1 628 ? 24.807  32.949  -22.774 1.00 42.16  ? 628  HIS A NE2 1 
ATOM   3783 N  N   . THR A 1 629 ? 19.961  35.187  -18.958 1.00 35.18  ? 629  THR A N   1 
ATOM   3784 C  CA  . THR A 1 629 ? 18.778  35.278  -18.113 1.00 39.59  ? 629  THR A CA  1 
ATOM   3785 C  C   . THR A 1 629 ? 17.563  34.633  -18.766 1.00 41.23  ? 629  THR A C   1 
ATOM   3786 O  O   . THR A 1 629 ? 17.357  34.744  -19.973 1.00 39.40  ? 629  THR A O   1 
ATOM   3787 C  CB  . THR A 1 629 ? 18.425  36.744  -17.771 1.00 35.60  ? 629  THR A CB  1 
ATOM   3788 O  OG1 . THR A 1 629 ? 17.828  37.375  -18.910 1.00 37.56  ? 629  THR A OG1 1 
ATOM   3789 C  CG2 . THR A 1 629 ? 19.660  37.521  -17.341 1.00 26.76  ? 629  THR A CG2 1 
ATOM   3790 N  N   . ALA A 1 630 ? 16.764  33.956  -17.950 1.00 42.36  ? 630  ALA A N   1 
ATOM   3791 C  CA  . ALA A 1 630 ? 15.490  33.414  -18.392 1.00 41.06  ? 630  ALA A CA  1 
ATOM   3792 C  C   . ALA A 1 630 ? 14.383  34.071  -17.580 1.00 44.22  ? 630  ALA A C   1 
ATOM   3793 O  O   . ALA A 1 630 ? 14.656  34.801  -16.625 1.00 43.18  ? 630  ALA A O   1 
ATOM   3794 C  CB  . ALA A 1 630 ? 15.463  31.908  -18.215 1.00 31.76  ? 630  ALA A CB  1 
ATOM   3795 N  N   . THR A 1 631 ? 13.136  33.818  -17.958 1.00 40.16  ? 631  THR A N   1 
ATOM   3796 C  CA  . THR A 1 631 ? 12.009  34.415  -17.254 1.00 37.95  ? 631  THR A CA  1 
ATOM   3797 C  C   . THR A 1 631 ? 11.305  33.428  -16.327 1.00 40.10  ? 631  THR A C   1 
ATOM   3798 O  O   . THR A 1 631 ? 11.071  32.275  -16.687 1.00 36.22  ? 631  THR A O   1 
ATOM   3799 C  CB  . THR A 1 631 ? 10.997  35.061  -18.227 1.00 40.57  ? 631  THR A CB  1 
ATOM   3800 O  OG1 . THR A 1 631 ? 9.683   35.014  -17.655 1.00 40.73  ? 631  THR A OG1 1 
ATOM   3801 C  CG2 . THR A 1 631 ? 10.988  34.332  -19.552 1.00 42.28  ? 631  THR A CG2 1 
ATOM   3802 N  N   . LEU A 1 632 ? 10.980  33.898  -15.128 1.00 39.14  ? 632  LEU A N   1 
ATOM   3803 C  CA  . LEU A 1 632 ? 10.318  33.080  -14.122 1.00 33.84  ? 632  LEU A CA  1 
ATOM   3804 C  C   . LEU A 1 632 ? 8.870   33.526  -13.960 1.00 38.51  ? 632  LEU A C   1 
ATOM   3805 O  O   . LEU A 1 632 ? 8.601   34.700  -13.708 1.00 40.18  ? 632  LEU A O   1 
ATOM   3806 C  CB  . LEU A 1 632 ? 11.059  33.192  -12.788 1.00 27.84  ? 632  LEU A CB  1 
ATOM   3807 C  CG  . LEU A 1 632 ? 10.445  32.524  -11.558 1.00 28.58  ? 632  LEU A CG  1 
ATOM   3808 C  CD1 . LEU A 1 632 ? 10.425  31.012  -11.714 1.00 28.23  ? 632  LEU A CD1 1 
ATOM   3809 C  CD2 . LEU A 1 632 ? 11.207  32.926  -10.306 1.00 25.34  ? 632  LEU A CD2 1 
ATOM   3810 N  N   . ARG A 1 633 ? 7.940   32.587  -14.106 1.00 35.03  ? 633  ARG A N   1 
ATOM   3811 C  CA  . ARG A 1 633 ? 6.520   32.908  -14.029 1.00 36.39  ? 633  ARG A CA  1 
ATOM   3812 C  C   . ARG A 1 633 ? 5.876   32.339  -12.769 1.00 40.17  ? 633  ARG A C   1 
ATOM   3813 O  O   . ARG A 1 633 ? 6.141   31.200  -12.385 1.00 42.56  ? 633  ARG A O   1 
ATOM   3814 C  CB  . ARG A 1 633 ? 5.782   32.392  -15.268 1.00 29.39  ? 633  ARG A CB  1 
ATOM   3815 C  CG  . ARG A 1 633 ? 4.512   33.163  -15.581 1.00 33.35  ? 633  ARG A CG  1 
ATOM   3816 C  CD  . ARG A 1 633 ? 3.628   32.449  -16.589 1.00 30.72  ? 633  ARG A CD  1 
ATOM   3817 N  NE  . ARG A 1 633 ? 2.855   31.385  -15.960 1.00 38.59  ? 633  ARG A NE  1 
ATOM   3818 C  CZ  . ARG A 1 633 ? 1.643   31.008  -16.352 1.00 38.51  ? 633  ARG A CZ  1 
ATOM   3819 N  NH1 . ARG A 1 633 ? 1.050   31.613  -17.371 1.00 40.54  ? 633  ARG A NH1 1 
ATOM   3820 N  NH2 . ARG A 1 633 ? 1.020   30.030  -15.715 1.00 46.70  ? 633  ARG A NH2 1 
ATOM   3821 N  N   . ASP A 1 634 ? 5.031   33.144  -12.132 1.00 35.17  ? 634  ASP A N   1 
ATOM   3822 C  CA  . ASP A 1 634 ? 4.257   32.700  -10.978 1.00 33.51  ? 634  ASP A CA  1 
ATOM   3823 C  C   . ASP A 1 634 ? 2.917   32.143  -11.449 1.00 38.04  ? 634  ASP A C   1 
ATOM   3824 O  O   . ASP A 1 634 ? 2.215   32.787  -12.227 1.00 45.25  ? 634  ASP A O   1 
ATOM   3825 C  CB  . ASP A 1 634 ? 4.031   33.864  -10.012 1.00 37.93  ? 634  ASP A CB  1 
ATOM   3826 C  CG  . ASP A 1 634 ? 3.146   33.486  -8.840  1.00 43.87  ? 634  ASP A CG  1 
ATOM   3827 O  OD1 . ASP A 1 634 ? 2.012   34.007  -8.760  1.00 43.53  ? 634  ASP A OD1 1 
ATOM   3828 O  OD2 . ASP A 1 634 ? 3.579   32.664  -8.005  1.00 45.56  ? 634  ASP A OD2 1 
ATOM   3829 N  N   . ARG A 1 635 ? 2.563   30.951  -10.978 1.00 31.49  ? 635  ARG A N   1 
ATOM   3830 C  CA  . ARG A 1 635 ? 1.330   30.294  -11.409 1.00 36.66  ? 635  ARG A CA  1 
ATOM   3831 C  C   . ARG A 1 635 ? 0.090   31.148  -11.151 1.00 36.70  ? 635  ARG A C   1 
ATOM   3832 O  O   . ARG A 1 635 ? -0.657  31.470  -12.074 1.00 39.17  ? 635  ARG A O   1 
ATOM   3833 C  CB  . ARG A 1 635 ? 1.154   28.944  -10.712 1.00 29.15  ? 635  ARG A CB  1 
ATOM   3834 C  CG  . ARG A 1 635 ? -0.035  28.156  -11.231 1.00 30.51  ? 635  ARG A CG  1 
ATOM   3835 C  CD  . ARG A 1 635 ? -0.933  27.664  -10.106 1.00 36.86  ? 635  ARG A CD  1 
ATOM   3836 N  NE  . ARG A 1 635 ? -0.309  26.623  -9.296  1.00 43.64  ? 635  ARG A NE  1 
ATOM   3837 C  CZ  . ARG A 1 635 ? 0.032   26.769  -8.020  1.00 38.50  ? 635  ARG A CZ  1 
ATOM   3838 N  NH1 . ARG A 1 635 ? -0.193  27.916  -7.395  1.00 37.39  ? 635  ARG A NH1 1 
ATOM   3839 N  NH2 . ARG A 1 635 ? 0.595   25.762  -7.368  1.00 37.94  ? 635  ARG A NH2 1 
ATOM   3840 N  N   . ASP A 1 636 ? -0.117  31.503  -9.887  1.00 43.07  ? 636  ASP A N   1 
ATOM   3841 C  CA  . ASP A 1 636 ? -1.331  32.190  -9.454  1.00 40.45  ? 636  ASP A CA  1 
ATOM   3842 C  C   . ASP A 1 636 ? -1.570  33.515  -10.172 1.00 43.62  ? 636  ASP A C   1 
ATOM   3843 O  O   . ASP A 1 636 ? -2.621  33.717  -10.780 1.00 51.59  ? 636  ASP A O   1 
ATOM   3844 C  CB  . ASP A 1 636 ? -1.299  32.418  -7.940  1.00 44.68  ? 636  ASP A CB  1 
ATOM   3845 C  CG  . ASP A 1 636 ? -1.365  31.123  -7.152  1.00 42.48  ? 636  ASP A CG  1 
ATOM   3846 O  OD1 . ASP A 1 636 ? -1.910  30.129  -7.676  1.00 42.57  ? 636  ASP A OD1 1 
ATOM   3847 O  OD2 . ASP A 1 636 ? -0.874  31.102  -6.004  1.00 43.20  ? 636  ASP A OD2 1 
ATOM   3848 N  N   . SER A 1 637 ? -0.592  34.412  -10.099 1.00 41.99  ? 637  SER A N   1 
ATOM   3849 C  CA  . SER A 1 637 ? -0.746  35.756  -10.648 1.00 41.28  ? 637  SER A CA  1 
ATOM   3850 C  C   . SER A 1 637 ? -0.419  35.834  -12.137 1.00 48.32  ? 637  SER A C   1 
ATOM   3851 O  O   . SER A 1 637 ? -0.860  36.756  -12.824 1.00 46.89  ? 637  SER A O   1 
ATOM   3852 C  CB  . SER A 1 637 ? 0.127   36.746  -9.877  1.00 38.04  ? 637  SER A CB  1 
ATOM   3853 O  OG  . SER A 1 637 ? 1.501   36.452  -10.053 1.00 42.41  ? 637  SER A OG  1 
ATOM   3854 N  N   . MET A 1 638 ? 0.358   34.871  -12.625 1.00 51.26  ? 638  MET A N   1 
ATOM   3855 C  CA  . MET A 1 638 ? 0.803   34.860  -14.018 1.00 44.40  ? 638  MET A CA  1 
ATOM   3856 C  C   . MET A 1 638 ? 1.880   35.911  -14.281 1.00 43.50  ? 638  MET A C   1 
ATOM   3857 O  O   . MET A 1 638 ? 2.302   36.107  -15.422 1.00 44.47  ? 638  MET A O   1 
ATOM   3858 C  CB  . MET A 1 638 ? -0.376  35.066  -14.969 1.00 40.68  ? 638  MET A CB  1 
ATOM   3859 C  CG  . MET A 1 638 ? -1.124  33.799  -15.320 1.00 40.02  ? 638  MET A CG  1 
ATOM   3860 S  SD  . MET A 1 638 ? -2.655  34.157  -16.195 1.00 43.47  ? 638  MET A SD  1 
ATOM   3861 C  CE  . MET A 1 638 ? -2.718  32.780  -17.336 1.00 47.33  ? 638  MET A CE  1 
ATOM   3862 N  N   . ARG A 1 639 ? 2.319   36.582  -13.222 1.00 35.18  ? 639  ARG A N   1 
ATOM   3863 C  CA  . ARG A 1 639 ? 3.340   37.618  -13.337 1.00 43.96  ? 639  ARG A CA  1 
ATOM   3864 C  C   . ARG A 1 639 ? 4.716   36.998  -13.551 1.00 38.73  ? 639  ARG A C   1 
ATOM   3865 O  O   . ARG A 1 639 ? 4.970   35.872  -13.123 1.00 46.04  ? 639  ARG A O   1 
ATOM   3866 C  CB  . ARG A 1 639 ? 3.333   38.515  -12.097 1.00 41.82  ? 639  ARG A CB  1 
ATOM   3867 C  CG  . ARG A 1 639 ? 2.040   39.300  -11.925 1.00 41.22  ? 639  ARG A CG  1 
ATOM   3868 C  CD  . ARG A 1 639 ? 1.925   39.914  -10.539 1.00 44.50  ? 639  ARG A CD  1 
ATOM   3869 N  NE  . ARG A 1 639 ? 2.904   40.973  -10.315 1.00 44.36  ? 639  ARG A NE  1 
ATOM   3870 C  CZ  . ARG A 1 639 ? 2.730   42.241  -10.675 1.00 45.98  ? 639  ARG A CZ  1 
ATOM   3871 N  NH1 . ARG A 1 639 ? 1.613   42.613  -11.285 1.00 41.50  ? 639  ARG A NH1 1 
ATOM   3872 N  NH2 . ARG A 1 639 ? 3.676   43.138  -10.428 1.00 45.93  ? 639  ARG A NH2 1 
ATOM   3873 N  N   . GLN A 1 640 ? 5.600   37.733  -14.220 1.00 37.66  ? 640  GLN A N   1 
ATOM   3874 C  CA  . GLN A 1 640 ? 6.913   37.202  -14.573 1.00 36.86  ? 640  GLN A CA  1 
ATOM   3875 C  C   . GLN A 1 640 ? 8.054   38.147  -14.213 1.00 36.01  ? 640  GLN A C   1 
ATOM   3876 O  O   . GLN A 1 640 ? 7.871   39.361  -14.135 1.00 49.85  ? 640  GLN A O   1 
ATOM   3877 C  CB  . GLN A 1 640 ? 6.976   36.875  -16.067 1.00 36.84  ? 640  GLN A CB  1 
ATOM   3878 C  CG  . GLN A 1 640 ? 5.755   36.147  -16.601 1.00 40.21  ? 640  GLN A CG  1 
ATOM   3879 C  CD  . GLN A 1 640 ? 6.006   35.478  -17.937 1.00 44.63  ? 640  GLN A CD  1 
ATOM   3880 O  OE1 . GLN A 1 640 ? 5.158   35.511  -18.828 1.00 51.99  ? 640  GLN A OE1 1 
ATOM   3881 N  NE2 . GLN A 1 640 ? 7.174   34.865  -18.084 1.00 49.90  ? 640  GLN A NE2 1 
ATOM   3882 N  N   . ILE A 1 641 ? 9.231   37.571  -13.992 1.00 43.29  ? 641  ILE A N   1 
ATOM   3883 C  CA  . ILE A 1 641 ? 10.455  38.340  -13.800 1.00 39.29  ? 641  ILE A CA  1 
ATOM   3884 C  C   . ILE A 1 641 ? 11.523  37.840  -14.764 1.00 40.85  ? 641  ILE A C   1 
ATOM   3885 O  O   . ILE A 1 641 ? 11.320  36.848  -15.462 1.00 37.74  ? 641  ILE A O   1 
ATOM   3886 C  CB  . ILE A 1 641 ? 11.006  38.208  -12.370 1.00 33.68  ? 641  ILE A CB  1 
ATOM   3887 C  CG1 . ILE A 1 641 ? 11.395  36.755  -12.087 1.00 36.91  ? 641  ILE A CG1 1 
ATOM   3888 C  CG2 . ILE A 1 641 ? 9.998   38.728  -11.356 1.00 38.86  ? 641  ILE A CG2 1 
ATOM   3889 C  CD1 . ILE A 1 641 ? 12.582  36.605  -11.166 1.00 36.75  ? 641  ILE A CD1 1 
ATOM   3890 N  N   . ARG A 1 642 ? 12.662  38.524  -14.794 1.00 38.61  ? 642  ARG A N   1 
ATOM   3891 C  CA  . ARG A 1 642 ? 13.777  38.112  -15.636 1.00 39.76  ? 642  ARG A CA  1 
ATOM   3892 C  C   . ARG A 1 642 ? 15.060  38.064  -14.818 1.00 40.00  ? 642  ARG A C   1 
ATOM   3893 O  O   . ARG A 1 642 ? 15.710  39.088  -14.603 1.00 50.89  ? 642  ARG A O   1 
ATOM   3894 C  CB  . ARG A 1 642 ? 13.944  39.067  -16.819 1.00 38.77  ? 642  ARG A CB  1 
ATOM   3895 C  CG  . ARG A 1 642 ? 14.892  38.562  -17.899 1.00 40.31  ? 642  ARG A CG  1 
ATOM   3896 C  CD  . ARG A 1 642 ? 14.226  37.509  -18.772 1.00 44.05  ? 642  ARG A CD  1 
ATOM   3897 N  NE  . ARG A 1 642 ? 15.107  37.025  -19.832 1.00 41.22  ? 642  ARG A NE  1 
ATOM   3898 C  CZ  . ARG A 1 642 ? 14.695  36.313  -20.877 1.00 43.37  ? 642  ARG A CZ  1 
ATOM   3899 N  NH1 . ARG A 1 642 ? 13.412  36.006  -21.008 1.00 38.46  ? 642  ARG A NH1 1 
ATOM   3900 N  NH2 . ARG A 1 642 ? 15.564  35.912  -21.794 1.00 40.95  ? 642  ARG A NH2 1 
ATOM   3901 N  N   . ALA A 1 643 ? 15.420  36.870  -14.360 1.00 43.20  ? 643  ALA A N   1 
ATOM   3902 C  CA  . ALA A 1 643 ? 16.609  36.700  -13.534 1.00 42.60  ? 643  ALA A CA  1 
ATOM   3903 C  C   . ALA A 1 643 ? 17.668  35.854  -14.231 1.00 47.14  ? 643  ALA A C   1 
ATOM   3904 O  O   . ALA A 1 643 ? 17.372  35.125  -15.178 1.00 48.39  ? 643  ALA A O   1 
ATOM   3905 C  CB  . ALA A 1 643 ? 16.239  36.087  -12.191 1.00 42.04  ? 643  ALA A CB  1 
ATOM   3906 N  N   . GLU A 1 644 ? 18.903  35.970  -13.750 1.00 51.28  ? 644  GLU A N   1 
ATOM   3907 C  CA  . GLU A 1 644 ? 20.022  35.166  -14.231 1.00 51.05  ? 644  GLU A CA  1 
ATOM   3908 C  C   . GLU A 1 644 ? 19.697  33.678  -14.119 1.00 48.35  ? 644  GLU A C   1 
ATOM   3909 O  O   . GLU A 1 644 ? 19.270  33.208  -13.063 1.00 41.76  ? 644  GLU A O   1 
ATOM   3910 C  CB  . GLU A 1 644 ? 21.280  35.498  -13.422 1.00 59.02  ? 644  GLU A CB  1 
ATOM   3911 C  CG  . GLU A 1 644 ? 22.353  34.419  -13.430 1.00 65.75  ? 644  GLU A CG  1 
ATOM   3912 C  CD  . GLU A 1 644 ? 23.355  34.589  -14.553 1.00 69.61  ? 644  GLU A CD  1 
ATOM   3913 O  OE1 . GLU A 1 644 ? 23.691  35.746  -14.883 1.00 76.14  ? 644  GLU A OE1 1 
ATOM   3914 O  OE2 . GLU A 1 644 ? 23.813  33.563  -15.100 1.00 70.47  ? 644  GLU A OE2 1 
ATOM   3915 N  N   . ILE A 1 645 ? 19.905  32.942  -15.207 1.00 44.32  ? 645  ILE A N   1 
ATOM   3916 C  CA  . ILE A 1 645 ? 19.522  31.531  -15.271 1.00 45.23  ? 645  ILE A CA  1 
ATOM   3917 C  C   . ILE A 1 645 ? 20.234  30.656  -14.234 1.00 48.42  ? 645  ILE A C   1 
ATOM   3918 O  O   . ILE A 1 645 ? 19.804  29.534  -13.963 1.00 53.28  ? 645  ILE A O   1 
ATOM   3919 C  CB  . ILE A 1 645 ? 19.738  30.945  -16.688 1.00 40.06  ? 645  ILE A CB  1 
ATOM   3920 C  CG1 . ILE A 1 645 ? 18.920  29.662  -16.869 1.00 39.93  ? 645  ILE A CG1 1 
ATOM   3921 C  CG2 . ILE A 1 645 ? 21.219  30.703  -16.952 1.00 37.67  ? 645  ILE A CG2 1 
ATOM   3922 C  CD1 . ILE A 1 645 ? 18.876  29.153  -18.294 1.00 43.73  ? 645  ILE A CD1 1 
ATOM   3923 N  N   . SER A 1 646 ? 21.312  31.169  -13.649 1.00 46.47  ? 646  SER A N   1 
ATOM   3924 C  CA  . SER A 1 646 ? 22.080  30.397  -12.674 1.00 43.82  ? 646  SER A CA  1 
ATOM   3925 C  C   . SER A 1 646 ? 21.655  30.691  -11.236 1.00 48.35  ? 646  SER A C   1 
ATOM   3926 O  O   . SER A 1 646 ? 22.023  29.963  -10.314 1.00 47.26  ? 646  SER A O   1 
ATOM   3927 C  CB  . SER A 1 646 ? 23.582  30.639  -12.842 1.00 35.50  ? 646  SER A CB  1 
ATOM   3928 O  OG  . SER A 1 646 ? 23.973  31.869  -12.258 1.00 42.47  ? 646  SER A OG  1 
ATOM   3929 N  N   . GLU A 1 647 ? 20.887  31.760  -11.050 1.00 47.10  ? 647  GLU A N   1 
ATOM   3930 C  CA  . GLU A 1 647 ? 20.367  32.111  -9.733  1.00 51.48  ? 647  GLU A CA  1 
ATOM   3931 C  C   . GLU A 1 647 ? 18.962  31.554  -9.546  1.00 44.13  ? 647  GLU A C   1 
ATOM   3932 O  O   . GLU A 1 647 ? 18.508  31.351  -8.420  1.00 49.61  ? 647  GLU A O   1 
ATOM   3933 C  CB  . GLU A 1 647 ? 20.331  33.629  -9.552  1.00 57.05  ? 647  GLU A CB  1 
ATOM   3934 C  CG  . GLU A 1 647 ? 21.669  34.323  -9.716  1.00 63.97  ? 647  GLU A CG  1 
ATOM   3935 C  CD  . GLU A 1 647 ? 21.549  35.832  -9.609  1.00 67.44  ? 647  GLU A CD  1 
ATOM   3936 O  OE1 . GLU A 1 647 ? 20.504  36.314  -9.123  1.00 70.41  ? 647  GLU A OE1 1 
ATOM   3937 O  OE2 . GLU A 1 647 ? 22.499  36.536  -10.011 1.00 68.72  ? 647  GLU A OE2 1 
ATOM   3938 N  N   . LEU A 1 648 ? 18.279  31.315  -10.661 1.00 38.70  ? 648  LEU A N   1 
ATOM   3939 C  CA  . LEU A 1 648 ? 16.887  30.869  -10.642 1.00 45.17  ? 648  LEU A CA  1 
ATOM   3940 C  C   . LEU A 1 648 ? 16.631  29.662  -9.737  1.00 49.38  ? 648  LEU A C   1 
ATOM   3941 O  O   . LEU A 1 648 ? 15.659  29.658  -8.982  1.00 55.10  ? 648  LEU A O   1 
ATOM   3942 C  CB  . LEU A 1 648 ? 16.378  30.602  -12.063 1.00 44.37  ? 648  LEU A CB  1 
ATOM   3943 C  CG  . LEU A 1 648 ? 15.980  31.846  -12.860 1.00 47.18  ? 648  LEU A CG  1 
ATOM   3944 C  CD1 . LEU A 1 648 ? 15.712  31.494  -14.313 1.00 44.63  ? 648  LEU A CD1 1 
ATOM   3945 C  CD2 . LEU A 1 648 ? 14.764  32.513  -12.237 1.00 49.12  ? 648  LEU A CD2 1 
ATOM   3946 N  N   . PRO A 1 649 ? 17.496  28.635  -9.805  1.00 48.25  ? 649  PRO A N   1 
ATOM   3947 C  CA  . PRO A 1 649 ? 17.311  27.490  -8.917  1.00 45.88  ? 649  PRO A CA  1 
ATOM   3948 C  C   . PRO A 1 649 ? 17.204  27.903  -7.450  1.00 43.84  ? 649  PRO A C   1 
ATOM   3949 O  O   . PRO A 1 649 ? 16.388  27.350  -6.713  1.00 44.55  ? 649  PRO A O   1 
ATOM   3950 C  CB  . PRO A 1 649 ? 18.580  26.665  -9.142  1.00 46.19  ? 649  PRO A CB  1 
ATOM   3951 C  CG  . PRO A 1 649 ? 19.011  27.014  -10.517 1.00 43.99  ? 649  PRO A CG  1 
ATOM   3952 C  CD  . PRO A 1 649 ? 18.661  28.461  -10.692 1.00 44.73  ? 649  PRO A CD  1 
ATOM   3953 N  N   . SER A 1 650 ? 18.018  28.871  -7.040  1.00 39.77  ? 650  SER A N   1 
ATOM   3954 C  CA  . SER A 1 650 ? 18.035  29.326  -5.652  1.00 46.64  ? 650  SER A CA  1 
ATOM   3955 C  C   . SER A 1 650 ? 16.740  30.026  -5.249  1.00 49.56  ? 650  SER A C   1 
ATOM   3956 O  O   . SER A 1 650 ? 16.224  29.804  -4.154  1.00 51.13  ? 650  SER A O   1 
ATOM   3957 C  CB  . SER A 1 650 ? 19.226  30.254  -5.404  1.00 43.79  ? 650  SER A CB  1 
ATOM   3958 O  OG  . SER A 1 650 ? 20.451  29.580  -5.631  1.00 57.99  ? 650  SER A OG  1 
ATOM   3959 N  N   . ILE A 1 651 ? 16.217  30.870  -6.133  1.00 47.10  ? 651  ILE A N   1 
ATOM   3960 C  CA  . ILE A 1 651 ? 15.022  31.645  -5.812  1.00 54.31  ? 651  ILE A CA  1 
ATOM   3961 C  C   . ILE A 1 651 ? 13.735  30.836  -5.979  1.00 51.15  ? 651  ILE A C   1 
ATOM   3962 O  O   . ILE A 1 651 ? 12.720  31.147  -5.359  1.00 55.41  ? 651  ILE A O   1 
ATOM   3963 C  CB  . ILE A 1 651 ? 14.947  32.967  -6.617  1.00 58.01  ? 651  ILE A CB  1 
ATOM   3964 C  CG1 . ILE A 1 651 ? 14.630  32.699  -8.088  1.00 62.99  ? 651  ILE A CG1 1 
ATOM   3965 C  CG2 . ILE A 1 651 ? 16.247  33.751  -6.483  1.00 57.21  ? 651  ILE A CG2 1 
ATOM   3966 C  CD1 . ILE A 1 651 ? 14.530  33.959  -8.919  1.00 68.92  ? 651  ILE A CD1 1 
ATOM   3967 N  N   . VAL A 1 652 ? 13.780  29.798  -6.809  1.00 41.64  ? 652  VAL A N   1 
ATOM   3968 C  CA  . VAL A 1 652 ? 12.648  28.888  -6.940  1.00 38.35  ? 652  VAL A CA  1 
ATOM   3969 C  C   . VAL A 1 652 ? 12.599  27.977  -5.717  1.00 41.46  ? 652  VAL A C   1 
ATOM   3970 O  O   . VAL A 1 652 ? 11.524  27.615  -5.238  1.00 40.95  ? 652  VAL A O   1 
ATOM   3971 C  CB  . VAL A 1 652 ? 12.726  28.046  -8.230  1.00 37.60  ? 652  VAL A CB  1 
ATOM   3972 C  CG1 . VAL A 1 652 ? 11.581  27.042  -8.286  1.00 27.00  ? 652  VAL A CG1 1 
ATOM   3973 C  CG2 . VAL A 1 652 ? 12.699  28.950  -9.455  1.00 32.59  ? 652  VAL A CG2 1 
ATOM   3974 N  N   . GLN A 1 653 ? 13.777  27.620  -5.215  1.00 42.86  ? 653  GLN A N   1 
ATOM   3975 C  CA  . GLN A 1 653 ? 13.896  26.859  -3.978  1.00 43.65  ? 653  GLN A CA  1 
ATOM   3976 C  C   . GLN A 1 653 ? 13.361  27.681  -2.808  1.00 43.27  ? 653  GLN A C   1 
ATOM   3977 O  O   . GLN A 1 653 ? 12.674  27.159  -1.930  1.00 48.91  ? 653  GLN A O   1 
ATOM   3978 C  CB  . GLN A 1 653 ? 15.359  26.486  -3.731  1.00 44.26  ? 653  GLN A CB  1 
ATOM   3979 C  CG  . GLN A 1 653 ? 15.600  25.648  -2.487  1.00 44.68  ? 653  GLN A CG  1 
ATOM   3980 C  CD  . GLN A 1 653 ? 17.069  25.565  -2.119  1.00 46.12  ? 653  GLN A CD  1 
ATOM   3981 O  OE1 . GLN A 1 653 ? 17.817  26.531  -2.277  1.00 49.65  ? 653  GLN A OE1 1 
ATOM   3982 N  NE2 . GLN A 1 653 ? 17.489  24.409  -1.621  1.00 48.32  ? 653  GLN A NE2 1 
ATOM   3983 N  N   . ASP A 1 654 ? 13.676  28.974  -2.812  1.00 43.31  ? 654  ASP A N   1 
ATOM   3984 C  CA  . ASP A 1 654 ? 13.253  29.882  -1.748  1.00 43.72  ? 654  ASP A CA  1 
ATOM   3985 C  C   . ASP A 1 654 ? 11.780  30.276  -1.853  1.00 47.09  ? 654  ASP A C   1 
ATOM   3986 O  O   . ASP A 1 654 ? 11.189  30.749  -0.883  1.00 43.96  ? 654  ASP A O   1 
ATOM   3987 C  CB  . ASP A 1 654 ? 14.128  31.139  -1.736  1.00 48.71  ? 654  ASP A CB  1 
ATOM   3988 C  CG  . ASP A 1 654 ? 15.454  30.926  -1.027  1.00 50.88  ? 654  ASP A CG  1 
ATOM   3989 O  OD1 . ASP A 1 654 ? 15.587  29.928  -0.288  1.00 53.16  ? 654  ASP A OD1 1 
ATOM   3990 O  OD2 . ASP A 1 654 ? 16.363  31.764  -1.206  1.00 49.72  ? 654  ASP A OD2 1 
ATOM   3991 N  N   . LEU A 1 655 ? 11.193  30.094  -3.032  1.00 43.97  ? 655  LEU A N   1 
ATOM   3992 C  CA  . LEU A 1 655 ? 9.773   30.371  -3.219  1.00 40.18  ? 655  LEU A CA  1 
ATOM   3993 C  C   . LEU A 1 655 ? 8.932   29.160  -2.827  1.00 51.09  ? 655  LEU A C   1 
ATOM   3994 O  O   . LEU A 1 655 ? 7.897   29.299  -2.175  1.00 54.51  ? 655  LEU A O   1 
ATOM   3995 C  CB  . LEU A 1 655 ? 9.481   30.776  -4.665  1.00 37.17  ? 655  LEU A CB  1 
ATOM   3996 C  CG  . LEU A 1 655 ? 9.851   32.202  -5.083  1.00 38.75  ? 655  LEU A CG  1 
ATOM   3997 C  CD1 . LEU A 1 655 ? 9.780   32.356  -6.596  1.00 36.04  ? 655  LEU A CD1 1 
ATOM   3998 C  CD2 . LEU A 1 655 ? 8.956   33.219  -4.393  1.00 35.91  ? 655  LEU A CD2 1 
ATOM   3999 N  N   . ALA A 1 656 ? 9.385   27.975  -3.228  1.00 54.22  ? 656  ALA A N   1 
ATOM   4000 C  CA  . ALA A 1 656 ? 8.710   26.730  -2.875  1.00 54.03  ? 656  ALA A CA  1 
ATOM   4001 C  C   . ALA A 1 656 ? 8.690   26.557  -1.360  1.00 53.52  ? 656  ALA A C   1 
ATOM   4002 O  O   . ALA A 1 656 ? 7.625   26.461  -0.750  1.00 50.64  ? 656  ALA A O   1 
ATOM   4003 C  CB  . ALA A 1 656 ? 9.393   25.548  -3.540  1.00 54.50  ? 656  ALA A CB  1 
ATOM   4004 N  N   . ASN A 1 657 ? 9.877   26.510  -0.764  1.00 53.47  ? 657  ASN A N   1 
ATOM   4005 C  CA  . ASN A 1 657 ? 10.007  26.593  0.680   1.00 51.26  ? 657  ASN A CA  1 
ATOM   4006 C  C   . ASN A 1 657 ? 9.772   28.050  1.066   1.00 59.48  ? 657  ASN A C   1 
ATOM   4007 O  O   . ASN A 1 657 ? 10.630  28.897  0.831   1.00 77.31  ? 657  ASN A O   1 
ATOM   4008 C  CB  . ASN A 1 657 ? 11.404  26.154  1.119   1.00 47.96  ? 657  ASN A CB  1 
ATOM   4009 C  CG  . ASN A 1 657 ? 11.848  24.861  0.457   1.00 47.59  ? 657  ASN A CG  1 
ATOM   4010 O  OD1 . ASN A 1 657 ? 11.026  24.069  -0.006  1.00 46.46  ? 657  ASN A OD1 1 
ATOM   4011 N  ND2 . ASN A 1 657 ? 13.157  24.642  0.412   1.00 46.66  ? 657  ASN A ND2 1 
ATOM   4012 N  N   . GLY A 1 658 ? 8.609   28.334  1.645   1.00 50.00  ? 658  GLY A N   1 
ATOM   4013 C  CA  . GLY A 1 658 ? 8.165   29.711  1.882   1.00 46.71  ? 658  GLY A CA  1 
ATOM   4014 C  C   . GLY A 1 658 ? 9.157   30.657  2.537   1.00 44.31  ? 658  GLY A C   1 
ATOM   4015 O  O   . GLY A 1 658 ? 8.797   31.410  3.442   1.00 50.39  ? 658  GLY A O   1 
ATOM   4016 N  N   . ASN A 1 659 ? 10.403  30.633  2.073   1.00 45.09  ? 659  ASN A N   1 
ATOM   4017 C  CA  . ASN A 1 659 ? 11.448  31.493  2.621   1.00 46.57  ? 659  ASN A CA  1 
ATOM   4018 C  C   . ASN A 1 659 ? 11.327  32.935  2.138   1.00 53.19  ? 659  ASN A C   1 
ATOM   4019 O  O   . ASN A 1 659 ? 11.651  33.872  2.869   1.00 59.22  ? 659  ASN A O   1 
ATOM   4020 C  CB  . ASN A 1 659 ? 12.832  30.931  2.290   1.00 50.15  ? 659  ASN A CB  1 
ATOM   4021 C  CG  . ASN A 1 659 ? 13.103  29.609  2.983   1.00 57.34  ? 659  ASN A CG  1 
ATOM   4022 O  OD1 . ASN A 1 659 ? 12.599  29.352  4.077   1.00 58.79  ? 659  ASN A OD1 1 
ATOM   4023 N  ND2 . ASN A 1 659 ? 13.907  28.762  2.349   1.00 58.23  ? 659  ASN A ND2 1 
ATOM   4024 N  N   . ILE A 1 660 ? 10.867  33.104  0.902   1.00 47.18  ? 660  ILE A N   1 
ATOM   4025 C  CA  . ILE A 1 660 ? 10.583  34.428  0.356   1.00 42.53  ? 660  ILE A CA  1 
ATOM   4026 C  C   . ILE A 1 660 ? 9.271   34.399  -0.421  1.00 43.43  ? 660  ILE A C   1 
ATOM   4027 O  O   . ILE A 1 660 ? 8.833   33.342  -0.877  1.00 40.85  ? 660  ILE A O   1 
ATOM   4028 C  CB  . ILE A 1 660 ? 11.718  34.940  -0.564  1.00 46.05  ? 660  ILE A CB  1 
ATOM   4029 C  CG1 . ILE A 1 660 ? 11.854  34.052  -1.803  1.00 47.37  ? 660  ILE A CG1 1 
ATOM   4030 C  CG2 . ILE A 1 660 ? 13.039  35.020  0.193   1.00 46.27  ? 660  ILE A CG2 1 
ATOM   4031 C  CD1 . ILE A 1 660 ? 12.935  34.502  -2.761  1.00 50.02  ? 660  ILE A CD1 1 
ATOM   4032 N  N   . THR A 1 661 ? 8.643   35.561  -0.565  1.00 43.46  ? 661  THR A N   1 
ATOM   4033 C  CA  . THR A 1 661 ? 7.389   35.659  -1.301  1.00 46.27  ? 661  THR A CA  1 
ATOM   4034 C  C   . THR A 1 661 ? 7.645   36.159  -2.716  1.00 43.95  ? 661  THR A C   1 
ATOM   4035 O  O   . THR A 1 661 ? 8.759   36.568  -3.045  1.00 43.39  ? 661  THR A O   1 
ATOM   4036 C  CB  . THR A 1 661 ? 6.394   36.603  -0.601  1.00 52.57  ? 661  THR A CB  1 
ATOM   4037 O  OG1 . THR A 1 661 ? 6.978   37.905  -0.470  1.00 57.02  ? 661  THR A OG1 1 
ATOM   4038 C  CG2 . THR A 1 661 ? 6.031   36.069  0.778   1.00 48.40  ? 661  THR A CG2 1 
ATOM   4039 N  N   . TRP A 1 662 ? 6.613   36.121  -3.553  1.00 41.71  ? 662  TRP A N   1 
ATOM   4040 C  CA  . TRP A 1 662 ? 6.729   36.616  -4.918  1.00 47.46  ? 662  TRP A CA  1 
ATOM   4041 C  C   . TRP A 1 662 ? 6.981   38.118  -4.919  1.00 53.87  ? 662  TRP A C   1 
ATOM   4042 O  O   . TRP A 1 662 ? 7.717   38.633  -5.761  1.00 59.36  ? 662  TRP A O   1 
ATOM   4043 C  CB  . TRP A 1 662 ? 5.473   36.290  -5.729  1.00 49.82  ? 662  TRP A CB  1 
ATOM   4044 C  CG  . TRP A 1 662 ? 5.621   36.603  -7.185  1.00 50.82  ? 662  TRP A CG  1 
ATOM   4045 C  CD1 . TRP A 1 662 ? 5.004   37.604  -7.877  1.00 50.96  ? 662  TRP A CD1 1 
ATOM   4046 C  CD2 . TRP A 1 662 ? 6.453   35.917  -8.128  1.00 51.82  ? 662  TRP A CD2 1 
ATOM   4047 N  NE1 . TRP A 1 662 ? 5.394   37.580  -9.195  1.00 50.44  ? 662  TRP A NE1 1 
ATOM   4048 C  CE2 . TRP A 1 662 ? 6.285   36.554  -9.374  1.00 51.00  ? 662  TRP A CE2 1 
ATOM   4049 C  CE3 . TRP A 1 662 ? 7.322   34.824  -8.040  1.00 50.98  ? 662  TRP A CE3 1 
ATOM   4050 C  CZ2 . TRP A 1 662 ? 6.952   36.134  -10.524 1.00 50.04  ? 662  TRP A CZ2 1 
ATOM   4051 C  CZ3 . TRP A 1 662 ? 7.984   34.409  -9.183  1.00 51.59  ? 662  TRP A CZ3 1 
ATOM   4052 C  CH2 . TRP A 1 662 ? 7.796   35.062  -10.408 1.00 52.14  ? 662  TRP A CH2 1 
ATOM   4053 N  N   . ALA A 1 663 ? 6.368   38.814  -3.965  1.00 57.75  ? 663  ALA A N   1 
ATOM   4054 C  CA  . ALA A 1 663 ? 6.576   40.248  -3.806  1.00 55.53  ? 663  ALA A CA  1 
ATOM   4055 C  C   . ALA A 1 663 ? 8.047   40.545  -3.543  1.00 54.05  ? 663  ALA A C   1 
ATOM   4056 O  O   . ALA A 1 663 ? 8.610   41.485  -4.105  1.00 54.49  ? 663  ALA A O   1 
ATOM   4057 C  CB  . ALA A 1 663 ? 5.712   40.788  -2.679  1.00 55.08  ? 663  ALA A CB  1 
ATOM   4058 N  N   . ASP A 1 664 ? 8.665   39.735  -2.688  1.00 53.60  ? 664  ASP A N   1 
ATOM   4059 C  CA  . ASP A 1 664 ? 10.090  39.863  -2.410  1.00 59.40  ? 664  ASP A CA  1 
ATOM   4060 C  C   . ASP A 1 664 ? 10.893  39.727  -3.698  1.00 58.39  ? 664  ASP A C   1 
ATOM   4061 O  O   . ASP A 1 664 ? 11.795  40.519  -3.959  1.00 59.30  ? 664  ASP A O   1 
ATOM   4062 C  CB  . ASP A 1 664 ? 10.543  38.816  -1.389  1.00 64.31  ? 664  ASP A CB  1 
ATOM   4063 C  CG  . ASP A 1 664 ? 9.952   39.047  -0.012  1.00 65.46  ? 664  ASP A CG  1 
ATOM   4064 O  OD1 . ASP A 1 664 ? 10.252  38.254  0.904   1.00 69.97  ? 664  ASP A OD1 1 
ATOM   4065 O  OD2 . ASP A 1 664 ? 9.188   40.021  0.156   1.00 67.98  ? 664  ASP A OD2 1 
ATOM   4066 N  N   . VAL A 1 665 ? 10.550  38.730  -4.507  1.00 56.19  ? 665  VAL A N   1 
ATOM   4067 C  CA  . VAL A 1 665 ? 11.244  38.484  -5.768  1.00 52.16  ? 665  VAL A CA  1 
ATOM   4068 C  C   . VAL A 1 665 ? 11.103  39.655  -6.742  1.00 49.66  ? 665  VAL A C   1 
ATOM   4069 O  O   . VAL A 1 665 ? 12.076  40.061  -7.378  1.00 47.19  ? 665  VAL A O   1 
ATOM   4070 C  CB  . VAL A 1 665 ? 10.753  37.183  -6.438  1.00 52.19  ? 665  VAL A CB  1 
ATOM   4071 C  CG1 . VAL A 1 665 ? 11.282  37.076  -7.859  1.00 51.54  ? 665  VAL A CG1 1 
ATOM   4072 C  CG2 . VAL A 1 665 ? 11.175  35.975  -5.619  1.00 50.87  ? 665  VAL A CG2 1 
ATOM   4073 N  N   . GLU A 1 666 ? 9.892   40.197  -6.849  1.00 52.33  ? 666  GLU A N   1 
ATOM   4074 C  CA  . GLU A 1 666 ? 9.633   41.332  -7.734  1.00 57.24  ? 666  GLU A CA  1 
ATOM   4075 C  C   . GLU A 1 666 ? 10.291  42.616  -7.235  1.00 57.01  ? 666  GLU A C   1 
ATOM   4076 O  O   . GLU A 1 666 ? 10.298  43.631  -7.930  1.00 61.79  ? 666  GLU A O   1 
ATOM   4077 C  CB  . GLU A 1 666 ? 8.129   41.552  -7.913  1.00 53.14  ? 666  GLU A CB  1 
ATOM   4078 C  CG  . GLU A 1 666 ? 7.482   40.623  -8.926  1.00 56.95  ? 666  GLU A CG  1 
ATOM   4079 C  CD  . GLU A 1 666 ? 6.036   40.983  -9.207  1.00 57.12  ? 666  GLU A CD  1 
ATOM   4080 O  OE1 . GLU A 1 666 ? 5.400   41.619  -8.341  1.00 59.93  ? 666  GLU A OE1 1 
ATOM   4081 O  OE2 . GLU A 1 666 ? 5.535   40.627  -10.294 1.00 59.79  ? 666  GLU A OE2 1 
ATOM   4082 N  N   . ALA A 1 667 ? 10.842  42.563  -6.027  1.00 56.54  ? 667  ALA A N   1 
ATOM   4083 C  CA  . ALA A 1 667 ? 11.526  43.710  -5.446  1.00 54.31  ? 667  ALA A CA  1 
ATOM   4084 C  C   . ALA A 1 667 ? 13.027  43.650  -5.707  1.00 59.07  ? 667  ALA A C   1 
ATOM   4085 O  O   . ALA A 1 667 ? 13.719  44.664  -5.615  1.00 64.49  ? 667  ALA A O   1 
ATOM   4086 C  CB  . ALA A 1 667 ? 11.247  43.793  -3.954  1.00 55.77  ? 667  ALA A CB  1 
ATOM   4087 N  N   . ARG A 1 668 ? 13.528  42.461  -6.032  1.00 60.08  ? 668  ARG A N   1 
ATOM   4088 C  CA  . ARG A 1 668 ? 14.957  42.276  -6.273  1.00 58.02  ? 668  ARG A CA  1 
ATOM   4089 C  C   . ARG A 1 668 ? 15.285  42.080  -7.750  1.00 58.18  ? 668  ARG A C   1 
ATOM   4090 O  O   . ARG A 1 668 ? 16.345  42.496  -8.210  1.00 61.85  ? 668  ARG A O   1 
ATOM   4091 C  CB  . ARG A 1 668 ? 15.512  41.096  -5.466  1.00 71.12  ? 668  ARG A CB  1 
ATOM   4092 C  CG  . ARG A 1 668 ? 15.423  41.250  -3.954  1.00 78.30  ? 668  ARG A CG  1 
ATOM   4093 C  CD  . ARG A 1 668 ? 14.116  40.685  -3.435  1.00 81.94  ? 668  ARG A CD  1 
ATOM   4094 N  NE  . ARG A 1 668 ? 13.925  40.900  -2.003  1.00 84.52  ? 668  ARG A NE  1 
ATOM   4095 C  CZ  . ARG A 1 668 ? 14.035  39.948  -1.082  1.00 86.18  ? 668  ARG A CZ  1 
ATOM   4096 N  NH1 . ARG A 1 668 ? 14.341  38.707  -1.438  1.00 85.35  ? 668  ARG A NH1 1 
ATOM   4097 N  NH2 . ARG A 1 668 ? 13.841  40.237  0.198   1.00 85.92  ? 668  ARG A NH2 1 
ATOM   4098 N  N   . TYR A 1 669 ? 14.380  41.447  -8.488  1.00 52.46  ? 669  TYR A N   1 
ATOM   4099 C  CA  . TYR A 1 669 ? 14.645  41.106  -9.884  1.00 50.86  ? 669  TYR A CA  1 
ATOM   4100 C  C   . TYR A 1 669 ? 13.697  41.821  -10.846 1.00 50.46  ? 669  TYR A C   1 
ATOM   4101 O  O   . TYR A 1 669 ? 12.521  42.009  -10.535 1.00 62.06  ? 669  TYR A O   1 
ATOM   4102 C  CB  . TYR A 1 669 ? 14.579  39.588  -10.080 1.00 46.67  ? 669  TYR A CB  1 
ATOM   4103 C  CG  . TYR A 1 669 ? 15.520  38.829  -9.172  1.00 44.74  ? 669  TYR A CG  1 
ATOM   4104 C  CD1 . TYR A 1 669 ? 15.086  38.329  -7.950  1.00 46.61  ? 669  TYR A CD1 1 
ATOM   4105 C  CD2 . TYR A 1 669 ? 16.847  38.623  -9.530  1.00 46.12  ? 669  TYR A CD2 1 
ATOM   4106 C  CE1 . TYR A 1 669 ? 15.945  37.640  -7.112  1.00 46.90  ? 669  TYR A CE1 1 
ATOM   4107 C  CE2 . TYR A 1 669 ? 17.714  37.936  -8.699  1.00 47.23  ? 669  TYR A CE2 1 
ATOM   4108 C  CZ  . TYR A 1 669 ? 17.257  37.446  -7.492  1.00 48.62  ? 669  TYR A CZ  1 
ATOM   4109 O  OH  . TYR A 1 669 ? 18.117  36.761  -6.664  1.00 48.83  ? 669  TYR A OH  1 
ATOM   4110 N  N   . PRO A 1 670 ? 14.214  42.219  -12.021 1.00 48.12  ? 670  PRO A N   1 
ATOM   4111 C  CA  . PRO A 1 670 ? 13.476  42.978  -13.033 1.00 49.82  ? 670  PRO A CA  1 
ATOM   4112 C  C   . PRO A 1 670 ? 12.180  42.301  -13.463 1.00 47.74  ? 670  PRO A C   1 
ATOM   4113 O  O   . PRO A 1 670 ? 12.091  41.076  -13.458 1.00 59.66  ? 670  PRO A O   1 
ATOM   4114 C  CB  . PRO A 1 670 ? 14.446  43.019  -14.216 1.00 48.87  ? 670  PRO A CB  1 
ATOM   4115 C  CG  . PRO A 1 670 ? 15.783  42.853  -13.614 1.00 52.40  ? 670  PRO A CG  1 
ATOM   4116 C  CD  . PRO A 1 670 ? 15.597  41.942  -12.445 1.00 55.40  ? 670  PRO A CD  1 
ATOM   4117 N  N   . LEU A 1 671 ? 11.191  43.104  -13.841 1.00 49.66  ? 671  LEU A N   1 
ATOM   4118 C  CA  . LEU A 1 671 ? 9.914   42.581  -14.316 1.00 50.76  ? 671  LEU A CA  1 
ATOM   4119 C  C   . LEU A 1 671 ? 9.986   42.214  -15.794 1.00 55.04  ? 671  LEU A C   1 
ATOM   4120 O  O   . LEU A 1 671 ? 10.888  42.651  -16.509 1.00 61.12  ? 671  LEU A O   1 
ATOM   4121 C  CB  . LEU A 1 671 ? 8.792   43.596  -14.077 1.00 54.09  ? 671  LEU A CB  1 
ATOM   4122 C  CG  . LEU A 1 671 ? 8.095   43.573  -12.713 1.00 53.80  ? 671  LEU A CG  1 
ATOM   4123 C  CD1 . LEU A 1 671 ? 9.086   43.748  -11.570 1.00 52.76  ? 671  LEU A CD1 1 
ATOM   4124 C  CD2 . LEU A 1 671 ? 7.011   44.640  -12.654 1.00 56.31  ? 671  LEU A CD2 1 
ATOM   4125 N  N   . PHE A 1 672 ? 9.029   41.410  -16.247 1.00 53.63  ? 672  PHE A N   1 
ATOM   4126 C  CA  . PHE A 1 672 ? 9.009   40.947  -17.628 1.00 56.34  ? 672  PHE A CA  1 
ATOM   4127 C  C   . PHE A 1 672 ? 7.577   40.779  -18.125 1.00 62.36  ? 672  PHE A C   1 
ATOM   4128 O  O   . PHE A 1 672 ? 6.706   40.315  -17.388 1.00 67.29  ? 672  PHE A O   1 
ATOM   4129 C  CB  . PHE A 1 672 ? 9.766   39.622  -17.749 1.00 57.89  ? 672  PHE A CB  1 
ATOM   4130 C  CG  . PHE A 1 672 ? 10.213  39.302  -19.145 1.00 56.45  ? 672  PHE A CG  1 
ATOM   4131 C  CD1 . PHE A 1 672 ? 11.426  39.776  -19.622 1.00 57.05  ? 672  PHE A CD1 1 
ATOM   4132 C  CD2 . PHE A 1 672 ? 9.427   38.524  -19.981 1.00 58.85  ? 672  PHE A CD2 1 
ATOM   4133 C  CE1 . PHE A 1 672 ? 11.846  39.484  -20.906 1.00 58.15  ? 672  PHE A CE1 1 
ATOM   4134 C  CE2 . PHE A 1 672 ? 9.840   38.228  -21.267 1.00 59.83  ? 672  PHE A CE2 1 
ATOM   4135 C  CZ  . PHE A 1 672 ? 11.052  38.708  -21.731 1.00 59.60  ? 672  PHE A CZ  1 
ATOM   4136 N  N   . GLU A 1 673 ? 7.340   41.160  -19.376 1.00 71.86  ? 673  GLU A N   1 
ATOM   4137 C  CA  . GLU A 1 673 ? 6.016   41.044  -19.979 1.00 83.03  ? 673  GLU A CA  1 
ATOM   4138 C  C   . GLU A 1 673 ? 6.114   40.753  -21.473 1.00 92.41  ? 673  GLU A C   1 
ATOM   4139 O  O   . GLU A 1 673 ? 6.210   41.671  -22.289 1.00 99.09  ? 673  GLU A O   1 
ATOM   4140 C  CB  . GLU A 1 673 ? 5.206   42.310  -19.732 1.00 81.81  ? 673  GLU A CB  1 
ATOM   4141 N  N   . GLY A 1 674 ? 6.090   39.471  -21.823 1.00 98.09  ? 674  GLY A N   1 
ATOM   4142 C  CA  . GLY A 1 674 ? 6.178   39.051  -23.217 1.00 99.50  ? 674  GLY A CA  1 
ATOM   4143 C  C   . GLY A 1 674 ? 7.573   39.218  -23.790 1.00 101.67 ? 674  GLY A C   1 
ATOM   4144 O  O   . GLY A 1 674 ? 8.219   38.243  -24.172 1.00 99.90  ? 674  GLY A O   1 
HETATM 4145 CL CL  . CL  B 2 .   ? -9.743  8.716   1.927   1.00 51.74  ? 901  CL  A CL  1 
HETATM 4146 C  C1  . GOL C 3 .   ? 17.401  38.468  -22.420 1.00 74.58  ? 801  GOL A C1  1 
HETATM 4147 O  O1  . GOL C 3 .   ? 16.732  39.679  -22.686 1.00 76.79  ? 801  GOL A O1  1 
HETATM 4148 C  C2  . GOL C 3 .   ? 18.406  38.661  -21.293 1.00 75.47  ? 801  GOL A C2  1 
HETATM 4149 O  O2  . GOL C 3 .   ? 18.574  40.034  -21.021 1.00 70.68  ? 801  GOL A O2  1 
HETATM 4150 C  C3  . GOL C 3 .   ? 19.741  38.043  -21.692 1.00 75.73  ? 801  GOL A C3  1 
HETATM 4151 O  O3  . GOL C 3 .   ? 19.693  36.645  -21.514 1.00 71.17  ? 801  GOL A O3  1 
HETATM 4152 O  O   . HOH D 4 .   ? -22.466 7.825   -2.173  1.00 39.90  ? 902  HOH A O   1 
HETATM 4153 O  O   . HOH D 4 .   ? 1.858   30.569  -7.889  1.00 31.34  ? 903  HOH A O   1 
HETATM 4154 O  O   . HOH D 4 .   ? -25.580 8.288   -0.963  1.00 68.93  ? 904  HOH A O   1 
HETATM 4155 O  O   . HOH D 4 .   ? -5.390  -3.199  11.249  1.00 43.03  ? 905  HOH A O   1 
HETATM 4156 O  O   . HOH D 4 .   ? 2.617   13.544  25.576  1.00 27.03  ? 906  HOH A O   1 
HETATM 4157 O  O   . HOH D 4 .   ? -8.728  29.023  10.686  1.00 42.80  ? 907  HOH A O   1 
HETATM 4158 O  O   . HOH D 4 .   ? -25.740 -0.874  12.312  1.00 32.29  ? 908  HOH A O   1 
HETATM 4159 O  O   . HOH D 4 .   ? 17.112  20.656  -27.443 1.00 97.88  ? 909  HOH A O   1 
HETATM 4160 O  O   . HOH D 4 .   ? -0.362  -9.055  28.519  1.00 68.28  ? 910  HOH A O   1 
HETATM 4161 O  O   . HOH D 4 .   ? -6.651  7.341   -1.342  1.00 36.33  ? 911  HOH A O   1 
HETATM 4162 O  O   . HOH D 4 .   ? -17.662 2.644   6.604   1.00 40.77  ? 912  HOH A O   1 
HETATM 4163 O  O   . HOH D 4 .   ? -22.606 1.576   2.866   1.00 31.81  ? 913  HOH A O   1 
HETATM 4164 O  O   . HOH D 4 .   ? 4.338   11.596  19.682  1.00 39.98  ? 914  HOH A O   1 
HETATM 4165 O  O   . HOH D 4 .   ? 21.268  26.914  -17.424 1.00 40.42  ? 915  HOH A O   1 
HETATM 4166 O  O   . HOH D 4 .   ? -8.919  32.286  -21.144 1.00 54.79  ? 916  HOH A O   1 
HETATM 4167 O  O   . HOH D 4 .   ? 8.002   34.361  -21.016 1.00 44.77  ? 917  HOH A O   1 
HETATM 4168 O  O   . HOH D 4 .   ? -4.897  27.023  -17.662 1.00 32.36  ? 918  HOH A O   1 
HETATM 4169 O  O   . HOH D 4 .   ? 10.716  18.859  -4.977  1.00 29.84  ? 919  HOH A O   1 
HETATM 4170 O  O   . HOH D 4 .   ? 20.488  27.018  -14.615 1.00 40.71  ? 920  HOH A O   1 
HETATM 4171 O  O   . HOH D 4 .   ? 3.197   23.548  9.892   1.00 42.86  ? 921  HOH A O   1 
HETATM 4172 O  O   . HOH D 4 .   ? -10.229 5.313   -3.957  1.00 38.28  ? 922  HOH A O   1 
HETATM 4173 O  O   . HOH D 4 .   ? 9.006   20.188  -0.172  1.00 37.57  ? 923  HOH A O   1 
HETATM 4174 O  O   . HOH D 4 .   ? 11.860  23.413  -2.683  1.00 32.56  ? 924  HOH A O   1 
HETATM 4175 O  O   . HOH D 4 .   ? 3.807   4.596   2.562   1.00 45.07  ? 925  HOH A O   1 
HETATM 4176 O  O   . HOH D 4 .   ? 0.518   29.327  16.834  1.00 52.50  ? 926  HOH A O   1 
HETATM 4177 O  O   . HOH D 4 .   ? 2.721   11.256  36.991  1.00 90.76  ? 927  HOH A O   1 
HETATM 4178 O  O   . HOH D 4 .   ? -20.244 -1.362  -8.624  1.00 67.37  ? 928  HOH A O   1 
HETATM 4179 O  O   . HOH D 4 .   ? -11.482 31.879  8.174   1.00 49.46  ? 929  HOH A O   1 
HETATM 4180 O  O   . HOH D 4 .   ? 4.171   35.020  -2.611  1.00 66.39  ? 930  HOH A O   1 
HETATM 4181 O  O   . HOH D 4 .   ? -26.144 7.875   4.325   1.00 55.69  ? 931  HOH A O   1 
HETATM 4182 O  O   . HOH D 4 .   ? 22.813  26.834  -13.454 1.00 38.46  ? 932  HOH A O   1 
HETATM 4183 O  O   . HOH D 4 .   ? -3.737  18.924  29.610  1.00 65.48  ? 933  HOH A O   1 
HETATM 4184 O  O   . HOH D 4 .   ? -18.712 -14.548 11.725  1.00 77.45  ? 934  HOH A O   1 
HETATM 4185 O  O   . HOH D 4 .   ? 14.323  22.556  -1.445  1.00 46.78  ? 935  HOH A O   1 
HETATM 4186 O  O   . HOH D 4 .   ? 1.716   28.947  19.562  1.00 40.39  ? 936  HOH A O   1 
HETATM 4187 O  O   . HOH D 4 .   ? -21.137 4.629   0.687   1.00 80.80  ? 937  HOH A O   1 
HETATM 4188 O  O   . HOH D 4 .   ? 24.215  24.724  -7.986  1.00 52.74  ? 938  HOH A O   1 
HETATM 4189 O  O   . HOH D 4 .   ? 4.337   29.191  -14.212 1.00 49.19  ? 939  HOH A O   1 
HETATM 4190 O  O   . HOH D 4 .   ? -22.900 24.943  12.311  1.00 54.34  ? 940  HOH A O   1 
HETATM 4191 O  O   . HOH D 4 .   ? 10.179  34.857  -22.802 1.00 48.26  ? 941  HOH A O   1 
HETATM 4192 O  O   . HOH D 4 .   ? -38.116 -1.493  -7.794  1.00 82.89  ? 942  HOH A O   1 
HETATM 4193 O  O   . HOH D 4 .   ? -10.409 26.662  10.786  1.00 37.87  ? 943  HOH A O   1 
HETATM 4194 O  O   . HOH D 4 .   ? -3.069  30.739  -19.810 1.00 55.47  ? 944  HOH A O   1 
HETATM 4195 O  O   . HOH D 4 .   ? -7.368  34.043  12.472  1.00 56.13  ? 945  HOH A O   1 
HETATM 4196 O  O   . HOH D 4 .   ? 4.849   14.176  20.756  1.00 44.88  ? 946  HOH A O   1 
HETATM 4197 O  O   . HOH D 4 .   ? 16.556  33.886  -3.155  1.00 42.99  ? 947  HOH A O   1 
HETATM 4198 O  O   . HOH D 4 .   ? 4.108   25.007  -0.087  1.00 42.94  ? 948  HOH A O   1 
HETATM 4199 O  O   . HOH D 4 .   ? -19.223 20.260  24.260  1.00 41.81  ? 949  HOH A O   1 
HETATM 4200 O  O   . HOH D 4 .   ? -2.771  -5.865  10.253  1.00 53.94  ? 950  HOH A O   1 
HETATM 4201 O  O   . HOH D 4 .   ? 2.270   24.856  2.097   1.00 37.27  ? 951  HOH A O   1 
HETATM 4202 O  O   . HOH D 4 .   ? 25.973  18.106  -17.991 1.00 52.28  ? 952  HOH A O   1 
HETATM 4203 O  O   . HOH D 4 .   ? 1.036   6.364   36.452  1.00 57.73  ? 953  HOH A O   1 
HETATM 4204 O  O   . HOH D 4 .   ? -19.353 12.187  10.175  1.00 36.99  ? 954  HOH A O   1 
HETATM 4205 O  O   . HOH D 4 .   ? -39.215 -2.500  7.482   1.00 65.60  ? 955  HOH A O   1 
HETATM 4206 O  O   . HOH D 4 .   ? -25.370 5.924   0.636   1.00 58.86  ? 956  HOH A O   1 
HETATM 4207 O  O   . HOH D 4 .   ? 15.204  22.744  -26.999 1.00 60.41  ? 957  HOH A O   1 
HETATM 4208 O  O   . HOH D 4 .   ? -22.650 -0.483  -6.662  1.00 66.43  ? 958  HOH A O   1 
HETATM 4209 O  O   . HOH D 4 .   ? 23.837  26.678  -26.815 1.00 50.42  ? 959  HOH A O   1 
HETATM 4210 O  O   . HOH D 4 .   ? 2.734   12.571  28.670  1.00 40.02  ? 960  HOH A O   1 
HETATM 4211 O  O   . HOH D 4 .   ? -14.691 -22.073 8.849   1.00 66.02  ? 961  HOH A O   1 
HETATM 4212 O  O   . HOH D 4 .   ? 7.083   8.448   19.675  1.00 54.35  ? 962  HOH A O   1 
HETATM 4213 O  O   . HOH D 4 .   ? 18.947  33.447  -4.390  1.00 58.90  ? 963  HOH A O   1 
HETATM 4214 O  O   . HOH D 4 .   ? 16.256  21.313  -24.832 1.00 58.31  ? 964  HOH A O   1 
HETATM 4215 O  O   . HOH D 4 .   ? 23.925  22.576  -30.135 1.00 71.09  ? 965  HOH A O   1 
HETATM 4216 O  O   . HOH D 4 .   ? 18.998  37.111  -28.795 1.00 43.32  ? 966  HOH A O   1 
HETATM 4217 O  O   . HOH D 4 .   ? 2.426   29.850  -5.259  1.00 42.86  ? 967  HOH A O   1 
HETATM 4218 O  O   . HOH D 4 .   ? 3.011   26.461  -14.659 1.00 51.77  ? 968  HOH A O   1 
HETATM 4219 O  O   . HOH D 4 .   ? -3.061  -21.756 6.568   1.00 60.52  ? 969  HOH A O   1 
HETATM 4220 O  O   . HOH D 4 .   ? -21.846 5.851   3.255   1.00 64.18  ? 970  HOH A O   1 
HETATM 4221 O  O   . HOH D 4 .   ? -13.071 6.842   8.037   1.00 61.95  ? 971  HOH A O   1 
HETATM 4222 O  O   . HOH D 4 .   ? -9.230  30.704  3.423   1.00 67.71  ? 972  HOH A O   1 
HETATM 4223 O  O   . HOH D 4 .   ? -12.748 17.814  24.488  1.00 68.66  ? 973  HOH A O   1 
HETATM 4224 O  O   . HOH D 4 .   ? -26.683 31.017  12.818  1.00 71.16  ? 974  HOH A O   1 
HETATM 4225 O  O   . HOH D 4 .   ? -12.227 33.752  10.199  1.00 57.40  ? 975  HOH A O   1 
HETATM 4226 O  O   . HOH D 4 .   ? -19.890 -10.736 8.320   1.00 72.73  ? 976  HOH A O   1 
HETATM 4227 O  O   . HOH D 4 .   ? -9.338  4.053   13.389  1.00 59.98  ? 977  HOH A O   1 
HETATM 4228 O  O   . HOH D 4 .   ? -17.891 25.971  22.096  1.00 36.04  ? 978  HOH A O   1 
HETATM 4229 O  O   . HOH D 4 .   ? -9.314  -20.839 5.089   1.00 52.19  ? 979  HOH A O   1 
HETATM 4230 O  O   . HOH D 4 .   ? 14.120  38.968  -23.259 1.00 68.90  ? 980  HOH A O   1 
HETATM 4231 O  O   . HOH D 4 .   ? -22.958 19.896  9.009   1.00 50.34  ? 981  HOH A O   1 
HETATM 4232 O  O   . HOH D 4 .   ? 6.723   20.778  -17.822 1.00 32.24  ? 982  HOH A O   1 
HETATM 4233 O  O   . HOH D 4 .   ? -16.372 14.539  -7.357  1.00 50.14  ? 983  HOH A O   1 
HETATM 4234 O  O   . HOH D 4 .   ? 5.875   19.078  6.655   1.00 41.39  ? 984  HOH A O   1 
HETATM 4235 O  O   . HOH D 4 .   ? 7.517   17.477  2.328   1.00 43.46  ? 985  HOH A O   1 
HETATM 4236 O  O   . HOH D 4 .   ? 20.394  27.926  -34.413 1.00 38.89  ? 986  HOH A O   1 
HETATM 4237 O  O   . HOH D 4 .   ? 13.466  37.835  2.409   1.00 55.91  ? 987  HOH A O   1 
HETATM 4238 O  O   . HOH D 4 .   ? 3.215   42.172  -6.284  1.00 31.59  ? 988  HOH A O   1 
HETATM 4239 O  O   . HOH D 4 .   ? -9.868  8.382   15.285  1.00 46.35  ? 989  HOH A O   1 
HETATM 4240 O  O   . HOH D 4 .   ? 2.454   9.909   29.182  1.00 49.49  ? 990  HOH A O   1 
HETATM 4241 O  O   . HOH D 4 .   ? -22.659 27.936  0.832   1.00 73.05  ? 991  HOH A O   1 
HETATM 4242 O  O   . HOH D 4 .   ? 4.330   24.968  3.952   1.00 45.52  ? 992  HOH A O   1 
HETATM 4243 O  O   . HOH D 4 .   ? 13.735  20.490  -25.008 1.00 39.85  ? 993  HOH A O   1 
HETATM 4244 O  O   . HOH D 4 .   ? -16.672 -8.508  17.177  1.00 73.86  ? 994  HOH A O   1 
HETATM 4245 O  O   . HOH D 4 .   ? -4.624  26.619  27.659  1.00 71.15  ? 995  HOH A O   1 
HETATM 4246 O  O   . HOH D 4 .   ? -23.378 22.709  9.378   1.00 31.81  ? 996  HOH A O   1 
HETATM 4247 O  O   . HOH D 4 .   ? -41.568 -0.281  3.038   1.00 60.15  ? 997  HOH A O   1 
HETATM 4248 O  O   . HOH D 4 .   ? 10.761  8.489   13.830  1.00 48.69  ? 998  HOH A O   1 
HETATM 4249 O  O   . HOH D 4 .   ? 1.275   4.103   1.130   1.00 45.17  ? 999  HOH A O   1 
HETATM 4250 O  O   . HOH D 4 .   ? 6.289   20.783  11.120  1.00 47.26  ? 1000 HOH A O   1 
HETATM 4251 O  O   . HOH D 4 .   ? -0.689  41.248  -12.278 1.00 56.39  ? 1001 HOH A O   1 
HETATM 4252 O  O   . HOH D 4 .   ? 24.777  27.033  -6.691  1.00 60.66  ? 1002 HOH A O   1 
HETATM 4253 O  O   . HOH D 4 .   ? 22.005  17.118  -10.359 1.00 31.74  ? 1003 HOH A O   1 
HETATM 4254 O  O   . HOH D 4 .   ? 20.663  25.138  -34.358 1.00 55.96  ? 1004 HOH A O   1 
HETATM 4255 O  O   . HOH D 4 .   ? -7.510  35.322  -14.816 1.00 51.75  ? 1005 HOH A O   1 
HETATM 4256 O  O   . HOH D 4 .   ? 14.105  16.798  -9.835  1.00 39.66  ? 1006 HOH A O   1 
HETATM 4257 O  O   . HOH D 4 .   ? -7.824  35.635  9.745   1.00 51.46  ? 1007 HOH A O   1 
HETATM 4258 O  O   . HOH D 4 .   ? 18.996  39.572  -14.148 1.00 46.96  ? 1008 HOH A O   1 
HETATM 4259 O  O   . HOH D 4 .   ? 16.088  37.222  -3.126  1.00 57.94  ? 1009 HOH A O   1 
HETATM 4260 O  O   . HOH D 4 .   ? 2.902   -6.751  20.859  1.00 45.08  ? 1010 HOH A O   1 
HETATM 4261 O  O   . HOH D 4 .   ? -7.351  11.086  28.120  1.00 79.10  ? 1011 HOH A O   1 
HETATM 4262 O  O   . HOH D 4 .   ? -28.074 -0.409  -8.188  1.00 100.03 ? 1012 HOH A O   1 
HETATM 4263 O  O   . HOH D 4 .   ? -15.710 0.105   17.172  1.00 92.72  ? 1013 HOH A O   1 
HETATM 4264 O  O   . HOH D 4 .   ? 19.953  38.574  -11.796 1.00 44.59  ? 1014 HOH A O   1 
HETATM 4265 O  O   . HOH D 4 .   ? 13.501  35.423  -27.759 1.00 47.17  ? 1015 HOH A O   1 
HETATM 4266 O  O   . HOH D 4 .   ? -2.472  -2.662  10.204  1.00 55.73  ? 1016 HOH A O   1 
HETATM 4267 O  O   . HOH D 4 .   ? -13.638 0.651   11.267  1.00 59.32  ? 1017 HOH A O   1 
HETATM 4268 O  O   . HOH D 4 .   ? -22.950 19.404  5.585   1.00 46.89  ? 1018 HOH A O   1 
HETATM 4269 O  O   . HOH D 4 .   ? 0.616   -0.361  5.702   1.00 54.19  ? 1019 HOH A O   1 
HETATM 4270 O  O   . HOH D 4 .   ? 3.147   -5.107  27.939  1.00 79.67  ? 1020 HOH A O   1 
HETATM 4271 O  O   . HOH D 4 .   ? 7.560   22.597  27.808  1.00 50.98  ? 1021 HOH A O   1 
HETATM 4272 O  O   . HOH D 4 .   ? -10.169 25.458  -19.939 1.00 74.57  ? 1022 HOH A O   1 
HETATM 4273 O  O   . HOH D 4 .   ? -9.599  -21.606 0.668   1.00 57.73  ? 1023 HOH A O   1 
HETATM 4274 O  O   . HOH D 4 .   ? -40.856 24.305  5.996   1.00 77.91  ? 1024 HOH A O   1 
HETATM 4275 O  O   . HOH D 4 .   ? -8.302  31.803  9.718   1.00 36.94  ? 1025 HOH A O   1 
HETATM 4276 O  O   . HOH D 4 .   ? 8.788   -2.738  27.461  1.00 52.11  ? 1026 HOH A O   1 
HETATM 4277 O  O   . HOH D 4 .   ? -8.809  -25.044 5.764   1.00 76.80  ? 1027 HOH A O   1 
HETATM 4278 O  O   . HOH D 4 .   ? -21.780 22.639  1.201   1.00 64.89  ? 1028 HOH A O   1 
HETATM 4279 O  O   . HOH D 4 .   ? 13.596  27.165  5.029   1.00 56.17  ? 1029 HOH A O   1 
HETATM 4280 O  O   . HOH D 4 .   ? 3.646   27.519  -1.772  1.00 46.82  ? 1030 HOH A O   1 
HETATM 4281 O  O   . HOH D 4 .   ? -44.119 0.096   1.060   1.00 77.54  ? 1031 HOH A O   1 
HETATM 4282 O  O   . HOH D 4 .   ? 14.828  16.765  -7.116  1.00 35.57  ? 1032 HOH A O   1 
HETATM 4283 O  O   . HOH D 4 .   ? -21.029 -4.106  17.876  1.00 59.75  ? 1033 HOH A O   1 
HETATM 4284 O  O   . HOH D 4 .   ? -18.029 22.967  25.160  1.00 40.67  ? 1034 HOH A O   1 
HETATM 4285 O  O   . HOH D 4 .   ? 5.053   -5.477  34.937  1.00 82.03  ? 1035 HOH A O   1 
HETATM 4286 O  O   . HOH D 4 .   ? -19.052 9.648   22.124  1.00 60.47  ? 1036 HOH A O   1 
HETATM 4287 O  O   . HOH D 4 .   ? -19.075 -7.009  3.102   1.00 63.04  ? 1037 HOH A O   1 
HETATM 4288 O  O   . HOH D 4 .   ? 7.282   -1.178  37.412  1.00 85.05  ? 1038 HOH A O   1 
HETATM 4289 O  O   . HOH D 4 .   ? -21.937 27.379  11.691  1.00 60.37  ? 1039 HOH A O   1 
HETATM 4290 O  O   . HOH D 4 .   ? -8.949  2.115   17.128  1.00 68.39  ? 1040 HOH A O   1 
HETATM 4291 O  O   . HOH D 4 .   ? -18.402 6.847   -5.002  1.00 41.56  ? 1041 HOH A O   1 
HETATM 4292 O  O   . HOH D 4 .   ? -3.771  34.703  19.637  1.00 70.11  ? 1042 HOH A O   1 
HETATM 4293 O  O   . HOH D 4 .   ? -13.228 13.041  -11.954 1.00 45.96  ? 1043 HOH A O   1 
HETATM 4294 O  O   . HOH D 4 .   ? -8.490  -2.553  17.291  1.00 69.10  ? 1044 HOH A O   1 
HETATM 4295 O  O   . HOH D 4 .   ? -12.299 10.993  -12.969 1.00 77.25  ? 1045 HOH A O   1 
HETATM 4296 O  O   . HOH D 4 .   ? -10.376 -17.485 10.808  1.00 65.75  ? 1046 HOH A O   1 
HETATM 4297 O  O   . HOH D 4 .   ? 8.911   7.174   7.319   1.00 69.20  ? 1047 HOH A O   1 
HETATM 4298 O  O   . HOH D 4 .   ? -39.919 7.865   -9.235  1.00 57.99  ? 1048 HOH A O   1 
HETATM 4299 O  O   . HOH D 4 .   ? -18.393 5.546   21.240  1.00 82.15  ? 1049 HOH A O   1 
HETATM 4300 O  O   . HOH D 4 .   ? 10.272  2.498   42.634  1.00 59.38  ? 1050 HOH A O   1 
HETATM 4301 O  O   . HOH D 4 .   ? -20.004 22.248  31.109  1.00 88.21  ? 1051 HOH A O   1 
HETATM 4302 O  O   . HOH D 4 .   ? -2.252  -7.513  27.964  1.00 128.16 ? 1052 HOH A O   1 
HETATM 4303 O  O   . HOH D 4 .   ? 9.443   9.614   7.984   1.00 38.19  ? 1053 HOH A O   1 
HETATM 4304 O  O   . HOH D 4 .   ? -34.223 -10.118 -5.560  1.00 104.16 ? 1054 HOH A O   1 
HETATM 4305 O  O   . HOH D 4 .   ? -26.078 8.180   -3.934  1.00 65.44  ? 1055 HOH A O   1 
HETATM 4306 O  O   . HOH D 4 .   ? 13.962  17.598  -22.888 1.00 59.58  ? 1056 HOH A O   1 
HETATM 4307 O  O   . HOH D 4 .   ? -18.325 25.093  19.787  1.00 62.33  ? 1057 HOH A O   1 
HETATM 4308 O  O   . HOH D 4 .   ? -12.834 -4.915  4.347   1.00 45.66  ? 1058 HOH A O   1 
HETATM 4309 O  O   . HOH D 4 .   ? -26.615 7.498   10.333  1.00 89.15  ? 1059 HOH A O   1 
HETATM 4310 O  O   . HOH D 4 .   ? -52.397 22.171  14.560  1.00 69.03  ? 1060 HOH A O   1 
HETATM 4311 O  O   . HOH D 4 .   ? -21.546 11.329  0.803   1.00 65.62  ? 1061 HOH A O   1 
HETATM 4312 O  O   . HOH D 4 .   ? -6.254  3.477   -6.161  1.00 56.84  ? 1062 HOH A O   1 
HETATM 4313 O  O   . HOH D 4 .   ? -11.041 10.239  27.483  1.00 47.68  ? 1063 HOH A O   1 
HETATM 4314 O  O   . HOH D 4 .   ? 11.337  16.796  16.988  1.00 61.46  ? 1064 HOH A O   1 
HETATM 4315 O  O   . HOH D 4 .   ? -25.319 -3.497  12.787  1.00 61.94  ? 1065 HOH A O   1 
HETATM 4316 O  O   . HOH D 4 .   ? -5.592  -22.447 5.830   1.00 83.16  ? 1066 HOH A O   1 
HETATM 4317 O  O   . HOH D 4 .   ? 20.728  29.070  -8.101  1.00 40.03  ? 1067 HOH A O   1 
HETATM 4318 O  O   . HOH D 4 .   ? -20.818 15.862  8.769   1.00 45.71  ? 1068 HOH A O   1 
HETATM 4319 O  O   . HOH D 4 .   ? -23.277 2.931   0.564   1.00 56.93  ? 1069 HOH A O   1 
HETATM 4320 O  O   . HOH D 4 .   ? -33.705 17.552  11.457  1.00 53.27  ? 1070 HOH A O   1 
HETATM 4321 O  O   . HOH D 4 .   ? -42.130 8.873   14.397  1.00 71.54  ? 1071 HOH A O   1 
HETATM 4322 O  O   . HOH D 4 .   ? 9.065   7.919   25.088  1.00 50.49  ? 1072 HOH A O   1 
HETATM 4323 O  O   . HOH D 4 .   ? 10.100  14.911  3.175   1.00 81.90  ? 1073 HOH A O   1 
HETATM 4324 O  O   . HOH D 4 .   ? -3.328  29.279  -17.462 1.00 53.78  ? 1074 HOH A O   1 
HETATM 4325 O  O   . HOH D 4 .   ? 8.982   8.733   29.223  1.00 58.33  ? 1075 HOH A O   1 
HETATM 4326 O  O   . HOH D 4 .   ? -17.793 26.899  -0.240  1.00 102.39 ? 1076 HOH A O   1 
HETATM 4327 O  O   . HOH D 4 .   ? -12.080 10.630  15.939  1.00 108.91 ? 1077 HOH A O   1 
HETATM 4328 O  O   . HOH D 4 .   ? -17.424 -5.447  11.397  1.00 56.46  ? 1078 HOH A O   1 
HETATM 4329 O  O   . HOH D 4 .   ? 5.917   3.414   31.818  1.00 66.38  ? 1079 HOH A O   1 
HETATM 4330 O  O   . HOH D 4 .   ? -26.469 -2.505  10.588  1.00 65.98  ? 1080 HOH A O   1 
HETATM 4331 O  O   . HOH D 4 .   ? -0.098  27.049  1.777   1.00 37.94  ? 1081 HOH A O   1 
HETATM 4332 O  O   . HOH D 4 .   ? -0.380  39.144  -15.316 1.00 42.88  ? 1082 HOH A O   1 
HETATM 4333 O  O   . HOH D 4 .   ? 5.641   19.504  -5.071  1.00 28.66  ? 1083 HOH A O   1 
HETATM 4334 O  O   . HOH D 4 .   ? 7.300   18.089  -1.140  1.00 33.95  ? 1084 HOH A O   1 
HETATM 4335 O  O   . HOH D 4 .   ? -8.172  -0.407  -13.148 1.00 44.10  ? 1085 HOH A O   1 
HETATM 4336 O  O   . HOH D 4 .   ? 1.175   -9.885  17.385  1.00 38.95  ? 1086 HOH A O   1 
HETATM 4337 O  O   . HOH D 4 .   ? -8.625  9.491   -18.382 1.00 54.67  ? 1087 HOH A O   1 
HETATM 4338 O  O   . HOH D 4 .   ? -28.199 2.140   6.861   1.00 57.68  ? 1088 HOH A O   1 
HETATM 4339 O  O   . HOH D 4 .   ? 4.467   32.322  -5.097  1.00 50.44  ? 1089 HOH A O   1 
HETATM 4340 O  O   . HOH D 4 .   ? -17.550 13.435  11.507  1.00 34.32  ? 1090 HOH A O   1 
HETATM 4341 O  O   . HOH D 4 .   ? -11.251 -13.185 19.499  1.00 62.77  ? 1091 HOH A O   1 
HETATM 4342 O  O   . HOH D 4 .   ? -18.149 -9.033  6.292   1.00 49.50  ? 1092 HOH A O   1 
HETATM 4343 O  O   . HOH D 4 .   ? 3.100   16.468  14.461  1.00 44.72  ? 1093 HOH A O   1 
HETATM 4344 O  O   . HOH D 4 .   ? -15.094 5.851   2.014   1.00 51.44  ? 1094 HOH A O   1 
HETATM 4345 O  O   . HOH D 4 .   ? -1.530  27.522  8.464   1.00 45.48  ? 1095 HOH A O   1 
HETATM 4346 O  O   . HOH D 4 .   ? -3.308  -2.633  34.997  1.00 67.85  ? 1096 HOH A O   1 
HETATM 4347 O  O   . HOH D 4 .   ? 2.952   1.909   7.147   1.00 42.99  ? 1097 HOH A O   1 
HETATM 4348 O  O   . HOH D 4 .   ? -10.998 13.361  26.761  1.00 55.17  ? 1098 HOH A O   1 
HETATM 4349 O  O   . HOH D 4 .   ? 16.353  12.043  17.686  1.00 42.27  ? 1099 HOH A O   1 
HETATM 4350 O  O   . HOH D 4 .   ? 2.088   35.007  -18.171 1.00 53.46  ? 1100 HOH A O   1 
HETATM 4351 O  O   . HOH D 4 .   ? -45.553 -0.456  12.388  1.00 47.29  ? 1101 HOH A O   1 
HETATM 4352 O  O   . HOH D 4 .   ? -4.502  26.438  3.205   1.00 42.42  ? 1102 HOH A O   1 
HETATM 4353 O  O   . HOH D 4 .   ? -10.861 8.868   -0.950  1.00 50.32  ? 1103 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   ALA 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   ALA 6   6   ?   ?   ?   A . n 
A 1 7   GLU 7   7   ?   ?   ?   A . n 
A 1 8   GLU 8   8   ?   ?   ?   A . n 
A 1 9   VAL 9   9   ?   ?   ?   A . n 
A 1 10  LEU 10  10  ?   ?   ?   A . n 
A 1 11  ALA 11  11  ?   ?   ?   A . n 
A 1 12  PRO 12  12  ?   ?   ?   A . n 
A 1 13  LEU 13  13  ?   ?   ?   A . n 
A 1 14  ARG 14  14  ?   ?   ?   A . n 
A 1 15  LEU 15  15  ?   ?   ?   A . n 
A 1 16  ALA 16  16  ?   ?   ?   A . n 
A 1 17  VAL 17  17  ?   ?   ?   A . n 
A 1 18  ARG 18  18  ?   ?   ?   A . n 
A 1 19  GLN 19  19  ?   ?   ?   A . n 
A 1 20  GLN 20  20  ?   ?   ?   A . n 
A 1 21  GLY 21  21  ?   ?   ?   A . n 
A 1 22  ASP 22  22  ?   ?   ?   A . n 
A 1 23  LEU 23  23  ?   ?   ?   A . n 
A 1 24  VAL 24  24  ?   ?   ?   A . n 
A 1 25  ARG 25  25  ?   ?   ?   A . n 
A 1 26  LYS 26  26  ?   ?   ?   A . n 
A 1 27  LEU 27  27  ?   ?   ?   A . n 
A 1 28  LYS 28  28  ?   ?   ?   A . n 
A 1 29  GLU 29  29  ?   ?   ?   A . n 
A 1 30  ASP 30  30  ?   ?   ?   A . n 
A 1 31  LYS 31  31  ?   ?   ?   A . n 
A 1 32  ALA 32  32  ?   ?   ?   A . n 
A 1 33  PRO 33  33  ?   ?   ?   A . n 
A 1 34  GLN 34  34  ?   ?   ?   A . n 
A 1 35  VAL 35  35  ?   ?   ?   A . n 
A 1 36  ASP 36  36  ?   ?   ?   A . n 
A 1 37  VAL 37  37  ?   ?   ?   A . n 
A 1 38  ASP 38  38  ?   ?   ?   A . n 
A 1 39  LYS 39  39  ?   ?   ?   A . n 
A 1 40  ALA 40  40  ?   ?   ?   A . n 
A 1 41  VAL 41  41  ?   ?   ?   A . n 
A 1 42  ALA 42  42  ?   ?   ?   A . n 
A 1 43  GLU 43  43  ?   ?   ?   A . n 
A 1 44  LEU 44  44  ?   ?   ?   A . n 
A 1 45  LYS 45  45  ?   ?   ?   A . n 
A 1 46  ALA 46  46  ?   ?   ?   A . n 
A 1 47  ARG 47  47  ?   ?   ?   A . n 
A 1 48  LYS 48  48  ?   ?   ?   A . n 
A 1 49  ARG 49  49  ?   ?   ?   A . n 
A 1 50  VAL 50  50  ?   ?   ?   A . n 
A 1 51  LEU 51  51  ?   ?   ?   A . n 
A 1 52  GLU 52  52  ?   ?   ?   A . n 
A 1 53  ALA 53  53  ?   ?   ?   A . n 
A 1 54  LYS 54  54  ?   ?   ?   A . n 
A 1 55  GLU 55  55  ?   ?   ?   A . n 
A 1 56  LEU 56  56  ?   ?   ?   A . n 
A 1 57  ALA 57  57  ?   ?   ?   A . n 
A 1 58  LEU 58  58  ?   ?   ?   A . n 
A 1 59  GLN 59  59  ?   ?   ?   A . n 
A 1 60  PRO 60  60  ?   ?   ?   A . n 
A 1 61  LYS 61  61  ?   ?   ?   A . n 
A 1 62  ASP 62  62  ?   ?   ?   A . n 
A 1 63  ASP 63  63  63  ASP ASP A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  MET 70  70  70  MET MET A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  TYR 80  80  80  TYR TYR A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  GLN 82  82  82  GLN GLN A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 CYS 101 101 101 CYS CYS A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 GLN 109 109 109 GLN GLN A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 TRP 111 111 111 TRP TRP A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 GLN 113 113 113 GLN GLN A . n 
A 1 114 HIS 114 114 114 HIS HIS A . n 
A 1 115 PHE 115 115 115 PHE PHE A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 GLN 120 120 120 GLN GLN A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 ASP 125 125 125 ASP ASP A . n 
A 1 126 CYS 126 126 126 CYS CYS A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 MET 128 128 128 MET MET A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 LYS 136 136 136 LYS LYS A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 HIS 140 140 140 HIS HIS A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 ASP 151 151 151 ASP ASP A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 ASN 154 154 154 ASN ASN A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 GLU 156 156 156 GLU GLU A . n 
A 1 157 CYS 157 157 157 CYS CYS A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 LYS 165 165 165 LYS LYS A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 HIS 167 167 167 HIS HIS A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLN 169 169 169 GLN GLN A . n 
A 1 170 LYS 170 170 170 LYS LYS A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 MET 172 172 172 MET MET A . n 
A 1 173 SER 173 173 173 SER SER A . n 
A 1 174 ASP 174 174 174 ASP ASP A . n 
A 1 175 LYS 175 175 175 LYS LYS A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 CYS 177 177 177 CYS CYS A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 MET 185 185 185 MET MET A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 GLN 191 191 191 GLN GLN A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 GLN 198 198 198 GLN GLN A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 PHE 204 204 204 PHE PHE A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 ASN 206 206 206 ASN ASN A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 PRO 212 212 212 PRO PRO A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 ASN 216 216 216 ASN ASN A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 PRO 221 221 221 PRO PRO A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 PHE 224 224 224 PHE PHE A . n 
A 1 225 ASN 225 225 225 ASN ASN A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 MET 227 227 227 MET MET A . n 
A 1 228 PHE 228 228 228 PHE PHE A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 THR 230 230 230 THR THR A . n 
A 1 231 PHE 231 231 231 PHE PHE A . n 
A 1 232 ILE 232 232 232 ILE ILE A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 PRO 234 234 234 PRO PRO A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 ASN 237 237 237 ASN ASN A . n 
A 1 238 MET 238 238 238 MET MET A . n 
A 1 239 PRO 239 239 239 PRO PRO A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 TYR 241 241 241 TYR TYR A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 PRO 244 244 244 PRO PRO A . n 
A 1 245 GLU 245 245 245 GLU GLU A . n 
A 1 246 THR 246 246 246 THR THR A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 GLN 248 248 248 GLN GLN A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ILE 250 250 250 ILE ILE A . n 
A 1 251 PHE 251 251 251 PHE PHE A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 PHE 254 254 254 PHE PHE A . n 
A 1 255 LYS 255 255 255 LYS LYS A . n 
A 1 256 ARG 256 256 256 ARG ARG A . n 
A 1 257 LEU 257 257 257 LEU LEU A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 PHE 260 260 260 PHE PHE A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 GLN 262 262 262 GLN GLN A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 LYS 264 264 264 LYS LYS A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 PRO 266 266 266 PRO PRO A . n 
A 1 267 PHE 267 267 267 PHE PHE A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 ALA 270 270 270 ALA ALA A . n 
A 1 271 GLN 271 271 271 GLN GLN A . n 
A 1 272 ILE 272 272 272 ILE ILE A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 ASN 274 274 274 ASN ASN A . n 
A 1 275 SER 275 275 275 SER SER A . n 
A 1 276 PHE 276 276 276 PHE PHE A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 GLU 279 279 279 GLU GLU A . n 
A 1 280 ILE 280 280 280 ILE ILE A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 PRO 282 282 282 PRO PRO A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 GLY 285 285 285 GLY GLY A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 ARG 288 288 288 ARG ARG A . n 
A 1 289 VAL 289 289 289 VAL VAL A . n 
A 1 290 ARG 290 290 290 ARG ARG A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 THR 293 293 293 THR THR A . n 
A 1 294 MET 294 294 294 MET MET A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 ILE 297 297 297 ILE ILE A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 HIS 299 299 299 HIS HIS A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 ASP 302 302 302 ASP ASP A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 LYS 306 306 306 LYS LYS A . n 
A 1 307 ASP 307 307 307 ASP ASP A . n 
A 1 308 HIS 308 308 308 HIS HIS A . n 
A 1 309 PRO 309 309 309 PRO PRO A . n 
A 1 310 LYS 310 310 310 LYS LYS A . n 
A 1 311 PHE 311 311 311 PHE PHE A . n 
A 1 312 GLN 312 312 312 GLN GLN A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 ASP 316 316 316 ASP ASP A . n 
A 1 317 LEU 317 317 317 LEU LEU A . n 
A 1 318 HIS 318 318 318 HIS HIS A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 TYR 320 320 320 TYR TYR A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 TYR 322 322 322 TYR TYR A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 ALA 324 324 324 ALA ALA A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ALA 326 326 326 ALA ALA A . n 
A 1 327 GLN 327 327 327 GLN GLN A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 GLY 330 330 330 GLY GLY A . n 
A 1 331 GLN 331 331 331 GLN GLN A . n 
A 1 332 SER 332 332 332 SER SER A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 ARG 334 334 334 ARG ARG A . n 
A 1 335 LYS 335 335 335 LYS LYS A . n 
A 1 336 MET 336 336 336 MET MET A . n 
A 1 337 ARG 337 337 337 ARG ARG A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 GLY 339 339 339 GLY GLY A . n 
A 1 340 ASP 340 340 340 ASP ASP A . n 
A 1 341 ALA 341 341 341 ALA ALA A . n 
A 1 342 VAL 342 342 342 VAL VAL A . n 
A 1 343 GLU 343 343 343 GLU GLU A . n 
A 1 344 GLN 344 344 344 GLN GLN A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 ASN 348 348 348 ASN ASN A . n 
A 1 349 ASN 349 349 349 ASN ASN A . n 
A 1 350 THR 350 350 350 THR THR A . n 
A 1 351 VAL 351 351 351 VAL VAL A . n 
A 1 352 LEU 352 352 352 LEU LEU A . n 
A 1 353 GLY 353 353 353 GLY GLY A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 PHE 355 355 355 PHE PHE A . n 
A 1 356 ILE 356 356 356 ILE ILE A . n 
A 1 357 GLY 357 357 357 GLY GLY A . n 
A 1 358 ARG 358 358 358 ARG ARG A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 TYR 360 360 360 TYR TYR A . n 
A 1 361 LEU 361 361 361 LEU LEU A . n 
A 1 362 TYR 362 362 362 TYR TYR A . n 
A 1 363 LEU 363 363 363 LEU LEU A . n 
A 1 364 THR 364 364 364 THR THR A . n 
A 1 365 LYS 365 365 365 LYS LYS A . n 
A 1 366 VAL 366 366 366 VAL VAL A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 ILE 368 368 368 ILE ILE A . n 
A 1 369 SER 369 369 369 SER SER A . n 
A 1 370 PRO 370 370 370 PRO PRO A . n 
A 1 371 ASP 371 371 371 ASP ASP A . n 
A 1 372 LYS 372 372 372 LYS LYS A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ARG 374 374 374 ARG ARG A . n 
A 1 375 PHE 375 375 375 PHE PHE A . n 
A 1 376 ARG 376 376 376 ARG ARG A . n 
A 1 377 GLN 377 377 377 GLN GLN A . n 
A 1 378 HIS 378 378 378 HIS HIS A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 GLU 380 380 380 GLU GLU A . n 
A 1 381 ASN 381 381 381 ASN ASN A . n 
A 1 382 GLU 382 382 ?   ?   ?   A . n 
A 1 383 MET 383 383 ?   ?   ?   A . n 
A 1 384 ALA 384 384 ?   ?   ?   A . n 
A 1 385 HIS 385 385 ?   ?   ?   A . n 
A 1 386 TYR 386 386 ?   ?   ?   A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 CYS 388 388 388 CYS CYS A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 CYS 390 390 390 CYS CYS A . n 
A 1 391 TRP 391 391 391 TRP TRP A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ALA 393 393 393 ALA ALA A . n 
A 1 394 GLU 394 394 394 GLU GLU A . n 
A 1 395 SER 395 395 395 SER SER A . n 
A 1 396 LYS 396 396 396 LYS LYS A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 SER 398 398 398 SER SER A . n 
A 1 399 TYR 399 399 399 TYR TYR A . n 
A 1 400 GLY 400 400 400 GLY GLY A . n 
A 1 401 TRP 401 401 401 TRP TRP A . n 
A 1 402 ILE 402 402 402 ILE ILE A . n 
A 1 403 GLU 403 403 403 GLU GLU A . n 
A 1 404 ILE 404 404 404 ILE ILE A . n 
A 1 405 VAL 405 405 405 VAL VAL A . n 
A 1 406 GLY 406 406 406 GLY GLY A . n 
A 1 407 CYS 407 407 407 CYS CYS A . n 
A 1 408 ALA 408 408 408 ALA ALA A . n 
A 1 409 ASP 409 409 409 ASP ASP A . n 
A 1 410 ARG 410 410 410 ARG ARG A . n 
A 1 411 SER 411 411 411 SER SER A . n 
A 1 412 CYS 412 412 412 CYS CYS A . n 
A 1 413 TYR 413 413 413 TYR TYR A . n 
A 1 414 ASP 414 414 414 ASP ASP A . n 
A 1 415 LEU 415 415 415 LEU LEU A . n 
A 1 416 SER 416 416 416 SER SER A . n 
A 1 417 CYS 417 417 417 CYS CYS A . n 
A 1 418 HIS 418 418 418 HIS HIS A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ARG 420 420 420 ARG ARG A . n 
A 1 421 ALA 421 421 ?   ?   ?   A . n 
A 1 422 THR 422 422 ?   ?   ?   A . n 
A 1 423 LYS 423 423 ?   ?   ?   A . n 
A 1 424 VAL 424 424 ?   ?   ?   A . n 
A 1 425 PRO 425 425 ?   ?   ?   A . n 
A 1 426 LEU 426 426 ?   ?   ?   A . n 
A 1 427 VAL 427 427 ?   ?   ?   A . n 
A 1 428 ALA 428 428 ?   ?   ?   A . n 
A 1 429 GLU 429 429 ?   ?   ?   A . n 
A 1 430 LYS 430 430 ?   ?   ?   A . n 
A 1 431 PRO 431 431 ?   ?   ?   A . n 
A 1 432 LEU 432 432 ?   ?   ?   A . n 
A 1 433 LYS 433 433 ?   ?   ?   A . n 
A 1 434 GLU 434 434 ?   ?   ?   A . n 
A 1 435 PRO 435 435 ?   ?   ?   A . n 
A 1 436 LYS 436 436 ?   ?   ?   A . n 
A 1 437 THR 437 437 ?   ?   ?   A . n 
A 1 438 VAL 438 438 ?   ?   ?   A . n 
A 1 439 ASN 439 439 ?   ?   ?   A . n 
A 1 440 VAL 440 440 ?   ?   ?   A . n 
A 1 441 VAL 441 441 ?   ?   ?   A . n 
A 1 442 GLN 442 442 ?   ?   ?   A . n 
A 1 443 PHE 443 443 ?   ?   ?   A . n 
A 1 444 GLU 444 444 ?   ?   ?   A . n 
A 1 445 PRO 445 445 ?   ?   ?   A . n 
A 1 446 SER 446 446 ?   ?   ?   A . n 
A 1 447 LYS 447 447 ?   ?   ?   A . n 
A 1 448 GLY 448 448 ?   ?   ?   A . n 
A 1 449 ALA 449 449 ?   ?   ?   A . n 
A 1 450 ILE 450 450 ?   ?   ?   A . n 
A 1 451 GLY 451 451 ?   ?   ?   A . n 
A 1 452 LYS 452 452 ?   ?   ?   A . n 
A 1 453 ALA 453 453 ?   ?   ?   A . n 
A 1 454 TYR 454 454 ?   ?   ?   A . n 
A 1 455 LYS 455 455 ?   ?   ?   A . n 
A 1 456 LYS 456 456 ?   ?   ?   A . n 
A 1 457 ASP 457 457 ?   ?   ?   A . n 
A 1 458 ALA 458 458 ?   ?   ?   A . n 
A 1 459 LYS 459 459 ?   ?   ?   A . n 
A 1 460 LEU 460 460 ?   ?   ?   A . n 
A 1 461 VAL 461 461 ?   ?   ?   A . n 
A 1 462 MET 462 462 ?   ?   ?   A . n 
A 1 463 GLU 463 463 ?   ?   ?   A . n 
A 1 464 TYR 464 464 ?   ?   ?   A . n 
A 1 465 LEU 465 465 ?   ?   ?   A . n 
A 1 466 ALA 466 466 ?   ?   ?   A . n 
A 1 467 ILE 467 467 ?   ?   ?   A . n 
A 1 468 CYS 468 468 ?   ?   ?   A . n 
A 1 469 ASP 469 469 ?   ?   ?   A . n 
A 1 470 GLU 470 470 ?   ?   ?   A . n 
A 1 471 CYS 471 471 ?   ?   ?   A . n 
A 1 472 TYR 472 472 ?   ?   ?   A . n 
A 1 473 ILE 473 473 ?   ?   ?   A . n 
A 1 474 THR 474 474 ?   ?   ?   A . n 
A 1 475 GLU 475 475 ?   ?   ?   A . n 
A 1 476 MET 476 476 ?   ?   ?   A . n 
A 1 477 GLU 477 477 ?   ?   ?   A . n 
A 1 478 MET 478 478 ?   ?   ?   A . n 
A 1 479 LEU 479 479 ?   ?   ?   A . n 
A 1 480 LEU 480 480 ?   ?   ?   A . n 
A 1 481 ASN 481 481 ?   ?   ?   A . n 
A 1 482 GLU 482 482 ?   ?   ?   A . n 
A 1 483 LYS 483 483 ?   ?   ?   A . n 
A 1 484 GLY 484 484 ?   ?   ?   A . n 
A 1 485 GLU 485 485 ?   ?   ?   A . n 
A 1 486 PHE 486 486 ?   ?   ?   A . n 
A 1 487 THR 487 487 ?   ?   ?   A . n 
A 1 488 ILE 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 THR 490 490 ?   ?   ?   A . n 
A 1 491 GLU 491 491 ?   ?   ?   A . n 
A 1 492 GLY 492 492 ?   ?   ?   A . n 
A 1 493 LYS 493 493 ?   ?   ?   A . n 
A 1 494 THR 494 494 ?   ?   ?   A . n 
A 1 495 PHE 495 495 ?   ?   ?   A . n 
A 1 496 GLN 496 496 ?   ?   ?   A . n 
A 1 497 LEU 497 497 ?   ?   ?   A . n 
A 1 498 THR 498 498 ?   ?   ?   A . n 
A 1 499 LYS 499 499 ?   ?   ?   A . n 
A 1 500 ASP 500 500 ?   ?   ?   A . n 
A 1 501 MET 501 501 ?   ?   ?   A . n 
A 1 502 ILE 502 502 ?   ?   ?   A . n 
A 1 503 ASN 503 503 ?   ?   ?   A . n 
A 1 504 VAL 504 504 ?   ?   ?   A . n 
A 1 505 LYS 505 505 ?   ?   ?   A . n 
A 1 506 ARG 506 506 506 ARG ARG A . n 
A 1 507 PHE 507 507 507 PHE PHE A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 LYS 509 509 509 LYS LYS A . n 
A 1 510 THR 510 510 510 THR THR A . n 
A 1 511 LEU 511 511 511 LEU LEU A . n 
A 1 512 TYR 512 512 512 TYR TYR A . n 
A 1 513 VAL 513 513 513 VAL VAL A . n 
A 1 514 GLU 514 514 514 GLU GLU A . n 
A 1 515 GLU 515 515 515 GLU GLU A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 VAL 517 517 517 VAL VAL A . n 
A 1 518 PRO 518 518 518 PRO PRO A . n 
A 1 519 ASN 519 519 519 ASN ASN A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 GLU 522 522 522 GLU GLU A . n 
A 1 523 PRO 523 523 523 PRO PRO A . n 
A 1 524 SER 524 524 524 SER SER A . n 
A 1 525 PHE 525 525 525 PHE PHE A . n 
A 1 526 ARG 526 526 526 ARG ARG A . n 
A 1 527 LEU 527 527 527 LEU LEU A . n 
A 1 528 GLY 528 528 528 GLY GLY A . n 
A 1 529 ARG 529 529 529 ARG ARG A . n 
A 1 530 ILE 530 530 530 ILE ILE A . n 
A 1 531 MET 531 531 531 MET MET A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 THR 533 533 533 THR THR A . n 
A 1 534 VAL 534 534 534 VAL VAL A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 GLU 536 536 536 GLU GLU A . n 
A 1 537 HIS 537 537 537 HIS HIS A . n 
A 1 538 THR 538 538 538 THR THR A . n 
A 1 539 PHE 539 539 539 PHE PHE A . n 
A 1 540 HIS 540 540 540 HIS HIS A . n 
A 1 541 VAL 541 541 541 VAL VAL A . n 
A 1 542 ARG 542 542 542 ARG ARG A . n 
A 1 543 GLU 543 543 543 GLU GLU A . n 
A 1 544 GLY 544 544 544 GLY GLY A . n 
A 1 545 ASP 545 545 545 ASP ASP A . n 
A 1 546 GLU 546 546 546 GLU GLU A . n 
A 1 547 GLN 547 547 547 GLN GLN A . n 
A 1 548 ARG 548 548 548 ARG ARG A . n 
A 1 549 THR 549 549 549 THR THR A . n 
A 1 550 PHE 550 550 550 PHE PHE A . n 
A 1 551 PHE 551 551 551 PHE PHE A . n 
A 1 552 SER 552 552 552 SER SER A . n 
A 1 553 PHE 553 553 553 PHE PHE A . n 
A 1 554 PRO 554 554 554 PRO PRO A . n 
A 1 555 ALA 555 555 555 ALA ALA A . n 
A 1 556 VAL 556 556 556 VAL VAL A . n 
A 1 557 VAL 557 557 557 VAL VAL A . n 
A 1 558 ALA 558 558 558 ALA ALA A . n 
A 1 559 PRO 559 559 559 PRO PRO A . n 
A 1 560 PHE 560 560 560 PHE PHE A . n 
A 1 561 LYS 561 561 561 LYS LYS A . n 
A 1 562 CYS 562 562 562 CYS CYS A . n 
A 1 563 SER 563 563 563 SER SER A . n 
A 1 564 VAL 564 564 564 VAL VAL A . n 
A 1 565 LEU 565 565 565 LEU LEU A . n 
A 1 566 PRO 566 566 566 PRO PRO A . n 
A 1 567 LEU 567 567 567 LEU LEU A . n 
A 1 568 SER 568 568 568 SER SER A . n 
A 1 569 GLN 569 569 569 GLN GLN A . n 
A 1 570 ASN 570 570 570 ASN ASN A . n 
A 1 571 GLN 571 571 571 GLN GLN A . n 
A 1 572 GLU 572 572 572 GLU GLU A . n 
A 1 573 PHE 573 573 573 PHE PHE A . n 
A 1 574 MET 574 574 574 MET MET A . n 
A 1 575 PRO 575 575 575 PRO PRO A . n 
A 1 576 PHE 576 576 576 PHE PHE A . n 
A 1 577 VAL 577 577 577 VAL VAL A . n 
A 1 578 LYS 578 578 578 LYS LYS A . n 
A 1 579 GLU 579 579 579 GLU GLU A . n 
A 1 580 LEU 580 580 580 LEU LEU A . n 
A 1 581 SER 581 581 581 SER SER A . n 
A 1 582 GLU 582 582 582 GLU GLU A . n 
A 1 583 ALA 583 583 583 ALA ALA A . n 
A 1 584 LEU 584 584 584 LEU LEU A . n 
A 1 585 THR 585 585 585 THR THR A . n 
A 1 586 ARG 586 586 586 ARG ARG A . n 
A 1 587 HIS 587 587 587 HIS HIS A . n 
A 1 588 GLY 588 588 588 GLY GLY A . n 
A 1 589 VAL 589 589 589 VAL VAL A . n 
A 1 590 SER 590 590 590 SER SER A . n 
A 1 591 HIS 591 591 591 HIS HIS A . n 
A 1 592 LYS 592 592 592 LYS LYS A . n 
A 1 593 VAL 593 593 593 VAL VAL A . n 
A 1 594 ASP 594 594 594 ASP ASP A . n 
A 1 595 ASP 595 595 595 ASP ASP A . n 
A 1 596 SER 596 596 596 SER SER A . n 
A 1 597 SER 597 597 597 SER SER A . n 
A 1 598 GLY 598 598 598 GLY GLY A . n 
A 1 599 SER 599 599 599 SER SER A . n 
A 1 600 ILE 600 600 600 ILE ILE A . n 
A 1 601 GLY 601 601 601 GLY GLY A . n 
A 1 602 ARG 602 602 602 ARG ARG A . n 
A 1 603 ARG 603 603 603 ARG ARG A . n 
A 1 604 TYR 604 604 604 TYR TYR A . n 
A 1 605 ALA 605 605 605 ALA ALA A . n 
A 1 606 ARG 606 606 606 ARG ARG A . n 
A 1 607 THR 607 607 607 THR THR A . n 
A 1 608 ASP 608 608 608 ASP ASP A . n 
A 1 609 GLU 609 609 609 GLU GLU A . n 
A 1 610 ILE 610 610 610 ILE ILE A . n 
A 1 611 GLY 611 611 611 GLY GLY A . n 
A 1 612 VAL 612 612 612 VAL VAL A . n 
A 1 613 ALA 613 613 613 ALA ALA A . n 
A 1 614 PHE 614 614 614 PHE PHE A . n 
A 1 615 GLY 615 615 615 GLY GLY A . n 
A 1 616 VAL 616 616 616 VAL VAL A . n 
A 1 617 THR 617 617 617 THR THR A . n 
A 1 618 ILE 618 618 618 ILE ILE A . n 
A 1 619 ASP 619 619 619 ASP ASP A . n 
A 1 620 PHE 620 620 620 PHE PHE A . n 
A 1 621 ASP 621 621 621 ASP ASP A . n 
A 1 622 THR 622 622 622 THR THR A . n 
A 1 623 VAL 623 623 623 VAL VAL A . n 
A 1 624 ASN 624 624 624 ASN ASN A . n 
A 1 625 LYS 625 625 625 LYS LYS A . n 
A 1 626 THR 626 626 626 THR THR A . n 
A 1 627 PRO 627 627 627 PRO PRO A . n 
A 1 628 HIS 628 628 628 HIS HIS A . n 
A 1 629 THR 629 629 629 THR THR A . n 
A 1 630 ALA 630 630 630 ALA ALA A . n 
A 1 631 THR 631 631 631 THR THR A . n 
A 1 632 LEU 632 632 632 LEU LEU A . n 
A 1 633 ARG 633 633 633 ARG ARG A . n 
A 1 634 ASP 634 634 634 ASP ASP A . n 
A 1 635 ARG 635 635 635 ARG ARG A . n 
A 1 636 ASP 636 636 636 ASP ASP A . n 
A 1 637 SER 637 637 637 SER SER A . n 
A 1 638 MET 638 638 638 MET MET A . n 
A 1 639 ARG 639 639 639 ARG ARG A . n 
A 1 640 GLN 640 640 640 GLN GLN A . n 
A 1 641 ILE 641 641 641 ILE ILE A . n 
A 1 642 ARG 642 642 642 ARG ARG A . n 
A 1 643 ALA 643 643 643 ALA ALA A . n 
A 1 644 GLU 644 644 644 GLU GLU A . n 
A 1 645 ILE 645 645 645 ILE ILE A . n 
A 1 646 SER 646 646 646 SER SER A . n 
A 1 647 GLU 647 647 647 GLU GLU A . n 
A 1 648 LEU 648 648 648 LEU LEU A . n 
A 1 649 PRO 649 649 649 PRO PRO A . n 
A 1 650 SER 650 650 650 SER SER A . n 
A 1 651 ILE 651 651 651 ILE ILE A . n 
A 1 652 VAL 652 652 652 VAL VAL A . n 
A 1 653 GLN 653 653 653 GLN GLN A . n 
A 1 654 ASP 654 654 654 ASP ASP A . n 
A 1 655 LEU 655 655 655 LEU LEU A . n 
A 1 656 ALA 656 656 656 ALA ALA A . n 
A 1 657 ASN 657 657 657 ASN ASN A . n 
A 1 658 GLY 658 658 658 GLY GLY A . n 
A 1 659 ASN 659 659 659 ASN ASN A . n 
A 1 660 ILE 660 660 660 ILE ILE A . n 
A 1 661 THR 661 661 661 THR THR A . n 
A 1 662 TRP 662 662 662 TRP TRP A . n 
A 1 663 ALA 663 663 663 ALA ALA A . n 
A 1 664 ASP 664 664 664 ASP ASP A . n 
A 1 665 VAL 665 665 665 VAL VAL A . n 
A 1 666 GLU 666 666 666 GLU GLU A . n 
A 1 667 ALA 667 667 667 ALA ALA A . n 
A 1 668 ARG 668 668 668 ARG ARG A . n 
A 1 669 TYR 669 669 669 TYR TYR A . n 
A 1 670 PRO 670 670 670 PRO PRO A . n 
A 1 671 LEU 671 671 671 LEU LEU A . n 
A 1 672 PHE 672 672 672 PHE PHE A . n 
A 1 673 GLU 673 673 673 GLU GLU A . n 
A 1 674 GLY 674 674 674 GLY GLY A . n 
A 1 675 GLN 675 675 ?   ?   ?   A . n 
A 1 676 GLU 676 676 ?   ?   ?   A . n 
A 1 677 THR 677 677 ?   ?   ?   A . n 
A 1 678 GLY 678 678 ?   ?   ?   A . n 
A 1 679 LYS 679 679 ?   ?   ?   A . n 
A 1 680 LYS 680 680 ?   ?   ?   A . n 
A 1 681 GLU 681 681 ?   ?   ?   A . n 
A 1 682 THR 682 682 ?   ?   ?   A . n 
A 1 683 ILE 683 683 ?   ?   ?   A . n 
A 1 684 GLU 684 684 ?   ?   ?   A . n 
A 1 685 GLU 685 685 ?   ?   ?   A . n 
A 1 686 LEU 686 686 ?   ?   ?   A . n 
A 1 687 GLU 687 687 ?   ?   ?   A . n 
A 1 688 HIS 688 688 ?   ?   ?   A . n 
A 1 689 HIS 689 689 ?   ?   ?   A . n 
A 1 690 HIS 690 690 ?   ?   ?   A . n 
A 1 691 HIS 691 691 ?   ?   ?   A . n 
A 1 692 HIS 692 692 ?   ?   ?   A . n 
A 1 693 HIS 693 693 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1   901  901 CL  CL  A . 
C 3 GOL 1   801  801 GOL GOL A . 
D 4 HOH 1   902  1   HOH HOH A . 
D 4 HOH 2   903  2   HOH HOH A . 
D 4 HOH 3   904  3   HOH HOH A . 
D 4 HOH 4   905  4   HOH HOH A . 
D 4 HOH 5   906  5   HOH HOH A . 
D 4 HOH 6   907  6   HOH HOH A . 
D 4 HOH 7   908  7   HOH HOH A . 
D 4 HOH 8   909  8   HOH HOH A . 
D 4 HOH 9   910  9   HOH HOH A . 
D 4 HOH 10  911  10  HOH HOH A . 
D 4 HOH 11  912  11  HOH HOH A . 
D 4 HOH 12  913  12  HOH HOH A . 
D 4 HOH 13  914  13  HOH HOH A . 
D 4 HOH 14  915  14  HOH HOH A . 
D 4 HOH 15  916  15  HOH HOH A . 
D 4 HOH 16  917  16  HOH HOH A . 
D 4 HOH 17  918  17  HOH HOH A . 
D 4 HOH 18  919  18  HOH HOH A . 
D 4 HOH 19  920  19  HOH HOH A . 
D 4 HOH 20  921  20  HOH HOH A . 
D 4 HOH 21  922  21  HOH HOH A . 
D 4 HOH 22  923  22  HOH HOH A . 
D 4 HOH 23  924  23  HOH HOH A . 
D 4 HOH 24  925  24  HOH HOH A . 
D 4 HOH 25  926  25  HOH HOH A . 
D 4 HOH 26  927  26  HOH HOH A . 
D 4 HOH 27  928  27  HOH HOH A . 
D 4 HOH 28  929  28  HOH HOH A . 
D 4 HOH 29  930  29  HOH HOH A . 
D 4 HOH 30  931  30  HOH HOH A . 
D 4 HOH 31  932  31  HOH HOH A . 
D 4 HOH 32  933  32  HOH HOH A . 
D 4 HOH 33  934  33  HOH HOH A . 
D 4 HOH 34  935  34  HOH HOH A . 
D 4 HOH 35  936  35  HOH HOH A . 
D 4 HOH 36  937  36  HOH HOH A . 
D 4 HOH 37  938  37  HOH HOH A . 
D 4 HOH 38  939  38  HOH HOH A . 
D 4 HOH 39  940  39  HOH HOH A . 
D 4 HOH 40  941  40  HOH HOH A . 
D 4 HOH 41  942  41  HOH HOH A . 
D 4 HOH 42  943  42  HOH HOH A . 
D 4 HOH 43  944  43  HOH HOH A . 
D 4 HOH 44  945  44  HOH HOH A . 
D 4 HOH 45  946  45  HOH HOH A . 
D 4 HOH 46  947  46  HOH HOH A . 
D 4 HOH 47  948  47  HOH HOH A . 
D 4 HOH 48  949  48  HOH HOH A . 
D 4 HOH 49  950  49  HOH HOH A . 
D 4 HOH 50  951  50  HOH HOH A . 
D 4 HOH 51  952  51  HOH HOH A . 
D 4 HOH 52  953  52  HOH HOH A . 
D 4 HOH 53  954  53  HOH HOH A . 
D 4 HOH 54  955  54  HOH HOH A . 
D 4 HOH 55  956  55  HOH HOH A . 
D 4 HOH 56  957  56  HOH HOH A . 
D 4 HOH 57  958  57  HOH HOH A . 
D 4 HOH 58  959  58  HOH HOH A . 
D 4 HOH 59  960  59  HOH HOH A . 
D 4 HOH 60  961  60  HOH HOH A . 
D 4 HOH 61  962  61  HOH HOH A . 
D 4 HOH 62  963  62  HOH HOH A . 
D 4 HOH 63  964  63  HOH HOH A . 
D 4 HOH 64  965  64  HOH HOH A . 
D 4 HOH 65  966  65  HOH HOH A . 
D 4 HOH 66  967  66  HOH HOH A . 
D 4 HOH 67  968  67  HOH HOH A . 
D 4 HOH 68  969  68  HOH HOH A . 
D 4 HOH 69  970  69  HOH HOH A . 
D 4 HOH 70  971  70  HOH HOH A . 
D 4 HOH 71  972  71  HOH HOH A . 
D 4 HOH 72  973  72  HOH HOH A . 
D 4 HOH 73  974  73  HOH HOH A . 
D 4 HOH 74  975  74  HOH HOH A . 
D 4 HOH 75  976  75  HOH HOH A . 
D 4 HOH 76  977  76  HOH HOH A . 
D 4 HOH 77  978  77  HOH HOH A . 
D 4 HOH 78  979  78  HOH HOH A . 
D 4 HOH 79  980  79  HOH HOH A . 
D 4 HOH 80  981  80  HOH HOH A . 
D 4 HOH 81  982  81  HOH HOH A . 
D 4 HOH 82  983  82  HOH HOH A . 
D 4 HOH 83  984  83  HOH HOH A . 
D 4 HOH 84  985  84  HOH HOH A . 
D 4 HOH 85  986  85  HOH HOH A . 
D 4 HOH 86  987  86  HOH HOH A . 
D 4 HOH 87  988  87  HOH HOH A . 
D 4 HOH 88  989  88  HOH HOH A . 
D 4 HOH 89  990  89  HOH HOH A . 
D 4 HOH 90  991  90  HOH HOH A . 
D 4 HOH 91  992  91  HOH HOH A . 
D 4 HOH 92  993  92  HOH HOH A . 
D 4 HOH 93  994  93  HOH HOH A . 
D 4 HOH 94  995  94  HOH HOH A . 
D 4 HOH 95  996  95  HOH HOH A . 
D 4 HOH 96  997  96  HOH HOH A . 
D 4 HOH 97  998  97  HOH HOH A . 
D 4 HOH 98  999  98  HOH HOH A . 
D 4 HOH 99  1000 99  HOH HOH A . 
D 4 HOH 100 1001 100 HOH HOH A . 
D 4 HOH 101 1002 101 HOH HOH A . 
D 4 HOH 102 1003 102 HOH HOH A . 
D 4 HOH 103 1004 103 HOH HOH A . 
D 4 HOH 104 1005 104 HOH HOH A . 
D 4 HOH 105 1006 105 HOH HOH A . 
D 4 HOH 106 1007 106 HOH HOH A . 
D 4 HOH 107 1008 107 HOH HOH A . 
D 4 HOH 108 1009 108 HOH HOH A . 
D 4 HOH 109 1010 109 HOH HOH A . 
D 4 HOH 110 1011 110 HOH HOH A . 
D 4 HOH 111 1012 111 HOH HOH A . 
D 4 HOH 112 1013 112 HOH HOH A . 
D 4 HOH 113 1014 113 HOH HOH A . 
D 4 HOH 114 1015 114 HOH HOH A . 
D 4 HOH 115 1016 115 HOH HOH A . 
D 4 HOH 116 1017 116 HOH HOH A . 
D 4 HOH 117 1018 117 HOH HOH A . 
D 4 HOH 118 1019 118 HOH HOH A . 
D 4 HOH 119 1020 119 HOH HOH A . 
D 4 HOH 120 1021 120 HOH HOH A . 
D 4 HOH 121 1022 121 HOH HOH A . 
D 4 HOH 122 1023 122 HOH HOH A . 
D 4 HOH 123 1024 123 HOH HOH A . 
D 4 HOH 124 1025 124 HOH HOH A . 
D 4 HOH 125 1026 125 HOH HOH A . 
D 4 HOH 126 1027 126 HOH HOH A . 
D 4 HOH 127 1028 127 HOH HOH A . 
D 4 HOH 128 1029 128 HOH HOH A . 
D 4 HOH 129 1030 129 HOH HOH A . 
D 4 HOH 130 1031 130 HOH HOH A . 
D 4 HOH 131 1032 131 HOH HOH A . 
D 4 HOH 132 1033 132 HOH HOH A . 
D 4 HOH 133 1034 133 HOH HOH A . 
D 4 HOH 134 1035 134 HOH HOH A . 
D 4 HOH 135 1036 135 HOH HOH A . 
D 4 HOH 136 1037 136 HOH HOH A . 
D 4 HOH 137 1038 137 HOH HOH A . 
D 4 HOH 138 1039 138 HOH HOH A . 
D 4 HOH 139 1040 139 HOH HOH A . 
D 4 HOH 140 1041 140 HOH HOH A . 
D 4 HOH 141 1042 141 HOH HOH A . 
D 4 HOH 142 1043 142 HOH HOH A . 
D 4 HOH 143 1044 143 HOH HOH A . 
D 4 HOH 144 1045 144 HOH HOH A . 
D 4 HOH 145 1046 145 HOH HOH A . 
D 4 HOH 146 1047 146 HOH HOH A . 
D 4 HOH 147 1048 147 HOH HOH A . 
D 4 HOH 148 1049 148 HOH HOH A . 
D 4 HOH 149 1050 149 HOH HOH A . 
D 4 HOH 150 1051 150 HOH HOH A . 
D 4 HOH 151 1052 151 HOH HOH A . 
D 4 HOH 152 1053 152 HOH HOH A . 
D 4 HOH 153 1054 153 HOH HOH A . 
D 4 HOH 154 1055 154 HOH HOH A . 
D 4 HOH 155 1056 155 HOH HOH A . 
D 4 HOH 156 1057 156 HOH HOH A . 
D 4 HOH 157 1058 157 HOH HOH A . 
D 4 HOH 158 1059 158 HOH HOH A . 
D 4 HOH 159 1060 159 HOH HOH A . 
D 4 HOH 160 1061 160 HOH HOH A . 
D 4 HOH 161 1062 161 HOH HOH A . 
D 4 HOH 162 1063 162 HOH HOH A . 
D 4 HOH 163 1064 163 HOH HOH A . 
D 4 HOH 164 1065 164 HOH HOH A . 
D 4 HOH 165 1066 165 HOH HOH A . 
D 4 HOH 166 1067 166 HOH HOH A . 
D 4 HOH 167 1068 167 HOH HOH A . 
D 4 HOH 168 1069 168 HOH HOH A . 
D 4 HOH 169 1070 169 HOH HOH A . 
D 4 HOH 170 1071 170 HOH HOH A . 
D 4 HOH 171 1072 171 HOH HOH A . 
D 4 HOH 172 1073 172 HOH HOH A . 
D 4 HOH 173 1074 173 HOH HOH A . 
D 4 HOH 174 1075 174 HOH HOH A . 
D 4 HOH 175 1076 175 HOH HOH A . 
D 4 HOH 176 1077 176 HOH HOH A . 
D 4 HOH 177 1078 177 HOH HOH A . 
D 4 HOH 178 1079 178 HOH HOH A . 
D 4 HOH 179 1080 179 HOH HOH A . 
D 4 HOH 180 1081 180 HOH HOH A . 
D 4 HOH 181 1082 181 HOH HOH A . 
D 4 HOH 182 1083 182 HOH HOH A . 
D 4 HOH 183 1084 183 HOH HOH A . 
D 4 HOH 184 1085 184 HOH HOH A . 
D 4 HOH 185 1086 185 HOH HOH A . 
D 4 HOH 186 1087 186 HOH HOH A . 
D 4 HOH 187 1088 187 HOH HOH A . 
D 4 HOH 188 1089 188 HOH HOH A . 
D 4 HOH 189 1090 189 HOH HOH A . 
D 4 HOH 190 1091 190 HOH HOH A . 
D 4 HOH 191 1092 191 HOH HOH A . 
D 4 HOH 192 1093 192 HOH HOH A . 
D 4 HOH 193 1094 193 HOH HOH A . 
D 4 HOH 194 1095 194 HOH HOH A . 
D 4 HOH 195 1096 195 HOH HOH A . 
D 4 HOH 196 1097 196 HOH HOH A . 
D 4 HOH 197 1098 197 HOH HOH A . 
D 4 HOH 198 1099 198 HOH HOH A . 
D 4 HOH 199 1100 199 HOH HOH A . 
D 4 HOH 200 1101 200 HOH HOH A . 
D 4 HOH 201 1102 201 HOH HOH A . 
D 4 HOH 202 1103 202 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6120  ? 
1 MORE         -59   ? 
1 'SSA (A^2)'  46600 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-05-22 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification'       
2 4 'Structure model' '_software.contact_author'       
3 4 'Structure model' '_software.contact_author_email' 
4 4 'Structure model' '_software.date'                 
5 4 'Structure model' '_software.language'             
6 4 'Structure model' '_software.location'             
7 4 'Structure model' '_software.name'                 
8 4 'Structure model' '_software.type'                 
9 4 'Structure model' '_software.version'              
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
REFMAC      .     ?                program 'Murshudov, G.N.'    ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 3 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 4 
HKL-2000    .     ?                ?       ?                    ?                        'data collection' ? ?          ? 5 
HKL-2000    .     ?                ?       ?                    ?                        'data reduction'  ? ?          ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A ASN 154 ? ? N A GLU 156 ? ? 2.00 
2 1 O A ASN 657 ? ? N A ASN 659 ? ? 2.15 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OG 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    SER 
_pdbx_validate_symm_contact.auth_seq_id_1     178 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    ARG 
_pdbx_validate_symm_contact.auth_seq_id_2     668 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   7_455 
_pdbx_validate_symm_contact.dist              2.14 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ILE A 64  ? ? -92.04  -100.69 
2  1 SER A 138 ? ? -126.91 -65.79  
3  1 PHE A 144 ? ? 157.23  137.09  
4  1 ASP A 174 ? ? -163.98 104.25  
5  1 LYS A 175 ? ? -119.53 69.00   
6  1 GLN A 198 ? ? -50.82  -94.27  
7  1 GLU A 199 ? ? 10.67   -59.64  
8  1 PRO A 212 ? ? -55.47  -75.56  
9  1 THR A 214 ? ? -35.78  139.80  
10 1 ASN A 278 ? ? -69.79  78.30   
11 1 SER A 281 ? ? -151.41 78.30   
12 1 ARG A 283 ? ? -154.19 39.70   
13 1 LYS A 306 ? ? -95.78  41.51   
14 1 SER A 329 ? ? -106.64 46.51   
15 1 TYR A 413 ? ? -117.66 -158.86 
16 1 LEU A 511 ? ? -44.25  151.12  
17 1 TYR A 512 ? ? 90.47   22.30   
18 1 GLN A 547 ? ? -38.68  87.27   
19 1 SER A 552 ? ? -93.96  54.59   
20 1 SER A 568 ? ? -25.38  126.06  
21 1 GLN A 569 ? ? -41.79  109.76  
22 1 GLN A 571 ? ? -55.53  -3.95   
23 1 ASP A 595 ? ? -96.77  55.03   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 LYS A 143 ? ? PHE A 144 ? ? 137.73  
2 1 LYS A 175 ? ? LYS A 176 ? ? 145.13  
3 1 LEU A 265 ? ? PRO A 266 ? ? 121.68  
4 1 HIS A 378 ? ? MET A 379 ? ? -148.04 
5 1 THR A 626 ? ? PRO A 627 ? ? 129.53  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 63  ? CG  ? A ASP 63  CG  
2  1 Y 1 A ASP 63  ? OD1 ? A ASP 63  OD1 
3  1 Y 1 A ASP 63  ? OD2 ? A ASP 63  OD2 
4  1 Y 1 A ILE 64  ? CG1 ? A ILE 64  CG1 
5  1 Y 1 A ILE 64  ? CG2 ? A ILE 64  CG2 
6  1 Y 1 A ILE 64  ? CD1 ? A ILE 64  CD1 
7  1 Y 1 A ARG 506 ? CG  ? A ARG 506 CG  
8  1 Y 1 A ARG 506 ? CD  ? A ARG 506 CD  
9  1 Y 1 A ARG 506 ? NE  ? A ARG 506 NE  
10 1 Y 1 A ARG 506 ? CZ  ? A ARG 506 CZ  
11 1 Y 1 A ARG 506 ? NH1 ? A ARG 506 NH1 
12 1 Y 1 A ARG 506 ? NH2 ? A ARG 506 NH2 
13 1 Y 1 A GLN 508 ? CG  ? A GLN 508 CG  
14 1 Y 1 A GLN 508 ? CD  ? A GLN 508 CD  
15 1 Y 1 A GLN 508 ? OE1 ? A GLN 508 OE1 
16 1 Y 1 A GLN 508 ? NE2 ? A GLN 508 NE2 
17 1 Y 1 A THR 510 ? OG1 ? A THR 510 OG1 
18 1 Y 1 A THR 510 ? CG2 ? A THR 510 CG2 
19 1 Y 1 A LEU 511 ? CG  ? A LEU 511 CG  
20 1 Y 1 A LEU 511 ? CD1 ? A LEU 511 CD1 
21 1 Y 1 A LEU 511 ? CD2 ? A LEU 511 CD2 
22 1 Y 1 A TYR 512 ? CG  ? A TYR 512 CG  
23 1 Y 1 A TYR 512 ? CD1 ? A TYR 512 CD1 
24 1 Y 1 A TYR 512 ? CD2 ? A TYR 512 CD2 
25 1 Y 1 A TYR 512 ? CE1 ? A TYR 512 CE1 
26 1 Y 1 A TYR 512 ? CE2 ? A TYR 512 CE2 
27 1 Y 1 A TYR 512 ? CZ  ? A TYR 512 CZ  
28 1 Y 1 A TYR 512 ? OH  ? A TYR 512 OH  
29 1 Y 1 A VAL 513 ? CG1 ? A VAL 513 CG1 
30 1 Y 1 A VAL 513 ? CG2 ? A VAL 513 CG2 
31 1 Y 1 A GLU 673 ? CG  ? A GLU 673 CG  
32 1 Y 1 A GLU 673 ? CD  ? A GLU 673 CD  
33 1 Y 1 A GLU 673 ? OE1 ? A GLU 673 OE1 
34 1 Y 1 A GLU 673 ? OE2 ? A GLU 673 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A ASP 2   ? A ASP 2   
3   1 Y 1 A GLY 3   ? A GLY 3   
4   1 Y 1 A ALA 4   ? A ALA 4   
5   1 Y 1 A GLY 5   ? A GLY 5   
6   1 Y 1 A ALA 6   ? A ALA 6   
7   1 Y 1 A GLU 7   ? A GLU 7   
8   1 Y 1 A GLU 8   ? A GLU 8   
9   1 Y 1 A VAL 9   ? A VAL 9   
10  1 Y 1 A LEU 10  ? A LEU 10  
11  1 Y 1 A ALA 11  ? A ALA 11  
12  1 Y 1 A PRO 12  ? A PRO 12  
13  1 Y 1 A LEU 13  ? A LEU 13  
14  1 Y 1 A ARG 14  ? A ARG 14  
15  1 Y 1 A LEU 15  ? A LEU 15  
16  1 Y 1 A ALA 16  ? A ALA 16  
17  1 Y 1 A VAL 17  ? A VAL 17  
18  1 Y 1 A ARG 18  ? A ARG 18  
19  1 Y 1 A GLN 19  ? A GLN 19  
20  1 Y 1 A GLN 20  ? A GLN 20  
21  1 Y 1 A GLY 21  ? A GLY 21  
22  1 Y 1 A ASP 22  ? A ASP 22  
23  1 Y 1 A LEU 23  ? A LEU 23  
24  1 Y 1 A VAL 24  ? A VAL 24  
25  1 Y 1 A ARG 25  ? A ARG 25  
26  1 Y 1 A LYS 26  ? A LYS 26  
27  1 Y 1 A LEU 27  ? A LEU 27  
28  1 Y 1 A LYS 28  ? A LYS 28  
29  1 Y 1 A GLU 29  ? A GLU 29  
30  1 Y 1 A ASP 30  ? A ASP 30  
31  1 Y 1 A LYS 31  ? A LYS 31  
32  1 Y 1 A ALA 32  ? A ALA 32  
33  1 Y 1 A PRO 33  ? A PRO 33  
34  1 Y 1 A GLN 34  ? A GLN 34  
35  1 Y 1 A VAL 35  ? A VAL 35  
36  1 Y 1 A ASP 36  ? A ASP 36  
37  1 Y 1 A VAL 37  ? A VAL 37  
38  1 Y 1 A ASP 38  ? A ASP 38  
39  1 Y 1 A LYS 39  ? A LYS 39  
40  1 Y 1 A ALA 40  ? A ALA 40  
41  1 Y 1 A VAL 41  ? A VAL 41  
42  1 Y 1 A ALA 42  ? A ALA 42  
43  1 Y 1 A GLU 43  ? A GLU 43  
44  1 Y 1 A LEU 44  ? A LEU 44  
45  1 Y 1 A LYS 45  ? A LYS 45  
46  1 Y 1 A ALA 46  ? A ALA 46  
47  1 Y 1 A ARG 47  ? A ARG 47  
48  1 Y 1 A LYS 48  ? A LYS 48  
49  1 Y 1 A ARG 49  ? A ARG 49  
50  1 Y 1 A VAL 50  ? A VAL 50  
51  1 Y 1 A LEU 51  ? A LEU 51  
52  1 Y 1 A GLU 52  ? A GLU 52  
53  1 Y 1 A ALA 53  ? A ALA 53  
54  1 Y 1 A LYS 54  ? A LYS 54  
55  1 Y 1 A GLU 55  ? A GLU 55  
56  1 Y 1 A LEU 56  ? A LEU 56  
57  1 Y 1 A ALA 57  ? A ALA 57  
58  1 Y 1 A LEU 58  ? A LEU 58  
59  1 Y 1 A GLN 59  ? A GLN 59  
60  1 Y 1 A PRO 60  ? A PRO 60  
61  1 Y 1 A LYS 61  ? A LYS 61  
62  1 Y 1 A ASP 62  ? A ASP 62  
63  1 Y 1 A GLU 382 ? A GLU 382 
64  1 Y 1 A MET 383 ? A MET 383 
65  1 Y 1 A ALA 384 ? A ALA 384 
66  1 Y 1 A HIS 385 ? A HIS 385 
67  1 Y 1 A TYR 386 ? A TYR 386 
68  1 Y 1 A ALA 421 ? A ALA 421 
69  1 Y 1 A THR 422 ? A THR 422 
70  1 Y 1 A LYS 423 ? A LYS 423 
71  1 Y 1 A VAL 424 ? A VAL 424 
72  1 Y 1 A PRO 425 ? A PRO 425 
73  1 Y 1 A LEU 426 ? A LEU 426 
74  1 Y 1 A VAL 427 ? A VAL 427 
75  1 Y 1 A ALA 428 ? A ALA 428 
76  1 Y 1 A GLU 429 ? A GLU 429 
77  1 Y 1 A LYS 430 ? A LYS 430 
78  1 Y 1 A PRO 431 ? A PRO 431 
79  1 Y 1 A LEU 432 ? A LEU 432 
80  1 Y 1 A LYS 433 ? A LYS 433 
81  1 Y 1 A GLU 434 ? A GLU 434 
82  1 Y 1 A PRO 435 ? A PRO 435 
83  1 Y 1 A LYS 436 ? A LYS 436 
84  1 Y 1 A THR 437 ? A THR 437 
85  1 Y 1 A VAL 438 ? A VAL 438 
86  1 Y 1 A ASN 439 ? A ASN 439 
87  1 Y 1 A VAL 440 ? A VAL 440 
88  1 Y 1 A VAL 441 ? A VAL 441 
89  1 Y 1 A GLN 442 ? A GLN 442 
90  1 Y 1 A PHE 443 ? A PHE 443 
91  1 Y 1 A GLU 444 ? A GLU 444 
92  1 Y 1 A PRO 445 ? A PRO 445 
93  1 Y 1 A SER 446 ? A SER 446 
94  1 Y 1 A LYS 447 ? A LYS 447 
95  1 Y 1 A GLY 448 ? A GLY 448 
96  1 Y 1 A ALA 449 ? A ALA 449 
97  1 Y 1 A ILE 450 ? A ILE 450 
98  1 Y 1 A GLY 451 ? A GLY 451 
99  1 Y 1 A LYS 452 ? A LYS 452 
100 1 Y 1 A ALA 453 ? A ALA 453 
101 1 Y 1 A TYR 454 ? A TYR 454 
102 1 Y 1 A LYS 455 ? A LYS 455 
103 1 Y 1 A LYS 456 ? A LYS 456 
104 1 Y 1 A ASP 457 ? A ASP 457 
105 1 Y 1 A ALA 458 ? A ALA 458 
106 1 Y 1 A LYS 459 ? A LYS 459 
107 1 Y 1 A LEU 460 ? A LEU 460 
108 1 Y 1 A VAL 461 ? A VAL 461 
109 1 Y 1 A MET 462 ? A MET 462 
110 1 Y 1 A GLU 463 ? A GLU 463 
111 1 Y 1 A TYR 464 ? A TYR 464 
112 1 Y 1 A LEU 465 ? A LEU 465 
113 1 Y 1 A ALA 466 ? A ALA 466 
114 1 Y 1 A ILE 467 ? A ILE 467 
115 1 Y 1 A CYS 468 ? A CYS 468 
116 1 Y 1 A ASP 469 ? A ASP 469 
117 1 Y 1 A GLU 470 ? A GLU 470 
118 1 Y 1 A CYS 471 ? A CYS 471 
119 1 Y 1 A TYR 472 ? A TYR 472 
120 1 Y 1 A ILE 473 ? A ILE 473 
121 1 Y 1 A THR 474 ? A THR 474 
122 1 Y 1 A GLU 475 ? A GLU 475 
123 1 Y 1 A MET 476 ? A MET 476 
124 1 Y 1 A GLU 477 ? A GLU 477 
125 1 Y 1 A MET 478 ? A MET 478 
126 1 Y 1 A LEU 479 ? A LEU 479 
127 1 Y 1 A LEU 480 ? A LEU 480 
128 1 Y 1 A ASN 481 ? A ASN 481 
129 1 Y 1 A GLU 482 ? A GLU 482 
130 1 Y 1 A LYS 483 ? A LYS 483 
131 1 Y 1 A GLY 484 ? A GLY 484 
132 1 Y 1 A GLU 485 ? A GLU 485 
133 1 Y 1 A PHE 486 ? A PHE 486 
134 1 Y 1 A THR 487 ? A THR 487 
135 1 Y 1 A ILE 488 ? A ILE 488 
136 1 Y 1 A GLU 489 ? A GLU 489 
137 1 Y 1 A THR 490 ? A THR 490 
138 1 Y 1 A GLU 491 ? A GLU 491 
139 1 Y 1 A GLY 492 ? A GLY 492 
140 1 Y 1 A LYS 493 ? A LYS 493 
141 1 Y 1 A THR 494 ? A THR 494 
142 1 Y 1 A PHE 495 ? A PHE 495 
143 1 Y 1 A GLN 496 ? A GLN 496 
144 1 Y 1 A LEU 497 ? A LEU 497 
145 1 Y 1 A THR 498 ? A THR 498 
146 1 Y 1 A LYS 499 ? A LYS 499 
147 1 Y 1 A ASP 500 ? A ASP 500 
148 1 Y 1 A MET 501 ? A MET 501 
149 1 Y 1 A ILE 502 ? A ILE 502 
150 1 Y 1 A ASN 503 ? A ASN 503 
151 1 Y 1 A VAL 504 ? A VAL 504 
152 1 Y 1 A LYS 505 ? A LYS 505 
153 1 Y 1 A GLN 675 ? A GLN 675 
154 1 Y 1 A GLU 676 ? A GLU 676 
155 1 Y 1 A THR 677 ? A THR 677 
156 1 Y 1 A GLY 678 ? A GLY 678 
157 1 Y 1 A LYS 679 ? A LYS 679 
158 1 Y 1 A LYS 680 ? A LYS 680 
159 1 Y 1 A GLU 681 ? A GLU 681 
160 1 Y 1 A THR 682 ? A THR 682 
161 1 Y 1 A ILE 683 ? A ILE 683 
162 1 Y 1 A GLU 684 ? A GLU 684 
163 1 Y 1 A GLU 685 ? A GLU 685 
164 1 Y 1 A LEU 686 ? A LEU 686 
165 1 Y 1 A GLU 687 ? A GLU 687 
166 1 Y 1 A HIS 688 ? A HIS 688 
167 1 Y 1 A HIS 689 ? A HIS 689 
168 1 Y 1 A HIS 690 ? A HIS 690 
169 1 Y 1 A HIS 691 ? A HIS 691 
170 1 Y 1 A HIS 692 ? A HIS 692 
171 1 Y 1 A HIS 693 ? A HIS 693 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 GLYCEROL       GOL 
4 water          HOH 
#