data_2PPB
# 
_entry.id   2PPB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2PPB         
NDB   PH0039       
RCSB  RCSB042633   
WWPDB D_1000042633 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2O5I 'Crystal structure of the T. thermophilus RNA polymerase elongation complex' unspecified 
PDB 2O5J 
'Crystal structure of the T. thermophilus RNA polymerase elongation complex with the non-hydrolyzable substrate analog, AMPcPP' 
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2PPB 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vassylyev, D.G.'  1 
'Vassylyeva, M.N.' 2 
'Artsimovitch, I.' 3 
'Landick, R.'      4 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for substrate loading in bacterial RNA polymerase.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            448 
_citation.page_first                163 
_citation.page_last                 168 
_citation.year                      2007 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17581591 
_citation.pdbx_database_id_DOI      10.1038/nature05931 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vassylyev, D.G.'  1 
primary 'Vassylyeva, M.N.' 2 
primary 'Zhang, J.'        3 
primary 'Palangat, M.'     4 
primary 'Artsimovitch, I.' 5 
primary 'Landick, R.'      6 
# 
_cell.entry_id           2PPB 
_cell.length_a           155.379 
_cell.length_b           155.379 
_cell.length_c           496.992 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2PPB 
_symmetry.space_group_name_H-M             'P 41' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                76 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     syn 
;DNA (5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*CP*GP*CP*GP*CP*CP*G)-3')
;
7001.470   2    ?       ? ? 'DNA TEMPLATE STRAND'     
2  polymer     syn 
;RNA (5'-R(P*GP*AP*GP*UP*CP*UP*GP*CP*GP*GP*CP*GP*CP*GP*CP*G)-3')
;
5184.135   2    ?       ? ? 'RNA TRANSCRIPT'          
3  polymer     syn 
;DNA (5'-D(*AP*AP*CP*GP*CP*CP*AP*GP*AP*CP*AP*GP*GP*G)-3')
;
4323.833   2    ?       ? ? 'DNA NON-TEMPLATE STRAND' 
4  polymer     nat 'DNA-directed RNA polymerase alpha chain'                                              35056.164  4    2.7.7.6 
? ? ?                         
5  polymer     nat 'DNA-directed RNA polymerase beta chain'                                               125436.539 2    2.7.7.6 
? ? ?                         
6  polymer     nat 
;DNA-directed RNA polymerase beta' chain
;
170997.391 2    2.7.7.6 ? ? ?                         
7  polymer     nat 'DNA-directed RNA polymerase omega chain'                                              11533.316  2    2.7.7.6 
? ? ?                         
8  non-polymer syn STREPTOLYDIGIN                                                                         600.700    2    ?       
? ? ?                         
9  non-polymer syn 'ZINC ION'                                                                             65.409     4    ?       
? ? ?                         
10 non-polymer syn 'MAGNESIUM ION'                                                                        24.305     4    ?       
? ? ?                         
11 non-polymer syn 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER'                                        505.208    2    ?       
? ? ?                         
12 water       nat water                                                                                  18.015     2470 ?       
? ? ?                         
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
4 'RNAP alpha subunit, Transcriptase alpha chain, RNA polymerase subunit alpha' 
5 'RNAP beta subunit, Transcriptase beta chain, RNA polymerase subunit beta'    
6 
;RNAP beta' subunit, Transcriptase beta' chain, RNA polymerase beta' subunit
;
7 'RNAP omega subunit, Transcriptase omega chain, RNA polymerase omega subunit' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DC)(DC)(DC)(DT)(DG)(DT)(DC)(DT)(DG)(DG)(DC)(DG)(DT)(DT)(DC)(DG)(DC)(DG)(DC)(DG)
(DC)(DC)(DG)
;
CCCTGTCTGGCGTTCGCGCGCCG G,X     ? 
2 polyribonucleotide      no no GAGUCUGCGGCGCGCG GAGUCUGCGGCGCGCG H,Y     ? 
3 polydeoxyribonucleotide no no '(DA)(DA)(DC)(DG)(DC)(DC)(DA)(DG)(DA)(DC)(DA)(DG)(DG)(DG)' AACGCCAGACAGGG I,Z     ? 
4 'polypeptide(L)'        no no 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B,K,L ? 
5 'polypeptide(L)'        no no 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C,M     ? 
6 'polypeptide(L)'        no no 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D,N     ? 
7 'polypeptide(L)'        no no 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E,O     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    DC  n 
1 2    DC  n 
1 3    DC  n 
1 4    DT  n 
1 5    DG  n 
1 6    DT  n 
1 7    DC  n 
1 8    DT  n 
1 9    DG  n 
1 10   DG  n 
1 11   DC  n 
1 12   DG  n 
1 13   DT  n 
1 14   DT  n 
1 15   DC  n 
1 16   DG  n 
1 17   DC  n 
1 18   DG  n 
1 19   DC  n 
1 20   DG  n 
1 21   DC  n 
1 22   DC  n 
1 23   DG  n 
2 1    G   n 
2 2    A   n 
2 3    G   n 
2 4    U   n 
2 5    C   n 
2 6    U   n 
2 7    G   n 
2 8    C   n 
2 9    G   n 
2 10   G   n 
2 11   C   n 
2 12   G   n 
2 13   C   n 
2 14   G   n 
2 15   C   n 
2 16   G   n 
3 1    DA  n 
3 2    DA  n 
3 3    DC  n 
3 4    DG  n 
3 5    DC  n 
3 6    DC  n 
3 7    DA  n 
3 8    DG  n 
3 9    DA  n 
3 10   DC  n 
3 11   DA  n 
3 12   DG  n 
3 13   DG  n 
3 14   DG  n 
4 1    MET n 
4 2    LEU n 
4 3    ASP n 
4 4    SER n 
4 5    LYS n 
4 6    LEU n 
4 7    LYS n 
4 8    ALA n 
4 9    PRO n 
4 10   VAL n 
4 11   PHE n 
4 12   THR n 
4 13   VAL n 
4 14   ARG n 
4 15   THR n 
4 16   GLN n 
4 17   GLY n 
4 18   ARG n 
4 19   GLU n 
4 20   TYR n 
4 21   GLY n 
4 22   GLU n 
4 23   PHE n 
4 24   VAL n 
4 25   LEU n 
4 26   GLU n 
4 27   PRO n 
4 28   LEU n 
4 29   GLU n 
4 30   ARG n 
4 31   GLY n 
4 32   PHE n 
4 33   GLY n 
4 34   VAL n 
4 35   THR n 
4 36   LEU n 
4 37   GLY n 
4 38   ASN n 
4 39   PRO n 
4 40   LEU n 
4 41   ARG n 
4 42   ARG n 
4 43   ILE n 
4 44   LEU n 
4 45   LEU n 
4 46   SER n 
4 47   SER n 
4 48   ILE n 
4 49   PRO n 
4 50   GLY n 
4 51   THR n 
4 52   ALA n 
4 53   VAL n 
4 54   THR n 
4 55   SER n 
4 56   VAL n 
4 57   TYR n 
4 58   ILE n 
4 59   GLU n 
4 60   ASP n 
4 61   VAL n 
4 62   LEU n 
4 63   HIS n 
4 64   GLU n 
4 65   PHE n 
4 66   SER n 
4 67   THR n 
4 68   ILE n 
4 69   PRO n 
4 70   GLY n 
4 71   VAL n 
4 72   LYS n 
4 73   GLU n 
4 74   ASP n 
4 75   VAL n 
4 76   VAL n 
4 77   GLU n 
4 78   ILE n 
4 79   ILE n 
4 80   LEU n 
4 81   ASN n 
4 82   LEU n 
4 83   LYS n 
4 84   GLU n 
4 85   LEU n 
4 86   VAL n 
4 87   VAL n 
4 88   ARG n 
4 89   PHE n 
4 90   LEU n 
4 91   ASN n 
4 92   PRO n 
4 93   SER n 
4 94   LEU n 
4 95   GLN n 
4 96   THR n 
4 97   VAL n 
4 98   THR n 
4 99   LEU n 
4 100  LEU n 
4 101  LEU n 
4 102  LYS n 
4 103  ALA n 
4 104  GLU n 
4 105  GLY n 
4 106  PRO n 
4 107  LYS n 
4 108  GLU n 
4 109  VAL n 
4 110  LYS n 
4 111  ALA n 
4 112  ARG n 
4 113  ASP n 
4 114  PHE n 
4 115  LEU n 
4 116  PRO n 
4 117  VAL n 
4 118  ALA n 
4 119  ASP n 
4 120  VAL n 
4 121  GLU n 
4 122  ILE n 
4 123  MET n 
4 124  ASN n 
4 125  PRO n 
4 126  ASP n 
4 127  LEU n 
4 128  HIS n 
4 129  ILE n 
4 130  ALA n 
4 131  THR n 
4 132  LEU n 
4 133  GLU n 
4 134  GLU n 
4 135  GLY n 
4 136  GLY n 
4 137  ARG n 
4 138  LEU n 
4 139  ASN n 
4 140  MET n 
4 141  GLU n 
4 142  VAL n 
4 143  ARG n 
4 144  VAL n 
4 145  ASP n 
4 146  ARG n 
4 147  GLY n 
4 148  VAL n 
4 149  GLY n 
4 150  TYR n 
4 151  VAL n 
4 152  PRO n 
4 153  ALA n 
4 154  GLU n 
4 155  LYS n 
4 156  HIS n 
4 157  GLY n 
4 158  ILE n 
4 159  LYS n 
4 160  ASP n 
4 161  ARG n 
4 162  ILE n 
4 163  ASN n 
4 164  ALA n 
4 165  ILE n 
4 166  PRO n 
4 167  VAL n 
4 168  ASP n 
4 169  ALA n 
4 170  VAL n 
4 171  PHE n 
4 172  SER n 
4 173  PRO n 
4 174  VAL n 
4 175  ARG n 
4 176  ARG n 
4 177  VAL n 
4 178  ALA n 
4 179  PHE n 
4 180  GLN n 
4 181  VAL n 
4 182  GLU n 
4 183  ASP n 
4 184  THR n 
4 185  ARG n 
4 186  LEU n 
4 187  GLY n 
4 188  GLN n 
4 189  ARG n 
4 190  THR n 
4 191  ASP n 
4 192  LEU n 
4 193  ASP n 
4 194  LYS n 
4 195  LEU n 
4 196  THR n 
4 197  LEU n 
4 198  ARG n 
4 199  ILE n 
4 200  TRP n 
4 201  THR n 
4 202  ASP n 
4 203  GLY n 
4 204  SER n 
4 205  VAL n 
4 206  THR n 
4 207  PRO n 
4 208  LEU n 
4 209  GLU n 
4 210  ALA n 
4 211  LEU n 
4 212  ASN n 
4 213  GLN n 
4 214  ALA n 
4 215  VAL n 
4 216  GLU n 
4 217  ILE n 
4 218  LEU n 
4 219  ARG n 
4 220  GLU n 
4 221  HIS n 
4 222  LEU n 
4 223  THR n 
4 224  TYR n 
4 225  PHE n 
4 226  SER n 
4 227  ASN n 
4 228  PRO n 
4 229  GLN n 
4 230  ALA n 
4 231  ALA n 
4 232  ALA n 
4 233  VAL n 
4 234  ALA n 
4 235  ALA n 
4 236  PRO n 
4 237  GLU n 
4 238  GLU n 
4 239  ALA n 
4 240  LYS n 
4 241  GLU n 
4 242  PRO n 
4 243  GLU n 
4 244  ALA n 
4 245  PRO n 
4 246  PRO n 
4 247  GLU n 
4 248  GLN n 
4 249  GLU n 
4 250  GLU n 
4 251  GLU n 
4 252  LEU n 
4 253  ASP n 
4 254  LEU n 
4 255  PRO n 
4 256  LEU n 
4 257  GLU n 
4 258  GLU n 
4 259  LEU n 
4 260  GLY n 
4 261  LEU n 
4 262  SER n 
4 263  THR n 
4 264  ARG n 
4 265  VAL n 
4 266  LEU n 
4 267  HIS n 
4 268  SER n 
4 269  LEU n 
4 270  LYS n 
4 271  GLU n 
4 272  GLU n 
4 273  GLY n 
4 274  ILE n 
4 275  GLU n 
4 276  SER n 
4 277  VAL n 
4 278  ARG n 
4 279  ALA n 
4 280  LEU n 
4 281  LEU n 
4 282  ALA n 
4 283  LEU n 
4 284  ASN n 
4 285  LEU n 
4 286  LYS n 
4 287  ASP n 
4 288  LEU n 
4 289  LYS n 
4 290  ASN n 
4 291  ILE n 
4 292  PRO n 
4 293  GLY n 
4 294  ILE n 
4 295  GLY n 
4 296  GLU n 
4 297  ARG n 
4 298  SER n 
4 299  LEU n 
4 300  GLU n 
4 301  GLU n 
4 302  ILE n 
4 303  LYS n 
4 304  GLU n 
4 305  ALA n 
4 306  LEU n 
4 307  GLU n 
4 308  LYS n 
4 309  LYS n 
4 310  GLY n 
4 311  PHE n 
4 312  THR n 
4 313  LEU n 
4 314  LYS n 
4 315  GLU n 
5 1    MET n 
5 2    GLU n 
5 3    ILE n 
5 4    LYS n 
5 5    ARG n 
5 6    PHE n 
5 7    GLY n 
5 8    ARG n 
5 9    ILE n 
5 10   ARG n 
5 11   GLU n 
5 12   VAL n 
5 13   ILE n 
5 14   PRO n 
5 15   LEU n 
5 16   PRO n 
5 17   PRO n 
5 18   LEU n 
5 19   THR n 
5 20   GLU n 
5 21   ILE n 
5 22   GLN n 
5 23   VAL n 
5 24   GLU n 
5 25   SER n 
5 26   TYR n 
5 27   ARG n 
5 28   ARG n 
5 29   ALA n 
5 30   LEU n 
5 31   GLN n 
5 32   ALA n 
5 33   ASP n 
5 34   VAL n 
5 35   PRO n 
5 36   PRO n 
5 37   GLU n 
5 38   LYS n 
5 39   ARG n 
5 40   GLU n 
5 41   ASN n 
5 42   VAL n 
5 43   GLY n 
5 44   ILE n 
5 45   GLN n 
5 46   ALA n 
5 47   ALA n 
5 48   PHE n 
5 49   ARG n 
5 50   GLU n 
5 51   THR n 
5 52   PHE n 
5 53   PRO n 
5 54   ILE n 
5 55   GLU n 
5 56   GLU n 
5 57   GLU n 
5 58   ASP n 
5 59   LYS n 
5 60   GLY n 
5 61   LYS n 
5 62   GLY n 
5 63   GLY n 
5 64   LEU n 
5 65   VAL n 
5 66   LEU n 
5 67   ASP n 
5 68   PHE n 
5 69   LEU n 
5 70   GLU n 
5 71   TYR n 
5 72   ARG n 
5 73   LEU n 
5 74   GLY n 
5 75   GLU n 
5 76   PRO n 
5 77   PRO n 
5 78   PHE n 
5 79   PRO n 
5 80   GLN n 
5 81   ASP n 
5 82   GLU n 
5 83   CYS n 
5 84   ARG n 
5 85   GLU n 
5 86   LYS n 
5 87   ASP n 
5 88   LEU n 
5 89   THR n 
5 90   TYR n 
5 91   GLN n 
5 92   ALA n 
5 93   PRO n 
5 94   LEU n 
5 95   TYR n 
5 96   ALA n 
5 97   ARG n 
5 98   LEU n 
5 99   GLN n 
5 100  LEU n 
5 101  ILE n 
5 102  HIS n 
5 103  LYS n 
5 104  ASP n 
5 105  THR n 
5 106  GLY n 
5 107  LEU n 
5 108  ILE n 
5 109  LYS n 
5 110  GLU n 
5 111  ASP n 
5 112  GLU n 
5 113  VAL n 
5 114  PHE n 
5 115  LEU n 
5 116  GLY n 
5 117  HIS n 
5 118  ILE n 
5 119  PRO n 
5 120  LEU n 
5 121  MET n 
5 122  THR n 
5 123  GLU n 
5 124  ASP n 
5 125  GLY n 
5 126  SER n 
5 127  PHE n 
5 128  ILE n 
5 129  ILE n 
5 130  ASN n 
5 131  GLY n 
5 132  ALA n 
5 133  ASP n 
5 134  ARG n 
5 135  VAL n 
5 136  ILE n 
5 137  VAL n 
5 138  SER n 
5 139  GLN n 
5 140  ILE n 
5 141  HIS n 
5 142  ARG n 
5 143  SER n 
5 144  PRO n 
5 145  GLY n 
5 146  VAL n 
5 147  TYR n 
5 148  PHE n 
5 149  THR n 
5 150  PRO n 
5 151  ASP n 
5 152  PRO n 
5 153  ALA n 
5 154  ARG n 
5 155  PRO n 
5 156  GLY n 
5 157  ARG n 
5 158  TYR n 
5 159  ILE n 
5 160  ALA n 
5 161  SER n 
5 162  ILE n 
5 163  ILE n 
5 164  PRO n 
5 165  LEU n 
5 166  PRO n 
5 167  LYS n 
5 168  ARG n 
5 169  GLY n 
5 170  PRO n 
5 171  TRP n 
5 172  ILE n 
5 173  ASP n 
5 174  LEU n 
5 175  GLU n 
5 176  VAL n 
5 177  GLU n 
5 178  PRO n 
5 179  ASN n 
5 180  GLY n 
5 181  VAL n 
5 182  VAL n 
5 183  SER n 
5 184  MET n 
5 185  LYS n 
5 186  VAL n 
5 187  ASN n 
5 188  LYS n 
5 189  ARG n 
5 190  LYS n 
5 191  PHE n 
5 192  PRO n 
5 193  LEU n 
5 194  VAL n 
5 195  LEU n 
5 196  LEU n 
5 197  LEU n 
5 198  ARG n 
5 199  VAL n 
5 200  LEU n 
5 201  GLY n 
5 202  TYR n 
5 203  ASP n 
5 204  GLN n 
5 205  GLU n 
5 206  THR n 
5 207  LEU n 
5 208  ALA n 
5 209  ARG n 
5 210  GLU n 
5 211  LEU n 
5 212  GLY n 
5 213  ALA n 
5 214  TYR n 
5 215  GLY n 
5 216  GLU n 
5 217  LEU n 
5 218  VAL n 
5 219  GLN n 
5 220  GLY n 
5 221  LEU n 
5 222  MET n 
5 223  ASP n 
5 224  GLU n 
5 225  SER n 
5 226  VAL n 
5 227  PHE n 
5 228  ALA n 
5 229  MET n 
5 230  ARG n 
5 231  PRO n 
5 232  GLU n 
5 233  GLU n 
5 234  ALA n 
5 235  LEU n 
5 236  ILE n 
5 237  ARG n 
5 238  LEU n 
5 239  PHE n 
5 240  THR n 
5 241  LEU n 
5 242  LEU n 
5 243  ARG n 
5 244  PRO n 
5 245  GLY n 
5 246  ASP n 
5 247  PRO n 
5 248  PRO n 
5 249  LYS n 
5 250  ARG n 
5 251  ASP n 
5 252  LYS n 
5 253  ALA n 
5 254  VAL n 
5 255  ALA n 
5 256  TYR n 
5 257  VAL n 
5 258  TYR n 
5 259  GLY n 
5 260  LEU n 
5 261  ILE n 
5 262  ALA n 
5 263  ASP n 
5 264  PRO n 
5 265  ARG n 
5 266  ARG n 
5 267  TYR n 
5 268  ASP n 
5 269  LEU n 
5 270  GLY n 
5 271  GLU n 
5 272  ALA n 
5 273  GLY n 
5 274  ARG n 
5 275  TYR n 
5 276  LYS n 
5 277  ALA n 
5 278  GLU n 
5 279  GLU n 
5 280  LYS n 
5 281  LEU n 
5 282  GLY n 
5 283  ILE n 
5 284  ARG n 
5 285  LEU n 
5 286  SER n 
5 287  GLY n 
5 288  ARG n 
5 289  THR n 
5 290  LEU n 
5 291  ALA n 
5 292  ARG n 
5 293  PHE n 
5 294  GLU n 
5 295  ASP n 
5 296  GLY n 
5 297  GLU n 
5 298  PHE n 
5 299  LYS n 
5 300  ASP n 
5 301  GLU n 
5 302  VAL n 
5 303  PHE n 
5 304  LEU n 
5 305  PRO n 
5 306  THR n 
5 307  LEU n 
5 308  ARG n 
5 309  TYR n 
5 310  LEU n 
5 311  PHE n 
5 312  ALA n 
5 313  LEU n 
5 314  THR n 
5 315  ALA n 
5 316  GLY n 
5 317  VAL n 
5 318  PRO n 
5 319  GLY n 
5 320  HIS n 
5 321  GLU n 
5 322  VAL n 
5 323  ASP n 
5 324  ASP n 
5 325  ILE n 
5 326  ASP n 
5 327  HIS n 
5 328  LEU n 
5 329  GLY n 
5 330  ASN n 
5 331  ARG n 
5 332  ARG n 
5 333  ILE n 
5 334  ARG n 
5 335  THR n 
5 336  VAL n 
5 337  GLY n 
5 338  GLU n 
5 339  LEU n 
5 340  MET n 
5 341  THR n 
5 342  ASP n 
5 343  GLN n 
5 344  PHE n 
5 345  ARG n 
5 346  VAL n 
5 347  GLY n 
5 348  LEU n 
5 349  ALA n 
5 350  ARG n 
5 351  LEU n 
5 352  ALA n 
5 353  ARG n 
5 354  GLY n 
5 355  VAL n 
5 356  ARG n 
5 357  GLU n 
5 358  ARG n 
5 359  MET n 
5 360  LEU n 
5 361  MET n 
5 362  GLY n 
5 363  SER n 
5 364  GLU n 
5 365  ASP n 
5 366  SER n 
5 367  LEU n 
5 368  THR n 
5 369  PRO n 
5 370  ALA n 
5 371  LYS n 
5 372  LEU n 
5 373  VAL n 
5 374  ASN n 
5 375  SER n 
5 376  ARG n 
5 377  PRO n 
5 378  LEU n 
5 379  GLU n 
5 380  ALA n 
5 381  ALA n 
5 382  ILE n 
5 383  ARG n 
5 384  GLU n 
5 385  PHE n 
5 386  PHE n 
5 387  SER n 
5 388  ARG n 
5 389  SER n 
5 390  GLN n 
5 391  LEU n 
5 392  SER n 
5 393  GLN n 
5 394  PHE n 
5 395  LYS n 
5 396  ASP n 
5 397  GLU n 
5 398  THR n 
5 399  ASN n 
5 400  PRO n 
5 401  LEU n 
5 402  SER n 
5 403  SER n 
5 404  LEU n 
5 405  ARG n 
5 406  HIS n 
5 407  LYS n 
5 408  ARG n 
5 409  ARG n 
5 410  ILE n 
5 411  SER n 
5 412  ALA n 
5 413  LEU n 
5 414  GLY n 
5 415  PRO n 
5 416  GLY n 
5 417  GLY n 
5 418  LEU n 
5 419  THR n 
5 420  ARG n 
5 421  GLU n 
5 422  ARG n 
5 423  ALA n 
5 424  GLY n 
5 425  PHE n 
5 426  ASP n 
5 427  VAL n 
5 428  ARG n 
5 429  ASP n 
5 430  VAL n 
5 431  HIS n 
5 432  ARG n 
5 433  THR n 
5 434  HIS n 
5 435  TYR n 
5 436  GLY n 
5 437  ARG n 
5 438  ILE n 
5 439  CYS n 
5 440  PRO n 
5 441  VAL n 
5 442  GLU n 
5 443  THR n 
5 444  PRO n 
5 445  GLU n 
5 446  GLY n 
5 447  ALA n 
5 448  ASN n 
5 449  ILE n 
5 450  GLY n 
5 451  LEU n 
5 452  ILE n 
5 453  THR n 
5 454  SER n 
5 455  LEU n 
5 456  ALA n 
5 457  ALA n 
5 458  TYR n 
5 459  ALA n 
5 460  ARG n 
5 461  VAL n 
5 462  ASP n 
5 463  GLU n 
5 464  LEU n 
5 465  GLY n 
5 466  PHE n 
5 467  ILE n 
5 468  ARG n 
5 469  THR n 
5 470  PRO n 
5 471  TYR n 
5 472  ARG n 
5 473  ARG n 
5 474  VAL n 
5 475  VAL n 
5 476  GLY n 
5 477  GLY n 
5 478  VAL n 
5 479  VAL n 
5 480  THR n 
5 481  ASP n 
5 482  GLU n 
5 483  VAL n 
5 484  VAL n 
5 485  TYR n 
5 486  MET n 
5 487  THR n 
5 488  ALA n 
5 489  THR n 
5 490  GLU n 
5 491  GLU n 
5 492  ASP n 
5 493  ARG n 
5 494  TYR n 
5 495  THR n 
5 496  ILE n 
5 497  ALA n 
5 498  GLN n 
5 499  ALA n 
5 500  ASN n 
5 501  THR n 
5 502  PRO n 
5 503  LEU n 
5 504  GLU n 
5 505  GLY n 
5 506  ASN n 
5 507  ARG n 
5 508  ILE n 
5 509  ALA n 
5 510  ALA n 
5 511  GLU n 
5 512  ARG n 
5 513  VAL n 
5 514  VAL n 
5 515  ALA n 
5 516  ARG n 
5 517  ARG n 
5 518  LYS n 
5 519  GLY n 
5 520  GLU n 
5 521  PRO n 
5 522  VAL n 
5 523  ILE n 
5 524  VAL n 
5 525  SER n 
5 526  PRO n 
5 527  GLU n 
5 528  GLU n 
5 529  VAL n 
5 530  GLU n 
5 531  PHE n 
5 532  MET n 
5 533  ASP n 
5 534  VAL n 
5 535  SER n 
5 536  PRO n 
5 537  LYS n 
5 538  GLN n 
5 539  VAL n 
5 540  PHE n 
5 541  SER n 
5 542  VAL n 
5 543  ASN n 
5 544  THR n 
5 545  ASN n 
5 546  LEU n 
5 547  ILE n 
5 548  PRO n 
5 549  PHE n 
5 550  LEU n 
5 551  GLU n 
5 552  HIS n 
5 553  ASP n 
5 554  ASP n 
5 555  ALA n 
5 556  ASN n 
5 557  ARG n 
5 558  ALA n 
5 559  LEU n 
5 560  MET n 
5 561  GLY n 
5 562  SER n 
5 563  ASN n 
5 564  MET n 
5 565  GLN n 
5 566  THR n 
5 567  GLN n 
5 568  ALA n 
5 569  VAL n 
5 570  PRO n 
5 571  LEU n 
5 572  ILE n 
5 573  ARG n 
5 574  ALA n 
5 575  GLN n 
5 576  ALA n 
5 577  PRO n 
5 578  VAL n 
5 579  VAL n 
5 580  MET n 
5 581  THR n 
5 582  GLY n 
5 583  LEU n 
5 584  GLU n 
5 585  GLU n 
5 586  ARG n 
5 587  VAL n 
5 588  VAL n 
5 589  ARG n 
5 590  ASP n 
5 591  SER n 
5 592  LEU n 
5 593  ALA n 
5 594  ALA n 
5 595  LEU n 
5 596  TYR n 
5 597  ALA n 
5 598  GLU n 
5 599  GLU n 
5 600  ASP n 
5 601  GLY n 
5 602  GLU n 
5 603  VAL n 
5 604  ALA n 
5 605  LYS n 
5 606  VAL n 
5 607  ASP n 
5 608  GLY n 
5 609  ASN n 
5 610  ARG n 
5 611  ILE n 
5 612  VAL n 
5 613  VAL n 
5 614  ARG n 
5 615  TYR n 
5 616  GLU n 
5 617  ASP n 
5 618  GLY n 
5 619  ARG n 
5 620  LEU n 
5 621  VAL n 
5 622  GLU n 
5 623  TYR n 
5 624  PRO n 
5 625  LEU n 
5 626  ARG n 
5 627  ARG n 
5 628  PHE n 
5 629  TYR n 
5 630  ARG n 
5 631  SER n 
5 632  ASN n 
5 633  GLN n 
5 634  GLY n 
5 635  THR n 
5 636  ALA n 
5 637  LEU n 
5 638  ASP n 
5 639  GLN n 
5 640  ARG n 
5 641  PRO n 
5 642  ARG n 
5 643  VAL n 
5 644  VAL n 
5 645  VAL n 
5 646  GLY n 
5 647  GLN n 
5 648  ARG n 
5 649  VAL n 
5 650  ARG n 
5 651  LYS n 
5 652  GLY n 
5 653  ASP n 
5 654  LEU n 
5 655  LEU n 
5 656  ALA n 
5 657  ASP n 
5 658  GLY n 
5 659  PRO n 
5 660  ALA n 
5 661  SER n 
5 662  GLU n 
5 663  ASN n 
5 664  GLY n 
5 665  PHE n 
5 666  LEU n 
5 667  ALA n 
5 668  LEU n 
5 669  GLY n 
5 670  GLN n 
5 671  ASN n 
5 672  VAL n 
5 673  LEU n 
5 674  VAL n 
5 675  ALA n 
5 676  ILE n 
5 677  MET n 
5 678  PRO n 
5 679  PHE n 
5 680  ASP n 
5 681  GLY n 
5 682  TYR n 
5 683  ASN n 
5 684  PHE n 
5 685  GLU n 
5 686  ASP n 
5 687  ALA n 
5 688  ILE n 
5 689  VAL n 
5 690  ILE n 
5 691  SER n 
5 692  GLU n 
5 693  GLU n 
5 694  LEU n 
5 695  LEU n 
5 696  LYS n 
5 697  ARG n 
5 698  ASP n 
5 699  PHE n 
5 700  TYR n 
5 701  THR n 
5 702  SER n 
5 703  ILE n 
5 704  HIS n 
5 705  ILE n 
5 706  GLU n 
5 707  ARG n 
5 708  TYR n 
5 709  GLU n 
5 710  ILE n 
5 711  GLU n 
5 712  ALA n 
5 713  ARG n 
5 714  ASP n 
5 715  THR n 
5 716  LYS n 
5 717  LEU n 
5 718  GLY n 
5 719  PRO n 
5 720  GLU n 
5 721  ARG n 
5 722  ILE n 
5 723  THR n 
5 724  ARG n 
5 725  ASP n 
5 726  ILE n 
5 727  PRO n 
5 728  HIS n 
5 729  LEU n 
5 730  SER n 
5 731  GLU n 
5 732  ALA n 
5 733  ALA n 
5 734  LEU n 
5 735  ARG n 
5 736  ASP n 
5 737  LEU n 
5 738  ASP n 
5 739  GLU n 
5 740  GLU n 
5 741  GLY n 
5 742  VAL n 
5 743  VAL n 
5 744  ARG n 
5 745  ILE n 
5 746  GLY n 
5 747  ALA n 
5 748  GLU n 
5 749  VAL n 
5 750  LYS n 
5 751  PRO n 
5 752  GLY n 
5 753  ASP n 
5 754  ILE n 
5 755  LEU n 
5 756  VAL n 
5 757  GLY n 
5 758  ARG n 
5 759  THR n 
5 760  SER n 
5 761  PHE n 
5 762  LYS n 
5 763  GLY n 
5 764  GLU n 
5 765  SER n 
5 766  GLU n 
5 767  PRO n 
5 768  THR n 
5 769  PRO n 
5 770  GLU n 
5 771  GLU n 
5 772  ARG n 
5 773  LEU n 
5 774  LEU n 
5 775  ARG n 
5 776  SER n 
5 777  ILE n 
5 778  PHE n 
5 779  GLY n 
5 780  GLU n 
5 781  LYS n 
5 782  ALA n 
5 783  ARG n 
5 784  ASP n 
5 785  VAL n 
5 786  LYS n 
5 787  ASP n 
5 788  THR n 
5 789  SER n 
5 790  LEU n 
5 791  ARG n 
5 792  VAL n 
5 793  PRO n 
5 794  PRO n 
5 795  GLY n 
5 796  GLU n 
5 797  GLY n 
5 798  GLY n 
5 799  ILE n 
5 800  VAL n 
5 801  VAL n 
5 802  ARG n 
5 803  THR n 
5 804  VAL n 
5 805  ARG n 
5 806  LEU n 
5 807  ARG n 
5 808  ARG n 
5 809  GLY n 
5 810  ASP n 
5 811  PRO n 
5 812  GLY n 
5 813  VAL n 
5 814  GLU n 
5 815  LEU n 
5 816  LYS n 
5 817  PRO n 
5 818  GLY n 
5 819  VAL n 
5 820  ARG n 
5 821  GLU n 
5 822  VAL n 
5 823  VAL n 
5 824  ARG n 
5 825  VAL n 
5 826  TYR n 
5 827  VAL n 
5 828  ALA n 
5 829  GLN n 
5 830  LYS n 
5 831  ARG n 
5 832  LYS n 
5 833  LEU n 
5 834  GLN n 
5 835  VAL n 
5 836  GLY n 
5 837  ASP n 
5 838  LYS n 
5 839  LEU n 
5 840  ALA n 
5 841  ASN n 
5 842  ARG n 
5 843  HIS n 
5 844  GLY n 
5 845  ASN n 
5 846  LYS n 
5 847  GLY n 
5 848  VAL n 
5 849  VAL n 
5 850  ALA n 
5 851  LYS n 
5 852  ILE n 
5 853  LEU n 
5 854  PRO n 
5 855  VAL n 
5 856  GLU n 
5 857  ASP n 
5 858  MET n 
5 859  PRO n 
5 860  HIS n 
5 861  LEU n 
5 862  PRO n 
5 863  ASP n 
5 864  GLY n 
5 865  THR n 
5 866  PRO n 
5 867  VAL n 
5 868  ASP n 
5 869  VAL n 
5 870  ILE n 
5 871  LEU n 
5 872  ASN n 
5 873  PRO n 
5 874  LEU n 
5 875  GLY n 
5 876  VAL n 
5 877  PRO n 
5 878  SER n 
5 879  ARG n 
5 880  MET n 
5 881  ASN n 
5 882  LEU n 
5 883  GLY n 
5 884  GLN n 
5 885  ILE n 
5 886  LEU n 
5 887  GLU n 
5 888  THR n 
5 889  HIS n 
5 890  LEU n 
5 891  GLY n 
5 892  LEU n 
5 893  ALA n 
5 894  GLY n 
5 895  TYR n 
5 896  PHE n 
5 897  LEU n 
5 898  GLY n 
5 899  GLN n 
5 900  ARG n 
5 901  TYR n 
5 902  ILE n 
5 903  SER n 
5 904  PRO n 
5 905  ILE n 
5 906  PHE n 
5 907  ASP n 
5 908  GLY n 
5 909  ALA n 
5 910  LYS n 
5 911  GLU n 
5 912  PRO n 
5 913  GLU n 
5 914  ILE n 
5 915  LYS n 
5 916  GLU n 
5 917  LEU n 
5 918  LEU n 
5 919  ALA n 
5 920  GLN n 
5 921  ALA n 
5 922  PHE n 
5 923  GLU n 
5 924  VAL n 
5 925  TYR n 
5 926  PHE n 
5 927  GLY n 
5 928  LYS n 
5 929  ARG n 
5 930  LYS n 
5 931  GLY n 
5 932  GLU n 
5 933  GLY n 
5 934  PHE n 
5 935  GLY n 
5 936  VAL n 
5 937  ASP n 
5 938  LYS n 
5 939  ARG n 
5 940  GLU n 
5 941  VAL n 
5 942  GLU n 
5 943  VAL n 
5 944  LEU n 
5 945  ARG n 
5 946  ARG n 
5 947  ALA n 
5 948  GLU n 
5 949  LYS n 
5 950  LEU n 
5 951  GLY n 
5 952  LEU n 
5 953  VAL n 
5 954  THR n 
5 955  PRO n 
5 956  GLY n 
5 957  LYS n 
5 958  THR n 
5 959  PRO n 
5 960  GLU n 
5 961  GLU n 
5 962  GLN n 
5 963  LEU n 
5 964  LYS n 
5 965  GLU n 
5 966  LEU n 
5 967  PHE n 
5 968  LEU n 
5 969  GLN n 
5 970  GLY n 
5 971  LYS n 
5 972  VAL n 
5 973  VAL n 
5 974  LEU n 
5 975  TYR n 
5 976  ASP n 
5 977  GLY n 
5 978  ARG n 
5 979  THR n 
5 980  GLY n 
5 981  GLU n 
5 982  PRO n 
5 983  ILE n 
5 984  GLU n 
5 985  GLY n 
5 986  PRO n 
5 987  ILE n 
5 988  VAL n 
5 989  VAL n 
5 990  GLY n 
5 991  GLN n 
5 992  MET n 
5 993  PHE n 
5 994  ILE n 
5 995  MET n 
5 996  LYS n 
5 997  LEU n 
5 998  TYR n 
5 999  HIS n 
5 1000 MET n 
5 1001 VAL n 
5 1002 GLU n 
5 1003 ASP n 
5 1004 LYS n 
5 1005 MET n 
5 1006 HIS n 
5 1007 ALA n 
5 1008 ARG n 
5 1009 SER n 
5 1010 THR n 
5 1011 GLY n 
5 1012 PRO n 
5 1013 TYR n 
5 1014 SER n 
5 1015 LEU n 
5 1016 ILE n 
5 1017 THR n 
5 1018 GLN n 
5 1019 GLN n 
5 1020 PRO n 
5 1021 LEU n 
5 1022 GLY n 
5 1023 GLY n 
5 1024 LYS n 
5 1025 ALA n 
5 1026 GLN n 
5 1027 PHE n 
5 1028 GLY n 
5 1029 GLY n 
5 1030 GLN n 
5 1031 ARG n 
5 1032 PHE n 
5 1033 GLY n 
5 1034 GLU n 
5 1035 MET n 
5 1036 GLU n 
5 1037 VAL n 
5 1038 TRP n 
5 1039 ALA n 
5 1040 LEU n 
5 1041 GLU n 
5 1042 ALA n 
5 1043 TYR n 
5 1044 GLY n 
5 1045 ALA n 
5 1046 ALA n 
5 1047 HIS n 
5 1048 THR n 
5 1049 LEU n 
5 1050 GLN n 
5 1051 GLU n 
5 1052 MET n 
5 1053 LEU n 
5 1054 THR n 
5 1055 LEU n 
5 1056 LYS n 
5 1057 SER n 
5 1058 ASP n 
5 1059 ASP n 
5 1060 ILE n 
5 1061 GLU n 
5 1062 GLY n 
5 1063 ARG n 
5 1064 ASN n 
5 1065 ALA n 
5 1066 ALA n 
5 1067 TYR n 
5 1068 GLU n 
5 1069 ALA n 
5 1070 ILE n 
5 1071 ILE n 
5 1072 LYS n 
5 1073 GLY n 
5 1074 GLU n 
5 1075 ASP n 
5 1076 VAL n 
5 1077 PRO n 
5 1078 GLU n 
5 1079 PRO n 
5 1080 SER n 
5 1081 VAL n 
5 1082 PRO n 
5 1083 GLU n 
5 1084 SER n 
5 1085 PHE n 
5 1086 ARG n 
5 1087 VAL n 
5 1088 LEU n 
5 1089 VAL n 
5 1090 LYS n 
5 1091 GLU n 
5 1092 LEU n 
5 1093 GLN n 
5 1094 ALA n 
5 1095 LEU n 
5 1096 ALA n 
5 1097 LEU n 
5 1098 ASP n 
5 1099 VAL n 
5 1100 GLN n 
5 1101 THR n 
5 1102 LEU n 
5 1103 ASP n 
5 1104 GLU n 
5 1105 LYS n 
5 1106 ASP n 
5 1107 ASN n 
5 1108 PRO n 
5 1109 VAL n 
5 1110 ASP n 
5 1111 ILE n 
5 1112 PHE n 
5 1113 GLU n 
5 1114 GLY n 
5 1115 LEU n 
5 1116 ALA n 
5 1117 SER n 
5 1118 LYS n 
5 1119 ARG n 
6 1    MET n 
6 2    LYS n 
6 3    LYS n 
6 4    GLU n 
6 5    VAL n 
6 6    ARG n 
6 7    LYS n 
6 8    VAL n 
6 9    ARG n 
6 10   ILE n 
6 11   ALA n 
6 12   LEU n 
6 13   ALA n 
6 14   SER n 
6 15   PRO n 
6 16   GLU n 
6 17   LYS n 
6 18   ILE n 
6 19   ARG n 
6 20   SER n 
6 21   TRP n 
6 22   SER n 
6 23   TYR n 
6 24   GLY n 
6 25   GLU n 
6 26   VAL n 
6 27   GLU n 
6 28   LYS n 
6 29   PRO n 
6 30   GLU n 
6 31   THR n 
6 32   ILE n 
6 33   ASN n 
6 34   TYR n 
6 35   ARG n 
6 36   THR n 
6 37   LEU n 
6 38   LYS n 
6 39   PRO n 
6 40   GLU n 
6 41   ARG n 
6 42   ASP n 
6 43   GLY n 
6 44   LEU n 
6 45   PHE n 
6 46   ASP n 
6 47   GLU n 
6 48   ARG n 
6 49   ILE n 
6 50   PHE n 
6 51   GLY n 
6 52   PRO n 
6 53   ILE n 
6 54   LYS n 
6 55   ASP n 
6 56   TYR n 
6 57   GLU n 
6 58   CYS n 
6 59   ALA n 
6 60   CYS n 
6 61   GLY n 
6 62   LYS n 
6 63   TYR n 
6 64   LYS n 
6 65   ARG n 
6 66   GLN n 
6 67   ARG n 
6 68   PHE n 
6 69   GLU n 
6 70   GLY n 
6 71   LYS n 
6 72   VAL n 
6 73   CYS n 
6 74   GLU n 
6 75   ARG n 
6 76   CYS n 
6 77   GLY n 
6 78   VAL n 
6 79   GLU n 
6 80   VAL n 
6 81   THR n 
6 82   LYS n 
6 83   SER n 
6 84   ILE n 
6 85   VAL n 
6 86   ARG n 
6 87   ARG n 
6 88   TYR n 
6 89   ARG n 
6 90   MET n 
6 91   GLY n 
6 92   HIS n 
6 93   ILE n 
6 94   GLU n 
6 95   LEU n 
6 96   ALA n 
6 97   THR n 
6 98   PRO n 
6 99   ALA n 
6 100  ALA n 
6 101  HIS n 
6 102  ILE n 
6 103  TRP n 
6 104  PHE n 
6 105  VAL n 
6 106  LYS n 
6 107  ASP n 
6 108  VAL n 
6 109  PRO n 
6 110  SER n 
6 111  LYS n 
6 112  ILE n 
6 113  GLY n 
6 114  THR n 
6 115  LEU n 
6 116  LEU n 
6 117  ASP n 
6 118  LEU n 
6 119  SER n 
6 120  ALA n 
6 121  THR n 
6 122  GLU n 
6 123  LEU n 
6 124  GLU n 
6 125  GLN n 
6 126  VAL n 
6 127  LEU n 
6 128  TYR n 
6 129  PHE n 
6 130  SER n 
6 131  LYS n 
6 132  TYR n 
6 133  ILE n 
6 134  VAL n 
6 135  LEU n 
6 136  ASP n 
6 137  PRO n 
6 138  LYS n 
6 139  GLY n 
6 140  ALA n 
6 141  ILE n 
6 142  LEU n 
6 143  ASN n 
6 144  GLY n 
6 145  VAL n 
6 146  PRO n 
6 147  VAL n 
6 148  GLU n 
6 149  LYS n 
6 150  ARG n 
6 151  GLN n 
6 152  LEU n 
6 153  LEU n 
6 154  THR n 
6 155  ASP n 
6 156  GLU n 
6 157  GLU n 
6 158  TYR n 
6 159  ARG n 
6 160  GLU n 
6 161  LEU n 
6 162  ARG n 
6 163  TYR n 
6 164  GLY n 
6 165  LYS n 
6 166  GLN n 
6 167  GLU n 
6 168  THR n 
6 169  TYR n 
6 170  PRO n 
6 171  LEU n 
6 172  PRO n 
6 173  PRO n 
6 174  GLY n 
6 175  VAL n 
6 176  ASP n 
6 177  ALA n 
6 178  LEU n 
6 179  VAL n 
6 180  LYS n 
6 181  ASP n 
6 182  GLY n 
6 183  GLU n 
6 184  GLU n 
6 185  VAL n 
6 186  VAL n 
6 187  LYS n 
6 188  GLY n 
6 189  GLN n 
6 190  GLU n 
6 191  LEU n 
6 192  ALA n 
6 193  PRO n 
6 194  GLY n 
6 195  VAL n 
6 196  VAL n 
6 197  SER n 
6 198  ARG n 
6 199  LEU n 
6 200  ASP n 
6 201  GLY n 
6 202  VAL n 
6 203  ALA n 
6 204  LEU n 
6 205  TYR n 
6 206  ARG n 
6 207  PHE n 
6 208  PRO n 
6 209  ARG n 
6 210  ARG n 
6 211  VAL n 
6 212  ARG n 
6 213  VAL n 
6 214  GLU n 
6 215  TYR n 
6 216  VAL n 
6 217  LYS n 
6 218  LYS n 
6 219  GLU n 
6 220  ARG n 
6 221  ALA n 
6 222  GLY n 
6 223  LEU n 
6 224  ARG n 
6 225  LEU n 
6 226  PRO n 
6 227  LEU n 
6 228  ALA n 
6 229  ALA n 
6 230  TRP n 
6 231  VAL n 
6 232  GLU n 
6 233  LYS n 
6 234  GLU n 
6 235  ALA n 
6 236  TYR n 
6 237  LYS n 
6 238  PRO n 
6 239  GLY n 
6 240  GLU n 
6 241  ILE n 
6 242  LEU n 
6 243  ALA n 
6 244  GLU n 
6 245  LEU n 
6 246  PRO n 
6 247  GLU n 
6 248  PRO n 
6 249  TYR n 
6 250  LEU n 
6 251  PHE n 
6 252  ARG n 
6 253  ALA n 
6 254  GLU n 
6 255  GLU n 
6 256  GLU n 
6 257  GLY n 
6 258  VAL n 
6 259  VAL n 
6 260  GLU n 
6 261  LEU n 
6 262  LYS n 
6 263  GLU n 
6 264  LEU n 
6 265  GLU n 
6 266  GLU n 
6 267  GLY n 
6 268  ALA n 
6 269  PHE n 
6 270  LEU n 
6 271  VAL n 
6 272  LEU n 
6 273  ARG n 
6 274  ARG n 
6 275  GLU n 
6 276  ASP n 
6 277  GLU n 
6 278  PRO n 
6 279  VAL n 
6 280  ALA n 
6 281  THR n 
6 282  TYR n 
6 283  PHE n 
6 284  LEU n 
6 285  PRO n 
6 286  VAL n 
6 287  GLY n 
6 288  MET n 
6 289  THR n 
6 290  PRO n 
6 291  LEU n 
6 292  VAL n 
6 293  VAL n 
6 294  HIS n 
6 295  GLY n 
6 296  GLU n 
6 297  ILE n 
6 298  VAL n 
6 299  GLU n 
6 300  LYS n 
6 301  GLY n 
6 302  GLN n 
6 303  PRO n 
6 304  LEU n 
6 305  ALA n 
6 306  GLU n 
6 307  ALA n 
6 308  LYS n 
6 309  GLY n 
6 310  LEU n 
6 311  LEU n 
6 312  ARG n 
6 313  MET n 
6 314  PRO n 
6 315  ARG n 
6 316  GLN n 
6 317  VAL n 
6 318  ARG n 
6 319  ALA n 
6 320  ALA n 
6 321  GLN n 
6 322  VAL n 
6 323  GLU n 
6 324  ALA n 
6 325  GLU n 
6 326  GLU n 
6 327  GLU n 
6 328  GLY n 
6 329  GLU n 
6 330  THR n 
6 331  VAL n 
6 332  TYR n 
6 333  LEU n 
6 334  THR n 
6 335  LEU n 
6 336  PHE n 
6 337  LEU n 
6 338  GLU n 
6 339  TRP n 
6 340  THR n 
6 341  GLU n 
6 342  PRO n 
6 343  LYS n 
6 344  ASP n 
6 345  TYR n 
6 346  ARG n 
6 347  VAL n 
6 348  GLN n 
6 349  PRO n 
6 350  HIS n 
6 351  MET n 
6 352  ASN n 
6 353  VAL n 
6 354  VAL n 
6 355  VAL n 
6 356  PRO n 
6 357  GLU n 
6 358  GLY n 
6 359  ALA n 
6 360  ARG n 
6 361  VAL n 
6 362  GLU n 
6 363  ALA n 
6 364  GLY n 
6 365  ASP n 
6 366  LYS n 
6 367  ILE n 
6 368  VAL n 
6 369  ALA n 
6 370  ALA n 
6 371  ILE n 
6 372  ASP n 
6 373  PRO n 
6 374  GLU n 
6 375  GLU n 
6 376  GLU n 
6 377  VAL n 
6 378  ILE n 
6 379  ALA n 
6 380  GLU n 
6 381  ALA n 
6 382  GLU n 
6 383  GLY n 
6 384  VAL n 
6 385  VAL n 
6 386  HIS n 
6 387  LEU n 
6 388  HIS n 
6 389  GLU n 
6 390  PRO n 
6 391  ALA n 
6 392  SER n 
6 393  ILE n 
6 394  LEU n 
6 395  VAL n 
6 396  VAL n 
6 397  LYS n 
6 398  ALA n 
6 399  ARG n 
6 400  VAL n 
6 401  TYR n 
6 402  PRO n 
6 403  PHE n 
6 404  GLU n 
6 405  ASP n 
6 406  ASP n 
6 407  VAL n 
6 408  GLU n 
6 409  VAL n 
6 410  SER n 
6 411  THR n 
6 412  GLY n 
6 413  ASP n 
6 414  ARG n 
6 415  VAL n 
6 416  ALA n 
6 417  PRO n 
6 418  GLY n 
6 419  ASP n 
6 420  VAL n 
6 421  LEU n 
6 422  ALA n 
6 423  ASP n 
6 424  GLY n 
6 425  GLY n 
6 426  LYS n 
6 427  VAL n 
6 428  LYS n 
6 429  SER n 
6 430  ASP n 
6 431  VAL n 
6 432  TYR n 
6 433  GLY n 
6 434  ARG n 
6 435  VAL n 
6 436  GLU n 
6 437  VAL n 
6 438  ASP n 
6 439  LEU n 
6 440  VAL n 
6 441  ARG n 
6 442  ASN n 
6 443  VAL n 
6 444  VAL n 
6 445  ARG n 
6 446  VAL n 
6 447  VAL n 
6 448  GLU n 
6 449  SER n 
6 450  TYR n 
6 451  ASP n 
6 452  ILE n 
6 453  ASP n 
6 454  ALA n 
6 455  ARG n 
6 456  MET n 
6 457  GLY n 
6 458  ALA n 
6 459  GLU n 
6 460  ALA n 
6 461  ILE n 
6 462  GLN n 
6 463  GLN n 
6 464  LEU n 
6 465  LEU n 
6 466  LYS n 
6 467  GLU n 
6 468  LEU n 
6 469  ASP n 
6 470  LEU n 
6 471  GLU n 
6 472  ALA n 
6 473  LEU n 
6 474  GLU n 
6 475  LYS n 
6 476  GLU n 
6 477  LEU n 
6 478  LEU n 
6 479  GLU n 
6 480  GLU n 
6 481  MET n 
6 482  LYS n 
6 483  HIS n 
6 484  PRO n 
6 485  SER n 
6 486  ARG n 
6 487  ALA n 
6 488  ARG n 
6 489  ARG n 
6 490  ALA n 
6 491  LYS n 
6 492  ALA n 
6 493  ARG n 
6 494  LYS n 
6 495  ARG n 
6 496  LEU n 
6 497  GLU n 
6 498  VAL n 
6 499  VAL n 
6 500  ARG n 
6 501  ALA n 
6 502  PHE n 
6 503  LEU n 
6 504  ASP n 
6 505  SER n 
6 506  GLY n 
6 507  ASN n 
6 508  ARG n 
6 509  PRO n 
6 510  GLU n 
6 511  TRP n 
6 512  MET n 
6 513  ILE n 
6 514  LEU n 
6 515  GLU n 
6 516  ALA n 
6 517  VAL n 
6 518  PRO n 
6 519  VAL n 
6 520  LEU n 
6 521  PRO n 
6 522  PRO n 
6 523  ASP n 
6 524  LEU n 
6 525  ARG n 
6 526  PRO n 
6 527  MET n 
6 528  VAL n 
6 529  GLN n 
6 530  VAL n 
6 531  ASP n 
6 532  GLY n 
6 533  GLY n 
6 534  ARG n 
6 535  PHE n 
6 536  ALA n 
6 537  THR n 
6 538  SER n 
6 539  ASP n 
6 540  LEU n 
6 541  ASN n 
6 542  ASP n 
6 543  LEU n 
6 544  TYR n 
6 545  ARG n 
6 546  ARG n 
6 547  LEU n 
6 548  ILE n 
6 549  ASN n 
6 550  ARG n 
6 551  ASN n 
6 552  ASN n 
6 553  ARG n 
6 554  LEU n 
6 555  LYS n 
6 556  LYS n 
6 557  LEU n 
6 558  LEU n 
6 559  ALA n 
6 560  GLN n 
6 561  GLY n 
6 562  ALA n 
6 563  PRO n 
6 564  GLU n 
6 565  ILE n 
6 566  ILE n 
6 567  ILE n 
6 568  ARG n 
6 569  ASN n 
6 570  GLU n 
6 571  LYS n 
6 572  ARG n 
6 573  MET n 
6 574  LEU n 
6 575  GLN n 
6 576  GLU n 
6 577  ALA n 
6 578  VAL n 
6 579  ASP n 
6 580  ALA n 
6 581  LEU n 
6 582  LEU n 
6 583  ASP n 
6 584  ASN n 
6 585  GLY n 
6 586  ARG n 
6 587  ARG n 
6 588  GLY n 
6 589  ALA n 
6 590  PRO n 
6 591  VAL n 
6 592  THR n 
6 593  ASN n 
6 594  PRO n 
6 595  GLY n 
6 596  SER n 
6 597  ASP n 
6 598  ARG n 
6 599  PRO n 
6 600  LEU n 
6 601  ARG n 
6 602  SER n 
6 603  LEU n 
6 604  THR n 
6 605  ASP n 
6 606  ILE n 
6 607  LEU n 
6 608  SER n 
6 609  GLY n 
6 610  LYS n 
6 611  GLN n 
6 612  GLY n 
6 613  ARG n 
6 614  PHE n 
6 615  ARG n 
6 616  GLN n 
6 617  ASN n 
6 618  LEU n 
6 619  LEU n 
6 620  GLY n 
6 621  LYS n 
6 622  ARG n 
6 623  VAL n 
6 624  ASP n 
6 625  TYR n 
6 626  SER n 
6 627  GLY n 
6 628  ARG n 
6 629  SER n 
6 630  VAL n 
6 631  ILE n 
6 632  VAL n 
6 633  VAL n 
6 634  GLY n 
6 635  PRO n 
6 636  GLN n 
6 637  LEU n 
6 638  LYS n 
6 639  LEU n 
6 640  HIS n 
6 641  GLN n 
6 642  CYS n 
6 643  GLY n 
6 644  LEU n 
6 645  PRO n 
6 646  LYS n 
6 647  ARG n 
6 648  MET n 
6 649  ALA n 
6 650  LEU n 
6 651  GLU n 
6 652  LEU n 
6 653  PHE n 
6 654  LYS n 
6 655  PRO n 
6 656  PHE n 
6 657  LEU n 
6 658  LEU n 
6 659  LYS n 
6 660  LYS n 
6 661  MET n 
6 662  GLU n 
6 663  GLU n 
6 664  LYS n 
6 665  GLY n 
6 666  ILE n 
6 667  ALA n 
6 668  PRO n 
6 669  ASN n 
6 670  VAL n 
6 671  LYS n 
6 672  ALA n 
6 673  ALA n 
6 674  ARG n 
6 675  ARG n 
6 676  MET n 
6 677  LEU n 
6 678  GLU n 
6 679  ARG n 
6 680  GLN n 
6 681  ARG n 
6 682  ASP n 
6 683  ILE n 
6 684  LYS n 
6 685  ASP n 
6 686  GLU n 
6 687  VAL n 
6 688  TRP n 
6 689  ASP n 
6 690  ALA n 
6 691  LEU n 
6 692  GLU n 
6 693  GLU n 
6 694  VAL n 
6 695  ILE n 
6 696  HIS n 
6 697  GLY n 
6 698  LYS n 
6 699  VAL n 
6 700  VAL n 
6 701  LEU n 
6 702  LEU n 
6 703  ASN n 
6 704  ARG n 
6 705  ALA n 
6 706  PRO n 
6 707  THR n 
6 708  LEU n 
6 709  HIS n 
6 710  ARG n 
6 711  LEU n 
6 712  GLY n 
6 713  ILE n 
6 714  GLN n 
6 715  ALA n 
6 716  PHE n 
6 717  GLN n 
6 718  PRO n 
6 719  VAL n 
6 720  LEU n 
6 721  VAL n 
6 722  GLU n 
6 723  GLY n 
6 724  GLN n 
6 725  SER n 
6 726  ILE n 
6 727  GLN n 
6 728  LEU n 
6 729  HIS n 
6 730  PRO n 
6 731  LEU n 
6 732  VAL n 
6 733  CYS n 
6 734  GLU n 
6 735  ALA n 
6 736  PHE n 
6 737  ASN n 
6 738  ALA n 
6 739  ASP n 
6 740  PHE n 
6 741  ASP n 
6 742  GLY n 
6 743  ASP n 
6 744  GLN n 
6 745  MET n 
6 746  ALA n 
6 747  VAL n 
6 748  HIS n 
6 749  VAL n 
6 750  PRO n 
6 751  LEU n 
6 752  SER n 
6 753  SER n 
6 754  PHE n 
6 755  ALA n 
6 756  GLN n 
6 757  ALA n 
6 758  GLU n 
6 759  ALA n 
6 760  ARG n 
6 761  ILE n 
6 762  GLN n 
6 763  MET n 
6 764  LEU n 
6 765  SER n 
6 766  ALA n 
6 767  HIS n 
6 768  ASN n 
6 769  LEU n 
6 770  LEU n 
6 771  SER n 
6 772  PRO n 
6 773  ALA n 
6 774  SER n 
6 775  GLY n 
6 776  GLU n 
6 777  PRO n 
6 778  LEU n 
6 779  ALA n 
6 780  LYS n 
6 781  PRO n 
6 782  SER n 
6 783  ARG n 
6 784  ASP n 
6 785  ILE n 
6 786  ILE n 
6 787  LEU n 
6 788  GLY n 
6 789  LEU n 
6 790  TYR n 
6 791  TYR n 
6 792  ILE n 
6 793  THR n 
6 794  GLN n 
6 795  VAL n 
6 796  ARG n 
6 797  LYS n 
6 798  GLU n 
6 799  LYS n 
6 800  LYS n 
6 801  GLY n 
6 802  ALA n 
6 803  GLY n 
6 804  LEU n 
6 805  GLU n 
6 806  PHE n 
6 807  ALA n 
6 808  THR n 
6 809  PRO n 
6 810  GLU n 
6 811  GLU n 
6 812  ALA n 
6 813  LEU n 
6 814  ALA n 
6 815  ALA n 
6 816  HIS n 
6 817  GLU n 
6 818  ARG n 
6 819  GLY n 
6 820  GLU n 
6 821  VAL n 
6 822  ALA n 
6 823  LEU n 
6 824  ASN n 
6 825  ALA n 
6 826  PRO n 
6 827  ILE n 
6 828  LYS n 
6 829  VAL n 
6 830  ALA n 
6 831  GLY n 
6 832  ARG n 
6 833  GLU n 
6 834  THR n 
6 835  SER n 
6 836  VAL n 
6 837  GLY n 
6 838  ARG n 
6 839  LEU n 
6 840  LYS n 
6 841  TYR n 
6 842  VAL n 
6 843  PHE n 
6 844  ALA n 
6 845  ASN n 
6 846  PRO n 
6 847  ASP n 
6 848  GLU n 
6 849  ALA n 
6 850  LEU n 
6 851  LEU n 
6 852  ALA n 
6 853  VAL n 
6 854  ALA n 
6 855  HIS n 
6 856  GLY n 
6 857  ILE n 
6 858  VAL n 
6 859  ASP n 
6 860  LEU n 
6 861  GLN n 
6 862  ASP n 
6 863  VAL n 
6 864  VAL n 
6 865  THR n 
6 866  VAL n 
6 867  ARG n 
6 868  TYR n 
6 869  MET n 
6 870  GLY n 
6 871  LYS n 
6 872  ARG n 
6 873  LEU n 
6 874  GLU n 
6 875  THR n 
6 876  SER n 
6 877  PRO n 
6 878  GLY n 
6 879  ARG n 
6 880  ILE n 
6 881  LEU n 
6 882  PHE n 
6 883  ALA n 
6 884  ARG n 
6 885  ILE n 
6 886  VAL n 
6 887  ALA n 
6 888  GLU n 
6 889  ALA n 
6 890  VAL n 
6 891  GLU n 
6 892  ASP n 
6 893  GLU n 
6 894  LYS n 
6 895  VAL n 
6 896  ALA n 
6 897  TRP n 
6 898  GLU n 
6 899  LEU n 
6 900  ILE n 
6 901  GLN n 
6 902  LEU n 
6 903  ASP n 
6 904  VAL n 
6 905  PRO n 
6 906  GLN n 
6 907  GLU n 
6 908  LYS n 
6 909  ASN n 
6 910  SER n 
6 911  LEU n 
6 912  LYS n 
6 913  ASP n 
6 914  LEU n 
6 915  VAL n 
6 916  TYR n 
6 917  GLN n 
6 918  ALA n 
6 919  PHE n 
6 920  LEU n 
6 921  ARG n 
6 922  LEU n 
6 923  GLY n 
6 924  MET n 
6 925  GLU n 
6 926  LYS n 
6 927  THR n 
6 928  ALA n 
6 929  ARG n 
6 930  LEU n 
6 931  LEU n 
6 932  ASP n 
6 933  ALA n 
6 934  LEU n 
6 935  LYS n 
6 936  TYR n 
6 937  TYR n 
6 938  GLY n 
6 939  PHE n 
6 940  THR n 
6 941  PHE n 
6 942  SER n 
6 943  THR n 
6 944  THR n 
6 945  SER n 
6 946  GLY n 
6 947  ILE n 
6 948  THR n 
6 949  ILE n 
6 950  GLY n 
6 951  ILE n 
6 952  ASP n 
6 953  ASP n 
6 954  ALA n 
6 955  VAL n 
6 956  ILE n 
6 957  PRO n 
6 958  GLU n 
6 959  GLU n 
6 960  LYS n 
6 961  LYS n 
6 962  GLN n 
6 963  TYR n 
6 964  LEU n 
6 965  GLU n 
6 966  GLU n 
6 967  ALA n 
6 968  ASP n 
6 969  ARG n 
6 970  LYS n 
6 971  LEU n 
6 972  LEU n 
6 973  GLN n 
6 974  ILE n 
6 975  GLU n 
6 976  GLN n 
6 977  ALA n 
6 978  TYR n 
6 979  GLU n 
6 980  MET n 
6 981  GLY n 
6 982  PHE n 
6 983  LEU n 
6 984  THR n 
6 985  ASP n 
6 986  ARG n 
6 987  GLU n 
6 988  ARG n 
6 989  TYR n 
6 990  ASP n 
6 991  GLN n 
6 992  ILE n 
6 993  LEU n 
6 994  GLN n 
6 995  LEU n 
6 996  TRP n 
6 997  THR n 
6 998  GLU n 
6 999  THR n 
6 1000 THR n 
6 1001 GLU n 
6 1002 LYS n 
6 1003 VAL n 
6 1004 THR n 
6 1005 GLN n 
6 1006 ALA n 
6 1007 VAL n 
6 1008 PHE n 
6 1009 LYS n 
6 1010 ASN n 
6 1011 PHE n 
6 1012 GLU n 
6 1013 GLU n 
6 1014 ASN n 
6 1015 TYR n 
6 1016 PRO n 
6 1017 PHE n 
6 1018 ASN n 
6 1019 PRO n 
6 1020 LEU n 
6 1021 TYR n 
6 1022 VAL n 
6 1023 MET n 
6 1024 ALA n 
6 1025 GLN n 
6 1026 SER n 
6 1027 GLY n 
6 1028 ALA n 
6 1029 ARG n 
6 1030 GLY n 
6 1031 ASN n 
6 1032 PRO n 
6 1033 GLN n 
6 1034 GLN n 
6 1035 ILE n 
6 1036 ARG n 
6 1037 GLN n 
6 1038 LEU n 
6 1039 CYS n 
6 1040 GLY n 
6 1041 LEU n 
6 1042 ARG n 
6 1043 GLY n 
6 1044 LEU n 
6 1045 MET n 
6 1046 GLN n 
6 1047 LYS n 
6 1048 PRO n 
6 1049 SER n 
6 1050 GLY n 
6 1051 GLU n 
6 1052 THR n 
6 1053 PHE n 
6 1054 GLU n 
6 1055 VAL n 
6 1056 PRO n 
6 1057 VAL n 
6 1058 ARG n 
6 1059 SER n 
6 1060 SER n 
6 1061 PHE n 
6 1062 ARG n 
6 1063 GLU n 
6 1064 GLY n 
6 1065 LEU n 
6 1066 THR n 
6 1067 VAL n 
6 1068 LEU n 
6 1069 GLU n 
6 1070 TYR n 
6 1071 PHE n 
6 1072 ILE n 
6 1073 SER n 
6 1074 SER n 
6 1075 HIS n 
6 1076 GLY n 
6 1077 ALA n 
6 1078 ARG n 
6 1079 LYS n 
6 1080 GLY n 
6 1081 GLY n 
6 1082 ALA n 
6 1083 ASP n 
6 1084 THR n 
6 1085 ALA n 
6 1086 LEU n 
6 1087 ARG n 
6 1088 THR n 
6 1089 ALA n 
6 1090 ASP n 
6 1091 SER n 
6 1092 GLY n 
6 1093 TYR n 
6 1094 LEU n 
6 1095 THR n 
6 1096 ARG n 
6 1097 LYS n 
6 1098 LEU n 
6 1099 VAL n 
6 1100 ASP n 
6 1101 VAL n 
6 1102 THR n 
6 1103 HIS n 
6 1104 GLU n 
6 1105 ILE n 
6 1106 VAL n 
6 1107 VAL n 
6 1108 ARG n 
6 1109 GLU n 
6 1110 ALA n 
6 1111 ASP n 
6 1112 CYS n 
6 1113 GLY n 
6 1114 THR n 
6 1115 THR n 
6 1116 ASN n 
6 1117 TYR n 
6 1118 ILE n 
6 1119 SER n 
6 1120 VAL n 
6 1121 PRO n 
6 1122 LEU n 
6 1123 PHE n 
6 1124 GLN n 
6 1125 PRO n 
6 1126 ASP n 
6 1127 GLU n 
6 1128 VAL n 
6 1129 THR n 
6 1130 ARG n 
6 1131 SER n 
6 1132 LEU n 
6 1133 ARG n 
6 1134 LEU n 
6 1135 ARG n 
6 1136 LYS n 
6 1137 ARG n 
6 1138 ALA n 
6 1139 ASP n 
6 1140 ILE n 
6 1141 GLU n 
6 1142 ALA n 
6 1143 GLY n 
6 1144 LEU n 
6 1145 TYR n 
6 1146 GLY n 
6 1147 ARG n 
6 1148 VAL n 
6 1149 LEU n 
6 1150 ALA n 
6 1151 ARG n 
6 1152 GLU n 
6 1153 VAL n 
6 1154 GLU n 
6 1155 VAL n 
6 1156 LEU n 
6 1157 GLY n 
6 1158 VAL n 
6 1159 ARG n 
6 1160 LEU n 
6 1161 GLU n 
6 1162 GLU n 
6 1163 GLY n 
6 1164 ARG n 
6 1165 TYR n 
6 1166 LEU n 
6 1167 SER n 
6 1168 MET n 
6 1169 ASP n 
6 1170 ASP n 
6 1171 VAL n 
6 1172 HIS n 
6 1173 LEU n 
6 1174 LEU n 
6 1175 ILE n 
6 1176 LYS n 
6 1177 ALA n 
6 1178 ALA n 
6 1179 GLU n 
6 1180 ALA n 
6 1181 GLY n 
6 1182 GLU n 
6 1183 ILE n 
6 1184 GLN n 
6 1185 GLU n 
6 1186 VAL n 
6 1187 PRO n 
6 1188 VAL n 
6 1189 ARG n 
6 1190 SER n 
6 1191 PRO n 
6 1192 LEU n 
6 1193 THR n 
6 1194 CYS n 
6 1195 GLN n 
6 1196 THR n 
6 1197 ARG n 
6 1198 TYR n 
6 1199 GLY n 
6 1200 VAL n 
6 1201 CYS n 
6 1202 GLN n 
6 1203 LYS n 
6 1204 CYS n 
6 1205 TYR n 
6 1206 GLY n 
6 1207 TYR n 
6 1208 ASP n 
6 1209 LEU n 
6 1210 SER n 
6 1211 MET n 
6 1212 ALA n 
6 1213 ARG n 
6 1214 PRO n 
6 1215 VAL n 
6 1216 SER n 
6 1217 ILE n 
6 1218 GLY n 
6 1219 GLU n 
6 1220 ALA n 
6 1221 VAL n 
6 1222 GLY n 
6 1223 ILE n 
6 1224 VAL n 
6 1225 ALA n 
6 1226 ALA n 
6 1227 GLN n 
6 1228 SER n 
6 1229 ILE n 
6 1230 GLY n 
6 1231 GLU n 
6 1232 PRO n 
6 1233 GLY n 
6 1234 THR n 
6 1235 GLN n 
6 1236 LEU n 
6 1237 THR n 
6 1238 MET n 
6 1239 ARG n 
6 1240 THR n 
6 1241 PHE n 
6 1242 HIS n 
6 1243 THR n 
6 1244 GLY n 
6 1245 GLY n 
6 1246 VAL n 
6 1247 ALA n 
6 1248 GLY n 
6 1249 ALA n 
6 1250 ALA n 
6 1251 ASP n 
6 1252 ILE n 
6 1253 THR n 
6 1254 GLN n 
6 1255 GLY n 
6 1256 LEU n 
6 1257 PRO n 
6 1258 ARG n 
6 1259 VAL n 
6 1260 ILE n 
6 1261 GLU n 
6 1262 LEU n 
6 1263 PHE n 
6 1264 GLU n 
6 1265 ALA n 
6 1266 ARG n 
6 1267 ARG n 
6 1268 PRO n 
6 1269 LYS n 
6 1270 ALA n 
6 1271 LYS n 
6 1272 ALA n 
6 1273 VAL n 
6 1274 ILE n 
6 1275 SER n 
6 1276 GLU n 
6 1277 ILE n 
6 1278 ASP n 
6 1279 GLY n 
6 1280 VAL n 
6 1281 VAL n 
6 1282 ARG n 
6 1283 ILE n 
6 1284 GLU n 
6 1285 GLU n 
6 1286 THR n 
6 1287 GLU n 
6 1288 GLU n 
6 1289 LYS n 
6 1290 LEU n 
6 1291 SER n 
6 1292 VAL n 
6 1293 PHE n 
6 1294 VAL n 
6 1295 GLU n 
6 1296 SER n 
6 1297 GLU n 
6 1298 GLY n 
6 1299 PHE n 
6 1300 SER n 
6 1301 LYS n 
6 1302 GLU n 
6 1303 TYR n 
6 1304 LYS n 
6 1305 LEU n 
6 1306 PRO n 
6 1307 LYS n 
6 1308 GLU n 
6 1309 ALA n 
6 1310 ARG n 
6 1311 LEU n 
6 1312 LEU n 
6 1313 VAL n 
6 1314 LYS n 
6 1315 ASP n 
6 1316 GLY n 
6 1317 ASP n 
6 1318 TYR n 
6 1319 VAL n 
6 1320 GLU n 
6 1321 ALA n 
6 1322 GLY n 
6 1323 GLN n 
6 1324 PRO n 
6 1325 LEU n 
6 1326 THR n 
6 1327 ARG n 
6 1328 GLY n 
6 1329 ALA n 
6 1330 ILE n 
6 1331 ASP n 
6 1332 PRO n 
6 1333 HIS n 
6 1334 GLN n 
6 1335 LEU n 
6 1336 LEU n 
6 1337 GLU n 
6 1338 ALA n 
6 1339 LYS n 
6 1340 GLY n 
6 1341 PRO n 
6 1342 GLU n 
6 1343 ALA n 
6 1344 VAL n 
6 1345 GLU n 
6 1346 ARG n 
6 1347 TYR n 
6 1348 LEU n 
6 1349 VAL n 
6 1350 GLU n 
6 1351 GLU n 
6 1352 ILE n 
6 1353 GLN n 
6 1354 LYS n 
6 1355 VAL n 
6 1356 TYR n 
6 1357 ARG n 
6 1358 ALA n 
6 1359 GLN n 
6 1360 GLY n 
6 1361 VAL n 
6 1362 LYS n 
6 1363 LEU n 
6 1364 HIS n 
6 1365 ASP n 
6 1366 LYS n 
6 1367 HIS n 
6 1368 ILE n 
6 1369 GLU n 
6 1370 ILE n 
6 1371 VAL n 
6 1372 VAL n 
6 1373 ARG n 
6 1374 GLN n 
6 1375 MET n 
6 1376 MET n 
6 1377 LYS n 
6 1378 TYR n 
6 1379 VAL n 
6 1380 GLU n 
6 1381 VAL n 
6 1382 THR n 
6 1383 ASP n 
6 1384 PRO n 
6 1385 GLY n 
6 1386 ASP n 
6 1387 SER n 
6 1388 ARG n 
6 1389 LEU n 
6 1390 LEU n 
6 1391 GLU n 
6 1392 GLY n 
6 1393 GLN n 
6 1394 VAL n 
6 1395 LEU n 
6 1396 GLU n 
6 1397 LYS n 
6 1398 TRP n 
6 1399 ASP n 
6 1400 VAL n 
6 1401 GLU n 
6 1402 ALA n 
6 1403 LEU n 
6 1404 ASN n 
6 1405 GLU n 
6 1406 ARG n 
6 1407 LEU n 
6 1408 ILE n 
6 1409 ALA n 
6 1410 GLU n 
6 1411 GLY n 
6 1412 LYS n 
6 1413 THR n 
6 1414 PRO n 
6 1415 VAL n 
6 1416 ALA n 
6 1417 TRP n 
6 1418 LYS n 
6 1419 PRO n 
6 1420 LEU n 
6 1421 LEU n 
6 1422 MET n 
6 1423 GLY n 
6 1424 VAL n 
6 1425 THR n 
6 1426 LYS n 
6 1427 SER n 
6 1428 ALA n 
6 1429 LEU n 
6 1430 SER n 
6 1431 THR n 
6 1432 LYS n 
6 1433 SER n 
6 1434 TRP n 
6 1435 LEU n 
6 1436 SER n 
6 1437 ALA n 
6 1438 ALA n 
6 1439 SER n 
6 1440 PHE n 
6 1441 GLN n 
6 1442 ASN n 
6 1443 THR n 
6 1444 THR n 
6 1445 HIS n 
6 1446 VAL n 
6 1447 LEU n 
6 1448 THR n 
6 1449 GLU n 
6 1450 ALA n 
6 1451 ALA n 
6 1452 ILE n 
6 1453 ALA n 
6 1454 GLY n 
6 1455 LYS n 
6 1456 LYS n 
6 1457 ASP n 
6 1458 GLU n 
6 1459 LEU n 
6 1460 ILE n 
6 1461 GLY n 
6 1462 LEU n 
6 1463 LYS n 
6 1464 GLU n 
6 1465 ASN n 
6 1466 VAL n 
6 1467 ILE n 
6 1468 LEU n 
6 1469 GLY n 
6 1470 ARG n 
6 1471 LEU n 
6 1472 ILE n 
6 1473 PRO n 
6 1474 ALA n 
6 1475 GLY n 
6 1476 THR n 
6 1477 GLY n 
6 1478 SER n 
6 1479 ASP n 
6 1480 PHE n 
6 1481 VAL n 
6 1482 ARG n 
6 1483 PHE n 
6 1484 THR n 
6 1485 GLN n 
6 1486 VAL n 
6 1487 VAL n 
6 1488 ASP n 
6 1489 GLN n 
6 1490 LYS n 
6 1491 THR n 
6 1492 LEU n 
6 1493 LYS n 
6 1494 ALA n 
6 1495 ILE n 
6 1496 GLU n 
6 1497 GLU n 
6 1498 ALA n 
6 1499 ARG n 
6 1500 LYS n 
6 1501 GLU n 
6 1502 ALA n 
6 1503 VAL n 
6 1504 GLU n 
6 1505 ALA n 
6 1506 LYS n 
6 1507 GLU n 
6 1508 ARG n 
6 1509 PRO n 
6 1510 ALA n 
6 1511 ALA n 
6 1512 ARG n 
6 1513 ARG n 
6 1514 GLY n 
6 1515 VAL n 
6 1516 LYS n 
6 1517 ARG n 
6 1518 GLU n 
6 1519 GLN n 
6 1520 PRO n 
6 1521 GLY n 
6 1522 LYS n 
6 1523 GLN n 
6 1524 ALA n 
7 1    MET n 
7 2    ALA n 
7 3    GLU n 
7 4    PRO n 
7 5    GLY n 
7 6    ILE n 
7 7    ASP n 
7 8    LYS n 
7 9    LEU n 
7 10   PHE n 
7 11   GLY n 
7 12   MET n 
7 13   VAL n 
7 14   ASP n 
7 15   SER n 
7 16   LYS n 
7 17   TYR n 
7 18   ARG n 
7 19   LEU n 
7 20   THR n 
7 21   VAL n 
7 22   VAL n 
7 23   VAL n 
7 24   ALA n 
7 25   LYS n 
7 26   ARG n 
7 27   ALA n 
7 28   GLN n 
7 29   GLN n 
7 30   LEU n 
7 31   LEU n 
7 32   ARG n 
7 33   HIS n 
7 34   GLY n 
7 35   PHE n 
7 36   LYS n 
7 37   ASN n 
7 38   THR n 
7 39   VAL n 
7 40   LEU n 
7 41   GLU n 
7 42   PRO n 
7 43   GLU n 
7 44   GLU n 
7 45   ARG n 
7 46   PRO n 
7 47   LYS n 
7 48   MET n 
7 49   GLN n 
7 50   THR n 
7 51   LEU n 
7 52   GLU n 
7 53   GLY n 
7 54   LEU n 
7 55   PHE n 
7 56   ASP n 
7 57   ASP n 
7 58   PRO n 
7 59   ASN n 
7 60   ALA n 
7 61   VAL n 
7 62   THR n 
7 63   TRP n 
7 64   ALA n 
7 65   MET n 
7 66   LYS n 
7 67   GLU n 
7 68   LEU n 
7 69   LEU n 
7 70   THR n 
7 71   GLY n 
7 72   ARG n 
7 73   LEU n 
7 74   VAL n 
7 75   PHE n 
7 76   GLY n 
7 77   GLU n 
7 78   ASN n 
7 79   LEU n 
7 80   VAL n 
7 81   PRO n 
7 82   GLU n 
7 83   ASP n 
7 84   ARG n 
7 85   LEU n 
7 86   GLN n 
7 87   LYS n 
7 88   GLU n 
7 89   MET n 
7 90   GLU n 
7 91   ARG n 
7 92   LEU n 
7 93   TYR n 
7 94   PRO n 
7 95   VAL n 
7 96   GLU n 
7 97   ARG n 
7 98   GLU n 
7 99   GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
4 1 sample ? ? ? 'Thermus thermophilus' 300852 Thermus 'Thermus thermophilus' HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample ? ? ? 'Thermus thermophilus' 300852 Thermus 'Thermus thermophilus' HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample ? ? ? 'Thermus thermophilus' 300852 Thermus 'Thermus thermophilus' HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample ? ? ? 'Thermus thermophilus' 300852 Thermus 'Thermus thermophilus' HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RPOA_THETH Q9Z9H6 4 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 ? 
2 UNP RPOB_THET8 Q8RQE9 5 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 ? 
3 UNP RPOC_THET8 Q8RQE8 6 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 ? 
4 UNP RPOZ_THET8 Q8RQE7 7 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 ? 
5 PDB 2PPB       2PPB   1 ? ? ? 
6 PDB 2PPB       2PPB   2 ? ? ? 
7 PDB 2PPB       2PPB   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2PPB A 1 ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
2  1 2PPB B 1 ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
3  2 2PPB C 1 ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4  3 2PPB D 1 ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5  4 2PPB E 1 ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
6  1 2PPB K 1 ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
7  1 2PPB L 1 ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
8  2 2PPB M 1 ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
9  3 2PPB N 1 ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
10 4 2PPB O 1 ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
11 5 2PPB G 1 ? 23   ? 2PPB   1 ? 23   ? 1 23   
12 6 2PPB H 1 ? 16   ? 2PPB   1 ? 16   ? 1 16   
13 7 2PPB I 1 ? 14   ? 2PPB   2 ? 15   ? 2 15   
14 5 2PPB X 1 ? 23   ? 2PPB   1 ? 23   ? 1 23   
15 6 2PPB Y 1 ? 16   ? 2PPB   1 ? 16   ? 1 16   
16 7 2PPB Z 1 ? 14   ? 2PPB   2 ? 15   ? 2 15   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                    ? 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                         ? 'C3 H7 N O2'        89.093  
APC non-polymer         . 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' "ALPHA,BETA-METHYLENEADENOSINE-5'-TRIPHOSPHATE" 
'C11 H18 N5 O12 P3' 505.208 
ARG 'L-peptide linking' y ARGININE                                        ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                      ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                 ? 'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                     ? 'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                                        ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"            ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"             ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"            ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                    ? 'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                    ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                       ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                 ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                         ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                       ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                           ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                      ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                         ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                          ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                      ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                 ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                   ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                         ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                          ? 'C3 H7 N O3'        105.093 
STD non-polymer         . STREPTOLYDIGIN                                  
;2-PYRROLIDINEACETAMIDE, 4-[6-(1,4-DIMETHYLSPIRO[2,9-DIOXABICYCLO[3.3.1]NON-6-ENE-8,2'-OXIRAN-3-YL)-1-HYDROXY-4-METHYL-2,4-HEPTADIENYLIDENE]-N,ALPHA-DIMETHYL-3,5-DIOXO-1-(TETRAHYDRO-5-HYDROXY-6-METHYL-2H-PYRAN-2-YL)-; PORTAMYCIN
;
'C32 H44 N2 O9'     600.700 
THR 'L-peptide linking' y THREONINE                                       ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                      ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                        ? 'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                      ? 'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                                          ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                      ? 'Zn 2'              65.409  
# 
_exptl.entry_id          2PPB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.85 
_exptl_crystal.density_percent_sol   68.05 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.50 
_exptl_crystal_grow.pdbx_details    
;30% MPD, 0.1M NA CACODYLATE, 0.2M MG ACETATE, 2MM AMPCPP, 2MM STD, PH 6.5, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 293K, pH 6.50, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 MPD             ? ? ? 
1 2 1 'NA CACODYLATE' ? ? ? 
1 3 1 'MG ACETATE'    ? ? ? 
1 4 1 AMPCPP          ? ? ? 
1 5 2 MPD             ? ? ? 
1 6 2 'NA CACODYLATE' ? ? ? 
1 7 2 'MG ACETATE'    ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-08-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     2PPB 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   0.000 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            3.000 
_reflns.number_obs                   207148 
_reflns.number_all                   207148 
_reflns.percent_possible_obs         88.7 
_reflns.pdbx_Rmerge_I_obs            0.11 
_reflns.pdbx_Rsym_value              0.11 
_reflns.pdbx_netI_over_sigmaI        7.10000 
_reflns.B_iso_Wilson_estimate        47 
_reflns.pdbx_redundancy              2.6 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   70.1 
_reflns_shell.Rmerge_I_obs           0.439 
_reflns_shell.pdbx_Rsym_value        0.439 
_reflns_shell.meanI_over_sigI_obs    2.200 
_reflns_shell.pdbx_redundancy        1.90 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      16469 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2PPB 
_refine.ls_number_reflns_obs                     207148 
_refine.ls_number_reflns_all                     207148 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    87.8 
_refine.ls_R_factor_obs                          0.234 
_refine.ls_R_factor_all                          0.243 
_refine.ls_R_factor_R_work                       0.234 
_refine.ls_R_factor_R_free                       0.266 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  11916 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               55.10 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;THE PERFECT MEROHEDRAL TWINNING WAS DETECTED IN THE CRYSTALS WITH THE TWINNING OPERATOR {H,-K,-L}. THE REFINEMENT STATISTICS PRESENTED FOR THIS ENTRY CORRESPONDS TO THE REFINEMENT CARRIED OUT USING THE TWINNING OPTION OF THE CNS PROGRAM. FOR THE DEPOSITION THE DIFFRACTION DATA WERE DETWINNED USING THE CNS PROGRAM. THEREFORE, SOME REFLECTIONS WERE LOST DUE TO THE DETWINNING PROCEDURE AND ARE MISSING IN THE DEPOSITED SF FILE, WHEREAS THE REFINEMENT STATISTICS CALCULATED BASED ON THE DETWINNED 
ATA MIGHT BE SLIGHTLY DIFFERENT FROM THOSE OBTAINED DURING THE "TWINNED" REFINEMENT INCLUDED IN THIS ENTRY.
;
_refine.pdbx_starting_model                      'PDB ENTRY 2O5I' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2PPB 
_refine_analyze.Luzzati_coordinate_error_obs    0.38 
_refine_analyze.Luzzati_sigma_a_obs             0.39 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.43 
_refine_analyze.Luzzati_sigma_a_free            0.42 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        47168 
_refine_hist.pdbx_number_atoms_nucleic_acid   2168 
_refine_hist.pdbx_number_atoms_ligand         156 
_refine_hist.number_atoms_solvent             2470 
_refine_hist.number_atoms_total               51962 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.016 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.84  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      26.8  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.37  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.11 
_refine_ls_shell.number_reflns_R_work             16469 
_refine_ls_shell.R_factor_R_work                  0.284 
_refine_ls_shell.percent_reflns_obs               70.10 
_refine_ls_shell.R_factor_R_free                  0.314 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            3.9 
_refine_ls_shell.number_reflns_R_free             910 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                16469 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2PPB 
_struct.title                     
;Crystal structure of the T. thermophilus RNAP polymerase elongation complex with the ntp substrate analog and antibiotic streptolydigin
;
_struct.pdbx_descriptor           'DNA-directed RNA polymerase/DNA/RNA/Streptolydigin Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2PPB 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA/RNA 
_struct_keywords.text            
;RNA POLYMERASE, ELONGATION COMPLEX, TEMPLATE DNA, NON-TEMPLATE DNA, RNA TRANSCRIPT, NTP SUBSTRATE, ANTIBIOTIC STREPTOLYDIGIN, TRANSFERASE-DNA-RNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 1  ? 
E  N N 2  ? 
F  N N 3  ? 
G  N N 4  ? 
H  N N 4  ? 
I  N N 5  ? 
J  N N 6  ? 
K  N N 7  ? 
L  N N 4  ? 
M  N N 4  ? 
N  N N 5  ? 
O  N N 6  ? 
P  N N 7  ? 
Q  N N 8  ? 
R  N N 9  ? 
S  N N 9  ? 
T  N N 10 ? 
U  N N 10 ? 
V  N N 11 ? 
W  N N 11 ? 
X  N N 8  ? 
Y  N N 9  ? 
Z  N N 9  ? 
AA N N 10 ? 
BA N N 10 ? 
CA N N 12 ? 
DA N N 12 ? 
EA N N 12 ? 
FA N N 12 ? 
GA N N 12 ? 
HA N N 12 ? 
IA N N 12 ? 
JA N N 12 ? 
KA N N 12 ? 
LA N N 12 ? 
MA N N 12 ? 
NA N N 12 ? 
OA N N 12 ? 
PA N N 12 ? 
QA N N 12 ? 
RA N N 12 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY G 31   ? SER G 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   2   ASP G 74   ? GLU G 84   ? ASP A 74   GLU A 84   1 ? 11 
HELX_P HELX_P3   3   ARG G 112  ? PHE G 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   4   PRO G 152  ? GLY G 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   5   THR G 206  ? THR G 223  ? THR A 206  THR A 223  1 ? 18 
HELX_P HELX_P6   6   PHE H 32   ? SER H 47   ? PHE B 32   SER B 47   1 ? 16 
HELX_P HELX_P7   7   ASP H 74   ? GLU H 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P8   8   ARG H 112  ? PHE H 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P9   9   PRO H 152  ? GLY H 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P10  10  THR H 206  ? TYR H 224  ? THR B 206  TYR B 224  1 ? 19 
HELX_P HELX_P11  11  THR I 19   ? LEU I 30   ? THR C 19   LEU C 30   1 ? 12 
HELX_P HELX_P12  12  GLN I 31   ? VAL I 34   ? GLN C 31   VAL C 34   5 ? 4  
HELX_P HELX_P13  13  GLY I 43   ? THR I 51   ? GLY C 43   THR C 51   1 ? 9  
HELX_P HELX_P14  14  PRO I 79   ? LYS I 86   ? PRO C 79   LYS C 86   1 ? 8  
HELX_P HELX_P15  15  PRO I 192  ? GLY I 201  ? PRO C 192  GLY C 201  1 ? 10 
HELX_P HELX_P16  16  ASP I 203  ? GLY I 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P17  17  LEU I 217  ? MET I 222  ? LEU C 217  MET C 222  1 ? 6  
HELX_P HELX_P18  18  GLU I 224  ? MET I 229  ? GLU C 224  MET C 229  1 ? 6  
HELX_P HELX_P19  19  ARG I 230  ? LEU I 242  ? ARG C 230  LEU C 242  1 ? 13 
HELX_P HELX_P20  20  ALA I 253  ? TYR I 258  ? ALA C 253  TYR C 258  1 ? 6  
HELX_P HELX_P21  21  GLY I 273  ? GLU I 279  ? GLY C 273  GLU C 279  1 ? 7  
HELX_P HELX_P22  22  VAL I 302  ? GLY I 316  ? VAL C 302  GLY C 316  1 ? 15 
HELX_P HELX_P23  23  THR I 335  ? GLY I 362  ? THR C 335  GLY C 362  1 ? 28 
HELX_P HELX_P24  24  THR I 368  ? VAL I 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P25  25  SER I 375  ? ARG I 388  ? SER C 375  ARG C 388  1 ? 14 
HELX_P HELX_P26  26  ASN I 399  ? ARG I 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P27  27  HIS I 431  ? TYR I 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P28  28  THR I 489  ? TYR I 494  ? THR C 489  TYR C 494  1 ? 6  
HELX_P HELX_P29  29  SER I 535  ? PHE I 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P30  30  SER I 541  ? LEU I 546  ? SER C 541  LEU C 546  1 ? 6  
HELX_P HELX_P31  31  PHE I 549  ? ASP I 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P32  32  ASP I 554  ? THR I 566  ? ASP C 554  THR C 566  1 ? 13 
HELX_P HELX_P33  33  LEU I 583  ? SER I 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P34  34  GLU I 692  ? ARG I 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P35  35  THR I 768  ? GLU I 780  ? THR C 768  GLU C 780  1 ? 13 
HELX_P HELX_P36  36  PRO I 873  ? VAL I 876  ? PRO C 873  VAL C 876  5 ? 4  
HELX_P HELX_P37  37  LEU I 882  ? GLY I 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P38  38  LYS I 910  ? GLU I 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P39  39  ASP I 937  ? LYS I 949  ? ASP C 937  LYS C 949  1 ? 13 
HELX_P HELX_P40  40  THR I 958  ? GLN I 969  ? THR C 958  GLN C 969  1 ? 12 
HELX_P HELX_P41  41  GLY I 1033 ? TYR I 1043 ? GLY C 1033 TYR C 1043 1 ? 11 
HELX_P HELX_P42  42  ALA I 1045 ? THR I 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P43  43  ASP I 1059 ? GLY I 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P44  44  PRO I 1082 ? LEU I 1095 ? PRO C 1082 LEU C 1095 1 ? 14 
HELX_P HELX_P45  45  SER J 14   ? SER J 22   ? SER D 14   SER D 22   1 ? 9  
HELX_P HELX_P46  46  SER J 83   ? ARG J 89   ? SER D 83   ARG D 89   1 ? 7  
HELX_P HELX_P47  47  HIS J 101  ? LYS J 106  ? HIS D 101  LYS D 106  1 ? 6  
HELX_P HELX_P48  48  SER J 110  ? LEU J 116  ? SER D 110  LEU D 116  1 ? 7  
HELX_P HELX_P49  49  THR J 121  ? SER J 130  ? THR D 121  SER D 130  1 ? 10 
HELX_P HELX_P50  50  THR J 154  ? TYR J 163  ? THR D 154  TYR D 163  1 ? 10 
HELX_P HELX_P51  51  GLY J 457  ? GLU J 467  ? GLY D 457  GLU D 467  1 ? 11 
HELX_P HELX_P52  52  ASP J 469  ? HIS J 483  ? ASP D 469  HIS D 483  1 ? 15 
HELX_P HELX_P53  53  SER J 485  ? GLY J 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P54  54  ARG J 508  ? TRP J 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P55  55  ASP J 539  ? GLY J 561  ? ASP D 539  GLY D 561  1 ? 23 
HELX_P HELX_P56  56  PRO J 563  ? ASP J 583  ? PRO D 563  ASP D 583  1 ? 21 
HELX_P HELX_P57  57  SER J 602  ? SER J 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P58  58  GLY J 612  ? GLY J 620  ? GLY D 612  GLY D 620  1 ? 9  
HELX_P HELX_P59  59  PRO J 645  ? PHE J 653  ? PRO D 645  PHE D 653  1 ? 9  
HELX_P HELX_P60  60  PHE J 653  ? GLU J 663  ? PHE D 653  GLU D 663  1 ? 11 
HELX_P HELX_P61  61  ASN J 669  ? ARG J 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P62  62  GLN J 680  ? ILE J 683  ? GLN D 680  ILE D 683  5 ? 4  
HELX_P HELX_P63  63  LYS J 684  ? ILE J 695  ? LYS D 684  ILE D 695  1 ? 12 
HELX_P HELX_P64  64  HIS J 709  ? LEU J 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P65  65  PRO J 730  ? ALA J 735  ? PRO D 730  ALA D 735  5 ? 6  
HELX_P HELX_P66  66  SER J 752  ? GLN J 762  ? SER D 752  GLN D 762  1 ? 11 
HELX_P HELX_P67  67  SER J 782  ? GLN J 794  ? SER D 782  GLN D 794  1 ? 13 
HELX_P HELX_P68  68  GLU J 810  ? ALA J 822  ? GLU D 810  ALA D 822  1 ? 13 
HELX_P HELX_P69  69  SER J 835  ? TYR J 841  ? SER D 835  TYR D 841  1 ? 7  
HELX_P HELX_P70  70  ASN J 845  ? HIS J 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P71  71  SER J 876  ? VAL J 890  ? SER D 876  VAL D 890  1 ? 15 
HELX_P HELX_P72  72  ASP J 892  ? LEU J 899  ? ASP D 892  LEU D 899  1 ? 8  
HELX_P HELX_P73  73  GLU J 907  ? GLY J 923  ? GLU D 907  GLY D 923  1 ? 17 
HELX_P HELX_P74  74  GLY J 923  ? GLY J 946  ? GLY D 923  GLY D 946  1 ? 24 
HELX_P HELX_P75  75  GLU J 959  ? MET J 980  ? GLU D 959  MET D 980  1 ? 22 
HELX_P HELX_P76  76  THR J 984  ? ASN J 1014 ? THR D 984  ASN D 1014 1 ? 31 
HELX_P HELX_P77  77  ASN J 1018 ? SER J 1026 ? ASN D 1018 SER D 1026 1 ? 9  
HELX_P HELX_P78  78  ASN J 1031 ? CYS J 1039 ? ASN D 1031 CYS D 1039 1 ? 9  
HELX_P HELX_P79  79  THR J 1066 ? HIS J 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P80  80  LYS J 1136 ? TYR J 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P81  81  SER J 1167 ? GLY J 1181 ? SER D 1167 GLY D 1181 1 ? 15 
HELX_P HELX_P82  82  SER J 1190 ? CYS J 1194 ? SER D 1190 CYS D 1194 5 ? 5  
HELX_P HELX_P83  83  CYS J 1201 ? GLY J 1206 ? CYS D 1201 GLY D 1206 1 ? 6  
HELX_P HELX_P84  84  ALA J 1220 ? THR J 1243 ? ALA D 1220 THR D 1243 1 ? 24 
HELX_P HELX_P85  85  GLY J 1255 ? GLU J 1264 ? GLY D 1255 GLU D 1264 1 ? 10 
HELX_P HELX_P86  86  ASP J 1331 ? GLY J 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P87  87  GLY J 1340 ? ALA J 1358 ? GLY D 1340 ALA D 1358 1 ? 19 
HELX_P HELX_P88  88  HIS J 1364 ? MET J 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P89  89  LEU J 1395 ? LEU J 1407 ? LEU D 1395 LEU D 1407 1 ? 13 
HELX_P HELX_P90  90  GLY J 1423 ? SER J 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P91  91  ASN J 1442 ? ALA J 1453 ? ASN D 1442 ALA D 1453 1 ? 12 
HELX_P HELX_P92  92  GLY J 1461 ? LEU J 1468 ? GLY D 1461 LEU D 1468 1 ? 8  
HELX_P HELX_P93  93  GLN J 1489 ? GLU J 1501 ? GLN D 1489 GLU D 1501 1 ? 13 
HELX_P HELX_P94  94  GLY K 5    ? VAL K 13   ? GLY E 5    VAL E 13   1 ? 9  
HELX_P HELX_P95  95  SER K 15   ? HIS K 33   ? SER E 15   HIS E 33   1 ? 19 
HELX_P HELX_P96  96  GLU K 52   ? ASP K 56   ? GLU E 52   ASP E 56   5 ? 5  
HELX_P HELX_P97  97  ASN K 59   ? LEU K 69   ? ASN E 59   LEU E 69   1 ? 11 
HELX_P HELX_P98  98  ASP K 83   ? TYR K 93   ? ASP E 83   TYR E 93   1 ? 11 
HELX_P HELX_P99  99  GLY L 31   ? SER L 47   ? GLY K 31   SER K 47   1 ? 17 
HELX_P HELX_P100 100 ASP L 74   ? GLU L 84   ? ASP K 74   GLU K 84   1 ? 11 
HELX_P HELX_P101 101 ARG L 112  ? PHE L 114  ? ARG K 112  PHE K 114  5 ? 3  
HELX_P HELX_P102 102 PRO L 152  ? GLY L 157  ? PRO K 152  GLY K 157  1 ? 6  
HELX_P HELX_P103 103 THR L 206  ? THR L 223  ? THR K 206  THR K 223  1 ? 18 
HELX_P HELX_P104 104 PHE M 32   ? SER M 47   ? PHE L 32   SER L 47   1 ? 16 
HELX_P HELX_P105 105 ASP M 74   ? GLU M 84   ? ASP L 74   GLU L 84   1 ? 11 
HELX_P HELX_P106 106 ARG M 112  ? PHE M 114  ? ARG L 112  PHE L 114  5 ? 3  
HELX_P HELX_P107 107 PRO M 152  ? GLY M 157  ? PRO L 152  GLY L 157  1 ? 6  
HELX_P HELX_P108 108 THR M 206  ? TYR M 224  ? THR L 206  TYR L 224  1 ? 19 
HELX_P HELX_P109 109 THR N 19   ? LEU N 30   ? THR M 19   LEU M 30   1 ? 12 
HELX_P HELX_P110 110 GLN N 31   ? VAL N 34   ? GLN M 31   VAL M 34   5 ? 4  
HELX_P HELX_P111 111 GLY N 43   ? THR N 51   ? GLY M 43   THR M 51   1 ? 9  
HELX_P HELX_P112 112 PRO N 79   ? LYS N 86   ? PRO M 79   LYS M 86   1 ? 8  
HELX_P HELX_P113 113 PRO N 192  ? GLY N 201  ? PRO M 192  GLY M 201  1 ? 10 
HELX_P HELX_P114 114 ASP N 203  ? GLY N 212  ? ASP M 203  GLY M 212  1 ? 10 
HELX_P HELX_P115 115 LEU N 217  ? MET N 222  ? LEU M 217  MET M 222  1 ? 6  
HELX_P HELX_P116 116 GLU N 224  ? MET N 229  ? GLU M 224  MET M 229  1 ? 6  
HELX_P HELX_P117 117 ARG N 230  ? LEU N 242  ? ARG M 230  LEU M 242  1 ? 13 
HELX_P HELX_P118 118 ALA N 253  ? TYR N 258  ? ALA M 253  TYR M 258  1 ? 6  
HELX_P HELX_P119 119 GLY N 273  ? GLU N 279  ? GLY M 273  GLU M 279  1 ? 7  
HELX_P HELX_P120 120 VAL N 302  ? GLY N 316  ? VAL M 302  GLY M 316  1 ? 15 
HELX_P HELX_P121 121 THR N 335  ? GLY N 362  ? THR M 335  GLY M 362  1 ? 28 
HELX_P HELX_P122 122 THR N 368  ? VAL N 373  ? THR M 368  VAL M 373  1 ? 6  
HELX_P HELX_P123 123 SER N 375  ? SER N 389  ? SER M 375  SER M 389  1 ? 15 
HELX_P HELX_P124 124 ASN N 399  ? ARG N 408  ? ASN M 399  ARG M 408  1 ? 10 
HELX_P HELX_P125 125 GLY N 424  ? ASP N 429  ? GLY M 424  ASP M 429  1 ? 6  
HELX_P HELX_P126 126 HIS N 431  ? TYR N 435  ? HIS M 431  TYR M 435  5 ? 5  
HELX_P HELX_P127 127 THR N 489  ? TYR N 494  ? THR M 489  TYR M 494  1 ? 6  
HELX_P HELX_P128 128 SER N 535  ? PHE N 540  ? SER M 535  PHE M 540  5 ? 6  
HELX_P HELX_P129 129 SER N 541  ? LEU N 546  ? SER M 541  LEU M 546  1 ? 6  
HELX_P HELX_P130 130 PHE N 549  ? ASP N 553  ? PHE M 549  ASP M 553  5 ? 5  
HELX_P HELX_P131 131 ASP N 554  ? THR N 566  ? ASP M 554  THR M 566  1 ? 13 
HELX_P HELX_P132 132 LEU N 583  ? SER N 591  ? LEU M 583  SER M 591  1 ? 9  
HELX_P HELX_P133 133 GLU N 692  ? ARG N 697  ? GLU M 692  ARG M 697  1 ? 6  
HELX_P HELX_P134 134 THR N 768  ? GLU N 780  ? THR M 768  GLU M 780  1 ? 13 
HELX_P HELX_P135 135 PRO N 873  ? VAL N 876  ? PRO M 873  VAL M 876  5 ? 4  
HELX_P HELX_P136 136 LEU N 882  ? GLY N 898  ? LEU M 882  GLY M 898  1 ? 17 
HELX_P HELX_P137 137 LYS N 910  ? GLU N 932  ? LYS M 910  GLU M 932  1 ? 23 
HELX_P HELX_P138 138 ASP N 937  ? LYS N 949  ? ASP M 937  LYS M 949  1 ? 13 
HELX_P HELX_P139 139 THR N 958  ? GLN N 969  ? THR M 958  GLN M 969  1 ? 12 
HELX_P HELX_P140 140 GLY N 1033 ? TYR N 1043 ? GLY M 1033 TYR M 1043 1 ? 11 
HELX_P HELX_P141 141 ALA N 1045 ? THR N 1054 ? ALA M 1045 THR M 1054 1 ? 10 
HELX_P HELX_P142 142 ASP N 1059 ? GLY N 1073 ? ASP M 1059 GLY M 1073 1 ? 15 
HELX_P HELX_P143 143 PRO N 1082 ? LEU N 1095 ? PRO M 1082 LEU M 1095 1 ? 14 
HELX_P HELX_P144 144 SER O 14   ? SER O 22   ? SER N 14   SER N 22   1 ? 9  
HELX_P HELX_P145 145 SER O 83   ? ARG O 89   ? SER N 83   ARG N 89   1 ? 7  
HELX_P HELX_P146 146 HIS O 101  ? LYS O 106  ? HIS N 101  LYS N 106  1 ? 6  
HELX_P HELX_P147 147 SER O 110  ? LEU O 116  ? SER N 110  LEU N 116  1 ? 7  
HELX_P HELX_P148 148 THR O 121  ? SER O 130  ? THR N 121  SER N 130  1 ? 10 
HELX_P HELX_P149 149 THR O 154  ? TYR O 163  ? THR N 154  TYR N 163  1 ? 10 
HELX_P HELX_P150 150 GLY O 457  ? GLU O 467  ? GLY N 457  GLU N 467  1 ? 11 
HELX_P HELX_P151 151 ASP O 469  ? HIS O 483  ? ASP N 469  HIS N 483  1 ? 15 
HELX_P HELX_P152 152 SER O 485  ? GLY O 506  ? SER N 485  GLY N 506  1 ? 22 
HELX_P HELX_P153 153 ARG O 508  ? TRP O 511  ? ARG N 508  TRP N 511  5 ? 4  
HELX_P HELX_P154 154 ASP O 539  ? GLY O 561  ? ASP N 539  GLY N 561  1 ? 23 
HELX_P HELX_P155 155 PRO O 563  ? ASP O 583  ? PRO N 563  ASP N 583  1 ? 21 
HELX_P HELX_P156 156 SER O 602  ? SER O 608  ? SER N 602  SER N 608  1 ? 7  
HELX_P HELX_P157 157 GLY O 612  ? GLY O 620  ? GLY N 612  GLY N 620  1 ? 9  
HELX_P HELX_P158 158 PRO O 645  ? PHE O 653  ? PRO N 645  PHE N 653  1 ? 9  
HELX_P HELX_P159 159 PHE O 653  ? GLU O 663  ? PHE N 653  GLU N 663  1 ? 11 
HELX_P HELX_P160 160 ASN O 669  ? ARG O 679  ? ASN N 669  ARG N 679  1 ? 11 
HELX_P HELX_P161 161 GLN O 680  ? ILE O 683  ? GLN N 680  ILE N 683  5 ? 4  
HELX_P HELX_P162 162 LYS O 684  ? ILE O 695  ? LYS N 684  ILE N 695  1 ? 12 
HELX_P HELX_P163 163 HIS O 709  ? LEU O 711  ? HIS N 709  LEU N 711  5 ? 3  
HELX_P HELX_P164 164 PRO O 730  ? GLU O 734  ? PRO N 730  GLU N 734  5 ? 5  
HELX_P HELX_P165 165 SER O 752  ? GLN O 762  ? SER N 752  GLN N 762  1 ? 11 
HELX_P HELX_P166 166 LEU O 764  ? ASN O 768  ? LEU N 764  ASN N 768  5 ? 5  
HELX_P HELX_P167 167 SER O 782  ? GLN O 794  ? SER N 782  GLN N 794  1 ? 13 
HELX_P HELX_P168 168 GLU O 810  ? ALA O 822  ? GLU N 810  ALA N 822  1 ? 13 
HELX_P HELX_P169 169 SER O 835  ? TYR O 841  ? SER N 835  TYR N 841  1 ? 7  
HELX_P HELX_P170 170 ASN O 845  ? HIS O 855  ? ASN N 845  HIS N 855  1 ? 11 
HELX_P HELX_P171 171 SER O 876  ? VAL O 890  ? SER N 876  VAL N 890  1 ? 15 
HELX_P HELX_P172 172 ASP O 892  ? LEU O 899  ? ASP N 892  LEU N 899  1 ? 8  
HELX_P HELX_P173 173 GLU O 907  ? GLY O 923  ? GLU N 907  GLY N 923  1 ? 17 
HELX_P HELX_P174 174 GLY O 923  ? GLY O 946  ? GLY N 923  GLY N 946  1 ? 24 
HELX_P HELX_P175 175 GLU O 959  ? GLU O 979  ? GLU N 959  GLU N 979  1 ? 21 
HELX_P HELX_P176 176 THR O 984  ? ASN O 1014 ? THR N 984  ASN N 1014 1 ? 31 
HELX_P HELX_P177 177 ASN O 1018 ? SER O 1026 ? ASN N 1018 SER N 1026 1 ? 9  
HELX_P HELX_P178 178 ASN O 1031 ? CYS O 1039 ? ASN N 1031 CYS N 1039 1 ? 9  
HELX_P HELX_P179 179 THR O 1066 ? HIS O 1103 ? THR N 1066 HIS N 1103 1 ? 38 
HELX_P HELX_P180 180 LYS O 1136 ? TYR O 1145 ? LYS N 1136 TYR N 1145 1 ? 10 
HELX_P HELX_P181 181 SER O 1167 ? GLY O 1181 ? SER N 1167 GLY N 1181 1 ? 15 
HELX_P HELX_P182 182 SER O 1190 ? CYS O 1194 ? SER N 1190 CYS N 1194 5 ? 5  
HELX_P HELX_P183 183 CYS O 1201 ? GLY O 1206 ? CYS N 1201 GLY N 1206 1 ? 6  
HELX_P HELX_P184 184 ALA O 1220 ? THR O 1243 ? ALA N 1220 THR N 1243 1 ? 24 
HELX_P HELX_P185 185 GLY O 1255 ? GLU O 1264 ? GLY N 1255 GLU N 1264 1 ? 10 
HELX_P HELX_P186 186 ASP O 1331 ? GLY O 1340 ? ASP N 1331 GLY N 1340 1 ? 10 
HELX_P HELX_P187 187 GLY O 1340 ? ALA O 1358 ? GLY N 1340 ALA N 1358 1 ? 19 
HELX_P HELX_P188 188 HIS O 1364 ? MET O 1375 ? HIS N 1364 MET N 1375 1 ? 12 
HELX_P HELX_P189 189 LEU O 1395 ? LEU O 1407 ? LEU N 1395 LEU N 1407 1 ? 13 
HELX_P HELX_P190 190 GLY O 1423 ? SER O 1430 ? GLY N 1423 SER N 1430 1 ? 8  
HELX_P HELX_P191 191 ASN O 1442 ? ALA O 1453 ? ASN N 1442 ALA N 1453 1 ? 12 
HELX_P HELX_P192 192 GLY O 1461 ? LEU O 1468 ? GLY N 1461 LEU N 1468 1 ? 8  
HELX_P HELX_P193 193 GLN O 1489 ? GLU O 1501 ? GLN N 1489 GLU N 1501 1 ? 13 
HELX_P HELX_P194 194 GLY P 5    ? VAL P 13   ? GLY O 5    VAL O 13   1 ? 9  
HELX_P HELX_P195 195 SER P 15   ? HIS P 33   ? SER O 15   HIS O 33   1 ? 19 
HELX_P HELX_P196 196 GLU P 52   ? ASP P 56   ? GLU O 52   ASP O 56   5 ? 5  
HELX_P HELX_P197 197 ASN P 59   ? LEU P 69   ? ASN O 59   LEU O 69   1 ? 11 
HELX_P HELX_P198 198 ASP P 83   ? TYR P 93   ? ASP O 83   TYR O 93   1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? B  G   16  "O3'" ? ? ? 1_555 T  MG  .    MG  ? ? H G   16   D MG  9001 1_555 ? ? ? ? ? ? ?            2.127 ? 
metalc2   metalc ? ? E  G   16  "O3'" ? ? ? 1_555 AA MG  .    MG  ? ? Y G   16   N MG  9003 1_555 ? ? ? ? ? ? ?            2.020 ? 
metalc3   metalc ? ? J  ASP 739 OD2   ? ? ? 1_555 T  MG  .    MG  ? ? D ASP 739  D MG  9001 1_555 ? ? ? ? ? ? ?            2.044 ? 
metalc4   metalc ? ? J  ASP 741 OD1   ? ? ? 1_555 T  MG  .    MG  ? ? D ASP 741  D MG  9001 1_555 ? ? ? ? ? ? ?            2.267 ? 
metalc5   metalc ? ? J  ASP 743 OD2   ? ? ? 1_555 T  MG  .    MG  ? ? D ASP 743  D MG  9001 1_555 ? ? ? ? ? ? ?            2.381 ? 
metalc6   metalc ? ? O  ASP 739 OD2   ? ? ? 1_555 AA MG  .    MG  ? ? N ASP 739  N MG  9003 1_555 ? ? ? ? ? ? ?            2.084 ? 
metalc7   metalc ? ? O  ASP 741 OD1   ? ? ? 1_555 AA MG  .    MG  ? ? N ASP 741  N MG  9003 1_555 ? ? ? ? ? ? ?            2.323 ? 
metalc8   metalc ? ? O  ASP 743 OD2   ? ? ? 1_555 AA MG  .    MG  ? ? N ASP 743  N MG  9003 1_555 ? ? ? ? ? ? ?            2.252 ? 
metalc9   metalc ? ? U  MG  .   MG    ? ? ? 1_555 LA HOH .    O   ? ? D MG  9002 D HOH 9004 1_555 ? ? ? ? ? ? ?            2.016 ? 
metalc10  metalc ? ? BA MG  .   MG    ? ? ? 1_555 PA HOH .    O   ? ? N MG  9004 M HOH 7001 1_555 ? ? ? ? ? ? ?            2.255 ? 
metalc11  metalc ? ? U  MG  .   MG    ? ? ? 1_555 V  APC .    O3G ? ? D MG  9002 D APC 5999 1_555 ? ? ? ? ? ? ?            2.218 ? 
metalc12  metalc ? ? U  MG  .   MG    ? ? ? 1_555 V  APC .    O2B ? ? D MG  9002 D APC 5999 1_555 ? ? ? ? ? ? ?            2.366 ? 
metalc13  metalc ? ? U  MG  .   MG    ? ? ? 1_555 V  APC .    O1A ? ? D MG  9002 D APC 5999 1_555 ? ? ? ? ? ? ?            2.094 ? 
metalc14  metalc ? ? BA MG  .   MG    ? ? ? 1_555 W  APC .    O2B ? ? N MG  9004 M APC 6999 1_555 ? ? ? ? ? ? ?            2.277 ? 
metalc15  metalc ? ? BA MG  .   MG    ? ? ? 1_555 W  APC .    O3G ? ? N MG  9004 M APC 6999 1_555 ? ? ? ? ? ? ?            2.170 ? 
metalc16  metalc ? ? BA MG  .   MG    ? ? ? 1_555 W  APC .    O1A ? ? N MG  9004 M APC 6999 1_555 ? ? ? ? ? ? ?            2.268 ? 
metalc17  metalc ? ? R  ZN  .   ZN    ? ? ? 1_555 J  CYS 76   SG  ? ? D ZN  7058 D CYS 76   1_555 ? ? ? ? ? ? ?            2.394 ? 
metalc18  metalc ? ? R  ZN  .   ZN    ? ? ? 1_555 J  CYS 58   SG  ? ? D ZN  7058 D CYS 58   1_555 ? ? ? ? ? ? ?            2.439 ? 
metalc19  metalc ? ? R  ZN  .   ZN    ? ? ? 1_555 J  CYS 60   SG  ? ? D ZN  7058 D CYS 60   1_555 ? ? ? ? ? ? ?            2.469 ? 
metalc20  metalc ? ? R  ZN  .   ZN    ? ? ? 1_555 J  CYS 73   SG  ? ? D ZN  7058 D CYS 73   1_555 ? ? ? ? ? ? ?            2.399 ? 
metalc21  metalc ? ? S  ZN  .   ZN    ? ? ? 1_555 J  CYS 1112 SG  ? ? D ZN  8112 D CYS 1112 1_555 ? ? ? ? ? ? ?            2.322 ? 
metalc22  metalc ? ? S  ZN  .   ZN    ? ? ? 1_555 J  CYS 1201 SG  ? ? D ZN  8112 D CYS 1201 1_555 ? ? ? ? ? ? ?            2.359 ? 
metalc23  metalc ? ? S  ZN  .   ZN    ? ? ? 1_555 J  CYS 1204 SG  ? ? D ZN  8112 D CYS 1204 1_555 ? ? ? ? ? ? ?            2.390 ? 
metalc24  metalc ? ? S  ZN  .   ZN    ? ? ? 1_555 J  CYS 1194 SG  ? ? D ZN  8112 D CYS 1194 1_555 ? ? ? ? ? ? ?            2.364 ? 
metalc25  metalc ? ? T  MG  .   MG    ? ? ? 1_555 J  ASP 741  OD2 ? ? D MG  9001 D ASP 741  1_555 ? ? ? ? ? ? ?            2.577 ? 
metalc26  metalc ? ? Y  ZN  .   ZN    ? ? ? 1_555 O  CYS 73   SG  ? ? N ZN  7158 N CYS 73   1_555 ? ? ? ? ? ? ?            2.384 ? 
metalc27  metalc ? ? Y  ZN  .   ZN    ? ? ? 1_555 O  CYS 76   SG  ? ? N ZN  7158 N CYS 76   1_555 ? ? ? ? ? ? ?            2.322 ? 
metalc28  metalc ? ? Y  ZN  .   ZN    ? ? ? 1_555 O  CYS 58   SG  ? ? N ZN  7158 N CYS 58   1_555 ? ? ? ? ? ? ?            2.357 ? 
metalc29  metalc ? ? Y  ZN  .   ZN    ? ? ? 1_555 O  CYS 60   SG  ? ? N ZN  7158 N CYS 60   1_555 ? ? ? ? ? ? ?            2.454 ? 
metalc30  metalc ? ? Z  ZN  .   ZN    ? ? ? 1_555 O  CYS 1194 SG  ? ? N ZN  8212 N CYS 1194 1_555 ? ? ? ? ? ? ?            2.380 ? 
metalc31  metalc ? ? Z  ZN  .   ZN    ? ? ? 1_555 O  CYS 1201 SG  ? ? N ZN  8212 N CYS 1201 1_555 ? ? ? ? ? ? ?            2.350 ? 
metalc32  metalc ? ? Z  ZN  .   ZN    ? ? ? 1_555 O  CYS 1204 SG  ? ? N ZN  8212 N CYS 1204 1_555 ? ? ? ? ? ? ?            2.350 ? 
metalc33  metalc ? ? Z  ZN  .   ZN    ? ? ? 1_555 O  CYS 1112 SG  ? ? N ZN  8212 N CYS 1112 1_555 ? ? ? ? ? ? ?            2.361 ? 
metalc34  metalc ? ? AA MG  .   MG    ? ? ? 1_555 O  ASP 743  OD1 ? ? N MG  9003 N ASP 743  1_555 ? ? ? ? ? ? ?            2.639 ? 
metalc35  metalc ? ? AA MG  .   MG    ? ? ? 1_555 O  ASP 741  OD2 ? ? N MG  9003 N ASP 741  1_555 ? ? ? ? ? ? ?            2.909 ? 
metalc36  metalc ? ? BA MG  .   MG    ? ? ? 1_555 W  APC .    O1G ? ? N MG  9004 M APC 6999 1_555 ? ? ? ? ? ? ?            3.148 ? 
metalc37  metalc ? ? BA MG  .   MG    ? ? ? 1_555 W  APC .    O3B ? ? N MG  9004 M APC 6999 1_555 ? ? ? ? ? ? ?            3.135 ? 
hydrog1   hydrog ? ? A  DC  1   N3    ? ? ? 1_555 C  DG  14   N1  ? ? G DC  1    I DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ? ? A  DC  1   N4    ? ? ? 1_555 C  DG  14   O6  ? ? G DC  1    I DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ? ? A  DC  1   O2    ? ? ? 1_555 C  DG  14   N2  ? ? G DC  1    I DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ? ? A  DC  2   N3    ? ? ? 1_555 C  DG  13   N1  ? ? G DC  2    I DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ? ? A  DC  2   N4    ? ? ? 1_555 C  DG  13   O6  ? ? G DC  2    I DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ? ? A  DC  2   O2    ? ? ? 1_555 C  DG  13   N2  ? ? G DC  2    I DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ? ? A  DC  3   N3    ? ? ? 1_555 C  DG  12   N1  ? ? G DC  3    I DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ? ? A  DC  3   N4    ? ? ? 1_555 C  DG  12   O6  ? ? G DC  3    I DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ? ? A  DC  3   O2    ? ? ? 1_555 C  DG  12   N2  ? ? G DC  3    I DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ? ? A  DT  4   N3    ? ? ? 1_555 C  DA  11   N1  ? ? G DT  4    I DA  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ? ? A  DT  4   O4    ? ? ? 1_555 C  DA  11   N6  ? ? G DT  4    I DA  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ? ? A  DG  5   N1    ? ? ? 1_555 C  DC  10   N3  ? ? G DG  5    I DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ? ? A  DG  5   N2    ? ? ? 1_555 C  DC  10   O2  ? ? G DG  5    I DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ? ? A  DG  5   O6    ? ? ? 1_555 C  DC  10   N4  ? ? G DG  5    I DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ? ? A  DT  6   N3    ? ? ? 1_555 C  DA  9    N1  ? ? G DT  6    I DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ? ? A  DT  6   O4    ? ? ? 1_555 C  DA  9    N6  ? ? G DT  6    I DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ? ? A  DC  7   N3    ? ? ? 1_555 C  DG  8    N1  ? ? G DC  7    I DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ? ? A  DC  7   N4    ? ? ? 1_555 C  DG  8    O6  ? ? G DC  7    I DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ? ? A  DC  7   O2    ? ? ? 1_555 C  DG  8    N2  ? ? G DC  7    I DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ? ? A  DT  8   N3    ? ? ? 1_555 C  DA  7    N1  ? ? G DT  8    I DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ? ? A  DT  8   O4    ? ? ? 1_555 C  DA  7    N6  ? ? G DT  8    I DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ? ? A  DG  9   N1    ? ? ? 1_555 C  DC  6    N3  ? ? G DG  9    I DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ? ? A  DG  9   N2    ? ? ? 1_555 C  DC  6    O2  ? ? G DG  9    I DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ? ? A  DG  9   O6    ? ? ? 1_555 C  DC  6    N4  ? ? G DG  9    I DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ? ? A  DG  10  N1    ? ? ? 1_555 C  DC  5    N3  ? ? G DG  10   I DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ? ? A  DG  10  N2    ? ? ? 1_555 C  DC  5    O2  ? ? G DG  10   I DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ? ? A  DG  10  O6    ? ? ? 1_555 C  DC  5    N4  ? ? G DG  10   I DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ? ? A  DC  11  N3    ? ? ? 1_555 C  DG  4    N1  ? ? G DC  11   I DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ? ? A  DC  11  N4    ? ? ? 1_555 C  DG  4    O6  ? ? G DC  11   I DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ? ? A  DC  11  O2    ? ? ? 1_555 C  DG  4    N2  ? ? G DC  11   I DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ? ? A  DG  12  N1    ? ? ? 1_555 C  DC  3    N3  ? ? G DG  12   I DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ? ? A  DG  12  N2    ? ? ? 1_555 C  DC  3    O2  ? ? G DG  12   I DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ? ? A  DG  12  O6    ? ? ? 1_555 C  DC  3    N4  ? ? G DG  12   I DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ? ? A  DT  13  N3    ? ? ? 1_555 C  DA  2    N1  ? ? G DT  13   I DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ? ? A  DT  13  O4    ? ? ? 1_555 C  DA  2    N6  ? ? G DT  13   I DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ? ? A  DC  15  N3    ? ? ? 1_555 B  G   16   N1  ? ? G DC  15   H G   16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ? ? A  DC  15  N4    ? ? ? 1_555 B  G   16   O6  ? ? G DC  15   H G   16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ? ? A  DC  15  O2    ? ? ? 1_555 B  G   16   N2  ? ? G DC  15   H G   16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ? ? A  DG  16  N1    ? ? ? 1_555 B  C   15   N3  ? ? G DG  16   H C   15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ? ? A  DG  16  N2    ? ? ? 1_555 B  C   15   O2  ? ? G DG  16   H C   15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ? ? A  DG  16  O6    ? ? ? 1_555 B  C   15   N4  ? ? G DG  16   H C   15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ? ? A  DC  17  N3    ? ? ? 1_555 B  G   14   N1  ? ? G DC  17   H G   14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ? ? A  DC  17  N4    ? ? ? 1_555 B  G   14   O6  ? ? G DC  17   H G   14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ? ? A  DC  17  O2    ? ? ? 1_555 B  G   14   N2  ? ? G DC  17   H G   14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ? ? A  DG  18  N1    ? ? ? 1_555 B  C   13   N3  ? ? G DG  18   H C   13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ? ? A  DG  18  N2    ? ? ? 1_555 B  C   13   O2  ? ? G DG  18   H C   13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ? ? A  DG  18  O6    ? ? ? 1_555 B  C   13   N4  ? ? G DG  18   H C   13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ? ? A  DC  19  N3    ? ? ? 1_555 B  G   12   N1  ? ? G DC  19   H G   12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ? ? A  DC  19  N4    ? ? ? 1_555 B  G   12   O6  ? ? G DC  19   H G   12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ? ? A  DC  19  O2    ? ? ? 1_555 B  G   12   N2  ? ? G DC  19   H G   12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ? ? A  DG  20  N1    ? ? ? 1_555 B  C   11   N3  ? ? G DG  20   H C   11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ? ? A  DG  20  N2    ? ? ? 1_555 B  C   11   O2  ? ? G DG  20   H C   11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ? ? A  DG  20  O6    ? ? ? 1_555 B  C   11   N4  ? ? G DG  20   H C   11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ? ? A  DC  21  N3    ? ? ? 1_555 B  G   10   N1  ? ? G DC  21   H G   10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ? ? A  DC  21  N4    ? ? ? 1_555 B  G   10   O6  ? ? G DC  21   H G   10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ? ? A  DC  21  O2    ? ? ? 1_555 B  G   10   N2  ? ? G DC  21   H G   10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ? ? A  DC  22  N3    ? ? ? 1_555 B  G   9    N1  ? ? G DC  22   H G   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ? ? A  DC  22  N4    ? ? ? 1_555 B  G   9    O6  ? ? G DC  22   H G   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ? ? A  DC  22  O2    ? ? ? 1_555 B  G   9    N2  ? ? G DC  22   H G   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ? ? A  DG  23  N1    ? ? ? 1_555 B  C   8    N3  ? ? G DG  23   H C   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ? ? A  DG  23  N2    ? ? ? 1_555 B  C   8    O2  ? ? G DG  23   H C   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ? ? A  DG  23  O6    ? ? ? 1_555 B  C   8    N4  ? ? G DG  23   H C   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ? ? D  DC  1   N3    ? ? ? 1_555 F  DG  14   N1  ? ? X DC  1    Z DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ? ? D  DC  1   N4    ? ? ? 1_555 F  DG  14   O6  ? ? X DC  1    Z DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ? ? D  DC  1   O2    ? ? ? 1_555 F  DG  14   N2  ? ? X DC  1    Z DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ? ? D  DC  2   N3    ? ? ? 1_555 F  DG  13   N1  ? ? X DC  2    Z DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ? ? D  DC  2   N4    ? ? ? 1_555 F  DG  13   O6  ? ? X DC  2    Z DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ? ? D  DC  2   O2    ? ? ? 1_555 F  DG  13   N2  ? ? X DC  2    Z DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ? ? D  DC  3   N3    ? ? ? 1_555 F  DG  12   N1  ? ? X DC  3    Z DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ? ? D  DC  3   N4    ? ? ? 1_555 F  DG  12   O6  ? ? X DC  3    Z DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ? ? D  DC  3   O2    ? ? ? 1_555 F  DG  12   N2  ? ? X DC  3    Z DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ? ? D  DT  4   N3    ? ? ? 1_555 F  DA  11   N1  ? ? X DT  4    Z DA  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ? ? D  DT  4   O4    ? ? ? 1_555 F  DA  11   N6  ? ? X DT  4    Z DA  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ? ? D  DG  5   N1    ? ? ? 1_555 F  DC  10   N3  ? ? X DG  5    Z DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ? ? D  DG  5   N2    ? ? ? 1_555 F  DC  10   O2  ? ? X DG  5    Z DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ? ? D  DG  5   O6    ? ? ? 1_555 F  DC  10   N4  ? ? X DG  5    Z DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ? ? D  DT  6   N3    ? ? ? 1_555 F  DA  9    N1  ? ? X DT  6    Z DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ? ? D  DT  6   O4    ? ? ? 1_555 F  DA  9    N6  ? ? X DT  6    Z DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ? ? D  DC  7   N3    ? ? ? 1_555 F  DG  8    N1  ? ? X DC  7    Z DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ? ? D  DC  7   N4    ? ? ? 1_555 F  DG  8    O6  ? ? X DC  7    Z DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ? ? D  DC  7   O2    ? ? ? 1_555 F  DG  8    N2  ? ? X DC  7    Z DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ? ? D  DT  8   N3    ? ? ? 1_555 F  DA  7    N1  ? ? X DT  8    Z DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ? ? D  DT  8   O4    ? ? ? 1_555 F  DA  7    N6  ? ? X DT  8    Z DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ? ? D  DG  9   N1    ? ? ? 1_555 F  DC  6    N3  ? ? X DG  9    Z DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ? ? D  DG  9   N2    ? ? ? 1_555 F  DC  6    O2  ? ? X DG  9    Z DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ? ? D  DG  9   O6    ? ? ? 1_555 F  DC  6    N4  ? ? X DG  9    Z DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ? ? D  DG  10  N1    ? ? ? 1_555 F  DC  5    N3  ? ? X DG  10   Z DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ? ? D  DG  10  N2    ? ? ? 1_555 F  DC  5    O2  ? ? X DG  10   Z DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ? ? D  DG  10  O6    ? ? ? 1_555 F  DC  5    N4  ? ? X DG  10   Z DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ? ? D  DC  11  N3    ? ? ? 1_555 F  DG  4    N1  ? ? X DC  11   Z DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ? ? D  DC  11  N4    ? ? ? 1_555 F  DG  4    O6  ? ? X DC  11   Z DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ? ? D  DC  11  O2    ? ? ? 1_555 F  DG  4    N2  ? ? X DC  11   Z DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ? ? D  DG  12  N1    ? ? ? 1_555 F  DC  3    N3  ? ? X DG  12   Z DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ? ? D  DG  12  N2    ? ? ? 1_555 F  DC  3    O2  ? ? X DG  12   Z DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ? ? D  DG  12  O6    ? ? ? 1_555 F  DC  3    N4  ? ? X DG  12   Z DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ? ? D  DT  13  N3    ? ? ? 1_555 F  DA  2    N1  ? ? X DT  13   Z DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ? ? D  DT  13  O4    ? ? ? 1_555 F  DA  2    N6  ? ? X DT  13   Z DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ? ? D  DC  15  N3    ? ? ? 1_555 E  G   16   N1  ? ? X DC  15   Y G   16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ? ? D  DC  15  N4    ? ? ? 1_555 E  G   16   O6  ? ? X DC  15   Y G   16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ? ? D  DC  15  O2    ? ? ? 1_555 E  G   16   N2  ? ? X DC  15   Y G   16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ? ? D  DG  16  N1    ? ? ? 1_555 E  C   15   N3  ? ? X DG  16   Y C   15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ? ? D  DG  16  N2    ? ? ? 1_555 E  C   15   O2  ? ? X DG  16   Y C   15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ? ? D  DG  16  O6    ? ? ? 1_555 E  C   15   N4  ? ? X DG  16   Y C   15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog104 hydrog ? ? D  DC  17  N3    ? ? ? 1_555 E  G   14   N1  ? ? X DC  17   Y G   14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog105 hydrog ? ? D  DC  17  N4    ? ? ? 1_555 E  G   14   O6  ? ? X DC  17   Y G   14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog106 hydrog ? ? D  DC  17  O2    ? ? ? 1_555 E  G   14   N2  ? ? X DC  17   Y G   14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog107 hydrog ? ? D  DG  18  N1    ? ? ? 1_555 E  C   13   N3  ? ? X DG  18   Y C   13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog108 hydrog ? ? D  DG  18  N2    ? ? ? 1_555 E  C   13   O2  ? ? X DG  18   Y C   13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog109 hydrog ? ? D  DG  18  O6    ? ? ? 1_555 E  C   13   N4  ? ? X DG  18   Y C   13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog110 hydrog ? ? D  DC  19  N3    ? ? ? 1_555 E  G   12   N1  ? ? X DC  19   Y G   12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog111 hydrog ? ? D  DC  19  N4    ? ? ? 1_555 E  G   12   O6  ? ? X DC  19   Y G   12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog112 hydrog ? ? D  DC  19  O2    ? ? ? 1_555 E  G   12   N2  ? ? X DC  19   Y G   12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog113 hydrog ? ? D  DG  20  N1    ? ? ? 1_555 E  C   11   N3  ? ? X DG  20   Y C   11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog114 hydrog ? ? D  DG  20  N2    ? ? ? 1_555 E  C   11   O2  ? ? X DG  20   Y C   11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog115 hydrog ? ? D  DG  20  O6    ? ? ? 1_555 E  C   11   N4  ? ? X DG  20   Y C   11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog116 hydrog ? ? D  DC  21  N3    ? ? ? 1_555 E  G   10   N1  ? ? X DC  21   Y G   10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog117 hydrog ? ? D  DC  21  N4    ? ? ? 1_555 E  G   10   O6  ? ? X DC  21   Y G   10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog118 hydrog ? ? D  DC  21  O2    ? ? ? 1_555 E  G   10   N2  ? ? X DC  21   Y G   10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog119 hydrog ? ? D  DC  22  N3    ? ? ? 1_555 E  G   9    N1  ? ? X DC  22   Y G   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog120 hydrog ? ? D  DC  22  N4    ? ? ? 1_555 E  G   9    O6  ? ? X DC  22   Y G   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog121 hydrog ? ? D  DC  22  O2    ? ? ? 1_555 E  G   9    N2  ? ? X DC  22   Y G   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog122 hydrog ? ? D  DG  23  N1    ? ? ? 1_555 E  C   8    N3  ? ? X DG  23   Y C   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog123 hydrog ? ? D  DG  23  N2    ? ? ? 1_555 E  C   8    O2  ? ? X DG  23   Y C   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog124 hydrog ? ? D  DG  23  O6    ? ? ? 1_555 E  C   8    N4  ? ? X DG  23   Y C   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26  G . ? GLU 26  A PRO 27  G ? PRO 27  A 1 -0.21 
2 GLU 26  H . ? GLU 26  B PRO 27  H ? PRO 27  B 1 -0.46 
3 LEU 165 I . ? LEU 165 C PRO 166 I ? PRO 166 C 1 0.67  
4 GLU 26  L . ? GLU 26  K PRO 27  L ? PRO 27  K 1 -0.02 
5 GLU 26  M . ? GLU 26  L PRO 27  M ? PRO 27  L 1 0.02  
6 LEU 165 N . ? LEU 165 M PRO 166 N ? PRO 166 M 1 0.73  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 4 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 3 ? 
L  ? 4 ? 
M  ? 2 ? 
N  ? 3 ? 
O  ? 2 ? 
P  ? 4 ? 
Q  ? 2 ? 
R  ? 2 ? 
S  ? 6 ? 
T  ? 3 ? 
U  ? 3 ? 
V  ? 2 ? 
W  ? 8 ? 
X  ? 3 ? 
Y  ? 2 ? 
Z  ? 6 ? 
AA ? 3 ? 
AB ? 3 ? 
AC ? 2 ? 
AD ? 2 ? 
AE ? 4 ? 
AF ? 3 ? 
AG ? 2 ? 
AH ? 2 ? 
AI ? 2 ? 
AJ ? 3 ? 
AK ? 3 ? 
AL ? 2 ? 
AM ? 2 ? 
AN ? 3 ? 
AO ? 4 ? 
AP ? 3 ? 
AQ ? 2 ? 
AR ? 4 ? 
AS ? 4 ? 
AT ? 2 ? 
AU ? 2 ? 
AV ? 2 ? 
AW ? 4 ? 
AX ? 4 ? 
AY ? 2 ? 
AZ ? 2 ? 
BA ? 2 ? 
BB ? 3 ? 
BC ? 4 ? 
BD ? 2 ? 
BE ? 3 ? 
BF ? 2 ? 
BG ? 5 ? 
BH ? 2 ? 
BI ? 2 ? 
BJ ? 6 ? 
BK ? 3 ? 
BL ? 3 ? 
BM ? 2 ? 
BN ? 8 ? 
BO ? 3 ? 
BP ? 2 ? 
BQ ? 6 ? 
BR ? 3 ? 
BS ? 3 ? 
BT ? 2 ? 
BU ? 3 ? 
BV ? 4 ? 
BW ? 4 ? 
BX ? 2 ? 
BY ? 2 ? 
BZ ? 3 ? 
CA ? 2 ? 
CB ? 2 ? 
CC ? 2 ? 
CD ? 3 ? 
CE ? 4 ? 
CF ? 3 ? 
CG ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? parallel      
K  2 3 ? parallel      
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
Q  1 2 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? parallel      
S  4 5 ? anti-parallel 
S  5 6 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
W  4 5 ? parallel      
W  5 6 ? anti-parallel 
W  6 7 ? parallel      
W  7 8 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
Z  4 5 ? anti-parallel 
Z  5 6 ? parallel      
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? parallel      
AJ 2 3 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AT 1 2 ? anti-parallel 
AU 1 2 ? anti-parallel 
AV 1 2 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AW 3 4 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AY 1 2 ? anti-parallel 
AZ 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BB 1 2 ? parallel      
BB 2 3 ? parallel      
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BD 1 2 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BF 1 2 ? anti-parallel 
BG 1 2 ? anti-parallel 
BG 2 3 ? anti-parallel 
BG 3 4 ? anti-parallel 
BG 4 5 ? anti-parallel 
BH 1 2 ? anti-parallel 
BI 1 2 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BJ 2 3 ? anti-parallel 
BJ 3 4 ? parallel      
BJ 4 5 ? anti-parallel 
BJ 5 6 ? anti-parallel 
BK 1 2 ? anti-parallel 
BK 2 3 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BM 1 2 ? anti-parallel 
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BN 3 4 ? anti-parallel 
BN 4 5 ? parallel      
BN 5 6 ? anti-parallel 
BN 6 7 ? parallel      
BN 7 8 ? anti-parallel 
BO 1 2 ? anti-parallel 
BO 2 3 ? anti-parallel 
BP 1 2 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BQ 2 3 ? anti-parallel 
BQ 3 4 ? anti-parallel 
BQ 4 5 ? anti-parallel 
BQ 5 6 ? parallel      
BR 1 2 ? anti-parallel 
BR 2 3 ? parallel      
BS 1 2 ? anti-parallel 
BS 2 3 ? anti-parallel 
BT 1 2 ? anti-parallel 
BU 1 2 ? anti-parallel 
BU 2 3 ? anti-parallel 
BV 1 2 ? anti-parallel 
BV 2 3 ? anti-parallel 
BV 3 4 ? anti-parallel 
BW 1 2 ? anti-parallel 
BW 2 3 ? anti-parallel 
BW 3 4 ? anti-parallel 
BX 1 2 ? anti-parallel 
BY 1 2 ? anti-parallel 
BZ 1 2 ? parallel      
BZ 2 3 ? anti-parallel 
CA 1 2 ? anti-parallel 
CB 1 2 ? anti-parallel 
CC 1 2 ? anti-parallel 
CD 1 2 ? anti-parallel 
CD 2 3 ? anti-parallel 
CE 1 2 ? anti-parallel 
CE 2 3 ? anti-parallel 
CE 3 4 ? anti-parallel 
CF 1 2 ? anti-parallel 
CF 2 3 ? anti-parallel 
CG 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL G 10   ? GLN G 16   ? VAL A 10   GLN A 16   
A  2 TYR G 20   ? LEU G 28   ? TYR A 20   LEU A 28   
A  3 ASP G 193  ? THR G 201  ? ASP A 193  THR A 201  
A  4 VAL G 174  ? VAL G 181  ? VAL A 174  VAL A 181  
B  1 THR G 96   ? GLU G 104  ? THR A 96   GLU A 104  
B  2 ARG G 137  ? GLY G 147  ? ARG A 137  GLY A 147  
B  3 GLY G 50   ? ILE G 58   ? GLY A 50   ILE A 58   
B  4 ILE G 165  ? PRO G 166  ? ILE A 165  PRO A 166  
C  1 VAL G 87   ? PHE G 89   ? VAL A 87   PHE A 89   
C  2 VAL G 120  ? ILE G 122  ? VAL A 120  ILE A 122  
D  1 GLU G 108  ? LYS G 110  ? GLU A 108  LYS A 110  
D  2 HIS G 128  ? THR G 131  ? HIS A 128  THR A 131  
E  1 TYR G 150  ? VAL G 151  ? TYR A 150  VAL A 151  
E  2 ALA G 169  ? VAL G 170  ? ALA A 169  VAL A 170  
F  1 VAL H 10   ? GLN H 16   ? VAL B 10   GLN B 16   
F  2 TYR H 20   ? LEU H 28   ? TYR B 20   LEU B 28   
F  3 ASP H 193  ? THR H 201  ? ASP B 193  THR B 201  
F  4 VAL H 174  ? VAL H 181  ? VAL B 174  VAL B 181  
G  1 THR H 96   ? GLU H 104  ? THR B 96   GLU B 104  
G  2 ARG H 137  ? GLY H 147  ? ARG B 137  GLY B 147  
G  3 GLY H 50   ? ILE H 58   ? GLY B 50   ILE B 58   
G  4 ILE H 165  ? PRO H 166  ? ILE B 165  PRO B 166  
H  1 VAL H 87   ? PHE H 89   ? VAL B 87   PHE B 89   
H  2 VAL H 120  ? ILE H 122  ? VAL B 120  ILE B 122  
I  1 GLU H 108  ? LYS H 110  ? GLU B 108  LYS B 110  
I  2 HIS H 128  ? THR H 131  ? HIS B 128  THR B 131  
J  1 TYR H 150  ? VAL H 151  ? TYR B 150  VAL B 151  
J  2 ALA H 169  ? VAL H 170  ? ALA B 169  VAL B 170  
K  1 GLU I 2    ? LYS I 4    ? GLU C 2    LYS C 4    
K  2 GLN I 899  ? ILE I 902  ? GLN C 899  ILE C 902  
K  3 VAL I 579  ? MET I 580  ? VAL C 579  MET C 580  
L  1 ILE I 54   ? GLU I 56   ? ILE C 54   GLU C 56   
L  2 LEU I 64   ? PHE I 68   ? LEU C 64   PHE C 68   
L  3 LEU I 98   ? ILE I 101  ? LEU C 98   ILE C 101  
L  4 LEU I 107  ? ILE I 108  ? LEU C 107  ILE C 108  
M  1 GLN I 91   ? PRO I 93   ? GLN C 91   PRO C 93   
M  2 HIS I 117  ? PRO I 119  ? HIS C 117  PRO C 119  
N  1 PHE I 127  ? ILE I 128  ? PHE C 127  ILE C 128  
N  2 ASP I 133  ? ILE I 136  ? ASP C 133  ILE C 136  
N  3 SER I 392  ? PHE I 394  ? SER C 392  PHE C 394  
O  1 GLN I 139  ? ARG I 142  ? GLN C 139  ARG C 142  
O  2 ARG I 331  ? ARG I 334  ? ARG C 331  ARG C 334  
P  1 VAL I 146  ? THR I 149  ? VAL C 146  THR C 149  
P  2 ILE I 159  ? ILE I 162  ? ILE C 159  ILE C 162  
P  3 ILE I 172  ? GLU I 177  ? ILE C 172  GLU C 177  
P  4 VAL I 181  ? MET I 184  ? VAL C 181  MET C 184  
Q  1 ARG I 409  ? SER I 411  ? ARG C 409  SER C 411  
Q  2 ILE I 452  ? SER I 454  ? ILE C 452  SER C 454  
R  1 ARG I 460  ? VAL I 461  ? ARG C 460  VAL C 461  
R  2 ILE I 467  ? ARG I 468  ? ILE C 467  ARG C 468  
S  1 VAL I 478  ? VAL I 483  ? VAL C 478  VAL C 483  
S  2 TYR I 471  ? VAL I 475  ? TYR C 471  VAL C 475  
S  3 PHE I 531  ? ASP I 533  ? PHE C 531  ASP C 533  
S  4 ILE I 496  ? ALA I 497  ? ILE C 496  ALA C 497  
S  5 VAL I 513  ? ARG I 516  ? VAL C 513  ARG C 516  
S  6 PRO I 521  ? VAL I 524  ? PRO C 521  VAL C 524  
T  1 LEU I 595  ? TYR I 596  ? LEU C 595  TYR C 596  
T  2 LEU I 654  ? ASP I 657  ? LEU C 654  ASP C 657  
T  3 ARG I 640  ? PRO I 641  ? ARG C 640  PRO C 641  
U  1 GLY I 601  ? VAL I 606  ? GLY C 601  VAL C 606  
U  2 ILE I 611  ? TYR I 615  ? ILE C 611  TYR C 615  
U  3 LEU I 620  ? VAL I 621  ? LEU C 620  VAL C 621  
V  1 TYR I 629  ? ARG I 630  ? TYR C 629  ARG C 630  
V  2 ALA I 636  ? LEU I 637  ? ALA C 636  LEU C 637  
W  1 LYS I 971  ? VAL I 972  ? LYS C 971  VAL C 972  
W  2 ILE I 987  ? LYS I 996  ? ILE C 987  LYS C 996  
W  3 LYS I 838  ? ALA I 840  ? LYS C 838  ALA C 840  
W  4 LYS I 846  ? LEU I 853  ? LYS C 846  LEU C 853  
W  5 ALA I 687  ? SER I 691  ? ALA C 687  SER C 691  
W  6 VAL I 869  ? LEU I 871  ? VAL C 869  LEU C 871  
W  7 GLN I 670  ? ALA I 675  ? GLN C 670  ALA C 675  
W  8 ILE I 987  ? LYS I 996  ? ILE C 987  LYS C 996  
X  1 THR I 701  ? ARG I 713  ? THR C 701  ARG C 713  
X  2 VAL I 819  ? LYS I 832  ? VAL C 819  LYS C 832  
X  3 ILE I 799  ? LEU I 806  ? ILE C 799  LEU C 806  
Y  1 THR I 759  ? PHE I 761  ? THR C 759  PHE C 761  
Y  2 VAL I 785  ? ASP I 787  ? VAL C 785  ASP C 787  
Z  1 HIS I 1006 ? ARG I 1008 ? HIS C 1006 ARG C 1008 
Z  2 SER J 626  ? VAL J 633  ? SER D 626  VAL D 633  
Z  3 GLN J 744  ? HIS J 748  ? GLN D 744  HIS D 748  
Z  4 VAL J 700  ? ASN J 703  ? VAL D 700  ASN D 703  
Z  5 ILE J 713  ? PRO J 718  ? ILE D 713  PRO D 718  
Z  6 GLN J 641  ? CYS J 642  ? GLN D 641  CYS D 642  
AA 1 HIS I 1006 ? ARG I 1008 ? HIS C 1006 ARG C 1008 
AA 2 SER J 626  ? VAL J 633  ? SER D 626  VAL D 633  
AA 3 ILE J 726  ? LEU J 728  ? ILE D 726  LEU D 728  
AB 1 ASP I 1098 ? LEU I 1102 ? ASP C 1098 LEU C 1102 
AB 2 LYS J 7    ? ALA J 11   ? LYS D 7    ALA D 11   
AB 3 LYS J 1455 ? GLU J 1458 ? LYS D 1455 GLU D 1458 
AC 1 GLY J 91   ? ALA J 100  ? GLY D 91   ALA D 100  
AC 2 ILE J 513  ? VAL J 519  ? ILE D 513  VAL D 519  
AD 1 ILE J 133  ? VAL J 134  ? ILE D 133  VAL D 134  
AD 2 ARG J 455  ? MET J 456  ? ARG D 455  MET D 456  
AE 1 GLU J 167  ? PRO J 170  ? GLU D 167  PRO D 170  
AE 2 SER J 392  ? VAL J 396  ? SER D 392  VAL D 396  
AE 3 GLY J 201  ? ARG J 206  ? GLY D 201  ARG D 206  
AE 4 GLU J 184  ? VAL J 185  ? GLU D 184  VAL D 185  
AF 1 ALA J 398  ? PRO J 402  ? ALA D 398  PRO D 402  
AF 2 VAL J 443  ? VAL J 447  ? VAL D 443  VAL D 447  
AF 3 GLU J 436  ? ASP J 438  ? GLU D 436  ASP D 438  
AG 1 ARG J 414  ? VAL J 415  ? ARG D 414  VAL D 415  
AG 2 GLY J 433  ? ARG J 434  ? GLY D 433  ARG D 434  
AH 1 VAL J 420  ? ALA J 422  ? VAL D 420  ALA D 422  
AH 2 VAL J 427  ? LYS J 428  ? VAL D 427  LYS D 428  
AI 1 VAL J 528  ? GLN J 529  ? VAL D 528  GLN D 529  
AI 2 PHE J 535  ? ALA J 536  ? PHE D 535  ALA D 536  
AJ 1 VAL J 842  ? PHE J 843  ? VAL D 842  PHE D 843  
AJ 2 THR J 865  ? ARG J 867  ? THR D 865  ARG D 867  
AJ 3 ARG J 872  ? LEU J 873  ? ARG D 872  LEU D 873  
AK 1 ILE J 1118 ? SER J 1119 ? ILE D 1118 SER D 1119 
AK 2 PRO J 1187 ? ARG J 1189 ? PRO D 1187 ARG D 1189 
AK 3 VAL J 1148 ? LEU J 1149 ? VAL D 1148 LEU D 1149 
AL 1 PHE J 1123 ? GLN J 1124 ? PHE D 1123 GLN D 1124 
AL 2 ARG J 1133 ? LEU J 1134 ? ARG D 1133 LEU D 1134 
AM 1 VAL J 1153 ? GLU J 1154 ? VAL D 1153 GLU D 1154 
AM 2 ARG J 1159 ? LEU J 1160 ? ARG D 1159 LEU D 1160 
AN 1 SER J 1300 ? LYS J 1301 ? SER D 1300 LYS D 1301 
AN 2 LEU J 1290 ? GLU J 1295 ? LEU D 1290 GLU D 1295 
AN 3 LYS J 1304 ? LEU J 1305 ? LYS D 1304 LEU D 1305 
AO 1 SER J 1300 ? LYS J 1301 ? SER D 1300 LYS D 1301 
AO 2 LEU J 1290 ? GLU J 1295 ? LEU D 1290 GLU D 1295 
AO 3 GLY J 1279 ? ILE J 1283 ? GLY D 1279 ILE D 1283 
AO 4 TYR J 1318 ? VAL J 1319 ? TYR D 1318 VAL D 1319 
AP 1 GLY J 1392 ? VAL J 1394 ? GLY D 1392 VAL D 1394 
AP 2 TYR J 1378 ? ASP J 1383 ? TYR D 1378 ASP D 1383 
AP 3 ALA J 1416 ? LEU J 1420 ? ALA D 1416 LEU D 1420 
AQ 1 GLN J 1485 ? ASP J 1488 ? GLN D 1485 ASP D 1488 
AQ 2 LEU K 73   ? GLY K 76   ? LEU E 73   GLY E 76   
AR 1 VAL L 10   ? GLN L 16   ? VAL K 10   GLN K 16   
AR 2 TYR L 20   ? LEU L 28   ? TYR K 20   LEU K 28   
AR 3 ASP L 193  ? THR L 201  ? ASP K 193  THR K 201  
AR 4 VAL L 174  ? VAL L 181  ? VAL K 174  VAL K 181  
AS 1 THR L 96   ? GLU L 104  ? THR K 96   GLU K 104  
AS 2 ARG L 137  ? VAL L 148  ? ARG K 137  VAL K 148  
AS 3 PRO L 49   ? ILE L 58   ? PRO K 49   ILE K 58   
AS 4 ILE L 165  ? PRO L 166  ? ILE K 165  PRO K 166  
AT 1 VAL L 87   ? PHE L 89   ? VAL K 87   PHE K 89   
AT 2 VAL L 120  ? ILE L 122  ? VAL K 120  ILE K 122  
AU 1 GLU L 108  ? LYS L 110  ? GLU K 108  LYS K 110  
AU 2 HIS L 128  ? THR L 131  ? HIS K 128  THR K 131  
AV 1 TYR L 150  ? VAL L 151  ? TYR K 150  VAL K 151  
AV 2 ALA L 169  ? VAL L 170  ? ALA K 169  VAL K 170  
AW 1 VAL M 10   ? GLN M 16   ? VAL L 10   GLN L 16   
AW 2 TYR M 20   ? LEU M 28   ? TYR L 20   LEU L 28   
AW 3 ASP M 193  ? THR M 201  ? ASP L 193  THR L 201  
AW 4 VAL M 174  ? VAL M 181  ? VAL L 174  VAL L 181  
AX 1 THR M 96   ? GLU M 104  ? THR L 96   GLU L 104  
AX 2 ARG M 137  ? VAL M 148  ? ARG L 137  VAL L 148  
AX 3 PRO M 49   ? ILE M 58   ? PRO L 49   ILE L 58   
AX 4 ILE M 165  ? PRO M 166  ? ILE L 165  PRO L 166  
AY 1 VAL M 87   ? PHE M 89   ? VAL L 87   PHE L 89   
AY 2 VAL M 120  ? ILE M 122  ? VAL L 120  ILE L 122  
AZ 1 GLU M 108  ? LYS M 110  ? GLU L 108  LYS L 110  
AZ 2 HIS M 128  ? THR M 131  ? HIS L 128  THR L 131  
BA 1 TYR M 150  ? VAL M 151  ? TYR L 150  VAL L 151  
BA 2 ALA M 169  ? VAL M 170  ? ALA L 169  VAL L 170  
BB 1 GLU N 2    ? LYS N 4    ? GLU M 2    LYS M 4    
BB 2 GLN N 899  ? ILE N 902  ? GLN M 899  ILE M 902  
BB 3 VAL N 579  ? MET N 580  ? VAL M 579  MET M 580  
BC 1 ILE N 54   ? GLU N 56   ? ILE M 54   GLU M 56   
BC 2 LEU N 64   ? PHE N 68   ? LEU M 64   PHE M 68   
BC 3 LEU N 98   ? ILE N 101  ? LEU M 98   ILE M 101  
BC 4 LEU N 107  ? LYS N 109  ? LEU M 107  LYS M 109  
BD 1 GLN N 91   ? PRO N 93   ? GLN M 91   PRO M 93   
BD 2 HIS N 117  ? PRO N 119  ? HIS M 117  PRO M 119  
BE 1 PHE N 127  ? ILE N 128  ? PHE M 127  ILE M 128  
BE 2 ASP N 133  ? ILE N 136  ? ASP M 133  ILE M 136  
BE 3 SER N 392  ? PHE N 394  ? SER M 392  PHE M 394  
BF 1 ILE N 140  ? ARG N 142  ? ILE M 140  ARG M 142  
BF 2 ARG N 331  ? ILE N 333  ? ARG M 331  ILE M 333  
BG 1 VAL N 146  ? THR N 149  ? VAL M 146  THR M 149  
BG 2 ILE N 159  ? ILE N 162  ? ILE M 159  ILE M 162  
BG 3 ILE N 172  ? GLU N 177  ? ILE M 172  GLU M 177  
BG 4 VAL N 181  ? LYS N 185  ? VAL M 181  LYS M 185  
BG 5 LYS N 190  ? PHE N 191  ? LYS M 190  PHE M 191  
BH 1 ARG N 409  ? SER N 411  ? ARG M 409  SER M 411  
BH 2 ILE N 452  ? SER N 454  ? ILE M 452  SER M 454  
BI 1 ARG N 460  ? VAL N 461  ? ARG M 460  VAL M 461  
BI 2 ILE N 467  ? ARG N 468  ? ILE M 467  ARG M 468  
BJ 1 VAL N 478  ? VAL N 483  ? VAL M 478  VAL M 483  
BJ 2 TYR N 471  ? VAL N 475  ? TYR M 471  VAL M 475  
BJ 3 PHE N 531  ? ASP N 533  ? PHE M 531  ASP M 533  
BJ 4 ILE N 496  ? ALA N 497  ? ILE M 496  ALA M 497  
BJ 5 VAL N 513  ? ARG N 516  ? VAL M 513  ARG M 516  
BJ 6 PRO N 521  ? VAL N 524  ? PRO M 521  VAL M 524  
BK 1 LEU N 595  ? TYR N 596  ? LEU M 595  TYR M 596  
BK 2 LEU N 654  ? ASP N 657  ? LEU M 654  ASP M 657  
BK 3 ARG N 640  ? PRO N 641  ? ARG M 640  PRO M 641  
BL 1 GLY N 601  ? VAL N 606  ? GLY M 601  VAL M 606  
BL 2 ILE N 611  ? TYR N 615  ? ILE M 611  TYR M 615  
BL 3 LEU N 620  ? VAL N 621  ? LEU M 620  VAL M 621  
BM 1 TYR N 629  ? ARG N 630  ? TYR M 629  ARG M 630  
BM 2 ALA N 636  ? LEU N 637  ? ALA M 636  LEU M 637  
BN 1 LYS N 971  ? VAL N 972  ? LYS M 971  VAL M 972  
BN 2 ILE N 987  ? LYS N 996  ? ILE M 987  LYS M 996  
BN 3 LYS N 838  ? ALA N 840  ? LYS M 838  ALA M 840  
BN 4 LYS N 846  ? LEU N 853  ? LYS M 846  LEU M 853  
BN 5 ALA N 687  ? SER N 691  ? ALA M 687  SER M 691  
BN 6 VAL N 869  ? LEU N 871  ? VAL M 869  LEU M 871  
BN 7 GLN N 670  ? ALA N 675  ? GLN M 670  ALA M 675  
BN 8 ILE N 987  ? LYS N 996  ? ILE M 987  LYS M 996  
BO 1 THR N 701  ? ARG N 713  ? THR M 701  ARG M 713  
BO 2 VAL N 819  ? LYS N 832  ? VAL M 819  LYS M 832  
BO 3 ILE N 799  ? LEU N 806  ? ILE M 799  LEU M 806  
BP 1 THR N 759  ? PHE N 761  ? THR M 759  PHE M 761  
BP 2 VAL N 785  ? ASP N 787  ? VAL M 785  ASP M 787  
BQ 1 HIS N 1006 ? ARG N 1008 ? HIS M 1006 ARG M 1008 
BQ 2 SER O 626  ? VAL O 633  ? SER N 626  VAL N 633  
BQ 3 GLN O 744  ? HIS O 748  ? GLN N 744  HIS N 748  
BQ 4 VAL O 700  ? ASN O 703  ? VAL N 700  ASN N 703  
BQ 5 ILE O 713  ? PRO O 718  ? ILE N 713  PRO N 718  
BQ 6 GLN O 641  ? CYS O 642  ? GLN N 641  CYS N 642  
BR 1 HIS N 1006 ? ARG N 1008 ? HIS M 1006 ARG M 1008 
BR 2 SER O 626  ? VAL O 633  ? SER N 626  VAL N 633  
BR 3 ILE O 726  ? LEU O 728  ? ILE N 726  LEU N 728  
BS 1 ASP N 1098 ? VAL N 1099 ? ASP M 1098 VAL M 1099 
BS 2 LYS O 7    ? ALA O 11   ? LYS N 7    ALA N 11   
BS 3 LYS O 1455 ? GLU O 1458 ? LYS N 1455 GLU N 1458 
BT 1 GLY O 91   ? ALA O 100  ? GLY N 91   ALA N 100  
BT 2 ILE O 513  ? VAL O 519  ? ILE N 513  VAL N 519  
BU 1 LEU O 152  ? LEU O 153  ? LEU N 152  LEU N 153  
BU 2 ILE O 133  ? LEU O 135  ? ILE N 133  LEU N 135  
BU 3 ALA O 454  ? MET O 456  ? ALA N 454  MET N 456  
BV 1 GLU O 167  ? PRO O 170  ? GLU N 167  PRO N 170  
BV 2 SER O 392  ? VAL O 396  ? SER N 392  VAL N 396  
BV 3 GLY O 201  ? ARG O 206  ? GLY N 201  ARG N 206  
BV 4 GLU O 184  ? VAL O 185  ? GLU N 184  VAL N 185  
BW 1 ALA O 398  ? PRO O 402  ? ALA N 398  PRO N 402  
BW 2 VAL O 443  ? VAL O 447  ? VAL N 443  VAL N 447  
BW 3 GLY O 433  ? ASP O 438  ? GLY N 433  ASP N 438  
BW 4 ARG O 414  ? VAL O 415  ? ARG N 414  VAL N 415  
BX 1 VAL O 420  ? ALA O 422  ? VAL N 420  ALA N 422  
BX 2 VAL O 427  ? LYS O 428  ? VAL N 427  LYS N 428  
BY 1 MET O 527  ? GLN O 529  ? MET N 527  GLN N 529  
BY 2 PHE O 535  ? THR O 537  ? PHE N 535  THR N 537  
BZ 1 VAL O 842  ? PHE O 843  ? VAL N 842  PHE N 843  
BZ 2 THR O 865  ? ARG O 867  ? THR N 865  ARG N 867  
BZ 3 ARG O 872  ? LEU O 873  ? ARG N 872  LEU N 873  
CA 1 ILE O 1118 ? SER O 1119 ? ILE N 1118 SER N 1119 
CA 2 PRO O 1187 ? VAL O 1188 ? PRO N 1187 VAL N 1188 
CB 1 PHE O 1123 ? GLN O 1124 ? PHE N 1123 GLN N 1124 
CB 2 ARG O 1133 ? LEU O 1134 ? ARG N 1133 LEU N 1134 
CC 1 VAL O 1153 ? GLU O 1154 ? VAL N 1153 GLU N 1154 
CC 2 ARG O 1159 ? LEU O 1160 ? ARG N 1159 LEU N 1160 
CD 1 SER O 1300 ? LYS O 1301 ? SER N 1300 LYS N 1301 
CD 2 LEU O 1290 ? GLU O 1295 ? LEU N 1290 GLU N 1295 
CD 3 LYS O 1304 ? LEU O 1305 ? LYS N 1304 LEU N 1305 
CE 1 SER O 1300 ? LYS O 1301 ? SER N 1300 LYS N 1301 
CE 2 LEU O 1290 ? GLU O 1295 ? LEU N 1290 GLU N 1295 
CE 3 GLY O 1279 ? ILE O 1283 ? GLY N 1279 ILE N 1283 
CE 4 TYR O 1318 ? VAL O 1319 ? TYR N 1318 VAL N 1319 
CF 1 GLY O 1392 ? VAL O 1394 ? GLY N 1392 VAL N 1394 
CF 2 TYR O 1378 ? ASP O 1383 ? TYR N 1378 ASP N 1383 
CF 3 ALA O 1416 ? PRO O 1419 ? ALA N 1416 PRO N 1419 
CG 1 GLN O 1485 ? ASP O 1488 ? GLN N 1485 ASP N 1488 
CG 2 LEU P 73   ? GLY P 76   ? LEU O 73   GLY O 76   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N VAL G 10   ? N VAL A 10   O GLU G 26   ? O GLU A 26   
A  2 3 N PHE G 23   ? N PHE A 23   O LEU G 197  ? O LEU A 197  
A  3 4 O ARG G 198  ? O ARG A 198  N ALA G 178  ? N ALA A 178  
B  1 2 N LEU G 101  ? N LEU A 101  O MET G 140  ? O MET A 140  
B  2 3 O GLY G 147  ? O GLY A 147  N GLY G 50   ? N GLY A 50   
B  3 4 N VAL G 56   ? N VAL A 56   O ILE G 165  ? O ILE A 165  
C  1 2 N ARG G 88   ? N ARG A 88   O GLU G 121  ? O GLU A 121  
D  1 2 N VAL G 109  ? N VAL A 109  O ALA G 130  ? O ALA A 130  
E  1 2 N VAL G 151  ? N VAL A 151  O ALA G 169  ? O ALA A 169  
F  1 2 N VAL H 10   ? N VAL B 10   O GLU H 26   ? O GLU B 26   
F  2 3 N PHE H 23   ? N PHE B 23   O LEU H 197  ? O LEU B 197  
F  3 4 O ARG H 198  ? O ARG B 198  N ALA H 178  ? N ALA B 178  
G  1 2 N LEU H 101  ? N LEU B 101  O MET H 140  ? O MET B 140  
G  2 3 O GLY H 147  ? O GLY B 147  N GLY H 50   ? N GLY B 50   
G  3 4 N VAL H 56   ? N VAL B 56   O ILE H 165  ? O ILE B 165  
H  1 2 N ARG H 88   ? N ARG B 88   O GLU H 121  ? O GLU B 121  
I  1 2 N VAL H 109  ? N VAL B 109  O ALA H 130  ? O ALA B 130  
J  1 2 N VAL H 151  ? N VAL B 151  O ALA H 169  ? O ALA B 169  
K  1 2 N GLU I 2    ? N GLU C 2    O ARG I 900  ? O ARG C 900  
K  2 3 O TYR I 901  ? O TYR C 901  N MET I 580  ? N MET C 580  
L  1 2 N GLU I 56   ? N GLU C 56   O LEU I 64   ? O LEU C 64   
L  2 3 N VAL I 65   ? N VAL C 65   O ILE I 101  ? O ILE C 101  
L  3 4 N LEU I 100  ? N LEU C 100  O ILE I 108  ? O ILE C 108  
M  1 2 N ALA I 92   ? N ALA C 92   O ILE I 118  ? O ILE C 118  
N  1 2 N PHE I 127  ? N PHE C 127  O ARG I 134  ? O ARG C 134  
N  2 3 N VAL I 135  ? N VAL C 135  O GLN I 393  ? O GLN C 393  
O  1 2 N GLN I 139  ? N GLN C 139  O ARG I 334  ? O ARG C 334  
P  1 2 N THR I 149  ? N THR C 149  O ILE I 159  ? O ILE C 159  
P  2 3 N ILE I 162  ? N ILE C 162  O ILE I 172  ? O ILE C 172  
P  3 4 N GLU I 175  ? N GLU C 175  O SER I 183  ? O SER C 183  
Q  1 2 N ILE I 410  ? N ILE C 410  O THR I 453  ? O THR C 453  
R  1 2 N ARG I 460  ? N ARG C 460  O ARG I 468  ? O ARG C 468  
S  1 2 O THR I 480  ? O THR C 480  N ARG I 473  ? N ARG C 473  
S  2 3 N ARG I 472  ? N ARG C 472  O MET I 532  ? O MET C 532  
S  3 4 O ASP I 533  ? O ASP C 533  N ALA I 497  ? N ALA C 497  
S  4 5 N ILE I 496  ? N ILE C 496  O ARG I 516  ? O ARG C 516  
S  5 6 N ALA I 515  ? N ALA C 515  O VAL I 522  ? O VAL C 522  
T  1 2 N LEU I 595  ? N LEU C 595  O LEU I 655  ? O LEU C 655  
T  2 3 O ASP I 657  ? O ASP C 657  N ARG I 640  ? N ARG C 640  
U  1 2 N GLU I 602  ? N GLU C 602  O ARG I 614  ? O ARG C 614  
U  2 3 N VAL I 613  ? N VAL C 613  O VAL I 621  ? O VAL C 621  
V  1 2 N TYR I 629  ? N TYR C 629  O LEU I 637  ? O LEU C 637  
W  1 2 N VAL I 972  ? N VAL C 972  O ILE I 987  ? O ILE C 987  
W  2 3 O MET I 995  ? O MET C 995  N ALA I 840  ? N ALA C 840  
W  3 4 N LEU I 839  ? N LEU C 839  O GLY I 847  ? O GLY C 847  
W  4 5 O VAL I 848  ? O VAL C 848  N ILE I 688  ? N ILE C 688  
W  5 6 N VAL I 689  ? N VAL C 689  O ILE I 870  ? O ILE C 870  
W  6 7 O VAL I 869  ? O VAL C 869  N ALA I 675  ? N ALA C 675  
W  7 8 N VAL I 674  ? N VAL C 674  O GLY I 990  ? O GLY C 990  
X  1 2 N ALA I 712  ? N ALA C 712  O GLU I 821  ? O GLU C 821  
X  2 3 O ALA I 828  ? O ALA C 828  N ILE I 799  ? N ILE C 799  
Y  1 2 N SER I 760  ? N SER C 760  O LYS I 786  ? O LYS C 786  
Z  1 2 N ARG I 1008 ? N ARG C 1008 O SER J 626  ? O SER D 626  
Z  2 3 N GLY J 627  ? N GLY D 627  O VAL J 747  ? O VAL D 747  
Z  3 4 O ALA J 746  ? O ALA D 746  N ASN J 703  ? N ASN D 703  
Z  4 5 N LEU J 702  ? N LEU D 702  O GLN J 714  ? O GLN D 714  
Z  5 6 O GLN J 717  ? O GLN D 717  N CYS J 642  ? N CYS D 642  
AA 1 2 N ARG I 1008 ? N ARG C 1008 O SER J 626  ? O SER D 626  
AA 2 3 N VAL J 632  ? N VAL D 632  O ILE J 726  ? O ILE D 726  
AB 1 2 N ASP I 1098 ? N ASP C 1098 O ALA J 11   ? O ALA D 11   
AB 2 3 N VAL J 8    ? N VAL D 8    O ASP J 1457 ? O ASP D 1457 
AC 1 2 N ALA J 99   ? N ALA D 99   O LEU J 514  ? O LEU D 514  
AD 1 2 N VAL J 134  ? N VAL D 134  O ARG J 455  ? O ARG D 455  
AE 1 2 N TYR J 169  ? N TYR D 169  O ILE J 393  ? O ILE D 393  
AE 2 3 O SER J 392  ? O SER D 392  N ARG J 206  ? N ARG D 206  
AE 3 4 O GLY J 201  ? O GLY D 201  N VAL J 185  ? N VAL D 185  
AF 1 2 N TYR J 401  ? N TYR D 401  O VAL J 444  ? O VAL D 444  
AF 2 3 O VAL J 443  ? O VAL D 443  N ASP J 438  ? N ASP D 438  
AG 1 2 N VAL J 415  ? N VAL D 415  O GLY J 433  ? O GLY D 433  
AH 1 2 N LEU J 421  ? N LEU D 421  O VAL J 427  ? O VAL D 427  
AI 1 2 N VAL J 528  ? N VAL D 528  O ALA J 536  ? O ALA D 536  
AJ 1 2 N PHE J 843  ? N PHE D 843  O ARG J 867  ? O ARG D 867  
AJ 2 3 N VAL J 866  ? N VAL D 866  O LEU J 873  ? O LEU D 873  
AK 1 2 N ILE J 1118 ? N ILE D 1118 O VAL J 1188 ? O VAL D 1188 
AK 2 3 O ARG J 1189 ? O ARG D 1189 N VAL J 1148 ? N VAL D 1148 
AL 1 2 N GLN J 1124 ? N GLN D 1124 O ARG J 1133 ? O ARG D 1133 
AM 1 2 N VAL J 1153 ? N VAL D 1153 O LEU J 1160 ? O LEU D 1160 
AN 1 2 O LYS J 1301 ? O LYS D 1301 N VAL J 1294 ? N VAL D 1294 
AN 2 3 N LEU J 1290 ? N LEU D 1290 O LEU J 1305 ? O LEU D 1305 
AO 1 2 O LYS J 1301 ? O LYS D 1301 N VAL J 1294 ? N VAL D 1294 
AO 2 3 O GLU J 1295 ? O GLU D 1295 N VAL J 1280 ? N VAL D 1280 
AO 3 4 N GLY J 1279 ? N GLY D 1279 O VAL J 1319 ? O VAL D 1319 
AP 1 2 O GLN J 1393 ? O GLN D 1393 N VAL J 1379 ? N VAL D 1379 
AP 2 3 N THR J 1382 ? N THR D 1382 O ALA J 1416 ? O ALA D 1416 
AQ 1 2 N VAL J 1487 ? N VAL D 1487 O VAL K 74   ? O VAL E 74   
AR 1 2 N VAL L 10   ? N VAL K 10   O GLU L 26   ? O GLU K 26   
AR 2 3 N PHE L 23   ? N PHE K 23   O LEU L 197  ? O LEU K 197  
AR 3 4 O ARG L 198  ? O ARG K 198  N ALA L 178  ? N ALA K 178  
AS 1 2 N LEU L 101  ? N LEU K 101  O MET L 140  ? O MET K 140  
AS 2 3 O GLY L 147  ? O GLY K 147  N GLY L 50   ? N GLY K 50   
AS 3 4 N VAL L 56   ? N VAL K 56   O ILE L 165  ? O ILE K 165  
AT 1 2 N ARG L 88   ? N ARG K 88   O GLU L 121  ? O GLU K 121  
AU 1 2 N VAL L 109  ? N VAL K 109  O ALA L 130  ? O ALA K 130  
AV 1 2 N VAL L 151  ? N VAL K 151  O ALA L 169  ? O ALA K 169  
AW 1 2 N VAL M 10   ? N VAL L 10   O GLU M 26   ? O GLU L 26   
AW 2 3 N PHE M 23   ? N PHE L 23   O LEU M 197  ? O LEU L 197  
AW 3 4 O ARG M 198  ? O ARG L 198  N ALA M 178  ? N ALA L 178  
AX 1 2 N LEU M 99   ? N LEU L 99   O VAL M 142  ? O VAL L 142  
AX 2 3 O GLY M 147  ? O GLY L 147  N GLY M 50   ? N GLY L 50   
AX 3 4 N VAL M 56   ? N VAL L 56   O ILE M 165  ? O ILE L 165  
AY 1 2 N ARG M 88   ? N ARG L 88   O GLU M 121  ? O GLU L 121  
AZ 1 2 N VAL M 109  ? N VAL L 109  O ALA M 130  ? O ALA L 130  
BA 1 2 N VAL M 151  ? N VAL L 151  O ALA M 169  ? O ALA L 169  
BB 1 2 N GLU N 2    ? N GLU M 2    O ARG N 900  ? O ARG M 900  
BB 2 3 O TYR N 901  ? O TYR M 901  N MET N 580  ? N MET M 580  
BC 1 2 N GLU N 56   ? N GLU M 56   O LEU N 64   ? O LEU M 64   
BC 2 3 N VAL N 65   ? N VAL M 65   O ILE N 101  ? O ILE M 101  
BC 3 4 N LEU N 100  ? N LEU M 100  O ILE N 108  ? O ILE M 108  
BD 1 2 N ALA N 92   ? N ALA M 92   O ILE N 118  ? O ILE M 118  
BE 1 2 N PHE N 127  ? N PHE M 127  O ARG N 134  ? O ARG M 134  
BE 2 3 N VAL N 135  ? N VAL M 135  O GLN N 393  ? O GLN M 393  
BF 1 2 N HIS N 141  ? N HIS M 141  O ARG N 332  ? O ARG M 332  
BG 1 2 N TYR N 147  ? N TYR M 147  O SER N 161  ? O SER M 161  
BG 2 3 N ILE N 162  ? N ILE M 162  O ILE N 172  ? O ILE M 172  
BG 3 4 N GLU N 175  ? N GLU M 175  O SER N 183  ? O SER M 183  
BG 4 5 N MET N 184  ? N MET M 184  O PHE N 191  ? O PHE M 191  
BH 1 2 N ILE N 410  ? N ILE M 410  O THR N 453  ? O THR M 453  
BI 1 2 N ARG N 460  ? N ARG M 460  O ARG N 468  ? O ARG M 468  
BJ 1 2 O THR N 480  ? O THR M 480  N ARG N 473  ? N ARG M 473  
BJ 2 3 N ARG N 472  ? N ARG M 472  O MET N 532  ? O MET M 532  
BJ 3 4 O ASP N 533  ? O ASP M 533  N ALA N 497  ? N ALA M 497  
BJ 4 5 N ILE N 496  ? N ILE M 496  O ARG N 516  ? O ARG M 516  
BJ 5 6 N ALA N 515  ? N ALA M 515  O VAL N 522  ? O VAL M 522  
BK 1 2 N LEU N 595  ? N LEU M 595  O LEU N 655  ? O LEU M 655  
BK 2 3 O ASP N 657  ? O ASP M 657  N ARG N 640  ? N ARG M 640  
BL 1 2 N GLU N 602  ? N GLU M 602  O ARG N 614  ? O ARG M 614  
BL 2 3 N VAL N 613  ? N VAL M 613  O VAL N 621  ? O VAL M 621  
BM 1 2 N TYR N 629  ? N TYR M 629  O LEU N 637  ? O LEU M 637  
BN 1 2 N VAL N 972  ? N VAL M 972  O ILE N 987  ? O ILE M 987  
BN 2 3 O MET N 995  ? O MET M 995  N ALA N 840  ? N ALA M 840  
BN 3 4 N LEU N 839  ? N LEU M 839  O GLY N 847  ? O GLY M 847  
BN 4 5 O ALA N 850  ? O ALA M 850  N ILE N 688  ? N ILE M 688  
BN 5 6 N VAL N 689  ? N VAL M 689  O ILE N 870  ? O ILE M 870  
BN 6 7 O VAL N 869  ? O VAL M 869  N ALA N 675  ? N ALA M 675  
BN 7 8 N VAL N 674  ? N VAL M 674  O GLY N 990  ? O GLY M 990  
BO 1 2 N ALA N 712  ? N ALA M 712  O GLU N 821  ? O GLU M 821  
BO 2 3 O ALA N 828  ? O ALA M 828  N ILE N 799  ? N ILE M 799  
BP 1 2 N SER N 760  ? N SER M 760  O LYS N 786  ? O LYS M 786  
BQ 1 2 N ARG N 1008 ? N ARG M 1008 O SER O 626  ? O SER N 626  
BQ 2 3 N GLY O 627  ? N GLY N 627  O VAL O 747  ? O VAL N 747  
BQ 3 4 O HIS O 748  ? O HIS N 748  N LEU O 701  ? N LEU N 701  
BQ 4 5 N LEU O 702  ? N LEU N 702  O GLN O 714  ? O GLN N 714  
BQ 5 6 O GLN O 717  ? O GLN N 717  N CYS O 642  ? N CYS N 642  
BR 1 2 N ARG N 1008 ? N ARG M 1008 O SER O 626  ? O SER N 626  
BR 2 3 N VAL O 632  ? N VAL N 632  O ILE O 726  ? O ILE N 726  
BS 1 2 N ASP N 1098 ? N ASP M 1098 O ALA O 11   ? O ALA N 11   
BS 2 3 N VAL O 8    ? N VAL N 8    O ASP O 1457 ? O ASP N 1457 
BT 1 2 N GLY O 91   ? N GLY N 91   O VAL O 519  ? O VAL N 519  
BU 1 2 O LEU O 153  ? O LEU N 153  N ILE O 133  ? N ILE N 133  
BU 2 3 N VAL O 134  ? N VAL N 134  O ARG O 455  ? O ARG N 455  
BV 1 2 N TYR O 169  ? N TYR N 169  O ILE O 393  ? O ILE N 393  
BV 2 3 O SER O 392  ? O SER N 392  N ARG O 206  ? N ARG N 206  
BV 3 4 O GLY O 201  ? O GLY N 201  N VAL O 185  ? N VAL N 185  
BW 1 2 N TYR O 401  ? N TYR N 401  O VAL O 444  ? O VAL N 444  
BW 2 3 O VAL O 443  ? O VAL N 443  N ASP O 438  ? N ASP N 438  
BW 3 4 O GLY O 433  ? O GLY N 433  N VAL O 415  ? N VAL N 415  
BX 1 2 N LEU O 421  ? N LEU N 421  O VAL O 427  ? O VAL N 427  
BY 1 2 N VAL O 528  ? N VAL N 528  O ALA O 536  ? O ALA N 536  
BZ 1 2 N PHE O 843  ? N PHE N 843  O ARG O 867  ? O ARG N 867  
BZ 2 3 N VAL O 866  ? N VAL N 866  O LEU O 873  ? O LEU N 873  
CA 1 2 N ILE O 1118 ? N ILE N 1118 O VAL O 1188 ? O VAL N 1188 
CB 1 2 N GLN O 1124 ? N GLN N 1124 O ARG O 1133 ? O ARG N 1133 
CC 1 2 N VAL O 1153 ? N VAL N 1153 O LEU O 1160 ? O LEU N 1160 
CD 1 2 O LYS O 1301 ? O LYS N 1301 N VAL O 1294 ? N VAL N 1294 
CD 2 3 N LEU O 1290 ? N LEU N 1290 O LEU O 1305 ? O LEU N 1305 
CE 1 2 O LYS O 1301 ? O LYS N 1301 N VAL O 1294 ? N VAL N 1294 
CE 2 3 O PHE O 1293 ? O PHE N 1293 N ARG O 1282 ? N ARG N 1282 
CE 3 4 N GLY O 1279 ? N GLY N 1279 O VAL O 1319 ? O VAL N 1319 
CF 1 2 O GLN O 1393 ? O GLN N 1393 N VAL O 1379 ? N VAL N 1379 
CF 2 3 N THR O 1382 ? N THR N 1382 O ALA O 1416 ? O ALA N 1416 
CG 1 2 N VAL O 1487 ? N VAL N 1487 O VAL P 74   ? O VAL O 74   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE STD D 7001' 
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE STD N 8001' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 7058'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 8112'  
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN N 7158'  
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN N 8212'  
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG D 9001'  
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG D 9002'  
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG N 9003'  
BC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG N 9004'  
BC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE APC D 5999' 
BC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE APC M 6999' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 ARG I  422  ? ARG C 422  . ? 1_555 ? 
2  AC1 12 ARG I  428  ? ARG C 428  . ? 1_555 ? 
3  AC1 12 ALA I  447  ? ALA C 447  . ? 1_555 ? 
4  AC1 12 ILE I  449  ? ILE C 449  . ? 1_555 ? 
5  AC1 12 ALA J  1082 ? ALA D 1082 . ? 1_555 ? 
6  AC1 12 ALA J  1085 ? ALA D 1085 . ? 1_555 ? 
7  AC1 12 LEU J  1086 ? LEU D 1086 . ? 1_555 ? 
8  AC1 12 ARG J  1087 ? ARG D 1087 . ? 1_555 ? 
9  AC1 12 ASP J  1090 ? ASP D 1090 . ? 1_555 ? 
10 AC1 12 PRO J  1257 ? PRO D 1257 . ? 1_555 ? 
11 AC1 12 HOH LA .    ? HOH D 9308 . ? 1_555 ? 
12 AC1 12 DG  C  4    ? DG  I 5    . ? 1_555 ? 
13 AC2 12 ARG N  422  ? ARG M 422  . ? 1_555 ? 
14 AC2 12 PHE N  425  ? PHE M 425  . ? 1_555 ? 
15 AC2 12 ALA N  447  ? ALA M 447  . ? 1_555 ? 
16 AC2 12 ILE N  449  ? ILE M 449  . ? 1_555 ? 
17 AC2 12 ALA O  1082 ? ALA N 1082 . ? 1_555 ? 
18 AC2 12 ALA O  1085 ? ALA N 1085 . ? 1_555 ? 
19 AC2 12 LEU O  1086 ? LEU N 1086 . ? 1_555 ? 
20 AC2 12 ARG O  1087 ? ARG N 1087 . ? 1_555 ? 
21 AC2 12 ASP O  1090 ? ASP N 1090 . ? 1_555 ? 
22 AC2 12 PRO O  1257 ? PRO N 1257 . ? 1_555 ? 
23 AC2 12 HOH QA .    ? HOH N 9065 . ? 1_555 ? 
24 AC2 12 DG  F  4    ? DG  Z 5    . ? 1_555 ? 
25 AC3 4  CYS J  58   ? CYS D 58   . ? 1_555 ? 
26 AC3 4  CYS J  60   ? CYS D 60   . ? 1_555 ? 
27 AC3 4  CYS J  73   ? CYS D 73   . ? 1_555 ? 
28 AC3 4  CYS J  76   ? CYS D 76   . ? 1_555 ? 
29 AC4 4  CYS J  1112 ? CYS D 1112 . ? 1_555 ? 
30 AC4 4  CYS J  1194 ? CYS D 1194 . ? 1_555 ? 
31 AC4 4  CYS J  1201 ? CYS D 1201 . ? 1_555 ? 
32 AC4 4  CYS J  1204 ? CYS D 1204 . ? 1_555 ? 
33 AC5 4  CYS O  58   ? CYS N 58   . ? 1_555 ? 
34 AC5 4  CYS O  60   ? CYS N 60   . ? 1_555 ? 
35 AC5 4  CYS O  73   ? CYS N 73   . ? 1_555 ? 
36 AC5 4  CYS O  76   ? CYS N 76   . ? 1_555 ? 
37 AC6 4  CYS O  1112 ? CYS N 1112 . ? 1_555 ? 
38 AC6 4  CYS O  1194 ? CYS N 1194 . ? 1_555 ? 
39 AC6 4  CYS O  1201 ? CYS N 1201 . ? 1_555 ? 
40 AC6 4  CYS O  1204 ? CYS N 1204 . ? 1_555 ? 
41 AC7 4  ASP J  739  ? ASP D 739  . ? 1_555 ? 
42 AC7 4  ASP J  741  ? ASP D 741  . ? 1_555 ? 
43 AC7 4  ASP J  743  ? ASP D 743  . ? 1_555 ? 
44 AC7 4  G   B  16   ? G   H 16   . ? 1_555 ? 
45 AC8 3  ASP J  739  ? ASP D 739  . ? 1_555 ? 
46 AC8 3  APC V  .    ? APC D 5999 . ? 1_555 ? 
47 AC8 3  HOH LA .    ? HOH D 9004 . ? 1_555 ? 
48 AC9 4  ASP O  739  ? ASP N 739  . ? 1_555 ? 
49 AC9 4  ASP O  741  ? ASP N 741  . ? 1_555 ? 
50 AC9 4  ASP O  743  ? ASP N 743  . ? 1_555 ? 
51 AC9 4  G   E  16   ? G   Y 16   . ? 1_555 ? 
52 BC1 3  APC W  .    ? APC M 6999 . ? 1_555 ? 
53 BC1 3  HOH PA .    ? HOH M 7001 . ? 1_555 ? 
54 BC1 3  ASP O  739  ? ASP N 739  . ? 1_555 ? 
55 BC2 14 ARG I  557  ? ARG C 557  . ? 1_555 ? 
56 BC2 14 ARG I  879  ? ARG C 879  . ? 1_555 ? 
57 BC2 14 ARG J  704  ? ARG D 704  . ? 1_555 ? 
58 BC2 14 PRO J  706  ? PRO D 706  . ? 1_555 ? 
59 BC2 14 ASN J  737  ? ASN D 737  . ? 1_555 ? 
60 BC2 14 ARG J  1029 ? ARG D 1029 . ? 1_555 ? 
61 BC2 14 MG  U  .    ? MG  D 9002 . ? 1_555 ? 
62 BC2 14 HOH LA .    ? HOH D 9003 . ? 1_555 ? 
63 BC2 14 HOH LA .    ? HOH D 9004 . ? 1_555 ? 
64 BC2 14 HOH LA .    ? HOH D 9231 . ? 1_555 ? 
65 BC2 14 HOH LA .    ? HOH D 9347 . ? 1_555 ? 
66 BC2 14 HOH LA .    ? HOH D 9498 . ? 1_555 ? 
67 BC2 14 DT  A  14   ? DT  G 14   . ? 1_555 ? 
68 BC2 14 G   B  16   ? G   H 16   . ? 1_555 ? 
69 BC3 11 ARG N  557  ? ARG M 557  . ? 1_555 ? 
70 BC3 11 ARG N  879  ? ARG M 879  . ? 1_555 ? 
71 BC3 11 HOH PA .    ? HOH M 7000 . ? 1_555 ? 
72 BC3 11 HOH PA .    ? HOH M 7319 . ? 1_555 ? 
73 BC3 11 ARG O  704  ? ARG N 704  . ? 1_555 ? 
74 BC3 11 PRO O  706  ? PRO N 706  . ? 1_555 ? 
75 BC3 11 ASN O  737  ? ASN N 737  . ? 1_555 ? 
76 BC3 11 ARG O  1029 ? ARG N 1029 . ? 1_555 ? 
77 BC3 11 MG  BA .    ? MG  N 9004 . ? 1_555 ? 
78 BC3 11 DT  D  14   ? DT  X 14   . ? 1_555 ? 
79 BC3 11 G   E  16   ? G   Y 16   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2PPB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2PPB 
_atom_sites.fract_transf_matrix[1][1]   0.006436 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006436 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002012 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  OP3   . DC  A  1  1    ? 11.815  68.905  44.294  1.00 77.23  ? 1    DC  G OP3   1 
ATOM   2     P  P     . DC  A  1  1    ? 11.865  67.883  43.160  1.00 76.22  ? 1    DC  G P     1 
ATOM   3     O  OP1   . DC  A  1  1    ? 13.210  67.159  43.084  1.00 77.40  ? 1    DC  G OP1   1 
ATOM   4     O  OP2   . DC  A  1  1    ? 10.692  66.913  43.220  1.00 76.35  ? 1    DC  G OP2   1 
ATOM   5     O  "O5'" . DC  A  1  1    ? 11.688  68.749  41.776  1.00 74.47  ? 1    DC  G "O5'" 1 
ATOM   6     C  "C5'" . DC  A  1  1    ? 12.626  68.627  40.669  1.00 69.64  ? 1    DC  G "C5'" 1 
ATOM   7     C  "C4'" . DC  A  1  1    ? 12.515  67.260  40.033  1.00 64.90  ? 1    DC  G "C4'" 1 
ATOM   8     O  "O4'" . DC  A  1  1    ? 11.448  67.214  39.066  1.00 63.89  ? 1    DC  G "O4'" 1 
ATOM   9     C  "C3'" . DC  A  1  1    ? 13.744  66.751  39.294  1.00 62.54  ? 1    DC  G "C3'" 1 
ATOM   10    O  "O3'" . DC  A  1  1    ? 13.775  65.345  39.534  1.00 60.58  ? 1    DC  G "O3'" 1 
ATOM   11    C  "C2'" . DC  A  1  1    ? 13.427  67.052  37.836  1.00 61.29  ? 1    DC  G "C2'" 1 
ATOM   12    C  "C1'" . DC  A  1  1    ? 11.949  66.761  37.820  1.00 61.62  ? 1    DC  G "C1'" 1 
ATOM   13    N  N1    . DC  A  1  1    ? 11.119  67.372  36.781  1.00 61.01  ? 1    DC  G N1    1 
ATOM   14    C  C2    . DC  A  1  1    ? 10.641  66.562  35.761  1.00 61.10  ? 1    DC  G C2    1 
ATOM   15    O  O2    . DC  A  1  1    ? 11.040  65.390  35.688  1.00 59.63  ? 1    DC  G O2    1 
ATOM   16    N  N3    . DC  A  1  1    ? 9.745   67.065  34.881  1.00 62.04  ? 1    DC  G N3    1 
ATOM   17    C  C4    . DC  A  1  1    ? 9.339   68.332  34.991  1.00 61.39  ? 1    DC  G C4    1 
ATOM   18    N  N4    . DC  A  1  1    ? 8.422   68.762  34.121  1.00 60.35  ? 1    DC  G N4    1 
ATOM   19    C  C5    . DC  A  1  1    ? 9.853   69.202  35.998  1.00 61.32  ? 1    DC  G C5    1 
ATOM   20    C  C6    . DC  A  1  1    ? 10.746  68.687  36.854  1.00 61.14  ? 1    DC  G C6    1 
ATOM   21    P  P     . DC  A  1  2    ? 15.154  64.542  39.424  1.00 59.44  ? 2    DC  G P     1 
ATOM   22    O  OP1   . DC  A  1  2    ? 15.175  63.476  40.465  1.00 58.36  ? 2    DC  G OP1   1 
ATOM   23    O  OP2   . DC  A  1  2    ? 16.270  65.535  39.352  1.00 58.93  ? 2    DC  G OP2   1 
ATOM   24    O  "O5'" . DC  A  1  2    ? 15.014  63.847  38.004  1.00 55.94  ? 2    DC  G "O5'" 1 
ATOM   25    C  "C5'" . DC  A  1  2    ? 16.046  63.955  37.064  1.00 47.79  ? 2    DC  G "C5'" 1 
ATOM   26    C  "C4'" . DC  A  1  2    ? 15.862  62.903  36.010  1.00 43.36  ? 2    DC  G "C4'" 1 
ATOM   27    O  "O4'" . DC  A  1  2    ? 14.635  63.197  35.302  1.00 39.98  ? 2    DC  G "O4'" 1 
ATOM   28    C  "C3'" . DC  A  1  2    ? 16.985  62.953  34.988  1.00 42.28  ? 2    DC  G "C3'" 1 
ATOM   29    O  "O3'" . DC  A  1  2    ? 17.427  61.635  34.607  1.00 41.71  ? 2    DC  G "O3'" 1 
ATOM   30    C  "C2'" . DC  A  1  2    ? 16.399  63.775  33.862  1.00 42.30  ? 2    DC  G "C2'" 1 
ATOM   31    C  "C1'" . DC  A  1  2    ? 14.896  63.538  33.948  1.00 40.79  ? 2    DC  G "C1'" 1 
ATOM   32    N  N1    . DC  A  1  2    ? 14.111  64.750  33.618  1.00 40.82  ? 2    DC  G N1    1 
ATOM   33    C  C2    . DC  A  1  2    ? 13.201  64.737  32.533  1.00 39.86  ? 2    DC  G C2    1 
ATOM   34    O  O2    . DC  A  1  2    ? 13.020  63.694  31.887  1.00 38.02  ? 2    DC  G O2    1 
ATOM   35    N  N3    . DC  A  1  2    ? 12.541  65.880  32.218  1.00 40.39  ? 2    DC  G N3    1 
ATOM   36    C  C4    . DC  A  1  2    ? 12.753  66.996  32.923  1.00 40.86  ? 2    DC  G C4    1 
ATOM   37    N  N4    . DC  A  1  2    ? 12.109  68.098  32.556  1.00 39.94  ? 2    DC  G N4    1 
ATOM   38    C  C5    . DC  A  1  2    ? 13.639  67.030  34.033  1.00 42.20  ? 2    DC  G C5    1 
ATOM   39    C  C6    . DC  A  1  2    ? 14.287  65.897  34.347  1.00 43.18  ? 2    DC  G C6    1 
ATOM   40    P  P     . DC  A  1  3    ? 18.891  61.449  33.969  1.00 40.85  ? 3    DC  G P     1 
ATOM   41    O  OP1   . DC  A  1  3    ? 19.449  60.144  34.377  1.00 41.49  ? 3    DC  G OP1   1 
ATOM   42    O  OP2   . DC  A  1  3    ? 19.664  62.693  34.224  1.00 39.06  ? 3    DC  G OP2   1 
ATOM   43    O  "O5'" . DC  A  1  3    ? 18.581  61.359  32.413  1.00 44.36  ? 3    DC  G "O5'" 1 
ATOM   44    C  "C5'" . DC  A  1  3    ? 17.522  60.516  31.934  1.00 48.33  ? 3    DC  G "C5'" 1 
ATOM   45    C  "C4'" . DC  A  1  3    ? 17.190  60.784  30.475  1.00 51.43  ? 3    DC  G "C4'" 1 
ATOM   46    O  "O4'" . DC  A  1  3    ? 16.242  61.865  30.257  1.00 48.69  ? 3    DC  G "O4'" 1 
ATOM   47    C  "C3'" . DC  A  1  3    ? 18.345  60.997  29.494  1.00 52.95  ? 3    DC  G "C3'" 1 
ATOM   48    O  "O3'" . DC  A  1  3    ? 18.184  60.088  28.400  1.00 55.57  ? 3    DC  G "O3'" 1 
ATOM   49    C  "C2'" . DC  A  1  3    ? 18.184  62.445  29.046  1.00 52.59  ? 3    DC  G "C2'" 1 
ATOM   50    C  "C1'" . DC  A  1  3    ? 16.688  62.729  29.202  1.00 51.73  ? 3    DC  G "C1'" 1 
ATOM   51    N  N1    . DC  A  1  3    ? 16.387  64.114  29.621  1.00 52.54  ? 3    DC  G N1    1 
ATOM   52    C  C2    . DC  A  1  3    ? 15.442  64.906  28.909  1.00 52.29  ? 3    DC  G C2    1 
ATOM   53    O  O2    . DC  A  1  3    ? 14.932  64.483  27.850  1.00 50.17  ? 3    DC  G O2    1 
ATOM   54    N  N3    . DC  A  1  3    ? 15.115  66.122  29.413  1.00 51.95  ? 3    DC  G N3    1 
ATOM   55    C  C4    . DC  A  1  3    ? 15.684  66.563  30.548  1.00 52.58  ? 3    DC  G C4    1 
ATOM   56    N  N4    . DC  A  1  3    ? 15.310  67.734  31.037  1.00 53.51  ? 3    DC  G N4    1 
ATOM   57    C  C5    . DC  A  1  3    ? 16.662  65.812  31.239  1.00 53.02  ? 3    DC  G C5    1 
ATOM   58    C  C6    . DC  A  1  3    ? 16.989  64.614  30.744  1.00 54.48  ? 3    DC  G C6    1 
ATOM   59    P  P     . DT  A  1  4    ? 19.200  60.136  27.163  1.00 58.12  ? 4    DT  G P     1 
ATOM   60    O  OP1   . DT  A  1  4    ? 19.189  58.774  26.558  1.00 57.01  ? 4    DT  G OP1   1 
ATOM   61    O  OP2   . DT  A  1  4    ? 20.493  60.724  27.627  1.00 57.86  ? 4    DT  G OP2   1 
ATOM   62    O  "O5'" . DT  A  1  4    ? 18.469  61.159  26.167  1.00 61.41  ? 4    DT  G "O5'" 1 
ATOM   63    C  "C5'" . DT  A  1  4    ? 17.108  60.933  25.751  1.00 63.39  ? 4    DT  G "C5'" 1 
ATOM   64    C  "C4'" . DT  A  1  4    ? 16.704  61.879  24.640  1.00 65.64  ? 4    DT  G "C4'" 1 
ATOM   65    O  "O4'" . DT  A  1  4    ? 16.231  63.138  25.171  1.00 65.27  ? 4    DT  G "O4'" 1 
ATOM   66    C  "C3'" . DT  A  1  4    ? 17.760  62.207  23.580  1.00 66.62  ? 4    DT  G "C3'" 1 
ATOM   67    O  "O3'" . DT  A  1  4    ? 17.222  62.048  22.261  1.00 67.28  ? 4    DT  G "O3'" 1 
ATOM   68    C  "C2'" . DT  A  1  4    ? 18.114  63.661  23.850  1.00 66.86  ? 4    DT  G "C2'" 1 
ATOM   69    C  "C1'" . DT  A  1  4    ? 16.869  64.227  24.527  1.00 66.97  ? 4    DT  G "C1'" 1 
ATOM   70    N  N1    . DT  A  1  4    ? 17.189  65.212  25.569  1.00 67.98  ? 4    DT  G N1    1 
ATOM   71    C  C2    . DT  A  1  4    ? 16.480  66.390  25.622  1.00 69.10  ? 4    DT  G C2    1 
ATOM   72    O  O2    . DT  A  1  4    ? 15.585  66.670  24.832  1.00 69.22  ? 4    DT  G O2    1 
ATOM   73    N  N3    . DT  A  1  4    ? 16.866  67.238  26.645  1.00 69.28  ? 4    DT  G N3    1 
ATOM   74    C  C4    . DT  A  1  4    ? 17.867  67.009  27.576  1.00 68.68  ? 4    DT  G C4    1 
ATOM   75    O  O4    . DT  A  1  4    ? 18.112  67.839  28.426  1.00 70.26  ? 4    DT  G O4    1 
ATOM   76    C  C5    . DT  A  1  4    ? 18.555  65.756  27.452  1.00 68.40  ? 4    DT  G C5    1 
ATOM   77    C  C7    . DT  A  1  4    ? 19.650  65.431  28.419  1.00 68.34  ? 4    DT  G C7    1 
ATOM   78    C  C6    . DT  A  1  4    ? 18.190  64.935  26.474  1.00 68.31  ? 4    DT  G C6    1 
ATOM   79    P  P     . DG  A  1  5    ? 18.083  62.502  20.983  1.00 67.36  ? 5    DG  G P     1 
ATOM   80    O  OP1   . DG  A  1  5    ? 17.684  61.640  19.841  1.00 67.00  ? 5    DG  G OP1   1 
ATOM   81    O  OP2   . DG  A  1  5    ? 19.505  62.534  21.407  1.00 66.89  ? 5    DG  G OP2   1 
ATOM   82    O  "O5'" . DG  A  1  5    ? 17.563  63.995  20.718  1.00 66.84  ? 5    DG  G "O5'" 1 
ATOM   83    C  "C5'" . DG  A  1  5    ? 16.155  64.279  20.706  1.00 66.33  ? 5    DG  G "C5'" 1 
ATOM   84    C  "C4'" . DG  A  1  5    ? 15.888  65.692  20.235  1.00 66.04  ? 5    DG  G "C4'" 1 
ATOM   85    O  "O4'" . DG  A  1  5    ? 16.101  66.642  21.306  1.00 64.11  ? 5    DG  G "O4'" 1 
ATOM   86    C  "C3'" . DG  A  1  5    ? 16.741  66.163  19.055  1.00 66.98  ? 5    DG  G "C3'" 1 
ATOM   87    O  "O3'" . DG  A  1  5    ? 15.939  66.892  18.111  1.00 70.15  ? 5    DG  G "O3'" 1 
ATOM   88    C  "C2'" . DG  A  1  5    ? 17.773  67.058  19.713  1.00 64.85  ? 5    DG  G "C2'" 1 
ATOM   89    C  "C1'" . DG  A  1  5    ? 17.031  67.633  20.903  1.00 63.89  ? 5    DG  G "C1'" 1 
ATOM   90    N  N9    . DG  A  1  5    ? 17.908  67.887  22.036  1.00 62.77  ? 5    DG  G N9    1 
ATOM   91    C  C8    . DG  A  1  5    ? 18.915  67.069  22.487  1.00 62.55  ? 5    DG  G C8    1 
ATOM   92    N  N7    . DG  A  1  5    ? 19.510  67.528  23.551  1.00 63.22  ? 5    DG  G N7    1 
ATOM   93    C  C5    . DG  A  1  5    ? 18.858  68.726  23.820  1.00 63.11  ? 5    DG  G C5    1 
ATOM   94    C  C6    . DG  A  1  5    ? 19.065  69.659  24.864  1.00 63.46  ? 5    DG  G C6    1 
ATOM   95    O  O6    . DG  A  1  5    ? 19.889  69.601  25.785  1.00 63.75  ? 5    DG  G O6    1 
ATOM   96    N  N1    . DG  A  1  5    ? 18.189  70.746  24.770  1.00 63.04  ? 5    DG  G N1    1 
ATOM   97    C  C2    . DG  A  1  5    ? 17.233  70.900  23.785  1.00 61.80  ? 5    DG  G C2    1 
ATOM   98    N  N2    . DG  A  1  5    ? 16.485  72.006  23.858  1.00 60.70  ? 5    DG  G N2    1 
ATOM   99    N  N3    . DG  A  1  5    ? 17.030  70.026  22.805  1.00 61.87  ? 5    DG  G N3    1 
ATOM   100   C  C4    . DG  A  1  5    ? 17.873  68.970  22.886  1.00 62.57  ? 5    DG  G C4    1 
ATOM   101   P  P     . DT  A  1  6    ? 16.631  67.650  16.855  1.00 72.14  ? 6    DT  G P     1 
ATOM   102   O  OP1   . DT  A  1  6    ? 15.710  67.570  15.690  1.00 72.10  ? 6    DT  G OP1   1 
ATOM   103   O  OP2   . DT  A  1  6    ? 18.033  67.177  16.706  1.00 70.99  ? 6    DT  G OP2   1 
ATOM   104   O  "O5'" . DT  A  1  6    ? 16.611  69.178  17.316  1.00 71.07  ? 6    DT  G "O5'" 1 
ATOM   105   C  "C5'" . DT  A  1  6    ? 15.398  69.773  17.799  1.00 69.29  ? 6    DT  G "C5'" 1 
ATOM   106   C  "C4'" . DT  A  1  6    ? 15.580  71.258  17.995  1.00 67.66  ? 6    DT  G "C4'" 1 
ATOM   107   O  "O4'" . DT  A  1  6    ? 16.266  71.530  19.246  1.00 67.18  ? 6    DT  G "O4'" 1 
ATOM   108   C  "C3'" . DT  A  1  6    ? 16.421  71.878  16.887  1.00 66.98  ? 6    DT  G "C3'" 1 
ATOM   109   O  "O3'" . DT  A  1  6    ? 15.922  73.150  16.488  1.00 66.87  ? 6    DT  G "O3'" 1 
ATOM   110   C  "C2'" . DT  A  1  6    ? 17.781  72.019  17.532  1.00 67.46  ? 6    DT  G "C2'" 1 
ATOM   111   C  "C1'" . DT  A  1  6    ? 17.458  72.256  19.006  1.00 67.84  ? 6    DT  G "C1'" 1 
ATOM   112   N  N1    . DT  A  1  6    ? 18.494  71.751  19.941  1.00 68.22  ? 6    DT  G N1    1 
ATOM   113   C  C2    . DT  A  1  6    ? 18.872  72.498  21.051  1.00 68.45  ? 6    DT  G C2    1 
ATOM   114   O  O2    . DT  A  1  6    ? 18.390  73.575  21.332  1.00 67.71  ? 6    DT  G O2    1 
ATOM   115   N  N3    . DT  A  1  6    ? 19.856  71.920  21.826  1.00 69.17  ? 6    DT  G N3    1 
ATOM   116   C  C4    . DT  A  1  6    ? 20.478  70.702  21.590  1.00 69.99  ? 6    DT  G C4    1 
ATOM   117   O  O4    . DT  A  1  6    ? 21.342  70.294  22.346  1.00 70.46  ? 6    DT  G O4    1 
ATOM   118   C  C5    . DT  A  1  6    ? 20.033  69.987  20.425  1.00 70.65  ? 6    DT  G C5    1 
ATOM   119   C  C7    . DT  A  1  6    ? 20.663  68.669  20.102  1.00 71.85  ? 6    DT  G C7    1 
ATOM   120   C  C6    . DT  A  1  6    ? 19.077  70.534  19.676  1.00 69.76  ? 6    DT  G C6    1 
ATOM   121   P  P     . DC  A  1  7    ? 16.327  73.749  15.053  1.00 67.13  ? 7    DC  G P     1 
ATOM   122   O  OP1   . DC  A  1  7    ? 15.095  73.873  14.235  1.00 65.61  ? 7    DC  G OP1   1 
ATOM   123   O  OP2   . DC  A  1  7    ? 17.461  72.940  14.543  1.00 67.18  ? 7    DC  G OP2   1 
ATOM   124   O  "O5'" . DC  A  1  7    ? 16.850  75.217  15.394  1.00 66.86  ? 7    DC  G "O5'" 1 
ATOM   125   C  "C5'" . DC  A  1  7    ? 15.994  76.147  16.049  1.00 67.40  ? 7    DC  G "C5'" 1 
ATOM   126   C  "C4'" . DC  A  1  7    ? 16.730  76.888  17.142  1.00 67.98  ? 7    DC  G "C4'" 1 
ATOM   127   O  "O4'" . DC  A  1  7    ? 17.542  75.975  17.920  1.00 67.47  ? 7    DC  G "O4'" 1 
ATOM   128   C  "C3'" . DC  A  1  7    ? 17.667  78.021  16.714  1.00 68.61  ? 7    DC  G "C3'" 1 
ATOM   129   O  "O3'" . DC  A  1  7    ? 17.401  79.142  17.552  1.00 69.63  ? 7    DC  G "O3'" 1 
ATOM   130   C  "C2'" . DC  A  1  7    ? 19.062  77.473  16.974  1.00 67.75  ? 7    DC  G "C2'" 1 
ATOM   131   C  "C1'" . DC  A  1  7    ? 18.817  76.554  18.150  1.00 66.58  ? 7    DC  G "C1'" 1 
ATOM   132   N  N1    . DC  A  1  7    ? 19.785  75.462  18.288  1.00 65.05  ? 7    DC  G N1    1 
ATOM   133   C  C2    . DC  A  1  7    ? 20.618  75.448  19.400  1.00 65.23  ? 7    DC  G C2    1 
ATOM   134   O  O2    . DC  A  1  7    ? 20.539  76.377  20.222  1.00 64.82  ? 7    DC  G O2    1 
ATOM   135   N  N3    . DC  A  1  7    ? 21.500  74.426  19.553  1.00 65.36  ? 7    DC  G N3    1 
ATOM   136   C  C4    . DC  A  1  7    ? 21.562  73.455  18.643  1.00 64.53  ? 7    DC  G C4    1 
ATOM   137   N  N4    . DC  A  1  7    ? 22.437  72.470  18.839  1.00 63.25  ? 7    DC  G N4    1 
ATOM   138   C  C5    . DC  A  1  7    ? 20.727  73.455  17.496  1.00 65.07  ? 7    DC  G C5    1 
ATOM   139   C  C6    . DC  A  1  7    ? 19.863  74.470  17.357  1.00 64.34  ? 7    DC  G C6    1 
ATOM   140   P  P     . DT  A  1  8    ? 18.279  80.470  17.411  1.00 70.87  ? 8    DT  G P     1 
ATOM   141   O  OP1   . DT  A  1  8    ? 17.439  81.622  17.852  1.00 73.13  ? 8    DT  G OP1   1 
ATOM   142   O  OP2   . DT  A  1  8    ? 18.925  80.498  16.084  1.00 69.51  ? 8    DT  G OP2   1 
ATOM   143   O  "O5'" . DT  A  1  8    ? 19.392  80.234  18.512  1.00 69.62  ? 8    DT  G "O5'" 1 
ATOM   144   C  "C5'" . DT  A  1  8    ? 19.025  80.028  19.873  1.00 66.64  ? 8    DT  G "C5'" 1 
ATOM   145   C  "C4'" . DT  A  1  8    ? 20.241  80.207  20.739  1.00 65.27  ? 8    DT  G "C4'" 1 
ATOM   146   O  "O4'" . DT  A  1  8    ? 21.079  79.036  20.614  1.00 63.53  ? 8    DT  G "O4'" 1 
ATOM   147   C  "C3'" . DT  A  1  8    ? 21.093  81.393  20.277  1.00 64.91  ? 8    DT  G "C3'" 1 
ATOM   148   O  "O3'" . DT  A  1  8    ? 21.663  82.048  21.407  1.00 66.05  ? 8    DT  G "O3'" 1 
ATOM   149   C  "C2'" . DT  A  1  8    ? 22.185  80.739  19.449  1.00 64.30  ? 8    DT  G "C2'" 1 
ATOM   150   C  "C1'" . DT  A  1  8    ? 22.376  79.447  20.205  1.00 63.32  ? 8    DT  G "C1'" 1 
ATOM   151   N  N1    . DT  A  1  8    ? 22.972  78.351  19.457  1.00 62.10  ? 8    DT  G N1    1 
ATOM   152   C  C2    . DT  A  1  8    ? 23.995  77.694  20.058  1.00 61.61  ? 8    DT  G C2    1 
ATOM   153   O  O2    . DT  A  1  8    ? 24.442  78.042  21.138  1.00 62.28  ? 8    DT  G O2    1 
ATOM   154   N  N3    . DT  A  1  8    ? 24.485  76.619  19.356  1.00 61.58  ? 8    DT  G N3    1 
ATOM   155   C  C4    . DT  A  1  8    ? 24.043  76.167  18.135  1.00 61.91  ? 8    DT  G C4    1 
ATOM   156   O  O4    . DT  A  1  8    ? 24.560  75.178  17.631  1.00 61.39  ? 8    DT  G O4    1 
ATOM   157   C  C5    . DT  A  1  8    ? 22.962  76.932  17.549  1.00 62.55  ? 8    DT  G C5    1 
ATOM   158   C  C7    . DT  A  1  8    ? 22.399  76.519  16.226  1.00 63.26  ? 8    DT  G C7    1 
ATOM   159   C  C6    . DT  A  1  8    ? 22.498  77.980  18.228  1.00 62.47  ? 8    DT  G C6    1 
ATOM   160   P  P     . DG  A  1  9    ? 22.111  83.592  21.304  1.00 66.15  ? 9    DG  G P     1 
ATOM   161   O  OP1   . DG  A  1  9    ? 21.308  84.351  22.305  1.00 65.92  ? 9    DG  G OP1   1 
ATOM   162   O  OP2   . DG  A  1  9    ? 22.106  84.017  19.879  1.00 66.28  ? 9    DG  G OP2   1 
ATOM   163   O  "O5'" . DG  A  1  9    ? 23.629  83.551  21.789  1.00 63.66  ? 9    DG  G "O5'" 1 
ATOM   164   C  "C5'" . DG  A  1  9    ? 23.973  82.996  23.059  1.00 58.09  ? 9    DG  G "C5'" 1 
ATOM   165   C  "C4'" . DG  A  1  9    ? 25.454  82.717  23.111  1.00 54.16  ? 9    DG  G "C4'" 1 
ATOM   166   O  "O4'" . DG  A  1  9    ? 25.733  81.470  22.426  1.00 52.95  ? 9    DG  G "O4'" 1 
ATOM   167   C  "C3'" . DG  A  1  9    ? 26.296  83.795  22.427  1.00 51.17  ? 9    DG  G "C3'" 1 
ATOM   168   O  "O3'" . DG  A  1  9    ? 27.463  84.089  23.209  1.00 48.26  ? 9    DG  G "O3'" 1 
ATOM   169   C  "C2'" . DG  A  1  9    ? 26.640  83.163  21.086  1.00 51.72  ? 9    DG  G "C2'" 1 
ATOM   170   C  "C1'" . DG  A  1  9    ? 26.712  81.686  21.432  1.00 51.98  ? 9    DG  G "C1'" 1 
ATOM   171   N  N9    . DG  A  1  9    ? 26.478  80.740  20.342  1.00 51.32  ? 9    DG  G N9    1 
ATOM   172   C  C8    . DG  A  1  9    ? 25.510  80.778  19.365  1.00 49.41  ? 9    DG  G C8    1 
ATOM   173   N  N7    . DG  A  1  9    ? 25.585  79.777  18.534  1.00 49.89  ? 9    DG  G N7    1 
ATOM   174   C  C5    . DG  A  1  9    ? 26.672  79.033  18.990  1.00 51.33  ? 9    DG  G C5    1 
ATOM   175   C  C6    . DG  A  1  9    ? 27.242  77.816  18.506  1.00 51.64  ? 9    DG  G C6    1 
ATOM   176   O  O6    . DG  A  1  9    ? 26.895  77.139  17.532  1.00 51.05  ? 9    DG  G O6    1 
ATOM   177   N  N1    . DG  A  1  9    ? 28.330  77.404  19.289  1.00 52.01  ? 9    DG  G N1    1 
ATOM   178   C  C2    . DG  A  1  9    ? 28.799  78.073  20.393  1.00 52.30  ? 9    DG  G C2    1 
ATOM   179   N  N2    . DG  A  1  9    ? 29.842  77.530  21.042  1.00 53.39  ? 9    DG  G N2    1 
ATOM   180   N  N3    . DG  A  1  9    ? 28.279  79.200  20.846  1.00 53.00  ? 9    DG  G N3    1 
ATOM   181   C  C4    . DG  A  1  9    ? 27.225  79.616  20.105  1.00 51.65  ? 9    DG  G C4    1 
ATOM   182   P  P     . DG  A  1  10   ? 28.396  85.337  22.820  1.00 45.72  ? 10   DG  G P     1 
ATOM   183   O  OP1   . DG  A  1  10   ? 28.472  86.255  23.979  1.00 44.81  ? 10   DG  G OP1   1 
ATOM   184   O  OP2   . DG  A  1  10   ? 27.960  85.854  21.502  1.00 45.50  ? 10   DG  G OP2   1 
ATOM   185   O  "O5'" . DG  A  1  10   ? 29.821  84.663  22.657  1.00 44.29  ? 10   DG  G "O5'" 1 
ATOM   186   C  "C5'" . DG  A  1  10   ? 30.349  83.842  23.694  1.00 42.10  ? 10   DG  G "C5'" 1 
ATOM   187   C  "C4'" . DG  A  1  10   ? 31.539  83.075  23.180  1.00 41.21  ? 10   DG  G "C4'" 1 
ATOM   188   O  "O4'" . DG  A  1  10   ? 31.109  82.014  22.295  1.00 41.11  ? 10   DG  G "O4'" 1 
ATOM   189   C  "C3'" . DG  A  1  10   ? 32.485  83.944  22.363  1.00 40.05  ? 10   DG  G "C3'" 1 
ATOM   190   O  "O3'" . DG  A  1  10   ? 33.803  83.515  22.600  1.00 40.69  ? 10   DG  G "O3'" 1 
ATOM   191   C  "C2'" . DG  A  1  10   ? 32.122  83.612  20.933  1.00 42.06  ? 10   DG  G "C2'" 1 
ATOM   192   C  "C1'" . DG  A  1  10   ? 31.774  82.147  21.048  1.00 42.87  ? 10   DG  G "C1'" 1 
ATOM   193   N  N9    . DG  A  1  10   ? 30.881  81.693  19.985  1.00 44.11  ? 10   DG  G N9    1 
ATOM   194   C  C8    . DG  A  1  10   ? 29.721  82.295  19.555  1.00 44.27  ? 10   DG  G C8    1 
ATOM   195   N  N7    . DG  A  1  10   ? 29.148  81.657  18.575  1.00 43.72  ? 10   DG  G N7    1 
ATOM   196   C  C5    . DG  A  1  10   ? 29.975  80.576  18.343  1.00 43.98  ? 10   DG  G C5    1 
ATOM   197   C  C6    . DG  A  1  10   ? 29.854  79.549  17.414  1.00 45.10  ? 10   DG  G C6    1 
ATOM   198   O  O6    . DG  A  1  10   ? 28.956  79.383  16.586  1.00 47.27  ? 10   DG  G O6    1 
ATOM   199   N  N1    . DG  A  1  10   ? 30.908  78.641  17.502  1.00 46.98  ? 10   DG  G N1    1 
ATOM   200   C  C2    . DG  A  1  10   ? 31.950  78.735  18.402  1.00 48.31  ? 10   DG  G C2    1 
ATOM   201   N  N2    . DG  A  1  10   ? 32.886  77.770  18.359  1.00 50.89  ? 10   DG  G N2    1 
ATOM   202   N  N3    . DG  A  1  10   ? 32.066  79.708  19.290  1.00 46.94  ? 10   DG  G N3    1 
ATOM   203   C  C4    . DG  A  1  10   ? 31.049  80.583  19.204  1.00 44.50  ? 10   DG  G C4    1 
ATOM   204   P  P     . DC  A  1  11   ? 35.001  84.147  21.758  1.00 42.02  ? 11   DC  G P     1 
ATOM   205   O  OP1   . DC  A  1  11   ? 36.074  84.433  22.764  1.00 43.10  ? 11   DC  G OP1   1 
ATOM   206   O  OP2   . DC  A  1  11   ? 34.459  85.246  20.924  1.00 38.95  ? 11   DC  G OP2   1 
ATOM   207   O  "O5'" . DC  A  1  11   ? 35.491  82.945  20.835  1.00 39.01  ? 11   DC  G "O5'" 1 
ATOM   208   C  "C5'" . DC  A  1  11   ? 36.495  82.040  21.301  1.00 37.43  ? 11   DC  G "C5'" 1 
ATOM   209   C  "C4'" . DC  A  1  11   ? 37.486  81.768  20.201  1.00 37.30  ? 11   DC  G "C4'" 1 
ATOM   210   O  "O4'" . DC  A  1  11   ? 36.805  80.926  19.237  1.00 37.68  ? 11   DC  G "O4'" 1 
ATOM   211   C  "C3'" . DC  A  1  11   ? 37.852  83.063  19.478  1.00 37.69  ? 11   DC  G "C3'" 1 
ATOM   212   O  "O3'" . DC  A  1  11   ? 39.212  83.492  19.604  1.00 36.49  ? 11   DC  G "O3'" 1 
ATOM   213   C  "C2'" . DC  A  1  11   ? 37.316  82.928  18.067  1.00 38.74  ? 11   DC  G "C2'" 1 
ATOM   214   C  "C1'" . DC  A  1  11   ? 36.811  81.492  17.934  1.00 38.52  ? 11   DC  G "C1'" 1 
ATOM   215   N  N1    . DC  A  1  11   ? 35.429  81.481  17.381  1.00 38.91  ? 11   DC  G N1    1 
ATOM   216   C  C2    . DC  A  1  11   ? 35.067  80.547  16.379  1.00 38.66  ? 11   DC  G C2    1 
ATOM   217   O  O2    . DC  A  1  11   ? 35.875  79.674  16.024  1.00 38.07  ? 11   DC  G O2    1 
ATOM   218   N  N3    . DC  A  1  11   ? 33.834  80.638  15.818  1.00 38.99  ? 11   DC  G N3    1 
ATOM   219   C  C4    . DC  A  1  11   ? 32.980  81.583  16.213  1.00 39.90  ? 11   DC  G C4    1 
ATOM   220   N  N4    . DC  A  1  11   ? 31.784  81.637  15.621  1.00 38.46  ? 11   DC  G N4    1 
ATOM   221   C  C5    . DC  A  1  11   ? 33.307  82.513  17.235  1.00 40.71  ? 11   DC  G C5    1 
ATOM   222   C  C6    . DC  A  1  11   ? 34.518  82.419  17.796  1.00 40.51  ? 11   DC  G C6    1 
ATOM   223   P  P     . DG  A  1  12   ? 40.407  82.632  18.991  1.00 37.37  ? 12   DG  G P     1 
ATOM   224   O  OP1   . DG  A  1  12   ? 40.671  81.505  19.884  1.00 37.12  ? 12   DG  G OP1   1 
ATOM   225   O  OP2   . DG  A  1  12   ? 41.487  83.604  18.677  1.00 35.77  ? 12   DG  G OP2   1 
ATOM   226   O  "O5'" . DG  A  1  12   ? 39.861  81.920  17.685  1.00 35.18  ? 12   DG  G "O5'" 1 
ATOM   227   C  "C5'" . DG  A  1  12   ? 40.026  80.527  17.552  1.00 29.73  ? 12   DG  G "C5'" 1 
ATOM   228   C  "C4'" . DG  A  1  12   ? 40.446  80.190  16.150  1.00 28.14  ? 12   DG  G "C4'" 1 
ATOM   229   O  "O4'" . DG  A  1  12   ? 39.297  79.878  15.344  1.00 28.91  ? 12   DG  G "O4'" 1 
ATOM   230   C  "C3'" . DG  A  1  12   ? 41.272  81.236  15.417  1.00 24.79  ? 12   DG  G "C3'" 1 
ATOM   231   O  "O3'" . DG  A  1  12   ? 42.440  80.567  15.062  1.00 25.08  ? 12   DG  G "O3'" 1 
ATOM   232   C  "C2'" . DG  A  1  12   ? 40.415  81.637  14.234  1.00 26.72  ? 12   DG  G "C2'" 1 
ATOM   233   C  "C1'" . DG  A  1  12   ? 39.289  80.607  14.140  1.00 29.50  ? 12   DG  G "C1'" 1 
ATOM   234   N  N9    . DG  A  1  12   ? 37.968  81.236  14.035  1.00 33.05  ? 12   DG  G N9    1 
ATOM   235   C  C8    . DG  A  1  12   ? 37.489  82.253  14.829  1.00 34.68  ? 12   DG  G C8    1 
ATOM   236   N  N7    . DG  A  1  12   ? 36.294  82.656  14.495  1.00 33.81  ? 12   DG  G N7    1 
ATOM   237   C  C5    . DG  A  1  12   ? 35.954  81.853  13.419  1.00 34.61  ? 12   DG  G C5    1 
ATOM   238   C  C6    . DG  A  1  12   ? 34.781  81.835  12.644  1.00 36.38  ? 12   DG  G C6    1 
ATOM   239   O  O6    . DG  A  1  12   ? 33.773  82.541  12.767  1.00 38.35  ? 12   DG  G O6    1 
ATOM   240   N  N1    . DG  A  1  12   ? 34.845  80.869  11.638  1.00 37.32  ? 12   DG  G N1    1 
ATOM   241   C  C2    . DG  A  1  12   ? 35.913  80.027  11.421  1.00 36.07  ? 12   DG  G C2    1 
ATOM   242   N  N2    . DG  A  1  12   ? 35.802  79.163  10.390  1.00 35.61  ? 12   DG  G N2    1 
ATOM   243   N  N3    . DG  A  1  12   ? 37.013  80.031  12.157  1.00 34.74  ? 12   DG  G N3    1 
ATOM   244   C  C4    . DG  A  1  12   ? 36.968  80.960  13.127  1.00 33.47  ? 12   DG  G C4    1 
ATOM   245   P  P     . DT  A  1  13   ? 43.488  81.179  14.042  1.00 29.44  ? 13   DT  G P     1 
ATOM   246   O  OP1   . DT  A  1  13   ? 44.410  80.047  14.215  1.00 30.18  ? 13   DT  G OP1   1 
ATOM   247   O  OP2   . DT  A  1  13   ? 43.968  82.552  14.319  1.00 26.28  ? 13   DT  G OP2   1 
ATOM   248   O  "O5'" . DT  A  1  13   ? 42.800  80.981  12.613  1.00 30.01  ? 13   DT  G "O5'" 1 
ATOM   249   C  "C5'" . DT  A  1  13   ? 42.653  79.642  12.072  1.00 28.15  ? 13   DT  G "C5'" 1 
ATOM   250   C  "C4'" . DT  A  1  13   ? 42.295  79.635  10.599  1.00 24.17  ? 13   DT  G "C4'" 1 
ATOM   251   O  "O4'" . DT  A  1  13   ? 40.851  79.706  10.420  1.00 18.59  ? 13   DT  G "O4'" 1 
ATOM   252   C  "C3'" . DT  A  1  13   ? 42.903  80.822  9.860   1.00 21.30  ? 13   DT  G "C3'" 1 
ATOM   253   O  "O3'" . DT  A  1  13   ? 43.775  80.524  8.781   1.00 22.00  ? 13   DT  G "O3'" 1 
ATOM   254   C  "C2'" . DT  A  1  13   ? 41.723  81.575  9.315   1.00 19.84  ? 13   DT  G "C2'" 1 
ATOM   255   C  "C1'" . DT  A  1  13   ? 40.539  80.634  9.407   1.00 18.49  ? 13   DT  G "C1'" 1 
ATOM   256   N  N1    . DT  A  1  13   ? 39.392  81.457  9.823   1.00 19.29  ? 13   DT  G N1    1 
ATOM   257   C  C2    . DT  A  1  13   ? 38.249  81.506  9.041   1.00 21.09  ? 13   DT  G C2    1 
ATOM   258   O  O2    . DT  A  1  13   ? 38.053  80.780  8.089   1.00 20.78  ? 13   DT  G O2    1 
ATOM   259   N  N3    . DT  A  1  13   ? 37.331  82.466  9.427   1.00 23.65  ? 13   DT  G N3    1 
ATOM   260   C  C4    . DT  A  1  13   ? 37.449  83.338  10.515  1.00 26.01  ? 13   DT  G C4    1 
ATOM   261   O  O4    . DT  A  1  13   ? 36.583  84.158  10.746  1.00 25.13  ? 13   DT  G O4    1 
ATOM   262   C  C5    . DT  A  1  13   ? 38.647  83.189  11.309  1.00 25.96  ? 13   DT  G C5    1 
ATOM   263   C  C7    . DT  A  1  13   ? 38.860  84.102  12.483  1.00 24.67  ? 13   DT  G C7    1 
ATOM   264   C  C6    . DT  A  1  13   ? 39.525  82.251  10.943  1.00 23.27  ? 13   DT  G C6    1 
ATOM   265   P  P     . DT  A  1  14   ? 44.690  81.707  8.200   1.00 25.44  ? 14   DT  G P     1 
ATOM   266   O  OP1   . DT  A  1  14   ? 44.244  82.899  8.956   1.00 23.63  ? 14   DT  G OP1   1 
ATOM   267   O  OP2   . DT  A  1  14   ? 44.624  81.756  6.725   1.00 25.75  ? 14   DT  G OP2   1 
ATOM   268   O  "O5'" . DT  A  1  14   ? 46.159  81.298  8.660   1.00 24.98  ? 14   DT  G "O5'" 1 
ATOM   269   C  "C5'" . DT  A  1  14   ? 46.861  80.263  7.985   1.00 28.78  ? 14   DT  G "C5'" 1 
ATOM   270   C  "C4'" . DT  A  1  14   ? 48.295  80.168  8.450   1.00 32.98  ? 14   DT  G "C4'" 1 
ATOM   271   O  "O4'" . DT  A  1  14   ? 48.993  79.608  7.307   1.00 32.70  ? 14   DT  G "O4'" 1 
ATOM   272   C  "C3'" . DT  A  1  14   ? 48.987  81.494  8.772   1.00 34.58  ? 14   DT  G "C3'" 1 
ATOM   273   O  "O3'" . DT  A  1  14   ? 49.808  81.433  9.964   1.00 37.45  ? 14   DT  G "O3'" 1 
ATOM   274   C  "C2'" . DT  A  1  14   ? 49.791  81.824  7.525   1.00 34.01  ? 14   DT  G "C2'" 1 
ATOM   275   C  "C1'" . DT  A  1  14   ? 49.872  80.547  6.696   1.00 32.17  ? 14   DT  G "C1'" 1 
ATOM   276   N  N1    . DT  A  1  14   ? 49.381  80.830  5.309   1.00 30.36  ? 14   DT  G N1    1 
ATOM   277   C  C2    . DT  A  1  14   ? 50.191  80.618  4.204   1.00 29.97  ? 14   DT  G C2    1 
ATOM   278   O  O2    . DT  A  1  14   ? 51.293  80.107  4.269   1.00 27.30  ? 14   DT  G O2    1 
ATOM   279   N  N3    . DT  A  1  14   ? 49.643  81.051  2.998   1.00 28.70  ? 14   DT  G N3    1 
ATOM   280   C  C4    . DT  A  1  14   ? 48.409  81.647  2.813   1.00 28.40  ? 14   DT  G C4    1 
ATOM   281   O  O4    . DT  A  1  14   ? 48.051  81.988  1.701   1.00 27.85  ? 14   DT  G O4    1 
ATOM   282   C  C5    . DT  A  1  14   ? 47.622  81.804  3.996   1.00 29.64  ? 14   DT  G C5    1 
ATOM   283   C  C7    . DT  A  1  14   ? 46.279  82.454  3.882   1.00 29.51  ? 14   DT  G C7    1 
ATOM   284   C  C6    . DT  A  1  14   ? 48.124  81.376  5.160   1.00 30.71  ? 14   DT  G C6    1 
ATOM   285   P  P     . DC  A  1  15   ? 50.251  82.806  10.713  1.00 40.32  ? 15   DC  G P     1 
ATOM   286   O  OP1   . DC  A  1  15   ? 50.253  82.615  12.199  1.00 39.01  ? 15   DC  G OP1   1 
ATOM   287   O  OP2   . DC  A  1  15   ? 49.505  83.964  10.122  1.00 39.55  ? 15   DC  G OP2   1 
ATOM   288   O  "O5'" . DC  A  1  15   ? 51.761  82.985  10.259  1.00 38.64  ? 15   DC  G "O5'" 1 
ATOM   289   C  "C5'" . DC  A  1  15   ? 52.326  82.093  9.316   1.00 38.26  ? 15   DC  G "C5'" 1 
ATOM   290   C  "C4'" . DC  A  1  15   ? 53.599  82.667  8.763   1.00 38.54  ? 15   DC  G "C4'" 1 
ATOM   291   O  "O4'" . DC  A  1  15   ? 53.574  82.389  7.348   1.00 38.25  ? 15   DC  G "O4'" 1 
ATOM   292   C  "C3'" . DC  A  1  15   ? 53.693  84.179  8.905   1.00 38.39  ? 15   DC  G "C3'" 1 
ATOM   293   O  "O3'" . DC  A  1  15   ? 54.780  84.551  9.724   1.00 39.48  ? 15   DC  G "O3'" 1 
ATOM   294   C  "C2'" . DC  A  1  15   ? 53.927  84.689  7.502   1.00 38.86  ? 15   DC  G "C2'" 1 
ATOM   295   C  "C1'" . DC  A  1  15   ? 54.078  83.471  6.614   1.00 39.07  ? 15   DC  G "C1'" 1 
ATOM   296   N  N1    . DC  A  1  15   ? 53.233  83.647  5.429   1.00 40.60  ? 15   DC  G N1    1 
ATOM   297   C  C2    . DC  A  1  15   ? 53.805  83.622  4.161   1.00 41.21  ? 15   DC  G C2    1 
ATOM   298   O  O2    . DC  A  1  15   ? 54.977  83.280  4.040   1.00 41.65  ? 15   DC  G O2    1 
ATOM   299   N  N3    . DC  A  1  15   ? 53.055  83.983  3.094   1.00 42.01  ? 15   DC  G N3    1 
ATOM   300   C  C4    . DC  A  1  15   ? 51.785  84.328  3.256   1.00 42.68  ? 15   DC  G C4    1 
ATOM   301   N  N4    . DC  A  1  15   ? 51.104  84.708  2.178   1.00 42.82  ? 15   DC  G N4    1 
ATOM   302   C  C5    . DC  A  1  15   ? 51.157  84.299  4.530   1.00 43.68  ? 15   DC  G C5    1 
ATOM   303   C  C6    . DC  A  1  15   ? 51.905  83.935  5.577   1.00 42.75  ? 15   DC  G C6    1 
ATOM   304   P  P     . DG  A  1  16   ? 54.979  86.088  10.097  1.00 42.13  ? 16   DG  G P     1 
ATOM   305   O  OP1   . DG  A  1  16   ? 55.825  86.145  11.305  1.00 41.70  ? 16   DG  G OP1   1 
ATOM   306   O  OP2   . DG  A  1  16   ? 53.685  86.819  10.069  1.00 42.71  ? 16   DG  G OP2   1 
ATOM   307   O  "O5'" . DG  A  1  16   ? 55.841  86.618  8.886   1.00 40.95  ? 16   DG  G "O5'" 1 
ATOM   308   C  "C5'" . DG  A  1  16   ? 57.127  86.104  8.709   1.00 41.06  ? 16   DG  G "C5'" 1 
ATOM   309   C  "C4'" . DG  A  1  16   ? 57.710  86.604  7.419   1.00 42.26  ? 16   DG  G "C4'" 1 
ATOM   310   O  "O4'" . DG  A  1  16   ? 56.973  86.023  6.316   1.00 41.23  ? 16   DG  G "O4'" 1 
ATOM   311   C  "C3'" . DG  A  1  16   ? 57.589  88.111  7.263   1.00 41.83  ? 16   DG  G "C3'" 1 
ATOM   312   O  "O3'" . DG  A  1  16   ? 58.839  88.767  7.379   1.00 45.06  ? 16   DG  G "O3'" 1 
ATOM   313   C  "C2'" . DG  A  1  16   ? 57.040  88.299  5.866   1.00 41.87  ? 16   DG  G "C2'" 1 
ATOM   314   C  "C1'" . DG  A  1  16   ? 57.026  86.919  5.237   1.00 42.66  ? 16   DG  G "C1'" 1 
ATOM   315   N  N9    . DG  A  1  16   ? 55.784  86.824  4.487   1.00 43.70  ? 16   DG  G N9    1 
ATOM   316   C  C8    . DG  A  1  16   ? 54.525  86.680  4.993   1.00 44.07  ? 16   DG  G C8    1 
ATOM   317   N  N7    . DG  A  1  16   ? 53.590  86.869  4.106   1.00 43.61  ? 16   DG  G N7    1 
ATOM   318   C  C5    . DG  A  1  16   ? 54.279  87.100  2.935   1.00 45.24  ? 16   DG  G C5    1 
ATOM   319   C  C6    . DG  A  1  16   ? 53.799  87.394  1.640   1.00 47.16  ? 16   DG  G C6    1 
ATOM   320   O  O6    . DG  A  1  16   ? 52.638  87.516  1.273   1.00 49.70  ? 16   DG  G O6    1 
ATOM   321   N  N1    . DG  A  1  16   ? 54.835  87.561  0.726   1.00 47.30  ? 16   DG  G N1    1 
ATOM   322   C  C2    . DG  A  1  16   ? 56.172  87.457  1.038   1.00 47.54  ? 16   DG  G C2    1 
ATOM   323   N  N2    . DG  A  1  16   ? 57.035  87.637  0.025   1.00 48.36  ? 16   DG  G N2    1 
ATOM   324   N  N3    . DG  A  1  16   ? 56.632  87.193  2.256   1.00 46.31  ? 16   DG  G N3    1 
ATOM   325   C  C4    . DG  A  1  16   ? 55.635  87.028  3.145   1.00 45.01  ? 16   DG  G C4    1 
ATOM   326   P  P     . DC  A  1  17   ? 58.868  90.377  7.402   1.00 48.83  ? 17   DC  G P     1 
ATOM   327   O  OP1   . DC  A  1  17   ? 60.151  90.891  8.014   1.00 47.57  ? 17   DC  G OP1   1 
ATOM   328   O  OP2   . DC  A  1  17   ? 57.570  90.815  7.975   1.00 48.41  ? 17   DC  G OP2   1 
ATOM   329   O  "O5'" . DC  A  1  17   ? 58.817  90.720  5.842   1.00 46.23  ? 17   DC  G "O5'" 1 
ATOM   330   C  "C5'" . DC  A  1  17   ? 59.794  90.181  4.948   1.00 43.90  ? 17   DC  G "C5'" 1 
ATOM   331   C  "C4'" . DC  A  1  17   ? 59.802  90.952  3.653   1.00 41.69  ? 17   DC  G "C4'" 1 
ATOM   332   O  "O4'" . DC  A  1  17   ? 58.814  90.360  2.778   1.00 41.07  ? 17   DC  G "O4'" 1 
ATOM   333   C  "C3'" . DC  A  1  17   ? 59.407  92.418  3.832   1.00 40.35  ? 17   DC  G "C3'" 1 
ATOM   334   O  "O3'" . DC  A  1  17   ? 60.366  93.351  3.357   1.00 37.00  ? 17   DC  G "O3'" 1 
ATOM   335   C  "C2'" . DC  A  1  17   ? 58.134  92.576  3.036   1.00 40.77  ? 17   DC  G "C2'" 1 
ATOM   336   C  "C1'" . DC  A  1  17   ? 58.073  91.374  2.130   1.00 41.90  ? 17   DC  G "C1'" 1 
ATOM   337   N  N1    . DC  A  1  17   ? 56.653  90.988  2.086   1.00 43.66  ? 17   DC  G N1    1 
ATOM   338   C  C2    . DC  A  1  17   ? 55.939  91.239  0.913   1.00 43.81  ? 17   DC  G C2    1 
ATOM   339   O  O2    . DC  A  1  17   ? 56.564  91.577  -0.110  1.00 43.18  ? 17   DC  G O2    1 
ATOM   340   N  N3    . DC  A  1  17   ? 54.585  91.114  0.928   1.00 43.47  ? 17   DC  G N3    1 
ATOM   341   C  C4    . DC  A  1  17   ? 53.958  90.731  2.042   1.00 42.23  ? 17   DC  G C4    1 
ATOM   342   N  N4    . DC  A  1  17   ? 52.628  90.678  2.017   1.00 40.90  ? 17   DC  G N4    1 
ATOM   343   C  C5    . DC  A  1  17   ? 54.670  90.392  3.226   1.00 41.64  ? 17   DC  G C5    1 
ATOM   344   C  C6    . DC  A  1  17   ? 56.006  90.510  3.198   1.00 42.98  ? 17   DC  G C6    1 
ATOM   345   P  P     . DG  A  1  18   ? 60.205  94.913  3.732   1.00 35.22  ? 18   DG  G P     1 
ATOM   346   O  OP1   . DG  A  1  18   ? 61.441  95.461  4.359   1.00 35.15  ? 18   DG  G OP1   1 
ATOM   347   O  OP2   . DG  A  1  18   ? 58.895  95.094  4.413   1.00 33.18  ? 18   DG  G OP2   1 
ATOM   348   O  "O5'" . DG  A  1  18   ? 60.113  95.564  2.297   1.00 32.51  ? 18   DG  G "O5'" 1 
ATOM   349   C  "C5'" . DG  A  1  18   ? 59.507  94.837  1.267   1.00 28.76  ? 18   DG  G "C5'" 1 
ATOM   350   C  "C4'" . DG  A  1  18   ? 59.453  95.660  0.019   1.00 27.10  ? 18   DG  G "C4'" 1 
ATOM   351   O  "O4'" . DG  A  1  18   ? 58.486  94.924  -0.747  1.00 25.54  ? 18   DG  G "O4'" 1 
ATOM   352   C  "C3'" . DG  A  1  18   ? 58.855  97.027  0.295   1.00 26.91  ? 18   DG  G "C3'" 1 
ATOM   353   O  "O3'" . DG  A  1  18   ? 59.635  98.128  -0.136  1.00 28.68  ? 18   DG  G "O3'" 1 
ATOM   354   C  "C2'" . DG  A  1  18   ? 57.513  97.034  -0.388  1.00 26.58  ? 18   DG  G "C2'" 1 
ATOM   355   C  "C1'" . DG  A  1  18   ? 57.331  95.676  -0.989  1.00 26.11  ? 18   DG  G "C1'" 1 
ATOM   356   N  N9    . DG  A  1  18   ? 56.225  95.117  -0.229  1.00 25.82  ? 18   DG  G N9    1 
ATOM   357   C  C8    . DG  A  1  18   ? 56.202  94.611  1.047   1.00 24.59  ? 18   DG  G C8    1 
ATOM   358   N  N7    . DG  A  1  18   ? 54.991  94.402  1.488   1.00 24.46  ? 18   DG  G N7    1 
ATOM   359   C  C5    . DG  A  1  18   ? 54.184  94.749  0.419   1.00 26.26  ? 18   DG  G C5    1 
ATOM   360   C  C6    . DG  A  1  18   ? 52.774  94.747  0.276   1.00 26.65  ? 18   DG  G C6    1 
ATOM   361   O  O6    . DG  A  1  18   ? 51.917  94.428  1.094   1.00 25.56  ? 18   DG  G O6    1 
ATOM   362   N  N1    . DG  A  1  18   ? 52.395  95.180  -0.990  1.00 29.53  ? 18   DG  G N1    1 
ATOM   363   C  C2    . DG  A  1  18   ? 53.268  95.567  -1.989  1.00 31.29  ? 18   DG  G C2    1 
ATOM   364   N  N2    . DG  A  1  18   ? 52.760  95.953  -3.161  1.00 33.45  ? 18   DG  G N2    1 
ATOM   365   N  N3    . DG  A  1  18   ? 54.562  95.573  -1.857  1.00 29.21  ? 18   DG  G N3    1 
ATOM   366   C  C4    . DG  A  1  18   ? 54.947  95.156  -0.649  1.00 26.55  ? 18   DG  G C4    1 
ATOM   367   P  P     . DC  A  1  19   ? 59.278  99.586  0.448   1.00 31.11  ? 19   DC  G P     1 
ATOM   368   O  OP1   . DC  A  1  19   ? 60.478  100.427 0.696   1.00 28.24  ? 19   DC  G OP1   1 
ATOM   369   O  OP2   . DC  A  1  19   ? 58.313  99.354  1.555   1.00 30.19  ? 19   DC  G OP2   1 
ATOM   370   O  "O5'" . DC  A  1  19   ? 58.409  100.234 -0.724  1.00 31.72  ? 19   DC  G "O5'" 1 
ATOM   371   C  "C5'" . DC  A  1  19   ? 58.281  99.610  -2.020  1.00 28.25  ? 19   DC  G "C5'" 1 
ATOM   372   C  "C4'" . DC  A  1  19   ? 57.006  100.067 -2.683  1.00 24.72  ? 19   DC  G "C4'" 1 
ATOM   373   O  "O4'" . DC  A  1  19   ? 55.915  99.195  -2.308  1.00 22.56  ? 19   DC  G "O4'" 1 
ATOM   374   C  "C3'" . DC  A  1  19   ? 56.654  101.448 -2.162  1.00 24.60  ? 19   DC  G "C3'" 1 
ATOM   375   O  "O3'" . DC  A  1  19   ? 56.515  102.418 -3.160  1.00 28.27  ? 19   DC  G "O3'" 1 
ATOM   376   C  "C2'" . DC  A  1  19   ? 55.377  101.271 -1.380  1.00 24.81  ? 19   DC  G "C2'" 1 
ATOM   377   C  "C1'" . DC  A  1  19   ? 54.821  99.960  -1.873  1.00 24.81  ? 19   DC  G "C1'" 1 
ATOM   378   N  N1    . DC  A  1  19   ? 54.148  99.245  -0.780  1.00 27.77  ? 19   DC  G N1    1 
ATOM   379   C  C2    . DC  A  1  19   ? 52.790  99.122  -0.844  1.00 29.62  ? 19   DC  G C2    1 
ATOM   380   O  O2    . DC  A  1  19   ? 52.227  99.509  -1.856  1.00 33.07  ? 19   DC  G O2    1 
ATOM   381   N  N3    . DC  A  1  19   ? 52.110  98.596  0.194   1.00 31.07  ? 19   DC  G N3    1 
ATOM   382   C  C4    . DC  A  1  19   ? 52.762  98.186  1.271   1.00 31.15  ? 19   DC  G C4    1 
ATOM   383   N  N4    . DC  A  1  19   ? 52.039  97.705  2.278   1.00 32.84  ? 19   DC  G N4    1 
ATOM   384   C  C5    . DC  A  1  19   ? 54.178  98.261  1.357   1.00 30.85  ? 19   DC  G C5    1 
ATOM   385   C  C6    . DC  A  1  19   ? 54.829  98.781  0.309   1.00 29.61  ? 19   DC  G C6    1 
ATOM   386   P  P     . DG  A  1  20   ? 56.564  103.958 -2.729  1.00 32.81  ? 20   DG  G P     1 
ATOM   387   O  OP1   . DG  A  1  20   ? 56.871  104.781 -3.936  1.00 30.76  ? 20   DG  G OP1   1 
ATOM   388   O  OP2   . DG  A  1  20   ? 57.439  104.060 -1.518  1.00 32.46  ? 20   DG  G OP2   1 
ATOM   389   O  "O5'" . DG  A  1  20   ? 55.055  104.225 -2.291  1.00 30.41  ? 20   DG  G "O5'" 1 
ATOM   390   C  "C5'" . DG  A  1  20   ? 54.013  104.085 -3.249  1.00 28.98  ? 20   DG  G "C5'" 1 
ATOM   391   C  "C4'" . DG  A  1  20   ? 52.717  104.632 -2.705  1.00 27.05  ? 20   DG  G "C4'" 1 
ATOM   392   O  "O4'" . DG  A  1  20   ? 51.918  103.620 -2.053  1.00 25.70  ? 20   DG  G "O4'" 1 
ATOM   393   C  "C3'" . DG  A  1  20   ? 52.865  105.787 -1.722  1.00 24.00  ? 20   DG  G "C3'" 1 
ATOM   394   O  "O3'" . DG  A  1  20   ? 51.908  106.782 -2.075  1.00 23.38  ? 20   DG  G "O3'" 1 
ATOM   395   C  "C2'" . DG  A  1  20   ? 52.531  105.146 -0.394  1.00 24.64  ? 20   DG  G "C2'" 1 
ATOM   396   C  "C1'" . DG  A  1  20   ? 51.523  104.078 -0.784  1.00 21.74  ? 20   DG  G "C1'" 1 
ATOM   397   N  N9    . DG  A  1  20   ? 51.560  102.951 0.128   1.00 19.49  ? 20   DG  G N9    1 
ATOM   398   C  C8    . DG  A  1  20   ? 52.667  102.312 0.610   1.00 15.17  ? 20   DG  G C8    1 
ATOM   399   N  N7    . DG  A  1  20   ? 52.381  101.420 1.509   1.00 18.34  ? 20   DG  G N7    1 
ATOM   400   C  C5    . DG  A  1  20   ? 50.997  101.454 1.602   1.00 19.89  ? 20   DG  G C5    1 
ATOM   401   C  C6    . DG  A  1  20   ? 50.103  100.710 2.425   1.00 19.37  ? 20   DG  G C6    1 
ATOM   402   O  O6    . DG  A  1  20   ? 50.372  99.864  3.267   1.00 18.13  ? 20   DG  G O6    1 
ATOM   403   N  N1    . DG  A  1  20   ? 48.770  101.054 2.188   1.00 19.24  ? 20   DG  G N1    1 
ATOM   404   C  C2    . DG  A  1  20   ? 48.353  102.002 1.281   1.00 18.18  ? 20   DG  G C2    1 
ATOM   405   N  N2    . DG  A  1  20   ? 47.024  102.211 1.192   1.00 15.46  ? 20   DG  G N2    1 
ATOM   406   N  N3    . DG  A  1  20   ? 49.182  102.705 0.515   1.00 21.10  ? 20   DG  G N3    1 
ATOM   407   C  C4    . DG  A  1  20   ? 50.478  102.378 0.732   1.00 20.44  ? 20   DG  G C4    1 
ATOM   408   P  P     . DC  A  1  21   ? 51.680  108.035 -1.127  1.00 24.65  ? 21   DC  G P     1 
ATOM   409   O  OP1   . DC  A  1  21   ? 51.371  109.210 -1.971  1.00 23.32  ? 21   DC  G OP1   1 
ATOM   410   O  OP2   . DC  A  1  21   ? 52.789  108.096 -0.139  1.00 25.23  ? 21   DC  G OP2   1 
ATOM   411   O  "O5'" . DC  A  1  21   ? 50.341  107.637 -0.414  1.00 25.40  ? 21   DC  G "O5'" 1 
ATOM   412   C  "C5'" . DC  A  1  21   ? 49.269  107.183 -1.206  1.00 30.88  ? 21   DC  G "C5'" 1 
ATOM   413   C  "C4'" . DC  A  1  21   ? 48.033  107.090 -0.361  1.00 34.50  ? 21   DC  G "C4'" 1 
ATOM   414   O  "O4'" . DC  A  1  21   ? 48.146  105.918 0.471   1.00 35.78  ? 21   DC  G "O4'" 1 
ATOM   415   C  "C3'" . DC  A  1  21   ? 47.940  108.290 0.577   1.00 34.54  ? 21   DC  G "C3'" 1 
ATOM   416   O  "O3'" . DC  A  1  21   ? 46.624  108.811 0.648   1.00 31.78  ? 21   DC  G "O3'" 1 
ATOM   417   C  "C2'" . DC  A  1  21   ? 48.394  107.741 1.909   1.00 37.30  ? 21   DC  G "C2'" 1 
ATOM   418   C  "C1'" . DC  A  1  21   ? 47.969  106.298 1.811   1.00 40.34  ? 21   DC  G "C1'" 1 
ATOM   419   N  N1    . DC  A  1  21   ? 48.740  105.387 2.655   1.00 46.56  ? 21   DC  G N1    1 
ATOM   420   C  C2    . DC  A  1  21   ? 48.038  104.590 3.558   1.00 51.08  ? 21   DC  G C2    1 
ATOM   421   O  O2    . DC  A  1  21   ? 46.793  104.643 3.562   1.00 52.93  ? 21   DC  G O2    1 
ATOM   422   N  N3    . DC  A  1  21   ? 48.718  103.787 4.405   1.00 53.36  ? 21   DC  G N3    1 
ATOM   423   C  C4    . DC  A  1  21   ? 50.049  103.750 4.361   1.00 54.08  ? 21   DC  G C4    1 
ATOM   424   N  N4    . DC  A  1  21   ? 50.665  102.942 5.227   1.00 56.52  ? 21   DC  G N4    1 
ATOM   425   C  C5    . DC  A  1  21   ? 50.799  104.536 3.431   1.00 52.48  ? 21   DC  G C5    1 
ATOM   426   C  C6    . DC  A  1  21   ? 50.107  105.330 2.597   1.00 49.00  ? 21   DC  G C6    1 
ATOM   427   P  P     . DC  A  1  22   ? 46.382  110.242 1.315   1.00 31.25  ? 22   DC  G P     1 
ATOM   428   O  OP1   . DC  A  1  22   ? 45.328  110.935 0.540   1.00 29.32  ? 22   DC  G OP1   1 
ATOM   429   O  OP2   . DC  A  1  22   ? 47.702  110.886 1.499   1.00 28.38  ? 22   DC  G OP2   1 
ATOM   430   O  "O5'" . DC  A  1  22   ? 45.826  109.858 2.747   1.00 30.59  ? 22   DC  G "O5'" 1 
ATOM   431   C  "C5'" . DC  A  1  22   ? 44.609  109.141 2.882   1.00 34.88  ? 22   DC  G "C5'" 1 
ATOM   432   C  "C4'" . DC  A  1  22   ? 44.226  109.049 4.338   1.00 39.51  ? 22   DC  G "C4'" 1 
ATOM   433   O  "O4'" . DC  A  1  22   ? 44.877  107.909 4.952   1.00 40.15  ? 22   DC  G "O4'" 1 
ATOM   434   C  "C3'" . DC  A  1  22   ? 44.676  110.285 5.117   1.00 41.24  ? 22   DC  G "C3'" 1 
ATOM   435   O  "O3'" . DC  A  1  22   ? 43.706  110.739 6.072   1.00 44.67  ? 22   DC  G "O3'" 1 
ATOM   436   C  "C2'" . DC  A  1  22   ? 45.924  109.807 5.826   1.00 42.83  ? 22   DC  G "C2'" 1 
ATOM   437   C  "C1'" . DC  A  1  22   ? 45.594  108.352 6.088   1.00 41.46  ? 22   DC  G "C1'" 1 
ATOM   438   N  N1    . DC  A  1  22   ? 46.759  107.471 6.302   1.00 41.06  ? 22   DC  G N1    1 
ATOM   439   C  C2    . DC  A  1  22   ? 46.671  106.522 7.294   1.00 41.06  ? 22   DC  G C2    1 
ATOM   440   O  O2    . DC  A  1  22   ? 45.623  106.452 7.949   1.00 43.03  ? 22   DC  G O2    1 
ATOM   441   N  N3    . DC  A  1  22   ? 47.716  105.710 7.525   1.00 41.48  ? 22   DC  G N3    1 
ATOM   442   C  C4    . DC  A  1  22   ? 48.827  105.829 6.804   1.00 40.65  ? 22   DC  G C4    1 
ATOM   443   N  N4    . DC  A  1  22   ? 49.832  105.003 7.073   1.00 39.96  ? 22   DC  G N4    1 
ATOM   444   C  C5    . DC  A  1  22   ? 48.954  106.798 5.781   1.00 40.78  ? 22   DC  G C5    1 
ATOM   445   C  C6    . DC  A  1  22   ? 47.903  107.592 5.558   1.00 40.69  ? 22   DC  G C6    1 
ATOM   446   P  P     . DG  A  1  23   ? 43.841  112.226 6.690   1.00 48.41  ? 23   DG  G P     1 
ATOM   447   O  OP1   . DG  A  1  23   ? 42.891  113.146 5.996   1.00 45.59  ? 23   DG  G OP1   1 
ATOM   448   O  OP2   . DG  A  1  23   ? 45.292  112.537 6.677   1.00 47.67  ? 23   DG  G OP2   1 
ATOM   449   O  "O5'" . DG  A  1  23   ? 43.426  112.060 8.226   1.00 50.61  ? 23   DG  G "O5'" 1 
ATOM   450   C  "C5'" . DG  A  1  23   ? 42.166  111.479 8.597   1.00 53.15  ? 23   DG  G "C5'" 1 
ATOM   451   C  "C4'" . DG  A  1  23   ? 42.181  111.018 10.042  1.00 55.04  ? 23   DG  G "C4'" 1 
ATOM   452   O  "O4'" . DG  A  1  23   ? 43.227  110.038 10.244  1.00 54.32  ? 23   DG  G "O4'" 1 
ATOM   453   C  "C3'" . DG  A  1  23   ? 42.415  112.094 11.103  1.00 55.91  ? 23   DG  G "C3'" 1 
ATOM   454   O  "O3'" . DG  A  1  23   ? 41.810  111.684 12.340  1.00 54.93  ? 23   DG  G "O3'" 1 
ATOM   455   C  "C2'" . DG  A  1  23   ? 43.916  112.030 11.315  1.00 57.27  ? 23   DG  G "C2'" 1 
ATOM   456   C  "C1'" . DG  A  1  23   ? 44.218  110.554 11.118  1.00 57.17  ? 23   DG  G "C1'" 1 
ATOM   457   N  N9    . DG  A  1  23   ? 45.520  110.263 10.524  1.00 60.44  ? 23   DG  G N9    1 
ATOM   458   C  C8    . DG  A  1  23   ? 46.129  110.882 9.458   1.00 60.32  ? 23   DG  G C8    1 
ATOM   459   N  N7    . DG  A  1  23   ? 47.288  110.357 9.158   1.00 61.46  ? 23   DG  G N7    1 
ATOM   460   C  C5    . DG  A  1  23   ? 47.452  109.337 10.085  1.00 62.60  ? 23   DG  G C5    1 
ATOM   461   C  C6    . DG  A  1  23   ? 48.514  108.405 10.269  1.00 62.56  ? 23   DG  G C6    1 
ATOM   462   O  O6    . DG  A  1  23   ? 49.553  108.298 9.628   1.00 63.07  ? 23   DG  G O6    1 
ATOM   463   N  N1    . DG  A  1  23   ? 48.268  107.543 11.336  1.00 63.11  ? 23   DG  G N1    1 
ATOM   464   C  C2    . DG  A  1  23   ? 47.152  107.578 12.124  1.00 64.14  ? 23   DG  G C2    1 
ATOM   465   N  N2    . DG  A  1  23   ? 47.082  106.683 13.105  1.00 64.98  ? 23   DG  G N2    1 
ATOM   466   N  N3    . DG  A  1  23   ? 46.162  108.436 11.965  1.00 65.39  ? 23   DG  G N3    1 
ATOM   467   C  C4    . DG  A  1  23   ? 46.374  109.276 10.937  1.00 62.96  ? 23   DG  G C4    1 
ATOM   468   O  OP3   . G   B  2  1    ? 88.895  107.799 26.504  1.00 93.35  ? 1    G   H OP3   1 
ATOM   469   P  P     . G   B  2  1    ? 88.226  108.386 25.282  1.00 93.21  ? 1    G   H P     1 
ATOM   470   O  OP1   . G   B  2  1    ? 89.080  109.574 25.114  1.00 92.43  ? 1    G   H OP1   1 
ATOM   471   O  OP2   . G   B  2  1    ? 88.317  107.534 24.080  1.00 93.48  ? 1    G   H OP2   1 
ATOM   472   O  "O5'" . G   B  2  1    ? 86.656  108.824 25.513  1.00 92.77  ? 1    G   H "O5'" 1 
ATOM   473   C  "C5'" . G   B  2  1    ? 85.690  107.822 26.088  1.00 91.85  ? 1    G   H "C5'" 1 
ATOM   474   C  "C4'" . G   B  2  1    ? 84.200  108.256 26.143  1.00 91.86  ? 1    G   H "C4'" 1 
ATOM   475   O  "O4'" . G   B  2  1    ? 84.218  109.374 27.030  1.00 90.74  ? 1    G   H "O4'" 1 
ATOM   476   C  "C3'" . G   B  2  1    ? 83.686  108.707 24.773  1.00 92.17  ? 1    G   H "C3'" 1 
ATOM   477   O  "O3'" . G   B  2  1    ? 83.120  107.479 24.092  1.00 94.25  ? 1    G   H "O3'" 1 
ATOM   478   C  "C2'" . G   B  2  1    ? 82.742  109.857 25.233  1.00 91.39  ? 1    G   H "C2'" 1 
ATOM   479   O  "O2'" . G   B  2  1    ? 81.414  109.447 25.507  1.00 90.93  ? 1    G   H "O2'" 1 
ATOM   480   C  "C1'" . G   B  2  1    ? 83.267  110.349 26.658  1.00 90.29  ? 1    G   H "C1'" 1 
ATOM   481   N  N9    . G   B  2  1    ? 83.874  111.449 27.434  1.00 89.39  ? 1    G   H N9    1 
ATOM   482   C  C8    . G   B  2  1    ? 85.003  112.157 27.101  1.00 88.70  ? 1    G   H C8    1 
ATOM   483   N  N7    . G   B  2  1    ? 85.258  113.163 27.901  1.00 88.53  ? 1    G   H N7    1 
ATOM   484   C  C5    . G   B  2  1    ? 84.216  113.084 28.847  1.00 88.37  ? 1    G   H C5    1 
ATOM   485   C  C6    . G   B  2  1    ? 83.930  113.915 29.955  1.00 87.59  ? 1    G   H C6    1 
ATOM   486   O  O6    . G   B  2  1    ? 84.520  114.921 30.355  1.00 87.78  ? 1    G   H O6    1 
ATOM   487   N  N1    . G   B  2  1    ? 82.822  113.471 30.658  1.00 87.61  ? 1    G   H N1    1 
ATOM   488   C  C2    . G   B  2  1    ? 82.075  112.369 30.338  1.00 88.82  ? 1    G   H C2    1 
ATOM   489   N  N2    . G   B  2  1    ? 81.046  112.129 31.157  1.00 89.36  ? 1    G   H N2    1 
ATOM   490   N  N3    . G   B  2  1    ? 82.318  111.590 29.296  1.00 89.64  ? 1    G   H N3    1 
ATOM   491   C  C4    . G   B  2  1    ? 83.399  112.037 28.598  1.00 89.20  ? 1    G   H C4    1 
ATOM   492   P  P     . A   B  2  2    ? 82.250  107.001 22.793  1.00 95.23  ? 2    A   H P     1 
ATOM   493   O  OP1   . A   B  2  2    ? 81.673  105.674 23.110  1.00 95.24  ? 2    A   H OP1   1 
ATOM   494   O  OP2   . A   B  2  2    ? 83.196  106.818 21.675  1.00 96.05  ? 2    A   H OP2   1 
ATOM   495   O  "O5'" . A   B  2  2    ? 80.973  107.973 22.390  1.00 95.13  ? 2    A   H "O5'" 1 
ATOM   496   C  "C5'" . A   B  2  2    ? 80.803  109.375 22.790  1.00 94.19  ? 2    A   H "C5'" 1 
ATOM   497   C  "C4'" . A   B  2  2    ? 79.357  109.951 22.692  1.00 93.56  ? 2    A   H "C4'" 1 
ATOM   498   O  "O4'" . A   B  2  2    ? 79.144  110.593 21.376  1.00 91.78  ? 2    A   H "O4'" 1 
ATOM   499   C  "C3'" . A   B  2  2    ? 78.138  109.057 22.686  1.00 93.18  ? 2    A   H "C3'" 1 
ATOM   500   O  "O3'" . A   B  2  2    ? 77.780  108.629 23.956  1.00 93.98  ? 2    A   H "O3'" 1 
ATOM   501   C  "C2'" . A   B  2  2    ? 76.967  109.858 22.066  1.00 92.17  ? 2    A   H "C2'" 1 
ATOM   502   O  "O2'" . A   B  2  2    ? 76.258  110.668 22.982  1.00 91.32  ? 2    A   H "O2'" 1 
ATOM   503   C  "C1'" . A   B  2  2    ? 77.758  110.694 21.095  1.00 91.24  ? 2    A   H "C1'" 1 
ATOM   504   N  N9    . A   B  2  2    ? 77.329  110.034 19.872  1.00 90.36  ? 2    A   H N9    1 
ATOM   505   C  C8    . A   B  2  2    ? 77.540  108.753 19.499  1.00 90.08  ? 2    A   H C8    1 
ATOM   506   N  N7    . A   B  2  2    ? 76.981  108.437 18.374  1.00 89.07  ? 2    A   H N7    1 
ATOM   507   C  C5    . A   B  2  2    ? 76.341  109.587 17.977  1.00 89.93  ? 2    A   H C5    1 
ATOM   508   C  C6    . A   B  2  2    ? 75.552  109.913 16.865  1.00 90.72  ? 2    A   H C6    1 
ATOM   509   N  N6    . A   B  2  2    ? 75.231  109.012 15.901  1.00 91.59  ? 2    A   H N6    1 
ATOM   510   N  N1    . A   B  2  2    ? 75.091  111.183 16.771  1.00 91.68  ? 2    A   H N1    1 
ATOM   511   C  C2    . A   B  2  2    ? 75.416  112.057 17.735  1.00 90.83  ? 2    A   H C2    1 
ATOM   512   N  N3    . A   B  2  2    ? 76.152  111.868 18.827  1.00 90.02  ? 2    A   H N3    1 
ATOM   513   C  C4    . A   B  2  2    ? 76.559  110.598 18.887  1.00 90.01  ? 2    A   H C4    1 
ATOM   514   P  P     . G   B  2  3    ? 76.500  107.706 23.871  1.00 94.58  ? 3    G   H P     1 
ATOM   515   O  OP1   . G   B  2  3    ? 76.244  107.048 25.163  1.00 94.41  ? 3    G   H OP1   1 
ATOM   516   O  OP2   . G   B  2  3    ? 76.642  106.707 22.801  1.00 94.17  ? 3    G   H OP2   1 
ATOM   517   O  "O5'" . G   B  2  3    ? 75.321  108.752 23.525  1.00 94.66  ? 3    G   H "O5'" 1 
ATOM   518   C  "C5'" . G   B  2  3    ? 74.157  108.932 24.403  1.00 94.10  ? 3    G   H "C5'" 1 
ATOM   519   C  "C4'" . G   B  2  3    ? 72.994  109.541 23.608  1.00 92.66  ? 3    G   H "C4'" 1 
ATOM   520   O  "O4'" . G   B  2  3    ? 73.512  109.673 22.257  1.00 92.38  ? 3    G   H "O4'" 1 
ATOM   521   C  "C3'" . G   B  2  3    ? 71.725  108.656 23.421  1.00 91.77  ? 3    G   H "C3'" 1 
ATOM   522   O  "O3'" . G   B  2  3    ? 70.768  108.858 24.467  1.00 91.03  ? 3    G   H "O3'" 1 
ATOM   523   C  "C2'" . G   B  2  3    ? 71.210  109.059 22.044  1.00 91.29  ? 3    G   H "C2'" 1 
ATOM   524   O  "O2'" . G   B  2  3    ? 70.406  110.231 22.046  1.00 91.59  ? 3    G   H "O2'" 1 
ATOM   525   C  "C1'" . G   B  2  3    ? 72.516  109.413 21.338  1.00 91.72  ? 3    G   H "C1'" 1 
ATOM   526   N  N9    . G   B  2  3    ? 72.934  108.226 20.587  1.00 91.87  ? 3    G   H N9    1 
ATOM   527   C  C8    . G   B  2  3    ? 73.549  107.076 21.023  1.00 92.05  ? 3    G   H C8    1 
ATOM   528   N  N7    . G   B  2  3    ? 73.694  106.167 20.103  1.00 92.63  ? 3    G   H N7    1 
ATOM   529   C  C5    . G   B  2  3    ? 73.114  106.756 18.976  1.00 92.91  ? 3    G   H C5    1 
ATOM   530   C  C6    . G   B  2  3    ? 72.950  106.246 17.658  1.00 93.93  ? 3    G   H C6    1 
ATOM   531   O  O6    . G   B  2  3    ? 73.274  105.159 17.208  1.00 94.05  ? 3    G   H O6    1 
ATOM   532   N  N1    . G   B  2  3    ? 72.337  107.180 16.827  1.00 94.81  ? 3    G   H N1    1 
ATOM   533   C  C2    . G   B  2  3    ? 71.933  108.440 17.213  1.00 94.73  ? 3    G   H C2    1 
ATOM   534   N  N2    . G   B  2  3    ? 71.358  109.163 16.267  1.00 96.05  ? 3    G   H N2    1 
ATOM   535   N  N3    . G   B  2  3    ? 72.082  108.922 18.434  1.00 93.34  ? 3    G   H N3    1 
ATOM   536   C  C4    . G   B  2  3    ? 72.676  108.034 19.257  1.00 92.43  ? 3    G   H C4    1 
ATOM   537   P  P     . U   B  2  4    ? 69.326  108.117 24.490  1.00 90.57  ? 4    U   H P     1 
ATOM   538   O  OP1   . U   B  2  4    ? 68.845  107.966 25.889  1.00 90.34  ? 4    U   H OP1   1 
ATOM   539   O  OP2   . U   B  2  4    ? 69.419  106.786 23.835  1.00 91.36  ? 4    U   H OP2   1 
ATOM   540   O  "O5'" . U   B  2  4    ? 68.361  109.096 23.623  1.00 90.55  ? 4    U   H "O5'" 1 
ATOM   541   C  "C5'" . U   B  2  4    ? 67.879  110.392 24.096  1.00 90.46  ? 4    U   H "C5'" 1 
ATOM   542   C  "C4'" . U   B  2  4    ? 67.347  111.220 22.921  1.00 90.24  ? 4    U   H "C4'" 1 
ATOM   543   O  "O4'" . U   B  2  4    ? 68.194  110.999 21.801  1.00 88.95  ? 4    U   H "O4'" 1 
ATOM   544   C  "C3'" . U   B  2  4    ? 65.971  110.844 22.365  1.00 90.91  ? 4    U   H "C3'" 1 
ATOM   545   O  "O3'" . U   B  2  4    ? 64.880  111.499 23.077  1.00 91.47  ? 4    U   H "O3'" 1 
ATOM   546   C  "C2'" . U   B  2  4    ? 66.023  111.280 20.914  1.00 90.49  ? 4    U   H "C2'" 1 
ATOM   547   O  "O2'" . U   B  2  4    ? 65.567  112.610 20.722  1.00 91.23  ? 4    U   H "O2'" 1 
ATOM   548   C  "C1'" . U   B  2  4    ? 67.490  111.158 20.591  1.00 88.98  ? 4    U   H "C1'" 1 
ATOM   549   N  N1    . U   B  2  4    ? 67.847  110.053 19.739  1.00 87.57  ? 4    U   H N1    1 
ATOM   550   C  C2    . U   B  2  4    ? 67.947  110.299 18.376  1.00 87.00  ? 4    U   H C2    1 
ATOM   551   O  O2    . U   B  2  4    ? 67.785  111.407 17.893  1.00 86.68  ? 4    U   H O2    1 
ATOM   552   N  N3    . U   B  2  4    ? 68.224  109.204 17.595  1.00 86.51  ? 4    U   H N3    1 
ATOM   553   C  C4    . U   B  2  4    ? 68.421  107.914 18.013  1.00 86.20  ? 4    U   H C4    1 
ATOM   554   O  O4    . U   B  2  4    ? 68.647  107.005 17.202  1.00 86.67  ? 4    U   H O4    1 
ATOM   555   C  C5    . U   B  2  4    ? 68.332  107.729 19.434  1.00 86.46  ? 4    U   H C5    1 
ATOM   556   C  C6    . U   B  2  4    ? 68.059  108.782 20.234  1.00 86.86  ? 4    U   H C6    1 
ATOM   557   P  P     . C   B  2  5    ? 63.487  110.715 23.287  1.00 91.54  ? 5    C   H P     1 
ATOM   558   O  OP1   . C   B  2  5    ? 62.737  111.304 24.432  1.00 92.21  ? 5    C   H OP1   1 
ATOM   559   O  OP2   . C   B  2  5    ? 63.805  109.257 23.303  1.00 91.86  ? 5    C   H OP2   1 
ATOM   560   O  "O5'" . C   B  2  5    ? 62.688  111.010 21.938  1.00 89.49  ? 5    C   H "O5'" 1 
ATOM   561   C  "C5'" . C   B  2  5    ? 62.746  112.304 21.355  1.00 84.95  ? 5    C   H "C5'" 1 
ATOM   562   C  "C4'" . C   B  2  5    ? 62.438  112.280 19.865  1.00 81.99  ? 5    C   H "C4'" 1 
ATOM   563   O  "O4'" . C   B  2  5    ? 63.662  111.946 19.122  1.00 81.19  ? 5    C   H "O4'" 1 
ATOM   564   C  "C3'" . C   B  2  5    ? 61.355  111.352 19.316  1.00 80.63  ? 5    C   H "C3'" 1 
ATOM   565   O  "O3'" . C   B  2  5    ? 60.055  111.812 19.029  1.00 78.93  ? 5    C   H "O3'" 1 
ATOM   566   C  "C2'" . C   B  2  5    ? 61.971  110.642 18.112  1.00 79.86  ? 5    C   H "C2'" 1 
ATOM   567   O  "O2'" . C   B  2  5    ? 61.628  111.303 16.912  1.00 80.00  ? 5    C   H "O2'" 1 
ATOM   568   C  "C1'" . C   B  2  5    ? 63.457  110.798 18.295  1.00 79.53  ? 5    C   H "C1'" 1 
ATOM   569   N  N1    . C   B  2  5    ? 63.990  109.515 18.862  1.00 77.33  ? 5    C   H N1    1 
ATOM   570   C  C2    . C   B  2  5    ? 64.863  108.742 18.070  1.00 75.80  ? 5    C   H C2    1 
ATOM   571   O  O2    . C   B  2  5    ? 65.194  109.159 16.950  1.00 74.97  ? 5    C   H O2    1 
ATOM   572   N  N3    . C   B  2  5    ? 65.309  107.551 18.544  1.00 75.59  ? 5    C   H N3    1 
ATOM   573   C  C4    . C   B  2  5    ? 64.928  107.125 19.755  1.00 75.67  ? 5    C   H C4    1 
ATOM   574   N  N4    . C   B  2  5    ? 65.384  105.941 20.186  1.00 75.26  ? 5    C   H N4    1 
ATOM   575   C  C5    . C   B  2  5    ? 64.060  107.888 20.578  1.00 75.29  ? 5    C   H C5    1 
ATOM   576   C  C6    . C   B  2  5    ? 63.620  109.059 20.101  1.00 76.67  ? 5    C   H C6    1 
ATOM   577   P  P     . U   B  2  6    ? 58.846  110.740 19.088  1.00 77.67  ? 6    U   H P     1 
ATOM   578   O  OP1   . U   B  2  6    ? 57.623  111.486 19.470  1.00 77.50  ? 6    U   H OP1   1 
ATOM   579   O  OP2   . U   B  2  6    ? 59.296  109.578 19.919  1.00 76.34  ? 6    U   H OP2   1 
ATOM   580   O  "O5'" . U   B  2  6    ? 58.693  110.232 17.584  1.00 76.06  ? 6    U   H "O5'" 1 
ATOM   581   C  "C5'" . U   B  2  6    ? 58.356  111.165 16.578  1.00 73.90  ? 6    U   H "C5'" 1 
ATOM   582   C  "C4'" . U   B  2  6    ? 58.807  110.726 15.195  1.00 73.27  ? 6    U   H "C4'" 1 
ATOM   583   O  "O4'" . U   B  2  6    ? 60.221  110.327 15.263  1.00 73.73  ? 6    U   H "O4'" 1 
ATOM   584   C  "C3'" . U   B  2  6    ? 58.058  109.607 14.452  1.00 72.59  ? 6    U   H "C3'" 1 
ATOM   585   O  "O3'" . U   B  2  6    ? 57.218  109.899 13.306  1.00 70.99  ? 6    U   H "O3'" 1 
ATOM   586   C  "C2'" . U   B  2  6    ? 59.108  108.546 14.125  1.00 73.05  ? 6    U   H "C2'" 1 
ATOM   587   O  "O2'" . U   B  2  6    ? 59.336  108.426 12.737  1.00 73.74  ? 6    U   H "O2'" 1 
ATOM   588   C  "C1'" . U   B  2  6    ? 60.385  109.000 14.784  1.00 73.05  ? 6    U   H "C1'" 1 
ATOM   589   N  N1    . U   B  2  6    ? 60.804  108.010 15.809  1.00 72.18  ? 6    U   H N1    1 
ATOM   590   C  C2    . U   B  2  6    ? 61.480  106.882 15.324  1.00 71.70  ? 6    U   H C2    1 
ATOM   591   O  O2    . U   B  2  6    ? 61.654  106.685 14.128  1.00 71.14  ? 6    U   H O2    1 
ATOM   592   N  N3    . U   B  2  6    ? 61.918  105.994 16.280  1.00 70.99  ? 6    U   H N3    1 
ATOM   593   C  C4    . U   B  2  6    ? 61.758  106.093 17.641  1.00 71.09  ? 6    U   H C4    1 
ATOM   594   O  O4    . U   B  2  6    ? 62.232  105.222 18.373  1.00 70.46  ? 6    U   H O4    1 
ATOM   595   C  C5    . U   B  2  6    ? 61.037  107.256 18.068  1.00 70.78  ? 6    U   H C5    1 
ATOM   596   C  C6    . U   B  2  6    ? 60.589  108.142 17.159  1.00 71.21  ? 6    U   H C6    1 
ATOM   597   P  P     . G   B  2  7    ? 55.740  109.185 13.171  1.00 69.92  ? 7    G   H P     1 
ATOM   598   O  OP1   . G   B  2  7    ? 54.810  110.139 12.501  1.00 69.67  ? 7    G   H OP1   1 
ATOM   599   O  OP2   . G   B  2  7    ? 55.394  108.675 14.525  1.00 70.29  ? 7    G   H OP2   1 
ATOM   600   O  "O5'" . G   B  2  7    ? 55.897  107.898 12.213  1.00 66.34  ? 7    G   H "O5'" 1 
ATOM   601   C  "C5'" . G   B  2  7    ? 55.095  106.682 12.414  1.00 60.29  ? 7    G   H "C5'" 1 
ATOM   602   C  "C4'" . G   B  2  7    ? 55.624  105.508 11.562  1.00 56.35  ? 7    G   H "C4'" 1 
ATOM   603   O  "O4'" . G   B  2  7    ? 57.012  105.830 11.245  1.00 53.98  ? 7    G   H "O4'" 1 
ATOM   604   C  "C3'" . G   B  2  7    ? 55.715  104.055 12.113  1.00 53.60  ? 7    G   H "C3'" 1 
ATOM   605   O  "O3'" . G   B  2  7    ? 54.905  102.978 11.687  1.00 52.27  ? 7    G   H "O3'" 1 
ATOM   606   C  "C2'" . G   B  2  7    ? 57.166  103.617 11.920  1.00 53.35  ? 7    G   H "C2'" 1 
ATOM   607   O  "O2'" . G   B  2  7    ? 57.375  102.845 10.740  1.00 53.70  ? 7    G   H "O2'" 1 
ATOM   608   C  "C1'" . G   B  2  7    ? 57.907  104.922 11.902  1.00 51.78  ? 7    G   H "C1'" 1 
ATOM   609   N  N9    . G   B  2  7    ? 57.976  105.166 13.343  1.00 48.38  ? 7    G   H N9    1 
ATOM   610   C  C8    . G   B  2  7    ? 57.479  106.214 14.029  1.00 47.55  ? 7    G   H C8    1 
ATOM   611   N  N7    . G   B  2  7    ? 57.694  106.169 15.301  1.00 46.92  ? 7    G   H N7    1 
ATOM   612   C  C5    . G   B  2  7    ? 58.376  104.999 15.480  1.00 47.76  ? 7    G   H C5    1 
ATOM   613   C  C6    . G   B  2  7    ? 58.867  104.441 16.645  1.00 48.69  ? 7    G   H C6    1 
ATOM   614   O  O6    . G   B  2  7    ? 58.811  104.894 17.783  1.00 49.21  ? 7    G   H O6    1 
ATOM   615   N  N1    . G   B  2  7    ? 59.482  103.231 16.411  1.00 49.65  ? 7    G   H N1    1 
ATOM   616   C  C2    . G   B  2  7    ? 59.602  102.640 15.193  1.00 49.60  ? 7    G   H C2    1 
ATOM   617   N  N2    . G   B  2  7    ? 60.218  101.476 15.216  1.00 50.06  ? 7    G   H N2    1 
ATOM   618   N  N3    . G   B  2  7    ? 59.146  103.166 14.062  1.00 48.84  ? 7    G   H N3    1 
ATOM   619   C  C4    . G   B  2  7    ? 58.551  104.349 14.285  1.00 47.89  ? 7    G   H C4    1 
ATOM   620   P  P     . C   B  2  8    ? 55.036  101.554 12.464  1.00 51.53  ? 8    C   H P     1 
ATOM   621   O  OP1   . C   B  2  8    ? 56.097  101.595 13.499  1.00 48.50  ? 8    C   H OP1   1 
ATOM   622   O  OP2   . C   B  2  8    ? 55.081  100.497 11.414  1.00 51.16  ? 8    C   H OP2   1 
ATOM   623   O  "O5'" . C   B  2  8    ? 53.705  101.410 13.310  1.00 50.15  ? 8    C   H "O5'" 1 
ATOM   624   C  "C5'" . C   B  2  8    ? 53.798  101.246 14.698  1.00 50.32  ? 8    C   H "C5'" 1 
ATOM   625   C  "C4'" . C   B  2  8    ? 52.459  101.389 15.353  1.00 51.69  ? 8    C   H "C4'" 1 
ATOM   626   O  "O4'" . C   B  2  8    ? 52.044  102.790 15.373  1.00 51.61  ? 8    C   H "O4'" 1 
ATOM   627   C  "C3'" . C   B  2  8    ? 51.296  100.584 14.789  1.00 51.88  ? 8    C   H "C3'" 1 
ATOM   628   O  "O3'" . C   B  2  8    ? 50.767  99.576  15.646  1.00 52.37  ? 8    C   H "O3'" 1 
ATOM   629   C  "C2'" . C   B  2  8    ? 50.328  101.607 14.173  1.00 52.21  ? 8    C   H "C2'" 1 
ATOM   630   O  "O2'" . C   B  2  8    ? 49.014  101.680 14.682  1.00 49.69  ? 8    C   H "O2'" 1 
ATOM   631   C  "C1'" . C   B  2  8    ? 50.871  102.952 14.589  1.00 52.49  ? 8    C   H "C1'" 1 
ATOM   632   N  N1    . C   B  2  8    ? 51.074  103.785 13.384  1.00 54.38  ? 8    C   H N1    1 
ATOM   633   C  C2    . C   B  2  8    ? 50.079  104.717 13.047  1.00 54.88  ? 8    C   H C2    1 
ATOM   634   O  O2    . C   B  2  8    ? 49.047  104.761 13.722  1.00 53.04  ? 8    C   H O2    1 
ATOM   635   N  N3    . C   B  2  8    ? 50.270  105.535 11.983  1.00 55.99  ? 8    C   H N3    1 
ATOM   636   C  C4    . C   B  2  8    ? 51.382  105.441 11.261  1.00 57.05  ? 8    C   H C4    1 
ATOM   637   N  N4    . C   B  2  8    ? 51.539  106.283 10.240  1.00 58.29  ? 8    C   H N4    1 
ATOM   638   C  C5    . C   B  2  8    ? 52.387  104.486 11.554  1.00 56.44  ? 8    C   H C5    1 
ATOM   639   C  C6    . C   B  2  8    ? 52.196  103.684 12.615  1.00 55.96  ? 8    C   H C6    1 
ATOM   640   P  P     . G   B  2  9    ? 50.562  98.074  15.078  1.00 53.23  ? 9    G   H P     1 
ATOM   641   O  OP1   . G   B  2  9    ? 50.530  97.126  16.228  1.00 52.37  ? 9    G   H OP1   1 
ATOM   642   O  OP2   . G   B  2  9    ? 51.512  97.859  13.952  1.00 50.18  ? 9    G   H OP2   1 
ATOM   643   O  "O5'" . G   B  2  9    ? 49.078  98.110  14.508  1.00 52.45  ? 9    G   H "O5'" 1 
ATOM   644   C  "C5'" . G   B  2  9    ? 48.236  99.140  14.949  1.00 51.62  ? 9    G   H "C5'" 1 
ATOM   645   C  "C4'" . G   B  2  9    ? 46.807  98.876  14.624  1.00 51.37  ? 9    G   H "C4'" 1 
ATOM   646   O  "O4'" . G   B  2  9    ? 46.301  100.238 14.544  1.00 50.88  ? 9    G   H "O4'" 1 
ATOM   647   C  "C3'" . G   B  2  9    ? 46.383  98.239  13.305  1.00 50.91  ? 9    G   H "C3'" 1 
ATOM   648   O  "O3'" . G   B  2  9    ? 45.787  96.977  13.336  1.00 53.14  ? 9    G   H "O3'" 1 
ATOM   649   C  "C2'" . G   B  2  9    ? 45.551  99.287  12.568  1.00 50.97  ? 9    G   H "C2'" 1 
ATOM   650   O  "O2'" . G   B  2  9    ? 44.156  99.160  12.779  1.00 51.60  ? 9    G   H "O2'" 1 
ATOM   651   C  "C1'" . G   B  2  9    ? 45.970  100.574 13.208  1.00 50.40  ? 9    G   H "C1'" 1 
ATOM   652   N  N9    . G   B  2  9    ? 47.113  100.992 12.398  1.00 49.72  ? 9    G   H N9    1 
ATOM   653   C  C8    . G   B  2  9    ? 48.355  100.431 12.269  1.00 49.24  ? 9    G   H C8    1 
ATOM   654   N  N7    . G   B  2  9    ? 49.103  101.003 11.383  1.00 51.03  ? 9    G   H N7    1 
ATOM   655   C  C5    . G   B  2  9    ? 48.307  102.009 10.878  1.00 51.80  ? 9    G   H C5    1 
ATOM   656   C  C6    . G   B  2  9    ? 48.567  102.936 9.857   1.00 51.58  ? 9    G   H C6    1 
ATOM   657   O  O6    . G   B  2  9    ? 49.602  103.061 9.190   1.00 49.76  ? 9    G   H O6    1 
ATOM   658   N  N1    . G   B  2  9    ? 47.466  103.762 9.628   1.00 52.07  ? 9    G   H N1    1 
ATOM   659   C  C2    . G   B  2  9    ? 46.266  103.693 10.312  1.00 52.97  ? 9    G   H C2    1 
ATOM   660   N  N2    . G   B  2  9    ? 45.310  104.564 9.968   1.00 52.48  ? 9    G   H N2    1 
ATOM   661   N  N3    . G   B  2  9    ? 46.021  102.823 11.273  1.00 53.62  ? 9    G   H N3    1 
ATOM   662   C  C4    . G   B  2  9    ? 47.076  102.019 11.503  1.00 51.81  ? 9    G   H C4    1 
ATOM   663   P  P     . G   B  2  10   ? 45.964  96.034  12.051  1.00 56.53  ? 10   G   H P     1 
ATOM   664   O  OP1   . G   B  2  10   ? 45.289  94.729  12.318  1.00 56.26  ? 10   G   H OP1   1 
ATOM   665   O  OP2   . G   B  2  10   ? 47.409  96.073  11.680  1.00 57.68  ? 10   G   H OP2   1 
ATOM   666   O  "O5'" . G   B  2  10   ? 45.109  96.775  10.943  1.00 53.20  ? 10   G   H "O5'" 1 
ATOM   667   C  "C5'" . G   B  2  10   ? 43.740  96.917  11.200  1.00 50.99  ? 10   G   H "C5'" 1 
ATOM   668   C  "C4'" . G   B  2  10   ? 43.030  97.721  10.155  1.00 49.52  ? 10   G   H "C4'" 1 
ATOM   669   O  "O4'" . G   B  2  10   ? 43.291  99.159  10.315  1.00 48.74  ? 10   G   H "O4'" 1 
ATOM   670   C  "C3'" . G   B  2  10   ? 43.279  97.405  8.707   1.00 48.12  ? 10   G   H "C3'" 1 
ATOM   671   O  "O3'" . G   B  2  10   ? 42.450  96.386  8.191   1.00 48.35  ? 10   G   H "O3'" 1 
ATOM   672   C  "C2'" . G   B  2  10   ? 43.218  98.767  8.006   1.00 47.12  ? 10   G   H "C2'" 1 
ATOM   673   O  "O2'" . G   B  2  10   ? 41.893  99.112  7.734   1.00 45.43  ? 10   G   H "O2'" 1 
ATOM   674   C  "C1'" . G   B  2  10   ? 43.611  99.758  9.066   1.00 46.95  ? 10   G   H "C1'" 1 
ATOM   675   N  N9    . G   B  2  10   ? 45.049  99.957  8.864   1.00 47.29  ? 10   G   H N9    1 
ATOM   676   C  C8    . G   B  2  10   ? 46.099  99.338  9.497   1.00 47.49  ? 10   G   H C8    1 
ATOM   677   N  N7    . G   B  2  10   ? 47.271  99.702  9.035   1.00 47.41  ? 10   G   H N7    1 
ATOM   678   C  C5    . G   B  2  10   ? 46.983  100.623 8.033   1.00 46.25  ? 10   G   H C5    1 
ATOM   679   C  C6    . G   B  2  10   ? 47.862  101.358 7.162   1.00 45.38  ? 10   G   H C6    1 
ATOM   680   O  O6    . G   B  2  10   ? 49.099  101.344 7.123   1.00 45.14  ? 10   G   H O6    1 
ATOM   681   N  N1    . G   B  2  10   ? 47.155  102.173 6.288   1.00 45.52  ? 10   G   H N1    1 
ATOM   682   C  C2    . G   B  2  10   ? 45.780  102.274 6.255   1.00 46.39  ? 10   G   H C2    1 
ATOM   683   N  N2    . G   B  2  10   ? 45.272  103.108 5.346   1.00 45.98  ? 10   G   H N2    1 
ATOM   684   N  N3    . G   B  2  10   ? 44.957  101.604 7.055   1.00 46.49  ? 10   G   H N3    1 
ATOM   685   C  C4    . G   B  2  10   ? 45.621  100.805 7.915   1.00 46.55  ? 10   G   H C4    1 
ATOM   686   P  P     . C   B  2  11   ? 43.035  95.442  7.017   1.00 47.76  ? 11   C   H P     1 
ATOM   687   O  OP1   . C   B  2  11   ? 42.416  94.090  7.020   1.00 45.17  ? 11   C   H OP1   1 
ATOM   688   O  OP2   . C   B  2  11   ? 44.522  95.566  7.050   1.00 47.82  ? 11   C   H OP2   1 
ATOM   689   O  "O5'" . C   B  2  11   ? 42.536  96.254  5.749   1.00 47.78  ? 11   C   H "O5'" 1 
ATOM   690   C  "C5'" . C   B  2  11   ? 41.424  97.127  5.912   1.00 43.35  ? 11   C   H "C5'" 1 
ATOM   691   C  "C4'" . C   B  2  11   ? 41.348  98.176  4.829   1.00 40.84  ? 11   C   H "C4'" 1 
ATOM   692   O  "O4'" . C   B  2  11   ? 42.132  99.388  5.132   1.00 38.75  ? 11   C   H "O4'" 1 
ATOM   693   C  "C3'" . C   B  2  11   ? 41.739  97.724  3.445   1.00 37.73  ? 11   C   H "C3'" 1 
ATOM   694   O  "O3'" . C   B  2  11   ? 40.719  97.170  2.637   1.00 35.31  ? 11   C   H "O3'" 1 
ATOM   695   C  "C2'" . C   B  2  11   ? 42.645  98.812  2.871   1.00 37.21  ? 11   C   H "C2'" 1 
ATOM   696   O  "O2'" . C   B  2  11   ? 41.956  99.597  1.928   1.00 35.25  ? 11   C   H "O2'" 1 
ATOM   697   C  "C1'" . C   B  2  11   ? 43.019  99.676  4.057   1.00 36.91  ? 11   C   H "C1'" 1 
ATOM   698   N  N1    . C   B  2  11   ? 44.437  99.352  4.357   1.00 35.48  ? 11   C   H N1    1 
ATOM   699   C  C2    . C   B  2  11   ? 45.437  100.040 3.638   1.00 34.93  ? 11   C   H C2    1 
ATOM   700   O  O2    . C   B  2  11   ? 45.109  100.921 2.836   1.00 35.27  ? 11   C   H O2    1 
ATOM   701   N  N3    . C   B  2  11   ? 46.730  99.713  3.824   1.00 34.93  ? 11   C   H N3    1 
ATOM   702   C  C4    . C   B  2  11   ? 47.058  98.757  4.687   1.00 36.22  ? 11   C   H C4    1 
ATOM   703   N  N4    . C   B  2  11   ? 48.345  98.464  4.819   1.00 36.94  ? 11   C   H N4    1 
ATOM   704   C  C5    . C   B  2  11   ? 46.078  98.061  5.453   1.00 35.87  ? 11   C   H C5    1 
ATOM   705   C  C6    . C   B  2  11   ? 44.792  98.393  5.262   1.00 35.95  ? 11   C   H C6    1 
ATOM   706   P  P     . G   B  2  12   ? 40.918  95.660  2.079   1.00 36.27  ? 12   G   H P     1 
ATOM   707   O  OP1   . G   B  2  12   ? 39.625  94.926  2.072   1.00 32.34  ? 12   G   H OP1   1 
ATOM   708   O  OP2   . G   B  2  12   ? 42.103  95.061  2.767   1.00 33.87  ? 12   G   H OP2   1 
ATOM   709   O  "O5'" . G   B  2  12   ? 41.424  95.909  0.598   1.00 35.70  ? 12   G   H "O5'" 1 
ATOM   710   C  "C5'" . G   B  2  12   ? 42.267  97.008  0.371   1.00 35.76  ? 12   G   H "C5'" 1 
ATOM   711   C  "C4'" . G   B  2  12   ? 42.310  97.400  -1.048  1.00 35.78  ? 12   G   H "C4'" 1 
ATOM   712   O  "O4'" . G   B  2  12   ? 43.038  98.660  -1.107  1.00 36.50  ? 12   G   H "O4'" 1 
ATOM   713   C  "C3'" . G   B  2  12   ? 43.096  96.460  -1.915  1.00 35.28  ? 12   G   H "C3'" 1 
ATOM   714   O  "O3'" . G   B  2  12   ? 42.355  95.727  -2.848  1.00 39.66  ? 12   G   H "O3'" 1 
ATOM   715   C  "C2'" . G   B  2  12   ? 44.383  97.183  -2.323  1.00 33.90  ? 12   G   H "C2'" 1 
ATOM   716   O  "O2'" . G   B  2  12   ? 44.336  97.655  -3.640  1.00 31.39  ? 12   G   H "O2'" 1 
ATOM   717   C  "C1'" . G   B  2  12   ? 44.397  98.431  -1.473  1.00 34.07  ? 12   G   H "C1'" 1 
ATOM   718   N  N9    . G   B  2  12   ? 45.302  98.204  -0.333  1.00 33.88  ? 12   G   H N9    1 
ATOM   719   C  C8    . G   B  2  12   ? 45.040  97.720  0.924   1.00 33.19  ? 12   G   H C8    1 
ATOM   720   N  N7    . G   B  2  12   ? 46.102  97.534  1.650   1.00 32.75  ? 12   G   H N7    1 
ATOM   721   C  C5    . G   B  2  12   ? 47.138  97.946  0.837   1.00 33.08  ? 12   G   H C5    1 
ATOM   722   C  C6    . G   B  2  12   ? 48.519  97.965  1.077   1.00 32.56  ? 12   G   H C6    1 
ATOM   723   O  O6    . G   B  2  12   ? 49.114  97.609  2.085   1.00 32.83  ? 12   G   H O6    1 
ATOM   724   N  N1    . G   B  2  12   ? 49.226  98.456  -0.012  1.00 32.27  ? 12   G   H N1    1 
ATOM   725   C  C2    . G   B  2  12   ? 48.656  98.871  -1.181  1.00 33.73  ? 12   G   H C2    1 
ATOM   726   N  N2    . G   B  2  12   ? 49.471  99.315  -2.118  1.00 34.04  ? 12   G   H N2    1 
ATOM   727   N  N3    . G   B  2  12   ? 47.358  98.855  -1.421  1.00 35.90  ? 12   G   H N3    1 
ATOM   728   C  C4    . G   B  2  12   ? 46.663  98.385  -0.379  1.00 33.77  ? 12   G   H C4    1 
ATOM   729   P  P     . C   B  2  13   ? 42.716  94.171  -3.045  1.00 45.97  ? 13   C   H P     1 
ATOM   730   O  OP1   . C   B  2  13   ? 41.660  93.537  -3.868  1.00 43.93  ? 13   C   H OP1   1 
ATOM   731   O  OP2   . C   B  2  13   ? 43.059  93.569  -1.702  1.00 46.99  ? 13   C   H OP2   1 
ATOM   732   O  "O5'" . C   B  2  13   ? 44.058  94.299  -3.906  1.00 46.72  ? 13   C   H "O5'" 1 
ATOM   733   C  "C5'" . C   B  2  13   ? 44.090  95.289  -4.938  1.00 45.82  ? 13   C   H "C5'" 1 
ATOM   734   C  "C4'" . C   B  2  13   ? 45.474  95.544  -5.534  1.00 44.75  ? 13   C   H "C4'" 1 
ATOM   735   O  "O4'" . C   B  2  13   ? 46.288  96.505  -4.792  1.00 42.87  ? 13   C   H "O4'" 1 
ATOM   736   C  "C3'" . C   B  2  13   ? 46.370  94.393  -5.945  1.00 43.68  ? 13   C   H "C3'" 1 
ATOM   737   O  "O3'" . C   B  2  13   ? 46.485  94.062  -7.301  1.00 43.28  ? 13   C   H "O3'" 1 
ATOM   738   C  "C2'" . C   B  2  13   ? 47.725  94.642  -5.323  1.00 42.76  ? 13   C   H "C2'" 1 
ATOM   739   O  "O2'" . C   B  2  13   ? 48.688  94.774  -6.343  1.00 40.93  ? 13   C   H "O2'" 1 
ATOM   740   C  "C1'" . C   B  2  13   ? 47.583  95.977  -4.604  1.00 42.57  ? 13   C   H "C1'" 1 
ATOM   741   N  N1    . C   B  2  13   ? 47.893  95.704  -3.186  1.00 42.73  ? 13   C   H N1    1 
ATOM   742   C  C2    . C   B  2  13   ? 49.227  95.730  -2.823  1.00 43.05  ? 13   C   H C2    1 
ATOM   743   O  O2    . C   B  2  13   ? 50.051  96.078  -3.661  1.00 45.22  ? 13   C   H O2    1 
ATOM   744   N  N3    . C   B  2  13   ? 49.586  95.363  -1.588  1.00 42.04  ? 13   C   H N3    1 
ATOM   745   C  C4    . C   B  2  13   ? 48.670  94.993  -0.716  1.00 43.06  ? 13   C   H C4    1 
ATOM   746   N  N4    . C   B  2  13   ? 49.084  94.601  0.479   1.00 45.49  ? 13   C   H N4    1 
ATOM   747   C  C5    . C   B  2  13   ? 47.288  95.006  -1.030  1.00 42.82  ? 13   C   H C5    1 
ATOM   748   C  C6    . C   B  2  13   ? 46.946  95.375  -2.269  1.00 42.97  ? 13   C   H C6    1 
ATOM   749   P  P     . G   B  2  14   ? 46.641  92.513  -7.667  1.00 45.44  ? 14   G   H P     1 
ATOM   750   O  OP1   . G   B  2  14   ? 46.392  92.304  -9.112  1.00 46.47  ? 14   G   H OP1   1 
ATOM   751   O  OP2   . G   B  2  14   ? 45.740  91.878  -6.685  1.00 45.21  ? 14   G   H OP2   1 
ATOM   752   O  "O5'" . G   B  2  14   ? 48.193  92.246  -7.429  1.00 41.29  ? 14   G   H "O5'" 1 
ATOM   753   C  "C5'" . G   B  2  14   ? 49.055  92.726  -8.434  1.00 35.23  ? 14   G   H "C5'" 1 
ATOM   754   C  "C4'" . G   B  2  14   ? 50.504  92.612  -8.086  1.00 31.60  ? 14   G   H "C4'" 1 
ATOM   755   O  "O4'" . G   B  2  14   ? 50.786  93.502  -6.971  1.00 29.81  ? 14   G   H "O4'" 1 
ATOM   756   C  "C3'" . G   B  2  14   ? 51.105  91.265  -7.756  1.00 28.66  ? 14   G   H "C3'" 1 
ATOM   757   O  "O3'" . G   B  2  14   ? 51.802  90.594  -8.779  1.00 28.69  ? 14   G   H "O3'" 1 
ATOM   758   C  "C2'" . G   B  2  14   ? 51.967  91.478  -6.524  1.00 27.53  ? 14   G   H "C2'" 1 
ATOM   759   O  "O2'" . G   B  2  14   ? 53.320  91.513  -6.869  1.00 27.41  ? 14   G   H "O2'" 1 
ATOM   760   C  "C1'" . G   B  2  14   ? 51.688  92.895  -6.086  1.00 28.59  ? 14   G   H "C1'" 1 
ATOM   761   N  N9    . G   B  2  14   ? 51.151  92.703  -4.751  1.00 28.69  ? 14   G   H N9    1 
ATOM   762   C  C8    . G   B  2  14   ? 49.875  92.567  -4.304  1.00 29.71  ? 14   G   H C8    1 
ATOM   763   N  N7    . G   B  2  14   ? 49.812  92.215  -3.047  1.00 29.42  ? 14   G   H N7    1 
ATOM   764   C  C5    . G   B  2  14   ? 51.129  92.150  -2.651  1.00 30.32  ? 14   G   H C5    1 
ATOM   765   C  C6    . G   B  2  14   ? 51.709  91.790  -1.406  1.00 32.55  ? 14   G   H C6    1 
ATOM   766   O  O6    . G   B  2  14   ? 51.152  91.441  -0.359  1.00 30.99  ? 14   G   H O6    1 
ATOM   767   N  N1    . G   B  2  14   ? 53.101  91.856  -1.457  1.00 35.84  ? 14   G   H N1    1 
ATOM   768   C  C2    . G   B  2  14   ? 53.834  92.220  -2.573  1.00 37.01  ? 14   G   H C2    1 
ATOM   769   N  N2    . G   B  2  14   ? 55.187  92.228  -2.468  1.00 39.40  ? 14   G   H N2    1 
ATOM   770   N  N3    . G   B  2  14   ? 53.293  92.551  -3.719  1.00 34.67  ? 14   G   H N3    1 
ATOM   771   C  C4    . G   B  2  14   ? 51.955  92.490  -3.685  1.00 30.52  ? 14   G   H C4    1 
ATOM   772   P  P     . C   B  2  15   ? 51.766  88.970  -8.795  1.00 32.10  ? 15   C   H P     1 
ATOM   773   O  OP1   . C   B  2  15   ? 51.830  88.501  -10.195 1.00 31.16  ? 15   C   H OP1   1 
ATOM   774   O  OP2   . C   B  2  15   ? 50.628  88.528  -7.953  1.00 28.63  ? 15   C   H OP2   1 
ATOM   775   O  "O5'" . C   B  2  15   ? 53.129  88.603  -8.056  1.00 29.79  ? 15   C   H "O5'" 1 
ATOM   776   C  "C5'" . C   B  2  15   ? 54.256  89.436  -8.258  1.00 27.36  ? 15   C   H "C5'" 1 
ATOM   777   C  "C4'" . C   B  2  15   ? 55.478  88.913  -7.555  1.00 26.77  ? 15   C   H "C4'" 1 
ATOM   778   O  "O4'" . C   B  2  15   ? 55.688  89.606  -6.288  1.00 25.62  ? 15   C   H "O4'" 1 
ATOM   779   C  "C3'" . C   B  2  15   ? 55.574  87.429  -7.278  1.00 25.57  ? 15   C   H "C3'" 1 
ATOM   780   O  "O3'" . C   B  2  15   ? 56.360  86.659  -8.138  1.00 26.27  ? 15   C   H "O3'" 1 
ATOM   781   C  "C2'" . C   B  2  15   ? 55.926  87.265  -5.803  1.00 25.72  ? 15   C   H "C2'" 1 
ATOM   782   O  "O2'" . C   B  2  15   ? 57.262  86.845  -5.587  1.00 27.61  ? 15   C   H "O2'" 1 
ATOM   783   C  "C1'" . C   B  2  15   ? 55.849  88.666  -5.244  1.00 24.03  ? 15   C   H "C1'" 1 
ATOM   784   N  N1    . C   B  2  15   ? 54.728  88.626  -4.295  1.00 21.92  ? 15   C   H N1    1 
ATOM   785   C  C2    . C   B  2  15   ? 55.051  88.364  -2.968  1.00 22.53  ? 15   C   H C2    1 
ATOM   786   O  O2    . C   B  2  15   ? 56.247  88.250  -2.664  1.00 25.64  ? 15   C   H O2    1 
ATOM   787   N  N3    . C   B  2  15   ? 54.068  88.224  -2.049  1.00 21.28  ? 15   C   H N3    1 
ATOM   788   C  C4    . C   B  2  15   ? 52.802  88.345  -2.413  1.00 17.20  ? 15   C   H C4    1 
ATOM   789   N  N4    . C   B  2  15   ? 51.880  88.189  -1.472  1.00 12.97  ? 15   C   H N4    1 
ATOM   790   C  C5    . C   B  2  15   ? 52.433  88.635  -3.762  1.00 17.59  ? 15   C   H C5    1 
ATOM   791   C  C6    . C   B  2  15   ? 53.427  88.778  -4.666  1.00 19.41  ? 15   C   H C6    1 
ATOM   792   P  P     . G   B  2  16   ? 55.855  85.183  -8.488  1.00 27.89  ? 16   G   H P     1 
ATOM   793   O  OP1   . G   B  2  16   ? 56.515  84.706  -9.717  1.00 28.26  ? 16   G   H OP1   1 
ATOM   794   O  OP2   . G   B  2  16   ? 54.378  85.263  -8.428  1.00 27.05  ? 16   G   H OP2   1 
ATOM   795   O  "O5'" . G   B  2  16   ? 56.384  84.309  -7.263  1.00 28.07  ? 16   G   H "O5'" 1 
ATOM   796   C  "C5'" . G   B  2  16   ? 57.769  84.315  -6.976  1.00 28.13  ? 16   G   H "C5'" 1 
ATOM   797   C  "C4'" . G   B  2  16   ? 58.130  83.516  -5.736  1.00 30.94  ? 16   G   H "C4'" 1 
ATOM   798   O  "O4'" . G   B  2  16   ? 57.784  84.427  -4.641  1.00 31.61  ? 16   G   H "O4'" 1 
ATOM   799   C  "C3'" . G   B  2  16   ? 57.426  82.194  -5.398  1.00 31.69  ? 16   G   H "C3'" 1 
ATOM   800   O  "O3'" . G   B  2  16   ? 57.634  80.861  -5.872  1.00 30.02  ? 16   G   H "O3'" 1 
ATOM   801   C  "C2'" . G   B  2  16   ? 57.122  82.240  -3.910  1.00 32.34  ? 16   G   H "C2'" 1 
ATOM   802   O  "O2'" . G   B  2  16   ? 58.194  81.619  -3.253  1.00 33.61  ? 16   G   H "O2'" 1 
ATOM   803   C  "C1'" . G   B  2  16   ? 57.269  83.702  -3.539  1.00 32.33  ? 16   G   H "C1'" 1 
ATOM   804   N  N9    . G   B  2  16   ? 55.940  84.137  -3.119  1.00 32.08  ? 16   G   H N9    1 
ATOM   805   C  C8    . G   B  2  16   ? 54.884  84.604  -3.854  1.00 32.13  ? 16   G   H C8    1 
ATOM   806   N  N7    . G   B  2  16   ? 53.812  84.804  -3.131  1.00 33.01  ? 16   G   H N7    1 
ATOM   807   C  C5    . G   B  2  16   ? 54.196  84.463  -1.844  1.00 32.81  ? 16   G   H C5    1 
ATOM   808   C  C6    . G   B  2  16   ? 53.467  84.463  -0.624  1.00 31.89  ? 16   G   H C6    1 
ATOM   809   O  O6    . G   B  2  16   ? 52.303  84.759  -0.425  1.00 31.76  ? 16   G   H O6    1 
ATOM   810   N  N1    . G   B  2  16   ? 54.249  84.055  0.435   1.00 33.50  ? 16   G   H N1    1 
ATOM   811   C  C2    . G   B  2  16   ? 55.558  83.686  0.339   1.00 35.25  ? 16   G   H C2    1 
ATOM   812   N  N2    . G   B  2  16   ? 56.142  83.333  1.473   1.00 36.97  ? 16   G   H N2    1 
ATOM   813   N  N3    . G   B  2  16   ? 56.244  83.666  -0.781  1.00 35.26  ? 16   G   H N3    1 
ATOM   814   C  C4    . G   B  2  16   ? 55.507  84.069  -1.824  1.00 33.16  ? 16   G   H C4    1 
ATOM   815   P  P     . DA  C  3  2    ? 25.038  85.281  2.792   1.00 55.33  ? 3    DA  I P     1 
ATOM   816   O  OP1   . DA  C  3  2    ? 24.852  86.012  4.102   1.00 53.96  ? 3    DA  I OP1   1 
ATOM   817   O  OP2   . DA  C  3  2    ? 24.729  86.168  1.605   1.00 54.95  ? 3    DA  I OP2   1 
ATOM   818   O  "O5'" . DA  C  3  2    ? 26.626  84.955  2.654   1.00 55.26  ? 3    DA  I "O5'" 1 
ATOM   819   C  "C5'" . DA  C  3  2    ? 27.504  84.983  3.788   1.00 55.44  ? 3    DA  I "C5'" 1 
ATOM   820   C  "C4'" . DA  C  3  2    ? 28.746  84.197  3.458   1.00 56.12  ? 3    DA  I "C4'" 1 
ATOM   821   O  "O4'" . DA  C  3  2    ? 29.895  84.553  4.260   1.00 55.88  ? 3    DA  I "O4'" 1 
ATOM   822   C  "C3'" . DA  C  3  2    ? 28.562  82.700  3.624   1.00 56.22  ? 3    DA  I "C3'" 1 
ATOM   823   O  "O3'" . DA  C  3  2    ? 29.042  82.070  2.450   1.00 57.26  ? 3    DA  I "O3'" 1 
ATOM   824   C  "C2'" . DA  C  3  2    ? 29.419  82.367  4.836   1.00 56.20  ? 3    DA  I "C2'" 1 
ATOM   825   C  "C1'" . DA  C  3  2    ? 30.548  83.361  4.688   1.00 55.46  ? 3    DA  I "C1'" 1 
ATOM   826   N  N9    . DA  C  3  2    ? 31.318  83.684  5.898   1.00 55.07  ? 3    DA  I N9    1 
ATOM   827   C  C8    . DA  C  3  2    ? 30.939  84.670  6.772   1.00 54.32  ? 3    DA  I C8    1 
ATOM   828   N  N7    . DA  C  3  2    ? 31.797  84.885  7.729   1.00 54.41  ? 3    DA  I N7    1 
ATOM   829   C  C5    . DA  C  3  2    ? 32.807  83.963  7.495   1.00 53.57  ? 3    DA  I C5    1 
ATOM   830   C  C6    . DA  C  3  2    ? 33.996  83.726  8.187   1.00 52.74  ? 3    DA  I C6    1 
ATOM   831   N  N6    . DA  C  3  2    ? 34.308  84.444  9.243   1.00 52.60  ? 3    DA  I N6    1 
ATOM   832   N  N1    . DA  C  3  2    ? 34.833  82.747  7.756   1.00 51.06  ? 3    DA  I N1    1 
ATOM   833   C  C2    . DA  C  3  2    ? 34.437  82.063  6.660   1.00 51.37  ? 3    DA  I C2    1 
ATOM   834   N  N3    . DA  C  3  2    ? 33.316  82.208  5.908   1.00 52.55  ? 3    DA  I N3    1 
ATOM   835   C  C4    . DA  C  3  2    ? 32.530  83.194  6.389   1.00 53.86  ? 3    DA  I C4    1 
ATOM   836   P  P     . DC  C  3  3    ? 28.686  80.534  2.191   1.00 59.02  ? 4    DC  I P     1 
ATOM   837   O  OP1   . DC  C  3  3    ? 29.058  80.161  0.804   1.00 60.88  ? 4    DC  I OP1   1 
ATOM   838   O  OP2   . DC  C  3  3    ? 27.298  80.277  2.669   1.00 59.90  ? 4    DC  I OP2   1 
ATOM   839   O  "O5'" . DC  C  3  3    ? 29.694  79.801  3.166   1.00 57.35  ? 4    DC  I "O5'" 1 
ATOM   840   C  "C5'" . DC  C  3  3    ? 29.235  79.173  4.335   1.00 55.38  ? 4    DC  I "C5'" 1 
ATOM   841   C  "C4'" . DC  C  3  3    ? 30.358  78.353  4.900   1.00 54.08  ? 4    DC  I "C4'" 1 
ATOM   842   O  "O4'" . DC  C  3  3    ? 31.235  79.165  5.718   1.00 54.84  ? 4    DC  I "O4'" 1 
ATOM   843   C  "C3'" . DC  C  3  3    ? 29.860  77.223  5.774   1.00 53.18  ? 4    DC  I "C3'" 1 
ATOM   844   O  "O3'" . DC  C  3  3    ? 30.526  76.070  5.332   1.00 51.14  ? 4    DC  I "O3'" 1 
ATOM   845   C  "C2'" . DC  C  3  3    ? 30.238  77.632  7.182   1.00 54.54  ? 4    DC  I "C2'" 1 
ATOM   846   C  "C1'" . DC  C  3  3    ? 31.425  78.560  6.991   1.00 56.14  ? 4    DC  I "C1'" 1 
ATOM   847   N  N1    . DC  C  3  3    ? 31.458  79.621  8.013   1.00 57.77  ? 4    DC  I N1    1 
ATOM   848   C  C2    . DC  C  3  3    ? 32.571  79.742  8.848   1.00 58.39  ? 4    DC  I C2    1 
ATOM   849   O  O2    . DC  C  3  3    ? 33.544  79.005  8.678   1.00 58.59  ? 4    DC  I O2    1 
ATOM   850   N  N3    . DC  C  3  3    ? 32.553  80.664  9.829   1.00 59.76  ? 4    DC  I N3    1 
ATOM   851   C  C4    . DC  C  3  3    ? 31.493  81.454  9.990   1.00 60.79  ? 4    DC  I C4    1 
ATOM   852   N  N4    . DC  C  3  3    ? 31.522  82.336  10.990  1.00 63.39  ? 4    DC  I N4    1 
ATOM   853   C  C5    . DC  C  3  3    ? 30.363  81.376  9.141   1.00 59.32  ? 4    DC  I C5    1 
ATOM   854   C  C6    . DC  C  3  3    ? 30.388  80.459  8.170   1.00 59.11  ? 4    DC  I C6    1 
ATOM   855   P  P     . DG  C  3  4    ? 30.282  74.704  6.078   1.00 50.79  ? 5    DG  I P     1 
ATOM   856   O  OP1   . DG  C  3  4    ? 30.871  73.631  5.225   1.00 50.69  ? 5    DG  I OP1   1 
ATOM   857   O  OP2   . DG  C  3  4    ? 28.887  74.594  6.552   1.00 48.44  ? 5    DG  I OP2   1 
ATOM   858   O  "O5'" . DG  C  3  4    ? 31.212  74.934  7.327   1.00 51.17  ? 5    DG  I "O5'" 1 
ATOM   859   C  "C5'" . DG  C  3  4    ? 32.597  75.090  7.137   1.00 49.75  ? 5    DG  I "C5'" 1 
ATOM   860   C  "C4'" . DG  C  3  4    ? 33.313  74.426  8.276   1.00 49.84  ? 5    DG  I "C4'" 1 
ATOM   861   O  "O4'" . DG  C  3  4    ? 33.433  75.380  9.334   1.00 48.56  ? 5    DG  I "O4'" 1 
ATOM   862   C  "C3'" . DG  C  3  4    ? 32.550  73.225  8.830   1.00 50.06  ? 5    DG  I "C3'" 1 
ATOM   863   O  "O3'" . DG  C  3  4    ? 33.513  72.209  9.121   1.00 50.41  ? 5    DG  I "O3'" 1 
ATOM   864   C  "C2'" . DG  C  3  4    ? 31.773  73.810  9.992   1.00 50.23  ? 5    DG  I "C2'" 1 
ATOM   865   C  "C1'" . DG  C  3  4    ? 32.655  74.976  10.434  1.00 50.58  ? 5    DG  I "C1'" 1 
ATOM   866   N  N9    . DG  C  3  4    ? 31.981  76.159  10.964  1.00 51.26  ? 5    DG  I N9    1 
ATOM   867   C  C8    . DG  C  3  4    ? 30.719  76.635  10.684  1.00 50.62  ? 5    DG  I C8    1 
ATOM   868   N  N7    . DG  C  3  4    ? 30.400  77.673  11.405  1.00 50.49  ? 5    DG  I N7    1 
ATOM   869   C  C5    . DG  C  3  4    ? 31.529  77.907  12.189  1.00 50.27  ? 5    DG  I C5    1 
ATOM   870   C  C6    . DG  C  3  4    ? 31.785  78.895  13.176  1.00 49.88  ? 5    DG  I C6    1 
ATOM   871   O  O6    . DG  C  3  4    ? 31.039  79.792  13.570  1.00 49.24  ? 5    DG  I O6    1 
ATOM   872   N  N1    . DG  C  3  4    ? 33.064  78.764  13.721  1.00 49.12  ? 5    DG  I N1    1 
ATOM   873   C  C2    . DG  C  3  4    ? 33.977  77.807  13.360  1.00 49.31  ? 5    DG  I C2    1 
ATOM   874   N  N2    . DG  C  3  4    ? 35.169  77.835  13.984  1.00 49.05  ? 5    DG  I N2    1 
ATOM   875   N  N3    . DG  C  3  4    ? 33.747  76.886  12.451  1.00 50.86  ? 5    DG  I N3    1 
ATOM   876   C  C4    . DG  C  3  4    ? 32.512  76.994  11.912  1.00 50.96  ? 5    DG  I C4    1 
ATOM   877   P  P     . DC  C  3  5    ? 33.215  71.053  10.192  1.00 50.78  ? 6    DC  I P     1 
ATOM   878   O  OP1   . DC  C  3  5    ? 34.466  70.273  10.017  1.00 48.49  ? 6    DC  I OP1   1 
ATOM   879   O  OP2   . DC  C  3  5    ? 31.920  70.338  10.139  1.00 51.37  ? 6    DC  I OP2   1 
ATOM   880   O  "O5'" . DC  C  3  5    ? 33.253  71.836  11.569  1.00 48.08  ? 6    DC  I "O5'" 1 
ATOM   881   C  "C5'" . DC  C  3  5    ? 34.412  72.585  11.921  1.00 45.10  ? 6    DC  I "C5'" 1 
ATOM   882   C  "C4'" . DC  C  3  5    ? 34.565  72.647  13.423  1.00 41.75  ? 6    DC  I "C4'" 1 
ATOM   883   O  "O4'" . DC  C  3  5    ? 33.945  73.831  13.940  1.00 41.23  ? 6    DC  I "O4'" 1 
ATOM   884   C  "C3'" . DC  C  3  5    ? 33.929  71.473  14.164  1.00 39.43  ? 6    DC  I "C3'" 1 
ATOM   885   O  "O3'" . DC  C  3  5    ? 34.854  70.904  15.094  1.00 37.95  ? 6    DC  I "O3'" 1 
ATOM   886   C  "C2'" . DC  C  3  5    ? 32.661  72.031  14.773  1.00 38.69  ? 6    DC  I "C2'" 1 
ATOM   887   C  "C1'" . DC  C  3  5    ? 33.012  73.488  14.954  1.00 39.24  ? 6    DC  I "C1'" 1 
ATOM   888   N  N1    . DC  C  3  5    ? 31.891  74.423  14.847  1.00 37.56  ? 6    DC  I N1    1 
ATOM   889   C  C2    . DC  C  3  5    ? 31.872  75.496  15.711  1.00 36.79  ? 6    DC  I C2    1 
ATOM   890   O  O2    . DC  C  3  5    ? 32.793  75.611  16.536  1.00 36.52  ? 6    DC  I O2    1 
ATOM   891   N  N3    . DC  C  3  5    ? 30.864  76.382  15.638  1.00 36.32  ? 6    DC  I N3    1 
ATOM   892   C  C4    . DC  C  3  5    ? 29.899  76.218  14.743  1.00 36.48  ? 6    DC  I C4    1 
ATOM   893   N  N4    . DC  C  3  5    ? 28.930  77.114  14.725  1.00 36.53  ? 6    DC  I N4    1 
ATOM   894   C  C5    . DC  C  3  5    ? 29.886  75.124  13.840  1.00 37.01  ? 6    DC  I C5    1 
ATOM   895   C  C6    . DC  C  3  5    ? 30.895  74.256  13.925  1.00 37.40  ? 6    DC  I C6    1 
ATOM   896   P  P     . DC  C  3  6    ? 34.426  69.601  15.907  1.00 38.28  ? 7    DC  I P     1 
ATOM   897   O  OP1   . DC  C  3  6    ? 35.605  68.756  16.239  1.00 39.19  ? 7    DC  I OP1   1 
ATOM   898   O  OP2   . DC  C  3  6    ? 33.449  69.080  14.920  1.00 40.37  ? 7    DC  I OP2   1 
ATOM   899   O  "O5'" . DC  C  3  6    ? 34.027  70.327  17.262  1.00 35.83  ? 7    DC  I "O5'" 1 
ATOM   900   C  "C5'" . DC  C  3  6    ? 35.079  71.117  17.829  1.00 35.65  ? 7    DC  I "C5'" 1 
ATOM   901   C  "C4'" . DC  C  3  6    ? 34.667  71.885  19.057  1.00 36.17  ? 7    DC  I "C4'" 1 
ATOM   902   O  "O4'" . DC  C  3  6    ? 33.765  72.965  18.751  1.00 36.64  ? 7    DC  I "O4'" 1 
ATOM   903   C  "C3'" . DC  C  3  6    ? 34.047  71.096  20.196  1.00 36.11  ? 7    DC  I "C3'" 1 
ATOM   904   O  "O3'" . DC  C  3  6    ? 34.707  71.497  21.393  1.00 34.54  ? 7    DC  I "O3'" 1 
ATOM   905   C  "C2'" . DC  C  3  6    ? 32.590  71.513  20.149  1.00 36.76  ? 7    DC  I "C2'" 1 
ATOM   906   C  "C1'" . DC  C  3  6    ? 32.664  72.939  19.634  1.00 37.75  ? 7    DC  I "C1'" 1 
ATOM   907   N  N1    . DC  C  3  6    ? 31.491  73.377  18.868  1.00 40.46  ? 7    DC  I N1    1 
ATOM   908   C  C2    . DC  C  3  6    ? 30.811  74.554  19.242  1.00 41.34  ? 7    DC  I C2    1 
ATOM   909   O  O2    . DC  C  3  6    ? 31.183  75.183  20.238  1.00 41.32  ? 7    DC  I O2    1 
ATOM   910   N  N3    . DC  C  3  6    ? 29.758  74.969  18.508  1.00 42.10  ? 7    DC  I N3    1 
ATOM   911   C  C4    . DC  C  3  6    ? 29.370  74.266  17.446  1.00 43.33  ? 7    DC  I C4    1 
ATOM   912   N  N4    . DC  C  3  6    ? 28.340  74.726  16.750  1.00 45.54  ? 7    DC  I N4    1 
ATOM   913   C  C5    . DC  C  3  6    ? 30.028  73.062  17.051  1.00 43.94  ? 7    DC  I C5    1 
ATOM   914   C  C6    . DC  C  3  6    ? 31.073  72.658  17.784  1.00 42.91  ? 7    DC  I C6    1 
ATOM   915   P  P     . DA  C  3  7    ? 34.253  70.893  22.802  1.00 35.96  ? 8    DA  I P     1 
ATOM   916   O  OP1   . DA  C  3  7    ? 35.403  70.942  23.748  1.00 34.32  ? 8    DA  I OP1   1 
ATOM   917   O  OP2   . DA  C  3  7    ? 33.523  69.623  22.593  1.00 34.60  ? 8    DA  I OP2   1 
ATOM   918   O  "O5'" . DA  C  3  7    ? 33.195  71.959  23.281  1.00 36.58  ? 8    DA  I "O5'" 1 
ATOM   919   C  "C5'" . DA  C  3  7    ? 33.624  73.249  23.650  1.00 39.25  ? 8    DA  I "C5'" 1 
ATOM   920   C  "C4'" . DA  C  3  7    ? 32.516  73.934  24.394  1.00 42.13  ? 8    DA  I "C4'" 1 
ATOM   921   O  "O4'" . DA  C  3  7    ? 31.488  74.318  23.454  1.00 41.08  ? 8    DA  I "O4'" 1 
ATOM   922   C  "C3'" . DA  C  3  7    ? 31.855  72.996  25.398  1.00 44.53  ? 8    DA  I "C3'" 1 
ATOM   923   O  "O3'" . DA  C  3  7    ? 31.616  73.752  26.606  1.00 51.35  ? 8    DA  I "O3'" 1 
ATOM   924   C  "C2'" . DA  C  3  7    ? 30.638  72.485  24.645  1.00 42.62  ? 8    DA  I "C2'" 1 
ATOM   925   C  "C1'" . DA  C  3  7    ? 30.269  73.681  23.789  1.00 42.10  ? 8    DA  I "C1'" 1 
ATOM   926   N  N9    . DA  C  3  7    ? 29.560  73.397  22.543  1.00 42.26  ? 8    DA  I N9    1 
ATOM   927   C  C8    . DA  C  3  7    ? 29.775  72.395  21.643  1.00 42.99  ? 8    DA  I C8    1 
ATOM   928   N  N7    . DA  C  3  7    ? 28.992  72.448  20.593  1.00 42.84  ? 8    DA  I N7    1 
ATOM   929   C  C5    . DA  C  3  7    ? 28.189  73.551  20.832  1.00 42.46  ? 8    DA  I C5    1 
ATOM   930   C  C6    . DA  C  3  7    ? 27.150  74.150  20.094  1.00 42.17  ? 8    DA  I C6    1 
ATOM   931   N  N6    . DA  C  3  7    ? 26.706  73.711  18.920  1.00 42.48  ? 8    DA  I N6    1 
ATOM   932   N  N1    . DA  C  3  7    ? 26.572  75.239  20.617  1.00 42.85  ? 8    DA  I N1    1 
ATOM   933   C  C2    . DA  C  3  7    ? 27.004  75.700  21.795  1.00 42.93  ? 8    DA  I C2    1 
ATOM   934   N  N3    . DA  C  3  7    ? 27.965  75.235  22.577  1.00 43.09  ? 8    DA  I N3    1 
ATOM   935   C  C4    . DA  C  3  7    ? 28.528  74.144  22.032  1.00 42.69  ? 8    DA  I C4    1 
ATOM   936   P  P     . DG  C  3  8    ? 30.355  73.432  27.557  1.00 56.11  ? 9    DG  I P     1 
ATOM   937   O  OP1   . DG  C  3  8    ? 30.571  74.090  28.877  1.00 53.82  ? 9    DG  I OP1   1 
ATOM   938   O  OP2   . DG  C  3  8    ? 30.099  71.963  27.509  1.00 55.53  ? 9    DG  I OP2   1 
ATOM   939   O  "O5'" . DG  C  3  8    ? 29.171  74.208  26.814  1.00 55.74  ? 9    DG  I "O5'" 1 
ATOM   940   C  "C5'" . DG  C  3  8    ? 29.314  75.577  26.433  1.00 55.85  ? 9    DG  I "C5'" 1 
ATOM   941   C  "C4'" . DG  C  3  8    ? 28.018  76.310  26.670  1.00 56.57  ? 9    DG  I "C4'" 1 
ATOM   942   O  "O4'" . DG  C  3  8    ? 27.084  76.133  25.585  1.00 56.99  ? 9    DG  I "O4'" 1 
ATOM   943   C  "C3'" . DG  C  3  8    ? 27.314  75.811  27.914  1.00 56.80  ? 9    DG  I "C3'" 1 
ATOM   944   O  "O3'" . DG  C  3  8    ? 26.639  76.893  28.518  1.00 57.44  ? 9    DG  I "O3'" 1 
ATOM   945   C  "C2'" . DG  C  3  8    ? 26.339  74.784  27.369  1.00 58.36  ? 9    DG  I "C2'" 1 
ATOM   946   C  "C1'" . DG  C  3  8    ? 25.965  75.371  26.020  1.00 58.88  ? 9    DG  I "C1'" 1 
ATOM   947   N  N9    . DG  C  3  8    ? 25.688  74.400  24.968  1.00 60.93  ? 9    DG  I N9    1 
ATOM   948   C  C8    . DG  C  3  8    ? 26.325  73.201  24.732  1.00 61.95  ? 9    DG  I C8    1 
ATOM   949   N  N7    . DG  C  3  8    ? 25.917  72.609  23.641  1.00 61.78  ? 9    DG  I N7    1 
ATOM   950   C  C5    . DG  C  3  8    ? 24.937  73.456  23.146  1.00 62.04  ? 9    DG  I C5    1 
ATOM   951   C  C6    . DG  C  3  8    ? 24.148  73.353  21.984  1.00 62.44  ? 9    DG  I C6    1 
ATOM   952   O  O6    . DG  C  3  8    ? 24.166  72.460  21.123  1.00 63.14  ? 9    DG  I O6    1 
ATOM   953   N  N1    . DG  C  3  8    ? 23.272  74.437  21.862  1.00 62.86  ? 9    DG  I N1    1 
ATOM   954   C  C2    . DG  C  3  8    ? 23.185  75.486  22.757  1.00 62.30  ? 9    DG  I C2    1 
ATOM   955   N  N2    . DG  C  3  8    ? 22.281  76.439  22.496  1.00 62.32  ? 9    DG  I N2    1 
ATOM   956   N  N3    . DG  C  3  8    ? 23.929  75.595  23.835  1.00 62.13  ? 9    DG  I N3    1 
ATOM   957   C  C4    . DG  C  3  8    ? 24.773  74.553  23.968  1.00 61.85  ? 9    DG  I C4    1 
ATOM   958   P  P     . DA  C  3  9    ? 26.354  76.850  30.084  1.00 57.75  ? 10   DA  I P     1 
ATOM   959   O  OP1   . DA  C  3  9    ? 27.494  77.508  30.771  1.00 58.83  ? 10   DA  I OP1   1 
ATOM   960   O  OP2   . DA  C  3  9    ? 25.997  75.444  30.410  1.00 59.67  ? 10   DA  I OP2   1 
ATOM   961   O  "O5'" . DA  C  3  9    ? 25.052  77.740  30.234  1.00 57.36  ? 10   DA  I "O5'" 1 
ATOM   962   C  "C5'" . DA  C  3  9    ? 24.682  78.635  29.200  1.00 56.77  ? 10   DA  I "C5'" 1 
ATOM   963   C  "C4'" . DA  C  3  9    ? 23.245  78.403  28.808  1.00 57.52  ? 10   DA  I "C4'" 1 
ATOM   964   O  "O4'" . DA  C  3  9    ? 23.105  77.389  27.786  1.00 55.04  ? 10   DA  I "O4'" 1 
ATOM   965   C  "C3'" . DA  C  3  9    ? 22.333  77.978  29.958  1.00 58.71  ? 10   DA  I "C3'" 1 
ATOM   966   O  "O3'" . DA  C  3  9    ? 21.167  78.783  29.903  1.00 62.59  ? 10   DA  I "O3'" 1 
ATOM   967   C  "C2'" . DA  C  3  9    ? 21.993  76.534  29.627  1.00 56.46  ? 10   DA  I "C2'" 1 
ATOM   968   C  "C1'" . DA  C  3  9    ? 21.999  76.566  28.122  1.00 54.61  ? 10   DA  I "C1'" 1 
ATOM   969   N  N9    . DA  C  3  9    ? 22.204  75.275  27.481  1.00 53.13  ? 10   DA  I N9    1 
ATOM   970   C  C8    . DA  C  3  9    ? 23.090  74.307  27.860  1.00 52.76  ? 10   DA  I C8    1 
ATOM   971   N  N7    . DA  C  3  9    ? 23.117  73.272  27.060  1.00 53.03  ? 10   DA  I N7    1 
ATOM   972   C  C5    . DA  C  3  9    ? 22.164  73.570  26.096  1.00 53.21  ? 10   DA  I C5    1 
ATOM   973   C  C6    . DA  C  3  9    ? 21.720  72.861  24.965  1.00 53.37  ? 10   DA  I C6    1 
ATOM   974   N  N6    . DA  C  3  9    ? 22.217  71.680  24.637  1.00 52.95  ? 10   DA  I N6    1 
ATOM   975   N  N1    . DA  C  3  9    ? 20.751  73.418  24.188  1.00 52.68  ? 10   DA  I N1    1 
ATOM   976   C  C2    . DA  C  3  9    ? 20.277  74.622  24.559  1.00 52.63  ? 10   DA  I C2    1 
ATOM   977   N  N3    . DA  C  3  9    ? 20.620  75.389  25.609  1.00 52.74  ? 10   DA  I N3    1 
ATOM   978   C  C4    . DA  C  3  9    ? 21.582  74.796  26.346  1.00 53.26  ? 10   DA  I C4    1 
ATOM   979   P  P     . DC  C  3  10   ? 19.992  78.551  30.956  1.00 65.64  ? 11   DC  I P     1 
ATOM   980   O  OP1   . DC  C  3  10   ? 19.670  79.858  31.573  1.00 66.10  ? 11   DC  I OP1   1 
ATOM   981   O  OP2   . DC  C  3  10   ? 20.352  77.400  31.826  1.00 66.11  ? 11   DC  I OP2   1 
ATOM   982   O  "O5'" . DC  C  3  10   ? 18.799  78.168  29.987  1.00 67.11  ? 11   DC  I "O5'" 1 
ATOM   983   C  "C5'" . DC  C  3  10   ? 18.552  78.956  28.827  1.00 71.63  ? 11   DC  I "C5'" 1 
ATOM   984   C  "C4'" . DC  C  3  10   ? 17.376  78.403  28.064  1.00 74.34  ? 11   DC  I "C4'" 1 
ATOM   985   O  "O4'" . DC  C  3  10   ? 17.767  77.201  27.354  1.00 75.99  ? 11   DC  I "O4'" 1 
ATOM   986   C  "C3'" . DC  C  3  10   ? 16.192  78.022  28.952  1.00 75.61  ? 11   DC  I "C3'" 1 
ATOM   987   O  "O3'" . DC  C  3  10   ? 14.992  78.525  28.362  1.00 75.99  ? 11   DC  I "O3'" 1 
ATOM   988   C  "C2'" . DC  C  3  10   ? 16.262  76.503  29.026  1.00 77.57  ? 11   DC  I "C2'" 1 
ATOM   989   C  "C1'" . DC  C  3  10   ? 16.938  76.099  27.722  1.00 77.87  ? 11   DC  I "C1'" 1 
ATOM   990   N  N1    . DC  C  3  10   ? 17.792  74.881  27.805  1.00 79.37  ? 11   DC  I N1    1 
ATOM   991   C  C2    . DC  C  3  10   ? 17.650  73.869  26.821  1.00 79.97  ? 11   DC  I C2    1 
ATOM   992   O  O2    . DC  C  3  10   ? 16.793  73.997  25.930  1.00 81.12  ? 11   DC  I O2    1 
ATOM   993   N  N3    . DC  C  3  10   ? 18.453  72.780  26.871  1.00 79.57  ? 11   DC  I N3    1 
ATOM   994   C  C4    . DC  C  3  10   ? 19.361  72.662  27.841  1.00 79.36  ? 11   DC  I C4    1 
ATOM   995   N  N4    . DC  C  3  10   ? 20.133  71.576  27.834  1.00 78.15  ? 11   DC  I N4    1 
ATOM   996   C  C5    . DC  C  3  10   ? 19.519  73.658  28.858  1.00 79.14  ? 11   DC  I C5    1 
ATOM   997   C  C6    . DC  C  3  10   ? 18.721  74.737  28.805  1.00 79.41  ? 11   DC  I C6    1 
ATOM   998   P  P     . DA  C  3  11   ? 13.560  77.923  28.783  1.00 76.82  ? 12   DA  I P     1 
ATOM   999   O  OP1   . DA  C  3  11   ? 12.535  78.977  28.547  1.00 77.89  ? 12   DA  I OP1   1 
ATOM   1000  O  OP2   . DA  C  3  11   ? 13.642  77.268  30.111  1.00 76.86  ? 12   DA  I OP2   1 
ATOM   1001  O  "O5'" . DA  C  3  11   ? 13.318  76.793  27.697  1.00 75.36  ? 12   DA  I "O5'" 1 
ATOM   1002  C  "C5'" . DA  C  3  11   ? 13.086  77.147  26.342  1.00 74.67  ? 12   DA  I "C5'" 1 
ATOM   1003  C  "C4'" . DA  C  3  11   ? 12.254  76.081  25.680  1.00 73.11  ? 12   DA  I "C4'" 1 
ATOM   1004  O  "O4'" . DA  C  3  11   ? 13.026  74.859  25.662  1.00 73.04  ? 12   DA  I "O4'" 1 
ATOM   1005  C  "C3'" . DA  C  3  11   ? 10.966  75.750  26.426  1.00 71.97  ? 12   DA  I "C3'" 1 
ATOM   1006  O  "O3'" . DA  C  3  11   ? 9.993   75.363  25.458  1.00 70.36  ? 12   DA  I "O3'" 1 
ATOM   1007  C  "C2'" . DA  C  3  11   ? 11.376  74.596  27.327  1.00 72.23  ? 12   DA  I "C2'" 1 
ATOM   1008  C  "C1'" . DA  C  3  11   ? 12.422  73.874  26.486  1.00 72.23  ? 12   DA  I "C1'" 1 
ATOM   1009  N  N9    . DA  C  3  11   ? 13.493  73.228  27.241  1.00 71.27  ? 12   DA  I N9    1 
ATOM   1010  C  C8    . DA  C  3  11   ? 14.156  73.694  28.352  1.00 70.81  ? 12   DA  I C8    1 
ATOM   1011  N  N7    . DA  C  3  11   ? 15.082  72.879  28.796  1.00 70.50  ? 12   DA  I N7    1 
ATOM   1012  C  C5    . DA  C  3  11   ? 15.025  71.802  27.919  1.00 69.41  ? 12   DA  I C5    1 
ATOM   1013  C  C6    . DA  C  3  11   ? 15.753  70.606  27.850  1.00 68.33  ? 12   DA  I C6    1 
ATOM   1014  N  N6    . DA  C  3  11   ? 16.713  70.295  28.709  1.00 66.72  ? 12   DA  I N6    1 
ATOM   1015  N  N1    . DA  C  3  11   ? 15.452  69.737  26.855  1.00 68.66  ? 12   DA  I N1    1 
ATOM   1016  C  C2    . DA  C  3  11   ? 14.483  70.073  25.986  1.00 68.78  ? 12   DA  I C2    1 
ATOM   1017  N  N3    . DA  C  3  11   ? 13.727  71.171  25.949  1.00 69.21  ? 12   DA  I N3    1 
ATOM   1018  C  C4    . DA  C  3  11   ? 14.052  72.005  26.955  1.00 70.02  ? 12   DA  I C4    1 
ATOM   1019  P  P     . DG  C  3  12   ? 8.519   74.927  25.917  1.00 69.30  ? 13   DG  I P     1 
ATOM   1020  O  OP1   . DG  C  3  12   ? 7.575   75.825  25.215  1.00 69.21  ? 13   DG  I OP1   1 
ATOM   1021  O  OP2   . DG  C  3  12   ? 8.456   74.824  27.393  1.00 68.07  ? 13   DG  I OP2   1 
ATOM   1022  O  "O5'" . DG  C  3  12   ? 8.387   73.472  25.267  1.00 69.81  ? 13   DG  I "O5'" 1 
ATOM   1023  C  "C5'" . DG  C  3  12   ? 8.832   73.243  23.922  1.00 69.97  ? 13   DG  I "C5'" 1 
ATOM   1024  C  "C4'" . DG  C  3  12   ? 8.979   71.764  23.646  1.00 71.04  ? 13   DG  I "C4'" 1 
ATOM   1025  O  "O4'" . DG  C  3  12   ? 10.090  71.224  24.401  1.00 70.92  ? 13   DG  I "O4'" 1 
ATOM   1026  C  "C3'" . DG  C  3  12   ? 7.765   70.901  23.997  1.00 71.78  ? 13   DG  I "C3'" 1 
ATOM   1027  O  "O3'" . DG  C  3  12   ? 7.559   69.886  22.996  1.00 72.50  ? 13   DG  I "O3'" 1 
ATOM   1028  C  "C2'" . DG  C  3  12   ? 8.157   70.280  25.325  1.00 71.19  ? 13   DG  I "C2'" 1 
ATOM   1029  C  "C1'" . DG  C  3  12   ? 9.657   70.103  25.165  1.00 71.11  ? 13   DG  I "C1'" 1 
ATOM   1030  N  N9    . DG  C  3  12   ? 10.410  70.116  26.415  1.00 70.98  ? 13   DG  I N9    1 
ATOM   1031  C  C8    . DG  C  3  12   ? 10.407  71.122  27.354  1.00 70.70  ? 13   DG  I C8    1 
ATOM   1032  N  N7    . DG  C  3  12   ? 11.234  70.909  28.338  1.00 70.18  ? 13   DG  I N7    1 
ATOM   1033  C  C5    . DG  C  3  12   ? 11.807  69.678  28.046  1.00 69.99  ? 13   DG  I C5    1 
ATOM   1034  C  C6    . DG  C  3  12   ? 12.786  68.948  28.752  1.00 69.17  ? 13   DG  I C6    1 
ATOM   1035  O  O6    . DG  C  3  12   ? 13.343  69.264  29.796  1.00 68.06  ? 13   DG  I O6    1 
ATOM   1036  N  N1    . DG  C  3  12   ? 13.096  67.744  28.116  1.00 68.61  ? 13   DG  I N1    1 
ATOM   1037  C  C2    . DG  C  3  12   ? 12.529  67.304  26.942  1.00 69.86  ? 13   DG  I C2    1 
ATOM   1038  N  N2    . DG  C  3  12   ? 12.958  66.107  26.490  1.00 70.34  ? 13   DG  I N2    1 
ATOM   1039  N  N3    . DG  C  3  12   ? 11.608  67.988  26.264  1.00 70.01  ? 13   DG  I N3    1 
ATOM   1040  C  C4    . DG  C  3  12   ? 11.298  69.160  26.873  1.00 70.47  ? 13   DG  I C4    1 
ATOM   1041  P  P     . DG  C  3  13   ? 6.160   69.078  22.946  1.00 73.75  ? 14   DG  I P     1 
ATOM   1042  O  OP1   . DG  C  3  13   ? 5.792   68.882  21.527  1.00 72.89  ? 14   DG  I OP1   1 
ATOM   1043  O  OP2   . DG  C  3  13   ? 5.206   69.754  23.855  1.00 73.06  ? 14   DG  I OP2   1 
ATOM   1044  O  "O5'" . DG  C  3  13   ? 6.506   67.652  23.584  1.00 74.05  ? 14   DG  I "O5'" 1 
ATOM   1045  C  "C5'" . DG  C  3  13   ? 7.031   66.596  22.777  1.00 74.52  ? 14   DG  I "C5'" 1 
ATOM   1046  C  "C4'" . DG  C  3  13   ? 7.147   65.318  23.576  1.00 75.22  ? 14   DG  I "C4'" 1 
ATOM   1047  O  "O4'" . DG  C  3  13   ? 8.152   65.494  24.607  1.00 75.20  ? 14   DG  I "O4'" 1 
ATOM   1048  C  "C3'" . DG  C  3  13   ? 5.874   64.837  24.280  1.00 75.98  ? 14   DG  I "C3'" 1 
ATOM   1049  O  "O3'" . DG  C  3  13   ? 5.718   63.416  24.093  1.00 76.28  ? 14   DG  I "O3'" 1 
ATOM   1050  C  "C2'" . DG  C  3  13   ? 6.115   65.211  25.732  1.00 77.54  ? 14   DG  I "C2'" 1 
ATOM   1051  C  "C1'" . DG  C  3  13   ? 7.632   65.139  25.876  1.00 77.07  ? 14   DG  I "C1'" 1 
ATOM   1052  N  N9    . DG  C  3  13   ? 8.160   66.085  26.860  1.00 77.74  ? 14   DG  I N9    1 
ATOM   1053  C  C8    . DG  C  3  13   ? 7.811   67.411  26.977  1.00 77.23  ? 14   DG  I C8    1 
ATOM   1054  N  N7    . DG  C  3  13   ? 8.406   68.019  27.967  1.00 77.58  ? 14   DG  I N7    1 
ATOM   1055  C  C5    . DG  C  3  13   ? 9.207   67.042  28.548  1.00 78.05  ? 14   DG  I C5    1 
ATOM   1056  C  C6    . DG  C  3  13   ? 10.083  67.124  29.668  1.00 77.74  ? 14   DG  I C6    1 
ATOM   1057  O  O6    . DG  C  3  13   ? 10.320  68.111  30.371  1.00 77.59  ? 14   DG  I O6    1 
ATOM   1058  N  N1    . DG  C  3  13   ? 10.710  65.900  29.934  1.00 77.04  ? 14   DG  I N1    1 
ATOM   1059  C  C2    . DG  C  3  13   ? 10.516  64.743  29.205  1.00 77.44  ? 14   DG  I C2    1 
ATOM   1060  N  N2    . DG  C  3  13   ? 11.212  63.661  29.617  1.00 76.86  ? 14   DG  I N2    1 
ATOM   1061  N  N3    . DG  C  3  13   ? 9.699   64.654  28.149  1.00 78.66  ? 14   DG  I N3    1 
ATOM   1062  C  C4    . DG  C  3  13   ? 9.080   65.837  27.879  1.00 78.44  ? 14   DG  I C4    1 
ATOM   1063  P  P     . DG  C  3  14   ? 4.659   62.581  24.984  1.00 76.44  ? 15   DG  I P     1 
ATOM   1064  O  OP1   . DG  C  3  14   ? 4.100   61.495  24.139  1.00 76.97  ? 15   DG  I OP1   1 
ATOM   1065  O  OP2   . DG  C  3  14   ? 3.723   63.521  25.659  1.00 76.99  ? 15   DG  I OP2   1 
ATOM   1066  O  "O5'" . DG  C  3  14   ? 5.598   61.907  26.086  1.00 76.92  ? 15   DG  I "O5'" 1 
ATOM   1067  C  "C5'" . DG  C  3  14   ? 5.064   61.120  27.158  1.00 78.50  ? 15   DG  I "C5'" 1 
ATOM   1068  C  "C4'" . DG  C  3  14   ? 6.179   60.402  27.892  1.00 78.50  ? 15   DG  I "C4'" 1 
ATOM   1069  O  "O4'" . DG  C  3  14   ? 7.189   61.354  28.306  1.00 78.07  ? 15   DG  I "O4'" 1 
ATOM   1070  C  "C3'" . DG  C  3  14   ? 5.761   59.653  29.161  1.00 78.23  ? 15   DG  I "C3'" 1 
ATOM   1071  O  "O3'" . DG  C  3  14   ? 6.577   58.505  29.374  1.00 78.56  ? 15   DG  I "O3'" 1 
ATOM   1072  C  "C2'" . DG  C  3  14   ? 6.071   60.639  30.271  1.00 77.26  ? 15   DG  I "C2'" 1 
ATOM   1073  C  "C1'" . DG  C  3  14   ? 7.243   61.455  29.725  1.00 77.14  ? 15   DG  I "C1'" 1 
ATOM   1074  N  N9    . DG  C  3  14   ? 7.114   62.866  30.061  1.00 76.79  ? 15   DG  I N9    1 
ATOM   1075  C  C8    . DG  C  3  14   ? 6.282   63.772  29.447  1.00 77.11  ? 15   DG  I C8    1 
ATOM   1076  N  N7    . DG  C  3  14   ? 6.314   64.955  30.000  1.00 77.71  ? 15   DG  I N7    1 
ATOM   1077  C  C5    . DG  C  3  14   ? 7.239   64.828  31.029  1.00 77.16  ? 15   DG  I C5    1 
ATOM   1078  C  C6    . DG  C  3  14   ? 7.690   65.788  31.982  1.00 77.12  ? 15   DG  I C6    1 
ATOM   1079  O  O6    . DG  C  3  14   ? 7.345   66.974  32.105  1.00 77.11  ? 15   DG  I O6    1 
ATOM   1080  N  N1    . DG  C  3  14   ? 8.637   65.243  32.851  1.00 76.85  ? 15   DG  I N1    1 
ATOM   1081  C  C2    . DG  C  3  14   ? 9.084   63.939  32.801  1.00 76.58  ? 15   DG  I C2    1 
ATOM   1082  N  N2    . DG  C  3  14   ? 9.993   63.596  33.717  1.00 76.28  ? 15   DG  I N2    1 
ATOM   1083  N  N3    . DG  C  3  14   ? 8.667   63.039  31.918  1.00 76.65  ? 15   DG  I N3    1 
ATOM   1084  C  C4    . DG  C  3  14   ? 7.752   63.548  31.071  1.00 76.70  ? 15   DG  I C4    1 
ATOM   1085  O  OP3   . DC  D  1  1    ? 68.714  -8.443  18.294  1.00 95.74  ? 1    DC  X OP3   1 
ATOM   1086  P  P     . DC  D  1  1    ? 68.638  -9.424  19.453  1.00 94.23  ? 1    DC  X P     1 
ATOM   1087  O  OP1   . DC  D  1  1    ? 67.294  -10.144 19.496  1.00 95.58  ? 1    DC  X OP1   1 
ATOM   1088  O  OP2   . DC  D  1  1    ? 69.832  -10.382 19.478  1.00 95.14  ? 1    DC  X OP2   1 
ATOM   1089  O  "O5'" . DC  D  1  1    ? 68.724  -8.516  20.810  1.00 93.46  ? 1    DC  X "O5'" 1 
ATOM   1090  C  "C5'" . DC  D  1  1    ? 67.747  -8.652  21.863  1.00 91.36  ? 1    DC  X "C5'" 1 
ATOM   1091  C  "C4'" . DC  D  1  1    ? 67.868  -10.015 22.504  1.00 90.94  ? 1    DC  X "C4'" 1 
ATOM   1092  O  "O4'" . DC  D  1  1    ? 68.917  -10.029 23.499  1.00 91.57  ? 1    DC  X "O4'" 1 
ATOM   1093  C  "C3'" . DC  D  1  1    ? 66.626  -10.556 23.209  1.00 88.87  ? 1    DC  X "C3'" 1 
ATOM   1094  O  "O3'" . DC  D  1  1    ? 66.604  -11.964 22.954  1.00 84.80  ? 1    DC  X "O3'" 1 
ATOM   1095  C  "C2'" . DC  D  1  1    ? 66.907  -10.264 24.679  1.00 90.14  ? 1    DC  X "C2'" 1 
ATOM   1096  C  "C1'" . DC  D  1  1    ? 68.401  -10.508 24.734  1.00 91.51  ? 1    DC  X "C1'" 1 
ATOM   1097  N  N1    . DC  D  1  1    ? 69.192  -9.884  25.808  1.00 92.66  ? 1    DC  X N1    1 
ATOM   1098  C  C2    . DC  D  1  1    ? 69.630  -10.692 26.863  1.00 93.37  ? 1    DC  X C2    1 
ATOM   1099  O  O2    . DC  D  1  1    ? 69.226  -11.866 26.932  1.00 94.58  ? 1    DC  X O2    1 
ATOM   1100  N  N3    . DC  D  1  1    ? 70.487  -10.181 27.776  1.00 93.05  ? 1    DC  X N3    1 
ATOM   1101  C  C4    . DC  D  1  1    ? 70.888  -8.915  27.676  1.00 92.61  ? 1    DC  X C4    1 
ATOM   1102  N  N4    . DC  D  1  1    ? 71.756  -8.482  28.580  1.00 92.65  ? 1    DC  X N4    1 
ATOM   1103  C  C5    . DC  D  1  1    ? 70.416  -8.048  26.643  1.00 92.28  ? 1    DC  X C5    1 
ATOM   1104  C  C6    . DC  D  1  1    ? 69.563  -8.566  25.746  1.00 92.37  ? 1    DC  X C6    1 
ATOM   1105  P  P     . DC  D  1  2    ? 65.229  -12.767 23.038  1.00 81.82  ? 2    DC  X P     1 
ATOM   1106  O  OP1   . DC  D  1  2    ? 65.260  -13.854 22.033  1.00 81.47  ? 2    DC  X OP1   1 
ATOM   1107  O  OP2   . DC  D  1  2    ? 64.096  -11.797 23.048  1.00 82.75  ? 2    DC  X OP2   1 
ATOM   1108  O  "O5'" . DC  D  1  2    ? 65.314  -13.415 24.480  1.00 80.78  ? 2    DC  X "O5'" 1 
ATOM   1109  C  "C5'" . DC  D  1  2    ? 64.242  -13.278 25.385  1.00 77.89  ? 2    DC  X "C5'" 1 
ATOM   1110  C  "C4'" . DC  D  1  2    ? 64.365  -14.308 26.476  1.00 76.02  ? 2    DC  X "C4'" 1 
ATOM   1111  O  "O4'" . DC  D  1  2    ? 65.563  -14.037 27.252  1.00 74.21  ? 2    DC  X "O4'" 1 
ATOM   1112  C  "C3'" . DC  D  1  2    ? 63.192  -14.241 27.440  1.00 74.49  ? 2    DC  X "C3'" 1 
ATOM   1113  O  "O3'" . DC  D  1  2    ? 62.756  -15.553 27.792  1.00 75.21  ? 2    DC  X "O3'" 1 
ATOM   1114  C  "C2'" . DC  D  1  2    ? 63.735  -13.451 28.611  1.00 72.86  ? 2    DC  X "C2'" 1 
ATOM   1115  C  "C1'" . DC  D  1  2    ? 65.241  -13.693 28.592  1.00 71.88  ? 2    DC  X "C1'" 1 
ATOM   1116  N  N1    . DC  D  1  2    ? 66.015  -12.483 28.934  1.00 69.41  ? 2    DC  X N1    1 
ATOM   1117  C  C2    . DC  D  1  2    ? 66.879  -12.484 30.060  1.00 67.78  ? 2    DC  X C2    1 
ATOM   1118  O  O2    . DC  D  1  2    ? 67.011  -13.514 30.746  1.00 66.18  ? 2    DC  X O2    1 
ATOM   1119  N  N3    . DC  D  1  2    ? 67.547  -11.351 30.368  1.00 67.29  ? 2    DC  X N3    1 
ATOM   1120  C  C4    . DC  D  1  2    ? 67.391  -10.255 29.622  1.00 67.62  ? 2    DC  X C4    1 
ATOM   1121  N  N4    . DC  D  1  2    ? 68.060  -9.162  29.978  1.00 67.59  ? 2    DC  X N4    1 
ATOM   1122  C  C5    . DC  D  1  2    ? 66.537  -10.230 28.476  1.00 68.27  ? 2    DC  X C5    1 
ATOM   1123  C  C6    . DC  D  1  2    ? 65.882  -11.353 28.171  1.00 68.70  ? 2    DC  X C6    1 
ATOM   1124  P  P     . DC  D  1  3    ? 61.272  -15.763 28.365  1.00 75.95  ? 3    DC  X P     1 
ATOM   1125  O  OP1   . DC  D  1  3    ? 60.755  -17.075 27.901  1.00 75.61  ? 3    DC  X OP1   1 
ATOM   1126  O  OP2   . DC  D  1  3    ? 60.520  -14.521 28.021  1.00 74.90  ? 3    DC  X OP2   1 
ATOM   1127  O  "O5'" . DC  D  1  3    ? 61.527  -15.836 29.949  1.00 77.37  ? 3    DC  X "O5'" 1 
ATOM   1128  C  "C5'" . DC  D  1  3    ? 62.542  -16.703 30.495  1.00 77.12  ? 3    DC  X "C5'" 1 
ATOM   1129  C  "C4'" . DC  D  1  3    ? 62.815  -16.413 31.958  1.00 77.90  ? 3    DC  X "C4'" 1 
ATOM   1130  O  "O4'" . DC  D  1  3    ? 63.732  -15.309 32.161  1.00 76.02  ? 3    DC  X "O4'" 1 
ATOM   1131  C  "C3'" . DC  D  1  3    ? 61.633  -16.181 32.899  1.00 79.68  ? 3    DC  X "C3'" 1 
ATOM   1132  O  "O3'" . DC  D  1  3    ? 61.775  -17.038 34.035  1.00 83.48  ? 3    DC  X "O3'" 1 
ATOM   1133  C  "C2'" . DC  D  1  3    ? 61.772  -14.721 33.311  1.00 78.40  ? 3    DC  X "C2'" 1 
ATOM   1134  C  "C1'" . DC  D  1  3    ? 63.272  -14.452 33.208  1.00 77.13  ? 3    DC  X "C1'" 1 
ATOM   1135  N  N1    . DC  D  1  3    ? 63.608  -13.077 32.796  1.00 76.33  ? 3    DC  X N1    1 
ATOM   1136  C  C2    . DC  D  1  3    ? 64.536  -12.289 33.530  1.00 75.89  ? 3    DC  X C2    1 
ATOM   1137  O  O2    . DC  D  1  3    ? 65.004  -12.698 34.611  1.00 74.45  ? 3    DC  X O2    1 
ATOM   1138  N  N3    . DC  D  1  3    ? 64.896  -11.088 33.026  1.00 76.08  ? 3    DC  X N3    1 
ATOM   1139  C  C4    . DC  D  1  3    ? 64.366  -10.657 31.873  1.00 76.11  ? 3    DC  X C4    1 
ATOM   1140  N  N4    . DC  D  1  3    ? 64.757  -9.487  31.394  1.00 75.74  ? 3    DC  X N4    1 
ATOM   1141  C  C5    . DC  D  1  3    ? 63.408  -11.407 31.157  1.00 76.07  ? 3    DC  X C5    1 
ATOM   1142  C  C6    . DC  D  1  3    ? 63.053  -12.588 31.651  1.00 76.83  ? 3    DC  X C6    1 
ATOM   1143  P  P     . DT  D  1  4    ? 60.717  -16.960 35.239  1.00 86.07  ? 4    DT  X P     1 
ATOM   1144  O  OP1   . DT  D  1  4    ? 60.694  -18.318 35.858  1.00 87.30  ? 4    DT  X OP1   1 
ATOM   1145  O  OP2   . DT  D  1  4    ? 59.456  -16.360 34.722  1.00 85.72  ? 4    DT  X OP2   1 
ATOM   1146  O  "O5'" . DT  D  1  4    ? 61.404  -15.950 36.263  1.00 85.92  ? 4    DT  X "O5'" 1 
ATOM   1147  C  "C5'" . DT  D  1  4    ? 62.730  -16.207 36.734  1.00 86.47  ? 4    DT  X "C5'" 1 
ATOM   1148  C  "C4'" . DT  D  1  4    ? 63.112  -15.248 37.838  1.00 86.73  ? 4    DT  X "C4'" 1 
ATOM   1149  O  "O4'" . DT  D  1  4    ? 63.605  -13.991 37.310  1.00 86.74  ? 4    DT  X "O4'" 1 
ATOM   1150  C  "C3'" . DT  D  1  4    ? 62.007  -14.905 38.842  1.00 86.51  ? 4    DT  X "C3'" 1 
ATOM   1151  O  "O3'" . DT  D  1  4    ? 62.499  -15.033 40.183  1.00 86.01  ? 4    DT  X "O3'" 1 
ATOM   1152  C  "C2'" . DT  D  1  4    ? 61.656  -13.461 38.522  1.00 86.22  ? 4    DT  X "C2'" 1 
ATOM   1153  C  "C1'" . DT  D  1  4    ? 62.931  -12.893 37.907  1.00 86.03  ? 4    DT  X "C1'" 1 
ATOM   1154  N  N1    . DT  D  1  4    ? 62.655  -11.918 36.841  1.00 85.62  ? 4    DT  X N1    1 
ATOM   1155  C  C2    . DT  D  1  4    ? 63.360  -10.738 36.804  1.00 85.92  ? 4    DT  X C2    1 
ATOM   1156  O  O2    . DT  D  1  4    ? 64.211  -10.443 37.631  1.00 86.51  ? 4    DT  X O2    1 
ATOM   1157  N  N3    . DT  D  1  4    ? 63.027  -9.910  35.753  1.00 86.24  ? 4    DT  X N3    1 
ATOM   1158  C  C4    . DT  D  1  4    ? 62.077  -10.159 34.775  1.00 85.69  ? 4    DT  X C4    1 
ATOM   1159  O  O4    . DT  D  1  4    ? 61.877  -9.346  33.895  1.00 85.87  ? 4    DT  X O4    1 
ATOM   1160  C  C5    . DT  D  1  4    ? 61.384  -11.410 34.890  1.00 85.27  ? 4    DT  X C5    1 
ATOM   1161  C  C7    . DT  D  1  4    ? 60.341  -11.758 33.878  1.00 85.25  ? 4    DT  X C7    1 
ATOM   1162  C  C6    . DT  D  1  4    ? 61.700  -12.212 35.897  1.00 84.94  ? 4    DT  X C6    1 
ATOM   1163  P  P     . DG  D  1  5    ? 61.593  -14.557 41.429  1.00 84.53  ? 5    DG  X P     1 
ATOM   1164  O  OP1   . DG  D  1  5    ? 61.951  -15.412 42.597  1.00 85.32  ? 5    DG  X OP1   1 
ATOM   1165  O  OP2   . DG  D  1  5    ? 60.174  -14.500 40.977  1.00 85.16  ? 5    DG  X OP2   1 
ATOM   1166  O  "O5'" . DG  D  1  5    ? 62.129  -13.075 41.692  1.00 82.53  ? 5    DG  X "O5'" 1 
ATOM   1167  C  "C5'" . DG  D  1  5    ? 63.549  -12.801 41.712  1.00 78.17  ? 5    DG  X "C5'" 1 
ATOM   1168  C  "C4'" . DG  D  1  5    ? 63.832  -11.389 42.186  1.00 74.44  ? 5    DG  X "C4'" 1 
ATOM   1169  O  "O4'" . DG  D  1  5    ? 63.680  -10.435 41.100  1.00 71.82  ? 5    DG  X "O4'" 1 
ATOM   1170  C  "C3'" . DG  D  1  5    ? 62.941  -10.902 43.335  1.00 72.57  ? 5    DG  X "C3'" 1 
ATOM   1171  O  "O3'" . DG  D  1  5    ? 63.702  -10.192 44.328  1.00 70.93  ? 5    DG  X "O3'" 1 
ATOM   1172  C  "C2'" . DG  D  1  5    ? 61.933  -10.001 42.642  1.00 71.72  ? 5    DG  X "C2'" 1 
ATOM   1173  C  "C1'" . DG  D  1  5    ? 62.699  -9.450  41.438  1.00 70.26  ? 5    DG  X "C1'" 1 
ATOM   1174  N  N9    . DG  D  1  5    ? 61.853  -9.224  40.263  1.00 67.35  ? 5    DG  X N9    1 
ATOM   1175  C  C8    . DG  D  1  5    ? 60.854  -10.047 39.791  1.00 66.02  ? 5    DG  X C8    1 
ATOM   1176  N  N7    . DG  D  1  5    ? 60.295  -9.599  38.704  1.00 64.77  ? 5    DG  X N7    1 
ATOM   1177  C  C5    . DG  D  1  5    ? 60.956  -8.409  38.441  1.00 63.68  ? 5    DG  X C5    1 
ATOM   1178  C  C6    . DG  D  1  5    ? 60.787  -7.494  37.388  1.00 62.52  ? 5    DG  X C6    1 
ATOM   1179  O  O6    . DG  D  1  5    ? 60.001  -7.564  36.449  1.00 62.77  ? 5    DG  X O6    1 
ATOM   1180  N  N1    . DG  D  1  5    ? 61.657  -6.412  37.496  1.00 61.76  ? 5    DG  X N1    1 
ATOM   1181  C  C2    . DG  D  1  5    ? 62.579  -6.247  38.494  1.00 62.28  ? 5    DG  X C2    1 
ATOM   1182  N  N2    . DG  D  1  5    ? 63.336  -5.144  38.424  1.00 61.13  ? 5    DG  X N2    1 
ATOM   1183  N  N3    . DG  D  1  5    ? 62.749  -7.104  39.487  1.00 63.79  ? 5    DG  X N3    1 
ATOM   1184  C  C4    . DG  D  1  5    ? 61.912  -8.155  39.398  1.00 64.78  ? 5    DG  X C4    1 
ATOM   1185  P  P     . DT  D  1  6    ? 62.948  -9.425  45.537  1.00 70.24  ? 6    DT  X P     1 
ATOM   1186  O  OP1   . DT  D  1  6    ? 63.815  -9.507  46.746  1.00 69.31  ? 6    DT  X OP1   1 
ATOM   1187  O  OP2   . DT  D  1  6    ? 61.527  -9.882  45.623  1.00 67.65  ? 6    DT  X OP2   1 
ATOM   1188  O  "O5'" . DT  D  1  6    ? 62.970  -7.906  45.040  1.00 70.21  ? 6    DT  X "O5'" 1 
ATOM   1189  C  "C5'" . DT  D  1  6    ? 64.197  -7.298  44.587  1.00 67.87  ? 6    DT  X "C5'" 1 
ATOM   1190  C  "C4'" . DT  D  1  6    ? 64.017  -5.810  44.384  1.00 65.59  ? 6    DT  X "C4'" 1 
ATOM   1191  O  "O4'" . DT  D  1  6    ? 63.368  -5.533  43.114  1.00 64.93  ? 6    DT  X "O4'" 1 
ATOM   1192  C  "C3'" . DT  D  1  6    ? 63.144  -5.178  45.461  1.00 64.77  ? 6    DT  X "C3'" 1 
ATOM   1193  O  "O3'" . DT  D  1  6    ? 63.622  -3.895  45.858  1.00 63.86  ? 6    DT  X "O3'" 1 
ATOM   1194  C  "C2'" . DT  D  1  6    ? 61.800  -5.061  44.782  1.00 65.62  ? 6    DT  X "C2'" 1 
ATOM   1195  C  "C1'" . DT  D  1  6    ? 62.157  -4.816  43.321  1.00 65.85  ? 6    DT  X "C1'" 1 
ATOM   1196  N  N1    . DT  D  1  6    ? 61.134  -5.328  42.356  1.00 66.98  ? 6    DT  X N1    1 
ATOM   1197  C  C2    . DT  D  1  6    ? 60.791  -4.586  41.230  1.00 67.18  ? 6    DT  X C2    1 
ATOM   1198  O  O2    . DT  D  1  6    ? 61.279  -3.510  40.960  1.00 67.86  ? 6    DT  X O2    1 
ATOM   1199  N  N3    . DT  D  1  6    ? 59.835  -5.172  40.424  1.00 67.32  ? 6    DT  X N3    1 
ATOM   1200  C  C4    . DT  D  1  6    ? 59.211  -6.388  40.643  1.00 67.29  ? 6    DT  X C4    1 
ATOM   1201  O  O4    . DT  D  1  6    ? 58.380  -6.803  39.867  1.00 67.53  ? 6    DT  X O4    1 
ATOM   1202  C  C5    . DT  D  1  6    ? 59.608  -7.092  41.818  1.00 67.92  ? 6    DT  X C5    1 
ATOM   1203  C  C7    . DT  D  1  6    ? 58.960  -8.406  42.112  1.00 68.52  ? 6    DT  X C7    1 
ATOM   1204  C  C6    . DT  D  1  6    ? 60.538  -6.544  42.603  1.00 67.45  ? 6    DT  X C6    1 
ATOM   1205  P  P     . DC  D  1  7    ? 63.149  -3.280  47.270  1.00 63.46  ? 7    DC  X P     1 
ATOM   1206  O  OP1   . DC  D  1  7    ? 64.362  -3.138  48.115  1.00 63.72  ? 7    DC  X OP1   1 
ATOM   1207  O  OP2   . DC  D  1  7    ? 61.995  -4.082  47.770  1.00 63.24  ? 7    DC  X OP2   1 
ATOM   1208  O  "O5'" . DC  D  1  7    ? 62.629  -1.821  46.881  1.00 60.91  ? 7    DC  X "O5'" 1 
ATOM   1209  C  "C5'" . DC  D  1  7    ? 63.517  -0.896  46.270  1.00 56.83  ? 7    DC  X "C5'" 1 
ATOM   1210  C  "C4'" . DC  D  1  7    ? 62.840  -0.161  45.136  1.00 54.37  ? 7    DC  X "C4'" 1 
ATOM   1211  O  "O4'" . DC  D  1  7    ? 62.058  -1.084  44.347  1.00 55.62  ? 7    DC  X "O4'" 1 
ATOM   1212  C  "C3'" . DC  D  1  7    ? 61.894  0.991   45.482  1.00 52.04  ? 7    DC  X "C3'" 1 
ATOM   1213  O  "O3'" . DC  D  1  7    ? 62.181  2.068   44.576  1.00 48.37  ? 7    DC  X "O3'" 1 
ATOM   1214  C  "C2'" . DC  D  1  7    ? 60.510  0.419   45.224  1.00 53.17  ? 7    DC  X "C2'" 1 
ATOM   1215  C  "C1'" . DC  D  1  7    ? 60.790  -0.511  44.061  1.00 55.46  ? 7    DC  X "C1'" 1 
ATOM   1216  N  N1    . DC  D  1  7    ? 59.829  -1.615  43.875  1.00 56.30  ? 7    DC  X N1    1 
ATOM   1217  C  C2    . DC  D  1  7    ? 59.044  -1.650  42.731  1.00 56.28  ? 7    DC  X C2    1 
ATOM   1218  O  O2    . DC  D  1  7    ? 59.144  -0.736  41.909  1.00 57.98  ? 7    DC  X O2    1 
ATOM   1219  N  N3    . DC  D  1  7    ? 58.184  -2.675  42.551  1.00 55.54  ? 7    DC  X N3    1 
ATOM   1220  C  C4    . DC  D  1  7    ? 58.089  -3.632  43.463  1.00 54.28  ? 7    DC  X C4    1 
ATOM   1221  N  N4    . DC  D  1  7    ? 57.239  -4.617  43.242  1.00 54.55  ? 7    DC  X N4    1 
ATOM   1222  C  C5    . DC  D  1  7    ? 58.863  -3.619  44.638  1.00 55.51  ? 7    DC  X C5    1 
ATOM   1223  C  C6    . DC  D  1  7    ? 59.714  -2.600  44.808  1.00 56.99  ? 7    DC  X C6    1 
ATOM   1224  P  P     . DT  D  1  8    ? 61.360  3.444   44.673  1.00 45.33  ? 8    DT  X P     1 
ATOM   1225  O  OP1   . DT  D  1  8    ? 62.192  4.597   44.245  1.00 43.28  ? 8    DT  X OP1   1 
ATOM   1226  O  OP2   . DT  D  1  8    ? 60.652  3.486   45.969  1.00 47.75  ? 8    DT  X OP2   1 
ATOM   1227  O  "O5'" . DT  D  1  8    ? 60.247  3.223   43.589  1.00 41.84  ? 8    DT  X "O5'" 1 
ATOM   1228  C  "C5'" . DT  D  1  8    ? 60.623  2.936   42.268  1.00 38.28  ? 8    DT  X "C5'" 1 
ATOM   1229  C  "C4'" . DT  D  1  8    ? 59.428  3.117   41.371  1.00 33.97  ? 8    DT  X "C4'" 1 
ATOM   1230  O  "O4'" . DT  D  1  8    ? 58.565  1.966   41.451  1.00 33.25  ? 8    DT  X "O4'" 1 
ATOM   1231  C  "C3'" . DT  D  1  8    ? 58.572  4.304   41.788  1.00 29.17  ? 8    DT  X "C3'" 1 
ATOM   1232  O  "O3'" . DT  D  1  8    ? 58.051  4.887   40.622  1.00 27.11  ? 8    DT  X "O3'" 1 
ATOM   1233  C  "C2'" . DT  D  1  8    ? 57.442  3.670   42.569  1.00 29.05  ? 8    DT  X "C2'" 1 
ATOM   1234  C  "C1'" . DT  D  1  8    ? 57.265  2.374   41.817  1.00 28.43  ? 8    DT  X "C1'" 1 
ATOM   1235  N  N1    . DT  D  1  8    ? 56.659  1.270   42.547  1.00 25.55  ? 8    DT  X N1    1 
ATOM   1236  C  C2    . DT  D  1  8    ? 55.660  0.605   41.926  1.00 23.82  ? 8    DT  X C2    1 
ATOM   1237  O  O2    . DT  D  1  8    ? 55.238  0.948   40.849  1.00 22.51  ? 8    DT  X O2    1 
ATOM   1238  N  N3    . DT  D  1  8    ? 55.163  -0.465  42.622  1.00 24.66  ? 8    DT  X N3    1 
ATOM   1239  C  C4    . DT  D  1  8    ? 55.565  -0.906  43.865  1.00 24.97  ? 8    DT  X C4    1 
ATOM   1240  O  O4    . DT  D  1  8    ? 55.028  -1.868  44.375  1.00 24.91  ? 8    DT  X O4    1 
ATOM   1241  C  C5    . DT  D  1  8    ? 56.626  -0.145  44.466  1.00 26.35  ? 8    DT  X C5    1 
ATOM   1242  C  C7    . DT  D  1  8    ? 57.150  -0.552  45.810  1.00 27.78  ? 8    DT  X C7    1 
ATOM   1243  C  C6    . DT  D  1  8    ? 57.106  0.900   43.790  1.00 26.41  ? 8    DT  X C6    1 
ATOM   1244  P  P     . DG  D  1  9    ? 57.620  6.404   40.648  1.00 27.31  ? 9    DG  X P     1 
ATOM   1245  O  OP1   . DG  D  1  9    ? 58.448  7.147   39.673  1.00 24.59  ? 9    DG  X OP1   1 
ATOM   1246  O  OP2   . DG  D  1  9    ? 57.591  6.809   42.065  1.00 28.46  ? 9    DG  X OP2   1 
ATOM   1247  O  "O5'" . DG  D  1  9    ? 56.119  6.364   40.152  1.00 27.25  ? 9    DG  X "O5'" 1 
ATOM   1248  C  "C5'" . DG  D  1  9    ? 55.799  5.858   38.860  1.00 26.03  ? 9    DG  X "C5'" 1 
ATOM   1249  C  "C4'" . DG  D  1  9    ? 54.316  5.587   38.763  1.00 25.23  ? 9    DG  X "C4'" 1 
ATOM   1250  O  "O4'" . DG  D  1  9    ? 53.982  4.347   39.441  1.00 24.05  ? 9    DG  X "O4'" 1 
ATOM   1251  C  "C3'" . DG  D  1  9    ? 53.473  6.683   39.416  1.00 24.01  ? 9    DG  X "C3'" 1 
ATOM   1252  O  "O3'" . DG  D  1  9    ? 52.352  6.994   38.581  1.00 22.64  ? 9    DG  X "O3'" 1 
ATOM   1253  C  "C2'" . DG  D  1  9    ? 53.068  6.060   40.744  1.00 25.21  ? 9    DG  X "C2'" 1 
ATOM   1254  C  "C1'" . DG  D  1  9    ? 52.969  4.587   40.396  1.00 24.04  ? 9    DG  X "C1'" 1 
ATOM   1255  N  N9    . DG  D  1  9    ? 53.173  3.666   41.503  1.00 23.71  ? 9    DG  X N9    1 
ATOM   1256  C  C8    . DG  D  1  9    ? 54.116  3.721   42.498  1.00 22.54  ? 9    DG  X C8    1 
ATOM   1257  N  N7    . DG  D  1  9    ? 54.024  2.729   43.340  1.00 23.97  ? 9    DG  X N7    1 
ATOM   1258  C  C5    . DG  D  1  9    ? 52.956  1.979   42.868  1.00 24.69  ? 9    DG  X C5    1 
ATOM   1259  C  C6    . DG  D  1  9    ? 52.383  0.766   43.356  1.00 25.99  ? 9    DG  X C6    1 
ATOM   1260  O  O6    . DG  D  1  9    ? 52.705  0.092   44.354  1.00 24.47  ? 9    DG  X O6    1 
ATOM   1261  N  N1    . DG  D  1  9    ? 51.325  0.352   42.547  1.00 27.03  ? 9    DG  X N1    1 
ATOM   1262  C  C2    . DG  D  1  9    ? 50.886  1.019   41.424  1.00 25.30  ? 9    DG  X C2    1 
ATOM   1263  N  N2    . DG  D  1  9    ? 49.876  0.461   40.763  1.00 26.01  ? 9    DG  X N2    1 
ATOM   1264  N  N3    . DG  D  1  9    ? 51.406  2.141   40.979  1.00 22.27  ? 9    DG  X N3    1 
ATOM   1265  C  C4    . DG  D  1  9    ? 52.427  2.553   41.734  1.00 22.80  ? 9    DG  X C4    1 
ATOM   1266  P  P     . DG  D  1  10   ? 51.427  8.264   38.914  1.00 24.36  ? 10   DG  X P     1 
ATOM   1267  O  OP1   . DG  D  1  10   ? 51.377  9.105   37.710  1.00 25.35  ? 10   DG  X OP1   1 
ATOM   1268  O  OP2   . DG  D  1  10   ? 51.844  8.858   40.196  1.00 20.38  ? 10   DG  X OP2   1 
ATOM   1269  O  "O5'" . DG  D  1  10   ? 49.972  7.626   39.045  1.00 23.96  ? 10   DG  X "O5'" 1 
ATOM   1270  C  "C5'" . DG  D  1  10   ? 49.446  6.804   38.001  1.00 26.17  ? 10   DG  X "C5'" 1 
ATOM   1271  C  "C4'" . DG  D  1  10   ? 48.274  5.996   38.504  1.00 29.75  ? 10   DG  X "C4'" 1 
ATOM   1272  O  "O4'" . DG  D  1  10   ? 48.706  4.947   39.408  1.00 31.22  ? 10   DG  X "O4'" 1 
ATOM   1273  C  "C3'" . DG  D  1  10   ? 47.249  6.818   39.277  1.00 30.24  ? 10   DG  X "C3'" 1 
ATOM   1274  O  "O3'" . DG  D  1  10   ? 45.953  6.349   38.944  1.00 30.04  ? 10   DG  X "O3'" 1 
ATOM   1275  C  "C2'" . DG  D  1  10   ? 47.552  6.482   40.723  1.00 31.24  ? 10   DG  X "C2'" 1 
ATOM   1276  C  "C1'" . DG  D  1  10   ? 47.974  5.036   40.616  1.00 32.24  ? 10   DG  X "C1'" 1 
ATOM   1277  N  N9    . DG  D  1  10   ? 48.836  4.576   41.700  1.00 33.90  ? 10   DG  X N9    1 
ATOM   1278  C  C8    . DG  D  1  10   ? 49.997  5.156   42.138  1.00 34.50  ? 10   DG  X C8    1 
ATOM   1279  N  N7    . DG  D  1  10   ? 50.529  4.533   43.150  1.00 34.78  ? 10   DG  X N7    1 
ATOM   1280  C  C5    . DG  D  1  10   ? 49.670  3.480   43.387  1.00 34.32  ? 10   DG  X C5    1 
ATOM   1281  C  C6    . DG  D  1  10   ? 49.736  2.478   44.348  1.00 35.85  ? 10   DG  X C6    1 
ATOM   1282  O  O6    . DG  D  1  10   ? 50.602  2.317   45.220  1.00 38.22  ? 10   DG  X O6    1 
ATOM   1283  N  N1    . DG  D  1  10   ? 48.665  1.592   44.242  1.00 35.10  ? 10   DG  X N1    1 
ATOM   1284  C  C2    . DG  D  1  10   ? 47.660  1.683   43.311  1.00 34.50  ? 10   DG  X C2    1 
ATOM   1285  N  N2    . DG  D  1  10   ? 46.716  0.742   43.349  1.00 35.24  ? 10   DG  X N2    1 
ATOM   1286  N  N3    . DG  D  1  10   ? 47.590  2.631   42.406  1.00 33.76  ? 10   DG  X N3    1 
ATOM   1287  C  C4    . DG  D  1  10   ? 48.623  3.488   42.500  1.00 33.71  ? 10   DG  X C4    1 
ATOM   1288  P  P     . DC  D  1  11   ? 44.676  7.000   39.639  1.00 31.88  ? 11   DC  X P     1 
ATOM   1289  O  OP1   . DC  D  1  11   ? 43.649  7.204   38.588  1.00 29.02  ? 11   DC  X OP1   1 
ATOM   1290  O  OP2   . DC  D  1  11   ? 45.125  8.138   40.483  1.00 30.12  ? 11   DC  X OP2   1 
ATOM   1291  O  "O5'" . DC  D  1  11   ? 44.169  5.845   40.589  1.00 35.54  ? 11   DC  X "O5'" 1 
ATOM   1292  C  "C5'" . DC  D  1  11   ? 43.182  4.937   40.144  1.00 40.62  ? 11   DC  X "C5'" 1 
ATOM   1293  C  "C4'" . DC  D  1  11   ? 42.203  4.682   41.257  1.00 46.22  ? 11   DC  X "C4'" 1 
ATOM   1294  O  "O4'" . DC  D  1  11   ? 42.885  3.871   42.257  1.00 47.97  ? 11   DC  X "O4'" 1 
ATOM   1295  C  "C3'" . DC  D  1  11   ? 41.799  5.984   41.945  1.00 48.30  ? 11   DC  X "C3'" 1 
ATOM   1296  O  "O3'" . DC  D  1  11   ? 40.439  6.397   41.729  1.00 51.66  ? 11   DC  X "O3'" 1 
ATOM   1297  C  "C2'" . DC  D  1  11   ? 42.292  5.879   43.380  1.00 50.23  ? 11   DC  X "C2'" 1 
ATOM   1298  C  "C1'" . DC  D  1  11   ? 42.814  4.453   43.560  1.00 49.25  ? 11   DC  X "C1'" 1 
ATOM   1299  N  N1    . DC  D  1  11   ? 44.176  4.450   44.177  1.00 49.45  ? 11   DC  X N1    1 
ATOM   1300  C  C2    . DC  D  1  11   ? 44.503  3.522   45.192  1.00 49.84  ? 11   DC  X C2    1 
ATOM   1301  O  O2    . DC  D  1  11   ? 43.676  2.673   45.546  1.00 50.70  ? 11   DC  X O2    1 
ATOM   1302  N  N3    . DC  D  1  11   ? 45.720  3.590   45.771  1.00 49.07  ? 11   DC  X N3    1 
ATOM   1303  C  C4    . DC  D  1  11   ? 46.588  4.515   45.388  1.00 49.85  ? 11   DC  X C4    1 
ATOM   1304  N  N4    . DC  D  1  11   ? 47.763  4.551   46.002  1.00 51.85  ? 11   DC  X N4    1 
ATOM   1305  C  C5    . DC  D  1  11   ? 46.296  5.447   44.362  1.00 49.68  ? 11   DC  X C5    1 
ATOM   1306  C  C6    . DC  D  1  11   ? 45.102  5.376   43.784  1.00 49.91  ? 11   DC  X C6    1 
ATOM   1307  P  P     . DG  D  1  12   ? 39.198  5.544   42.293  1.00 56.04  ? 12   DG  X P     1 
ATOM   1308  O  OP1   . DG  D  1  12   ? 38.890  4.460   41.338  1.00 55.78  ? 12   DG  X OP1   1 
ATOM   1309  O  OP2   . DG  D  1  12   ? 38.154  6.539   42.633  1.00 57.32  ? 12   DG  X OP2   1 
ATOM   1310  O  "O5'" . DG  D  1  12   ? 39.683  4.832   43.631  1.00 57.12  ? 12   DG  X "O5'" 1 
ATOM   1311  C  "C5'" . DG  D  1  12   ? 39.486  3.440   43.783  1.00 58.49  ? 12   DG  X "C5'" 1 
ATOM   1312  C  "C4'" . DG  D  1  12   ? 39.069  3.118   45.190  1.00 60.33  ? 12   DG  X "C4'" 1 
ATOM   1313  O  "O4'" . DG  D  1  12   ? 40.226  2.855   46.014  1.00 62.17  ? 12   DG  X "O4'" 1 
ATOM   1314  C  "C3'" . DG  D  1  12   ? 38.213  4.169   45.887  1.00 60.94  ? 12   DG  X "C3'" 1 
ATOM   1315  O  "O3'" . DG  D  1  12   ? 36.983  3.508   46.157  1.00 60.10  ? 12   DG  X "O3'" 1 
ATOM   1316  C  "C2'" . DG  D  1  12   ? 39.035  4.591   47.099  1.00 63.60  ? 12   DG  X "C2'" 1 
ATOM   1317  C  "C1'" . DG  D  1  12   ? 40.187  3.583   47.228  1.00 65.07  ? 12   DG  X "C1'" 1 
ATOM   1318  N  N9    . DG  D  1  12   ? 41.495  4.227   47.389  1.00 68.51  ? 12   DG  X N9    1 
ATOM   1319  C  C8    . DG  D  1  12   ? 41.998  5.241   46.608  1.00 68.29  ? 12   DG  X C8    1 
ATOM   1320  N  N7    . DG  D  1  12   ? 43.175  5.657   46.987  1.00 69.76  ? 12   DG  X N7    1 
ATOM   1321  C  C5    . DG  D  1  12   ? 43.484  4.868   48.092  1.00 71.32  ? 12   DG  X C5    1 
ATOM   1322  C  C6    . DG  D  1  12   ? 44.642  4.867   48.937  1.00 71.71  ? 12   DG  X C6    1 
ATOM   1323  O  O6    . DG  D  1  12   ? 45.645  5.584   48.861  1.00 71.81  ? 12   DG  X O6    1 
ATOM   1324  N  N1    . DG  D  1  12   ? 44.548  3.905   49.947  1.00 71.99  ? 12   DG  X N1    1 
ATOM   1325  C  C2    . DG  D  1  12   ? 43.480  3.057   50.125  1.00 72.26  ? 12   DG  X C2    1 
ATOM   1326  N  N2    . DG  D  1  12   ? 43.569  2.202   51.154  1.00 72.25  ? 12   DG  X N2    1 
ATOM   1327  N  N3    . DG  D  1  12   ? 42.396  3.048   49.346  1.00 72.75  ? 12   DG  X N3    1 
ATOM   1328  C  C4    . DG  D  1  12   ? 42.465  3.970   48.355  1.00 70.96  ? 12   DG  X C4    1 
ATOM   1329  P  P     . DT  D  1  13   ? 35.919  4.084   47.209  1.00 60.04  ? 13   DT  X P     1 
ATOM   1330  O  OP1   . DT  D  1  13   ? 34.967  2.982   47.101  1.00 60.35  ? 13   DT  X OP1   1 
ATOM   1331  O  OP2   . DT  D  1  13   ? 35.434  5.447   46.920  1.00 59.21  ? 13   DT  X OP2   1 
ATOM   1332  O  "O5'" . DT  D  1  13   ? 36.599  3.883   48.644  1.00 57.25  ? 13   DT  X "O5'" 1 
ATOM   1333  C  "C5'" . DT  D  1  13   ? 36.766  2.547   49.162  1.00 51.71  ? 13   DT  X "C5'" 1 
ATOM   1334  C  "C4'" . DT  D  1  13   ? 37.072  2.561   50.638  1.00 48.84  ? 13   DT  X "C4'" 1 
ATOM   1335  O  "O4'" . DT  D  1  13   ? 38.507  2.708   50.819  1.00 47.76  ? 13   DT  X "O4'" 1 
ATOM   1336  C  "C3'" . DT  D  1  13   ? 36.436  3.785   51.266  1.00 47.89  ? 13   DT  X "C3'" 1 
ATOM   1337  O  "O3'" . DT  D  1  13   ? 35.386  3.589   52.181  1.00 46.58  ? 13   DT  X "O3'" 1 
ATOM   1338  C  "C2'" . DT  D  1  13   ? 37.568  4.550   51.915  1.00 48.61  ? 13   DT  X "C2'" 1 
ATOM   1339  C  "C1'" . DT  D  1  13   ? 38.774  3.628   51.873  1.00 47.79  ? 13   DT  X "C1'" 1 
ATOM   1340  N  N1    . DT  D  1  13   ? 39.947  4.463   51.525  1.00 46.29  ? 13   DT  X N1    1 
ATOM   1341  C  C2    . DT  D  1  13   ? 41.071  4.515   52.364  1.00 47.27  ? 13   DT  X C2    1 
ATOM   1342  O  O2    . DT  D  1  13   ? 41.243  3.788   53.340  1.00 45.99  ? 13   DT  X O2    1 
ATOM   1343  N  N3    . DT  D  1  13   ? 41.997  5.490   52.008  1.00 47.03  ? 13   DT  X N3    1 
ATOM   1344  C  C4    . DT  D  1  13   ? 41.902  6.363   50.928  1.00 45.19  ? 13   DT  X C4    1 
ATOM   1345  O  O4    . DT  D  1  13   ? 42.755  7.184   50.738  1.00 45.29  ? 13   DT  X O4    1 
ATOM   1346  C  C5    . DT  D  1  13   ? 40.747  6.209   50.090  1.00 44.65  ? 13   DT  X C5    1 
ATOM   1347  C  C7    . DT  D  1  13   ? 40.587  7.112   48.913  1.00 44.83  ? 13   DT  X C7    1 
ATOM   1348  C  C6    . DT  D  1  13   ? 39.858  5.268   50.405  1.00 44.85  ? 13   DT  X C6    1 
ATOM   1349  P  P     . DT  D  1  14   ? 34.412  4.837   52.410  1.00 47.19  ? 14   DT  X P     1 
ATOM   1350  O  OP1   . DT  D  1  14   ? 34.938  5.947   51.558  1.00 47.94  ? 14   DT  X OP1   1 
ATOM   1351  O  OP2   . DT  D  1  14   ? 34.385  5.025   53.876  1.00 48.18  ? 14   DT  X OP2   1 
ATOM   1352  O  "O5'" . DT  D  1  14   ? 33.015  4.393   51.786  1.00 44.05  ? 14   DT  X "O5'" 1 
ATOM   1353  C  "C5'" . DT  D  1  14   ? 32.245  3.386   52.413  1.00 39.29  ? 14   DT  X "C5'" 1 
ATOM   1354  C  "C4'" . DT  D  1  14   ? 30.841  3.339   51.856  1.00 36.32  ? 14   DT  X "C4'" 1 
ATOM   1355  O  "O4'" . DT  D  1  14   ? 30.090  2.810   52.985  1.00 36.07  ? 14   DT  X "O4'" 1 
ATOM   1356  C  "C3'" . DT  D  1  14   ? 30.203  4.691   51.491  1.00 34.10  ? 14   DT  X "C3'" 1 
ATOM   1357  O  "O3'" . DT  D  1  14   ? 29.408  4.642   50.275  1.00 30.14  ? 14   DT  X "O3'" 1 
ATOM   1358  C  "C2'" . DT  D  1  14   ? 29.362  5.054   52.707  1.00 36.67  ? 14   DT  X "C2'" 1 
ATOM   1359  C  "C1'" . DT  D  1  14   ? 29.231  3.790   53.568  1.00 35.71  ? 14   DT  X "C1'" 1 
ATOM   1360  N  N1    . DT  D  1  14   ? 29.687  4.068   54.982  1.00 35.25  ? 14   DT  X N1    1 
ATOM   1361  C  C2    . DT  D  1  14   ? 28.855  3.859   56.072  1.00 33.65  ? 14   DT  X C2    1 
ATOM   1362  O  O2    . DT  D  1  14   ? 27.770  3.325   55.994  1.00 33.35  ? 14   DT  X O2    1 
ATOM   1363  N  N3    . DT  D  1  14   ? 29.362  4.323   57.284  1.00 32.73  ? 14   DT  X N3    1 
ATOM   1364  C  C4    . DT  D  1  14   ? 30.589  4.938   57.497  1.00 33.57  ? 14   DT  X C4    1 
ATOM   1365  O  O4    . DT  D  1  14   ? 30.915  5.322   58.604  1.00 32.79  ? 14   DT  X O4    1 
ATOM   1366  C  C5    . DT  D  1  14   ? 31.411  5.080   56.340  1.00 35.83  ? 14   DT  X C5    1 
ATOM   1367  C  C7    . DT  D  1  14   ? 32.754  5.736   56.488  1.00 34.06  ? 14   DT  X C7    1 
ATOM   1368  C  C6    . DT  D  1  14   ? 30.939  4.629   55.165  1.00 37.14  ? 14   DT  X C6    1 
ATOM   1369  P  P     . DC  D  1  15   ? 28.974  6.023   49.515  1.00 29.85  ? 15   DC  X P     1 
ATOM   1370  O  OP1   . DC  D  1  15   ? 28.971  5.812   48.043  1.00 28.64  ? 15   DC  X OP1   1 
ATOM   1371  O  OP2   . DC  D  1  15   ? 29.680  7.205   50.093  1.00 27.38  ? 15   DC  X OP2   1 
ATOM   1372  O  "O5'" . DC  D  1  15   ? 27.455  6.203   49.900  1.00 25.58  ? 15   DC  X "O5'" 1 
ATOM   1373  C  "C5'" . DC  D  1  15   ? 26.859  5.319   50.820  1.00 22.03  ? 15   DC  X "C5'" 1 
ATOM   1374  C  "C4'" . DC  D  1  15   ? 25.576  5.915   51.320  1.00 21.09  ? 15   DC  X "C4'" 1 
ATOM   1375  O  "O4'" . DC  D  1  15   ? 25.541  5.655   52.740  1.00 21.82  ? 15   DC  X "O4'" 1 
ATOM   1376  C  "C3'" . DC  D  1  15   ? 25.528  7.431   51.143  1.00 17.51  ? 15   DC  X "C3'" 1 
ATOM   1377  O  "O3'" . DC  D  1  15   ? 24.477  7.804   50.263  1.00 14.05  ? 15   DC  X "O3'" 1 
ATOM   1378  C  "C2'" . DC  D  1  15   ? 25.270  7.979   52.529  1.00 20.63  ? 15   DC  X "C2'" 1 
ATOM   1379  C  "C1'" . DC  D  1  15   ? 25.060  6.782   53.446  1.00 24.61  ? 15   DC  X "C1'" 1 
ATOM   1380  N  N1    . DC  D  1  15   ? 25.879  6.973   54.672  1.00 29.35  ? 15   DC  X N1    1 
ATOM   1381  C  C2    . DC  D  1  15   ? 25.264  6.970   55.949  1.00 30.65  ? 15   DC  X C2    1 
ATOM   1382  O  O2    . DC  D  1  15   ? 24.082  6.638   56.059  1.00 33.57  ? 15   DC  X O2    1 
ATOM   1383  N  N3    . DC  D  1  15   ? 25.986  7.338   57.026  1.00 30.64  ? 15   DC  X N3    1 
ATOM   1384  C  C4    . DC  D  1  15   ? 27.264  7.679   56.888  1.00 31.72  ? 15   DC  X C4    1 
ATOM   1385  N  N4    . DC  D  1  15   ? 27.920  8.083   57.971  1.00 34.16  ? 15   DC  X N4    1 
ATOM   1386  C  C5    . DC  D  1  15   ? 27.930  7.628   55.633  1.00 31.81  ? 15   DC  X C5    1 
ATOM   1387  C  C6    . DC  D  1  15   ? 27.214  7.253   54.565  1.00 31.10  ? 15   DC  X C6    1 
ATOM   1388  P  P     . DG  D  1  16   ? 24.288  9.339   49.873  1.00 16.54  ? 16   DG  X P     1 
ATOM   1389  O  OP1   . DG  D  1  16   ? 23.514  9.449   48.632  1.00 11.58  ? 16   DG  X OP1   1 
ATOM   1390  O  OP2   . DG  D  1  16   ? 25.586  10.031  49.992  1.00 19.08  ? 16   DG  X OP2   1 
ATOM   1391  O  "O5'" . DG  D  1  16   ? 23.401  9.913   51.050  1.00 15.17  ? 16   DG  X "O5'" 1 
ATOM   1392  C  "C5'" . DG  D  1  16   ? 22.115  9.397   51.245  1.00 18.18  ? 16   DG  X "C5'" 1 
ATOM   1393  C  "C4'" . DG  D  1  16   ? 21.494  9.961   52.493  1.00 20.92  ? 16   DG  X "C4'" 1 
ATOM   1394  O  "O4'" . DG  D  1  16   ? 22.141  9.394   53.650  1.00 22.06  ? 16   DG  X "O4'" 1 
ATOM   1395  C  "C3'" . DG  D  1  16   ? 21.627  11.469  52.624  1.00 23.37  ? 16   DG  X "C3'" 1 
ATOM   1396  O  "O3'" . DG  D  1  16   ? 20.389  12.124  52.465  1.00 26.46  ? 16   DG  X "O3'" 1 
ATOM   1397  C  "C2'" . DG  D  1  16   ? 22.117  11.687  54.042  1.00 23.75  ? 16   DG  X "C2'" 1 
ATOM   1398  C  "C1'" . DG  D  1  16   ? 22.088  10.330  54.707  1.00 25.91  ? 16   DG  X "C1'" 1 
ATOM   1399  N  N9    . DG  D  1  16   ? 23.311  10.241  55.496  1.00 29.61  ? 16   DG  X N9    1 
ATOM   1400  C  C8    . DG  D  1  16   ? 24.584  10.061  55.025  1.00 31.06  ? 16   DG  X C8    1 
ATOM   1401  N  N7    . DG  D  1  16   ? 25.499  10.243  55.936  1.00 32.85  ? 16   DG  X N7    1 
ATOM   1402  C  C5    . DG  D  1  16   ? 24.782  10.511  57.089  1.00 34.49  ? 16   DG  X C5    1 
ATOM   1403  C  C6    . DG  D  1  16   ? 25.234  10.813  58.404  1.00 36.51  ? 16   DG  X C6    1 
ATOM   1404  O  O6    . DG  D  1  16   ? 26.391  10.912  58.815  1.00 39.32  ? 16   DG  X O6    1 
ATOM   1405  N  N1    . DG  D  1  16   ? 24.173  11.016  59.277  1.00 37.28  ? 16   DG  X N1    1 
ATOM   1406  C  C2    . DG  D  1  16   ? 22.849  10.940  58.923  1.00 37.19  ? 16   DG  X C2    1 
ATOM   1407  N  N2    . DG  D  1  16   ? 21.961  11.158  59.906  1.00 37.69  ? 16   DG  X N2    1 
ATOM   1408  N  N3    . DG  D  1  16   ? 22.417  10.671  57.696  1.00 35.65  ? 16   DG  X N3    1 
ATOM   1409  C  C4    . DG  D  1  16   ? 23.429  10.471  56.841  1.00 32.65  ? 16   DG  X C4    1 
ATOM   1410  P  P     . DC  D  1  17   ? 20.366  13.720  52.392  1.00 31.59  ? 17   DC  X P     1 
ATOM   1411  O  OP1   . DC  D  1  17   ? 19.092  14.104  51.716  1.00 30.96  ? 17   DC  X OP1   1 
ATOM   1412  O  OP2   . DC  D  1  17   ? 21.660  14.201  51.825  1.00 29.81  ? 17   DC  X OP2   1 
ATOM   1413  O  "O5'" . DC  D  1  17   ? 20.357  14.131  53.938  1.00 29.58  ? 17   DC  X "O5'" 1 
ATOM   1414  C  "C5'" . DC  D  1  17   ? 19.380  13.611  54.832  1.00 29.03  ? 17   DC  X "C5'" 1 
ATOM   1415  C  "C4'" . DC  D  1  17   ? 19.383  14.384  56.129  1.00 29.77  ? 17   DC  X "C4'" 1 
ATOM   1416  O  "O4'" . DC  D  1  17   ? 20.342  13.780  57.034  1.00 28.30  ? 17   DC  X "O4'" 1 
ATOM   1417  C  "C3'" . DC  D  1  17   ? 19.788  15.851  55.961  1.00 31.09  ? 17   DC  X "C3'" 1 
ATOM   1418  O  "O3'" . DC  D  1  17   ? 18.793  16.775  56.364  1.00 33.64  ? 17   DC  X "O3'" 1 
ATOM   1419  C  "C2'" . DC  D  1  17   ? 21.006  16.018  56.846  1.00 30.62  ? 17   DC  X "C2'" 1 
ATOM   1420  C  "C1'" . DC  D  1  17   ? 21.043  14.793  57.736  1.00 30.91  ? 17   DC  X "C1'" 1 
ATOM   1421  N  N1    . DC  D  1  17   ? 22.455  14.417  57.841  1.00 31.93  ? 17   DC  X N1    1 
ATOM   1422  C  C2    . DC  D  1  17   ? 23.133  14.704  59.009  1.00 33.13  ? 17   DC  X C2    1 
ATOM   1423  O  O2    . DC  D  1  17   ? 22.494  15.089  59.986  1.00 34.22  ? 17   DC  X O2    1 
ATOM   1424  N  N3    . DC  D  1  17   ? 24.472  14.569  59.047  1.00 34.39  ? 17   DC  X N3    1 
ATOM   1425  C  C4    . DC  D  1  17   ? 25.127  14.145  57.970  1.00 35.22  ? 17   DC  X C4    1 
ATOM   1426  N  N4    . DC  D  1  17   ? 26.458  14.078  58.036  1.00 36.56  ? 17   DC  X N4    1 
ATOM   1427  C  C5    . DC  D  1  17   ? 24.452  13.778  56.782  1.00 34.54  ? 17   DC  X C5    1 
ATOM   1428  C  C6    . DC  D  1  17   ? 23.123  13.902  56.767  1.00 33.82  ? 17   DC  X C6    1 
ATOM   1429  P  P     . DG  D  1  18   ? 18.952  18.334  55.971  1.00 37.86  ? 18   DG  X P     1 
ATOM   1430  O  OP1   . DG  D  1  18   ? 17.707  18.786  55.301  1.00 36.01  ? 18   DG  X OP1   1 
ATOM   1431  O  OP2   . DG  D  1  18   ? 20.265  18.531  55.294  1.00 36.31  ? 18   DG  X OP2   1 
ATOM   1432  O  "O5'" . DG  D  1  18   ? 19.031  19.023  57.403  1.00 36.76  ? 18   DG  X "O5'" 1 
ATOM   1433  C  "C5'" . DG  D  1  18   ? 19.633  18.329  58.482  1.00 36.22  ? 18   DG  X "C5'" 1 
ATOM   1434  C  "C4'" . DG  D  1  18   ? 19.679  19.196  59.708  1.00 36.64  ? 18   DG  X "C4'" 1 
ATOM   1435  O  "O4'" . DG  D  1  18   ? 20.599  18.448  60.525  1.00 36.99  ? 18   DG  X "O4'" 1 
ATOM   1436  C  "C3'" . DG  D  1  18   ? 20.317  20.554  59.455  1.00 37.22  ? 18   DG  X "C3'" 1 
ATOM   1437  O  "O3'" . DG  D  1  18   ? 19.574  21.675  59.890  1.00 38.86  ? 18   DG  X "O3'" 1 
ATOM   1438  C  "C2'" . DG  D  1  18   ? 21.644  20.529  60.169  1.00 37.56  ? 18   DG  X "C2'" 1 
ATOM   1439  C  "C1'" . DG  D  1  18   ? 21.773  19.167  60.792  1.00 38.52  ? 18   DG  X "C1'" 1 
ATOM   1440  N  N9    . DG  D  1  18   ? 22.888  18.552  60.087  1.00 40.01  ? 18   DG  X N9    1 
ATOM   1441  C  C8    . DG  D  1  18   ? 22.942  18.014  58.827  1.00 39.41  ? 18   DG  X C8    1 
ATOM   1442  N  N7    . DG  D  1  18   ? 24.158  17.788  58.428  1.00 39.92  ? 18   DG  X N7    1 
ATOM   1443  C  C5    . DG  D  1  18   ? 24.935  18.148  59.512  1.00 43.23  ? 18   DG  X C5    1 
ATOM   1444  C  C6    . DG  D  1  18   ? 26.335  18.142  59.693  1.00 46.62  ? 18   DG  X C6    1 
ATOM   1445  O  O6    . DG  D  1  18   ? 27.215  17.810  58.890  1.00 49.66  ? 18   DG  X O6    1 
ATOM   1446  N  N1    . DG  D  1  18   ? 26.684  18.591  60.967  1.00 48.53  ? 18   DG  X N1    1 
ATOM   1447  C  C2    . DG  D  1  18   ? 25.794  18.994  61.930  1.00 47.52  ? 18   DG  X C2    1 
ATOM   1448  N  N2    . DG  D  1  18   ? 26.275  19.393  63.110  1.00 49.36  ? 18   DG  X N2    1 
ATOM   1449  N  N3    . DG  D  1  18   ? 24.504  19.005  61.759  1.00 46.05  ? 18   DG  X N3    1 
ATOM   1450  C  C4    . DG  D  1  18   ? 24.150  18.576  60.547  1.00 42.09  ? 18   DG  X C4    1 
ATOM   1451  P  P     . DC  D  1  19   ? 19.956  23.122  59.295  1.00 41.55  ? 19   DC  X P     1 
ATOM   1452  O  OP1   . DC  D  1  19   ? 18.745  23.920  58.980  1.00 41.30  ? 19   DC  X OP1   1 
ATOM   1453  O  OP2   . DC  D  1  19   ? 20.973  22.878  58.240  1.00 40.38  ? 19   DC  X OP2   1 
ATOM   1454  O  "O5'" . DC  D  1  19   ? 20.704  23.832  60.490  1.00 40.13  ? 19   DC  X "O5'" 1 
ATOM   1455  C  "C5'" . DC  D  1  19   ? 20.806  23.199  61.755  1.00 41.66  ? 19   DC  X "C5'" 1 
ATOM   1456  C  "C4'" . DC  D  1  19   ? 22.092  23.618  62.414  1.00 41.41  ? 19   DC  X "C4'" 1 
ATOM   1457  O  "O4'" . DC  D  1  19   ? 23.167  22.717  62.054  1.00 41.46  ? 19   DC  X "O4'" 1 
ATOM   1458  C  "C3'" . DC  D  1  19   ? 22.469  24.985  61.868  1.00 40.62  ? 19   DC  X "C3'" 1 
ATOM   1459  O  "O3'" . DC  D  1  19   ? 22.618  25.969  62.853  1.00 40.52  ? 19   DC  X "O3'" 1 
ATOM   1460  C  "C2'" . DC  D  1  19   ? 23.745  24.766  61.092  1.00 40.87  ? 19   DC  X "C2'" 1 
ATOM   1461  C  "C1'" . DC  D  1  19   ? 24.288  23.468  61.637  1.00 42.24  ? 19   DC  X "C1'" 1 
ATOM   1462  N  N1    . DC  D  1  19   ? 25.009  22.721  60.590  1.00 44.33  ? 19   DC  X N1    1 
ATOM   1463  C  C2    . DC  D  1  19   ? 26.383  22.540  60.734  1.00 44.82  ? 19   DC  X C2    1 
ATOM   1464  O  O2    . DC  D  1  19   ? 26.913  22.878  61.793  1.00 46.64  ? 19   DC  X O2    1 
ATOM   1465  N  N3    . DC  D  1  19   ? 27.097  22.001  59.722  1.00 44.25  ? 19   DC  X N3    1 
ATOM   1466  C  C4    . DC  D  1  19   ? 26.485  21.618  58.614  1.00 44.72  ? 19   DC  X C4    1 
ATOM   1467  N  N4    . DC  D  1  19   ? 27.239  21.124  57.640  1.00 43.99  ? 19   DC  X N4    1 
ATOM   1468  C  C5    . DC  D  1  19   ? 25.072  21.731  58.456  1.00 46.08  ? 19   DC  X C5    1 
ATOM   1469  C  C6    . DC  D  1  19   ? 24.377  22.277  59.466  1.00 45.28  ? 19   DC  X C6    1 
ATOM   1470  P  P     . DG  D  1  20   ? 22.607  27.496  62.388  1.00 41.89  ? 20   DG  X P     1 
ATOM   1471  O  OP1   . DG  D  1  20   ? 22.237  28.346  63.542  1.00 43.42  ? 20   DG  X OP1   1 
ATOM   1472  O  OP2   . DG  D  1  20   ? 21.803  27.576  61.134  1.00 41.22  ? 20   DG  X OP2   1 
ATOM   1473  O  "O5'" . DG  D  1  20   ? 24.137  27.723  62.047  1.00 36.30  ? 20   DG  X "O5'" 1 
ATOM   1474  C  "C5'" . DG  D  1  20   ? 25.119  27.592  63.056  1.00 31.74  ? 20   DG  X "C5'" 1 
ATOM   1475  C  "C4'" . DG  D  1  20   ? 26.441  28.094  62.541  1.00 31.01  ? 20   DG  X "C4'" 1 
ATOM   1476  O  "O4'" . DG  D  1  20   ? 27.182  27.022  61.914  1.00 29.85  ? 20   DG  X "O4'" 1 
ATOM   1477  C  "C3'" . DG  D  1  20   ? 26.355  29.228  61.515  1.00 30.52  ? 20   DG  X "C3'" 1 
ATOM   1478  O  "O3'" . DG  D  1  20   ? 27.272  30.277  61.849  1.00 31.35  ? 20   DG  X "O3'" 1 
ATOM   1479  C  "C2'" . DG  D  1  20   ? 26.739  28.551  60.213  1.00 31.10  ? 20   DG  X "C2'" 1 
ATOM   1480  C  "C1'" . DG  D  1  20   ? 27.679  27.450  60.665  1.00 28.97  ? 20   DG  X "C1'" 1 
ATOM   1481  N  N9    . DG  D  1  20   ? 27.675  26.308  59.761  1.00 28.21  ? 20   DG  X N9    1 
ATOM   1482  C  C8    . DG  D  1  20   ? 26.577  25.667  59.247  1.00 26.96  ? 20   DG  X C8    1 
ATOM   1483  N  N7    . DG  D  1  20   ? 26.887  24.748  58.379  1.00 27.49  ? 20   DG  X N7    1 
ATOM   1484  C  C5    . DG  D  1  20   ? 28.270  24.767  58.336  1.00 27.76  ? 20   DG  X C5    1 
ATOM   1485  C  C6    . DG  D  1  20   ? 29.168  24.001  57.568  1.00 27.69  ? 20   DG  X C6    1 
ATOM   1486  O  O6    . DG  D  1  20   ? 28.911  23.135  56.746  1.00 27.71  ? 20   DG  X O6    1 
ATOM   1487  N  N1    . DG  D  1  20   ? 30.492  24.333  57.834  1.00 27.65  ? 20   DG  X N1    1 
ATOM   1488  C  C2    . DG  D  1  20   ? 30.888  25.290  58.728  1.00 28.71  ? 20   DG  X C2    1 
ATOM   1489  N  N2    . DG  D  1  20   ? 32.198  25.485  58.844  1.00 29.86  ? 20   DG  X N2    1 
ATOM   1490  N  N3    . DG  D  1  20   ? 30.054  26.016  59.455  1.00 28.44  ? 20   DG  X N3    1 
ATOM   1491  C  C4    . DG  D  1  20   ? 28.771  25.706  59.204  1.00 28.16  ? 20   DG  X C4    1 
ATOM   1492  P  P     . DC  D  1  21   ? 27.565  31.493  60.828  1.00 32.08  ? 21   DC  X P     1 
ATOM   1493  O  OP1   . DC  D  1  21   ? 27.827  32.718  61.635  1.00 28.59  ? 21   DC  X OP1   1 
ATOM   1494  O  OP2   . DC  D  1  21   ? 26.503  31.504  59.790  1.00 30.72  ? 21   DC  X OP2   1 
ATOM   1495  O  "O5'" . DC  D  1  21   ? 28.950  31.050  60.216  1.00 25.81  ? 21   DC  X "O5'" 1 
ATOM   1496  C  "C5'" . DC  D  1  21   ? 29.946  30.580  61.092  1.00 26.59  ? 21   DC  X "C5'" 1 
ATOM   1497  C  "C4'" . DC  D  1  21   ? 31.229  30.449  60.338  1.00 28.59  ? 21   DC  X "C4'" 1 
ATOM   1498  O  "O4'" . DC  D  1  21   ? 31.132  29.275  59.513  1.00 31.71  ? 21   DC  X "O4'" 1 
ATOM   1499  C  "C3'" . DC  D  1  21   ? 31.356  31.631  59.399  1.00 27.69  ? 21   DC  X "C3'" 1 
ATOM   1500  O  "O3'" . DC  D  1  21   ? 32.673  32.111  59.385  1.00 27.62  ? 21   DC  X "O3'" 1 
ATOM   1501  C  "C2'" . DC  D  1  21   ? 30.969  31.076  58.047  1.00 30.66  ? 21   DC  X "C2'" 1 
ATOM   1502  C  "C1'" . DC  D  1  21   ? 31.371  29.625  58.173  1.00 32.31  ? 21   DC  X "C1'" 1 
ATOM   1503  N  N1    . DC  D  1  21   ? 30.620  28.698  57.315  1.00 34.57  ? 21   DC  X N1    1 
ATOM   1504  C  C2    . DC  D  1  21   ? 31.344  27.874  56.454  1.00 36.51  ? 21   DC  X C2    1 
ATOM   1505  O  O2    . DC  D  1  21   ? 32.587  27.908  56.494  1.00 35.22  ? 21   DC  X O2    1 
ATOM   1506  N  N3    . DC  D  1  21   ? 30.675  27.059  55.603  1.00 38.52  ? 21   DC  X N3    1 
ATOM   1507  C  C4    . DC  D  1  21   ? 29.342  27.034  55.606  1.00 36.73  ? 21   DC  X C4    1 
ATOM   1508  N  N4    . DC  D  1  21   ? 28.747  26.216  54.738  1.00 37.22  ? 21   DC  X N4    1 
ATOM   1509  C  C5    . DC  D  1  21   ? 28.575  27.845  56.495  1.00 35.21  ? 21   DC  X C5    1 
ATOM   1510  C  C6    . DC  D  1  21   ? 29.251  28.653  57.329  1.00 34.68  ? 21   DC  X C6    1 
ATOM   1511  P  P     . DC  D  1  22   ? 32.963  33.513  58.690  1.00 31.80  ? 22   DC  X P     1 
ATOM   1512  O  OP1   . DC  D  1  22   ? 33.995  34.216  59.490  1.00 29.39  ? 22   DC  X OP1   1 
ATOM   1513  O  OP2   . DC  D  1  22   ? 31.643  34.161  58.462  1.00 29.90  ? 22   DC  X OP2   1 
ATOM   1514  O  "O5'" . DC  D  1  22   ? 33.550  33.076  57.270  1.00 29.00  ? 22   DC  X "O5'" 1 
ATOM   1515  C  "C5'" . DC  D  1  22   ? 34.805  32.373  57.175  1.00 24.94  ? 22   DC  X "C5'" 1 
ATOM   1516  C  "C4'" . DC  D  1  22   ? 35.246  32.278  55.735  1.00 20.74  ? 22   DC  X "C4'" 1 
ATOM   1517  O  "O4'" . DC  D  1  22   ? 34.608  31.150  55.096  1.00 21.03  ? 22   DC  X "O4'" 1 
ATOM   1518  C  "C3'" . DC  D  1  22   ? 34.833  33.516  54.941  1.00 18.40  ? 22   DC  X "C3'" 1 
ATOM   1519  O  "O3'" . DC  D  1  22   ? 35.850  33.942  54.036  1.00 16.40  ? 22   DC  X "O3'" 1 
ATOM   1520  C  "C2'" . DC  D  1  22   ? 33.601  33.059  54.192  1.00 20.51  ? 22   DC  X "C2'" 1 
ATOM   1521  C  "C1'" . DC  D  1  22   ? 33.913  31.604  53.942  1.00 20.93  ? 22   DC  X "C1'" 1 
ATOM   1522  N  N1    . DC  D  1  22   ? 32.743  30.732  53.704  1.00 20.41  ? 22   DC  X N1    1 
ATOM   1523  C  C2    . DC  D  1  22   ? 32.857  29.752  52.723  1.00 20.44  ? 22   DC  X C2    1 
ATOM   1524  O  O2    . DC  D  1  22   ? 33.927  29.648  52.108  1.00 20.78  ? 22   DC  X O2    1 
ATOM   1525  N  N3    . DC  D  1  22   ? 31.806  28.948  52.465  1.00 21.80  ? 22   DC  X N3    1 
ATOM   1526  C  C4    . DC  D  1  22   ? 30.665  29.097  53.139  1.00 20.94  ? 22   DC  X C4    1 
ATOM   1527  N  N4    . DC  D  1  22   ? 29.655  28.277  52.832  1.00 19.47  ? 22   DC  X N4    1 
ATOM   1528  C  C5    . DC  D  1  22   ? 30.515  30.090  54.148  1.00 19.05  ? 22   DC  X C5    1 
ATOM   1529  C  C6    . DC  D  1  22   ? 31.573  30.875  54.402  1.00 18.85  ? 22   DC  X C6    1 
ATOM   1530  P  P     . DG  D  1  23   ? 35.761  35.419  53.412  1.00 17.83  ? 23   DG  X P     1 
ATOM   1531  O  OP1   . DG  D  1  23   ? 36.700  36.312  54.111  1.00 15.03  ? 23   DG  X OP1   1 
ATOM   1532  O  OP2   . DG  D  1  23   ? 34.320  35.772  53.421  1.00 15.49  ? 23   DG  X OP2   1 
ATOM   1533  O  "O5'" . DG  D  1  23   ? 36.212  35.212  51.884  1.00 14.28  ? 23   DG  X "O5'" 1 
ATOM   1534  C  "C5'" . DG  D  1  23   ? 37.472  34.606  51.535  1.00 9.58   ? 23   DG  X "C5'" 1 
ATOM   1535  C  "C4'" . DG  D  1  23   ? 37.494  34.158  50.082  1.00 5.58   ? 23   DG  X "C4'" 1 
ATOM   1536  O  "O4'" . DG  D  1  23   ? 36.453  33.188  49.853  1.00 5.08   ? 23   DG  X "O4'" 1 
ATOM   1537  C  "C3'" . DG  D  1  23   ? 37.302  35.224  49.003  1.00 4.67   ? 23   DG  X "C3'" 1 
ATOM   1538  O  "O3'" . DG  D  1  23   ? 37.915  34.785  47.798  1.00 4.26   ? 23   DG  X "O3'" 1 
ATOM   1539  C  "C2'" . DG  D  1  23   ? 35.818  35.166  48.724  1.00 2.80   ? 23   DG  X "C2'" 1 
ATOM   1540  C  "C1'" . DG  D  1  23   ? 35.503  33.690  48.931  1.00 5.95   ? 23   DG  X "C1'" 1 
ATOM   1541  N  N9    . DG  D  1  23   ? 34.182  33.416  49.487  1.00 7.95   ? 23   DG  X N9    1 
ATOM   1542  C  C8    . DG  D  1  23   ? 33.548  34.050  50.537  1.00 7.42   ? 23   DG  X C8    1 
ATOM   1543  N  N7    . DG  D  1  23   ? 32.372  33.551  50.805  1.00 6.55   ? 23   DG  X N7    1 
ATOM   1544  C  C5    . DG  D  1  23   ? 32.225  32.523  49.877  1.00 7.34   ? 23   DG  X C5    1 
ATOM   1545  C  C6    . DG  D  1  23   ? 31.152  31.606  49.668  1.00 6.31   ? 23   DG  X C6    1 
ATOM   1546  O  O6    . DG  D  1  23   ? 30.089  31.515  50.282  1.00 2.80   ? 23   DG  X O6    1 
ATOM   1547  N  N1    . DG  D  1  23   ? 31.426  30.742  48.616  1.00 7.61   ? 23   DG  X N1    1 
ATOM   1548  C  C2    . DG  D  1  23   ? 32.584  30.761  47.862  1.00 11.52  ? 23   DG  X C2    1 
ATOM   1549  N  N2    . DG  D  1  23   ? 32.679  29.856  46.872  1.00 12.89  ? 23   DG  X N2    1 
ATOM   1550  N  N3    . DG  D  1  23   ? 33.579  31.599  48.053  1.00 10.63  ? 23   DG  X N3    1 
ATOM   1551  C  C4    . DG  D  1  23   ? 33.338  32.440  49.061  1.00 7.55   ? 23   DG  X C4    1 
ATOM   1552  O  OP3   . G   E  2  1    ? -8.683  31.403  32.092  1.00 106.09 ? 1    G   Y OP3   1 
ATOM   1553  P  P     . G   E  2  1    ? -7.875  31.952  33.437  1.00 104.98 ? 1    G   Y P     1 
ATOM   1554  O  OP1   . G   E  2  1    ? -8.681  33.182  33.573  1.00 106.14 ? 1    G   Y OP1   1 
ATOM   1555  O  OP2   . G   E  2  1    ? -8.020  31.112  34.647  1.00 105.58 ? 1    G   Y OP2   1 
ATOM   1556  O  "O5'" . G   E  2  1    ? -6.317  32.326  33.206  1.00 104.87 ? 1    G   Y "O5'" 1 
ATOM   1557  C  "C5'" . G   E  2  1    ? -5.346  31.262  32.842  1.00 102.87 ? 1    G   Y "C5'" 1 
ATOM   1558  C  "C4'" . G   E  2  1    ? -3.909  31.778  32.819  1.00 101.31 ? 1    G   Y "C4'" 1 
ATOM   1559  O  "O4'" . G   E  2  1    ? -3.871  32.824  31.798  1.00 99.88  ? 1    G   Y "O4'" 1 
ATOM   1560  C  "C3'" . G   E  2  1    ? -3.462  32.527  34.117  1.00 100.65 ? 1    G   Y "C3'" 1 
ATOM   1561  O  "O3'" . G   E  2  1    ? -3.257  31.815  35.464  1.00 100.63 ? 1    G   Y "O3'" 1 
ATOM   1562  C  "C2'" . G   E  2  1    ? -2.425  33.459  33.467  1.00 99.92  ? 1    G   Y "C2'" 1 
ATOM   1563  O  "O2'" . G   E  2  1    ? -1.151  32.862  33.241  1.00 100.13 ? 1    G   Y "O2'" 1 
ATOM   1564  C  "C1'" . G   E  2  1    ? -2.967  33.822  32.045  1.00 98.69  ? 1    G   Y "C1'" 1 
ATOM   1565  N  N9    . G   E  2  1    ? -3.564  34.951  31.290  1.00 96.65  ? 1    G   Y N9    1 
ATOM   1566  C  C8    . G   E  2  1    ? -4.697  35.681  31.574  1.00 96.21  ? 1    G   Y C8    1 
ATOM   1567  N  N7    . G   E  2  1    ? -4.909  36.682  30.725  1.00 95.75  ? 1    G   Y N7    1 
ATOM   1568  C  C5    . G   E  2  1    ? -3.832  36.576  29.846  1.00 95.78  ? 1    G   Y C5    1 
ATOM   1569  C  C6    . G   E  2  1    ? -3.495  37.392  28.743  1.00 95.27  ? 1    G   Y C6    1 
ATOM   1570  O  O6    . G   E  2  1    ? -4.057  38.408  28.320  1.00 94.99  ? 1    G   Y O6    1 
ATOM   1571  N  N1    . G   E  2  1    ? -2.368  36.924  28.075  1.00 94.98  ? 1    G   Y N1    1 
ATOM   1572  C  C2    . G   E  2  1    ? -1.650  35.816  28.430  1.00 94.94  ? 1    G   Y C2    1 
ATOM   1573  N  N2    . G   E  2  1    ? -0.594  35.559  27.651  1.00 94.86  ? 1    G   Y N2    1 
ATOM   1574  N  N3    . G   E  2  1    ? -1.943  35.047  29.471  1.00 95.60  ? 1    G   Y N3    1 
ATOM   1575  C  C4    . G   E  2  1    ? -3.042  35.516  30.161  1.00 95.88  ? 1    G   Y C4    1 
ATOM   1576  P  P     . A   E  2  2    ? -2.151  30.952  36.353  1.00 101.11 ? 2    A   Y P     1 
ATOM   1577  O  OP1   . A   E  2  2    ? -2.118  29.554  35.842  1.00 102.05 ? 2    A   Y OP1   1 
ATOM   1578  O  OP2   . A   E  2  2    ? -2.593  30.922  37.758  1.00 100.48 ? 2    A   Y OP2   1 
ATOM   1579  O  "O5'" . A   E  2  2    ? -0.638  31.620  36.281  1.00 100.33 ? 2    A   Y "O5'" 1 
ATOM   1580  C  "C5'" . A   E  2  2    ? -0.376  32.935  35.639  1.00 99.03  ? 2    A   Y "C5'" 1 
ATOM   1581  C  "C4'" . A   E  2  2    ? 0.941   33.630  36.049  1.00 97.18  ? 2    A   Y "C4'" 1 
ATOM   1582  O  "O4'" . A   E  2  2    ? 0.884   34.161  37.431  1.00 95.86  ? 2    A   Y "O4'" 1 
ATOM   1583  C  "C3'" . A   E  2  2    ? 2.191   32.769  36.153  1.00 96.59  ? 2    A   Y "C3'" 1 
ATOM   1584  O  "O3'" . A   E  2  2    ? 2.748   32.355  34.934  1.00 95.61  ? 2    A   Y "O3'" 1 
ATOM   1585  C  "C2'" . A   E  2  2    ? 3.168   33.578  37.017  1.00 96.49  ? 2    A   Y "C2'" 1 
ATOM   1586  O  "O2'" . A   E  2  2    ? 3.902   34.586  36.338  1.00 96.82  ? 2    A   Y "O2'" 1 
ATOM   1587  C  "C1'" . A   E  2  2    ? 2.196   34.304  37.937  1.00 95.52  ? 2    A   Y "C1'" 1 
ATOM   1588  N  N9    . A   E  2  2    ? 2.632   33.570  39.150  1.00 94.26  ? 2    A   Y N9    1 
ATOM   1589  C  C8    . A   E  2  2    ? 2.408   32.279  39.532  1.00 93.06  ? 2    A   Y C8    1 
ATOM   1590  N  N7    . A   E  2  2    ? 2.987   31.977  40.656  1.00 92.35  ? 2    A   Y N7    1 
ATOM   1591  C  C5    . A   E  2  2    ? 3.616   33.145  41.029  1.00 92.35  ? 2    A   Y C5    1 
ATOM   1592  C  C6    . A   E  2  2    ? 4.391   33.482  42.158  1.00 91.83  ? 2    A   Y C6    1 
ATOM   1593  N  N6    . A   E  2  2    ? 4.636   32.606  43.166  1.00 92.03  ? 2    A   Y N6    1 
ATOM   1594  N  N1    . A   E  2  2    ? 4.910   34.733  42.217  1.00 91.25  ? 2    A   Y N1    1 
ATOM   1595  C  C2    . A   E  2  2    ? 4.664   35.575  41.214  1.00 91.23  ? 2    A   Y C2    1 
ATOM   1596  N  N3    . A   E  2  2    ? 3.954   35.380  40.106  1.00 92.66  ? 2    A   Y N3    1 
ATOM   1597  C  C4    . A   E  2  2    ? 3.448   34.131  40.105  1.00 93.14  ? 2    A   Y C4    1 
ATOM   1598  P  P     . G   E  2  3    ? 3.602   31.042  35.150  1.00 94.55  ? 3    G   Y P     1 
ATOM   1599  O  OP1   . G   E  2  3    ? 3.751   30.285  33.884  1.00 94.20  ? 3    G   Y OP1   1 
ATOM   1600  O  OP2   . G   E  2  3    ? 3.001   30.174  36.190  1.00 94.19  ? 3    G   Y OP2   1 
ATOM   1601  O  "O5'" . G   E  2  3    ? 5.033   31.612  35.645  1.00 94.59  ? 3    G   Y "O5'" 1 
ATOM   1602  C  "C5'" . G   E  2  3    ? 6.014   32.178  34.717  1.00 92.96  ? 3    G   Y "C5'" 1 
ATOM   1603  C  "C4'" . G   E  2  3    ? 7.119   32.871  35.511  1.00 91.97  ? 3    G   Y "C4'" 1 
ATOM   1604  O  "O4'" . G   E  2  3    ? 6.565   33.018  36.844  1.00 89.77  ? 3    G   Y "O4'" 1 
ATOM   1605  C  "C3'" . G   E  2  3    ? 8.412   32.062  35.730  1.00 91.71  ? 3    G   Y "C3'" 1 
ATOM   1606  O  "O3'" . G   E  2  3    ? 9.392   32.238  34.706  1.00 93.41  ? 3    G   Y "O3'" 1 
ATOM   1607  C  "C2'" . G   E  2  3    ? 8.874   32.550  37.116  1.00 89.95  ? 3    G   Y "C2'" 1 
ATOM   1608  O  "O2'" . G   E  2  3    ? 9.661   33.734  37.067  1.00 89.47  ? 3    G   Y "O2'" 1 
ATOM   1609  C  "C1'" . G   E  2  3    ? 7.548   32.819  37.801  1.00 88.46  ? 3    G   Y "C1'" 1 
ATOM   1610  N  N9    . G   E  2  3    ? 7.101   31.669  38.545  1.00 86.39  ? 3    G   Y N9    1 
ATOM   1611  C  C8    . G   E  2  3    ? 6.488   30.518  38.099  1.00 86.59  ? 3    G   Y C8    1 
ATOM   1612  N  N7    . G   E  2  3    ? 6.335   29.618  39.025  1.00 85.92  ? 3    G   Y N7    1 
ATOM   1613  C  C5    . G   E  2  3    ? 6.855   30.215  40.160  1.00 85.68  ? 3    G   Y C5    1 
ATOM   1614  C  C6    . G   E  2  3    ? 6.970   29.719  41.486  1.00 85.80  ? 3    G   Y C6    1 
ATOM   1615  O  O6    . G   E  2  3    ? 6.614   28.644  41.937  1.00 85.57  ? 3    G   Y O6    1 
ATOM   1616  N  N1    . G   E  2  3    ? 7.569   30.656  42.327  1.00 86.34  ? 3    G   Y N1    1 
ATOM   1617  C  C2    . G   E  2  3    ? 8.000   31.910  41.941  1.00 86.21  ? 3    G   Y C2    1 
ATOM   1618  N  N2    . G   E  2  3    ? 8.560   32.639  42.902  1.00 85.35  ? 3    G   Y N2    1 
ATOM   1619  N  N3    . G   E  2  3    ? 7.894   32.380  40.709  1.00 85.52  ? 3    G   Y N3    1 
ATOM   1620  C  C4    . G   E  2  3    ? 7.316   31.487  39.880  1.00 85.53  ? 3    G   Y C4    1 
ATOM   1621  P  P     . U   E  2  4    ? 10.785  31.477  34.789  1.00 94.01  ? 4    U   Y P     1 
ATOM   1622  O  OP1   . U   E  2  4    ? 11.378  31.297  33.439  1.00 94.95  ? 4    U   Y OP1   1 
ATOM   1623  O  OP2   . U   E  2  4    ? 10.630  30.160  35.455  1.00 94.43  ? 4    U   Y OP2   1 
ATOM   1624  O  "O5'" . U   E  2  4    ? 11.682  32.450  35.729  1.00 93.06  ? 4    U   Y "O5'" 1 
ATOM   1625  C  "C5'" . U   E  2  4    ? 12.322  33.638  35.204  1.00 92.11  ? 4    U   Y "C5'" 1 
ATOM   1626  C  "C4'" . U   E  2  4    ? 12.823  34.506  36.330  1.00 90.99  ? 4    U   Y "C4'" 1 
ATOM   1627  O  "O4'" . U   E  2  4    ? 11.932  34.289  37.478  1.00 89.84  ? 4    U   Y "O4'" 1 
ATOM   1628  C  "C3'" . U   E  2  4    ? 14.176  34.128  36.916  1.00 90.26  ? 4    U   Y "C3'" 1 
ATOM   1629  O  "O3'" . U   E  2  4    ? 15.290  34.750  36.238  1.00 88.83  ? 4    U   Y "O3'" 1 
ATOM   1630  C  "C2'" . U   E  2  4    ? 14.100  34.604  38.363  1.00 89.88  ? 4    U   Y "C2'" 1 
ATOM   1631  O  "O2'" . U   E  2  4    ? 14.435  35.966  38.574  1.00 89.06  ? 4    U   Y "O2'" 1 
ATOM   1632  C  "C1'" . U   E  2  4    ? 12.620  34.437  38.690  1.00 88.58  ? 4    U   Y "C1'" 1 
ATOM   1633  N  N1    . U   E  2  4    ? 12.182  33.353  39.577  1.00 86.33  ? 4    U   Y N1    1 
ATOM   1634  C  C2    . U   E  2  4    ? 12.043  33.679  40.902  1.00 84.80  ? 4    U   Y C2    1 
ATOM   1635  O  O2    . U   E  2  4    ? 12.179  34.794  41.379  1.00 83.76  ? 4    U   Y O2    1 
ATOM   1636  N  N3    . U   E  2  4    ? 11.724  32.596  41.684  1.00 83.40  ? 4    U   Y N3    1 
ATOM   1637  C  C4    . U   E  2  4    ? 11.519  31.272  41.271  1.00 82.64  ? 4    U   Y C4    1 
ATOM   1638  O  O4    . U   E  2  4    ? 11.242  30.407  42.112  1.00 81.89  ? 4    U   Y O4    1 
ATOM   1639  C  C5    . U   E  2  4    ? 11.644  31.038  39.856  1.00 83.22  ? 4    U   Y C5    1 
ATOM   1640  C  C6    . U   E  2  4    ? 11.958  32.075  39.087  1.00 85.21  ? 4    U   Y C6    1 
ATOM   1641  P  P     . C   E  2  5    ? 16.676  33.952  36.123  1.00 86.70  ? 5    C   Y P     1 
ATOM   1642  O  OP1   . C   E  2  5    ? 17.462  34.533  34.997  1.00 87.46  ? 5    C   Y OP1   1 
ATOM   1643  O  OP2   . C   E  2  5    ? 16.334  32.504  36.104  1.00 86.62  ? 5    C   Y OP2   1 
ATOM   1644  O  "O5'" . C   E  2  5    ? 17.426  34.248  37.500  1.00 84.20  ? 5    C   Y "O5'" 1 
ATOM   1645  C  "C5'" . C   E  2  5    ? 17.361  35.550  38.057  1.00 82.01  ? 5    C   Y "C5'" 1 
ATOM   1646  C  "C4'" . C   E  2  5    ? 17.615  35.559  39.551  1.00 79.83  ? 5    C   Y "C4'" 1 
ATOM   1647  O  "O4'" . C   E  2  5    ? 16.367  35.275  40.268  1.00 78.87  ? 5    C   Y "O4'" 1 
ATOM   1648  C  "C3'" . C   E  2  5    ? 18.662  34.627  40.141  1.00 78.96  ? 5    C   Y "C3'" 1 
ATOM   1649  O  "O3'" . C   E  2  5    ? 19.951  35.089  40.463  1.00 78.71  ? 5    C   Y "O3'" 1 
ATOM   1650  C  "C2'" . C   E  2  5    ? 18.000  33.950  41.335  1.00 78.29  ? 5    C   Y "C2'" 1 
ATOM   1651  O  "O2'" . C   E  2  5    ? 18.328  34.646  42.515  1.00 78.16  ? 5    C   Y "O2'" 1 
ATOM   1652  C  "C1'" . C   E  2  5    ? 16.521  34.141  41.113  1.00 78.23  ? 5    C   Y "C1'" 1 
ATOM   1653  N  N1    . C   E  2  5    ? 15.981  32.864  40.545  1.00 77.68  ? 5    C   Y N1    1 
ATOM   1654  C  C2    . C   E  2  5    ? 15.069  32.113  41.320  1.00 77.23  ? 5    C   Y C2    1 
ATOM   1655  O  O2    . C   E  2  5    ? 14.694  32.560  42.417  1.00 76.96  ? 5    C   Y O2    1 
ATOM   1656  N  N3    . C   E  2  5    ? 14.636  30.907  40.852  1.00 76.82  ? 5    C   Y N3    1 
ATOM   1657  C  C4    . C   E  2  5    ? 15.068  30.450  39.666  1.00 76.61  ? 5    C   Y C4    1 
ATOM   1658  N  N4    . C   E  2  5    ? 14.638  29.255  39.243  1.00 75.29  ? 5    C   Y N4    1 
ATOM   1659  C  C5    . C   E  2  5    ? 15.963  31.198  38.858  1.00 77.17  ? 5    C   Y C5    1 
ATOM   1660  C  C6    . C   E  2  5    ? 16.386  32.385  39.325  1.00 77.91  ? 5    C   Y C6    1 
ATOM   1661  P  P     . U   E  2  6    ? 21.154  34.014  40.464  1.00 78.19  ? 6    U   Y P     1 
ATOM   1662  O  OP1   . U   E  2  6    ? 22.410  34.707  40.103  1.00 78.13  ? 6    U   Y OP1   1 
ATOM   1663  O  OP2   . U   E  2  6    ? 20.698  32.855  39.650  1.00 78.09  ? 6    U   Y OP2   1 
ATOM   1664  O  "O5'" . U   E  2  6    ? 21.242  33.515  41.977  1.00 77.47  ? 6    U   Y "O5'" 1 
ATOM   1665  C  "C5'" . U   E  2  6    ? 21.575  34.442  42.996  1.00 75.36  ? 6    U   Y "C5'" 1 
ATOM   1666  C  "C4'" . U   E  2  6    ? 21.071  34.017  44.370  1.00 74.61  ? 6    U   Y "C4'" 1 
ATOM   1667  O  "O4'" . U   E  2  6    ? 19.651  33.634  44.267  1.00 73.41  ? 6    U   Y "O4'" 1 
ATOM   1668  C  "C3'" . U   E  2  6    ? 21.779  32.899  45.157  1.00 74.48  ? 6    U   Y "C3'" 1 
ATOM   1669  O  "O3'" . U   E  2  6    ? 22.602  33.207  46.315  1.00 74.31  ? 6    U   Y "O3'" 1 
ATOM   1670  C  "C2'" . U   E  2  6    ? 20.695  31.866  45.485  1.00 73.91  ? 6    U   Y "C2'" 1 
ATOM   1671  O  "O2'" . U   E  2  6    ? 20.424  31.777  46.874  1.00 74.76  ? 6    U   Y "O2'" 1 
ATOM   1672  C  "C1'" . U   E  2  6    ? 19.447  32.322  44.772  1.00 72.30  ? 6    U   Y "C1'" 1 
ATOM   1673  N  N1    . U   E  2  6    ? 19.034  31.321  43.754  1.00 70.34  ? 6    U   Y N1    1 
ATOM   1674  C  C2    . U   E  2  6    ? 18.302  30.223  44.230  1.00 69.48  ? 6    U   Y C2    1 
ATOM   1675  O  O2    . U   E  2  6    ? 18.067  30.045  45.412  1.00 69.24  ? 6    U   Y O2    1 
ATOM   1676  N  N3    . U   E  2  6    ? 17.873  29.335  43.271  1.00 68.74  ? 6    U   Y N3    1 
ATOM   1677  C  C4    . U   E  2  6    ? 18.082  29.407  41.917  1.00 68.91  ? 6    U   Y C4    1 
ATOM   1678  O  O4    . U   E  2  6    ? 17.591  28.543  41.177  1.00 68.69  ? 6    U   Y O4    1 
ATOM   1679  C  C5    . U   E  2  6    ? 18.860  30.537  41.501  1.00 69.14  ? 6    U   Y C5    1 
ATOM   1680  C  C6    . U   E  2  6    ? 19.308  31.423  42.414  1.00 69.26  ? 6    U   Y C6    1 
ATOM   1681  P  P     . G   E  2  7    ? 24.055  32.457  46.510  1.00 73.98  ? 7    G   Y P     1 
ATOM   1682  O  OP1   . G   E  2  7    ? 24.973  33.403  47.195  1.00 73.33  ? 7    G   Y OP1   1 
ATOM   1683  O  OP2   . G   E  2  7    ? 24.423  31.954  45.159  1.00 73.22  ? 7    G   Y OP2   1 
ATOM   1684  O  "O5'" . G   E  2  7    ? 23.843  31.188  47.496  1.00 71.31  ? 7    G   Y "O5'" 1 
ATOM   1685  C  "C5'" . G   E  2  7    ? 24.633  29.950  47.353  1.00 67.20  ? 7    G   Y "C5'" 1 
ATOM   1686  C  "C4'" . G   E  2  7    ? 24.054  28.794  48.209  1.00 64.79  ? 7    G   Y "C4'" 1 
ATOM   1687  O  "O4'" . G   E  2  7    ? 22.661  29.151  48.459  1.00 64.49  ? 7    G   Y "O4'" 1 
ATOM   1688  C  "C3'" . G   E  2  7    ? 23.961  27.318  47.699  1.00 62.54  ? 7    G   Y "C3'" 1 
ATOM   1689  O  "O3'" . G   E  2  7    ? 24.698  26.207  48.205  1.00 58.20  ? 7    G   Y "O3'" 1 
ATOM   1690  C  "C2'" . G   E  2  7    ? 22.492  26.918  47.821  1.00 63.38  ? 7    G   Y "C2'" 1 
ATOM   1691  O  "O2'" . G   E  2  7    ? 22.238  26.155  48.991  1.00 63.53  ? 7    G   Y "O2'" 1 
ATOM   1692  C  "C1'" . G   E  2  7    ? 21.775  28.238  47.795  1.00 64.15  ? 7    G   Y "C1'" 1 
ATOM   1693  N  N9    . G   E  2  7    ? 21.742  28.461  46.345  1.00 64.20  ? 7    G   Y N9    1 
ATOM   1694  C  C8    . G   E  2  7    ? 22.268  29.499  45.652  1.00 64.44  ? 7    G   Y C8    1 
ATOM   1695  N  N7    . G   E  2  7    ? 22.088  29.435  44.371  1.00 64.18  ? 7    G   Y N7    1 
ATOM   1696  C  C5    . G   E  2  7    ? 21.406  28.257  44.189  1.00 64.84  ? 7    G   Y C5    1 
ATOM   1697  C  C6    . G   E  2  7    ? 20.957  27.673  43.016  1.00 66.02  ? 7    G   Y C6    1 
ATOM   1698  O  O6    . G   E  2  7    ? 21.062  28.109  41.857  1.00 65.88  ? 7    G   Y O6    1 
ATOM   1699  N  N1    . G   E  2  7    ? 20.328  26.459  43.265  1.00 67.08  ? 7    G   Y N1    1 
ATOM   1700  C  C2    . G   E  2  7    ? 20.165  25.895  44.506  1.00 65.78  ? 7    G   Y C2    1 
ATOM   1701  N  N2    . G   E  2  7    ? 19.544  24.709  44.535  1.00 67.68  ? 7    G   Y N2    1 
ATOM   1702  N  N3    . G   E  2  7    ? 20.580  26.448  45.625  1.00 64.30  ? 7    G   Y N3    1 
ATOM   1703  C  C4    . G   E  2  7    ? 21.186  27.626  45.395  1.00 64.05  ? 7    G   Y C4    1 
ATOM   1704  P  P     . C   E  2  8    ? 24.567  24.758  47.444  1.00 54.78  ? 8    C   Y P     1 
ATOM   1705  O  OP1   . C   E  2  8    ? 23.512  24.763  46.384  1.00 53.51  ? 8    C   Y OP1   1 
ATOM   1706  O  OP2   . C   E  2  8    ? 24.515  23.734  48.504  1.00 53.98  ? 8    C   Y OP2   1 
ATOM   1707  O  "O5'" . C   E  2  8    ? 25.927  24.575  46.627  1.00 53.40  ? 8    C   Y "O5'" 1 
ATOM   1708  C  "C5'" . C   E  2  8    ? 25.885  24.461  45.210  1.00 48.39  ? 8    C   Y "C5'" 1 
ATOM   1709  C  "C4'" . C   E  2  8    ? 27.260  24.568  44.586  1.00 46.20  ? 8    C   Y "C4'" 1 
ATOM   1710  O  "O4'" . C   E  2  8    ? 27.707  25.959  44.546  1.00 44.17  ? 8    C   Y "O4'" 1 
ATOM   1711  C  "C3'" . C   E  2  8    ? 28.397  23.754  45.196  1.00 44.91  ? 8    C   Y "C3'" 1 
ATOM   1712  O  "O3'" . C   E  2  8    ? 28.980  22.733  44.381  1.00 45.73  ? 8    C   Y "O3'" 1 
ATOM   1713  C  "C2'" . C   E  2  8    ? 29.343  24.769  45.848  1.00 43.62  ? 8    C   Y "C2'" 1 
ATOM   1714  O  "O2'" . C   E  2  8    ? 30.653  24.786  45.333  1.00 44.54  ? 8    C   Y "O2'" 1 
ATOM   1715  C  "C1'" . C   E  2  8    ? 28.840  26.118  45.392  1.00 41.88  ? 8    C   Y "C1'" 1 
ATOM   1716  N  N1    . C   E  2  8    ? 28.603  27.004  46.560  1.00 38.00  ? 8    C   Y N1    1 
ATOM   1717  C  C2    . C   E  2  8    ? 29.593  27.933  46.902  1.00 36.89  ? 8    C   Y C2    1 
ATOM   1718  O  O2    . C   E  2  8    ? 30.640  27.964  46.251  1.00 38.02  ? 8    C   Y O2    1 
ATOM   1719  N  N3    . C   E  2  8    ? 29.388  28.768  47.938  1.00 34.43  ? 8    C   Y N3    1 
ATOM   1720  C  C4    . C   E  2  8    ? 28.264  28.707  48.620  1.00 33.16  ? 8    C   Y C4    1 
ATOM   1721  N  N4    . C   E  2  8    ? 28.102  29.558  49.616  1.00 33.20  ? 8    C   Y N4    1 
ATOM   1722  C  C5    . C   E  2  8    ? 27.254  27.772  48.314  1.00 33.47  ? 8    C   Y C5    1 
ATOM   1723  C  C6    . C   E  2  8    ? 27.460  26.945  47.287  1.00 36.27  ? 8    C   Y C6    1 
ATOM   1724  P  P     . G   E  2  9    ? 29.162  21.228  44.989  1.00 47.17  ? 9    G   Y P     1 
ATOM   1725  O  OP1   . G   E  2  9    ? 29.219  20.241  43.869  1.00 46.59  ? 9    G   Y OP1   1 
ATOM   1726  O  OP2   . G   E  2  9    ? 28.191  21.046  46.105  1.00 45.43  ? 9    G   Y OP2   1 
ATOM   1727  O  "O5'" . G   E  2  9    ? 30.623  21.255  45.588  1.00 45.95  ? 9    G   Y "O5'" 1 
ATOM   1728  C  "C5'" . G   E  2  9    ? 31.481  22.253  45.123  1.00 47.53  ? 9    G   Y "C5'" 1 
ATOM   1729  C  "C4'" . G   E  2  9    ? 32.887  21.993  45.503  1.00 47.49  ? 9    G   Y "C4'" 1 
ATOM   1730  O  "O4'" . G   E  2  9    ? 33.407  23.355  45.600  1.00 48.84  ? 9    G   Y "O4'" 1 
ATOM   1731  C  "C3'" . G   E  2  9    ? 33.223  21.360  46.849  1.00 45.35  ? 9    G   Y "C3'" 1 
ATOM   1732  O  "O3'" . G   E  2  9    ? 33.754  20.076  46.827  1.00 41.51  ? 9    G   Y "O3'" 1 
ATOM   1733  C  "C2'" . G   E  2  9    ? 34.063  22.392  47.613  1.00 47.59  ? 9    G   Y "C2'" 1 
ATOM   1734  O  "O2'" . G   E  2  9    ? 35.466  22.259  47.464  1.00 46.92  ? 9    G   Y "O2'" 1 
ATOM   1735  C  "C1'" . G   E  2  9    ? 33.692  23.687  46.957  1.00 49.30  ? 9    G   Y "C1'" 1 
ATOM   1736  N  N9    . G   E  2  9    ? 32.527  24.115  47.734  1.00 50.86  ? 9    G   Y N9    1 
ATOM   1737  C  C8    . G   E  2  9    ? 31.263  23.570  47.827  1.00 52.59  ? 9    G   Y C8    1 
ATOM   1738  N  N7    . G   E  2  9    ? 30.489  24.178  48.670  1.00 53.20  ? 9    G   Y N7    1 
ATOM   1739  C  C5    . G   E  2  9    ? 31.290  25.177  49.184  1.00 53.41  ? 9    G   Y C5    1 
ATOM   1740  C  C6    . G   E  2  9    ? 31.005  26.130  50.158  1.00 54.84  ? 9    G   Y C6    1 
ATOM   1741  O  O6    . G   E  2  9    ? 29.936  26.302  50.775  1.00 52.96  ? 9    G   Y O6    1 
ATOM   1742  N  N1    . G   E  2  9    ? 32.118  26.940  50.407  1.00 56.25  ? 9    G   Y N1    1 
ATOM   1743  C  C2    . G   E  2  9    ? 33.351  26.824  49.772  1.00 54.68  ? 9    G   Y C2    1 
ATOM   1744  N  N2    . G   E  2  9    ? 34.318  27.687  50.127  1.00 55.21  ? 9    G   Y N2    1 
ATOM   1745  N  N3    . G   E  2  9    ? 33.610  25.927  48.855  1.00 52.56  ? 9    G   Y N3    1 
ATOM   1746  C  C4    . G   E  2  9    ? 32.551  25.148  48.609  1.00 52.00  ? 9    G   Y C4    1 
ATOM   1747  P  P     . G   E  2  10   ? 33.528  19.160  48.104  1.00 39.55  ? 10   G   Y P     1 
ATOM   1748  O  OP1   . G   E  2  10   ? 34.195  17.855  47.845  1.00 39.27  ? 10   G   Y OP1   1 
ATOM   1749  O  OP2   . G   E  2  10   ? 32.077  19.215  48.392  1.00 38.81  ? 10   G   Y OP2   1 
ATOM   1750  O  "O5'" . G   E  2  10   ? 34.366  19.912  49.228  1.00 38.84  ? 10   G   Y "O5'" 1 
ATOM   1751  C  "C5'" . G   E  2  10   ? 35.763  20.007  49.035  1.00 38.09  ? 10   G   Y "C5'" 1 
ATOM   1752  C  "C4'" . G   E  2  10   ? 36.465  20.829  50.083  1.00 36.91  ? 10   G   Y "C4'" 1 
ATOM   1753  O  "O4'" . G   E  2  10   ? 36.201  22.259  49.899  1.00 36.27  ? 10   G   Y "O4'" 1 
ATOM   1754  C  "C3'" . G   E  2  10   ? 36.190  20.544  51.530  1.00 36.75  ? 10   G   Y "C3'" 1 
ATOM   1755  O  "O3'" . G   E  2  10   ? 36.980  19.538  52.099  1.00 37.65  ? 10   G   Y "O3'" 1 
ATOM   1756  C  "C2'" . G   E  2  10   ? 36.251  21.908  52.207  1.00 36.90  ? 10   G   Y "C2'" 1 
ATOM   1757  O  "O2'" . G   E  2  10   ? 37.593  22.237  52.477  1.00 37.25  ? 10   G   Y "O2'" 1 
ATOM   1758  C  "C1'" . G   E  2  10   ? 35.859  22.876  51.130  1.00 37.32  ? 10   G   Y "C1'" 1 
ATOM   1759  N  N9    . G   E  2  10   ? 34.418  23.076  51.315  1.00 39.78  ? 10   G   Y N9    1 
ATOM   1760  C  C8    . G   E  2  10   ? 33.379  22.462  50.674  1.00 41.06  ? 10   G   Y C8    1 
ATOM   1761  N  N7    . G   E  2  10   ? 32.203  22.851  51.095  1.00 41.52  ? 10   G   Y N7    1 
ATOM   1762  C  C5    . G   E  2  10   ? 32.473  23.784  52.090  1.00 41.96  ? 10   G   Y C5    1 
ATOM   1763  C  C6    . G   E  2  10   ? 31.575  24.558  52.925  1.00 42.71  ? 10   G   Y C6    1 
ATOM   1764  O  O6    . G   E  2  10   ? 30.336  24.563  52.931  1.00 44.57  ? 10   G   Y O6    1 
ATOM   1765  N  N1    . G   E  2  10   ? 32.271  25.388  53.802  1.00 41.18  ? 10   G   Y N1    1 
ATOM   1766  C  C2    . G   E  2  10   ? 33.642  25.471  53.873  1.00 40.33  ? 10   G   Y C2    1 
ATOM   1767  N  N2    . G   E  2  10   ? 34.128  26.323  54.769  1.00 40.47  ? 10   G   Y N2    1 
ATOM   1768  N  N3    . G   E  2  10   ? 34.480  24.763  53.114  1.00 41.27  ? 10   G   Y N3    1 
ATOM   1769  C  C4    . G   E  2  10   ? 33.832  23.948  52.245  1.00 41.35  ? 10   G   Y C4    1 
ATOM   1770  P  P     . C   E  2  11   ? 36.328  18.657  53.274  1.00 41.91  ? 11   C   Y P     1 
ATOM   1771  O  OP1   . C   E  2  11   ? 36.954  17.315  53.332  1.00 44.06  ? 11   C   Y OP1   1 
ATOM   1772  O  OP2   . C   E  2  11   ? 34.840  18.760  53.193  1.00 42.88  ? 11   C   Y OP2   1 
ATOM   1773  O  "O5'" . C   E  2  11   ? 36.766  19.483  54.548  1.00 40.83  ? 11   C   Y "O5'" 1 
ATOM   1774  C  "C5'" . C   E  2  11   ? 37.900  20.304  54.431  1.00 39.49  ? 11   C   Y "C5'" 1 
ATOM   1775  C  "C4'" . C   E  2  11   ? 37.952  21.360  55.492  1.00 39.30  ? 11   C   Y "C4'" 1 
ATOM   1776  O  "O4'" . C   E  2  11   ? 37.199  22.581  55.147  1.00 38.80  ? 11   C   Y "O4'" 1 
ATOM   1777  C  "C3'" . C   E  2  11   ? 37.484  20.915  56.851  1.00 37.45  ? 11   C   Y "C3'" 1 
ATOM   1778  O  "O3'" . C   E  2  11   ? 38.471  20.352  57.687  1.00 35.34  ? 11   C   Y "O3'" 1 
ATOM   1779  C  "C2'" . C   E  2  11   ? 36.556  22.014  57.380  1.00 37.90  ? 11   C   Y "C2'" 1 
ATOM   1780  O  "O2'" . C   E  2  11   ? 37.142  22.806  58.383  1.00 37.62  ? 11   C   Y "O2'" 1 
ATOM   1781  C  "C1'" . C   E  2  11   ? 36.278  22.900  56.185  1.00 38.82  ? 11   C   Y "C1'" 1 
ATOM   1782  N  N1    . C   E  2  11   ? 34.873  22.588  55.838  1.00 40.71  ? 11   C   Y N1    1 
ATOM   1783  C  C2    . C   E  2  11   ? 33.858  23.298  56.517  1.00 41.98  ? 11   C   Y C2    1 
ATOM   1784  O  O2    . C   E  2  11   ? 34.181  24.184  57.322  1.00 42.83  ? 11   C   Y O2    1 
ATOM   1785  N  N3    . C   E  2  11   ? 32.558  22.986  56.290  1.00 41.33  ? 11   C   Y N3    1 
ATOM   1786  C  C4    . C   E  2  11   ? 32.247  22.026  55.429  1.00 41.20  ? 11   C   Y C4    1 
ATOM   1787  N  N4    . C   E  2  11   ? 30.962  21.751  55.259  1.00 40.89  ? 11   C   Y N4    1 
ATOM   1788  C  C5    . C   E  2  11   ? 33.244  21.306  54.705  1.00 42.20  ? 11   C   Y C5    1 
ATOM   1789  C  C6    . C   E  2  11   ? 34.536  21.622  54.934  1.00 42.26  ? 11   C   Y C6    1 
ATOM   1790  P  P     . G   E  2  12   ? 38.246  18.857  58.238  1.00 34.56  ? 12   G   Y P     1 
ATOM   1791  O  OP1   . G   E  2  12   ? 39.555  18.125  58.252  1.00 32.34  ? 12   G   Y OP1   1 
ATOM   1792  O  OP2   . G   E  2  12   ? 37.085  18.278  57.510  1.00 33.41  ? 12   G   Y OP2   1 
ATOM   1793  O  "O5'" . G   E  2  12   ? 37.711  19.143  59.704  1.00 32.20  ? 12   G   Y "O5'" 1 
ATOM   1794  C  "C5'" . G   E  2  12   ? 36.881  20.257  59.889  1.00 30.42  ? 12   G   Y "C5'" 1 
ATOM   1795  C  "C4'" . G   E  2  12   ? 36.774  20.655  61.308  1.00 31.95  ? 12   G   Y "C4'" 1 
ATOM   1796  O  "O4'" . G   E  2  12   ? 36.062  21.928  61.335  1.00 31.85  ? 12   G   Y "O4'" 1 
ATOM   1797  C  "C3'" . G   E  2  12   ? 35.940  19.727  62.160  1.00 30.84  ? 12   G   Y "C3'" 1 
ATOM   1798  O  "O3'" . G   E  2  12   ? 36.633  18.964  63.119  1.00 28.97  ? 12   G   Y "O3'" 1 
ATOM   1799  C  "C2'" . G   E  2  12   ? 34.652  20.477  62.523  1.00 30.47  ? 12   G   Y "C2'" 1 
ATOM   1800  O  "O2'" . G   E  2  12   ? 34.630  20.962  63.837  1.00 30.13  ? 12   G   Y "O2'" 1 
ATOM   1801  C  "C1'" . G   E  2  12   ? 34.694  21.722  61.672  1.00 31.25  ? 12   G   Y "C1'" 1 
ATOM   1802  N  N9    . G   E  2  12   ? 33.826  21.481  60.516  1.00 31.24  ? 12   G   Y N9    1 
ATOM   1803  C  C8    . G   E  2  12   ? 34.126  20.966  59.286  1.00 31.95  ? 12   G   Y C8    1 
ATOM   1804  N  N7    . G   E  2  12   ? 33.089  20.801  58.524  1.00 33.92  ? 12   G   Y N7    1 
ATOM   1805  C  C5    . G   E  2  12   ? 32.040  21.256  59.288  1.00 33.52  ? 12   G   Y C5    1 
ATOM   1806  C  C6    . G   E  2  12   ? 30.685  21.313  58.989  1.00 34.37  ? 12   G   Y C6    1 
ATOM   1807  O  O6    . G   E  2  12   ? 30.126  20.967  57.958  1.00 35.30  ? 12   G   Y O6    1 
ATOM   1808  N  N1    . G   E  2  12   ? 29.957  21.835  60.039  1.00 35.75  ? 12   G   Y N1    1 
ATOM   1809  C  C2    . G   E  2  12   ? 30.495  22.246  61.230  1.00 37.96  ? 12   G   Y C2    1 
ATOM   1810  N  N2    . G   E  2  12   ? 29.657  22.717  62.147  1.00 40.76  ? 12   G   Y N2    1 
ATOM   1811  N  N3    . G   E  2  12   ? 31.774  22.195  61.513  1.00 37.03  ? 12   G   Y N3    1 
ATOM   1812  C  C4    . G   E  2  12   ? 32.482  21.694  60.510  1.00 32.95  ? 12   G   Y C4    1 
ATOM   1813  P  P     . C   E  2  13   ? 36.187  17.438  63.329  1.00 29.27  ? 13   C   Y P     1 
ATOM   1814  O  OP1   . C   E  2  13   ? 37.237  16.797  64.168  1.00 25.95  ? 13   C   Y OP1   1 
ATOM   1815  O  OP2   . C   E  2  13   ? 35.839  16.856  62.005  1.00 26.89  ? 13   C   Y OP2   1 
ATOM   1816  O  "O5'" . C   E  2  13   ? 34.826  17.631  64.135  1.00 26.55  ? 13   C   Y "O5'" 1 
ATOM   1817  C  "C5'" . C   E  2  13   ? 34.826  18.593  65.169  1.00 26.57  ? 13   C   Y "C5'" 1 
ATOM   1818  C  "C4'" . C   E  2  13   ? 33.460  18.896  65.724  1.00 26.04  ? 13   C   Y "C4'" 1 
ATOM   1819  O  "O4'" . C   E  2  13   ? 32.705  19.856  64.930  1.00 23.99  ? 13   C   Y "O4'" 1 
ATOM   1820  C  "C3'" . C   E  2  13   ? 32.542  17.765  66.100  1.00 26.38  ? 13   C   Y "C3'" 1 
ATOM   1821  O  "O3'" . C   E  2  13   ? 32.386  17.482  67.452  1.00 31.83  ? 13   C   Y "O3'" 1 
ATOM   1822  C  "C2'" . C   E  2  13   ? 31.200  18.055  65.467  1.00 25.19  ? 13   C   Y "C2'" 1 
ATOM   1823  O  "O2'" . C   E  2  13   ? 30.235  18.239  66.491  1.00 22.18  ? 13   C   Y "O2'" 1 
ATOM   1824  C  "C1'" . C   E  2  13   ? 31.401  19.366  64.719  1.00 23.75  ? 13   C   Y "C1'" 1 
ATOM   1825  N  N1    . C   E  2  13   ? 31.128  19.083  63.300  1.00 23.44  ? 13   C   Y N1    1 
ATOM   1826  C  C2    . C   E  2  13   ? 29.801  19.104  62.898  1.00 23.70  ? 13   C   Y C2    1 
ATOM   1827  O  O2    . C   E  2  13   ? 28.956  19.461  63.711  1.00 27.18  ? 13   C   Y O2    1 
ATOM   1828  N  N3    . C   E  2  13   ? 29.469  18.719  61.651  1.00 22.67  ? 13   C   Y N3    1 
ATOM   1829  C  C4    . C   E  2  13   ? 30.409  18.344  60.807  1.00 22.85  ? 13   C   Y C4    1 
ATOM   1830  N  N4    . C   E  2  13   ? 30.025  17.937  59.603  1.00 19.88  ? 13   C   Y N4    1 
ATOM   1831  C  C5    . C   E  2  13   ? 31.789  18.364  61.165  1.00 25.01  ? 13   C   Y C5    1 
ATOM   1832  C  C6    . C   E  2  13   ? 32.100  18.746  62.413  1.00 24.57  ? 13   C   Y C6    1 
ATOM   1833  P  P     . G   E  2  14   ? 32.179  15.962  67.852  1.00 38.33  ? 14   G   Y P     1 
ATOM   1834  O  OP1   . G   E  2  14   ? 32.366  15.781  69.317  1.00 38.83  ? 14   G   Y OP1   1 
ATOM   1835  O  OP2   . G   E  2  14   ? 33.108  15.307  66.915  1.00 37.99  ? 14   G   Y OP2   1 
ATOM   1836  O  "O5'" . G   E  2  14   ? 30.633  15.729  67.556  1.00 39.23  ? 14   G   Y "O5'" 1 
ATOM   1837  C  "C5'" . G   E  2  14   ? 29.753  16.233  68.528  1.00 39.51  ? 14   G   Y "C5'" 1 
ATOM   1838  C  "C4'" . G   E  2  14   ? 28.316  16.129  68.143  1.00 40.92  ? 14   G   Y "C4'" 1 
ATOM   1839  O  "O4'" . G   E  2  14   ? 28.064  17.020  67.019  1.00 40.63  ? 14   G   Y "O4'" 1 
ATOM   1840  C  "C3'" . G   E  2  14   ? 27.715  14.781  67.808  1.00 40.48  ? 14   G   Y "C3'" 1 
ATOM   1841  O  "O3'" . G   E  2  14   ? 26.970  14.149  68.811  1.00 40.09  ? 14   G   Y "O3'" 1 
ATOM   1842  C  "C2'" . G   E  2  14   ? 26.880  14.986  66.552  1.00 41.77  ? 14   G   Y "C2'" 1 
ATOM   1843  O  "O2'" . G   E  2  14   ? 25.496  14.985  66.822  1.00 41.27  ? 14   G   Y "O2'" 1 
ATOM   1844  C  "C1'" . G   E  2  14   ? 27.179  16.411  66.117  1.00 41.74  ? 14   G   Y "C1'" 1 
ATOM   1845  N  N9    . G   E  2  14   ? 27.751  16.176  64.807  1.00 41.70  ? 14   G   Y N9    1 
ATOM   1846  C  C8    . G   E  2  14   ? 29.042  15.989  64.410  1.00 43.24  ? 14   G   Y C8    1 
ATOM   1847  N  N7    . G   E  2  14   ? 29.137  15.596  63.164  1.00 44.44  ? 14   G   Y N7    1 
ATOM   1848  C  C5    . G   E  2  14   ? 27.827  15.564  62.720  1.00 42.89  ? 14   G   Y C5    1 
ATOM   1849  C  C6    . G   E  2  14   ? 27.287  15.190  61.476  1.00 42.80  ? 14   G   Y C6    1 
ATOM   1850  O  O6    . G   E  2  14   ? 27.879  14.792  60.473  1.00 41.47  ? 14   G   Y O6    1 
ATOM   1851  N  N1    . G   E  2  14   ? 25.896  15.306  61.471  1.00 44.20  ? 14   G   Y N1    1 
ATOM   1852  C  C2    . G   E  2  14   ? 25.136  15.715  62.546  1.00 44.89  ? 14   G   Y C2    1 
ATOM   1853  N  N2    . G   E  2  14   ? 23.816  15.774  62.392  1.00 48.02  ? 14   G   Y N2    1 
ATOM   1854  N  N3    . G   E  2  14   ? 25.636  16.048  63.701  1.00 43.96  ? 14   G   Y N3    1 
ATOM   1855  C  C4    . G   E  2  14   ? 26.973  15.955  63.716  1.00 42.90  ? 14   G   Y C4    1 
ATOM   1856  P  P     . C   E  2  15   ? 26.955  12.552  68.832  1.00 41.02  ? 15   C   Y P     1 
ATOM   1857  O  OP1   . C   E  2  15   ? 26.835  12.142  70.258  1.00 39.79  ? 15   C   Y OP1   1 
ATOM   1858  O  OP2   . C   E  2  15   ? 28.140  12.130  68.027  1.00 37.41  ? 15   C   Y OP2   1 
ATOM   1859  O  "O5'" . C   E  2  15   ? 25.626  12.178  68.034  1.00 38.26  ? 15   C   Y "O5'" 1 
ATOM   1860  C  "C5'" . C   E  2  15   ? 24.484  12.988  68.221  1.00 37.67  ? 15   C   Y "C5'" 1 
ATOM   1861  C  "C4'" . C   E  2  15   ? 23.272  12.461  67.497  1.00 36.96  ? 15   C   Y "C4'" 1 
ATOM   1862  O  "O4'" . C   E  2  15   ? 23.085  13.146  66.226  1.00 37.08  ? 15   C   Y "O4'" 1 
ATOM   1863  C  "C3'" . C   E  2  15   ? 23.159  10.976  67.232  1.00 34.56  ? 15   C   Y "C3'" 1 
ATOM   1864  O  "O3'" . C   E  2  15   ? 22.322  10.216  68.041  1.00 33.29  ? 15   C   Y "O3'" 1 
ATOM   1865  C  "C2'" . C   E  2  15   ? 22.810  10.809  65.769  1.00 36.04  ? 15   C   Y "C2'" 1 
ATOM   1866  O  "O2'" . C   E  2  15   ? 21.451  10.456  65.640  1.00 33.93  ? 15   C   Y "O2'" 1 
ATOM   1867  C  "C1'" . C   E  2  15   ? 22.952  12.197  65.185  1.00 38.04  ? 15   C   Y "C1'" 1 
ATOM   1868  N  N1    . C   E  2  15   ? 24.113  12.144  64.261  1.00 40.57  ? 15   C   Y N1    1 
ATOM   1869  C  C2    . C   E  2  15   ? 23.837  11.880  62.900  1.00 39.76  ? 15   C   Y C2    1 
ATOM   1870  O  O2    . C   E  2  15   ? 22.657  11.792  62.545  1.00 39.00  ? 15   C   Y O2    1 
ATOM   1871  N  N3    . C   E  2  15   ? 24.856  11.716  62.021  1.00 40.22  ? 15   C   Y N3    1 
ATOM   1872  C  C4    . C   E  2  15   ? 26.122  11.819  62.439  1.00 41.14  ? 15   C   Y C4    1 
ATOM   1873  N  N4    . C   E  2  15   ? 27.088  11.644  61.528  1.00 37.59  ? 15   C   Y N4    1 
ATOM   1874  C  C5    . C   E  2  15   ? 26.444  12.113  63.808  1.00 42.37  ? 15   C   Y C5    1 
ATOM   1875  C  C6    . C   E  2  15   ? 25.414  12.280  64.682  1.00 42.42  ? 15   C   Y C6    1 
ATOM   1876  P  P     . G   E  2  16   ? 22.825  8.746   68.440  1.00 34.85  ? 16   G   Y P     1 
ATOM   1877  O  OP1   . G   E  2  16   ? 22.139  8.305   69.687  1.00 32.68  ? 16   G   Y OP1   1 
ATOM   1878  O  OP2   . G   E  2  16   ? 24.302  8.807   68.390  1.00 33.07  ? 16   G   Y OP2   1 
ATOM   1879  O  "O5'" . G   E  2  16   ? 22.344  7.870   67.205  1.00 34.17  ? 16   G   Y "O5'" 1 
ATOM   1880  C  "C5'" . G   E  2  16   ? 20.969  7.896   66.872  1.00 36.09  ? 16   G   Y "C5'" 1 
ATOM   1881  C  "C4'" . G   E  2  16   ? 20.623  7.079   65.640  1.00 35.31  ? 16   G   Y "C4'" 1 
ATOM   1882  O  "O4'" . G   E  2  16   ? 20.996  7.975   64.551  1.00 34.74  ? 16   G   Y "O4'" 1 
ATOM   1883  C  "C3'" . G   E  2  16   ? 21.333  5.754   65.332  1.00 34.41  ? 16   G   Y "C3'" 1 
ATOM   1884  O  "O3'" . G   E  2  16   ? 21.049  4.433   65.772  1.00 32.67  ? 16   G   Y "O3'" 1 
ATOM   1885  C  "C2'" . G   E  2  16   ? 21.682  5.784   63.859  1.00 34.07  ? 16   G   Y "C2'" 1 
ATOM   1886  O  "O2'" . G   E  2  16   ? 20.664  5.093   63.168  1.00 34.46  ? 16   G   Y "O2'" 1 
ATOM   1887  C  "C1'" . G   E  2  16   ? 21.539  7.245   63.474  1.00 34.64  ? 16   G   Y "C1'" 1 
ATOM   1888  N  N9    . G   E  2  16   ? 22.878  7.685   63.105  1.00 34.90  ? 16   G   Y N9    1 
ATOM   1889  C  C8    . G   E  2  16   ? 23.908  8.159   63.875  1.00 35.52  ? 16   G   Y C8    1 
ATOM   1890  N  N7    . G   E  2  16   ? 25.002  8.343   63.191  1.00 35.02  ? 16   G   Y N7    1 
ATOM   1891  C  C5    . G   E  2  16   ? 24.651  7.990   61.900  1.00 36.61  ? 16   G   Y C5    1 
ATOM   1892  C  C6    . G   E  2  16   ? 25.411  7.970   60.707  1.00 38.14  ? 16   G   Y C6    1 
ATOM   1893  O  O6    . G   E  2  16   ? 26.595  8.276   60.547  1.00 41.18  ? 16   G   Y O6    1 
ATOM   1894  N  N1    . G   E  2  16   ? 24.652  7.537   59.617  1.00 37.77  ? 16   G   Y N1    1 
ATOM   1895  C  C2    . G   E  2  16   ? 23.338  7.181   59.680  1.00 37.11  ? 16   G   Y C2    1 
ATOM   1896  N  N2    . G   E  2  16   ? 22.757  6.814   58.536  1.00 35.55  ? 16   G   Y N2    1 
ATOM   1897  N  N3    . G   E  2  16   ? 22.631  7.190   60.785  1.00 38.13  ? 16   G   Y N3    1 
ATOM   1898  C  C4    . G   E  2  16   ? 23.345  7.604   61.842  1.00 36.04  ? 16   G   Y C4    1 
ATOM   1899  P  P     . DA  F  3  2    ? 54.054  8.329   59.049  1.00 79.75  ? 3    DA  Z P     1 
ATOM   1900  O  OP1   . DA  F  3  2    ? 54.295  9.049   57.739  1.00 79.87  ? 3    DA  Z OP1   1 
ATOM   1901  O  OP2   . DA  F  3  2    ? 54.321  9.203   60.269  1.00 81.29  ? 3    DA  Z OP2   1 
ATOM   1902  O  "O5'" . DA  F  3  2    ? 52.457  8.021   59.126  1.00 77.90  ? 3    DA  Z "O5'" 1 
ATOM   1903  C  "C5'" . DA  F  3  2    ? 51.612  8.068   57.965  1.00 72.48  ? 3    DA  Z "C5'" 1 
ATOM   1904  C  "C4'" . DA  F  3  2    ? 50.354  7.291   58.259  1.00 69.70  ? 3    DA  Z "C4'" 1 
ATOM   1905  O  "O4'" . DA  F  3  2    ? 49.260  7.646   57.394  1.00 67.08  ? 3    DA  Z "O4'" 1 
ATOM   1906  C  "C3'" . DA  F  3  2    ? 50.510  5.780   58.138  1.00 70.30  ? 3    DA  Z "C3'" 1 
ATOM   1907  O  "O3'" . DA  F  3  2    ? 49.978  5.173   59.325  1.00 72.36  ? 3    DA  Z "O3'" 1 
ATOM   1908  C  "C2'" . DA  F  3  2    ? 49.691  5.439   56.898  1.00 68.38  ? 3    DA  Z "C2'" 1 
ATOM   1909  C  "C1'" . DA  F  3  2    ? 48.584  6.462   56.989  1.00 66.42  ? 3    DA  Z "C1'" 1 
ATOM   1910  N  N9    . DA  F  3  2    ? 47.838  6.781   55.764  1.00 64.27  ? 3    DA  Z N9    1 
ATOM   1911  C  C8    . DA  F  3  2    ? 48.238  7.771   54.901  1.00 63.69  ? 3    DA  Z C8    1 
ATOM   1912  N  N7    . DA  F  3  2    ? 47.409  7.983   53.917  1.00 62.34  ? 3    DA  Z N7    1 
ATOM   1913  C  C5    . DA  F  3  2    ? 46.397  7.058   54.121  1.00 61.67  ? 3    DA  Z C5    1 
ATOM   1914  C  C6    . DA  F  3  2    ? 45.235  6.813   53.394  1.00 60.82  ? 3    DA  Z C6    1 
ATOM   1915  N  N6    . DA  F  3  2    ? 44.963  7.523   52.325  1.00 61.44  ? 3    DA  Z N6    1 
ATOM   1916  N  N1    . DA  F  3  2    ? 44.385  5.835   53.801  1.00 59.67  ? 3    DA  Z N1    1 
ATOM   1917  C  C2    . DA  F  3  2    ? 44.743  5.157   54.911  1.00 60.63  ? 3    DA  Z C2    1 
ATOM   1918  N  N3    . DA  F  3  2    ? 45.843  5.304   55.700  1.00 61.44  ? 3    DA  Z N3    1 
ATOM   1919  C  C4    . DA  F  3  2    ? 46.643  6.291   55.241  1.00 62.05  ? 3    DA  Z C4    1 
ATOM   1920  P  P     . DC  F  3  3    ? 50.319  3.632   59.655  1.00 73.17  ? 4    DC  Z P     1 
ATOM   1921  O  OP1   . DC  F  3  3    ? 49.878  3.282   61.031  1.00 72.84  ? 4    DC  Z OP1   1 
ATOM   1922  O  OP2   . DC  F  3  3    ? 51.721  3.341   59.245  1.00 74.90  ? 4    DC  Z OP2   1 
ATOM   1923  O  "O5'" . DC  F  3  3    ? 49.370  2.880   58.633  1.00 71.62  ? 4    DC  Z "O5'" 1 
ATOM   1924  C  "C5'" . DC  F  3  3    ? 49.881  2.278   57.463  1.00 66.84  ? 4    DC  Z "C5'" 1 
ATOM   1925  C  "C4'" . DC  F  3  3    ? 48.789  1.453   56.848  1.00 64.55  ? 4    DC  Z "C4'" 1 
ATOM   1926  O  "O4'" . DC  F  3  3    ? 47.954  2.270   55.995  1.00 62.95  ? 4    DC  Z "O4'" 1 
ATOM   1927  C  "C3'" . DC  F  3  3    ? 49.306  0.301   56.010  1.00 62.74  ? 4    DC  Z "C3'" 1 
ATOM   1928  O  "O3'" . DC  F  3  3    ? 48.606  -0.856  56.436  1.00 60.81  ? 4    DC  Z "O3'" 1 
ATOM   1929  C  "C2'" . DC  F  3  3    ? 48.984  0.706   54.589  1.00 63.54  ? 4    DC  Z "C2'" 1 
ATOM   1930  C  "C1'" . DC  F  3  3    ? 47.790  1.641   54.739  1.00 64.43  ? 4    DC  Z "C1'" 1 
ATOM   1931  N  N1    . DC  F  3  3    ? 47.791  2.686   53.700  1.00 65.50  ? 4    DC  Z N1    1 
ATOM   1932  C  C2    . DC  F  3  3    ? 46.700  2.792   52.803  1.00 65.48  ? 4    DC  Z C2    1 
ATOM   1933  O  O2    . DC  F  3  3    ? 45.718  2.049   52.941  1.00 63.65  ? 4    DC  Z O2    1 
ATOM   1934  N  N3    . DC  F  3  3    ? 46.758  3.706   51.810  1.00 65.99  ? 4    DC  Z N3    1 
ATOM   1935  C  C4    . DC  F  3  3    ? 47.826  4.496   51.685  1.00 66.75  ? 4    DC  Z C4    1 
ATOM   1936  N  N4    . DC  F  3  3    ? 47.845  5.368   50.675  1.00 65.96  ? 4    DC  Z N4    1 
ATOM   1937  C  C5    . DC  F  3  3    ? 48.929  4.425   52.587  1.00 67.17  ? 4    DC  Z C5    1 
ATOM   1938  C  C6    . DC  F  3  3    ? 48.868  3.524   53.577  1.00 66.38  ? 4    DC  Z C6    1 
ATOM   1939  P  P     . DG  F  3  4    ? 48.849  -2.237  55.696  1.00 58.31  ? 5    DG  Z P     1 
ATOM   1940  O  OP1   . DG  F  3  4    ? 48.202  -3.286  56.519  1.00 58.18  ? 5    DG  Z OP1   1 
ATOM   1941  O  OP2   . DG  F  3  4    ? 50.260  -2.369  55.285  1.00 58.44  ? 5    DG  Z OP2   1 
ATOM   1942  O  "O5'" . DG  F  3  4    ? 47.983  -2.016  54.408  1.00 58.19  ? 5    DG  Z "O5'" 1 
ATOM   1943  C  "C5'" . DG  F  3  4    ? 46.598  -1.850  54.545  1.00 57.11  ? 5    DG  Z "C5'" 1 
ATOM   1944  C  "C4'" . DG  F  3  4    ? 45.934  -2.529  53.389  1.00 56.39  ? 5    DG  Z "C4'" 1 
ATOM   1945  O  "O4'" . DG  F  3  4    ? 45.875  -1.595  52.303  1.00 54.82  ? 5    DG  Z "O4'" 1 
ATOM   1946  C  "C3'" . DG  F  3  4    ? 46.731  -3.733  52.904  1.00 55.84  ? 5    DG  Z "C3'" 1 
ATOM   1947  O  "O3'" . DG  F  3  4    ? 45.807  -4.778  52.620  1.00 56.56  ? 5    DG  Z "O3'" 1 
ATOM   1948  C  "C2'" . DG  F  3  4    ? 47.552  -3.166  51.758  1.00 55.85  ? 5    DG  Z "C2'" 1 
ATOM   1949  C  "C1'" . DG  F  3  4    ? 46.695  -2.020  51.245  1.00 54.60  ? 5    DG  Z "C1'" 1 
ATOM   1950  N  N9    . DG  F  3  4    ? 47.391  -0.846  50.736  1.00 54.81  ? 5    DG  Z N9    1 
ATOM   1951  C  C8    . DG  F  3  4    ? 48.647  -0.383  51.040  1.00 54.72  ? 5    DG  Z C8    1 
ATOM   1952  N  N7    . DG  F  3  4    ? 48.995  0.653   50.323  1.00 53.71  ? 5    DG  Z N7    1 
ATOM   1953  C  C5    . DG  F  3  4    ? 47.888  0.898   49.524  1.00 53.18  ? 5    DG  Z C5    1 
ATOM   1954  C  C6    . DG  F  3  4    ? 47.673  1.875   48.542  1.00 53.26  ? 5    DG  Z C6    1 
ATOM   1955  O  O6    . DG  F  3  4    ? 48.435  2.746   48.161  1.00 55.24  ? 5    DG  Z O6    1 
ATOM   1956  N  N1    . DG  F  3  4    ? 46.408  1.768   47.974  1.00 54.87  ? 5    DG  Z N1    1 
ATOM   1957  C  C2    . DG  F  3  4    ? 45.473  0.829   48.318  1.00 56.02  ? 5    DG  Z C2    1 
ATOM   1958  N  N2    . DG  F  3  4    ? 44.301  0.868   47.661  1.00 57.36  ? 5    DG  Z N2    1 
ATOM   1959  N  N3    . DG  F  3  4    ? 45.669  -0.090  49.237  1.00 55.34  ? 5    DG  Z N3    1 
ATOM   1960  C  C4    . DG  F  3  4    ? 46.888  -0.002  49.788  1.00 54.26  ? 5    DG  Z C4    1 
ATOM   1961  P  P     . DC  F  3  5    ? 46.165  -5.940  51.575  1.00 58.47  ? 6    DC  Z P     1 
ATOM   1962  O  OP1   . DC  F  3  5    ? 44.959  -6.790  51.695  1.00 59.42  ? 6    DC  Z OP1   1 
ATOM   1963  O  OP2   . DC  F  3  5    ? 47.502  -6.565  51.725  1.00 57.73  ? 6    DC  Z OP2   1 
ATOM   1964  O  "O5'" . DC  F  3  5    ? 46.122  -5.186  50.179  1.00 58.43  ? 6    DC  Z "O5'" 1 
ATOM   1965  C  "C5'" . DC  F  3  5    ? 44.961  -4.472  49.792  1.00 59.21  ? 6    DC  Z "C5'" 1 
ATOM   1966  C  "C4'" . DC  F  3  5    ? 44.871  -4.418  48.289  1.00 61.09  ? 6    DC  Z "C4'" 1 
ATOM   1967  O  "O4'" . DC  F  3  5    ? 45.500  -3.218  47.804  1.00 62.14  ? 6    DC  Z "O4'" 1 
ATOM   1968  C  "C3'" . DC  F  3  5    ? 45.556  -5.578  47.575  1.00 61.61  ? 6    DC  Z "C3'" 1 
ATOM   1969  O  "O3'" . DC  F  3  5    ? 44.712  -6.150  46.570  1.00 61.63  ? 6    DC  Z "O3'" 1 
ATOM   1970  C  "C2'" . DC  F  3  5    ? 46.839  -4.983  47.023  1.00 62.48  ? 6    DC  Z "C2'" 1 
ATOM   1971  C  "C1'" . DC  F  3  5    ? 46.458  -3.534  46.813  1.00 62.51  ? 6    DC  Z "C1'" 1 
ATOM   1972  N  N1    . DC  F  3  5    ? 47.558  -2.578  46.955  1.00 63.04  ? 6    DC  Z N1    1 
ATOM   1973  C  C2    . DC  F  3  5    ? 47.616  -1.513  46.055  1.00 63.86  ? 6    DC  Z C2    1 
ATOM   1974  O  O2    . DC  F  3  5    ? 46.728  -1.403  45.185  1.00 64.35  ? 6    DC  Z O2    1 
ATOM   1975  N  N3    . DC  F  3  5    ? 48.629  -0.638  46.148  1.00 64.57  ? 6    DC  Z N3    1 
ATOM   1976  C  C4    . DC  F  3  5    ? 49.556  -0.786  47.091  1.00 64.83  ? 6    DC  Z C4    1 
ATOM   1977  N  N4    . DC  F  3  5    ? 50.535  0.115   47.127  1.00 65.97  ? 6    DC  Z N4    1 
ATOM   1978  C  C5    . DC  F  3  5    ? 49.516  -1.857  48.031  1.00 63.69  ? 6    DC  Z C5    1 
ATOM   1979  C  C6    . DC  F  3  5    ? 48.507  -2.718  47.930  1.00 62.65  ? 6    DC  Z C6    1 
ATOM   1980  P  P     . DC  F  3  6    ? 45.220  -7.432  45.755  1.00 60.76  ? 7    DC  Z P     1 
ATOM   1981  O  OP1   . DC  F  3  6    ? 44.084  -8.348  45.453  1.00 62.96  ? 7    DC  Z OP1   1 
ATOM   1982  O  OP2   . DC  F  3  6    ? 46.307  -7.885  46.657  1.00 61.99  ? 7    DC  Z OP2   1 
ATOM   1983  O  "O5'" . DC  F  3  6    ? 45.569  -6.747  44.371  1.00 56.98  ? 7    DC  Z "O5'" 1 
ATOM   1984  C  "C5'" . DC  F  3  6    ? 44.521  -5.968  43.814  1.00 55.20  ? 7    DC  Z "C5'" 1 
ATOM   1985  C  "C4'" . DC  F  3  6    ? 44.961  -5.195  42.605  1.00 53.77  ? 7    DC  Z "C4'" 1 
ATOM   1986  O  "O4'" . DC  F  3  6    ? 45.850  -4.113  42.959  1.00 53.66  ? 7    DC  Z "O4'" 1 
ATOM   1987  C  "C3'" . DC  F  3  6    ? 45.642  -6.005  41.519  1.00 53.00  ? 7    DC  Z "C3'" 1 
ATOM   1988  O  "O3'" . DC  F  3  6    ? 45.029  -5.619  40.286  1.00 54.06  ? 7    DC  Z "O3'" 1 
ATOM   1989  C  "C2'" . DC  F  3  6    ? 47.096  -5.576  41.626  1.00 52.44  ? 7    DC  Z "C2'" 1 
ATOM   1990  C  "C1'" . DC  F  3  6    ? 46.991  -4.133  42.121  1.00 52.51  ? 7    DC  Z "C1'" 1 
ATOM   1991  N  N1    . DC  F  3  6    ? 48.133  -3.665  42.927  1.00 51.20  ? 7    DC  Z N1    1 
ATOM   1992  C  C2    . DC  F  3  6    ? 48.822  -2.486  42.561  1.00 49.90  ? 7    DC  Z C2    1 
ATOM   1993  O  O2    . DC  F  3  6    ? 48.483  -1.868  41.551  1.00 46.90  ? 7    DC  Z O2    1 
ATOM   1994  N  N3    . DC  F  3  6    ? 49.857  -2.065  43.328  1.00 49.75  ? 7    DC  Z N3    1 
ATOM   1995  C  C4    . DC  F  3  6    ? 50.222  -2.764  44.403  1.00 49.61  ? 7    DC  Z C4    1 
ATOM   1996  N  N4    . DC  F  3  6    ? 51.248  -2.311  45.119  1.00 48.78  ? 7    DC  Z N4    1 
ATOM   1997  C  C5    . DC  F  3  6    ? 49.547  -3.959  44.792  1.00 50.71  ? 7    DC  Z C5    1 
ATOM   1998  C  C6    . DC  F  3  6    ? 48.518  -4.368  44.032  1.00 51.25  ? 7    DC  Z C6    1 
ATOM   1999  P  P     . DA  F  3  7    ? 45.554  -6.223  38.896  1.00 54.63  ? 8    DA  Z P     1 
ATOM   2000  O  OP1   . DA  F  3  7    ? 44.456  -6.187  37.895  1.00 55.61  ? 8    DA  Z OP1   1 
ATOM   2001  O  OP2   . DA  F  3  7    ? 46.276  -7.491  39.141  1.00 55.48  ? 8    DA  Z OP2   1 
ATOM   2002  O  "O5'" . DA  F  3  7    ? 46.614  -5.140  38.457  1.00 55.71  ? 8    DA  Z "O5'" 1 
ATOM   2003  C  "C5'" . DA  F  3  7    ? 46.188  -3.846  38.058  1.00 58.25  ? 8    DA  Z "C5'" 1 
ATOM   2004  C  "C4'" . DA  F  3  7    ? 47.317  -3.166  37.334  1.00 59.27  ? 8    DA  Z "C4'" 1 
ATOM   2005  O  "O4'" . DA  F  3  7    ? 48.315  -2.771  38.307  1.00 60.45  ? 8    DA  Z "O4'" 1 
ATOM   2006  C  "C3'" . DA  F  3  7    ? 48.024  -4.103  36.355  1.00 59.26  ? 8    DA  Z "C3'" 1 
ATOM   2007  O  "O3'" . DA  F  3  7    ? 48.328  -3.357  35.164  1.00 57.94  ? 8    DA  Z "O3'" 1 
ATOM   2008  C  "C2'" . DA  F  3  7    ? 49.223  -4.606  37.150  1.00 60.58  ? 8    DA  Z "C2'" 1 
ATOM   2009  C  "C1'" . DA  F  3  7    ? 49.553  -3.408  38.030  1.00 61.95  ? 8    DA  Z "C1'" 1 
ATOM   2010  N  N9    . DA  F  3  7    ? 50.219  -3.684  39.309  1.00 63.09  ? 8    DA  Z N9    1 
ATOM   2011  C  C8    . DA  F  3  7    ? 49.970  -4.692  40.208  1.00 63.57  ? 8    DA  Z C8    1 
ATOM   2012  N  N7    . DA  F  3  7    ? 50.726  -4.645  41.279  1.00 63.94  ? 8    DA  Z N7    1 
ATOM   2013  C  C5    . DA  F  3  7    ? 51.537  -3.538  41.066  1.00 63.81  ? 8    DA  Z C5    1 
ATOM   2014  C  C6    . DA  F  3  7    ? 52.551  -2.943  41.835  1.00 63.77  ? 8    DA  Z C6    1 
ATOM   2015  N  N6    . DA  F  3  7    ? 52.951  -3.391  43.030  1.00 62.75  ? 8    DA  Z N6    1 
ATOM   2016  N  N1    . DA  F  3  7    ? 53.149  -1.853  41.331  1.00 62.97  ? 8    DA  Z N1    1 
ATOM   2017  C  C2    . DA  F  3  7    ? 52.759  -1.390  40.151  1.00 62.93  ? 8    DA  Z C2    1 
ATOM   2018  N  N3    . DA  F  3  7    ? 51.825  -1.852  39.336  1.00 63.21  ? 8    DA  Z N3    1 
ATOM   2019  C  C4    . DA  F  3  7    ? 51.239  -2.941  39.856  1.00 63.27  ? 8    DA  Z C4    1 
ATOM   2020  P  P     . DG  F  3  8    ? 49.624  -3.709  34.291  1.00 56.21  ? 9    DG  Z P     1 
ATOM   2021  O  OP1   . DG  F  3  8    ? 49.485  -3.056  32.972  1.00 54.15  ? 9    DG  Z OP1   1 
ATOM   2022  O  OP2   . DG  F  3  8    ? 49.858  -5.172  34.362  1.00 57.01  ? 9    DG  Z OP2   1 
ATOM   2023  O  "O5'" . DG  F  3  8    ? 50.767  -2.958  35.099  1.00 56.79  ? 9    DG  Z "O5'" 1 
ATOM   2024  C  "C5'" . DG  F  3  8    ? 50.619  -1.577  35.434  1.00 58.28  ? 9    DG  Z "C5'" 1 
ATOM   2025  C  "C4'" . DG  F  3  8    ? 51.921  -0.847  35.208  1.00 61.13  ? 9    DG  Z "C4'" 1 
ATOM   2026  O  "O4'" . DG  F  3  8    ? 52.821  -1.015  36.321  1.00 60.68  ? 9    DG  Z "O4'" 1 
ATOM   2027  C  "C3'" . DG  F  3  8    ? 52.669  -1.365  33.988  1.00 62.53  ? 9    DG  Z "C3'" 1 
ATOM   2028  O  "O3'" . DG  F  3  8    ? 53.348  -0.286  33.365  1.00 65.26  ? 9    DG  Z "O3'" 1 
ATOM   2029  C  "C2'" . DG  F  3  8    ? 53.629  -2.380  34.580  1.00 61.68  ? 9    DG  Z "C2'" 1 
ATOM   2030  C  "C1'" . DG  F  3  8    ? 53.948  -1.787  35.942  1.00 60.76  ? 9    DG  Z "C1'" 1 
ATOM   2031  N  N9    . DG  F  3  8    ? 54.165  -2.743  37.016  1.00 60.66  ? 9    DG  Z N9    1 
ATOM   2032  C  C8    . DG  F  3  8    ? 53.510  -3.931  37.237  1.00 60.89  ? 9    DG  Z C8    1 
ATOM   2033  N  N7    . DG  F  3  8    ? 53.869  -4.512  38.349  1.00 60.94  ? 9    DG  Z N7    1 
ATOM   2034  C  C5    . DG  F  3  8    ? 54.837  -3.666  38.876  1.00 60.78  ? 9    DG  Z C5    1 
ATOM   2035  C  C6    . DG  F  3  8    ? 55.591  -3.760  40.080  1.00 60.49  ? 9    DG  Z C6    1 
ATOM   2036  O  O6    . DG  F  3  8    ? 55.551  -4.648  40.942  1.00 59.70  ? 9    DG  Z O6    1 
ATOM   2037  N  N1    . DG  F  3  8    ? 56.461  -2.677  40.227  1.00 60.06  ? 9    DG  Z N1    1 
ATOM   2038  C  C2    . DG  F  3  8    ? 56.587  -1.638  39.328  1.00 60.01  ? 9    DG  Z C2    1 
ATOM   2039  N  N2    . DG  F  3  8    ? 57.486  -0.684  39.623  1.00 58.44  ? 9    DG  Z N2    1 
ATOM   2040  N  N3    . DG  F  3  8    ? 55.884  -1.543  38.212  1.00 60.94  ? 9    DG  Z N3    1 
ATOM   2041  C  C4    . DG  F  3  8    ? 55.039  -2.581  38.052  1.00 60.95  ? 9    DG  Z C4    1 
ATOM   2042  P  P     . DA  F  3  9    ? 53.683  -0.369  31.800  1.00 66.85  ? 10   DA  Z P     1 
ATOM   2043  O  OP1   . DA  F  3  9    ? 52.573  0.258   31.048  1.00 67.24  ? 10   DA  Z OP1   1 
ATOM   2044  O  OP2   . DA  F  3  9    ? 54.032  -1.780  31.537  1.00 65.99  ? 10   DA  Z OP2   1 
ATOM   2045  O  "O5'" . DA  F  3  9    ? 54.988  0.534   31.691  1.00 68.15  ? 10   DA  Z "O5'" 1 
ATOM   2046  C  "C5'" . DA  F  3  9    ? 55.319  1.452   32.737  1.00 72.43  ? 10   DA  Z "C5'" 1 
ATOM   2047  C  "C4'" . DA  F  3  9    ? 56.743  1.237   33.203  1.00 75.16  ? 10   DA  Z "C4'" 1 
ATOM   2048  O  "O4'" . DA  F  3  9    ? 56.870  0.257   34.270  1.00 75.83  ? 10   DA  Z "O4'" 1 
ATOM   2049  C  "C3'" . DA  F  3  9    ? 57.723  0.809   32.117  1.00 76.11  ? 10   DA  Z "C3'" 1 
ATOM   2050  O  "O3'" . DA  F  3  9    ? 58.883  1.625   32.220  1.00 78.96  ? 10   DA  Z "O3'" 1 
ATOM   2051  C  "C2'" . DA  F  3  9    ? 58.056  -0.626  32.487  1.00 75.00  ? 10   DA  Z "C2'" 1 
ATOM   2052  C  "C1'" . DA  F  3  9    ? 57.983  -0.582  33.994  1.00 75.27  ? 10   DA  Z "C1'" 1 
ATOM   2053  N  N9    . DA  F  3  9    ? 57.747  -1.873  34.637  1.00 75.57  ? 10   DA  Z N9    1 
ATOM   2054  C  C8    . DA  F  3  9    ? 56.866  -2.843  34.236  1.00 75.39  ? 10   DA  Z C8    1 
ATOM   2055  N  N7    . DA  F  3  9    ? 56.805  -3.870  35.042  1.00 76.01  ? 10   DA  Z N7    1 
ATOM   2056  C  C5    . DA  F  3  9    ? 57.729  -3.571  36.034  1.00 77.27  ? 10   DA  Z C5    1 
ATOM   2057  C  C6    . DA  F  3  9    ? 58.130  -4.274  37.188  1.00 78.29  ? 10   DA  Z C6    1 
ATOM   2058  N  N6    . DA  F  3  9    ? 57.615  -5.450  37.518  1.00 78.32  ? 10   DA  Z N6    1 
ATOM   2059  N  N1    . DA  F  3  9    ? 59.079  -3.716  37.991  1.00 79.11  ? 10   DA  Z N1    1 
ATOM   2060  C  C2    . DA  F  3  9    ? 59.576  -2.515  37.625  1.00 78.94  ? 10   DA  Z C2    1 
ATOM   2061  N  N3    . DA  F  3  9    ? 59.273  -1.755  36.555  1.00 78.30  ? 10   DA  Z N3    1 
ATOM   2062  C  C4    . DA  F  3  9    ? 58.328  -2.348  35.794  1.00 76.71  ? 10   DA  Z C4    1 
ATOM   2063  P  P     . DC  F  3  10   ? 60.114  1.393   31.220  1.00 81.90  ? 11   DC  Z P     1 
ATOM   2064  O  OP1   . DC  F  3  10   ? 60.491  2.689   30.579  1.00 81.97  ? 11   DC  Z OP1   1 
ATOM   2065  O  OP2   . DC  F  3  10   ? 59.798  0.210   30.362  1.00 82.83  ? 11   DC  Z OP2   1 
ATOM   2066  O  "O5'" . DC  F  3  10   ? 61.278  1.010   32.223  1.00 81.08  ? 11   DC  Z "O5'" 1 
ATOM   2067  C  "C5'" . DC  F  3  10   ? 61.488  1.788   33.397  1.00 78.98  ? 11   DC  Z "C5'" 1 
ATOM   2068  C  "C4'" . DC  F  3  10   ? 62.627  1.214   34.206  1.00 77.72  ? 11   DC  Z "C4'" 1 
ATOM   2069  O  "O4'" . DC  F  3  10   ? 62.199  0.018   34.917  1.00 77.20  ? 11   DC  Z "O4'" 1 
ATOM   2070  C  "C3'" . DC  F  3  10   ? 63.850  0.823   33.374  1.00 76.18  ? 11   DC  Z "C3'" 1 
ATOM   2071  O  "O3'" . DC  F  3  10   ? 65.038  1.364   33.985  1.00 73.52  ? 11   DC  Z "O3'" 1 
ATOM   2072  C  "C2'" . DC  F  3  10   ? 63.785  -0.700  33.327  1.00 76.76  ? 11   DC  Z "C2'" 1 
ATOM   2073  C  "C1'" . DC  F  3  10   ? 63.042  -1.085  34.606  1.00 77.20  ? 11   DC  Z "C1'" 1 
ATOM   2074  N  N1    . DC  F  3  10   ? 62.188  -2.293  34.502  1.00 78.02  ? 11   DC  Z N1    1 
ATOM   2075  C  C2    . DC  F  3  10   ? 62.284  -3.288  35.494  1.00 78.83  ? 11   DC  Z C2    1 
ATOM   2076  O  O2    . DC  F  3  10   ? 63.106  -3.159  36.408  1.00 78.78  ? 11   DC  Z O2    1 
ATOM   2077  N  N3    . DC  F  3  10   ? 61.475  -4.368  35.424  1.00 79.94  ? 11   DC  Z N3    1 
ATOM   2078  C  C4    . DC  F  3  10   ? 60.604  -4.491  34.423  1.00 80.21  ? 11   DC  Z C4    1 
ATOM   2079  N  N4    . DC  F  3  10   ? 59.817  -5.568  34.410  1.00 80.29  ? 11   DC  Z N4    1 
ATOM   2080  C  C5    . DC  F  3  10   ? 60.497  -3.512  33.391  1.00 79.50  ? 11   DC  Z C5    1 
ATOM   2081  C  C6    . DC  F  3  10   ? 61.300  -2.441  33.470  1.00 78.97  ? 11   DC  Z C6    1 
ATOM   2082  P  P     . DA  F  3  11   ? 66.495  0.778   33.614  1.00 71.13  ? 12   DA  Z P     1 
ATOM   2083  O  OP1   . DA  F  3  11   ? 67.518  1.827   33.852  1.00 69.74  ? 12   DA  Z OP1   1 
ATOM   2084  O  OP2   . DA  F  3  11   ? 66.436  0.100   32.290  1.00 70.43  ? 12   DA  Z OP2   1 
ATOM   2085  O  "O5'" . DA  F  3  11   ? 66.690  -0.345  34.724  1.00 68.92  ? 12   DA  Z "O5'" 1 
ATOM   2086  C  "C5'" . DA  F  3  11   ? 66.837  0.002   36.105  1.00 62.00  ? 12   DA  Z "C5'" 1 
ATOM   2087  C  "C4'" . DA  F  3  11   ? 67.618  -1.075  36.821  1.00 57.71  ? 12   DA  Z "C4'" 1 
ATOM   2088  O  "O4'" . DA  F  3  11   ? 66.832  -2.291  36.824  1.00 53.27  ? 12   DA  Z "O4'" 1 
ATOM   2089  C  "C3'" . DA  F  3  11   ? 68.938  -1.440  36.139  1.00 57.22  ? 12   DA  Z "C3'" 1 
ATOM   2090  O  "O3'" . DA  F  3  11   ? 69.873  -1.863  37.141  1.00 59.80  ? 12   DA  Z "O3'" 1 
ATOM   2091  C  "C2'" . DA  F  3  11   ? 68.541  -2.590  35.225  1.00 54.75  ? 12   DA  Z "C2'" 1 
ATOM   2092  C  "C1'" . DA  F  3  11   ? 67.459  -3.290  36.028  1.00 49.93  ? 12   DA  Z "C1'" 1 
ATOM   2093  N  N9    . DA  F  3  11   ? 66.422  -3.932  35.224  1.00 44.69  ? 12   DA  Z N9    1 
ATOM   2094  C  C8    . DA  F  3  11   ? 65.822  -3.486  34.074  1.00 41.87  ? 12   DA  Z C8    1 
ATOM   2095  N  N7    . DA  F  3  11   ? 64.916  -4.306  33.599  1.00 40.85  ? 12   DA  Z N7    1 
ATOM   2096  C  C5    . DA  F  3  11   ? 64.922  -5.364  34.498  1.00 41.60  ? 12   DA  Z C5    1 
ATOM   2097  C  C6    . DA  F  3  11   ? 64.189  -6.567  34.552  1.00 41.28  ? 12   DA  Z C6    1 
ATOM   2098  N  N6    . DA  F  3  11   ? 63.272  -6.903  33.655  1.00 39.67  ? 12   DA  Z N6    1 
ATOM   2099  N  N1    . DA  F  3  11   ? 64.441  -7.418  35.572  1.00 40.81  ? 12   DA  Z N1    1 
ATOM   2100  C  C2    . DA  F  3  11   ? 65.369  -7.067  36.477  1.00 41.94  ? 12   DA  Z C2    1 
ATOM   2101  N  N3    . DA  F  3  11   ? 66.121  -5.966  36.537  1.00 42.79  ? 12   DA  Z N3    1 
ATOM   2102  C  C4    . DA  F  3  11   ? 65.845  -5.146  35.502  1.00 43.01  ? 12   DA  Z C4    1 
ATOM   2103  P  P     . DG  F  3  12   ? 71.379  -2.305  36.738  1.00 61.56  ? 13   DG  Z P     1 
ATOM   2104  O  OP1   . DG  F  3  12   ? 72.324  -1.388  37.452  1.00 62.80  ? 13   DG  Z OP1   1 
ATOM   2105  O  OP2   . DG  F  3  12   ? 71.495  -2.464  35.261  1.00 61.72  ? 13   DG  Z OP2   1 
ATOM   2106  O  "O5'" . DG  F  3  12   ? 71.506  -3.734  37.420  1.00 57.81  ? 13   DG  Z "O5'" 1 
ATOM   2107  C  "C5'" . DG  F  3  12   ? 70.996  -3.931  38.733  1.00 54.27  ? 13   DG  Z "C5'" 1 
ATOM   2108  C  "C4'" . DG  F  3  12   ? 70.803  -5.399  39.012  1.00 53.10  ? 13   DG  Z "C4'" 1 
ATOM   2109  O  "O4'" . DG  F  3  12   ? 69.728  -5.934  38.205  1.00 49.98  ? 13   DG  Z "O4'" 1 
ATOM   2110  C  "C3'" . DG  F  3  12   ? 72.031  -6.243  38.699  1.00 54.51  ? 13   DG  Z "C3'" 1 
ATOM   2111  O  "O3'" . DG  F  3  12   ? 72.207  -7.243  39.704  1.00 59.00  ? 13   DG  Z "O3'" 1 
ATOM   2112  C  "C2'" . DG  F  3  12   ? 71.685  -6.879  37.366  1.00 52.61  ? 13   DG  Z "C2'" 1 
ATOM   2113  C  "C1'" . DG  F  3  12   ? 70.184  -7.059  37.473  1.00 49.01  ? 13   DG  Z "C1'" 1 
ATOM   2114  N  N9    . DG  F  3  12   ? 69.485  -7.061  36.193  1.00 45.94  ? 13   DG  Z N9    1 
ATOM   2115  C  C8    . DG  F  3  12   ? 69.534  -6.072  35.252  1.00 45.00  ? 13   DG  Z C8    1 
ATOM   2116  N  N7    . DG  F  3  12   ? 68.754  -6.293  34.237  1.00 44.82  ? 13   DG  Z N7    1 
ATOM   2117  C  C5    . DG  F  3  12   ? 68.163  -7.515  34.514  1.00 44.33  ? 13   DG  Z C5    1 
ATOM   2118  C  C6    . DG  F  3  12   ? 67.219  -8.248  33.773  1.00 43.59  ? 13   DG  Z C6    1 
ATOM   2119  O  O6    . DG  F  3  12   ? 66.711  -7.943  32.700  1.00 43.54  ? 13   DG  Z O6    1 
ATOM   2120  N  N1    . DG  F  3  12   ? 66.878  -9.443  34.401  1.00 43.24  ? 13   DG  Z N1    1 
ATOM   2121  C  C2    . DG  F  3  12   ? 67.388  -9.867  35.593  1.00 43.58  ? 13   DG  Z C2    1 
ATOM   2122  N  N2    . DG  F  3  12   ? 66.939  -11.060 36.029  1.00 44.85  ? 13   DG  Z N2    1 
ATOM   2123  N  N3    . DG  F  3  12   ? 68.274  -9.179  36.304  1.00 44.68  ? 13   DG  Z N3    1 
ATOM   2124  C  C4    . DG  F  3  12   ? 68.614  -8.016  35.706  1.00 44.56  ? 13   DG  Z C4    1 
ATOM   2125  P  P     . DG  F  3  13   ? 73.594  -8.055  39.782  1.00 62.26  ? 14   DG  Z P     1 
ATOM   2126  O  OP1   . DG  F  3  13   ? 73.929  -8.273  41.214  1.00 62.04  ? 14   DG  Z OP1   1 
ATOM   2127  O  OP2   . DG  F  3  13   ? 74.565  -7.355  38.907  1.00 62.12  ? 14   DG  Z OP2   1 
ATOM   2128  O  "O5'" . DG  F  3  13   ? 73.254  -9.472  39.130  1.00 64.30  ? 14   DG  Z "O5'" 1 
ATOM   2129  C  "C5'" . DG  F  3  13   ? 72.725  -10.530 39.936  1.00 68.51  ? 14   DG  Z "C5'" 1 
ATOM   2130  C  "C4'" . DG  F  3  13   ? 72.645  -11.824 39.155  1.00 70.68  ? 14   DG  Z "C4'" 1 
ATOM   2131  O  "O4'" . DG  F  3  13   ? 71.674  -11.681 38.088  1.00 70.02  ? 14   DG  Z "O4'" 1 
ATOM   2132  C  "C3'" . DG  F  3  13   ? 73.944  -12.314 38.500  1.00 72.40  ? 14   DG  Z "C3'" 1 
ATOM   2133  O  "O3'" . DG  F  3  13   ? 74.096  -13.733 38.696  1.00 74.87  ? 14   DG  Z "O3'" 1 
ATOM   2134  C  "C2'" . DG  F  3  13   ? 73.759  -11.957 37.037  1.00 71.97  ? 14   DG  Z "C2'" 1 
ATOM   2135  C  "C1'" . DG  F  3  13   ? 72.253  -12.039 36.842  1.00 70.91  ? 14   DG  Z "C1'" 1 
ATOM   2136  N  N9    . DG  F  3  13   ? 71.767  -11.098 35.834  1.00 70.27  ? 14   DG  Z N9    1 
ATOM   2137  C  C8    . DG  F  3  13   ? 72.140  -9.783  35.714  1.00 70.05  ? 14   DG  Z C8    1 
ATOM   2138  N  N7    . DG  F  3  13   ? 71.582  -9.185  34.702  1.00 69.85  ? 14   DG  Z N7    1 
ATOM   2139  C  C5    . DG  F  3  13   ? 70.785  -10.160 34.118  1.00 69.32  ? 14   DG  Z C5    1 
ATOM   2140  C  C6    . DG  F  3  13   ? 69.949  -10.088 32.982  1.00 69.49  ? 14   DG  Z C6    1 
ATOM   2141  O  O6    . DG  F  3  13   ? 69.748  -9.115  32.247  1.00 70.14  ? 14   DG  Z O6    1 
ATOM   2142  N  N1    . DG  F  3  13   ? 69.311  -11.302 32.725  1.00 69.47  ? 14   DG  Z N1    1 
ATOM   2143  C  C2    . DG  F  3  13   ? 69.467  -12.438 33.477  1.00 69.54  ? 14   DG  Z C2    1 
ATOM   2144  N  N2    . DG  F  3  13   ? 68.763  -13.508 33.071  1.00 69.79  ? 14   DG  Z N2    1 
ATOM   2145  N  N3    . DG  F  3  13   ? 70.251  -12.519 34.547  1.00 69.54  ? 14   DG  Z N3    1 
ATOM   2146  C  C4    . DG  F  3  13   ? 70.876  -11.345 34.807  1.00 69.52  ? 14   DG  Z C4    1 
ATOM   2147  P  P     . DG  F  3  14   ? 75.197  -14.568 37.849  1.00 77.19  ? 15   DG  Z P     1 
ATOM   2148  O  OP1   . DG  F  3  14   ? 75.723  -15.663 38.712  1.00 77.20  ? 15   DG  Z OP1   1 
ATOM   2149  O  OP2   . DG  F  3  14   ? 76.155  -13.628 37.193  1.00 75.92  ? 15   DG  Z OP2   1 
ATOM   2150  O  "O5'" . DG  F  3  14   ? 74.302  -15.257 36.727  1.00 77.15  ? 15   DG  Z "O5'" 1 
ATOM   2151  C  "C5'" . DG  F  3  14   ? 74.873  -16.096 35.725  1.00 78.39  ? 15   DG  Z "C5'" 1 
ATOM   2152  C  "C4'" . DG  F  3  14   ? 73.773  -16.814 34.977  1.00 78.05  ? 15   DG  Z "C4'" 1 
ATOM   2153  O  "O4'" . DG  F  3  14   ? 72.778  -15.854 34.532  1.00 77.82  ? 15   DG  Z "O4'" 1 
ATOM   2154  C  "C3'" . DG  F  3  14   ? 74.227  -17.563 33.726  1.00 78.21  ? 15   DG  Z "C3'" 1 
ATOM   2155  O  "O3'" . DG  F  3  14   ? 73.411  -18.715 33.532  1.00 78.97  ? 15   DG  Z "O3'" 1 
ATOM   2156  C  "C2'" . DG  F  3  14   ? 73.967  -16.570 32.605  1.00 77.63  ? 15   DG  Z "C2'" 1 
ATOM   2157  C  "C1'" . DG  F  3  14   ? 72.775  -15.744 33.105  1.00 76.66  ? 15   DG  Z "C1'" 1 
ATOM   2158  N  N9    . DG  F  3  14   ? 72.901  -14.324 32.760  1.00 75.25  ? 15   DG  Z N9    1 
ATOM   2159  C  C8    . DG  F  3  14   ? 73.704  -13.406 33.392  1.00 74.69  ? 15   DG  Z C8    1 
ATOM   2160  N  N7    . DG  F  3  14   ? 73.694  -12.233 32.821  1.00 74.13  ? 15   DG  Z N7    1 
ATOM   2161  C  C5    . DG  F  3  14   ? 72.815  -12.370 31.757  1.00 73.54  ? 15   DG  Z C5    1 
ATOM   2162  C  C6    . DG  F  3  14   ? 72.407  -11.421 30.765  1.00 73.01  ? 15   DG  Z C6    1 
ATOM   2163  O  O6    . DG  F  3  14   ? 72.769  -10.240 30.629  1.00 72.46  ? 15   DG  Z O6    1 
ATOM   2164  N  N1    . DG  F  3  14   ? 71.493  -11.973 29.874  1.00 72.22  ? 15   DG  Z N1    1 
ATOM   2165  C  C2    . DG  F  3  14   ? 71.038  -13.272 29.925  1.00 71.98  ? 15   DG  Z C2    1 
ATOM   2166  N  N2    . DG  F  3  14   ? 70.167  -13.628 28.982  1.00 71.31  ? 15   DG  Z N2    1 
ATOM   2167  N  N3    . DG  F  3  14   ? 71.412  -14.161 30.837  1.00 72.94  ? 15   DG  Z N3    1 
ATOM   2168  C  C4    . DG  F  3  14   ? 72.296  -13.648 31.714  1.00 73.67  ? 15   DG  Z C4    1 
ATOM   2169  N  N     . MET G  4  1    ? 111.812 72.438  -48.721 1.00 74.61  ? 1    MET A N     1 
ATOM   2170  C  CA    . MET G  4  1    ? 111.528 71.098  -48.132 1.00 73.67  ? 1    MET A CA    1 
ATOM   2171  C  C     . MET G  4  1    ? 110.565 70.343  -49.058 1.00 74.02  ? 1    MET A C     1 
ATOM   2172  O  O     . MET G  4  1    ? 109.928 70.990  -49.898 1.00 73.32  ? 1    MET A O     1 
ATOM   2173  C  CB    . MET G  4  1    ? 110.954 71.299  -46.731 1.00 72.57  ? 1    MET A CB    1 
ATOM   2174  C  CG    . MET G  4  1    ? 111.749 72.295  -45.863 1.00 71.16  ? 1    MET A CG    1 
ATOM   2175  S  SD    . MET G  4  1    ? 111.538 74.045  -46.304 1.00 67.66  ? 1    MET A SD    1 
ATOM   2176  C  CE    . MET G  4  1    ? 109.791 74.207  -45.978 1.00 69.98  ? 1    MET A CE    1 
ATOM   2177  N  N     . LEU G  4  2    ? 110.425 69.014  -48.920 1.00 73.91  ? 2    LEU A N     1 
ATOM   2178  C  CA    . LEU G  4  2    ? 109.631 68.288  -49.926 1.00 73.82  ? 2    LEU A CA    1 
ATOM   2179  C  C     . LEU G  4  2    ? 108.504 67.375  -49.353 1.00 74.03  ? 2    LEU A C     1 
ATOM   2180  O  O     . LEU G  4  2    ? 107.355 67.502  -49.799 1.00 73.74  ? 2    LEU A O     1 
ATOM   2181  C  CB    . LEU G  4  2    ? 110.566 67.413  -50.790 1.00 73.28  ? 2    LEU A CB    1 
ATOM   2182  C  CG    . LEU G  4  2    ? 112.075 67.704  -50.930 1.00 73.10  ? 2    LEU A CG    1 
ATOM   2183  C  CD1   . LEU G  4  2    ? 112.780 66.474  -51.482 1.00 72.55  ? 2    LEU A CD1   1 
ATOM   2184  C  CD2   . LEU G  4  2    ? 112.294 68.894  -51.847 1.00 73.11  ? 2    LEU A CD2   1 
ATOM   2185  N  N     . ASP G  4  3    ? 108.777 66.481  -48.402 1.00 73.96  ? 3    ASP A N     1 
ATOM   2186  C  CA    . ASP G  4  3    ? 107.750 65.481  -48.014 1.00 73.85  ? 3    ASP A CA    1 
ATOM   2187  C  C     . ASP G  4  3    ? 106.664 66.002  -47.028 1.00 73.53  ? 3    ASP A C     1 
ATOM   2188  O  O     . ASP G  4  3    ? 105.612 66.504  -47.448 1.00 72.29  ? 3    ASP A O     1 
ATOM   2189  C  CB    . ASP G  4  3    ? 108.442 64.222  -47.432 1.00 74.49  ? 3    ASP A CB    1 
ATOM   2190  C  CG    . ASP G  4  3    ? 107.835 62.901  -47.953 1.00 74.17  ? 3    ASP A CG    1 
ATOM   2191  O  OD1   . ASP G  4  3    ? 107.944 62.613  -49.162 1.00 74.67  ? 3    ASP A OD1   1 
ATOM   2192  O  OD2   . ASP G  4  3    ? 107.244 62.145  -47.151 1.00 74.50  ? 3    ASP A OD2   1 
ATOM   2193  N  N     . SER G  4  4    ? 106.909 65.853  -45.724 1.00 72.92  ? 4    SER A N     1 
ATOM   2194  C  CA    . SER G  4  4    ? 105.912 66.187  -44.696 1.00 72.18  ? 4    SER A CA    1 
ATOM   2195  C  C     . SER G  4  4    ? 105.892 67.678  -44.355 1.00 70.46  ? 4    SER A C     1 
ATOM   2196  O  O     . SER G  4  4    ? 104.819 68.222  -44.082 1.00 70.97  ? 4    SER A O     1 
ATOM   2197  C  CB    . SER G  4  4    ? 106.183 65.349  -43.418 1.00 73.41  ? 4    SER A CB    1 
ATOM   2198  O  OG    . SER G  4  4    ? 104.980 64.826  -42.845 1.00 73.60  ? 4    SER A OG    1 
ATOM   2199  N  N     . LYS G  4  5    ? 107.051 68.337  -44.364 1.00 68.86  ? 5    LYS A N     1 
ATOM   2200  C  CA    . LYS G  4  5    ? 107.101 69.754  -44.033 1.00 66.85  ? 5    LYS A CA    1 
ATOM   2201  C  C     . LYS G  4  5    ? 106.644 70.616  -45.205 1.00 66.94  ? 5    LYS A C     1 
ATOM   2202  O  O     . LYS G  4  5    ? 105.957 71.614  -44.964 1.00 67.31  ? 5    LYS A O     1 
ATOM   2203  C  CB    . LYS G  4  5    ? 108.508 70.149  -43.590 1.00 66.58  ? 5    LYS A CB    1 
ATOM   2204  C  CG    . LYS G  4  5    ? 108.586 70.489  -42.092 1.00 66.99  ? 5    LYS A CG    1 
ATOM   2205  C  CD    . LYS G  4  5    ? 109.465 69.520  -41.274 1.00 67.14  ? 5    LYS A CD    1 
ATOM   2206  C  CE    . LYS G  4  5    ? 108.764 68.203  -40.921 1.00 67.08  ? 5    LYS A CE    1 
ATOM   2207  N  NZ    . LYS G  4  5    ? 109.641 67.277  -40.125 1.00 66.08  ? 5    LYS A NZ    1 
ATOM   2208  N  N     . LEU G  4  6    ? 107.009 70.272  -46.455 1.00 66.52  ? 6    LEU A N     1 
ATOM   2209  C  CA    . LEU G  4  6    ? 106.484 71.052  -47.592 1.00 65.14  ? 6    LEU A CA    1 
ATOM   2210  C  C     . LEU G  4  6    ? 104.975 70.914  -47.634 1.00 64.30  ? 6    LEU A C     1 
ATOM   2211  O  O     . LEU G  4  6    ? 104.259 71.867  -47.947 1.00 65.50  ? 6    LEU A O     1 
ATOM   2212  C  CB    . LEU G  4  6    ? 107.035 70.593  -48.938 1.00 64.19  ? 6    LEU A CB    1 
ATOM   2213  C  CG    . LEU G  4  6    ? 106.411 71.484  -50.015 1.00 64.31  ? 6    LEU A CG    1 
ATOM   2214  C  CD1   . LEU G  4  6    ? 107.384 72.609  -50.355 1.00 64.79  ? 6    LEU A CD1   1 
ATOM   2215  C  CD2   . LEU G  4  6    ? 106.048 70.656  -51.226 1.00 63.81  ? 6    LEU A CD2   1 
ATOM   2216  N  N     . LYS G  4  7    ? 104.512 69.700  -47.335 1.00 62.80  ? 7    LYS A N     1 
ATOM   2217  C  CA    . LYS G  4  7    ? 103.094 69.472  -47.156 1.00 62.51  ? 7    LYS A CA    1 
ATOM   2218  C  C     . LYS G  4  7    ? 102.665 70.213  -45.894 1.00 64.03  ? 7    LYS A C     1 
ATOM   2219  O  O     . LYS G  4  7    ? 102.437 69.622  -44.826 1.00 64.66  ? 7    LYS A O     1 
ATOM   2220  C  CB    . LYS G  4  7    ? 102.827 67.971  -46.991 1.00 60.30  ? 7    LYS A CB    1 
ATOM   2221  C  CG    . LYS G  4  7    ? 101.354 67.552  -46.936 1.00 58.88  ? 7    LYS A CG    1 
ATOM   2222  C  CD    . LYS G  4  7    ? 101.131 66.317  -46.040 1.00 56.25  ? 7    LYS A CD    1 
ATOM   2223  C  CE    . LYS G  4  7    ? 100.185 65.303  -46.678 1.00 54.23  ? 7    LYS A CE    1 
ATOM   2224  N  NZ    . LYS G  4  7    ? 99.671  64.296  -45.708 1.00 50.75  ? 7    LYS A NZ    1 
ATOM   2225  N  N     . ALA G  4  8    ? 102.600 71.534  -46.026 1.00 64.02  ? 8    ALA A N     1 
ATOM   2226  C  CA    . ALA G  4  8    ? 102.292 72.399  -44.905 1.00 63.95  ? 8    ALA A CA    1 
ATOM   2227  C  C     . ALA G  4  8    ? 101.053 73.225  -45.166 1.00 63.44  ? 8    ALA A C     1 
ATOM   2228  O  O     . ALA G  4  8    ? 100.679 73.480  -46.323 1.00 63.28  ? 8    ALA A O     1 
ATOM   2229  C  CB    . ALA G  4  8    ? 103.481 73.325  -44.619 1.00 64.28  ? 8    ALA A CB    1 
ATOM   2230  N  N     . PRO G  4  9    ? 100.390 73.640  -44.078 1.00 62.63  ? 9    PRO A N     1 
ATOM   2231  C  CA    . PRO G  4  9    ? 99.203  74.450  -44.212 1.00 61.91  ? 9    PRO A CA    1 
ATOM   2232  C  C     . PRO G  4  9    ? 99.416  75.624  -45.126 1.00 61.98  ? 9    PRO A C     1 
ATOM   2233  O  O     . PRO G  4  9    ? 100.202 76.538  -44.831 1.00 62.40  ? 9    PRO A O     1 
ATOM   2234  C  CB    . PRO G  4  9    ? 98.917  74.821  -42.787 1.00 61.73  ? 9    PRO A CB    1 
ATOM   2235  C  CG    . PRO G  4  9    ? 99.064  73.501  -42.137 1.00 61.52  ? 9    PRO A CG    1 
ATOM   2236  C  CD    . PRO G  4  9    ? 100.378 73.001  -42.746 1.00 62.31  ? 9    PRO A CD    1 
ATOM   2237  N  N     . VAL G  4  10   ? 98.715  75.560  -46.254 1.00 60.97  ? 10   VAL A N     1 
ATOM   2238  C  CA    . VAL G  4  10   ? 98.711  76.636  -47.231 1.00 60.82  ? 10   VAL A CA    1 
ATOM   2239  C  C     . VAL G  4  10   ? 97.834  77.773  -46.722 1.00 60.93  ? 10   VAL A C     1 
ATOM   2240  O  O     . VAL G  4  10   ? 96.607  77.693  -46.804 1.00 61.28  ? 10   VAL A O     1 
ATOM   2241  C  CB    . VAL G  4  10   ? 98.149  76.142  -48.607 1.00 60.22  ? 10   VAL A CB    1 
ATOM   2242  C  CG1   . VAL G  4  10   ? 97.878  77.324  -49.551 1.00 59.69  ? 10   VAL A CG1   1 
ATOM   2243  C  CG2   . VAL G  4  10   ? 99.142  75.204  -49.253 1.00 59.83  ? 10   VAL A CG2   1 
ATOM   2244  N  N     . PHE G  4  11   ? 98.443  78.813  -46.174 1.00 60.31  ? 11   PHE A N     1 
ATOM   2245  C  CA    . PHE G  4  11   ? 97.643  79.911  -45.686 1.00 60.33  ? 11   PHE A CA    1 
ATOM   2246  C  C     . PHE G  4  11   ? 97.158  80.750  -46.844 1.00 59.28  ? 11   PHE A C     1 
ATOM   2247  O  O     . PHE G  4  11   ? 97.944  81.395  -47.517 1.00 60.16  ? 11   PHE A O     1 
ATOM   2248  C  CB    . PHE G  4  11   ? 98.476  80.750  -44.698 1.00 62.45  ? 11   PHE A CB    1 
ATOM   2249  C  CG    . PHE G  4  11   ? 97.774  82.004  -44.157 1.00 64.64  ? 11   PHE A CG    1 
ATOM   2250  C  CD1   . PHE G  4  11   ? 96.473  81.941  -43.610 1.00 65.29  ? 11   PHE A CD1   1 
ATOM   2251  C  CD2   . PHE G  4  11   ? 98.443  83.259  -44.171 1.00 65.08  ? 11   PHE A CD2   1 
ATOM   2252  C  CE1   . PHE G  4  11   ? 95.835  83.125  -43.075 1.00 66.00  ? 11   PHE A CE1   1 
ATOM   2253  C  CE2   . PHE G  4  11   ? 97.827  84.450  -43.643 1.00 64.96  ? 11   PHE A CE2   1 
ATOM   2254  C  CZ    . PHE G  4  11   ? 96.522  84.382  -43.094 1.00 65.27  ? 11   PHE A CZ    1 
ATOM   2255  N  N     . THR G  4  12   ? 95.865  80.719  -47.107 1.00 58.46  ? 12   THR A N     1 
ATOM   2256  C  CA    . THR G  4  12   ? 95.328  81.525  -48.187 1.00 57.37  ? 12   THR A CA    1 
ATOM   2257  C  C     . THR G  4  12   ? 94.429  82.622  -47.628 1.00 56.63  ? 12   THR A C     1 
ATOM   2258  O  O     . THR G  4  12   ? 93.683  82.392  -46.676 1.00 57.78  ? 12   THR A O     1 
ATOM   2259  C  CB    . THR G  4  12   ? 94.575  80.609  -49.248 1.00 57.55  ? 12   THR A CB    1 
ATOM   2260  O  OG1   . THR G  4  12   ? 93.470  81.325  -49.818 1.00 57.64  ? 12   THR A OG1   1 
ATOM   2261  C  CG2   . THR G  4  12   ? 94.114  79.307  -48.627 1.00 57.89  ? 12   THR A CG2   1 
ATOM   2262  N  N     . VAL G  4  13   ? 94.513  83.820  -48.194 1.00 54.87  ? 13   VAL A N     1 
ATOM   2263  C  CA    . VAL G  4  13   ? 93.715  84.920  -47.681 1.00 53.37  ? 13   VAL A CA    1 
ATOM   2264  C  C     . VAL G  4  13   ? 92.854  85.548  -48.769 1.00 53.95  ? 13   VAL A C     1 
ATOM   2265  O  O     . VAL G  4  13   ? 93.228  85.611  -49.942 1.00 54.50  ? 13   VAL A O     1 
ATOM   2266  C  CB    . VAL G  4  13   ? 94.614  86.021  -47.062 1.00 52.39  ? 13   VAL A CB    1 
ATOM   2267  C  CG1   . VAL G  4  13   ? 93.742  87.085  -46.382 1.00 51.65  ? 13   VAL A CG1   1 
ATOM   2268  C  CG2   . VAL G  4  13   ? 95.550  85.416  -46.051 1.00 50.35  ? 13   VAL A CG2   1 
ATOM   2269  N  N     . ARG G  4  14   ? 91.686  86.005  -48.336 1.00 53.70  ? 14   ARG A N     1 
ATOM   2270  C  CA    . ARG G  4  14   ? 90.690  86.679  -49.160 1.00 53.13  ? 14   ARG A CA    1 
ATOM   2271  C  C     . ARG G  4  14   ? 90.010  87.785  -48.338 1.00 52.90  ? 14   ARG A C     1 
ATOM   2272  O  O     . ARG G  4  14   ? 89.045  87.526  -47.599 1.00 52.18  ? 14   ARG A O     1 
ATOM   2273  C  CB    . ARG G  4  14   ? 89.626  85.670  -49.644 1.00 53.41  ? 14   ARG A CB    1 
ATOM   2274  C  CG    . ARG G  4  14   ? 90.113  84.192  -49.919 1.00 51.09  ? 14   ARG A CG    1 
ATOM   2275  C  CD    . ARG G  4  14   ? 88.958  83.122  -49.846 1.00 49.74  ? 14   ARG A CD    1 
ATOM   2276  N  NE    . ARG G  4  14   ? 88.700  82.602  -48.488 1.00 47.36  ? 14   ARG A NE    1 
ATOM   2277  C  CZ    . ARG G  4  14   ? 87.699  81.782  -48.150 1.00 46.08  ? 14   ARG A CZ    1 
ATOM   2278  N  NH1   . ARG G  4  14   ? 86.824  81.367  -49.055 1.00 47.14  ? 14   ARG A NH1   1 
ATOM   2279  N  NH2   . ARG G  4  14   ? 87.568  81.372  -46.897 1.00 44.09  ? 14   ARG A NH2   1 
ATOM   2280  N  N     . THR G  4  15   ? 90.512  89.011  -48.457 1.00 52.52  ? 15   THR A N     1 
ATOM   2281  C  CA    . THR G  4  15   ? 89.966  90.095  -47.658 1.00 50.48  ? 15   THR A CA    1 
ATOM   2282  C  C     . THR G  4  15   ? 89.557  91.299  -48.508 1.00 49.24  ? 15   THR A C     1 
ATOM   2283  O  O     . THR G  4  15   ? 90.327  91.843  -49.300 1.00 48.21  ? 15   THR A O     1 
ATOM   2284  C  CB    . THR G  4  15   ? 91.000  90.507  -46.562 1.00 50.09  ? 15   THR A CB    1 
ATOM   2285  O  OG1   . THR G  4  15   ? 90.442  91.540  -45.744 1.00 48.78  ? 15   THR A OG1   1 
ATOM   2286  C  CG2   . THR G  4  15   ? 92.316  90.958  -47.191 1.00 48.48  ? 15   THR A CG2   1 
ATOM   2287  N  N     . GLN G  4  16   ? 88.304  91.686  -48.327 1.00 49.49  ? 16   GLN A N     1 
ATOM   2288  C  CA    . GLN G  4  16   ? 87.725  92.834  -48.991 1.00 49.78  ? 16   GLN A CA    1 
ATOM   2289  C  C     . GLN G  4  16   ? 87.502  93.931  -47.987 1.00 50.14  ? 16   GLN A C     1 
ATOM   2290  O  O     . GLN G  4  16   ? 86.782  93.733  -47.012 1.00 50.57  ? 16   GLN A O     1 
ATOM   2291  C  CB    . GLN G  4  16   ? 86.393  92.457  -49.638 1.00 49.13  ? 16   GLN A CB    1 
ATOM   2292  C  CG    . GLN G  4  16   ? 85.892  93.459  -50.652 1.00 49.95  ? 16   GLN A CG    1 
ATOM   2293  C  CD    . GLN G  4  16   ? 84.847  94.418  -50.098 1.00 50.95  ? 16   GLN A CD    1 
ATOM   2294  O  OE1   . GLN G  4  16   ? 83.949  94.006  -49.353 1.00 51.35  ? 16   GLN A OE1   1 
ATOM   2295  N  NE2   . GLN G  4  16   ? 84.949  95.703  -50.467 1.00 51.05  ? 16   GLN A NE2   1 
ATOM   2296  N  N     . GLY G  4  17   ? 88.118  95.081  -48.205 1.00 51.14  ? 17   GLY A N     1 
ATOM   2297  C  CA    . GLY G  4  17   ? 87.963  96.134  -47.233 1.00 53.80  ? 17   GLY A CA    1 
ATOM   2298  C  C     . GLY G  4  17   ? 88.640  95.748  -45.927 1.00 56.37  ? 17   GLY A C     1 
ATOM   2299  O  O     . GLY G  4  17   ? 89.464  94.839  -45.891 1.00 56.08  ? 17   GLY A O     1 
ATOM   2300  N  N     . ARG G  4  18   ? 88.280  96.422  -44.846 1.00 56.80  ? 18   ARG A N     1 
ATOM   2301  C  CA    . ARG G  4  18   ? 88.894  96.177  -43.551 1.00 57.89  ? 18   ARG A CA    1 
ATOM   2302  C  C     . ARG G  4  18   ? 87.895  95.535  -42.589 1.00 58.45  ? 18   ARG A C     1 
ATOM   2303  O  O     . ARG G  4  18   ? 88.162  95.368  -41.391 1.00 58.04  ? 18   ARG A O     1 
ATOM   2304  C  CB    . ARG G  4  18   ? 89.398  97.527  -43.037 1.00 60.47  ? 18   ARG A CB    1 
ATOM   2305  C  CG    . ARG G  4  18   ? 89.405  98.602  -44.171 1.00 62.11  ? 18   ARG A CG    1 
ATOM   2306  C  CD    . ARG G  4  18   ? 90.321  99.744  -43.893 1.00 65.01  ? 18   ARG A CD    1 
ATOM   2307  N  NE    . ARG G  4  18   ? 91.648  99.239  -43.573 1.00 68.64  ? 18   ARG A NE    1 
ATOM   2308  C  CZ    . ARG G  4  18   ? 92.572  99.935  -42.919 1.00 71.48  ? 18   ARG A CZ    1 
ATOM   2309  N  NH1   . ARG G  4  18   ? 92.311  101.179 -42.511 1.00 72.62  ? 18   ARG A NH1   1 
ATOM   2310  N  NH2   . ARG G  4  18   ? 93.755  99.389  -42.661 1.00 72.40  ? 18   ARG A NH2   1 
ATOM   2311  N  N     . GLU G  4  19   ? 86.743  95.174  -43.153 1.00 59.03  ? 19   GLU A N     1 
ATOM   2312  C  CA    . GLU G  4  19   ? 85.614  94.584  -42.431 1.00 58.63  ? 19   GLU A CA    1 
ATOM   2313  C  C     . GLU G  4  19   ? 85.595  93.070  -42.564 1.00 57.53  ? 19   GLU A C     1 
ATOM   2314  O  O     . GLU G  4  19   ? 85.585  92.363  -41.573 1.00 57.80  ? 19   GLU A O     1 
ATOM   2315  C  CB    . GLU G  4  19   ? 84.277  95.159  -42.966 1.00 58.49  ? 19   GLU A CB    1 
ATOM   2316  C  CG    . GLU G  4  19   ? 83.921  96.602  -42.514 1.00 57.20  ? 19   GLU A CG    1 
ATOM   2317  C  CD    . GLU G  4  19   ? 83.576  97.552  -43.668 1.00 56.41  ? 19   GLU A CD    1 
ATOM   2318  O  OE1   . GLU G  4  19   ? 84.507  98.093  -44.313 1.00 54.17  ? 19   GLU A OE1   1 
ATOM   2319  O  OE2   . GLU G  4  19   ? 82.370  97.755  -43.925 1.00 56.75  ? 19   GLU A OE2   1 
ATOM   2320  N  N     . TYR G  4  20   ? 85.587  92.560  -43.785 1.00 58.13  ? 20   TYR A N     1 
ATOM   2321  C  CA    . TYR G  4  20   ? 85.539  91.116  -43.941 1.00 59.10  ? 20   TYR A CA    1 
ATOM   2322  C  C     . TYR G  4  20   ? 86.881  90.560  -44.396 1.00 61.04  ? 20   TYR A C     1 
ATOM   2323  O  O     . TYR G  4  20   ? 87.651  91.232  -45.086 1.00 62.01  ? 20   TYR A O     1 
ATOM   2324  C  CB    . TYR G  4  20   ? 84.455  90.727  -44.947 1.00 58.25  ? 20   TYR A CB    1 
ATOM   2325  C  CG    . TYR G  4  20   ? 83.954  89.296  -44.822 1.00 57.28  ? 20   TYR A CG    1 
ATOM   2326  C  CD1   . TYR G  4  20   ? 83.082  88.761  -45.794 1.00 57.26  ? 20   TYR A CD1   1 
ATOM   2327  C  CD2   . TYR G  4  20   ? 84.349  88.458  -43.747 1.00 56.76  ? 20   TYR A CD2   1 
ATOM   2328  C  CE1   . TYR G  4  20   ? 82.611  87.419  -45.703 1.00 56.45  ? 20   TYR A CE1   1 
ATOM   2329  C  CE2   . TYR G  4  20   ? 83.894  87.120  -43.650 1.00 55.86  ? 20   TYR A CE2   1 
ATOM   2330  C  CZ    . TYR G  4  20   ? 83.026  86.616  -44.631 1.00 55.74  ? 20   TYR A CZ    1 
ATOM   2331  O  OH    . TYR G  4  20   ? 82.575  85.330  -44.547 1.00 55.33  ? 20   TYR A OH    1 
ATOM   2332  N  N     . GLY G  4  21   ? 87.148  89.321  -43.993 1.00 60.65  ? 21   GLY A N     1 
ATOM   2333  C  CA    . GLY G  4  21   ? 88.380  88.659  -44.351 1.00 60.71  ? 21   GLY A CA    1 
ATOM   2334  C  C     . GLY G  4  21   ? 88.332  87.180  -44.034 1.00 61.05  ? 21   GLY A C     1 
ATOM   2335  O  O     . GLY G  4  21   ? 88.377  86.786  -42.867 1.00 61.13  ? 21   GLY A O     1 
ATOM   2336  N  N     . GLU G  4  22   ? 88.221  86.362  -45.076 1.00 60.28  ? 22   GLU A N     1 
ATOM   2337  C  CA    . GLU G  4  22   ? 88.215  84.913  -44.910 1.00 59.27  ? 22   GLU A CA    1 
ATOM   2338  C  C     . GLU G  4  22   ? 89.641  84.387  -44.824 1.00 58.66  ? 22   GLU A C     1 
ATOM   2339  O  O     . GLU G  4  22   ? 90.539  84.922  -45.473 1.00 58.29  ? 22   GLU A O     1 
ATOM   2340  C  CB    . GLU G  4  22   ? 87.507  84.252  -46.089 1.00 58.78  ? 22   GLU A CB    1 
ATOM   2341  C  CG    . GLU G  4  22   ? 86.045  83.892  -45.860 1.00 58.32  ? 22   GLU A CG    1 
ATOM   2342  C  CD    . GLU G  4  22   ? 85.194  84.114  -47.114 1.00 59.54  ? 22   GLU A CD    1 
ATOM   2343  O  OE1   . GLU G  4  22   ? 85.658  83.798  -48.236 1.00 58.97  ? 22   GLU A OE1   1 
ATOM   2344  O  OE2   . GLU G  4  22   ? 84.050  84.605  -46.981 1.00 60.17  ? 22   GLU A OE2   1 
ATOM   2345  N  N     . PHE G  4  23   ? 89.859  83.347  -44.028 1.00 59.12  ? 23   PHE A N     1 
ATOM   2346  C  CA    . PHE G  4  23   ? 91.203  82.795  -43.881 1.00 59.01  ? 23   PHE A CA    1 
ATOM   2347  C  C     . PHE G  4  23   ? 91.176  81.261  -43.930 1.00 58.64  ? 23   PHE A C     1 
ATOM   2348  O  O     . PHE G  4  23   ? 90.699  80.613  -42.997 1.00 58.28  ? 23   PHE A O     1 
ATOM   2349  C  CB    . PHE G  4  23   ? 91.822  83.268  -42.546 1.00 59.37  ? 23   PHE A CB    1 
ATOM   2350  C  CG    . PHE G  4  23   ? 91.731  84.763  -42.304 1.00 58.22  ? 23   PHE A CG    1 
ATOM   2351  C  CD1   . PHE G  4  23   ? 92.509  85.665  -43.052 1.00 58.72  ? 23   PHE A CD1   1 
ATOM   2352  C  CD2   . PHE G  4  23   ? 90.852  85.274  -41.320 1.00 58.06  ? 23   PHE A CD2   1 
ATOM   2353  C  CE1   . PHE G  4  23   ? 92.415  87.075  -42.825 1.00 59.76  ? 23   PHE A CE1   1 
ATOM   2354  C  CE2   . PHE G  4  23   ? 90.743  86.675  -41.078 1.00 57.39  ? 23   PHE A CE2   1 
ATOM   2355  C  CZ    . PHE G  4  23   ? 91.527  87.577  -41.832 1.00 58.83  ? 23   PHE A CZ    1 
ATOM   2356  N  N     . VAL G  4  24   ? 91.691  80.698  -45.026 1.00 59.18  ? 24   VAL A N     1 
ATOM   2357  C  CA    . VAL G  4  24   ? 91.732  79.251  -45.243 1.00 59.80  ? 24   VAL A CA    1 
ATOM   2358  C  C     . VAL G  4  24   ? 93.130  78.687  -44.978 1.00 60.73  ? 24   VAL A C     1 
ATOM   2359  O  O     . VAL G  4  24   ? 94.149  79.298  -45.334 1.00 61.20  ? 24   VAL A O     1 
ATOM   2360  C  CB    . VAL G  4  24   ? 91.317  78.889  -46.709 1.00 59.47  ? 24   VAL A CB    1 
ATOM   2361  C  CG1   . VAL G  4  24   ? 91.371  77.373  -46.925 1.00 58.68  ? 24   VAL A CG1   1 
ATOM   2362  C  CG2   . VAL G  4  24   ? 89.918  79.402  -46.990 1.00 60.74  ? 24   VAL A CG2   1 
ATOM   2363  N  N     . LEU G  4  25   ? 93.166  77.514  -44.351 1.00 61.55  ? 25   LEU A N     1 
ATOM   2364  C  CA    . LEU G  4  25   ? 94.419  76.867  -44.022 1.00 61.83  ? 25   LEU A CA    1 
ATOM   2365  C  C     . LEU G  4  25   ? 94.281  75.364  -44.016 1.00 61.66  ? 25   LEU A C     1 
ATOM   2366  O  O     . LEU G  4  25   ? 93.600  74.789  -43.168 1.00 60.65  ? 25   LEU A O     1 
ATOM   2367  C  CB    . LEU G  4  25   ? 94.897  77.315  -42.656 1.00 62.10  ? 25   LEU A CB    1 
ATOM   2368  C  CG    . LEU G  4  25   ? 96.263  76.733  -42.356 1.00 62.37  ? 25   LEU A CG    1 
ATOM   2369  C  CD1   . LEU G  4  25   ? 97.262  77.863  -42.517 1.00 62.65  ? 25   LEU A CD1   1 
ATOM   2370  C  CD2   . LEU G  4  25   ? 96.312  76.116  -40.965 1.00 61.47  ? 25   LEU A CD2   1 
ATOM   2371  N  N     . GLU G  4  26   ? 94.946  74.746  -44.974 1.00 62.87  ? 26   GLU A N     1 
ATOM   2372  C  CA    . GLU G  4  26   ? 94.939  73.306  -45.109 1.00 64.94  ? 26   GLU A CA    1 
ATOM   2373  C  C     . GLU G  4  26   ? 96.249  72.812  -45.755 1.00 66.00  ? 26   GLU A C     1 
ATOM   2374  O  O     . GLU G  4  26   ? 96.963  73.582  -46.402 1.00 65.37  ? 26   GLU A O     1 
ATOM   2375  C  CB    . GLU G  4  26   ? 93.699  72.877  -45.940 1.00 66.06  ? 26   GLU A CB    1 
ATOM   2376  C  CG    . GLU G  4  26   ? 93.959  72.043  -47.240 1.00 66.24  ? 26   GLU A CG    1 
ATOM   2377  C  CD    . GLU G  4  26   ? 94.393  72.887  -48.439 1.00 66.18  ? 26   GLU A CD    1 
ATOM   2378  O  OE1   . GLU G  4  26   ? 95.011  72.326  -49.376 1.00 65.24  ? 26   GLU A OE1   1 
ATOM   2379  O  OE2   . GLU G  4  26   ? 94.113  74.110  -48.448 1.00 66.52  ? 26   GLU A OE2   1 
ATOM   2380  N  N     . PRO G  4  27   ? 96.584  71.522  -45.579 1.00 66.77  ? 27   PRO A N     1 
ATOM   2381  C  CA    . PRO G  4  27   ? 95.850  70.486  -44.827 1.00 67.55  ? 27   PRO A CA    1 
ATOM   2382  C  C     . PRO G  4  27   ? 96.208  70.492  -43.332 1.00 66.97  ? 27   PRO A C     1 
ATOM   2383  O  O     . PRO G  4  27   ? 97.227  71.067  -42.928 1.00 67.15  ? 27   PRO A O     1 
ATOM   2384  C  CB    . PRO G  4  27   ? 96.244  69.192  -45.529 1.00 67.25  ? 27   PRO A CB    1 
ATOM   2385  C  CG    . PRO G  4  27   ? 96.739  69.682  -46.903 1.00 67.12  ? 27   PRO A CG    1 
ATOM   2386  C  CD    . PRO G  4  27   ? 97.505  70.899  -46.537 1.00 66.69  ? 27   PRO A CD    1 
ATOM   2387  N  N     . LEU G  4  28   ? 95.343  69.856  -42.539 1.00 66.05  ? 28   LEU A N     1 
ATOM   2388  C  CA    . LEU G  4  28   ? 95.489  69.713  -41.091 1.00 64.55  ? 28   LEU A CA    1 
ATOM   2389  C  C     . LEU G  4  28   ? 95.265  68.252  -40.703 1.00 64.86  ? 28   LEU A C     1 
ATOM   2390  O  O     . LEU G  4  28   ? 94.509  67.567  -41.392 1.00 65.85  ? 28   LEU A O     1 
ATOM   2391  C  CB    . LEU G  4  28   ? 94.466  70.614  -40.374 1.00 63.50  ? 28   LEU A CB    1 
ATOM   2392  C  CG    . LEU G  4  28   ? 94.199  72.041  -40.904 1.00 62.52  ? 28   LEU A CG    1 
ATOM   2393  C  CD1   . LEU G  4  28   ? 92.827  72.481  -40.486 1.00 60.82  ? 28   LEU A CD1   1 
ATOM   2394  C  CD2   . LEU G  4  28   ? 95.240  73.008  -40.372 1.00 62.93  ? 28   LEU A CD2   1 
ATOM   2395  N  N     . GLU G  4  29   ? 95.891  67.751  -39.636 1.00 64.36  ? 29   GLU A N     1 
ATOM   2396  C  CA    . GLU G  4  29   ? 95.710  66.333  -39.296 1.00 63.07  ? 29   GLU A CA    1 
ATOM   2397  C  C     . GLU G  4  29   ? 94.280  66.032  -38.858 1.00 61.49  ? 29   GLU A C     1 
ATOM   2398  O  O     . GLU G  4  29   ? 93.339  66.504  -39.471 1.00 61.98  ? 29   GLU A O     1 
ATOM   2399  C  CB    . GLU G  4  29   ? 96.706  65.890  -38.207 1.00 63.38  ? 29   GLU A CB    1 
ATOM   2400  C  CG    . GLU G  4  29   ? 97.555  64.680  -38.617 1.00 62.87  ? 29   GLU A CG    1 
ATOM   2401  C  CD    . GLU G  4  29   ? 96.734  63.581  -39.284 1.00 61.85  ? 29   GLU A CD    1 
ATOM   2402  O  OE1   . GLU G  4  29   ? 95.889  62.978  -38.592 1.00 61.15  ? 29   GLU A OE1   1 
ATOM   2403  O  OE2   . GLU G  4  29   ? 96.932  63.328  -40.499 1.00 61.33  ? 29   GLU A OE2   1 
ATOM   2404  N  N     . ARG G  4  30   ? 94.098  65.250  -37.807 1.00 60.50  ? 30   ARG A N     1 
ATOM   2405  C  CA    . ARG G  4  30   ? 92.745  64.888  -37.390 1.00 59.55  ? 30   ARG A CA    1 
ATOM   2406  C  C     . ARG G  4  30   ? 92.209  65.823  -36.319 1.00 58.99  ? 30   ARG A C     1 
ATOM   2407  O  O     . ARG G  4  30   ? 92.812  65.981  -35.261 1.00 58.28  ? 30   ARG A O     1 
ATOM   2408  C  CB    . ARG G  4  30   ? 92.720  63.446  -36.864 1.00 58.99  ? 30   ARG A CB    1 
ATOM   2409  C  CG    . ARG G  4  30   ? 91.369  62.999  -36.329 1.00 57.35  ? 30   ARG A CG    1 
ATOM   2410  C  CD    . ARG G  4  30   ? 90.917  61.739  -37.019 1.00 58.12  ? 30   ARG A CD    1 
ATOM   2411  N  NE    . ARG G  4  30   ? 89.466  61.606  -37.001 1.00 58.29  ? 30   ARG A NE    1 
ATOM   2412  C  CZ    . ARG G  4  30   ? 88.620  62.461  -37.570 1.00 59.38  ? 30   ARG A CZ    1 
ATOM   2413  N  NH1   . ARG G  4  30   ? 89.064  63.535  -38.220 1.00 59.30  ? 30   ARG A NH1   1 
ATOM   2414  N  NH2   . ARG G  4  30   ? 87.313  62.239  -37.486 1.00 60.40  ? 30   ARG A NH2   1 
ATOM   2415  N  N     . GLY G  4  31   ? 91.058  66.426  -36.617 1.00 59.08  ? 31   GLY A N     1 
ATOM   2416  C  CA    . GLY G  4  31   ? 90.376  67.326  -35.695 1.00 57.92  ? 31   GLY A CA    1 
ATOM   2417  C  C     . GLY G  4  31   ? 91.223  68.482  -35.201 1.00 56.73  ? 31   GLY A C     1 
ATOM   2418  O  O     . GLY G  4  31   ? 91.187  68.792  -34.013 1.00 56.71  ? 31   GLY A O     1 
ATOM   2419  N  N     . PHE G  4  32   ? 91.971  69.128  -36.091 1.00 55.29  ? 32   PHE A N     1 
ATOM   2420  C  CA    . PHE G  4  32   ? 92.814  70.229  -35.676 1.00 53.53  ? 32   PHE A CA    1 
ATOM   2421  C  C     . PHE G  4  32   ? 92.237  71.559  -36.064 1.00 53.33  ? 32   PHE A C     1 
ATOM   2422  O  O     . PHE G  4  32   ? 92.487  72.558  -35.394 1.00 52.80  ? 32   PHE A O     1 
ATOM   2423  C  CB    . PHE G  4  32   ? 94.203  70.032  -36.252 1.00 53.60  ? 32   PHE A CB    1 
ATOM   2424  C  CG    . PHE G  4  32   ? 95.035  69.119  -35.417 1.00 54.71  ? 32   PHE A CG    1 
ATOM   2425  C  CD1   . PHE G  4  32   ? 95.923  68.211  -36.011 1.00 56.19  ? 32   PHE A CD1   1 
ATOM   2426  C  CD2   . PHE G  4  32   ? 94.924  69.145  -34.001 1.00 54.37  ? 32   PHE A CD2   1 
ATOM   2427  C  CE1   . PHE G  4  32   ? 96.712  67.315  -35.200 1.00 55.83  ? 32   PHE A CE1   1 
ATOM   2428  C  CE2   . PHE G  4  32   ? 95.689  68.273  -33.180 1.00 54.30  ? 32   PHE A CE2   1 
ATOM   2429  C  CZ    . PHE G  4  32   ? 96.588  67.352  -33.784 1.00 55.53  ? 32   PHE A CZ    1 
ATOM   2430  N  N     . GLY G  4  33   ? 91.466  71.584  -37.144 1.00 54.41  ? 33   GLY A N     1 
ATOM   2431  C  CA    . GLY G  4  33   ? 90.828  72.823  -37.548 1.00 53.09  ? 33   GLY A CA    1 
ATOM   2432  C  C     . GLY G  4  33   ? 89.979  73.340  -36.409 1.00 51.82  ? 33   GLY A C     1 
ATOM   2433  O  O     . GLY G  4  33   ? 89.935  74.532  -36.143 1.00 50.16  ? 33   GLY A O     1 
ATOM   2434  N  N     . VAL G  4  34   ? 89.306  72.414  -35.729 1.00 51.53  ? 34   VAL A N     1 
ATOM   2435  C  CA    . VAL G  4  34   ? 88.478  72.749  -34.576 1.00 51.67  ? 34   VAL A CA    1 
ATOM   2436  C  C     . VAL G  4  34   ? 89.345  73.188  -33.391 1.00 52.17  ? 34   VAL A C     1 
ATOM   2437  O  O     . VAL G  4  34   ? 89.017  74.148  -32.687 1.00 52.02  ? 34   VAL A O     1 
ATOM   2438  C  CB    . VAL G  4  34   ? 87.601  71.535  -34.144 1.00 51.20  ? 34   VAL A CB    1 
ATOM   2439  C  CG1   . VAL G  4  34   ? 87.134  71.684  -32.694 1.00 51.22  ? 34   VAL A CG1   1 
ATOM   2440  C  CG2   . VAL G  4  34   ? 86.385  71.477  -35.015 1.00 51.73  ? 34   VAL A CG2   1 
ATOM   2441  N  N     . THR G  4  35   ? 90.449  72.477  -33.175 1.00 51.71  ? 35   THR A N     1 
ATOM   2442  C  CA    . THR G  4  35   ? 91.358  72.785  -32.078 1.00 52.08  ? 35   THR A CA    1 
ATOM   2443  C  C     . THR G  4  35   ? 91.971  74.171  -32.236 1.00 52.87  ? 35   THR A C     1 
ATOM   2444  O  O     . THR G  4  35   ? 92.292  74.811  -31.235 1.00 52.88  ? 35   THR A O     1 
ATOM   2445  C  CB    . THR G  4  35   ? 92.497  71.693  -31.965 1.00 51.54  ? 35   THR A CB    1 
ATOM   2446  O  OG1   . THR G  4  35   ? 92.048  70.670  -31.074 1.00 50.68  ? 35   THR A OG1   1 
ATOM   2447  C  CG2   . THR G  4  35   ? 93.811  72.255  -31.379 1.00 50.04  ? 35   THR A CG2   1 
ATOM   2448  N  N     . LEU G  4  36   ? 92.131  74.640  -33.472 1.00 53.11  ? 36   LEU A N     1 
ATOM   2449  C  CA    . LEU G  4  36   ? 92.723  75.955  -33.685 1.00 52.89  ? 36   LEU A CA    1 
ATOM   2450  C  C     . LEU G  4  36   ? 91.662  77.019  -33.836 1.00 53.26  ? 36   LEU A C     1 
ATOM   2451  O  O     . LEU G  4  36   ? 91.782  78.089  -33.258 1.00 54.25  ? 36   LEU A O     1 
ATOM   2452  C  CB    . LEU G  4  36   ? 93.620  75.944  -34.926 1.00 52.56  ? 36   LEU A CB    1 
ATOM   2453  C  CG    . LEU G  4  36   ? 94.987  75.271  -34.728 1.00 52.64  ? 36   LEU A CG    1 
ATOM   2454  C  CD1   . LEU G  4  36   ? 95.746  75.245  -36.024 1.00 53.67  ? 36   LEU A CD1   1 
ATOM   2455  C  CD2   . LEU G  4  36   ? 95.793  76.039  -33.720 1.00 52.53  ? 36   LEU A CD2   1 
ATOM   2456  N  N     . GLY G  4  37   ? 90.623  76.714  -34.605 1.00 53.65  ? 37   GLY A N     1 
ATOM   2457  C  CA    . GLY G  4  37   ? 89.543  77.660  -34.857 1.00 53.82  ? 37   GLY A CA    1 
ATOM   2458  C  C     . GLY G  4  37   ? 88.786  78.156  -33.632 1.00 53.67  ? 37   GLY A C     1 
ATOM   2459  O  O     . GLY G  4  37   ? 88.545  79.360  -33.528 1.00 53.91  ? 37   GLY A O     1 
ATOM   2460  N  N     . ASN G  4  38   ? 88.400  77.269  -32.713 1.00 52.83  ? 38   ASN A N     1 
ATOM   2461  C  CA    . ASN G  4  38   ? 87.649  77.707  -31.534 1.00 51.85  ? 38   ASN A CA    1 
ATOM   2462  C  C     . ASN G  4  38   ? 88.464  78.670  -30.648 1.00 52.39  ? 38   ASN A C     1 
ATOM   2463  O  O     . ASN G  4  38   ? 87.962  79.739  -30.287 1.00 52.86  ? 38   ASN A O     1 
ATOM   2464  C  CB    . ASN G  4  38   ? 87.209  76.518  -30.682 1.00 51.66  ? 38   ASN A CB    1 
ATOM   2465  C  CG    . ASN G  4  38   ? 86.338  76.948  -29.509 1.00 51.16  ? 38   ASN A CG    1 
ATOM   2466  O  OD1   . ASN G  4  38   ? 86.407  76.374  -28.426 1.00 51.29  ? 38   ASN A OD1   1 
ATOM   2467  N  ND2   . ASN G  4  38   ? 85.511  77.968  -29.728 1.00 50.12  ? 38   ASN A ND2   1 
ATOM   2468  N  N     . PRO G  4  39   ? 89.716  78.317  -30.275 1.00 51.80  ? 39   PRO A N     1 
ATOM   2469  C  CA    . PRO G  4  39   ? 90.512  79.220  -29.428 1.00 50.91  ? 39   PRO A CA    1 
ATOM   2470  C  C     . PRO G  4  39   ? 90.645  80.601  -30.035 1.00 49.58  ? 39   PRO A C     1 
ATOM   2471  O  O     . PRO G  4  39   ? 90.330  81.611  -29.402 1.00 49.30  ? 39   PRO A O     1 
ATOM   2472  C  CB    . PRO G  4  39   ? 91.856  78.514  -29.305 1.00 50.95  ? 39   PRO A CB    1 
ATOM   2473  C  CG    . PRO G  4  39   ? 91.501  77.103  -29.450 1.00 51.49  ? 39   PRO A CG    1 
ATOM   2474  C  CD    . PRO G  4  39   ? 90.465  77.076  -30.538 1.00 51.53  ? 39   PRO A CD    1 
ATOM   2475  N  N     . LEU G  4  40   ? 91.129  80.632  -31.268 1.00 49.77  ? 40   LEU A N     1 
ATOM   2476  C  CA    . LEU G  4  40   ? 91.297  81.881  -31.956 1.00 48.99  ? 40   LEU A CA    1 
ATOM   2477  C  C     . LEU G  4  40   ? 90.002  82.676  -31.942 1.00 50.89  ? 40   LEU A C     1 
ATOM   2478  O  O     . LEU G  4  40   ? 90.022  83.890  -31.786 1.00 50.54  ? 40   LEU A O     1 
ATOM   2479  C  CB    . LEU G  4  40   ? 91.801  81.581  -33.371 1.00 46.35  ? 40   LEU A CB    1 
ATOM   2480  C  CG    . LEU G  4  40   ? 93.126  80.798  -33.227 1.00 44.33  ? 40   LEU A CG    1 
ATOM   2481  C  CD1   . LEU G  4  40   ? 93.701  80.451  -34.598 1.00 44.25  ? 40   LEU A CD1   1 
ATOM   2482  C  CD2   . LEU G  4  40   ? 94.120  81.622  -32.442 1.00 43.61  ? 40   LEU A CD2   1 
ATOM   2483  N  N     . ARG G  4  41   ? 88.870  81.987  -32.074 1.00 52.70  ? 41   ARG A N     1 
ATOM   2484  C  CA    . ARG G  4  41   ? 87.574  82.659  -32.035 1.00 54.70  ? 41   ARG A CA    1 
ATOM   2485  C  C     . ARG G  4  41   ? 87.342  83.307  -30.664 1.00 55.49  ? 41   ARG A C     1 
ATOM   2486  O  O     . ARG G  4  41   ? 86.988  84.485  -30.577 1.00 55.17  ? 41   ARG A O     1 
ATOM   2487  C  CB    . ARG G  4  41   ? 86.449  81.657  -32.338 1.00 55.17  ? 41   ARG A CB    1 
ATOM   2488  C  CG    . ARG G  4  41   ? 85.068  82.276  -32.369 1.00 56.00  ? 41   ARG A CG    1 
ATOM   2489  C  CD    . ARG G  4  41   ? 84.247  81.841  -31.162 1.00 56.40  ? 41   ARG A CD    1 
ATOM   2490  N  NE    . ARG G  4  41   ? 82.928  82.472  -31.110 1.00 57.14  ? 41   ARG A NE    1 
ATOM   2491  C  CZ    . ARG G  4  41   ? 82.007  82.391  -32.070 1.00 59.20  ? 41   ARG A CZ    1 
ATOM   2492  N  NH1   . ARG G  4  41   ? 82.250  81.706  -33.186 1.00 60.55  ? 41   ARG A NH1   1 
ATOM   2493  N  NH2   . ARG G  4  41   ? 80.827  82.983  -31.919 1.00 59.70  ? 41   ARG A NH2   1 
ATOM   2494  N  N     . ARG G  4  42   ? 87.553  82.537  -29.598 1.00 56.80  ? 42   ARG A N     1 
ATOM   2495  C  CA    . ARG G  4  42   ? 87.376  83.040  -28.232 1.00 58.26  ? 42   ARG A CA    1 
ATOM   2496  C  C     . ARG G  4  42   ? 88.300  84.232  -27.960 1.00 58.48  ? 42   ARG A C     1 
ATOM   2497  O  O     . ARG G  4  42   ? 87.987  85.093  -27.145 1.00 57.69  ? 42   ARG A O     1 
ATOM   2498  C  CB    . ARG G  4  42   ? 87.646  81.916  -27.205 1.00 59.04  ? 42   ARG A CB    1 
ATOM   2499  C  CG    . ARG G  4  42   ? 86.474  80.925  -27.017 1.00 59.39  ? 42   ARG A CG    1 
ATOM   2500  C  CD    . ARG G  4  42   ? 86.646  79.928  -25.835 1.00 60.66  ? 42   ARG A CD    1 
ATOM   2501  N  NE    . ARG G  4  42   ? 86.590  80.527  -24.487 1.00 61.32  ? 42   ARG A NE    1 
ATOM   2502  C  CZ    . ARG G  4  42   ? 85.931  80.007  -23.441 1.00 60.75  ? 42   ARG A CZ    1 
ATOM   2503  N  NH1   . ARG G  4  42   ? 85.248  78.877  -23.559 1.00 59.87  ? 42   ARG A NH1   1 
ATOM   2504  N  NH2   . ARG G  4  42   ? 85.960  80.607  -22.259 1.00 60.78  ? 42   ARG A NH2   1 
ATOM   2505  N  N     . ILE G  4  43   ? 89.436  84.273  -28.648 1.00 59.13  ? 43   ILE A N     1 
ATOM   2506  C  CA    . ILE G  4  43   ? 90.396  85.363  -28.505 1.00 59.93  ? 43   ILE A CA    1 
ATOM   2507  C  C     . ILE G  4  43   ? 89.920  86.606  -29.265 1.00 61.39  ? 43   ILE A C     1 
ATOM   2508  O  O     . ILE G  4  43   ? 89.818  87.710  -28.728 1.00 60.94  ? 43   ILE A O     1 
ATOM   2509  C  CB    . ILE G  4  43   ? 91.793  84.945  -29.075 1.00 59.57  ? 43   ILE A CB    1 
ATOM   2510  C  CG1   . ILE G  4  43   ? 92.355  83.763  -28.277 1.00 58.42  ? 43   ILE A CG1   1 
ATOM   2511  C  CG2   . ILE G  4  43   ? 92.728  86.160  -29.106 1.00 59.77  ? 43   ILE A CG2   1 
ATOM   2512  C  CD1   . ILE G  4  43   ? 93.012  84.122  -26.950 1.00 58.14  ? 43   ILE A CD1   1 
ATOM   2513  N  N     . LEU G  4  44   ? 89.633  86.386  -30.538 1.00 63.38  ? 44   LEU A N     1 
ATOM   2514  C  CA    . LEU G  4  44   ? 89.201  87.425  -31.460 1.00 64.94  ? 44   LEU A CA    1 
ATOM   2515  C  C     . LEU G  4  44   ? 88.047  88.264  -30.893 1.00 65.26  ? 44   LEU A C     1 
ATOM   2516  O  O     . LEU G  4  44   ? 87.913  89.444  -31.238 1.00 65.24  ? 44   LEU A O     1 
ATOM   2517  C  CB    . LEU G  4  44   ? 88.770  86.780  -32.790 1.00 66.04  ? 44   LEU A CB    1 
ATOM   2518  C  CG    . LEU G  4  44   ? 89.823  86.262  -33.778 1.00 67.10  ? 44   LEU A CG    1 
ATOM   2519  C  CD1   . LEU G  4  44   ? 89.135  85.301  -34.732 1.00 67.45  ? 44   LEU A CD1   1 
ATOM   2520  C  CD2   . LEU G  4  44   ? 90.481  87.415  -34.534 1.00 67.88  ? 44   LEU A CD2   1 
ATOM   2521  N  N     . LEU G  4  45   ? 87.218  87.681  -30.029 1.00 64.63  ? 45   LEU A N     1 
ATOM   2522  C  CA    . LEU G  4  45   ? 86.074  88.428  -29.510 1.00 64.29  ? 45   LEU A CA    1 
ATOM   2523  C  C     . LEU G  4  45   ? 86.397  89.159  -28.211 1.00 64.54  ? 45   LEU A C     1 
ATOM   2524  O  O     . LEU G  4  45   ? 85.979  90.305  -28.018 1.00 64.96  ? 45   LEU A O     1 
ATOM   2525  C  CB    . LEU G  4  45   ? 84.882  87.489  -29.271 1.00 63.15  ? 45   LEU A CB    1 
ATOM   2526  C  CG    . LEU G  4  45   ? 83.999  87.119  -30.466 1.00 62.31  ? 45   LEU A CG    1 
ATOM   2527  C  CD1   . LEU G  4  45   ? 84.686  86.068  -31.281 1.00 62.18  ? 45   LEU A CD1   1 
ATOM   2528  C  CD2   . LEU G  4  45   ? 82.663  86.590  -29.991 1.00 61.61  ? 45   LEU A CD2   1 
ATOM   2529  N  N     . SER G  4  46   ? 87.147  88.513  -27.331 1.00 64.53  ? 46   SER A N     1 
ATOM   2530  C  CA    . SER G  4  46   ? 87.421  89.090  -26.022 1.00 63.92  ? 46   SER A CA    1 
ATOM   2531  C  C     . SER G  4  46   ? 88.690  89.922  -25.981 1.00 63.47  ? 46   SER A C     1 
ATOM   2532  O  O     . SER G  4  46   ? 88.656  91.079  -25.560 1.00 63.77  ? 46   SER A O     1 
ATOM   2533  C  CB    . SER G  4  46   ? 87.531  87.979  -24.971 1.00 63.92  ? 46   SER A CB    1 
ATOM   2534  O  OG    . SER G  4  46   ? 88.728  87.241  -25.100 1.00 62.82  ? 46   SER A OG    1 
ATOM   2535  N  N     . SER G  4  47   ? 89.788  89.325  -26.428 1.00 63.81  ? 47   SER A N     1 
ATOM   2536  C  CA    . SER G  4  47   ? 91.144  89.884  -26.320 1.00 64.71  ? 47   SER A CA    1 
ATOM   2537  C  C     . SER G  4  47   ? 91.392  91.148  -27.146 1.00 63.79  ? 47   SER A C     1 
ATOM   2538  O  O     . SER G  4  47   ? 91.840  92.163  -26.601 1.00 63.74  ? 47   SER A O     1 
ATOM   2539  C  CB    . SER G  4  47   ? 92.184  88.849  -26.745 1.00 65.83  ? 47   SER A CB    1 
ATOM   2540  O  OG    . SER G  4  47   ? 91.683  87.536  -26.643 1.00 69.02  ? 47   SER A OG    1 
ATOM   2541  N  N     . ILE G  4  48   ? 91.133  91.096  -28.441 1.00 62.20  ? 48   ILE A N     1 
ATOM   2542  C  CA    . ILE G  4  48   ? 91.469  92.213  -29.310 1.00 61.01  ? 48   ILE A CA    1 
ATOM   2543  C  C     . ILE G  4  48   ? 91.075  93.579  -28.724 1.00 59.61  ? 48   ILE A C     1 
ATOM   2544  O  O     . ILE G  4  48   ? 89.896  93.880  -28.561 1.00 59.48  ? 48   ILE A O     1 
ATOM   2545  C  CB    . ILE G  4  48   ? 90.826  92.009  -30.667 1.00 61.38  ? 48   ILE A CB    1 
ATOM   2546  C  CG1   . ILE G  4  48   ? 91.238  90.625  -31.185 1.00 61.85  ? 48   ILE A CG1   1 
ATOM   2547  C  CG2   . ILE G  4  48   ? 91.248  93.112  -31.611 1.00 62.30  ? 48   ILE A CG2   1 
ATOM   2548  C  CD1   . ILE G  4  48   ? 90.719  90.260  -32.548 1.00 62.57  ? 48   ILE A CD1   1 
ATOM   2549  N  N     . PRO G  4  49   ? 92.084  94.421  -28.401 1.00 59.04  ? 49   PRO A N     1 
ATOM   2550  C  CA    . PRO G  4  49   ? 91.835  95.756  -27.844 1.00 58.12  ? 49   PRO A CA    1 
ATOM   2551  C  C     . PRO G  4  49   ? 91.319  96.702  -28.923 1.00 57.17  ? 49   PRO A C     1 
ATOM   2552  O  O     . PRO G  4  49   ? 91.634  96.506  -30.094 1.00 56.60  ? 49   PRO A O     1 
ATOM   2553  C  CB    . PRO G  4  49   ? 93.194  96.165  -27.291 1.00 58.17  ? 49   PRO A CB    1 
ATOM   2554  C  CG    . PRO G  4  49   ? 94.123  95.608  -28.325 1.00 58.96  ? 49   PRO A CG    1 
ATOM   2555  C  CD    . PRO G  4  49   ? 93.544  94.207  -28.556 1.00 59.19  ? 49   PRO A CD    1 
ATOM   2556  N  N     . GLY G  4  50   ? 90.548  97.721  -28.554 1.00 55.78  ? 50   GLY A N     1 
ATOM   2557  C  CA    . GLY G  4  50   ? 90.044  98.621  -29.575 1.00 54.78  ? 50   GLY A CA    1 
ATOM   2558  C  C     . GLY G  4  50   ? 89.839  100.060 -29.142 1.00 54.77  ? 50   GLY A C     1 
ATOM   2559  O  O     . GLY G  4  50   ? 90.650  100.647 -28.415 1.00 53.85  ? 50   GLY A O     1 
ATOM   2560  N  N     . THR G  4  51   ? 88.721  100.619 -29.610 1.00 54.14  ? 51   THR A N     1 
ATOM   2561  C  CA    . THR G  4  51   ? 88.354  102.006 -29.350 1.00 52.66  ? 51   THR A CA    1 
ATOM   2562  C  C     . THR G  4  51   ? 86.839  102.159 -29.108 1.00 52.55  ? 51   THR A C     1 
ATOM   2563  O  O     . THR G  4  51   ? 86.041  101.402 -29.662 1.00 53.64  ? 51   THR A O     1 
ATOM   2564  C  CB    . THR G  4  51   ? 88.738  102.861 -30.548 1.00 52.08  ? 51   THR A CB    1 
ATOM   2565  O  OG1   . THR G  4  51   ? 88.112  102.323 -31.710 1.00 51.71  ? 51   THR A OG1   1 
ATOM   2566  C  CG2   . THR G  4  51   ? 90.227  102.845 -30.774 1.00 51.14  ? 51   THR A CG2   1 
ATOM   2567  N  N     . ALA G  4  52   ? 86.461  103.143 -28.283 1.00 52.96  ? 52   ALA A N     1 
ATOM   2568  C  CA    . ALA G  4  52   ? 85.057  103.439 -27.969 1.00 52.80  ? 52   ALA A CA    1 
ATOM   2569  C  C     . ALA G  4  52   ? 84.912  104.806 -27.299 1.00 53.40  ? 52   ALA A C     1 
ATOM   2570  O  O     . ALA G  4  52   ? 85.827  105.270 -26.620 1.00 53.60  ? 52   ALA A O     1 
ATOM   2571  C  CB    . ALA G  4  52   ? 84.498  102.376 -27.058 1.00 51.68  ? 52   ALA A CB    1 
ATOM   2572  N  N     . VAL G  4  53   ? 83.765  105.452 -27.490 1.00 54.28  ? 53   VAL A N     1 
ATOM   2573  C  CA    . VAL G  4  53   ? 83.538  106.748 -26.860 1.00 55.56  ? 53   VAL A CA    1 
ATOM   2574  C  C     . VAL G  4  53   ? 83.505  106.594 -25.358 1.00 57.40  ? 53   VAL A C     1 
ATOM   2575  O  O     . VAL G  4  53   ? 82.654  105.890 -24.826 1.00 57.58  ? 53   VAL A O     1 
ATOM   2576  C  CB    . VAL G  4  53   ? 82.207  107.379 -27.299 1.00 55.48  ? 53   VAL A CB    1 
ATOM   2577  C  CG1   . VAL G  4  53   ? 82.104  108.811 -26.740 1.00 53.91  ? 53   VAL A CG1   1 
ATOM   2578  C  CG2   . VAL G  4  53   ? 82.121  107.380 -28.789 1.00 55.74  ? 53   VAL A CG2   1 
ATOM   2579  N  N     . THR G  4  54   ? 84.430  107.262 -24.679 1.00 59.85  ? 54   THR A N     1 
ATOM   2580  C  CA    . THR G  4  54   ? 84.564  107.143 -23.226 1.00 61.77  ? 54   THR A CA    1 
ATOM   2581  C  C     . THR G  4  54   ? 83.841  108.280 -22.463 1.00 62.10  ? 54   THR A C     1 
ATOM   2582  O  O     . THR G  4  54   ? 83.456  108.093 -21.307 1.00 61.53  ? 54   THR A O     1 
ATOM   2583  C  CB    . THR G  4  54   ? 86.074  107.094 -22.852 1.00 62.88  ? 54   THR A CB    1 
ATOM   2584  O  OG1   . THR G  4  54   ? 86.715  106.020 -23.574 1.00 62.01  ? 54   THR A OG1   1 
ATOM   2585  C  CG2   . THR G  4  54   ? 86.250  106.840 -21.357 1.00 62.49  ? 54   THR A CG2   1 
ATOM   2586  N  N     . SER G  4  55   ? 83.649  109.441 -23.080 1.00 62.96  ? 55   SER A N     1 
ATOM   2587  C  CA    . SER G  4  55   ? 82.938  110.536 -22.409 1.00 64.16  ? 55   SER A CA    1 
ATOM   2588  C  C     . SER G  4  55   ? 82.460  111.573 -23.421 1.00 65.10  ? 55   SER A C     1 
ATOM   2589  O  O     . SER G  4  55   ? 82.950  111.614 -24.552 1.00 65.72  ? 55   SER A O     1 
ATOM   2590  C  CB    . SER G  4  55   ? 83.857  111.206 -21.369 1.00 63.92  ? 55   SER A CB    1 
ATOM   2591  O  OG    . SER G  4  55   ? 83.203  112.249 -20.656 1.00 62.77  ? 55   SER A OG    1 
ATOM   2592  N  N     . VAL G  4  56   ? 81.497  112.403 -23.032 1.00 65.62  ? 56   VAL A N     1 
ATOM   2593  C  CA    . VAL G  4  56   ? 80.978  113.440 -23.931 1.00 65.77  ? 56   VAL A CA    1 
ATOM   2594  C  C     . VAL G  4  56   ? 80.607  114.701 -23.162 1.00 65.94  ? 56   VAL A C     1 
ATOM   2595  O  O     . VAL G  4  56   ? 80.239  114.641 -21.982 1.00 65.91  ? 56   VAL A O     1 
ATOM   2596  C  CB    . VAL G  4  56   ? 79.709  112.973 -24.683 1.00 65.51  ? 56   VAL A CB    1 
ATOM   2597  C  CG1   . VAL G  4  56   ? 79.271  114.033 -25.693 1.00 64.48  ? 56   VAL A CG1   1 
ATOM   2598  C  CG2   . VAL G  4  56   ? 79.987  111.673 -25.394 1.00 65.15  ? 56   VAL A CG2   1 
ATOM   2599  N  N     . TYR G  4  57   ? 80.707  115.846 -23.828 1.00 65.62  ? 57   TYR A N     1 
ATOM   2600  C  CA    . TYR G  4  57   ? 80.337  117.069 -23.160 1.00 64.59  ? 57   TYR A CA    1 
ATOM   2601  C  C     . TYR G  4  57   ? 79.613  118.014 -24.070 1.00 63.90  ? 57   TYR A C     1 
ATOM   2602  O  O     . TYR G  4  57   ? 80.217  118.630 -24.947 1.00 64.02  ? 57   TYR A O     1 
ATOM   2603  C  CB    . TYR G  4  57   ? 81.532  117.837 -22.592 1.00 65.76  ? 57   TYR A CB    1 
ATOM   2604  C  CG    . TYR G  4  57   ? 81.067  119.113 -21.878 1.00 66.77  ? 57   TYR A CG    1 
ATOM   2605  C  CD1   . TYR G  4  57   ? 80.017  119.078 -20.925 1.00 66.58  ? 57   TYR A CD1   1 
ATOM   2606  C  CD2   . TYR G  4  57   ? 81.667  120.359 -22.148 1.00 68.11  ? 57   TYR A CD2   1 
ATOM   2607  C  CE1   . TYR G  4  57   ? 79.579  120.267 -20.256 1.00 67.21  ? 57   TYR A CE1   1 
ATOM   2608  C  CE2   . TYR G  4  57   ? 81.237  121.563 -21.478 1.00 68.31  ? 57   TYR A CE2   1 
ATOM   2609  C  CZ    . TYR G  4  57   ? 80.197  121.496 -20.540 1.00 67.25  ? 57   TYR A CZ    1 
ATOM   2610  O  OH    . TYR G  4  57   ? 79.786  122.636 -19.886 1.00 66.54  ? 57   TYR A OH    1 
ATOM   2611  N  N     . ILE G  4  58   ? 78.306  118.120 -23.872 1.00 61.20  ? 58   ILE A N     1 
ATOM   2612  C  CA    . ILE G  4  58   ? 77.576  119.136 -24.591 1.00 58.82  ? 58   ILE A CA    1 
ATOM   2613  C  C     . ILE G  4  58   ? 77.754  120.455 -23.842 1.00 58.77  ? 58   ILE A C     1 
ATOM   2614  O  O     . ILE G  4  58   ? 77.727  120.451 -22.616 1.00 57.75  ? 58   ILE A O     1 
ATOM   2615  C  CB    . ILE G  4  58   ? 76.086  118.791 -24.690 1.00 56.56  ? 58   ILE A CB    1 
ATOM   2616  C  CG1   . ILE G  4  58   ? 75.874  117.515 -25.511 1.00 54.19  ? 58   ILE A CG1   1 
ATOM   2617  C  CG2   . ILE G  4  58   ? 75.368  119.946 -25.338 1.00 56.42  ? 58   ILE A CG2   1 
ATOM   2618  C  CD1   . ILE G  4  58   ? 76.147  117.648 -27.002 1.00 50.85  ? 58   ILE A CD1   1 
ATOM   2619  N  N     . GLU G  4  59   ? 77.935  121.569 -24.533 1.00 58.99  ? 59   GLU A N     1 
ATOM   2620  C  CA    . GLU G  4  59   ? 78.254  122.812 -23.835 1.00 59.73  ? 59   GLU A CA    1 
ATOM   2621  C  C     . GLU G  4  59   ? 77.154  123.282 -22.873 1.00 60.29  ? 59   GLU A C     1 
ATOM   2622  O  O     . GLU G  4  59   ? 77.466  123.568 -21.709 1.00 60.41  ? 59   GLU A O     1 
ATOM   2623  C  CB    . GLU G  4  59   ? 78.567  123.921 -24.845 1.00 59.54  ? 59   GLU A CB    1 
ATOM   2624  C  CG    . GLU G  4  59   ? 79.880  123.770 -25.576 1.00 58.26  ? 59   GLU A CG    1 
ATOM   2625  C  CD    . GLU G  4  59   ? 81.041  124.520 -24.922 1.00 56.92  ? 59   GLU A CD    1 
ATOM   2626  O  OE1   . GLU G  4  59   ? 82.182  124.393 -25.422 1.00 57.98  ? 59   GLU A OE1   1 
ATOM   2627  O  OE2   . GLU G  4  59   ? 80.827  125.233 -23.922 1.00 53.44  ? 59   GLU A OE2   1 
ATOM   2628  N  N     . ASP G  4  60   ? 75.895  123.379 -23.297 1.00 60.20  ? 60   ASP A N     1 
ATOM   2629  C  CA    . ASP G  4  60   ? 74.883  123.914 -22.366 1.00 60.55  ? 60   ASP A CA    1 
ATOM   2630  C  C     . ASP G  4  60   ? 74.254  122.807 -21.502 1.00 60.01  ? 60   ASP A C     1 
ATOM   2631  O  O     . ASP G  4  60   ? 73.514  123.108 -20.560 1.00 60.49  ? 60   ASP A O     1 
ATOM   2632  C  CB    . ASP G  4  60   ? 73.757  124.668 -23.145 1.00 61.42  ? 60   ASP A CB    1 
ATOM   2633  C  CG    . ASP G  4  60   ? 73.489  126.137 -22.634 1.00 61.20  ? 60   ASP A CG    1 
ATOM   2634  O  OD1   . ASP G  4  60   ? 73.870  126.504 -21.493 1.00 60.80  ? 60   ASP A OD1   1 
ATOM   2635  O  OD2   . ASP G  4  60   ? 72.876  126.925 -23.402 1.00 58.76  ? 60   ASP A OD2   1 
ATOM   2636  N  N     . VAL G  4  61   ? 74.544  121.541 -21.801 1.00 59.19  ? 61   VAL A N     1 
ATOM   2637  C  CA    . VAL G  4  61   ? 73.957  120.412 -21.051 1.00 58.72  ? 61   VAL A CA    1 
ATOM   2638  C  C     . VAL G  4  61   ? 74.775  120.065 -19.790 1.00 57.61  ? 61   VAL A C     1 
ATOM   2639  O  O     . VAL G  4  61   ? 76.015  120.070 -19.795 1.00 57.23  ? 61   VAL A O     1 
ATOM   2640  C  CB    . VAL G  4  61   ? 73.850  119.145 -21.968 1.00 58.77  ? 61   VAL A CB    1 
ATOM   2641  C  CG1   . VAL G  4  61   ? 73.394  117.943 -21.172 1.00 60.63  ? 61   VAL A CG1   1 
ATOM   2642  C  CG2   . VAL G  4  61   ? 72.862  119.396 -23.085 1.00 59.62  ? 61   VAL A CG2   1 
ATOM   2643  N  N     . LEU G  4  62   ? 74.054  119.755 -18.714 1.00 56.22  ? 62   LEU A N     1 
ATOM   2644  C  CA    . LEU G  4  62   ? 74.652  119.417 -17.427 1.00 54.42  ? 62   LEU A CA    1 
ATOM   2645  C  C     . LEU G  4  62   ? 74.552  117.921 -17.133 1.00 53.02  ? 62   LEU A C     1 
ATOM   2646  O  O     . LEU G  4  62   ? 75.538  117.310 -16.709 1.00 52.78  ? 62   LEU A O     1 
ATOM   2647  C  CB    . LEU G  4  62   ? 73.961  120.209 -16.300 1.00 55.16  ? 62   LEU A CB    1 
ATOM   2648  C  CG    . LEU G  4  62   ? 72.706  121.062 -16.585 1.00 55.03  ? 62   LEU A CG    1 
ATOM   2649  C  CD1   . LEU G  4  62   ? 71.608  120.248 -17.223 1.00 55.81  ? 62   LEU A CD1   1 
ATOM   2650  C  CD2   . LEU G  4  62   ? 72.195  121.625 -15.278 1.00 56.26  ? 62   LEU A CD2   1 
ATOM   2651  N  N     . HIS G  4  63   ? 73.376  117.327 -17.348 1.00 51.87  ? 63   HIS A N     1 
ATOM   2652  C  CA    . HIS G  4  63   ? 73.213  115.898 -17.074 1.00 50.19  ? 63   HIS A CA    1 
ATOM   2653  C  C     . HIS G  4  63   ? 72.924  115.097 -18.343 1.00 47.37  ? 63   HIS A C     1 
ATOM   2654  O  O     . HIS G  4  63   ? 72.714  115.635 -19.417 1.00 45.86  ? 63   HIS A O     1 
ATOM   2655  C  CB    . HIS G  4  63   ? 72.102  115.656 -16.024 1.00 52.17  ? 63   HIS A CB    1 
ATOM   2656  C  CG    . HIS G  4  63   ? 70.730  116.097 -16.436 1.00 55.21  ? 63   HIS A CG    1 
ATOM   2657  N  ND1   . HIS G  4  63   ? 70.370  117.424 -16.549 1.00 55.85  ? 63   HIS A ND1   1 
ATOM   2658  C  CD2   . HIS G  4  63   ? 69.618  115.383 -16.732 1.00 55.92  ? 63   HIS A CD2   1 
ATOM   2659  C  CE1   . HIS G  4  63   ? 69.096  117.509 -16.895 1.00 57.05  ? 63   HIS A CE1   1 
ATOM   2660  N  NE2   . HIS G  4  63   ? 68.616  116.283 -17.012 1.00 56.33  ? 63   HIS A NE2   1 
ATOM   2661  N  N     . GLU G  4  64   ? 72.910  113.789 -18.184 1.00 45.12  ? 64   GLU A N     1 
ATOM   2662  C  CA    . GLU G  4  64   ? 72.723  112.850 -19.272 1.00 44.54  ? 64   GLU A CA    1 
ATOM   2663  C  C     . GLU G  4  64   ? 71.260  112.770 -19.740 1.00 44.31  ? 64   GLU A C     1 
ATOM   2664  O  O     . GLU G  4  64   ? 71.010  112.345 -20.867 1.00 41.40  ? 64   GLU A O     1 
ATOM   2665  C  CB    . GLU G  4  64   ? 73.189  111.471 -18.808 1.00 45.50  ? 64   GLU A CB    1 
ATOM   2666  C  CG    . GLU G  4  64   ? 73.644  110.555 -19.913 1.00 46.52  ? 64   GLU A CG    1 
ATOM   2667  C  CD    . GLU G  4  64   ? 73.341  109.107 -19.601 1.00 46.66  ? 64   GLU A CD    1 
ATOM   2668  O  OE1   . GLU G  4  64   ? 73.835  108.590 -18.559 1.00 47.45  ? 64   GLU A OE1   1 
ATOM   2669  O  OE2   . GLU G  4  64   ? 72.603  108.500 -20.408 1.00 45.35  ? 64   GLU A OE2   1 
ATOM   2670  N  N     . PHE G  4  65   ? 70.305  113.181 -18.900 1.00 43.94  ? 65   PHE A N     1 
ATOM   2671  C  CA    . PHE G  4  65   ? 68.869  113.054 -19.236 1.00 46.04  ? 65   PHE A CA    1 
ATOM   2672  C  C     . PHE G  4  65   ? 68.253  114.380 -19.727 1.00 46.48  ? 65   PHE A C     1 
ATOM   2673  O  O     . PHE G  4  65   ? 67.053  114.608 -19.546 1.00 45.70  ? 65   PHE A O     1 
ATOM   2674  C  CB    . PHE G  4  65   ? 68.062  112.556 -18.012 1.00 44.88  ? 65   PHE A CB    1 
ATOM   2675  C  CG    . PHE G  4  65   ? 68.775  111.507 -17.189 1.00 42.36  ? 65   PHE A CG    1 
ATOM   2676  C  CD1   . PHE G  4  65   ? 69.811  111.871 -16.314 1.00 40.23  ? 65   PHE A CD1   1 
ATOM   2677  C  CD2   . PHE G  4  65   ? 68.434  110.143 -17.306 1.00 42.18  ? 65   PHE A CD2   1 
ATOM   2678  C  CE1   . PHE G  4  65   ? 70.509  110.902 -15.565 1.00 41.52  ? 65   PHE A CE1   1 
ATOM   2679  C  CE2   . PHE G  4  65   ? 69.124  109.150 -16.560 1.00 41.32  ? 65   PHE A CE2   1 
ATOM   2680  C  CZ    . PHE G  4  65   ? 70.163  109.529 -15.689 1.00 41.52  ? 65   PHE A CZ    1 
ATOM   2681  N  N     . SER G  4  66   ? 69.049  115.242 -20.355 1.00 48.27  ? 66   SER A N     1 
ATOM   2682  C  CA    . SER G  4  66   ? 68.530  116.517 -20.853 1.00 47.76  ? 66   SER A CA    1 
ATOM   2683  C  C     . SER G  4  66   ? 68.239  116.462 -22.354 1.00 47.12  ? 66   SER A C     1 
ATOM   2684  O  O     . SER G  4  66   ? 68.634  115.544 -23.069 1.00 46.63  ? 66   SER A O     1 
ATOM   2685  C  CB    . SER G  4  66   ? 69.534  117.661 -20.614 1.00 48.83  ? 66   SER A CB    1 
ATOM   2686  O  OG    . SER G  4  66   ? 70.466  117.380 -19.574 1.00 49.14  ? 66   SER A OG    1 
ATOM   2687  N  N     . THR G  4  67   ? 67.527  117.479 -22.809 1.00 46.89  ? 67   THR A N     1 
ATOM   2688  C  CA    . THR G  4  67   ? 67.200  117.637 -24.207 1.00 46.02  ? 67   THR A CA    1 
ATOM   2689  C  C     . THR G  4  67   ? 67.628  119.005 -24.691 1.00 46.59  ? 67   THR A C     1 
ATOM   2690  O  O     . THR G  4  67   ? 67.378  120.010 -24.035 1.00 46.00  ? 67   THR A O     1 
ATOM   2691  C  CB    . THR G  4  67   ? 65.705  117.494 -24.476 1.00 45.23  ? 67   THR A CB    1 
ATOM   2692  O  OG1   . THR G  4  67   ? 65.334  118.371 -25.552 1.00 42.89  ? 67   THR A OG1   1 
ATOM   2693  C  CG2   . THR G  4  67   ? 64.925  117.797 -23.252 1.00 44.82  ? 67   THR A CG2   1 
ATOM   2694  N  N     . ILE G  4  68   ? 68.280  119.034 -25.843 1.00 48.48  ? 68   ILE A N     1 
ATOM   2695  C  CA    . ILE G  4  68   ? 68.775  120.281 -26.409 1.00 50.70  ? 68   ILE A CA    1 
ATOM   2696  C  C     . ILE G  4  68   ? 67.787  120.871 -27.443 1.00 50.97  ? 68   ILE A C     1 
ATOM   2697  O  O     . ILE G  4  68   ? 67.378  120.179 -28.389 1.00 51.41  ? 68   ILE A O     1 
ATOM   2698  C  CB    . ILE G  4  68   ? 70.150  120.051 -27.100 1.00 51.48  ? 68   ILE A CB    1 
ATOM   2699  C  CG1   . ILE G  4  68   ? 71.145  119.503 -26.079 1.00 51.18  ? 68   ILE A CG1   1 
ATOM   2700  C  CG2   . ILE G  4  68   ? 70.676  121.367 -27.690 1.00 50.70  ? 68   ILE A CG2   1 
ATOM   2701  C  CD1   . ILE G  4  68   ? 72.480  119.146 -26.681 1.00 52.86  ? 68   ILE A CD1   1 
ATOM   2702  N  N     . PRO G  4  69   ? 67.391  122.158 -27.268 1.00 49.47  ? 69   PRO A N     1 
ATOM   2703  C  CA    . PRO G  4  69   ? 66.464  122.764 -28.228 1.00 48.27  ? 69   PRO A CA    1 
ATOM   2704  C  C     . PRO G  4  69   ? 67.025  122.744 -29.643 1.00 48.16  ? 69   PRO A C     1 
ATOM   2705  O  O     . PRO G  4  69   ? 68.234  122.710 -29.842 1.00 49.59  ? 69   PRO A O     1 
ATOM   2706  C  CB    . PRO G  4  69   ? 66.270  124.165 -27.673 1.00 47.27  ? 69   PRO A CB    1 
ATOM   2707  C  CG    . PRO G  4  69   ? 66.328  123.933 -26.213 1.00 47.04  ? 69   PRO A CG    1 
ATOM   2708  C  CD    . PRO G  4  69   ? 67.542  123.034 -26.092 1.00 48.09  ? 69   PRO A CD    1 
ATOM   2709  N  N     . GLY G  4  70   ? 66.142  122.754 -30.627 1.00 48.41  ? 70   GLY A N     1 
ATOM   2710  C  CA    . GLY G  4  70   ? 66.582  122.731 -32.006 1.00 48.74  ? 70   GLY A CA    1 
ATOM   2711  C  C     . GLY G  4  70   ? 67.172  121.398 -32.392 1.00 48.48  ? 70   GLY A C     1 
ATOM   2712  O  O     . GLY G  4  70   ? 67.545  121.197 -33.543 1.00 49.91  ? 70   GLY A O     1 
ATOM   2713  N  N     . VAL G  4  71   ? 67.259  120.491 -31.425 1.00 48.61  ? 71   VAL A N     1 
ATOM   2714  C  CA    . VAL G  4  71   ? 67.790  119.156 -31.658 1.00 48.75  ? 71   VAL A CA    1 
ATOM   2715  C  C     . VAL G  4  71   ? 66.736  118.095 -31.315 1.00 49.88  ? 71   VAL A C     1 
ATOM   2716  O  O     . VAL G  4  71   ? 66.347  117.963 -30.151 1.00 51.25  ? 71   VAL A O     1 
ATOM   2717  C  CB    . VAL G  4  71   ? 69.039  118.928 -30.808 1.00 47.08  ? 71   VAL A CB    1 
ATOM   2718  C  CG1   . VAL G  4  71   ? 69.833  117.783 -31.390 1.00 47.58  ? 71   VAL A CG1   1 
ATOM   2719  C  CG2   . VAL G  4  71   ? 69.876  120.182 -30.777 1.00 45.37  ? 71   VAL A CG2   1 
ATOM   2720  N  N     . LYS G  4  72   ? 66.273  117.346 -32.323 1.00 50.83  ? 72   LYS A N     1 
ATOM   2721  C  CA    . LYS G  4  72   ? 65.226  116.332 -32.116 1.00 50.93  ? 72   LYS A CA    1 
ATOM   2722  C  C     . LYS G  4  72   ? 65.627  115.311 -31.053 1.00 52.36  ? 72   LYS A C     1 
ATOM   2723  O  O     . LYS G  4  72   ? 64.942  115.127 -30.040 1.00 53.79  ? 72   LYS A O     1 
ATOM   2724  C  CB    . LYS G  4  72   ? 64.922  115.591 -33.427 1.00 49.67  ? 72   LYS A CB    1 
ATOM   2725  C  CG    . LYS G  4  72   ? 63.590  114.801 -33.390 1.00 47.09  ? 72   LYS A CG    1 
ATOM   2726  C  CD    . LYS G  4  72   ? 63.760  113.318 -33.101 1.00 45.01  ? 72   LYS A CD    1 
ATOM   2727  C  CE    . LYS G  4  72   ? 64.085  112.546 -34.365 1.00 44.31  ? 72   LYS A CE    1 
ATOM   2728  N  NZ    . LYS G  4  72   ? 64.324  111.096 -34.105 1.00 44.39  ? 72   LYS A NZ    1 
ATOM   2729  N  N     . GLU G  4  73   ? 66.747  114.650 -31.295 1.00 52.55  ? 73   GLU A N     1 
ATOM   2730  C  CA    . GLU G  4  73   ? 67.264  113.631 -30.398 1.00 52.13  ? 73   GLU A CA    1 
ATOM   2731  C  C     . GLU G  4  73   ? 67.530  114.192 -28.994 1.00 51.50  ? 73   GLU A C     1 
ATOM   2732  O  O     . GLU G  4  73   ? 67.750  115.391 -28.808 1.00 51.48  ? 73   GLU A O     1 
ATOM   2733  C  CB    . GLU G  4  73   ? 68.558  113.065 -30.994 1.00 53.31  ? 73   GLU A CB    1 
ATOM   2734  C  CG    . GLU G  4  73   ? 69.080  113.868 -32.203 1.00 52.73  ? 73   GLU A CG    1 
ATOM   2735  C  CD    . GLU G  4  73   ? 68.671  113.263 -33.530 1.00 52.95  ? 73   GLU A CD    1 
ATOM   2736  O  OE1   . GLU G  4  73   ? 69.493  112.551 -34.144 1.00 53.72  ? 73   GLU A OE1   1 
ATOM   2737  O  OE2   . GLU G  4  73   ? 67.528  113.488 -33.965 1.00 53.25  ? 73   GLU A OE2   1 
ATOM   2738  N  N     . ASP G  4  74   ? 67.494  113.309 -28.000 1.00 50.18  ? 74   ASP A N     1 
ATOM   2739  C  CA    . ASP G  4  74   ? 67.799  113.714 -26.643 1.00 49.56  ? 74   ASP A CA    1 
ATOM   2740  C  C     . ASP G  4  74   ? 69.219  113.298 -26.286 1.00 49.30  ? 74   ASP A C     1 
ATOM   2741  O  O     . ASP G  4  74   ? 69.749  112.373 -26.891 1.00 50.26  ? 74   ASP A O     1 
ATOM   2742  C  CB    . ASP G  4  74   ? 66.779  113.103 -25.670 1.00 47.98  ? 74   ASP A CB    1 
ATOM   2743  C  CG    . ASP G  4  74   ? 66.911  111.637 -25.515 1.00 46.33  ? 74   ASP A CG    1 
ATOM   2744  O  OD1   . ASP G  4  74   ? 67.981  111.179 -25.068 1.00 45.05  ? 74   ASP A OD1   1 
ATOM   2745  O  OD2   . ASP G  4  74   ? 65.922  110.954 -25.839 1.00 45.94  ? 74   ASP A OD2   1 
ATOM   2746  N  N     . VAL G  4  75   ? 69.837  113.973 -25.328 1.00 48.55  ? 75   VAL A N     1 
ATOM   2747  C  CA    . VAL G  4  75   ? 71.210  113.668 -24.941 1.00 47.58  ? 75   VAL A CA    1 
ATOM   2748  C  C     . VAL G  4  75   ? 71.445  112.154 -24.851 1.00 47.83  ? 75   VAL A C     1 
ATOM   2749  O  O     . VAL G  4  75   ? 72.483  111.673 -25.299 1.00 47.96  ? 75   VAL A O     1 
ATOM   2750  C  CB    . VAL G  4  75   ? 71.547  114.364 -23.583 1.00 47.74  ? 75   VAL A CB    1 
ATOM   2751  C  CG1   . VAL G  4  75   ? 72.952  114.038 -23.141 1.00 47.94  ? 75   VAL A CG1   1 
ATOM   2752  C  CG2   . VAL G  4  75   ? 71.442  115.874 -23.755 1.00 45.85  ? 75   VAL A CG2   1 
ATOM   2753  N  N     . VAL G  4  76   ? 70.484  111.413 -24.302 1.00 46.80  ? 76   VAL A N     1 
ATOM   2754  C  CA    . VAL G  4  76   ? 70.620  109.958 -24.149 1.00 48.77  ? 76   VAL A CA    1 
ATOM   2755  C  C     . VAL G  4  76   ? 70.699  109.247 -25.506 1.00 48.93  ? 76   VAL A C     1 
ATOM   2756  O  O     . VAL G  4  76   ? 71.527  108.352 -25.705 1.00 48.44  ? 76   VAL A O     1 
ATOM   2757  C  CB    . VAL G  4  76   ? 69.440  109.366 -23.329 1.00 48.89  ? 76   VAL A CB    1 
ATOM   2758  C  CG1   . VAL G  4  76   ? 69.491  107.834 -23.333 1.00 48.91  ? 76   VAL A CG1   1 
ATOM   2759  C  CG2   . VAL G  4  76   ? 69.542  109.855 -21.905 1.00 49.69  ? 76   VAL A CG2   1 
ATOM   2760  N  N     . GLU G  4  77   ? 69.835  109.634 -26.433 1.00 47.90  ? 77   GLU A N     1 
ATOM   2761  C  CA    . GLU G  4  77   ? 69.836  109.017 -27.747 1.00 47.73  ? 77   GLU A CA    1 
ATOM   2762  C  C     . GLU G  4  77   ? 71.122  109.325 -28.482 1.00 47.60  ? 77   GLU A C     1 
ATOM   2763  O  O     . GLU G  4  77   ? 71.628  108.500 -29.226 1.00 47.95  ? 77   GLU A O     1 
ATOM   2764  C  CB    . GLU G  4  77   ? 68.639  109.520 -28.565 1.00 48.82  ? 77   GLU A CB    1 
ATOM   2765  C  CG    . GLU G  4  77   ? 67.262  109.160 -27.958 1.00 48.63  ? 77   GLU A CG    1 
ATOM   2766  C  CD    . GLU G  4  77   ? 66.070  109.744 -28.718 1.00 45.94  ? 77   GLU A CD    1 
ATOM   2767  O  OE1   . GLU G  4  77   ? 65.236  108.949 -29.186 1.00 43.66  ? 77   GLU A OE1   1 
ATOM   2768  O  OE2   . GLU G  4  77   ? 65.968  110.986 -28.842 1.00 45.38  ? 77   GLU A OE2   1 
ATOM   2769  N  N     . ILE G  4  78   ? 71.648  110.525 -28.262 1.00 48.80  ? 78   ILE A N     1 
ATOM   2770  C  CA    . ILE G  4  78   ? 72.877  110.959 -28.909 1.00 48.41  ? 78   ILE A CA    1 
ATOM   2771  C  C     . ILE G  4  78   ? 74.074  110.231 -28.352 1.00 48.03  ? 78   ILE A C     1 
ATOM   2772  O  O     . ILE G  4  78   ? 74.869  109.688 -29.104 1.00 46.62  ? 78   ILE A O     1 
ATOM   2773  C  CB    . ILE G  4  78   ? 73.088  112.458 -28.721 1.00 48.33  ? 78   ILE A CB    1 
ATOM   2774  C  CG1   . ILE G  4  78   ? 71.861  113.201 -29.249 1.00 47.67  ? 78   ILE A CG1   1 
ATOM   2775  C  CG2   . ILE G  4  78   ? 74.360  112.892 -29.452 1.00 47.86  ? 78   ILE A CG2   1 
ATOM   2776  C  CD1   . ILE G  4  78   ? 71.889  114.680 -29.035 1.00 48.91  ? 78   ILE A CD1   1 
ATOM   2777  N  N     . ILE G  4  79   ? 74.204  110.228 -27.033 1.00 50.11  ? 79   ILE A N     1 
ATOM   2778  C  CA    . ILE G  4  79   ? 75.315  109.525 -26.424 1.00 52.67  ? 79   ILE A CA    1 
ATOM   2779  C  C     . ILE G  4  79   ? 75.302  108.062 -26.839 1.00 53.38  ? 79   ILE A C     1 
ATOM   2780  O  O     . ILE G  4  79   ? 76.350  107.407 -26.944 1.00 53.54  ? 79   ILE A O     1 
ATOM   2781  C  CB    . ILE G  4  79   ? 75.273  109.652 -24.859 1.00 54.08  ? 79   ILE A CB    1 
ATOM   2782  C  CG1   . ILE G  4  79   ? 73.926  109.178 -24.294 1.00 54.61  ? 79   ILE A CG1   1 
ATOM   2783  C  CG2   . ILE G  4  79   ? 75.473  111.117 -24.472 1.00 53.27  ? 79   ILE A CG2   1 
ATOM   2784  C  CD1   . ILE G  4  79   ? 73.817  107.679 -23.997 1.00 55.66  ? 79   ILE A CD1   1 
ATOM   2785  N  N     . LEU G  4  80   ? 74.096  107.557 -27.086 1.00 53.18  ? 80   LEU A N     1 
ATOM   2786  C  CA    . LEU G  4  80   ? 73.936  106.177 -27.530 1.00 53.36  ? 80   LEU A CA    1 
ATOM   2787  C  C     . LEU G  4  80   ? 74.592  105.982 -28.899 1.00 52.25  ? 80   LEU A C     1 
ATOM   2788  O  O     . LEU G  4  80   ? 75.427  105.094 -29.104 1.00 52.28  ? 80   LEU A O     1 
ATOM   2789  C  CB    . LEU G  4  80   ? 72.436  105.819 -27.614 1.00 53.75  ? 80   LEU A CB    1 
ATOM   2790  C  CG    . LEU G  4  80   ? 72.007  104.475 -28.274 1.00 54.74  ? 80   LEU A CG    1 
ATOM   2791  C  CD1   . LEU G  4  80   ? 70.657  104.025 -27.723 1.00 53.45  ? 80   LEU A CD1   1 
ATOM   2792  C  CD2   . LEU G  4  80   ? 71.898  104.626 -29.798 1.00 55.80  ? 80   LEU A CD2   1 
ATOM   2793  N  N     . ASN G  4  81   ? 74.192  106.842 -29.828 1.00 50.48  ? 81   ASN A N     1 
ATOM   2794  C  CA    . ASN G  4  81   ? 74.694  106.821 -31.183 1.00 46.10  ? 81   ASN A CA    1 
ATOM   2795  C  C     . ASN G  4  81   ? 76.198  107.052 -31.210 1.00 44.85  ? 81   ASN A C     1 
ATOM   2796  O  O     . ASN G  4  81   ? 76.864  106.693 -32.177 1.00 44.22  ? 81   ASN A O     1 
ATOM   2797  C  CB    . ASN G  4  81   ? 73.923  107.864 -31.989 1.00 44.43  ? 81   ASN A CB    1 
ATOM   2798  C  CG    . ASN G  4  81   ? 72.470  107.445 -32.194 1.00 40.80  ? 81   ASN A CG    1 
ATOM   2799  O  OD1   . ASN G  4  81   ? 71.563  108.275 -32.161 1.00 40.35  ? 81   ASN A OD1   1 
ATOM   2800  N  ND2   . ASN G  4  81   ? 72.251  106.150 -32.401 1.00 36.20  ? 81   ASN A ND2   1 
ATOM   2801  N  N     . LEU G  4  82   ? 76.744  107.640 -30.152 1.00 43.70  ? 82   LEU A N     1 
ATOM   2802  C  CA    . LEU G  4  82   ? 78.175  107.818 -30.122 1.00 42.62  ? 82   LEU A CA    1 
ATOM   2803  C  C     . LEU G  4  82   ? 78.865  106.499 -29.868 1.00 43.19  ? 82   LEU A C     1 
ATOM   2804  O  O     . LEU G  4  82   ? 79.963  106.273 -30.362 1.00 43.47  ? 82   LEU A O     1 
ATOM   2805  C  CB    . LEU G  4  82   ? 78.590  108.815 -29.051 1.00 40.65  ? 82   LEU A CB    1 
ATOM   2806  C  CG    . LEU G  4  82   ? 79.084  110.168 -29.559 1.00 38.72  ? 82   LEU A CG    1 
ATOM   2807  C  CD1   . LEU G  4  82   ? 79.936  110.718 -28.499 1.00 37.24  ? 82   LEU A CD1   1 
ATOM   2808  C  CD2   . LEU G  4  82   ? 79.898  110.075 -30.842 1.00 39.57  ? 82   LEU A CD2   1 
ATOM   2809  N  N     . LYS G  4  83   ? 78.221  105.622 -29.099 1.00 43.01  ? 83   LYS A N     1 
ATOM   2810  C  CA    . LYS G  4  83   ? 78.788  104.304 -28.845 1.00 43.54  ? 83   LYS A CA    1 
ATOM   2811  C  C     . LYS G  4  83   ? 79.005  103.574 -30.159 1.00 45.29  ? 83   LYS A C     1 
ATOM   2812  O  O     . LYS G  4  83   ? 79.912  102.751 -30.312 1.00 44.39  ? 83   LYS A O     1 
ATOM   2813  C  CB    . LYS G  4  83   ? 77.846  103.479 -27.989 1.00 41.86  ? 83   LYS A CB    1 
ATOM   2814  C  CG    . LYS G  4  83   ? 77.196  104.250 -26.910 1.00 41.13  ? 83   LYS A CG    1 
ATOM   2815  C  CD    . LYS G  4  83   ? 76.131  103.427 -26.251 1.00 40.76  ? 83   LYS A CD    1 
ATOM   2816  C  CE    . LYS G  4  83   ? 75.510  104.205 -25.115 1.00 40.09  ? 83   LYS A CE    1 
ATOM   2817  N  NZ    . LYS G  4  83   ? 74.682  103.349 -24.230 1.00 39.43  ? 83   LYS A NZ    1 
ATOM   2818  N  N     . GLU G  4  84   ? 78.139  103.910 -31.109 1.00 47.14  ? 84   GLU A N     1 
ATOM   2819  C  CA    . GLU G  4  84   ? 78.161  103.345 -32.456 1.00 49.99  ? 84   GLU A CA    1 
ATOM   2820  C  C     . GLU G  4  84   ? 79.353  103.865 -33.262 1.00 50.97  ? 84   GLU A C     1 
ATOM   2821  O  O     . GLU G  4  84   ? 79.766  103.242 -34.232 1.00 51.74  ? 84   GLU A O     1 
ATOM   2822  C  CB    . GLU G  4  84   ? 76.879  103.714 -33.204 1.00 50.83  ? 84   GLU A CB    1 
ATOM   2823  C  CG    . GLU G  4  84   ? 76.051  102.568 -33.683 1.00 52.20  ? 84   GLU A CG    1 
ATOM   2824  C  CD    . GLU G  4  84   ? 75.218  101.974 -32.575 1.00 55.16  ? 84   GLU A CD    1 
ATOM   2825  O  OE1   . GLU G  4  84   ? 74.097  101.500 -32.892 1.00 57.78  ? 84   GLU A OE1   1 
ATOM   2826  O  OE2   . GLU G  4  84   ? 75.676  101.976 -31.398 1.00 54.79  ? 84   GLU A OE2   1 
ATOM   2827  N  N     . LEU G  4  85   ? 79.902  105.007 -32.871 1.00 51.28  ? 85   LEU A N     1 
ATOM   2828  C  CA    . LEU G  4  85   ? 81.032  105.575 -33.593 1.00 51.33  ? 85   LEU A CA    1 
ATOM   2829  C  C     . LEU G  4  85   ? 82.260  104.683 -33.482 1.00 52.34  ? 85   LEU A C     1 
ATOM   2830  O  O     . LEU G  4  85   ? 82.686  104.357 -32.381 1.00 53.12  ? 85   LEU A O     1 
ATOM   2831  C  CB    . LEU G  4  85   ? 81.349  106.982 -33.046 1.00 49.04  ? 85   LEU A CB    1 
ATOM   2832  C  CG    . LEU G  4  85   ? 82.759  107.585 -33.130 1.00 46.75  ? 85   LEU A CG    1 
ATOM   2833  C  CD1   . LEU G  4  85   ? 83.241  107.598 -34.561 1.00 45.07  ? 85   LEU A CD1   1 
ATOM   2834  C  CD2   . LEU G  4  85   ? 82.733  108.994 -32.579 1.00 44.51  ? 85   LEU A CD2   1 
ATOM   2835  N  N     . VAL G  4  86   ? 82.814  104.283 -34.630 1.00 54.17  ? 86   VAL A N     1 
ATOM   2836  C  CA    . VAL G  4  86   ? 84.032  103.469 -34.675 1.00 55.05  ? 86   VAL A CA    1 
ATOM   2837  C  C     . VAL G  4  86   ? 85.196  104.263 -35.275 1.00 56.47  ? 86   VAL A C     1 
ATOM   2838  O  O     . VAL G  4  86   ? 85.244  104.561 -36.474 1.00 56.65  ? 86   VAL A O     1 
ATOM   2839  C  CB    . VAL G  4  86   ? 83.844  102.138 -35.501 1.00 54.49  ? 86   VAL A CB    1 
ATOM   2840  C  CG1   . VAL G  4  86   ? 83.172  102.415 -36.822 1.00 55.03  ? 86   VAL A CG1   1 
ATOM   2841  C  CG2   . VAL G  4  86   ? 85.197  101.490 -35.751 1.00 53.59  ? 86   VAL A CG2   1 
ATOM   2842  N  N     . VAL G  4  87   ? 86.135  104.611 -34.410 1.00 57.65  ? 87   VAL A N     1 
ATOM   2843  C  CA    . VAL G  4  87   ? 87.316  105.360 -34.806 1.00 59.93  ? 87   VAL A CA    1 
ATOM   2844  C  C     . VAL G  4  87   ? 88.528  104.451 -34.884 1.00 61.94  ? 87   VAL A C     1 
ATOM   2845  O  O     . VAL G  4  87   ? 88.550  103.382 -34.276 1.00 62.70  ? 87   VAL A O     1 
ATOM   2846  C  CB    . VAL G  4  87   ? 87.632  106.491 -33.801 1.00 59.90  ? 87   VAL A CB    1 
ATOM   2847  C  CG1   . VAL G  4  87   ? 87.025  107.792 -34.280 1.00 61.06  ? 87   VAL A CG1   1 
ATOM   2848  C  CG2   . VAL G  4  87   ? 87.102  106.124 -32.419 1.00 60.15  ? 87   VAL A CG2   1 
ATOM   2849  N  N     . ARG G  4  88   ? 89.545  104.870 -35.620 1.00 62.49  ? 88   ARG A N     1 
ATOM   2850  C  CA    . ARG G  4  88   ? 90.733  104.049 -35.762 1.00 63.81  ? 88   ARG A CA    1 
ATOM   2851  C  C     . ARG G  4  88   ? 92.002  104.892 -35.674 1.00 64.97  ? 88   ARG A C     1 
ATOM   2852  O  O     . ARG G  4  88   ? 92.305  105.611 -36.626 1.00 65.69  ? 88   ARG A O     1 
ATOM   2853  C  CB    . ARG G  4  88   ? 90.650  103.321 -37.111 1.00 63.05  ? 88   ARG A CB    1 
ATOM   2854  C  CG    . ARG G  4  88   ? 91.942  102.832 -37.755 1.00 63.48  ? 88   ARG A CG    1 
ATOM   2855  C  CD    . ARG G  4  88   ? 91.727  102.568 -39.259 1.00 62.64  ? 88   ARG A CD    1 
ATOM   2856  N  NE    . ARG G  4  88   ? 91.462  101.173 -39.597 1.00 60.54  ? 88   ARG A NE    1 
ATOM   2857  C  CZ    . ARG G  4  88   ? 92.413  100.271 -39.803 1.00 60.15  ? 88   ARG A CZ    1 
ATOM   2858  N  NH1   . ARG G  4  88   ? 93.690  100.619 -39.712 1.00 59.95  ? 88   ARG A NH1   1 
ATOM   2859  N  NH2   . ARG G  4  88   ? 92.088  99.020  -40.096 1.00 60.39  ? 88   ARG A NH2   1 
ATOM   2860  N  N     . PHE G  4  89   ? 92.736  104.838 -34.548 1.00 68.05  ? 89   PHE A N     1 
ATOM   2861  C  CA    . PHE G  4  89   ? 94.012  105.590 -34.495 1.00 69.80  ? 89   PHE A CA    1 
ATOM   2862  C  C     . PHE G  4  89   ? 95.181  104.706 -34.989 1.00 70.40  ? 89   PHE A C     1 
ATOM   2863  O  O     . PHE G  4  89   ? 95.088  103.468 -34.985 1.00 70.44  ? 89   PHE A O     1 
ATOM   2864  C  CB    . PHE G  4  89   ? 94.436  106.131 -33.089 1.00 68.93  ? 89   PHE A CB    1 
ATOM   2865  C  CG    . PHE G  4  89   ? 93.411  106.031 -31.988 1.00 67.26  ? 89   PHE A CG    1 
ATOM   2866  C  CD1   . PHE G  4  89   ? 92.381  106.975 -31.858 1.00 66.52  ? 89   PHE A CD1   1 
ATOM   2867  C  CD2   . PHE G  4  89   ? 93.523  105.005 -31.022 1.00 66.90  ? 89   PHE A CD2   1 
ATOM   2868  C  CE1   . PHE G  4  89   ? 91.462  106.901 -30.760 1.00 67.14  ? 89   PHE A CE1   1 
ATOM   2869  C  CE2   . PHE G  4  89   ? 92.629  104.915 -29.933 1.00 66.21  ? 89   PHE A CE2   1 
ATOM   2870  C  CZ    . PHE G  4  89   ? 91.597  105.859 -29.794 1.00 66.08  ? 89   PHE A CZ    1 
ATOM   2871  N  N     . LEU G  4  90   ? 96.287  105.341 -35.380 1.00 70.31  ? 90   LEU A N     1 
ATOM   2872  C  CA    . LEU G  4  90   ? 97.388  104.608 -35.983 1.00 70.15  ? 90   LEU A CA    1 
ATOM   2873  C  C     . LEU G  4  90   ? 98.559  104.295 -35.016 1.00 71.98  ? 90   LEU A C     1 
ATOM   2874  O  O     . LEU G  4  90   ? 99.355  103.418 -35.361 1.00 72.26  ? 90   LEU A O     1 
ATOM   2875  C  CB    . LEU G  4  90   ? 97.883  105.394 -37.206 1.00 67.95  ? 90   LEU A CB    1 
ATOM   2876  C  CG    . LEU G  4  90   ? 96.884  105.355 -38.375 1.00 66.42  ? 90   LEU A CG    1 
ATOM   2877  C  CD1   . LEU G  4  90   ? 95.874  106.451 -38.224 1.00 64.04  ? 90   LEU A CD1   1 
ATOM   2878  C  CD2   . LEU G  4  90   ? 97.618  105.518 -39.689 1.00 66.55  ? 90   LEU A CD2   1 
ATOM   2879  N  N     . ASN G  4  91   ? 98.723  104.923 -33.849 1.00 71.90  ? 91   ASN A N     1 
ATOM   2880  C  CA    . ASN G  4  91   ? 99.908  104.540 -33.043 1.00 73.18  ? 91   ASN A CA    1 
ATOM   2881  C  C     . ASN G  4  91   ? 99.715  104.813 -31.526 1.00 74.00  ? 91   ASN A C     1 
ATOM   2882  O  O     . ASN G  4  91   ? 98.994  105.740 -31.160 1.00 74.33  ? 91   ASN A O     1 
ATOM   2883  C  CB    . ASN G  4  91   ? 101.126 105.309 -33.574 1.00 72.27  ? 91   ASN A CB    1 
ATOM   2884  C  CG    . ASN G  4  91   ? 102.436 104.791 -33.036 1.00 71.43  ? 91   ASN A CG    1 
ATOM   2885  O  OD1   . ASN G  4  91   ? 102.774 103.624 -33.215 1.00 71.04  ? 91   ASN A OD1   1 
ATOM   2886  N  ND2   . ASN G  4  91   ? 103.189 105.662 -32.372 1.00 71.37  ? 91   ASN A ND2   1 
ATOM   2887  N  N     . PRO G  4  92   ? 100.365 104.002 -30.628 1.00 75.46  ? 92   PRO A N     1 
ATOM   2888  C  CA    . PRO G  4  92   ? 100.322 104.087 -29.151 1.00 75.60  ? 92   PRO A CA    1 
ATOM   2889  C  C     . PRO G  4  92   ? 100.353 105.519 -28.614 1.00 76.01  ? 92   PRO A C     1 
ATOM   2890  O  O     . PRO G  4  92   ? 99.731  105.775 -27.582 1.00 75.29  ? 92   PRO A O     1 
ATOM   2891  C  CB    . PRO G  4  92   ? 101.527 103.259 -28.722 1.00 75.13  ? 92   PRO A CB    1 
ATOM   2892  C  CG    . PRO G  4  92   ? 101.383 102.099 -29.615 1.00 76.22  ? 92   PRO A CG    1 
ATOM   2893  C  CD    . PRO G  4  92   ? 101.049 102.740 -30.997 1.00 76.17  ? 92   PRO A CD    1 
ATOM   2894  N  N     . SER G  4  93   ? 101.063 106.434 -29.288 1.00 76.32  ? 93   SER A N     1 
ATOM   2895  C  CA    . SER G  4  93   ? 101.147 107.840 -28.854 1.00 76.00  ? 93   SER A CA    1 
ATOM   2896  C  C     . SER G  4  93   ? 99.750  108.422 -28.599 1.00 76.16  ? 93   SER A C     1 
ATOM   2897  O  O     . SER G  4  93   ? 99.585  109.332 -27.784 1.00 75.99  ? 93   SER A O     1 
ATOM   2898  C  CB    . SER G  4  93   ? 101.880 108.688 -29.915 1.00 76.40  ? 93   SER A CB    1 
ATOM   2899  O  OG    . SER G  4  93   ? 103.251 108.320 -30.048 1.00 76.73  ? 93   SER A OG    1 
ATOM   2900  N  N     . LEU G  4  94   ? 98.747  107.885 -29.303 1.00 75.90  ? 94   LEU A N     1 
ATOM   2901  C  CA    . LEU G  4  94   ? 97.354  108.307 -29.131 1.00 74.52  ? 94   LEU A CA    1 
ATOM   2902  C  C     . LEU G  4  94   ? 96.607  107.355 -28.195 1.00 74.40  ? 94   LEU A C     1 
ATOM   2903  O  O     . LEU G  4  94   ? 95.989  106.372 -28.625 1.00 74.14  ? 94   LEU A O     1 
ATOM   2904  C  CB    . LEU G  4  94   ? 96.629  108.358 -30.482 1.00 72.79  ? 94   LEU A CB    1 
ATOM   2905  C  CG    . LEU G  4  94   ? 95.979  109.709 -30.799 1.00 70.56  ? 94   LEU A CG    1 
ATOM   2906  C  CD1   . LEU G  4  94   ? 97.028  110.793 -30.890 1.00 70.09  ? 94   LEU A CD1   1 
ATOM   2907  C  CD2   . LEU G  4  94   ? 95.216  109.597 -32.102 1.00 71.11  ? 94   LEU A CD2   1 
ATOM   2908  N  N     . GLN G  4  95   ? 96.688  107.659 -26.904 1.00 74.47  ? 95   GLN A N     1 
ATOM   2909  C  CA    . GLN G  4  95   ? 96.021  106.872 -25.887 1.00 74.66  ? 95   GLN A CA    1 
ATOM   2910  C  C     . GLN G  4  95   ? 94.620  107.376 -25.671 1.00 74.13  ? 95   GLN A C     1 
ATOM   2911  O  O     . GLN G  4  95   ? 93.680  106.589 -25.605 1.00 74.04  ? 95   GLN A O     1 
ATOM   2912  C  CB    . GLN G  4  95   ? 96.817  106.936 -24.582 1.00 75.47  ? 95   GLN A CB    1 
ATOM   2913  C  CG    . GLN G  4  95   ? 97.910  105.858 -24.488 1.00 75.87  ? 95   GLN A CG    1 
ATOM   2914  C  CD    . GLN G  4  95   ? 99.037  106.222 -23.523 1.00 75.57  ? 95   GLN A CD    1 
ATOM   2915  O  OE1   . GLN G  4  95   ? 98.836  106.963 -22.556 1.00 75.66  ? 95   GLN A OE1   1 
ATOM   2916  N  NE2   . GLN G  4  95   ? 100.227 105.694 -23.780 1.00 75.34  ? 95   GLN A NE2   1 
ATOM   2917  N  N     . THR G  4  96   ? 94.496  108.697 -25.570 1.00 73.47  ? 96   THR A N     1 
ATOM   2918  C  CA    . THR G  4  96   ? 93.203  109.350 -25.393 1.00 73.66  ? 96   THR A CA    1 
ATOM   2919  C  C     . THR G  4  96   ? 93.064  110.573 -26.322 1.00 73.82  ? 96   THR A C     1 
ATOM   2920  O  O     . THR G  4  96   ? 93.724  111.597 -26.148 1.00 74.54  ? 96   THR A O     1 
ATOM   2921  C  CB    . THR G  4  96   ? 92.995  109.784 -23.901 1.00 73.53  ? 96   THR A CB    1 
ATOM   2922  O  OG1   . THR G  4  96   ? 91.771  110.519 -23.787 1.00 73.64  ? 96   THR A OG1   1 
ATOM   2923  C  CG2   . THR G  4  96   ? 94.157  110.639 -23.402 1.00 73.22  ? 96   THR A CG2   1 
ATOM   2924  N  N     . VAL G  4  97   ? 92.193  110.453 -27.317 1.00 72.75  ? 97   VAL A N     1 
ATOM   2925  C  CA    . VAL G  4  97   ? 91.972  111.528 -28.272 1.00 72.57  ? 97   VAL A CA    1 
ATOM   2926  C  C     . VAL G  4  97   ? 90.561  112.093 -28.132 1.00 72.34  ? 97   VAL A C     1 
ATOM   2927  O  O     . VAL G  4  97   ? 89.584  111.345 -28.167 1.00 72.37  ? 97   VAL A O     1 
ATOM   2928  C  CB    . VAL G  4  97   ? 92.156  111.025 -29.726 1.00 72.54  ? 97   VAL A CB    1 
ATOM   2929  C  CG1   . VAL G  4  97   ? 92.863  112.077 -30.570 1.00 73.54  ? 97   VAL A CG1   1 
ATOM   2930  C  CG2   . VAL G  4  97   ? 92.921  109.738 -29.721 1.00 73.01  ? 97   VAL A CG2   1 
ATOM   2931  N  N     . THR G  4  98   ? 90.470  113.411 -27.968 1.00 72.27  ? 98   THR A N     1 
ATOM   2932  C  CA    . THR G  4  98   ? 89.192  114.096 -27.840 1.00 70.96  ? 98   THR A CA    1 
ATOM   2933  C  C     . THR G  4  98   ? 88.767  114.704 -29.169 1.00 69.76  ? 98   THR A C     1 
ATOM   2934  O  O     . THR G  4  98   ? 89.361  115.678 -29.622 1.00 69.33  ? 98   THR A O     1 
ATOM   2935  C  CB    . THR G  4  98   ? 89.271  115.226 -26.804 1.00 71.61  ? 98   THR A CB    1 
ATOM   2936  O  OG1   . THR G  4  98   ? 89.641  114.680 -25.528 1.00 72.67  ? 98   THR A OG1   1 
ATOM   2937  C  CG2   . THR G  4  98   ? 87.917  115.936 -26.687 1.00 71.67  ? 98   THR A CG2   1 
ATOM   2938  N  N     . LEU G  4  99   ? 87.746  114.120 -29.789 1.00 69.70  ? 99   LEU A N     1 
ATOM   2939  C  CA    . LEU G  4  99   ? 87.213  114.624 -31.063 1.00 69.13  ? 99   LEU A CA    1 
ATOM   2940  C  C     . LEU G  4  99   ? 86.283  115.833 -30.825 1.00 67.59  ? 99   LEU A C     1 
ATOM   2941  O  O     . LEU G  4  99   ? 85.391  115.774 -29.972 1.00 68.81  ? 99   LEU A O     1 
ATOM   2942  C  CB    . LEU G  4  99   ? 86.447  113.498 -31.802 1.00 69.44  ? 99   LEU A CB    1 
ATOM   2943  C  CG    . LEU G  4  99   ? 87.184  112.679 -32.882 1.00 69.17  ? 99   LEU A CG    1 
ATOM   2944  C  CD1   . LEU G  4  99   ? 88.337  111.885 -32.256 1.00 68.50  ? 99   LEU A CD1   1 
ATOM   2945  C  CD2   . LEU G  4  99   ? 86.198  111.742 -33.557 1.00 68.64  ? 99   LEU A CD2   1 
ATOM   2946  N  N     . LEU G  4  100  ? 86.484  116.924 -31.565 1.00 64.99  ? 100  LEU A N     1 
ATOM   2947  C  CA    . LEU G  4  100  ? 85.657  118.110 -31.363 1.00 61.91  ? 100  LEU A CA    1 
ATOM   2948  C  C     . LEU G  4  100  ? 84.754  118.385 -32.550 1.00 60.80  ? 100  LEU A C     1 
ATOM   2949  O  O     . LEU G  4  100  ? 85.153  118.250 -33.690 1.00 61.24  ? 100  LEU A O     1 
ATOM   2950  C  CB    . LEU G  4  100  ? 86.538  119.322 -31.107 1.00 60.73  ? 100  LEU A CB    1 
ATOM   2951  C  CG    . LEU G  4  100  ? 85.722  120.316 -30.282 1.00 60.84  ? 100  LEU A CG    1 
ATOM   2952  C  CD1   . LEU G  4  100  ? 86.651  121.019 -29.303 1.00 59.95  ? 100  LEU A CD1   1 
ATOM   2953  C  CD2   . LEU G  4  100  ? 84.985  121.288 -31.210 1.00 59.81  ? 100  LEU A CD2   1 
ATOM   2954  N  N     . LEU G  4  101  ? 83.525  118.786 -32.265 1.00 59.73  ? 101  LEU A N     1 
ATOM   2955  C  CA    . LEU G  4  101  ? 82.556  119.077 -33.307 1.00 58.84  ? 101  LEU A CA    1 
ATOM   2956  C  C     . LEU G  4  101  ? 81.536  120.089 -32.831 1.00 58.52  ? 101  LEU A C     1 
ATOM   2957  O  O     . LEU G  4  101  ? 81.046  120.018 -31.703 1.00 58.19  ? 101  LEU A O     1 
ATOM   2958  C  CB    . LEU G  4  101  ? 81.822  117.792 -33.730 1.00 57.92  ? 101  LEU A CB    1 
ATOM   2959  C  CG    . LEU G  4  101  ? 80.876  117.715 -34.961 1.00 57.23  ? 101  LEU A CG    1 
ATOM   2960  C  CD1   . LEU G  4  101  ? 80.480  116.253 -35.175 1.00 54.17  ? 101  LEU A CD1   1 
ATOM   2961  C  CD2   . LEU G  4  101  ? 79.619  118.566 -34.777 1.00 55.53  ? 101  LEU A CD2   1 
ATOM   2962  N  N     . LYS G  4  102  ? 81.224  121.023 -33.717 1.00 58.15  ? 102  LYS A N     1 
ATOM   2963  C  CA    . LYS G  4  102  ? 80.230  122.046 -33.470 1.00 58.00  ? 102  LYS A CA    1 
ATOM   2964  C  C     . LYS G  4  102  ? 79.510  122.403 -34.772 1.00 58.59  ? 102  LYS A C     1 
ATOM   2965  O  O     . LYS G  4  102  ? 80.133  122.770 -35.772 1.00 58.72  ? 102  LYS A O     1 
ATOM   2966  C  CB    . LYS G  4  102  ? 80.895  123.288 -32.836 1.00 57.40  ? 102  LYS A CB    1 
ATOM   2967  C  CG    . LYS G  4  102  ? 81.618  124.253 -33.777 1.00 57.42  ? 102  LYS A CG    1 
ATOM   2968  C  CD    . LYS G  4  102  ? 82.976  124.690 -33.247 1.00 56.18  ? 102  LYS A CD    1 
ATOM   2969  C  CE    . LYS G  4  102  ? 83.708  125.494 -34.307 1.00 55.73  ? 102  LYS A CE    1 
ATOM   2970  N  NZ    . LYS G  4  102  ? 85.182  125.433 -34.135 1.00 57.44  ? 102  LYS A NZ    1 
ATOM   2971  N  N     . ALA G  4  103  ? 78.192  122.266 -34.764 1.00 59.24  ? 103  ALA A N     1 
ATOM   2972  C  CA    . ALA G  4  103  ? 77.390  122.564 -35.941 1.00 59.51  ? 103  ALA A CA    1 
ATOM   2973  C  C     . ALA G  4  103  ? 76.152  123.345 -35.554 1.00 59.51  ? 103  ALA A C     1 
ATOM   2974  O  O     . ALA G  4  103  ? 75.586  123.117 -34.489 1.00 60.35  ? 103  ALA A O     1 
ATOM   2975  C  CB    . ALA G  4  103  ? 76.995  121.261 -36.645 1.00 59.85  ? 103  ALA A CB    1 
ATOM   2976  N  N     . GLU G  4  104  ? 75.725  124.264 -36.412 1.00 59.40  ? 104  GLU A N     1 
ATOM   2977  C  CA    . GLU G  4  104  ? 74.575  125.083 -36.090 1.00 58.46  ? 104  GLU A CA    1 
ATOM   2978  C  C     . GLU G  4  104  ? 73.579  125.124 -37.215 1.00 58.57  ? 104  GLU A C     1 
ATOM   2979  O  O     . GLU G  4  104  ? 73.901  124.834 -38.367 1.00 58.45  ? 104  GLU A O     1 
ATOM   2980  C  CB    . GLU G  4  104  ? 75.019  126.508 -35.794 1.00 57.98  ? 104  GLU A CB    1 
ATOM   2981  C  CG    . GLU G  4  104  ? 75.785  126.680 -34.504 1.00 57.90  ? 104  GLU A CG    1 
ATOM   2982  C  CD    . GLU G  4  104  ? 75.070  127.619 -33.568 1.00 57.17  ? 104  GLU A CD    1 
ATOM   2983  O  OE1   . GLU G  4  104  ? 73.980  128.107 -33.964 1.00 57.04  ? 104  GLU A OE1   1 
ATOM   2984  O  OE2   . GLU G  4  104  ? 75.593  127.864 -32.453 1.00 56.15  ? 104  GLU A OE2   1 
ATOM   2985  N  N     . GLY G  4  105  ? 72.357  125.491 -36.849 1.00 58.33  ? 105  GLY A N     1 
ATOM   2986  C  CA    . GLY G  4  105  ? 71.311  125.670 -37.825 1.00 58.05  ? 105  GLY A CA    1 
ATOM   2987  C  C     . GLY G  4  105  ? 70.651  124.416 -38.358 1.00 58.57  ? 105  GLY A C     1 
ATOM   2988  O  O     . GLY G  4  105  ? 70.743  123.358 -37.750 1.00 58.90  ? 105  GLY A O     1 
ATOM   2989  N  N     . PRO G  4  106  ? 69.982  124.525 -39.530 1.00 58.38  ? 106  PRO A N     1 
ATOM   2990  C  CA    . PRO G  4  106  ? 69.227  123.509 -40.282 1.00 58.07  ? 106  PRO A CA    1 
ATOM   2991  C  C     . PRO G  4  106  ? 70.096  122.411 -40.889 1.00 57.60  ? 106  PRO A C     1 
ATOM   2992  O  O     . PRO G  4  106  ? 69.820  121.996 -42.010 1.00 57.97  ? 106  PRO A O     1 
ATOM   2993  C  CB    . PRO G  4  106  ? 68.497  124.327 -41.355 1.00 58.37  ? 106  PRO A CB    1 
ATOM   2994  C  CG    . PRO G  4  106  ? 68.734  125.799 -40.972 1.00 57.99  ? 106  PRO A CG    1 
ATOM   2995  C  CD    . PRO G  4  106  ? 70.074  125.754 -40.343 1.00 58.06  ? 106  PRO A CD    1 
ATOM   2996  N  N     . LYS G  4  107  ? 71.115  121.913 -40.194 1.00 57.30  ? 107  LYS A N     1 
ATOM   2997  C  CA    . LYS G  4  107  ? 71.950  120.866 -40.808 1.00 56.26  ? 107  LYS A CA    1 
ATOM   2998  C  C     . LYS G  4  107  ? 71.934  119.566 -40.003 1.00 56.00  ? 107  LYS A C     1 
ATOM   2999  O  O     . LYS G  4  107  ? 71.756  119.569 -38.776 1.00 54.87  ? 107  LYS A O     1 
ATOM   3000  C  CB    . LYS G  4  107  ? 73.409  121.351 -40.946 1.00 56.19  ? 107  LYS A CB    1 
ATOM   3001  C  CG    . LYS G  4  107  ? 74.364  120.379 -41.675 1.00 52.78  ? 107  LYS A CG    1 
ATOM   3002  C  CD    . LYS G  4  107  ? 75.795  120.918 -41.725 1.00 50.90  ? 107  LYS A CD    1 
ATOM   3003  C  CE    . LYS G  4  107  ? 76.771  119.919 -42.344 1.00 50.03  ? 107  LYS A CE    1 
ATOM   3004  N  NZ    . LYS G  4  107  ? 76.651  119.733 -43.826 1.00 50.20  ? 107  LYS A NZ    1 
ATOM   3005  N  N     . GLU G  4  108  ? 72.118  118.459 -40.729 1.00 55.68  ? 108  GLU A N     1 
ATOM   3006  C  CA    . GLU G  4  108  ? 72.210  117.117 -40.137 1.00 55.49  ? 108  GLU A CA    1 
ATOM   3007  C  C     . GLU G  4  108  ? 73.631  116.872 -39.626 1.00 54.94  ? 108  GLU A C     1 
ATOM   3008  O  O     . GLU G  4  108  ? 74.586  117.084 -40.361 1.00 56.37  ? 108  GLU A O     1 
ATOM   3009  C  CB    . GLU G  4  108  ? 71.868  116.043 -41.184 1.00 55.45  ? 108  GLU A CB    1 
ATOM   3010  C  CG    . GLU G  4  108  ? 70.499  115.378 -41.026 1.00 53.97  ? 108  GLU A CG    1 
ATOM   3011  C  CD    . GLU G  4  108  ? 70.190  114.350 -42.110 1.00 53.55  ? 108  GLU A CD    1 
ATOM   3012  O  OE1   . GLU G  4  108  ? 69.149  113.678 -41.993 1.00 53.49  ? 108  GLU A OE1   1 
ATOM   3013  O  OE2   . GLU G  4  108  ? 70.971  114.206 -43.074 1.00 52.79  ? 108  GLU A OE2   1 
ATOM   3014  N  N     . VAL G  4  109  ? 73.802  116.434 -38.392 1.00 53.09  ? 109  VAL A N     1 
ATOM   3015  C  CA    . VAL G  4  109  ? 75.158  116.263 -37.934 1.00 51.96  ? 109  VAL A CA    1 
ATOM   3016  C  C     . VAL G  4  109  ? 75.594  114.833 -38.056 1.00 50.52  ? 109  VAL A C     1 
ATOM   3017  O  O     . VAL G  4  109  ? 75.102  113.952 -37.367 1.00 51.63  ? 109  VAL A O     1 
ATOM   3018  C  CB    . VAL G  4  109  ? 75.307  116.775 -36.471 1.00 52.07  ? 109  VAL A CB    1 
ATOM   3019  C  CG1   . VAL G  4  109  ? 76.671  116.419 -35.914 1.00 53.24  ? 109  VAL A CG1   1 
ATOM   3020  C  CG2   . VAL G  4  109  ? 75.174  118.295 -36.455 1.00 51.70  ? 109  VAL A CG2   1 
ATOM   3021  N  N     . LYS G  4  110  ? 76.528  114.622 -38.967 1.00 49.43  ? 110  LYS A N     1 
ATOM   3022  C  CA    . LYS G  4  110  ? 77.071  113.312 -39.216 1.00 48.38  ? 110  LYS A CA    1 
ATOM   3023  C  C     . LYS G  4  110  ? 78.436  113.181 -38.572 1.00 49.35  ? 110  LYS A C     1 
ATOM   3024  O  O     . LYS G  4  110  ? 78.968  114.177 -38.093 1.00 48.67  ? 110  LYS A O     1 
ATOM   3025  C  CB    . LYS G  4  110  ? 77.130  113.105 -40.728 1.00 47.61  ? 110  LYS A CB    1 
ATOM   3026  C  CG    . LYS G  4  110  ? 75.828  113.529 -41.471 1.00 45.50  ? 110  LYS A CG    1 
ATOM   3027  C  CD    . LYS G  4  110  ? 74.646  112.554 -41.233 1.00 44.91  ? 110  LYS A CD    1 
ATOM   3028  C  CE    . LYS G  4  110  ? 73.472  112.831 -42.178 1.00 44.05  ? 110  LYS A CE    1 
ATOM   3029  N  NZ    . LYS G  4  110  ? 72.969  111.630 -42.912 1.00 42.31  ? 110  LYS A NZ    1 
ATOM   3030  N  N     . ALA G  4  111  ? 79.007  111.983 -38.551 1.00 50.22  ? 111  ALA A N     1 
ATOM   3031  C  CA    . ALA G  4  111  ? 80.300  111.792 -37.896 1.00 52.70  ? 111  ALA A CA    1 
ATOM   3032  C  C     . ALA G  4  111  ? 81.460  112.389 -38.695 1.00 54.33  ? 111  ALA A C     1 
ATOM   3033  O  O     . ALA G  4  111  ? 82.552  112.559 -38.146 1.00 54.01  ? 111  ALA A O     1 
ATOM   3034  C  CB    . ALA G  4  111  ? 80.545  110.327 -37.664 1.00 53.33  ? 111  ALA A CB    1 
ATOM   3035  N  N     . ARG G  4  112  ? 81.261  112.705 -39.971 1.00 56.18  ? 112  ARG A N     1 
ATOM   3036  C  CA    . ARG G  4  112  ? 82.358  113.287 -40.744 1.00 58.82  ? 112  ARG A CA    1 
ATOM   3037  C  C     . ARG G  4  112  ? 82.499  114.782 -40.465 1.00 60.18  ? 112  ARG A C     1 
ATOM   3038  O  O     . ARG G  4  112  ? 83.429  115.426 -40.961 1.00 60.34  ? 112  ARG A O     1 
ATOM   3039  C  CB    . ARG G  4  112  ? 82.129  113.060 -42.238 1.00 59.31  ? 112  ARG A CB    1 
ATOM   3040  C  CG    . ARG G  4  112  ? 80.845  113.628 -42.768 1.00 61.01  ? 112  ARG A CG    1 
ATOM   3041  C  CD    . ARG G  4  112  ? 80.488  113.011 -44.108 1.00 62.25  ? 112  ARG A CD    1 
ATOM   3042  N  NE    . ARG G  4  112  ? 80.225  111.581 -43.988 1.00 62.95  ? 112  ARG A NE    1 
ATOM   3043  C  CZ    . ARG G  4  112  ? 79.688  110.829 -44.945 1.00 63.69  ? 112  ARG A CZ    1 
ATOM   3044  N  NH1   . ARG G  4  112  ? 79.345  111.360 -46.113 1.00 64.20  ? 112  ARG A NH1   1 
ATOM   3045  N  NH2   . ARG G  4  112  ? 79.490  109.536 -44.733 1.00 64.68  ? 112  ARG A NH2   1 
ATOM   3046  N  N     . ASP G  4  113  ? 81.570  115.315 -39.664 1.00 62.12  ? 113  ASP A N     1 
ATOM   3047  C  CA    . ASP G  4  113  ? 81.544  116.733 -39.293 1.00 63.24  ? 113  ASP A CA    1 
ATOM   3048  C  C     . ASP G  4  113  ? 82.570  117.052 -38.188 1.00 63.29  ? 113  ASP A C     1 
ATOM   3049  O  O     . ASP G  4  113  ? 82.827  118.226 -37.885 1.00 62.37  ? 113  ASP A O     1 
ATOM   3050  C  CB    . ASP G  4  113  ? 80.124  117.117 -38.845 1.00 63.66  ? 113  ASP A CB    1 
ATOM   3051  C  CG    . ASP G  4  113  ? 79.156  117.229 -40.020 1.00 63.08  ? 113  ASP A CG    1 
ATOM   3052  O  OD1   . ASP G  4  113  ? 78.930  116.215 -40.723 1.00 61.81  ? 113  ASP A OD1   1 
ATOM   3053  O  OD2   . ASP G  4  113  ? 78.626  118.344 -40.232 1.00 63.93  ? 113  ASP A OD2   1 
ATOM   3054  N  N     . PHE G  4  114  ? 83.147  116.004 -37.591 1.00 63.59  ? 114  PHE A N     1 
ATOM   3055  C  CA    . PHE G  4  114  ? 84.192  116.168 -36.573 1.00 63.66  ? 114  PHE A CA    1 
ATOM   3056  C  C     . PHE G  4  114  ? 85.447  116.747 -37.204 1.00 65.96  ? 114  PHE A C     1 
ATOM   3057  O  O     . PHE G  4  114  ? 85.893  116.225 -38.231 1.00 66.57  ? 114  PHE A O     1 
ATOM   3058  C  CB    . PHE G  4  114  ? 84.639  114.829 -35.956 1.00 60.67  ? 114  PHE A CB    1 
ATOM   3059  C  CG    . PHE G  4  114  ? 83.715  114.248 -34.939 1.00 57.80  ? 114  PHE A CG    1 
ATOM   3060  C  CD1   . PHE G  4  114  ? 82.947  113.110 -35.256 1.00 56.97  ? 114  PHE A CD1   1 
ATOM   3061  C  CD2   . PHE G  4  114  ? 83.616  114.806 -33.653 1.00 55.46  ? 114  PHE A CD2   1 
ATOM   3062  C  CE1   . PHE G  4  114  ? 82.082  112.522 -34.303 1.00 56.03  ? 114  PHE A CE1   1 
ATOM   3063  C  CE2   . PHE G  4  114  ? 82.763  114.240 -32.689 1.00 55.22  ? 114  PHE A CE2   1 
ATOM   3064  C  CZ    . PHE G  4  114  ? 81.988  113.088 -33.013 1.00 55.48  ? 114  PHE A CZ    1 
ATOM   3065  N  N     . LEU G  4  115  ? 86.027  117.799 -36.629 1.00 68.27  ? 115  LEU A N     1 
ATOM   3066  C  CA    . LEU G  4  115  ? 87.259  118.303 -37.214 1.00 68.97  ? 115  LEU A CA    1 
ATOM   3067  C  C     . LEU G  4  115  ? 88.347  117.229 -37.153 1.00 68.90  ? 115  LEU A C     1 
ATOM   3068  O  O     . LEU G  4  115  ? 88.651  116.680 -36.085 1.00 69.31  ? 115  LEU A O     1 
ATOM   3069  C  CB    . LEU G  4  115  ? 87.721  119.595 -36.524 1.00 69.66  ? 115  LEU A CB    1 
ATOM   3070  C  CG    . LEU G  4  115  ? 87.693  119.892 -35.041 1.00 71.10  ? 115  LEU A CG    1 
ATOM   3071  C  CD1   . LEU G  4  115  ? 89.132  119.908 -34.496 1.00 72.81  ? 115  LEU A CD1   1 
ATOM   3072  C  CD2   . LEU G  4  115  ? 86.999  121.249 -34.832 1.00 71.45  ? 115  LEU A CD2   1 
ATOM   3073  N  N     . PRO G  4  116  ? 88.923  116.897 -38.319 1.00 68.76  ? 116  PRO A N     1 
ATOM   3074  C  CA    . PRO G  4  116  ? 89.966  115.886 -38.453 1.00 68.57  ? 116  PRO A CA    1 
ATOM   3075  C  C     . PRO G  4  116  ? 91.157  116.106 -37.534 1.00 68.86  ? 116  PRO A C     1 
ATOM   3076  O  O     . PRO G  4  116  ? 91.607  117.228 -37.274 1.00 66.21  ? 116  PRO A O     1 
ATOM   3077  C  CB    . PRO G  4  116  ? 90.317  115.960 -39.928 1.00 69.30  ? 116  PRO A CB    1 
ATOM   3078  C  CG    . PRO G  4  116  ? 88.998  116.208 -40.528 1.00 68.14  ? 116  PRO A CG    1 
ATOM   3079  C  CD    . PRO G  4  116  ? 88.437  117.292 -39.653 1.00 68.48  ? 116  PRO A CD    1 
ATOM   3080  N  N     . VAL G  4  117  ? 91.639  114.970 -37.045 1.00 69.50  ? 117  VAL A N     1 
ATOM   3081  C  CA    . VAL G  4  117  ? 92.818  114.906 -36.213 1.00 71.75  ? 117  VAL A CA    1 
ATOM   3082  C  C     . VAL G  4  117  ? 93.905  114.104 -36.941 1.00 72.73  ? 117  VAL A C     1 
ATOM   3083  O  O     . VAL G  4  117  ? 93.624  113.081 -37.575 1.00 73.17  ? 117  VAL A O     1 
ATOM   3084  C  CB    . VAL G  4  117  ? 92.487  114.272 -34.807 1.00 72.37  ? 117  VAL A CB    1 
ATOM   3085  C  CG1   . VAL G  4  117  ? 93.657  114.481 -33.833 1.00 72.05  ? 117  VAL A CG1   1 
ATOM   3086  C  CG2   . VAL G  4  117  ? 91.226  114.928 -34.222 1.00 72.63  ? 117  VAL A CG2   1 
ATOM   3087  N  N     . ALA G  4  118  ? 95.135  114.609 -36.850 1.00 74.20  ? 118  ALA A N     1 
ATOM   3088  C  CA    . ALA G  4  118  ? 96.347  114.106 -37.523 1.00 73.71  ? 118  ALA A CA    1 
ATOM   3089  C  C     . ALA G  4  118  ? 96.430  112.573 -37.590 1.00 72.94  ? 118  ALA A C     1 
ATOM   3090  O  O     . ALA G  4  118  ? 96.291  112.005 -38.672 1.00 72.60  ? 118  ALA A O     1 
ATOM   3091  C  CB    . ALA G  4  118  ? 97.604  114.669 -36.821 1.00 74.33  ? 118  ALA A CB    1 
ATOM   3092  N  N     . ASP G  4  119  ? 96.660  111.905 -36.459 1.00 72.92  ? 119  ASP A N     1 
ATOM   3093  C  CA    . ASP G  4  119  ? 96.863  110.440 -36.449 1.00 72.26  ? 119  ASP A CA    1 
ATOM   3094  C  C     . ASP G  4  119  ? 95.534  109.631 -36.298 1.00 71.89  ? 119  ASP A C     1 
ATOM   3095  O  O     . ASP G  4  119  ? 95.606  108.401 -36.236 1.00 71.34  ? 119  ASP A O     1 
ATOM   3096  C  CB    . ASP G  4  119  ? 97.820  110.021 -35.288 1.00 71.64  ? 119  ASP A CB    1 
ATOM   3097  C  CG    . ASP G  4  119  ? 99.240  110.646 -35.362 1.00 70.78  ? 119  ASP A CG    1 
ATOM   3098  O  OD1   . ASP G  4  119  ? 99.976  110.539 -34.344 1.00 68.10  ? 119  ASP A OD1   1 
ATOM   3099  O  OD2   . ASP G  4  119  ? 99.630  111.223 -36.406 1.00 70.35  ? 119  ASP A OD2   1 
ATOM   3100  N  N     . VAL G  4  120  ? 94.354  110.264 -36.240 1.00 70.85  ? 120  VAL A N     1 
ATOM   3101  C  CA    . VAL G  4  120  ? 93.097  109.501 -36.055 1.00 69.48  ? 120  VAL A CA    1 
ATOM   3102  C  C     . VAL G  4  120  ? 92.214  109.531 -37.313 1.00 68.40  ? 120  VAL A C     1 
ATOM   3103  O  O     . VAL G  4  120  ? 92.184  110.528 -38.043 1.00 69.07  ? 120  VAL A O     1 
ATOM   3104  C  CB    . VAL G  4  120  ? 92.253  110.054 -34.823 1.00 69.90  ? 120  VAL A CB    1 
ATOM   3105  C  CG1   . VAL G  4  120  ? 91.434  111.254 -35.222 1.00 69.79  ? 120  VAL A CG1   1 
ATOM   3106  C  CG2   . VAL G  4  120  ? 91.310  108.981 -34.308 1.00 69.97  ? 120  VAL A CG2   1 
ATOM   3107  N  N     . GLU G  4  121  ? 91.498  108.433 -37.554 1.00 66.27  ? 121  GLU A N     1 
ATOM   3108  C  CA    . GLU G  4  121  ? 90.598  108.335 -38.706 1.00 65.54  ? 121  GLU A CA    1 
ATOM   3109  C  C     . GLU G  4  121  ? 89.214  107.806 -38.289 1.00 65.53  ? 121  GLU A C     1 
ATOM   3110  O  O     . GLU G  4  121  ? 89.100  106.967 -37.389 1.00 64.76  ? 121  GLU A O     1 
ATOM   3111  C  CB    . GLU G  4  121  ? 91.206  107.420 -39.809 1.00 64.17  ? 121  GLU A CB    1 
ATOM   3112  C  CG    . GLU G  4  121  ? 90.827  105.915 -39.784 1.00 59.75  ? 121  GLU A CG    1 
ATOM   3113  C  CD    . GLU G  4  121  ? 91.159  105.175 -41.088 1.00 56.47  ? 121  GLU A CD    1 
ATOM   3114  O  OE1   . GLU G  4  121  ? 92.353  104.993 -41.398 1.00 53.52  ? 121  GLU A OE1   1 
ATOM   3115  O  OE2   . GLU G  4  121  ? 90.218  104.775 -41.803 1.00 54.35  ? 121  GLU A OE2   1 
ATOM   3116  N  N     . ILE G  4  122  ? 88.170  108.308 -38.946 1.00 65.69  ? 122  ILE A N     1 
ATOM   3117  C  CA    . ILE G  4  122  ? 86.786  107.900 -38.659 1.00 65.84  ? 122  ILE A CA    1 
ATOM   3118  C  C     . ILE G  4  122  ? 86.202  107.060 -39.821 1.00 67.19  ? 122  ILE A C     1 
ATOM   3119  O  O     . ILE G  4  122  ? 85.892  107.599 -40.897 1.00 66.71  ? 122  ILE A O     1 
ATOM   3120  C  CB    . ILE G  4  122  ? 85.854  109.174 -38.400 1.00 63.93  ? 122  ILE A CB    1 
ATOM   3121  C  CG1   . ILE G  4  122  ? 86.302  109.910 -37.121 1.00 61.09  ? 122  ILE A CG1   1 
ATOM   3122  C  CG2   . ILE G  4  122  ? 84.385  108.740 -38.228 1.00 62.64  ? 122  ILE A CG2   1 
ATOM   3123  C  CD1   . ILE G  4  122  ? 85.584  111.209 -36.838 1.00 56.77  ? 122  ILE A CD1   1 
ATOM   3124  N  N     . MET G  4  123  ? 86.051  105.748 -39.604 1.00 67.93  ? 123  MET A N     1 
ATOM   3125  C  CA    . MET G  4  123  ? 85.496  104.854 -40.634 1.00 68.13  ? 123  MET A CA    1 
ATOM   3126  C  C     . MET G  4  123  ? 83.978  104.797 -40.573 1.00 67.95  ? 123  MET A C     1 
ATOM   3127  O  O     . MET G  4  123  ? 83.348  104.051 -41.331 1.00 67.67  ? 123  MET A O     1 
ATOM   3128  C  CB    . MET G  4  123  ? 86.008  103.428 -40.500 1.00 69.13  ? 123  MET A CB    1 
ATOM   3129  C  CG    . MET G  4  123  ? 87.436  103.263 -40.862 1.00 69.93  ? 123  MET A CG    1 
ATOM   3130  S  SD    . MET G  4  123  ? 88.288  103.846 -39.454 1.00 72.02  ? 123  MET A SD    1 
ATOM   3131  C  CE    . MET G  4  123  ? 87.681  102.665 -38.253 1.00 71.63  ? 123  MET A CE    1 
ATOM   3132  N  N     . ASN G  4  124  ? 83.398  105.575 -39.668 1.00 67.77  ? 124  ASN A N     1 
ATOM   3133  C  CA    . ASN G  4  124  ? 81.952  105.667 -39.546 1.00 66.60  ? 124  ASN A CA    1 
ATOM   3134  C  C     . ASN G  4  124  ? 81.501  107.110 -39.784 1.00 65.86  ? 124  ASN A C     1 
ATOM   3135  O  O     . ASN G  4  124  ? 80.975  107.753 -38.886 1.00 66.17  ? 124  ASN A O     1 
ATOM   3136  C  CB    . ASN G  4  124  ? 81.513  105.203 -38.159 1.00 65.99  ? 124  ASN A CB    1 
ATOM   3137  C  CG    . ASN G  4  124  ? 80.164  104.504 -38.201 1.00 64.01  ? 124  ASN A CG    1 
ATOM   3138  O  OD1   . ASN G  4  124  ? 79.836  103.805 -39.172 1.00 63.33  ? 124  ASN A OD1   1 
ATOM   3139  N  ND2   . ASN G  4  124  ? 79.377  104.684 -37.153 1.00 64.09  ? 124  ASN A ND2   1 
ATOM   3140  N  N     . PRO G  4  125  ? 81.697  107.626 -41.018 1.00 64.77  ? 125  PRO A N     1 
ATOM   3141  C  CA    . PRO G  4  125  ? 81.351  108.992 -41.429 1.00 64.00  ? 125  PRO A CA    1 
ATOM   3142  C  C     . PRO G  4  125  ? 79.845  109.297 -41.378 1.00 64.03  ? 125  PRO A C     1 
ATOM   3143  O  O     . PRO G  4  125  ? 79.402  110.162 -40.603 1.00 63.56  ? 125  PRO A O     1 
ATOM   3144  C  CB    . PRO G  4  125  ? 81.913  109.084 -42.843 1.00 63.47  ? 125  PRO A CB    1 
ATOM   3145  C  CG    . PRO G  4  125  ? 82.924  107.954 -42.914 1.00 63.14  ? 125  PRO A CG    1 
ATOM   3146  C  CD    . PRO G  4  125  ? 82.204  106.889 -42.190 1.00 64.02  ? 125  PRO A CD    1 
ATOM   3147  N  N     . ASP G  4  126  ? 79.069  108.595 -42.198 1.00 63.07  ? 126  ASP A N     1 
ATOM   3148  C  CA    . ASP G  4  126  ? 77.639  108.870 -42.323 1.00 62.95  ? 126  ASP A CA    1 
ATOM   3149  C  C     . ASP G  4  126  ? 76.842  108.588 -41.044 1.00 61.96  ? 126  ASP A C     1 
ATOM   3150  O  O     . ASP G  4  126  ? 75.640  108.890 -41.027 1.00 62.91  ? 126  ASP A O     1 
ATOM   3151  C  CB    . ASP G  4  126  ? 77.042  108.069 -43.483 1.00 63.54  ? 126  ASP A CB    1 
ATOM   3152  C  CG    . ASP G  4  126  ? 76.524  108.963 -44.587 1.00 63.73  ? 126  ASP A CG    1 
ATOM   3153  O  OD1   . ASP G  4  126  ? 75.673  109.839 -44.296 1.00 64.01  ? 126  ASP A OD1   1 
ATOM   3154  O  OD2   . ASP G  4  126  ? 76.969  108.792 -45.739 1.00 65.05  ? 126  ASP A OD2   1 
ATOM   3155  N  N     . LEU G  4  127  ? 77.444  108.028 -39.993 1.00 59.99  ? 127  LEU A N     1 
ATOM   3156  C  CA    . LEU G  4  127  ? 76.672  107.809 -38.773 1.00 57.21  ? 127  LEU A CA    1 
ATOM   3157  C  C     . LEU G  4  127  ? 75.929  109.090 -38.373 1.00 55.94  ? 127  LEU A C     1 
ATOM   3158  O  O     . LEU G  4  127  ? 76.504  110.184 -38.361 1.00 54.66  ? 127  LEU A O     1 
ATOM   3159  C  CB    . LEU G  4  127  ? 77.595  107.351 -37.650 1.00 55.55  ? 127  LEU A CB    1 
ATOM   3160  C  CG    . LEU G  4  127  ? 77.326  107.732 -36.201 1.00 54.08  ? 127  LEU A CG    1 
ATOM   3161  C  CD1   . LEU G  4  127  ? 75.919  107.325 -35.759 1.00 52.98  ? 127  LEU A CD1   1 
ATOM   3162  C  CD2   . LEU G  4  127  ? 78.379  107.047 -35.367 1.00 53.93  ? 127  LEU A CD2   1 
ATOM   3163  N  N     . HIS G  4  128  ? 74.646  108.930 -38.063 1.00 56.66  ? 128  HIS A N     1 
ATOM   3164  C  CA    . HIS G  4  128  ? 73.771  110.044 -37.719 1.00 55.08  ? 128  HIS A CA    1 
ATOM   3165  C  C     . HIS G  4  128  ? 73.887  110.415 -36.261 1.00 54.23  ? 128  HIS A C     1 
ATOM   3166  O  O     . HIS G  4  128  ? 73.513  109.647 -35.376 1.00 54.70  ? 128  HIS A O     1 
ATOM   3167  C  CB    . HIS G  4  128  ? 72.308  109.674 -38.050 1.00 55.65  ? 128  HIS A CB    1 
ATOM   3168  C  CG    . HIS G  4  128  ? 71.309  110.775 -37.809 1.00 55.41  ? 128  HIS A CG    1 
ATOM   3169  N  ND1   . HIS G  4  128  ? 70.269  111.030 -38.677 1.00 54.42  ? 128  HIS A ND1   1 
ATOM   3170  C  CD2   . HIS G  4  128  ? 71.182  111.675 -36.802 1.00 54.63  ? 128  HIS A CD2   1 
ATOM   3171  C  CE1   . HIS G  4  128  ? 69.550  112.036 -38.218 1.00 53.78  ? 128  HIS A CE1   1 
ATOM   3172  N  NE2   . HIS G  4  128  ? 70.081  112.445 -37.081 1.00 53.97  ? 128  HIS A NE2   1 
ATOM   3173  N  N     . ILE G  4  129  ? 74.398  111.611 -36.016 1.00 51.90  ? 129  ILE A N     1 
ATOM   3174  C  CA    . ILE G  4  129  ? 74.479  112.087 -34.666 1.00 51.22  ? 129  ILE A CA    1 
ATOM   3175  C  C     . ILE G  4  129  ? 73.202  112.810 -34.294 1.00 50.61  ? 129  ILE A C     1 
ATOM   3176  O  O     . ILE G  4  129  ? 72.587  112.490 -33.285 1.00 50.32  ? 129  ILE A O     1 
ATOM   3177  C  CB    . ILE G  4  129  ? 75.708  113.017 -34.489 1.00 51.66  ? 129  ILE A CB    1 
ATOM   3178  C  CG1   . ILE G  4  129  ? 76.943  112.147 -34.222 1.00 51.32  ? 129  ILE A CG1   1 
ATOM   3179  C  CG2   . ILE G  4  129  ? 75.494  114.013 -33.326 1.00 52.68  ? 129  ILE A CG2   1 
ATOM   3180  C  CD1   . ILE G  4  129  ? 76.909  111.371 -32.903 1.00 50.98  ? 129  ILE A CD1   1 
ATOM   3181  N  N     . ALA G  4  130  ? 72.789  113.770 -35.110 1.00 49.65  ? 130  ALA A N     1 
ATOM   3182  C  CA    . ALA G  4  130  ? 71.584  114.492 -34.771 1.00 50.09  ? 130  ALA A CA    1 
ATOM   3183  C  C     . ALA G  4  130  ? 71.050  115.285 -35.930 1.00 51.33  ? 130  ALA A C     1 
ATOM   3184  O  O     . ALA G  4  130  ? 71.714  115.477 -36.955 1.00 51.07  ? 130  ALA A O     1 
ATOM   3185  C  CB    . ALA G  4  130  ? 71.848  115.432 -33.613 1.00 50.65  ? 130  ALA A CB    1 
ATOM   3186  N  N     . THR G  4  131  ? 69.817  115.737 -35.722 1.00 53.51  ? 131  THR A N     1 
ATOM   3187  C  CA    . THR G  4  131  ? 69.067  116.573 -36.642 1.00 54.42  ? 131  THR A CA    1 
ATOM   3188  C  C     . THR G  4  131  ? 68.872  117.947 -36.035 1.00 54.35  ? 131  THR A C     1 
ATOM   3189  O  O     . THR G  4  131  ? 68.149  118.092 -35.042 1.00 54.00  ? 131  THR A O     1 
ATOM   3190  C  CB    . THR G  4  131  ? 67.643  116.016 -36.931 1.00 55.68  ? 131  THR A CB    1 
ATOM   3191  O  OG1   . THR G  4  131  ? 66.867  116.081 -35.724 1.00 56.55  ? 131  THR A OG1   1 
ATOM   3192  C  CG2   . THR G  4  131  ? 67.682  114.580 -37.411 1.00 55.00  ? 131  THR A CG2   1 
ATOM   3193  N  N     . LEU G  4  132  ? 69.526  118.949 -36.606 1.00 55.86  ? 132  LEU A N     1 
ATOM   3194  C  CA    . LEU G  4  132  ? 69.381  120.308 -36.105 1.00 56.38  ? 132  LEU A CA    1 
ATOM   3195  C  C     . LEU G  4  132  ? 68.336  121.088 -36.928 1.00 58.39  ? 132  LEU A C     1 
ATOM   3196  O  O     . LEU G  4  132  ? 68.379  121.101 -38.174 1.00 58.04  ? 132  LEU A O     1 
ATOM   3197  C  CB    . LEU G  4  132  ? 70.740  120.996 -36.140 1.00 54.51  ? 132  LEU A CB    1 
ATOM   3198  C  CG    . LEU G  4  132  ? 71.286  121.489 -34.812 1.00 53.38  ? 132  LEU A CG    1 
ATOM   3199  C  CD1   . LEU G  4  132  ? 71.291  120.374 -33.780 1.00 53.21  ? 132  LEU A CD1   1 
ATOM   3200  C  CD2   . LEU G  4  132  ? 72.673  121.999 -35.048 1.00 50.75  ? 132  LEU A CD2   1 
ATOM   3201  N  N     . GLU G  4  133  ? 67.408  121.728 -36.210 1.00 58.00  ? 133  GLU A N     1 
ATOM   3202  C  CA    . GLU G  4  133  ? 66.274  122.468 -36.775 1.00 58.50  ? 133  GLU A CA    1 
ATOM   3203  C  C     . GLU G  4  133  ? 66.677  123.880 -37.229 1.00 58.59  ? 133  GLU A C     1 
ATOM   3204  O  O     . GLU G  4  133  ? 67.112  124.093 -38.355 1.00 58.32  ? 133  GLU A O     1 
ATOM   3205  C  CB    . GLU G  4  133  ? 65.181  122.482 -35.688 1.00 58.67  ? 133  GLU A CB    1 
ATOM   3206  C  CG    . GLU G  4  133  ? 64.120  123.561 -35.704 1.00 60.26  ? 133  GLU A CG    1 
ATOM   3207  C  CD    . GLU G  4  133  ? 63.690  123.934 -34.285 1.00 60.69  ? 133  GLU A CD    1 
ATOM   3208  O  OE1   . GLU G  4  133  ? 62.904  123.173 -33.681 1.00 61.81  ? 133  GLU A OE1   1 
ATOM   3209  O  OE2   . GLU G  4  133  ? 64.142  124.981 -33.767 1.00 60.42  ? 133  GLU A OE2   1 
ATOM   3210  N  N     . GLU G  4  134  ? 66.507  124.828 -36.328 1.00 59.24  ? 134  GLU A N     1 
ATOM   3211  C  CA    . GLU G  4  134  ? 66.817  126.230 -36.498 1.00 59.21  ? 134  GLU A CA    1 
ATOM   3212  C  C     . GLU G  4  134  ? 67.302  126.752 -35.200 1.00 59.48  ? 134  GLU A C     1 
ATOM   3213  O  O     . GLU G  4  134  ? 66.751  126.361 -34.175 1.00 60.21  ? 134  GLU A O     1 
ATOM   3214  C  CB    . GLU G  4  134  ? 65.577  127.031 -36.892 1.00 59.31  ? 134  GLU A CB    1 
ATOM   3215  C  CG    . GLU G  4  134  ? 64.958  126.696 -38.235 1.00 59.85  ? 134  GLU A CG    1 
ATOM   3216  C  CD    . GLU G  4  134  ? 65.683  127.356 -39.388 1.00 60.01  ? 134  GLU A CD    1 
ATOM   3217  O  OE1   . GLU G  4  134  ? 65.311  127.092 -40.552 1.00 59.61  ? 134  GLU A OE1   1 
ATOM   3218  O  OE2   . GLU G  4  134  ? 66.623  128.139 -39.125 1.00 60.02  ? 134  GLU A OE2   1 
ATOM   3219  N  N     . GLY G  4  135  ? 68.307  127.612 -35.197 1.00 61.76  ? 135  GLY A N     1 
ATOM   3220  C  CA    . GLY G  4  135  ? 68.809  128.067 -33.911 1.00 64.08  ? 135  GLY A CA    1 
ATOM   3221  C  C     . GLY G  4  135  ? 69.251  126.863 -33.102 1.00 64.79  ? 135  GLY A C     1 
ATOM   3222  O  O     . GLY G  4  135  ? 69.171  126.840 -31.867 1.00 64.56  ? 135  GLY A O     1 
ATOM   3223  N  N     . GLY G  4  136  ? 69.697  125.849 -33.847 1.00 65.40  ? 136  GLY A N     1 
ATOM   3224  C  CA    . GLY G  4  136  ? 70.167  124.611 -33.263 1.00 66.96  ? 136  GLY A CA    1 
ATOM   3225  C  C     . GLY G  4  136  ? 71.636  124.714 -32.974 1.00 68.18  ? 136  GLY A C     1 
ATOM   3226  O  O     . GLY G  4  136  ? 72.456  124.641 -33.885 1.00 69.12  ? 136  GLY A O     1 
ATOM   3227  N  N     . ARG G  4  137  ? 71.968  124.893 -31.701 1.00 68.41  ? 137  ARG A N     1 
ATOM   3228  C  CA    . ARG G  4  137  ? 73.354  125.050 -31.287 1.00 69.31  ? 137  ARG A CA    1 
ATOM   3229  C  C     . ARG G  4  137  ? 73.858  123.818 -30.571 1.00 69.75  ? 137  ARG A C     1 
ATOM   3230  O  O     . ARG G  4  137  ? 73.456  123.538 -29.443 1.00 68.67  ? 137  ARG A O     1 
ATOM   3231  C  CB    . ARG G  4  137  ? 73.507  126.253 -30.347 1.00 68.90  ? 137  ARG A CB    1 
ATOM   3232  C  CG    . ARG G  4  137  ? 72.836  127.547 -30.812 1.00 68.04  ? 137  ARG A CG    1 
ATOM   3233  C  CD    . ARG G  4  137  ? 73.170  128.749 -29.920 1.00 66.27  ? 137  ARG A CD    1 
ATOM   3234  N  NE    . ARG G  4  137  ? 72.001  129.604 -29.743 1.00 66.32  ? 137  ARG A NE    1 
ATOM   3235  C  CZ    . ARG G  4  137  ? 70.910  129.243 -29.070 1.00 66.50  ? 137  ARG A CZ    1 
ATOM   3236  N  NH1   . ARG G  4  137  ? 70.840  128.046 -28.503 1.00 65.44  ? 137  ARG A NH1   1 
ATOM   3237  N  NH2   . ARG G  4  137  ? 69.882  130.076 -28.972 1.00 66.84  ? 137  ARG A NH2   1 
ATOM   3238  N  N     . LEU G  4  138  ? 74.744  123.086 -31.243 1.00 72.39  ? 138  LEU A N     1 
ATOM   3239  C  CA    . LEU G  4  138  ? 75.354  121.891 -30.673 1.00 73.36  ? 138  LEU A CA    1 
ATOM   3240  C  C     . LEU G  4  138  ? 76.887  121.951 -30.787 1.00 74.18  ? 138  LEU A C     1 
ATOM   3241  O  O     . LEU G  4  138  ? 77.465  121.900 -31.878 1.00 74.05  ? 138  LEU A O     1 
ATOM   3242  C  CB    . LEU G  4  138  ? 74.801  120.609 -31.362 1.00 73.79  ? 138  LEU A CB    1 
ATOM   3243  C  CG    . LEU G  4  138  ? 75.370  119.919 -32.621 1.00 73.77  ? 138  LEU A CG    1 
ATOM   3244  C  CD1   . LEU G  4  138  ? 76.574  119.047 -32.249 1.00 73.97  ? 138  LEU A CD1   1 
ATOM   3245  C  CD2   . LEU G  4  138  ? 74.294  119.043 -33.251 1.00 72.95  ? 138  LEU A CD2   1 
ATOM   3246  N  N     . ASN G  4  139  ? 77.522  122.084 -29.622 1.00 75.23  ? 139  ASN A N     1 
ATOM   3247  C  CA    . ASN G  4  139  ? 78.977  122.141 -29.470 1.00 75.71  ? 139  ASN A CA    1 
ATOM   3248  C  C     . ASN G  4  139  ? 79.424  121.098 -28.449 1.00 73.69  ? 139  ASN A C     1 
ATOM   3249  O  O     . ASN G  4  139  ? 79.211  121.277 -27.246 1.00 72.70  ? 139  ASN A O     1 
ATOM   3250  C  CB    . ASN G  4  139  ? 79.396  123.567 -29.012 1.00 78.16  ? 139  ASN A CB    1 
ATOM   3251  C  CG    . ASN G  4  139  ? 80.940  123.805 -29.019 1.00 80.06  ? 139  ASN A CG    1 
ATOM   3252  O  OD1   . ASN G  4  139  ? 81.670  123.311 -29.894 1.00 81.56  ? 139  ASN A OD1   1 
ATOM   3253  N  ND2   . ASN G  4  139  ? 81.423  124.580 -28.044 1.00 80.49  ? 139  ASN A ND2   1 
ATOM   3254  N  N     . MET G  4  140  ? 80.029  120.010 -28.914 1.00 70.48  ? 140  MET A N     1 
ATOM   3255  C  CA    . MET G  4  140  ? 80.420  118.984 -27.974 1.00 67.94  ? 140  MET A CA    1 
ATOM   3256  C  C     . MET G  4  140  ? 81.832  118.502 -28.200 1.00 67.28  ? 140  MET A C     1 
ATOM   3257  O  O     . MET G  4  140  ? 82.429  118.711 -29.257 1.00 67.79  ? 140  MET A O     1 
ATOM   3258  C  CB    . MET G  4  140  ? 79.465  117.790 -28.055 1.00 67.48  ? 140  MET A CB    1 
ATOM   3259  C  CG    . MET G  4  140  ? 79.421  117.026 -29.370 1.00 65.85  ? 140  MET A CG    1 
ATOM   3260  S  SD    . MET G  4  140  ? 78.513  115.466 -29.126 1.00 64.05  ? 140  MET A SD    1 
ATOM   3261  C  CE    . MET G  4  140  ? 76.903  115.840 -29.776 1.00 64.95  ? 140  MET A CE    1 
ATOM   3262  N  N     . GLU G  4  141  ? 82.336  117.849 -27.151 1.00 65.64  ? 141  GLU A N     1 
ATOM   3263  C  CA    . GLU G  4  141  ? 83.656  117.226 -27.089 1.00 62.57  ? 141  GLU A CA    1 
ATOM   3264  C  C     . GLU G  4  141  ? 83.520  115.769 -26.669 1.00 60.32  ? 141  GLU A C     1 
ATOM   3265  O  O     . GLU G  4  141  ? 83.159  115.475 -25.530 1.00 59.59  ? 141  GLU A O     1 
ATOM   3266  C  CB    . GLU G  4  141  ? 84.556  117.966 -26.087 1.00 61.69  ? 141  GLU A CB    1 
ATOM   3267  C  CG    . GLU G  4  141  ? 83.884  118.332 -24.784 1.00 58.77  ? 141  GLU A CG    1 
ATOM   3268  C  CD    . GLU G  4  141  ? 83.355  119.756 -24.772 1.00 57.43  ? 141  GLU A CD    1 
ATOM   3269  O  OE1   . GLU G  4  141  ? 84.051  120.635 -24.223 1.00 57.41  ? 141  GLU A OE1   1 
ATOM   3270  O  OE2   . GLU G  4  141  ? 82.255  120.009 -25.307 1.00 55.57  ? 141  GLU A OE2   1 
ATOM   3271  N  N     . VAL G  4  142  ? 83.802  114.860 -27.593 1.00 58.41  ? 142  VAL A N     1 
ATOM   3272  C  CA    . VAL G  4  142  ? 83.649  113.451 -27.304 1.00 57.51  ? 142  VAL A CA    1 
ATOM   3273  C  C     . VAL G  4  142  ? 84.997  112.740 -27.190 1.00 56.68  ? 142  VAL A C     1 
ATOM   3274  O  O     . VAL G  4  142  ? 85.776  112.641 -28.140 1.00 55.27  ? 142  VAL A O     1 
ATOM   3275  C  CB    . VAL G  4  142  ? 82.739  112.783 -28.385 1.00 58.09  ? 142  VAL A CB    1 
ATOM   3276  C  CG1   . VAL G  4  142  ? 81.517  113.645 -28.573 1.00 58.51  ? 142  VAL A CG1   1 
ATOM   3277  C  CG2   . VAL G  4  142  ? 83.451  112.637 -29.720 1.00 58.19  ? 142  VAL A CG2   1 
ATOM   3278  N  N     . ARG G  4  143  ? 85.250  112.244 -25.986 1.00 55.91  ? 143  ARG A N     1 
ATOM   3279  C  CA    . ARG G  4  143  ? 86.478  111.541 -25.672 1.00 56.15  ? 143  ARG A CA    1 
ATOM   3280  C  C     . ARG G  4  143  ? 86.523  110.194 -26.369 1.00 57.06  ? 143  ARG A C     1 
ATOM   3281  O  O     . ARG G  4  143  ? 85.487  109.599 -26.646 1.00 57.79  ? 143  ARG A O     1 
ATOM   3282  C  CB    . ARG G  4  143  ? 86.577  111.348 -24.162 1.00 53.25  ? 143  ARG A CB    1 
ATOM   3283  C  CG    . ARG G  4  143  ? 87.924  110.898 -23.729 1.00 50.71  ? 143  ARG A CG    1 
ATOM   3284  C  CD    . ARG G  4  143  ? 88.402  111.706 -22.550 1.00 48.33  ? 143  ARG A CD    1 
ATOM   3285  N  NE    . ARG G  4  143  ? 88.394  110.920 -21.326 1.00 46.32  ? 143  ARG A NE    1 
ATOM   3286  C  CZ    . ARG G  4  143  ? 89.157  109.851 -21.114 1.00 44.94  ? 143  ARG A CZ    1 
ATOM   3287  N  NH1   . ARG G  4  143  ? 89.991  109.443 -22.049 1.00 44.46  ? 143  ARG A NH1   1 
ATOM   3288  N  NH2   . ARG G  4  143  ? 89.090  109.187 -19.971 1.00 43.93  ? 143  ARG A NH2   1 
ATOM   3289  N  N     . VAL G  4  144  ? 87.726  109.719 -26.657 1.00 58.20  ? 144  VAL A N     1 
ATOM   3290  C  CA    . VAL G  4  144  ? 87.912  108.425 -27.298 1.00 59.93  ? 144  VAL A CA    1 
ATOM   3291  C  C     . VAL G  4  144  ? 89.139  107.747 -26.744 1.00 59.95  ? 144  VAL A C     1 
ATOM   3292  O  O     . VAL G  4  144  ? 90.187  108.380 -26.666 1.00 60.64  ? 144  VAL A O     1 
ATOM   3293  C  CB    . VAL G  4  144  ? 88.092  108.563 -28.832 1.00 61.32  ? 144  VAL A CB    1 
ATOM   3294  C  CG1   . VAL G  4  144  ? 88.290  107.187 -29.450 1.00 62.39  ? 144  VAL A CG1   1 
ATOM   3295  C  CG2   . VAL G  4  144  ? 86.859  109.236 -29.453 1.00 62.65  ? 144  VAL A CG2   1 
ATOM   3296  N  N     . ASP G  4  145  ? 89.028  106.473 -26.366 1.00 59.93  ? 145  ASP A N     1 
ATOM   3297  C  CA    . ASP G  4  145  ? 90.185  105.795 -25.790 1.00 59.95  ? 145  ASP A CA    1 
ATOM   3298  C  C     . ASP G  4  145  ? 90.395  104.399 -26.340 1.00 60.33  ? 145  ASP A C     1 
ATOM   3299  O  O     . ASP G  4  145  ? 89.544  103.808 -26.991 1.00 60.21  ? 145  ASP A O     1 
ATOM   3300  C  CB    . ASP G  4  145  ? 90.043  105.717 -24.276 1.00 58.81  ? 145  ASP A CB    1 
ATOM   3301  C  CG    . ASP G  4  145  ? 90.777  106.846 -23.589 1.00 57.92  ? 145  ASP A CG    1 
ATOM   3302  O  OD1   . ASP G  4  145  ? 90.563  108.004 -23.996 1.00 56.60  ? 145  ASP A OD1   1 
ATOM   3303  O  OD2   . ASP G  4  145  ? 91.565  106.579 -22.657 1.00 56.81  ? 145  ASP A OD2   1 
ATOM   3304  N  N     . ARG G  4  146  ? 91.584  103.896 -26.052 1.00 61.55  ? 146  ARG A N     1 
ATOM   3305  C  CA    . ARG G  4  146  ? 91.992  102.567 -26.436 1.00 63.32  ? 146  ARG A CA    1 
ATOM   3306  C  C     . ARG G  4  146  ? 91.931  101.641 -25.237 1.00 64.68  ? 146  ARG A C     1 
ATOM   3307  O  O     . ARG G  4  146  ? 92.598  101.886 -24.237 1.00 64.91  ? 146  ARG A O     1 
ATOM   3308  C  CB    . ARG G  4  146  ? 93.420  102.623 -26.992 1.00 63.58  ? 146  ARG A CB    1 
ATOM   3309  C  CG    . ARG G  4  146  ? 94.148  101.295 -27.059 1.00 63.35  ? 146  ARG A CG    1 
ATOM   3310  C  CD    . ARG G  4  146  ? 95.605  101.455 -27.437 1.00 62.27  ? 146  ARG A CD    1 
ATOM   3311  N  NE    . ARG G  4  146  ? 96.121  100.191 -27.941 1.00 63.27  ? 146  ARG A NE    1 
ATOM   3312  C  CZ    . ARG G  4  146  ? 97.361  99.992  -28.380 1.00 63.61  ? 146  ARG A CZ    1 
ATOM   3313  N  NH1   . ARG G  4  146  ? 98.250  100.981 -28.383 1.00 63.04  ? 146  ARG A NH1   1 
ATOM   3314  N  NH2   . ARG G  4  146  ? 97.707  98.793  -28.827 1.00 64.45  ? 146  ARG A NH2   1 
ATOM   3315  N  N     . GLY G  4  147  ? 91.132  100.590 -25.328 1.00 66.52  ? 147  GLY A N     1 
ATOM   3316  C  CA    . GLY G  4  147  ? 91.035  99.665  -24.215 1.00 69.08  ? 147  GLY A CA    1 
ATOM   3317  C  C     . GLY G  4  147  ? 90.672  98.265  -24.665 1.00 70.58  ? 147  GLY A C     1 
ATOM   3318  O  O     . GLY G  4  147  ? 90.877  97.909  -25.829 1.00 70.20  ? 147  GLY A O     1 
ATOM   3319  N  N     . VAL G  4  148  ? 90.134  97.470  -23.739 1.00 72.33  ? 148  VAL A N     1 
ATOM   3320  C  CA    . VAL G  4  148  ? 89.728  96.098  -24.040 1.00 73.50  ? 148  VAL A CA    1 
ATOM   3321  C  C     . VAL G  4  148  ? 88.430  95.720  -23.304 1.00 74.12  ? 148  VAL A C     1 
ATOM   3322  O  O     . VAL G  4  148  ? 88.203  96.134  -22.158 1.00 73.85  ? 148  VAL A O     1 
ATOM   3323  C  CB    . VAL G  4  148  ? 90.815  95.061  -23.627 1.00 74.05  ? 148  VAL A CB    1 
ATOM   3324  C  CG1   . VAL G  4  148  ? 90.561  93.755  -24.380 1.00 73.29  ? 148  VAL A CG1   1 
ATOM   3325  C  CG2   . VAL G  4  148  ? 92.215  95.589  -23.918 1.00 73.90  ? 148  VAL A CG2   1 
ATOM   3326  N  N     . GLY G  4  149  ? 87.590  94.933  -23.979 1.00 74.09  ? 149  GLY A N     1 
ATOM   3327  C  CA    . GLY G  4  149  ? 86.334  94.475  -23.400 1.00 73.76  ? 149  GLY A CA    1 
ATOM   3328  C  C     . GLY G  4  149  ? 85.280  95.561  -23.233 1.00 73.39  ? 149  GLY A C     1 
ATOM   3329  O  O     . GLY G  4  149  ? 85.252  96.553  -23.974 1.00 73.06  ? 149  GLY A O     1 
ATOM   3330  N  N     . TYR G  4  150  ? 84.409  95.350  -22.241 1.00 72.41  ? 150  TYR A N     1 
ATOM   3331  C  CA    . TYR G  4  150  ? 83.305  96.258  -21.906 1.00 70.55  ? 150  TYR A CA    1 
ATOM   3332  C  C     . TYR G  4  150  ? 83.535  96.923  -20.542 1.00 69.25  ? 150  TYR A C     1 
ATOM   3333  O  O     . TYR G  4  150  ? 83.817  96.243  -19.549 1.00 69.37  ? 150  TYR A O     1 
ATOM   3334  C  CB    . TYR G  4  150  ? 81.984  95.454  -21.915 1.00 70.10  ? 150  TYR A CB    1 
ATOM   3335  C  CG    . TYR G  4  150  ? 80.854  95.971  -21.044 1.00 69.07  ? 150  TYR A CG    1 
ATOM   3336  C  CD1   . TYR G  4  150  ? 80.115  97.113  -21.412 1.00 68.16  ? 150  TYR A CD1   1 
ATOM   3337  C  CD2   . TYR G  4  150  ? 80.530  95.327  -19.819 1.00 68.37  ? 150  TYR A CD2   1 
ATOM   3338  C  CE1   . TYR G  4  150  ? 79.069  97.615  -20.573 1.00 68.13  ? 150  TYR A CE1   1 
ATOM   3339  C  CE2   . TYR G  4  150  ? 79.488  95.822  -18.971 1.00 67.99  ? 150  TYR A CE2   1 
ATOM   3340  C  CZ    . TYR G  4  150  ? 78.772  96.965  -19.362 1.00 67.76  ? 150  TYR A CZ    1 
ATOM   3341  O  OH    . TYR G  4  150  ? 77.790  97.473  -18.552 1.00 68.14  ? 150  TYR A OH    1 
ATOM   3342  N  N     . VAL G  4  151  ? 83.423  98.248  -20.506 1.00 67.03  ? 151  VAL A N     1 
ATOM   3343  C  CA    . VAL G  4  151  ? 83.618  99.002  -19.273 1.00 65.45  ? 151  VAL A CA    1 
ATOM   3344  C  C     . VAL G  4  151  ? 82.437  99.901  -18.999 1.00 64.42  ? 151  VAL A C     1 
ATOM   3345  O  O     . VAL G  4  151  ? 82.275  100.917 -19.670 1.00 63.76  ? 151  VAL A O     1 
ATOM   3346  C  CB    . VAL G  4  151  ? 84.870  99.887  -19.350 1.00 65.26  ? 151  VAL A CB    1 
ATOM   3347  C  CG1   . VAL G  4  151  ? 84.966  100.769 -18.117 1.00 65.65  ? 151  VAL A CG1   1 
ATOM   3348  C  CG2   . VAL G  4  151  ? 86.097  99.020  -19.489 1.00 66.30  ? 151  VAL A CG2   1 
ATOM   3349  N  N     . PRO G  4  152  ? 81.605  99.549  -18.003 1.00 64.30  ? 152  PRO A N     1 
ATOM   3350  C  CA    . PRO G  4  152  ? 80.447  100.391 -17.696 1.00 64.09  ? 152  PRO A CA    1 
ATOM   3351  C  C     . PRO G  4  152  ? 80.869  101.842 -17.451 1.00 63.78  ? 152  PRO A C     1 
ATOM   3352  O  O     . PRO G  4  152  ? 81.953  102.089 -16.901 1.00 62.82  ? 152  PRO A O     1 
ATOM   3353  C  CB    . PRO G  4  152  ? 79.843  99.726  -16.454 1.00 63.90  ? 152  PRO A CB    1 
ATOM   3354  C  CG    . PRO G  4  152  ? 80.352  98.322  -16.494 1.00 64.19  ? 152  PRO A CG    1 
ATOM   3355  C  CD    . PRO G  4  152  ? 81.761  98.492  -16.985 1.00 64.29  ? 152  PRO A CD    1 
ATOM   3356  N  N     . ALA G  4  153  ? 80.022  102.789 -17.864 1.00 63.94  ? 153  ALA A N     1 
ATOM   3357  C  CA    . ALA G  4  153  ? 80.288  104.214 -17.664 1.00 62.38  ? 153  ALA A CA    1 
ATOM   3358  C  C     . ALA G  4  153  ? 80.465  104.517 -16.181 1.00 62.18  ? 153  ALA A C     1 
ATOM   3359  O  O     . ALA G  4  153  ? 81.061  105.522 -15.778 1.00 62.80  ? 153  ALA A O     1 
ATOM   3360  C  CB    . ALA G  4  153  ? 79.128  105.048 -18.230 1.00 62.91  ? 153  ALA A CB    1 
ATOM   3361  N  N     . GLU G  4  154  ? 79.936  103.616 -15.374 1.00 61.11  ? 154  GLU A N     1 
ATOM   3362  C  CA    . GLU G  4  154  ? 80.008  103.726 -13.940 1.00 58.56  ? 154  GLU A CA    1 
ATOM   3363  C  C     . GLU G  4  154  ? 81.381  103.267 -13.421 1.00 58.60  ? 154  GLU A C     1 
ATOM   3364  O  O     . GLU G  4  154  ? 81.869  103.799 -12.432 1.00 59.72  ? 154  GLU A O     1 
ATOM   3365  C  CB    . GLU G  4  154  ? 78.884  102.887 -13.334 1.00 57.17  ? 154  GLU A CB    1 
ATOM   3366  C  CG    . GLU G  4  154  ? 77.518  103.099 -14.022 1.00 53.42  ? 154  GLU A CG    1 
ATOM   3367  C  CD    . GLU G  4  154  ? 77.388  102.367 -15.352 1.00 50.87  ? 154  GLU A CD    1 
ATOM   3368  O  OE1   . GLU G  4  154  ? 77.617  101.150 -15.367 1.00 49.35  ? 154  GLU A OE1   1 
ATOM   3369  O  OE2   . GLU G  4  154  ? 77.056  102.997 -16.379 1.00 50.00  ? 154  GLU A OE2   1 
ATOM   3370  N  N     . LYS G  4  155  ? 82.004  102.296 -14.092 1.00 58.11  ? 155  LYS A N     1 
ATOM   3371  C  CA    . LYS G  4  155  ? 83.291  101.769 -13.644 1.00 58.09  ? 155  LYS A CA    1 
ATOM   3372  C  C     . LYS G  4  155  ? 84.416  102.783 -13.796 1.00 57.91  ? 155  LYS A C     1 
ATOM   3373  O  O     . LYS G  4  155  ? 85.196  102.967 -12.862 1.00 56.74  ? 155  LYS A O     1 
ATOM   3374  C  CB    . LYS G  4  155  ? 83.666  100.503 -14.418 1.00 57.71  ? 155  LYS A CB    1 
ATOM   3375  C  CG    . LYS G  4  155  ? 85.060  99.911  -14.057 1.00 58.53  ? 155  LYS A CG    1 
ATOM   3376  C  CD    . LYS G  4  155  ? 85.136  99.253  -12.652 1.00 59.00  ? 155  LYS A CD    1 
ATOM   3377  C  CE    . LYS G  4  155  ? 85.300  100.267 -11.500 1.00 58.87  ? 155  LYS A CE    1 
ATOM   3378  N  NZ    . LYS G  4  155  ? 85.216  99.647  -10.148 1.00 58.26  ? 155  LYS A NZ    1 
ATOM   3379  N  N     . HIS G  4  156  ? 84.519  103.441 -14.949 1.00 58.42  ? 156  HIS A N     1 
ATOM   3380  C  CA    . HIS G  4  156  ? 85.613  104.400 -15.146 1.00 59.07  ? 156  HIS A CA    1 
ATOM   3381  C  C     . HIS G  4  156  ? 85.255  105.811 -14.663 1.00 59.38  ? 156  HIS A C     1 
ATOM   3382  O  O     . HIS G  4  156  ? 86.060  106.408 -13.939 1.00 58.96  ? 156  HIS A O     1 
ATOM   3383  C  CB    . HIS G  4  156  ? 86.070  104.445 -16.626 1.00 60.36  ? 156  HIS A CB    1 
ATOM   3384  C  CG    . HIS G  4  156  ? 84.964  104.469 -17.624 1.00 60.77  ? 156  HIS A CG    1 
ATOM   3385  N  ND1   . HIS G  4  156  ? 85.173  104.149 -18.945 1.00 60.87  ? 156  HIS A ND1   1 
ATOM   3386  C  CD2   . HIS G  4  156  ? 83.649  104.766 -17.509 1.00 60.96  ? 156  HIS A CD2   1 
ATOM   3387  C  CE1   . HIS G  4  156  ? 84.032  104.246 -19.603 1.00 62.11  ? 156  HIS A CE1   1 
ATOM   3388  N  NE2   . HIS G  4  156  ? 83.092  104.620 -18.754 1.00 61.81  ? 156  HIS A NE2   1 
ATOM   3389  N  N     . GLY G  4  157  ? 84.092  106.345 -15.039 1.00 58.11  ? 157  GLY A N     1 
ATOM   3390  C  CA    . GLY G  4  157  ? 83.712  107.684 -14.605 1.00 58.39  ? 157  GLY A CA    1 
ATOM   3391  C  C     . GLY G  4  157  ? 84.740  108.733 -14.981 1.00 59.41  ? 157  GLY A C     1 
ATOM   3392  O  O     . GLY G  4  157  ? 85.521  109.218 -14.152 1.00 59.64  ? 157  GLY A O     1 
ATOM   3393  N  N     . ILE G  4  158  ? 84.738  109.086 -16.254 1.00 59.87  ? 158  ILE A N     1 
ATOM   3394  C  CA    . ILE G  4  158  ? 85.683  110.055 -16.773 1.00 60.40  ? 158  ILE A CA    1 
ATOM   3395  C  C     . ILE G  4  158  ? 85.203  111.478 -16.536 1.00 60.03  ? 158  ILE A C     1 
ATOM   3396  O  O     . ILE G  4  158  ? 83.999  111.769 -16.577 1.00 59.53  ? 158  ILE A O     1 
ATOM   3397  C  CB    . ILE G  4  158  ? 85.916  109.771 -18.287 1.00 61.20  ? 158  ILE A CB    1 
ATOM   3398  C  CG1   . ILE G  4  158  ? 86.617  108.397 -18.432 1.00 60.51  ? 158  ILE A CG1   1 
ATOM   3399  C  CG2   . ILE G  4  158  ? 86.687  110.908 -18.926 1.00 61.20  ? 158  ILE A CG2   1 
ATOM   3400  C  CD1   . ILE G  4  158  ? 87.805  108.122 -17.483 1.00 58.77  ? 158  ILE A CD1   1 
ATOM   3401  N  N     . LYS G  4  159  ? 86.154  112.368 -16.275 1.00 60.43  ? 159  LYS A N     1 
ATOM   3402  C  CA    . LYS G  4  159  ? 85.775  113.735 -16.022 1.00 60.59  ? 159  LYS A CA    1 
ATOM   3403  C  C     . LYS G  4  159  ? 86.770  114.739 -16.586 1.00 58.64  ? 159  LYS A C     1 
ATOM   3404  O  O     . LYS G  4  159  ? 87.607  115.288 -15.873 1.00 59.51  ? 159  LYS A O     1 
ATOM   3405  C  CB    . LYS G  4  159  ? 85.582  113.940 -14.519 1.00 62.19  ? 159  LYS A CB    1 
ATOM   3406  C  CG    . LYS G  4  159  ? 84.127  113.637 -14.084 1.00 64.46  ? 159  LYS A CG    1 
ATOM   3407  C  CD    . LYS G  4  159  ? 83.080  114.371 -14.964 1.00 66.31  ? 159  LYS A CD    1 
ATOM   3408  C  CE    . LYS G  4  159  ? 81.636  114.073 -14.548 1.00 67.92  ? 159  LYS A CE    1 
ATOM   3409  N  NZ    . LYS G  4  159  ? 81.202  114.788 -13.296 1.00 69.90  ? 159  LYS A NZ    1 
ATOM   3410  N  N     . ASP G  4  160  ? 86.674  114.973 -17.887 1.00 55.81  ? 160  ASP A N     1 
ATOM   3411  C  CA    . ASP G  4  160  ? 87.505  115.978 -18.496 1.00 53.50  ? 160  ASP A CA    1 
ATOM   3412  C  C     . ASP G  4  160  ? 87.004  117.350 -18.058 1.00 52.43  ? 160  ASP A C     1 
ATOM   3413  O  O     . ASP G  4  160  ? 87.763  118.207 -17.590 1.00 51.58  ? 160  ASP A O     1 
ATOM   3414  C  CB    . ASP G  4  160  ? 87.449  115.803 -20.015 1.00 53.41  ? 160  ASP A CB    1 
ATOM   3415  C  CG    . ASP G  4  160  ? 87.787  114.371 -20.445 1.00 52.77  ? 160  ASP A CG    1 
ATOM   3416  O  OD1   . ASP G  4  160  ? 86.848  113.596 -20.735 1.00 52.47  ? 160  ASP A OD1   1 
ATOM   3417  O  OD2   . ASP G  4  160  ? 88.992  114.023 -20.489 1.00 52.18  ? 160  ASP A OD2   1 
ATOM   3418  N  N     . ARG G  4  161  ? 85.690  117.512 -18.210 1.00 50.39  ? 161  ARG A N     1 
ATOM   3419  C  CA    . ARG G  4  161  ? 84.953  118.684 -17.775 1.00 47.55  ? 161  ARG A CA    1 
ATOM   3420  C  C     . ARG G  4  161  ? 83.989  118.274 -16.691 1.00 47.04  ? 161  ARG A C     1 
ATOM   3421  O  O     . ARG G  4  161  ? 83.388  117.202 -16.787 1.00 46.74  ? 161  ARG A O     1 
ATOM   3422  C  CB    . ARG G  4  161  ? 84.194  119.301 -18.943 1.00 46.87  ? 161  ARG A CB    1 
ATOM   3423  C  CG    . ARG G  4  161  ? 84.547  120.742 -19.152 1.00 48.09  ? 161  ARG A CG    1 
ATOM   3424  C  CD    . ARG G  4  161  ? 84.542  121.155 -20.615 1.00 48.02  ? 161  ARG A CD    1 
ATOM   3425  N  NE    . ARG G  4  161  ? 85.575  120.500 -21.426 1.00 49.77  ? 161  ARG A NE    1 
ATOM   3426  C  CZ    . ARG G  4  161  ? 85.474  119.284 -21.970 1.00 50.32  ? 161  ARG A CZ    1 
ATOM   3427  N  NH1   . ARG G  4  161  ? 84.383  118.562 -21.800 1.00 50.18  ? 161  ARG A NH1   1 
ATOM   3428  N  NH2   . ARG G  4  161  ? 86.468  118.783 -22.698 1.00 50.03  ? 161  ARG A NH2   1 
ATOM   3429  N  N     . ILE G  4  162  ? 83.841  119.096 -15.662 1.00 46.49  ? 162  ILE A N     1 
ATOM   3430  C  CA    . ILE G  4  162  ? 82.996  118.756 -14.511 1.00 45.71  ? 162  ILE A CA    1 
ATOM   3431  C  C     . ILE G  4  162  ? 81.557  118.329 -14.907 1.00 45.40  ? 162  ILE A C     1 
ATOM   3432  O  O     . ILE G  4  162  ? 81.005  117.416 -14.268 1.00 43.76  ? 162  ILE A O     1 
ATOM   3433  C  CB    . ILE G  4  162  ? 82.910  119.951 -13.521 1.00 45.27  ? 162  ILE A CB    1 
ATOM   3434  C  CG1   . ILE G  4  162  ? 82.534  121.228 -14.289 1.00 44.43  ? 162  ILE A CG1   1 
ATOM   3435  C  CG2   . ILE G  4  162  ? 84.240  120.094 -12.783 1.00 43.28  ? 162  ILE A CG2   1 
ATOM   3436  C  CD1   . ILE G  4  162  ? 81.736  122.234 -13.497 1.00 43.88  ? 162  ILE A CD1   1 
ATOM   3437  N  N     . ASN G  4  163  ? 80.956  118.955 -15.928 1.00 43.92  ? 163  ASN A N     1 
ATOM   3438  C  CA    . ASN G  4  163  ? 79.563  118.644 -16.307 1.00 42.51  ? 163  ASN A CA    1 
ATOM   3439  C  C     . ASN G  4  163  ? 79.468  117.559 -17.405 1.00 41.91  ? 163  ASN A C     1 
ATOM   3440  O  O     . ASN G  4  163  ? 78.357  117.191 -17.811 1.00 41.75  ? 163  ASN A O     1 
ATOM   3441  C  CB    . ASN G  4  163  ? 78.856  119.929 -16.769 1.00 41.87  ? 163  ASN A CB    1 
ATOM   3442  C  CG    . ASN G  4  163  ? 78.782  120.978 -15.666 1.00 40.81  ? 163  ASN A CG    1 
ATOM   3443  O  OD1   . ASN G  4  163  ? 78.119  122.010 -15.803 1.00 40.67  ? 163  ASN A OD1   1 
ATOM   3444  N  ND2   . ASN G  4  163  ? 79.463  120.715 -14.571 1.00 39.71  ? 163  ASN A ND2   1 
ATOM   3445  N  N     . ALA G  4  164  ? 80.606  117.049 -17.882 1.00 39.01  ? 164  ALA A N     1 
ATOM   3446  C  CA    . ALA G  4  164  ? 80.592  116.005 -18.897 1.00 36.54  ? 164  ALA A CA    1 
ATOM   3447  C  C     . ALA G  4  164  ? 79.934  114.759 -18.353 1.00 36.13  ? 164  ALA A C     1 
ATOM   3448  O  O     . ALA G  4  164  ? 79.817  114.599 -17.140 1.00 33.56  ? 164  ALA A O     1 
ATOM   3449  C  CB    . ALA G  4  164  ? 82.016  115.684 -19.342 1.00 35.72  ? 164  ALA A CB    1 
ATOM   3450  N  N     . ILE G  4  165  ? 79.495  113.881 -19.250 1.00 37.21  ? 165  ILE A N     1 
ATOM   3451  C  CA    . ILE G  4  165  ? 78.867  112.631 -18.837 1.00 38.03  ? 165  ILE A CA    1 
ATOM   3452  C  C     . ILE G  4  165  ? 79.548  111.416 -19.495 1.00 38.75  ? 165  ILE A C     1 
ATOM   3453  O  O     . ILE G  4  165  ? 79.671  111.338 -20.724 1.00 38.51  ? 165  ILE A O     1 
ATOM   3454  C  CB    . ILE G  4  165  ? 77.323  112.620 -19.156 1.00 37.46  ? 165  ILE A CB    1 
ATOM   3455  C  CG1   . ILE G  4  165  ? 77.053  112.712 -20.653 1.00 36.70  ? 165  ILE A CG1   1 
ATOM   3456  C  CG2   . ILE G  4  165  ? 76.660  113.768 -18.414 1.00 37.34  ? 165  ILE A CG2   1 
ATOM   3457  C  CD1   . ILE G  4  165  ? 76.625  111.386 -21.244 1.00 36.15  ? 165  ILE A CD1   1 
ATOM   3458  N  N     . PRO G  4  166  ? 80.024  110.460 -18.668 1.00 39.48  ? 166  PRO A N     1 
ATOM   3459  C  CA    . PRO G  4  166  ? 80.685  109.273 -19.213 1.00 38.58  ? 166  PRO A CA    1 
ATOM   3460  C  C     . PRO G  4  166  ? 79.733  108.395 -20.017 1.00 38.26  ? 166  PRO A C     1 
ATOM   3461  O  O     . PRO G  4  166  ? 78.502  108.451 -19.867 1.00 38.30  ? 166  PRO A O     1 
ATOM   3462  C  CB    . PRO G  4  166  ? 81.235  108.584 -17.973 1.00 38.57  ? 166  PRO A CB    1 
ATOM   3463  C  CG    . PRO G  4  166  ? 81.551  109.729 -17.074 1.00 39.66  ? 166  PRO A CG    1 
ATOM   3464  C  CD    . PRO G  4  166  ? 80.278  110.543 -17.215 1.00 40.59  ? 166  PRO A CD    1 
ATOM   3465  N  N     . VAL G  4  167  ? 80.328  107.584 -20.879 1.00 36.58  ? 167  VAL A N     1 
ATOM   3466  C  CA    . VAL G  4  167  ? 79.562  106.669 -21.701 1.00 35.88  ? 167  VAL A CA    1 
ATOM   3467  C  C     . VAL G  4  167  ? 80.153  105.290 -21.640 1.00 33.85  ? 167  VAL A C     1 
ATOM   3468  O  O     . VAL G  4  167  ? 81.348  105.140 -21.449 1.00 32.18  ? 167  VAL A O     1 
ATOM   3469  C  CB    . VAL G  4  167  ? 79.512  107.147 -23.180 1.00 38.36  ? 167  VAL A CB    1 
ATOM   3470  C  CG1   . VAL G  4  167  ? 78.659  106.194 -24.024 1.00 38.35  ? 167  VAL A CG1   1 
ATOM   3471  C  CG2   . VAL G  4  167  ? 78.880  108.552 -23.237 1.00 38.20  ? 167  VAL A CG2   1 
ATOM   3472  N  N     . ASP G  4  168  ? 79.300  104.290 -21.798 1.00 32.84  ? 168  ASP A N     1 
ATOM   3473  C  CA    . ASP G  4  168  ? 79.703  102.903 -21.736 1.00 31.63  ? 168  ASP A CA    1 
ATOM   3474  C  C     . ASP G  4  168  ? 80.729  102.571 -22.827 1.00 30.90  ? 168  ASP A C     1 
ATOM   3475  O  O     . ASP G  4  168  ? 80.593  102.987 -23.968 1.00 29.96  ? 168  ASP A O     1 
ATOM   3476  C  CB    . ASP G  4  168  ? 78.438  102.049 -21.836 1.00 31.61  ? 168  ASP A CB    1 
ATOM   3477  C  CG    . ASP G  4  168  ? 77.421  102.363 -20.714 1.00 31.63  ? 168  ASP A CG    1 
ATOM   3478  O  OD1   . ASP G  4  168  ? 77.689  101.997 -19.548 1.00 31.24  ? 168  ASP A OD1   1 
ATOM   3479  O  OD2   . ASP G  4  168  ? 76.356  102.979 -20.993 1.00 32.08  ? 168  ASP A OD2   1 
ATOM   3480  N  N     . ALA G  4  169  ? 81.749  101.811 -22.442 1.00 32.23  ? 169  ALA A N     1 
ATOM   3481  C  CA    . ALA G  4  169  ? 82.864  101.443 -23.301 1.00 33.40  ? 169  ALA A CA    1 
ATOM   3482  C  C     . ALA G  4  169  ? 82.625  100.127 -24.037 1.00 35.96  ? 169  ALA A C     1 
ATOM   3483  O  O     . ALA G  4  169  ? 82.326  99.089  -23.433 1.00 36.81  ? 169  ALA A O     1 
ATOM   3484  C  CB    . ALA G  4  169  ? 84.111  101.346 -22.462 1.00 33.05  ? 169  ALA A CB    1 
ATOM   3485  N  N     . VAL G  4  170  ? 82.775  100.203 -25.357 1.00 37.40  ? 170  VAL A N     1 
ATOM   3486  C  CA    . VAL G  4  170  ? 82.649  99.084  -26.294 1.00 40.37  ? 170  VAL A CA    1 
ATOM   3487  C  C     . VAL G  4  170  ? 83.948  98.946  -27.084 1.00 43.65  ? 170  VAL A C     1 
ATOM   3488  O  O     . VAL G  4  170  ? 84.130  99.576  -28.122 1.00 43.64  ? 170  VAL A O     1 
ATOM   3489  C  CB    . VAL G  4  170  ? 81.477  99.337  -27.257 1.00 39.25  ? 170  VAL A CB    1 
ATOM   3490  C  CG1   . VAL G  4  170  ? 80.172  99.012  -26.572 1.00 38.85  ? 170  VAL A CG1   1 
ATOM   3491  C  CG2   . VAL G  4  170  ? 81.486  100.805 -27.703 1.00 38.10  ? 170  VAL A CG2   1 
ATOM   3492  N  N     . PHE G  4  171  ? 84.845  98.096  -26.593 1.00 46.38  ? 171  PHE A N     1 
ATOM   3493  C  CA    . PHE G  4  171  ? 86.197  98.023  -27.137 1.00 49.80  ? 171  PHE A CA    1 
ATOM   3494  C  C     . PHE G  4  171  ? 86.474  96.837  -28.093 1.00 52.65  ? 171  PHE A C     1 
ATOM   3495  O  O     . PHE G  4  171  ? 87.660  96.635  -28.393 1.00 52.91  ? 171  PHE A O     1 
ATOM   3496  C  CB    . PHE G  4  171  ? 87.168  97.973  -25.964 1.00 49.13  ? 171  PHE A CB    1 
ATOM   3497  C  CG    . PHE G  4  171  ? 87.362  99.301  -25.274 1.00 49.96  ? 171  PHE A CG    1 
ATOM   3498  C  CD1   . PHE G  4  171  ? 87.936  100.403 -25.969 1.00 49.29  ? 171  PHE A CD1   1 
ATOM   3499  C  CD2   . PHE G  4  171  ? 86.997  99.463  -23.915 1.00 49.31  ? 171  PHE A CD2   1 
ATOM   3500  C  CE1   . PHE G  4  171  ? 88.150  101.654 -25.324 1.00 47.99  ? 171  PHE A CE1   1 
ATOM   3501  C  CE2   . PHE G  4  171  ? 87.207  100.716 -23.251 1.00 48.72  ? 171  PHE A CE2   1 
ATOM   3502  C  CZ    . PHE G  4  171  ? 87.787  101.811 -23.965 1.00 48.34  ? 171  PHE A CZ    1 
ATOM   3503  N  N     . SER G  4  172  ? 85.510  96.056  -28.590 1.00 55.06  ? 172  SER A N     1 
ATOM   3504  C  CA    . SER G  4  172  ? 85.926  94.971  -29.521 1.00 57.77  ? 172  SER A CA    1 
ATOM   3505  C  C     . SER G  4  172  ? 85.802  95.399  -30.982 1.00 57.75  ? 172  SER A C     1 
ATOM   3506  O  O     . SER G  4  172  ? 84.692  95.564  -31.491 1.00 58.87  ? 172  SER A O     1 
ATOM   3507  C  CB    . SER G  4  172  ? 85.091  93.697  -29.342 1.00 59.30  ? 172  SER A CB    1 
ATOM   3508  O  OG    . SER G  4  172  ? 85.272  92.818  -30.453 1.00 59.56  ? 172  SER A OG    1 
ATOM   3509  N  N     . PRO G  4  173  ? 86.935  95.572  -31.682 1.00 57.33  ? 173  PRO A N     1 
ATOM   3510  C  CA    . PRO G  4  173  ? 86.774  95.977  -33.078 1.00 56.82  ? 173  PRO A CA    1 
ATOM   3511  C  C     . PRO G  4  173  ? 86.166  94.859  -33.927 1.00 56.47  ? 173  PRO A C     1 
ATOM   3512  O  O     . PRO G  4  173  ? 85.968  95.034  -35.134 1.00 56.27  ? 173  PRO A O     1 
ATOM   3513  C  CB    . PRO G  4  173  ? 88.192  96.363  -33.491 1.00 57.23  ? 173  PRO A CB    1 
ATOM   3514  C  CG    . PRO G  4  173  ? 88.758  96.891  -32.213 1.00 56.82  ? 173  PRO A CG    1 
ATOM   3515  C  CD    . PRO G  4  173  ? 88.316  95.818  -31.237 1.00 57.92  ? 173  PRO A CD    1 
ATOM   3516  N  N     . VAL G  4  174  ? 85.859  93.727  -33.289 1.00 55.25  ? 174  VAL A N     1 
ATOM   3517  C  CA    . VAL G  4  174  ? 85.302  92.570  -34.003 1.00 54.42  ? 174  VAL A CA    1 
ATOM   3518  C  C     . VAL G  4  174  ? 83.858  92.336  -33.653 1.00 52.48  ? 174  VAL A C     1 
ATOM   3519  O  O     . VAL G  4  174  ? 83.525  92.191  -32.470 1.00 51.44  ? 174  VAL A O     1 
ATOM   3520  C  CB    . VAL G  4  174  ? 86.039  91.244  -33.663 1.00 54.11  ? 174  VAL A CB    1 
ATOM   3521  C  CG1   . VAL G  4  174  ? 85.700  90.172  -34.705 1.00 53.31  ? 174  VAL A CG1   1 
ATOM   3522  C  CG2   . VAL G  4  174  ? 87.543  91.482  -33.596 1.00 54.40  ? 174  VAL A CG2   1 
ATOM   3523  N  N     . ARG G  4  175  ? 82.997  92.293  -34.670 1.00 51.37  ? 175  ARG A N     1 
ATOM   3524  C  CA    . ARG G  4  175  ? 81.631  91.983  -34.337 1.00 50.58  ? 175  ARG A CA    1 
ATOM   3525  C  C     . ARG G  4  175  ? 81.412  90.477  -34.344 1.00 51.54  ? 175  ARG A C     1 
ATOM   3526  O  O     . ARG G  4  175  ? 80.937  89.941  -33.349 1.00 52.37  ? 175  ARG A O     1 
ATOM   3527  C  CB    . ARG G  4  175  ? 80.631  92.664  -35.280 1.00 49.47  ? 175  ARG A CB    1 
ATOM   3528  C  CG    . ARG G  4  175  ? 79.135  92.252  -35.049 1.00 50.03  ? 175  ARG A CG    1 
ATOM   3529  C  CD    . ARG G  4  175  ? 78.656  92.064  -33.555 1.00 47.30  ? 175  ARG A CD    1 
ATOM   3530  N  NE    . ARG G  4  175  ? 77.666  90.973  -33.372 1.00 41.66  ? 175  ARG A NE    1 
ATOM   3531  C  CZ    . ARG G  4  175  ? 76.407  91.002  -33.799 1.00 39.71  ? 175  ARG A CZ    1 
ATOM   3532  N  NH1   . ARG G  4  175  ? 75.948  92.060  -34.442 1.00 40.37  ? 175  ARG A NH1   1 
ATOM   3533  N  NH2   . ARG G  4  175  ? 75.601  89.975  -33.574 1.00 38.42  ? 175  ARG A NH2   1 
ATOM   3534  N  N     . ARG G  4  176  ? 81.747  89.767  -35.421 1.00 52.13  ? 176  ARG A N     1 
ATOM   3535  C  CA    . ARG G  4  176  ? 81.525  88.324  -35.354 1.00 52.70  ? 176  ARG A CA    1 
ATOM   3536  C  C     . ARG G  4  176  ? 82.613  87.514  -36.076 1.00 52.96  ? 176  ARG A C     1 
ATOM   3537  O  O     . ARG G  4  176  ? 83.235  87.955  -37.046 1.00 52.76  ? 176  ARG A O     1 
ATOM   3538  C  CB    . ARG G  4  176  ? 80.126  87.974  -35.895 1.00 52.22  ? 176  ARG A CB    1 
ATOM   3539  C  CG    . ARG G  4  176  ? 79.803  88.329  -37.285 1.00 53.13  ? 176  ARG A CG    1 
ATOM   3540  C  CD    . ARG G  4  176  ? 78.551  87.595  -37.679 1.00 54.46  ? 176  ARG A CD    1 
ATOM   3541  N  NE    . ARG G  4  176  ? 78.276  87.739  -39.101 1.00 57.83  ? 176  ARG A NE    1 
ATOM   3542  C  CZ    . ARG G  4  176  ? 77.148  87.350  -39.686 1.00 59.74  ? 176  ARG A CZ    1 
ATOM   3543  N  NH1   . ARG G  4  176  ? 76.186  86.792  -38.961 1.00 60.36  ? 176  ARG A NH1   1 
ATOM   3544  N  NH2   . ARG G  4  176  ? 76.983  87.521  -40.993 1.00 60.62  ? 176  ARG A NH2   1 
ATOM   3545  N  N     . VAL G  4  177  ? 82.825  86.308  -35.542 1.00 53.91  ? 177  VAL A N     1 
ATOM   3546  C  CA    . VAL G  4  177  ? 83.780  85.320  -36.040 1.00 54.48  ? 177  VAL A CA    1 
ATOM   3547  C  C     . VAL G  4  177  ? 83.044  84.072  -36.493 1.00 54.93  ? 177  VAL A C     1 
ATOM   3548  O  O     . VAL G  4  177  ? 81.924  83.813  -36.048 1.00 53.64  ? 177  VAL A O     1 
ATOM   3549  C  CB    . VAL G  4  177  ? 84.812  84.921  -34.920 1.00 54.99  ? 177  VAL A CB    1 
ATOM   3550  C  CG1   . VAL G  4  177  ? 85.822  83.864  -35.428 1.00 54.30  ? 177  VAL A CG1   1 
ATOM   3551  C  CG2   . VAL G  4  177  ? 85.574  86.159  -34.479 1.00 54.48  ? 177  VAL A CG2   1 
ATOM   3552  N  N     . ALA G  4  178  ? 83.665  83.308  -37.378 1.00 55.65  ? 178  ALA A N     1 
ATOM   3553  C  CA    . ALA G  4  178  ? 83.047  82.092  -37.864 1.00 57.65  ? 178  ALA A CA    1 
ATOM   3554  C  C     . ALA G  4  178  ? 84.079  81.172  -38.490 1.00 57.47  ? 178  ALA A C     1 
ATOM   3555  O  O     . ALA G  4  178  ? 84.894  81.619  -39.281 1.00 56.08  ? 178  ALA A O     1 
ATOM   3556  C  CB    . ALA G  4  178  ? 81.952  82.449  -38.898 1.00 58.32  ? 178  ALA A CB    1 
ATOM   3557  N  N     . PHE G  4  179  ? 84.065  79.894  -38.132 1.00 57.84  ? 179  PHE A N     1 
ATOM   3558  C  CA    . PHE G  4  179  ? 85.004  78.994  -38.764 1.00 59.03  ? 179  PHE A CA    1 
ATOM   3559  C  C     . PHE G  4  179  ? 84.350  77.663  -39.124 1.00 60.23  ? 179  PHE A C     1 
ATOM   3560  O  O     . PHE G  4  179  ? 83.522  77.120  -38.390 1.00 59.94  ? 179  PHE A O     1 
ATOM   3561  C  CB    . PHE G  4  179  ? 86.247  78.801  -37.870 1.00 59.28  ? 179  PHE A CB    1 
ATOM   3562  C  CG    . PHE G  4  179  ? 86.033  77.955  -36.664 1.00 60.74  ? 179  PHE A CG    1 
ATOM   3563  C  CD1   . PHE G  4  179  ? 86.080  76.545  -36.755 1.00 61.23  ? 179  PHE A CD1   1 
ATOM   3564  C  CD2   . PHE G  4  179  ? 85.798  78.551  -35.417 1.00 60.64  ? 179  PHE A CD2   1 
ATOM   3565  C  CE1   . PHE G  4  179  ? 85.895  75.724  -35.610 1.00 61.46  ? 179  PHE A CE1   1 
ATOM   3566  C  CE2   . PHE G  4  179  ? 85.610  77.750  -34.256 1.00 61.02  ? 179  PHE A CE2   1 
ATOM   3567  C  CZ    . PHE G  4  179  ? 85.659  76.330  -34.354 1.00 61.23  ? 179  PHE A CZ    1 
ATOM   3568  N  N     . GLN G  4  180  ? 84.729  77.155  -40.286 1.00 61.00  ? 180  GLN A N     1 
ATOM   3569  C  CA    . GLN G  4  180  ? 84.209  75.894  -40.751 1.00 63.45  ? 180  GLN A CA    1 
ATOM   3570  C  C     . GLN G  4  180  ? 85.341  74.917  -41.028 1.00 64.21  ? 180  GLN A C     1 
ATOM   3571  O  O     . GLN G  4  180  ? 86.422  75.308  -41.482 1.00 64.28  ? 180  GLN A O     1 
ATOM   3572  C  CB    . GLN G  4  180  ? 83.359  76.122  -42.009 1.00 63.95  ? 180  GLN A CB    1 
ATOM   3573  C  CG    . GLN G  4  180  ? 82.073  76.964  -41.732 1.00 64.01  ? 180  GLN A CG    1 
ATOM   3574  C  CD    . GLN G  4  180  ? 80.779  76.141  -41.606 1.00 63.93  ? 180  GLN A CD    1 
ATOM   3575  O  OE1   . GLN G  4  180  ? 79.838  76.536  -40.908 1.00 62.70  ? 180  GLN A OE1   1 
ATOM   3576  N  NE2   . GLN G  4  180  ? 80.731  74.998  -42.289 1.00 63.29  ? 180  GLN A NE2   1 
ATOM   3577  N  N     . VAL G  4  181  ? 85.082  73.646  -40.726 1.00 65.42  ? 181  VAL A N     1 
ATOM   3578  C  CA    . VAL G  4  181  ? 86.040  72.572  -40.948 1.00 65.72  ? 181  VAL A CA    1 
ATOM   3579  C  C     . VAL G  4  181  ? 85.470  71.535  -41.918 1.00 66.91  ? 181  VAL A C     1 
ATOM   3580  O  O     . VAL G  4  181  ? 84.751  70.605  -41.521 1.00 66.49  ? 181  VAL A O     1 
ATOM   3581  C  CB    . VAL G  4  181  ? 86.413  71.874  -39.613 1.00 64.65  ? 181  VAL A CB    1 
ATOM   3582  C  CG1   . VAL G  4  181  ? 87.439  70.780  -39.861 1.00 63.69  ? 181  VAL A CG1   1 
ATOM   3583  C  CG2   . VAL G  4  181  ? 86.982  72.891  -38.650 1.00 64.05  ? 181  VAL A CG2   1 
ATOM   3584  N  N     . GLU G  4  182  ? 85.786  71.720  -43.197 1.00 66.31  ? 182  GLU A N     1 
ATOM   3585  C  CA    . GLU G  4  182  ? 85.330  70.810  -44.229 1.00 66.79  ? 182  GLU A CA    1 
ATOM   3586  C  C     . GLU G  4  182  ? 86.436  69.862  -44.630 1.00 67.83  ? 182  GLU A C     1 
ATOM   3587  O  O     . GLU G  4  182  ? 87.608  70.243  -44.657 1.00 67.04  ? 182  GLU A O     1 
ATOM   3588  C  CB    . GLU G  4  182  ? 84.851  71.594  -45.455 1.00 66.12  ? 182  GLU A CB    1 
ATOM   3589  C  CG    . GLU G  4  182  ? 85.729  72.776  -45.823 1.00 65.65  ? 182  GLU A CG    1 
ATOM   3590  C  CD    . GLU G  4  182  ? 85.242  73.501  -47.068 1.00 65.86  ? 182  GLU A CD    1 
ATOM   3591  O  OE1   . GLU G  4  182  ? 85.815  74.563  -47.403 1.00 65.70  ? 182  GLU A OE1   1 
ATOM   3592  O  OE2   . GLU G  4  182  ? 84.288  73.013  -47.715 1.00 66.74  ? 182  GLU A OE2   1 
ATOM   3593  N  N     . ASP G  4  183  ? 86.060  68.625  -44.928 1.00 68.78  ? 183  ASP A N     1 
ATOM   3594  C  CA    . ASP G  4  183  ? 87.021  67.621  -45.342 1.00 69.03  ? 183  ASP A CA    1 
ATOM   3595  C  C     . ASP G  4  183  ? 87.753  68.058  -46.606 1.00 69.17  ? 183  ASP A C     1 
ATOM   3596  O  O     . ASP G  4  183  ? 87.185  68.710  -47.487 1.00 69.08  ? 183  ASP A O     1 
ATOM   3597  C  CB    . ASP G  4  183  ? 86.309  66.293  -45.603 1.00 70.70  ? 183  ASP A CB    1 
ATOM   3598  C  CG    . ASP G  4  183  ? 86.705  65.208  -44.615 1.00 71.83  ? 183  ASP A CG    1 
ATOM   3599  O  OD1   . ASP G  4  183  ? 87.893  64.831  -44.595 1.00 72.70  ? 183  ASP A OD1   1 
ATOM   3600  O  OD2   . ASP G  4  183  ? 85.831  64.730  -43.858 1.00 72.85  ? 183  ASP A OD2   1 
ATOM   3601  N  N     . THR G  4  184  ? 89.027  67.693  -46.670 1.00 69.31  ? 184  THR A N     1 
ATOM   3602  C  CA    . THR G  4  184  ? 89.903  67.974  -47.807 1.00 69.11  ? 184  THR A CA    1 
ATOM   3603  C  C     . THR G  4  184  ? 90.631  66.704  -48.227 1.00 68.13  ? 184  THR A C     1 
ATOM   3604  O  O     . THR G  4  184  ? 90.895  65.843  -47.387 1.00 67.45  ? 184  THR A O     1 
ATOM   3605  C  CB    . THR G  4  184  ? 90.960  69.095  -47.457 1.00 69.70  ? 184  THR A CB    1 
ATOM   3606  O  OG1   . THR G  4  184  ? 92.046  69.057  -48.394 1.00 69.67  ? 184  THR A OG1   1 
ATOM   3607  C  CG2   . THR G  4  184  ? 91.540  68.885  -46.040 1.00 69.04  ? 184  THR A CG2   1 
ATOM   3608  N  N     . ARG G  4  185  ? 90.968  66.575  -49.504 1.00 66.46  ? 185  ARG A N     1 
ATOM   3609  C  CA    . ARG G  4  185  ? 91.589  65.333  -49.944 1.00 64.84  ? 185  ARG A CA    1 
ATOM   3610  C  C     . ARG G  4  185  ? 93.065  65.478  -50.274 1.00 64.65  ? 185  ARG A C     1 
ATOM   3611  O  O     . ARG G  4  185  ? 93.483  66.261  -51.132 1.00 64.26  ? 185  ARG A O     1 
ATOM   3612  C  CB    . ARG G  4  185  ? 90.862  64.780  -51.177 1.00 62.81  ? 185  ARG A CB    1 
ATOM   3613  C  CG    . ARG G  4  185  ? 90.935  65.700  -52.420 1.00 59.71  ? 185  ARG A CG    1 
ATOM   3614  C  CD    . ARG G  4  185  ? 91.747  65.081  -53.572 1.00 56.20  ? 185  ARG A CD    1 
ATOM   3615  N  NE    . ARG G  4  185  ? 92.314  66.080  -54.480 1.00 54.48  ? 185  ARG A NE    1 
ATOM   3616  C  CZ    . ARG G  4  185  ? 92.710  65.833  -55.729 1.00 54.39  ? 185  ARG A CZ    1 
ATOM   3617  N  NH1   . ARG G  4  185  ? 92.597  64.613  -56.244 1.00 53.72  ? 185  ARG A NH1   1 
ATOM   3618  N  NH2   . ARG G  4  185  ? 93.228  66.812  -56.467 1.00 54.22  ? 185  ARG A NH2   1 
ATOM   3619  N  N     . LEU G  4  186  ? 93.836  64.686  -49.543 1.00 64.61  ? 186  LEU A N     1 
ATOM   3620  C  CA    . LEU G  4  186  ? 95.257  64.491  -49.762 1.00 64.54  ? 186  LEU A CA    1 
ATOM   3621  C  C     . LEU G  4  186  ? 95.436  63.103  -50.280 1.00 64.53  ? 186  LEU A C     1 
ATOM   3622  O  O     . LEU G  4  186  ? 95.150  62.167  -49.547 1.00 64.45  ? 186  LEU A O     1 
ATOM   3623  C  CB    . LEU G  4  186  ? 96.087  64.564  -48.477 1.00 65.22  ? 186  LEU A CB    1 
ATOM   3624  C  CG    . LEU G  4  186  ? 96.575  65.783  -47.713 1.00 65.32  ? 186  LEU A CG    1 
ATOM   3625  C  CD1   . LEU G  4  186  ? 95.481  66.823  -47.692 1.00 66.06  ? 186  LEU A CD1   1 
ATOM   3626  C  CD2   . LEU G  4  186  ? 96.992  65.347  -46.305 1.00 64.48  ? 186  LEU A CD2   1 
ATOM   3627  N  N     . GLY G  4  187  ? 95.873  62.973  -51.523 1.00 64.79  ? 187  GLY A N     1 
ATOM   3628  C  CA    . GLY G  4  187  ? 96.060  61.688  -52.187 1.00 64.24  ? 187  GLY A CA    1 
ATOM   3629  C  C     . GLY G  4  187  ? 95.868  60.389  -51.391 1.00 63.65  ? 187  GLY A C     1 
ATOM   3630  O  O     . GLY G  4  187  ? 94.987  59.593  -51.733 1.00 63.82  ? 187  GLY A O     1 
ATOM   3631  N  N     . GLN G  4  188  ? 96.665  60.183  -50.338 1.00 63.62  ? 188  GLN A N     1 
ATOM   3632  C  CA    . GLN G  4  188  ? 96.692  58.931  -49.554 1.00 64.65  ? 188  GLN A CA    1 
ATOM   3633  C  C     . GLN G  4  188  ? 95.491  58.742  -48.586 1.00 64.81  ? 188  GLN A C     1 
ATOM   3634  O  O     . GLN G  4  188  ? 94.704  57.809  -48.769 1.00 64.76  ? 188  GLN A O     1 
ATOM   3635  C  CB    . GLN G  4  188  ? 98.025  58.842  -48.774 1.00 63.62  ? 188  GLN A CB    1 
ATOM   3636  C  CG    . GLN G  4  188  ? 98.438  60.059  -47.943 1.00 62.68  ? 188  GLN A CG    1 
ATOM   3637  C  CD    . GLN G  4  188  ? 99.669  59.806  -47.051 1.00 62.06  ? 188  GLN A CD    1 
ATOM   3638  O  OE1   . GLN G  4  188  ? 100.088 60.680  -46.283 1.00 62.28  ? 188  GLN A OE1   1 
ATOM   3639  N  NE2   . GLN G  4  188  ? 100.245 58.613  -47.151 1.00 60.82  ? 188  GLN A NE2   1 
ATOM   3640  N  N     . ARG G  4  189  ? 95.342  59.571  -47.560 1.00 66.55  ? 189  ARG A N     1 
ATOM   3641  C  CA    . ARG G  4  189  ? 94.245  59.384  -46.603 1.00 67.11  ? 189  ARG A CA    1 
ATOM   3642  C  C     . ARG G  4  189  ? 93.223  60.522  -46.702 1.00 69.58  ? 189  ARG A C     1 
ATOM   3643  O  O     . ARG G  4  189  ? 93.585  61.702  -46.649 1.00 70.12  ? 189  ARG A O     1 
ATOM   3644  C  CB    . ARG G  4  189  ? 94.825  59.302  -45.191 1.00 67.51  ? 189  ARG A CB    1 
ATOM   3645  C  CG    . ARG G  4  189  ? 93.950  58.600  -44.182 1.00 69.16  ? 189  ARG A CG    1 
ATOM   3646  C  CD    . ARG G  4  189  ? 93.726  57.105  -44.462 1.00 71.65  ? 189  ARG A CD    1 
ATOM   3647  N  NE    . ARG G  4  189  ? 93.207  56.428  -43.264 1.00 73.93  ? 189  ARG A NE    1 
ATOM   3648  C  CZ    . ARG G  4  189  ? 92.724  55.184  -43.214 1.00 73.93  ? 189  ARG A CZ    1 
ATOM   3649  N  NH1   . ARG G  4  189  ? 92.672  54.425  -44.309 1.00 74.04  ? 189  ARG A NH1   1 
ATOM   3650  N  NH2   . ARG G  4  189  ? 92.286  54.698  -42.055 1.00 74.51  ? 189  ARG A NH2   1 
ATOM   3651  N  N     . THR G  4  190  ? 91.947  60.150  -46.835 1.00 70.72  ? 190  THR A N     1 
ATOM   3652  C  CA    . THR G  4  190  ? 90.823  61.098  -47.007 1.00 72.18  ? 190  THR A CA    1 
ATOM   3653  C  C     . THR G  4  190  ? 90.427  61.831  -45.681 1.00 71.30  ? 190  THR A C     1 
ATOM   3654  O  O     . THR G  4  190  ? 89.852  62.920  -45.756 1.00 71.54  ? 190  THR A O     1 
ATOM   3655  C  CB    . THR G  4  190  ? 89.534  60.366  -47.577 1.00 73.40  ? 190  THR A CB    1 
ATOM   3656  O  OG1   . THR G  4  190  ? 89.895  59.098  -48.159 1.00 73.97  ? 190  THR A OG1   1 
ATOM   3657  C  CG2   . THR G  4  190  ? 88.856  61.230  -48.651 1.00 74.17  ? 190  THR A CG2   1 
ATOM   3658  N  N     . ASP G  4  191  ? 90.709  61.271  -44.495 1.00 70.46  ? 191  ASP A N     1 
ATOM   3659  C  CA    . ASP G  4  191  ? 90.332  61.925  -43.221 1.00 69.70  ? 191  ASP A CA    1 
ATOM   3660  C  C     . ASP G  4  191  ? 91.207  63.162  -42.928 1.00 68.23  ? 191  ASP A C     1 
ATOM   3661  O  O     . ASP G  4  191  ? 92.283  63.076  -42.343 1.00 67.93  ? 191  ASP A O     1 
ATOM   3662  C  CB    . ASP G  4  191  ? 90.397  60.891  -42.055 1.00 70.37  ? 191  ASP A CB    1 
ATOM   3663  C  CG    . ASP G  4  191  ? 91.803  60.673  -41.475 1.00 70.60  ? 191  ASP A CG    1 
ATOM   3664  O  OD1   . ASP G  4  191  ? 92.794  60.687  -42.233 1.00 72.28  ? 191  ASP A OD1   1 
ATOM   3665  O  OD2   . ASP G  4  191  ? 91.911  60.481  -40.243 1.00 70.40  ? 191  ASP A OD2   1 
ATOM   3666  N  N     . LEU G  4  192  ? 90.742  64.338  -43.340 1.00 67.33  ? 192  LEU A N     1 
ATOM   3667  C  CA    . LEU G  4  192  ? 91.533  65.548  -43.126 1.00 65.51  ? 192  LEU A CA    1 
ATOM   3668  C  C     . LEU G  4  192  ? 90.670  66.747  -42.805 1.00 65.17  ? 192  LEU A C     1 
ATOM   3669  O  O     . LEU G  4  192  ? 89.479  66.812  -43.125 1.00 65.67  ? 192  LEU A O     1 
ATOM   3670  C  CB    . LEU G  4  192  ? 92.383  65.841  -44.357 1.00 65.02  ? 192  LEU A CB    1 
ATOM   3671  C  CG    . LEU G  4  192  ? 93.434  64.733  -44.473 1.00 64.64  ? 192  LEU A CG    1 
ATOM   3672  C  CD1   . LEU G  4  192  ? 93.793  64.567  -45.917 1.00 63.98  ? 192  LEU A CD1   1 
ATOM   3673  C  CD2   . LEU G  4  192  ? 94.630  65.031  -43.570 1.00 63.88  ? 192  LEU A CD2   1 
ATOM   3674  N  N     . ASP G  4  193  ? 91.312  67.712  -42.169 1.00 64.10  ? 193  ASP A N     1 
ATOM   3675  C  CA    . ASP G  4  193  ? 90.650  68.920  -41.739 1.00 62.85  ? 193  ASP A CA    1 
ATOM   3676  C  C     . ASP G  4  193  ? 91.121  70.136  -42.526 1.00 61.90  ? 193  ASP A C     1 
ATOM   3677  O  O     . ASP G  4  193  ? 92.310  70.286  -42.831 1.00 62.37  ? 193  ASP A O     1 
ATOM   3678  C  CB    . ASP G  4  193  ? 90.926  69.135  -40.258 1.00 63.69  ? 193  ASP A CB    1 
ATOM   3679  C  CG    . ASP G  4  193  ? 90.447  67.979  -39.410 1.00 65.14  ? 193  ASP A CG    1 
ATOM   3680  O  OD1   . ASP G  4  193  ? 90.813  66.815  -39.715 1.00 64.80  ? 193  ASP A OD1   1 
ATOM   3681  O  OD2   . ASP G  4  193  ? 89.702  68.240  -38.437 1.00 66.30  ? 193  ASP A OD2   1 
ATOM   3682  N  N     . LYS G  4  194  ? 90.159  70.992  -42.855 1.00 59.27  ? 194  LYS A N     1 
ATOM   3683  C  CA    . LYS G  4  194  ? 90.410  72.256  -43.526 1.00 55.85  ? 194  LYS A CA    1 
ATOM   3684  C  C     . LYS G  4  194  ? 89.742  73.359  -42.753 1.00 53.84  ? 194  LYS A C     1 
ATOM   3685  O  O     . LYS G  4  194  ? 88.519  73.359  -42.633 1.00 53.04  ? 194  LYS A O     1 
ATOM   3686  C  CB    . LYS G  4  194  ? 89.873  72.225  -44.963 1.00 55.11  ? 194  LYS A CB    1 
ATOM   3687  C  CG    . LYS G  4  194  ? 90.421  73.343  -45.874 1.00 53.08  ? 194  LYS A CG    1 
ATOM   3688  C  CD    . LYS G  4  194  ? 90.476  72.935  -47.374 1.00 50.95  ? 194  LYS A CD    1 
ATOM   3689  C  CE    . LYS G  4  194  ? 91.017  74.063  -48.274 1.00 49.92  ? 194  LYS A CE    1 
ATOM   3690  N  NZ    . LYS G  4  194  ? 91.040  73.723  -49.731 1.00 49.56  ? 194  LYS A NZ    1 
ATOM   3691  N  N     . LEU G  4  195  ? 90.524  74.288  -42.215 1.00 53.60  ? 195  LEU A N     1 
ATOM   3692  C  CA    . LEU G  4  195  ? 89.925  75.333  -41.396 1.00 53.23  ? 195  LEU A CA    1 
ATOM   3693  C  C     . LEU G  4  195  ? 89.946  76.680  -42.061 1.00 51.99  ? 195  LEU A C     1 
ATOM   3694  O  O     . LEU G  4  195  ? 90.995  77.240  -42.381 1.00 51.78  ? 195  LEU A O     1 
ATOM   3695  C  CB    . LEU G  4  195  ? 90.630  75.471  -40.053 1.00 55.48  ? 195  LEU A CB    1 
ATOM   3696  C  CG    . LEU G  4  195  ? 90.038  76.610  -39.216 1.00 57.44  ? 195  LEU A CG    1 
ATOM   3697  C  CD1   . LEU G  4  195  ? 88.552  76.331  -38.915 1.00 57.08  ? 195  LEU A CD1   1 
ATOM   3698  C  CD2   . LEU G  4  195  ? 90.863  76.763  -37.934 1.00 59.24  ? 195  LEU A CD2   1 
ATOM   3699  N  N     . THR G  4  196  ? 88.742  77.193  -42.234 1.00 49.74  ? 196  THR A N     1 
ATOM   3700  C  CA    . THR G  4  196  ? 88.526  78.496  -42.808 1.00 49.47  ? 196  THR A CA    1 
ATOM   3701  C  C     . THR G  4  196  ? 87.737  79.364  -41.831 1.00 50.62  ? 196  THR A C     1 
ATOM   3702  O  O     . THR G  4  196  ? 86.565  79.079  -41.566 1.00 52.26  ? 196  THR A O     1 
ATOM   3703  C  CB    . THR G  4  196  ? 87.746  78.392  -44.167 1.00 46.98  ? 196  THR A CB    1 
ATOM   3704  O  OG1   . THR G  4  196  ? 86.370  78.102  -43.926 1.00 46.32  ? 196  THR A OG1   1 
ATOM   3705  C  CG2   . THR G  4  196  ? 88.291  77.266  -45.014 1.00 46.54  ? 196  THR A CG2   1 
ATOM   3706  N  N     . LEU G  4  197  ? 88.361  80.401  -41.274 1.00 49.31  ? 197  LEU A N     1 
ATOM   3707  C  CA    . LEU G  4  197  ? 87.629  81.241  -40.349 1.00 49.08  ? 197  LEU A CA    1 
ATOM   3708  C  C     . LEU G  4  197  ? 87.398  82.615  -40.927 1.00 49.05  ? 197  LEU A C     1 
ATOM   3709  O  O     . LEU G  4  197  ? 88.323  83.272  -41.385 1.00 50.23  ? 197  LEU A O     1 
ATOM   3710  C  CB    . LEU G  4  197  ? 88.372  81.347  -39.012 1.00 48.04  ? 197  LEU A CB    1 
ATOM   3711  C  CG    . LEU G  4  197  ? 89.285  82.514  -38.678 1.00 47.12  ? 197  LEU A CG    1 
ATOM   3712  C  CD1   . LEU G  4  197  ? 89.464  82.545  -37.183 1.00 45.76  ? 197  LEU A CD1   1 
ATOM   3713  C  CD2   . LEU G  4  197  ? 90.605  82.379  -39.410 1.00 47.08  ? 197  LEU A CD2   1 
ATOM   3714  N  N     . ARG G  4  198  ? 86.140  83.030  -40.915 1.00 48.81  ? 198  ARG A N     1 
ATOM   3715  C  CA    . ARG G  4  198  ? 85.723  84.322  -41.425 1.00 48.80  ? 198  ARG A CA    1 
ATOM   3716  C  C     . ARG G  4  198  ? 85.662  85.333  -40.285 1.00 47.92  ? 198  ARG A C     1 
ATOM   3717  O  O     . ARG G  4  198  ? 85.046  85.068  -39.253 1.00 47.11  ? 198  ARG A O     1 
ATOM   3718  C  CB    . ARG G  4  198  ? 84.335  84.187  -42.079 1.00 49.54  ? 198  ARG A CB    1 
ATOM   3719  C  CG    . ARG G  4  198  ? 84.030  82.806  -42.702 1.00 50.33  ? 198  ARG A CG    1 
ATOM   3720  C  CD    . ARG G  4  198  ? 82.549  82.396  -42.565 1.00 50.83  ? 198  ARG A CD    1 
ATOM   3721  N  NE    . ARG G  4  198  ? 81.632  83.352  -43.179 1.00 53.61  ? 198  ARG A NE    1 
ATOM   3722  C  CZ    . ARG G  4  198  ? 80.307  83.207  -43.274 1.00 54.21  ? 198  ARG A CZ    1 
ATOM   3723  N  NH1   . ARG G  4  198  ? 79.706  82.123  -42.790 1.00 54.22  ? 198  ARG A NH1   1 
ATOM   3724  N  NH2   . ARG G  4  198  ? 79.577  84.161  -43.853 1.00 53.64  ? 198  ARG A NH2   1 
ATOM   3725  N  N     . ILE G  4  199  ? 86.300  86.480  -40.453 1.00 46.47  ? 199  ILE A N     1 
ATOM   3726  C  CA    . ILE G  4  199  ? 86.273  87.480  -39.403 1.00 46.19  ? 199  ILE A CA    1 
ATOM   3727  C  C     . ILE G  4  199  ? 85.744  88.802  -39.914 1.00 48.39  ? 199  ILE A C     1 
ATOM   3728  O  O     . ILE G  4  199  ? 86.134  89.272  -40.982 1.00 49.15  ? 199  ILE A O     1 
ATOM   3729  C  CB    . ILE G  4  199  ? 87.659  87.712  -38.828 1.00 44.32  ? 199  ILE A CB    1 
ATOM   3730  C  CG1   . ILE G  4  199  ? 88.152  86.402  -38.222 1.00 43.48  ? 199  ILE A CG1   1 
ATOM   3731  C  CG2   . ILE G  4  199  ? 87.619  88.818  -37.770 1.00 42.69  ? 199  ILE A CG2   1 
ATOM   3732  C  CD1   . ILE G  4  199  ? 89.617  86.375  -37.901 1.00 41.25  ? 199  ILE A CD1   1 
ATOM   3733  N  N     . TRP G  4  200  ? 84.845  89.391  -39.133 1.00 50.17  ? 200  TRP A N     1 
ATOM   3734  C  CA    . TRP G  4  200  ? 84.243  90.672  -39.459 1.00 50.49  ? 200  TRP A CA    1 
ATOM   3735  C  C     . TRP G  4  200  ? 84.701  91.748  -38.480 1.00 50.10  ? 200  TRP A C     1 
ATOM   3736  O  O     . TRP G  4  200  ? 84.705  91.529  -37.276 1.00 50.06  ? 200  TRP A O     1 
ATOM   3737  C  CB    . TRP G  4  200  ? 82.740  90.525  -39.435 1.00 49.89  ? 200  TRP A CB    1 
ATOM   3738  C  CG    . TRP G  4  200  ? 82.189  89.733  -40.602 1.00 50.08  ? 200  TRP A CG    1 
ATOM   3739  C  CD1   . TRP G  4  200  ? 81.866  90.219  -41.846 1.00 51.08  ? 200  TRP A CD1   1 
ATOM   3740  C  CD2   . TRP G  4  200  ? 81.812  88.346  -40.607 1.00 48.95  ? 200  TRP A CD2   1 
ATOM   3741  N  NE1   . TRP G  4  200  ? 81.300  89.221  -42.616 1.00 50.86  ? 200  TRP A NE1   1 
ATOM   3742  C  CE2   . TRP G  4  200  ? 81.253  88.066  -41.882 1.00 49.26  ? 200  TRP A CE2   1 
ATOM   3743  C  CE3   . TRP G  4  200  ? 81.884  87.310  -39.655 1.00 47.74  ? 200  TRP A CE3   1 
ATOM   3744  C  CZ2   . TRP G  4  200  ? 80.761  86.789  -42.227 1.00 48.82  ? 200  TRP A CZ2   1 
ATOM   3745  C  CZ3   . TRP G  4  200  ? 81.394  86.031  -39.995 1.00 47.71  ? 200  TRP A CZ3   1 
ATOM   3746  C  CH2   . TRP G  4  200  ? 80.839  85.788  -41.274 1.00 48.74  ? 200  TRP A CH2   1 
ATOM   3747  N  N     . THR G  4  201  ? 85.086  92.905  -39.013 1.00 51.46  ? 201  THR A N     1 
ATOM   3748  C  CA    . THR G  4  201  ? 85.632  93.994  -38.211 1.00 51.25  ? 201  THR A CA    1 
ATOM   3749  C  C     . THR G  4  201  ? 84.914  95.329  -38.477 1.00 52.58  ? 201  THR A C     1 
ATOM   3750  O  O     . THR G  4  201  ? 84.542  95.645  -39.604 1.00 52.59  ? 201  THR A O     1 
ATOM   3751  C  CB    . THR G  4  201  ? 87.128  94.182  -38.523 1.00 50.53  ? 201  THR A CB    1 
ATOM   3752  O  OG1   . THR G  4  201  ? 87.775  92.904  -38.633 1.00 49.05  ? 201  THR A OG1   1 
ATOM   3753  C  CG2   . THR G  4  201  ? 87.781  94.982  -37.434 1.00 50.46  ? 201  THR A CG2   1 
ATOM   3754  N  N     . ASP G  4  202  ? 84.739  96.105  -37.414 1.00 53.11  ? 202  ASP A N     1 
ATOM   3755  C  CA    . ASP G  4  202  ? 84.086  97.414  -37.460 1.00 54.15  ? 202  ASP A CA    1 
ATOM   3756  C  C     . ASP G  4  202  ? 84.828  98.373  -38.393 1.00 54.94  ? 202  ASP A C     1 
ATOM   3757  O  O     . ASP G  4  202  ? 84.265  99.368  -38.846 1.00 55.67  ? 202  ASP A O     1 
ATOM   3758  C  CB    . ASP G  4  202  ? 84.082  98.031  -36.071 1.00 54.38  ? 202  ASP A CB    1 
ATOM   3759  C  CG    . ASP G  4  202  ? 85.513  98.207  -35.519 1.00 53.93  ? 202  ASP A CG    1 
ATOM   3760  O  OD1   . ASP G  4  202  ? 85.711  98.903  -34.498 1.00 54.38  ? 202  ASP A OD1   1 
ATOM   3761  O  OD2   . ASP G  4  202  ? 86.452  97.637  -36.117 1.00 53.57  ? 202  ASP A OD2   1 
ATOM   3762  N  N     . GLY G  4  203  ? 86.095  98.075  -38.660 1.00 56.13  ? 203  GLY A N     1 
ATOM   3763  C  CA    . GLY G  4  203  ? 86.899  98.937  -39.509 1.00 55.94  ? 203  GLY A CA    1 
ATOM   3764  C  C     . GLY G  4  203  ? 88.127  99.450  -38.784 1.00 55.19  ? 203  GLY A C     1 
ATOM   3765  O  O     . GLY G  4  203  ? 89.168  99.683  -39.401 1.00 54.83  ? 203  GLY A O     1 
ATOM   3766  N  N     . SER G  4  204  ? 87.997  99.634  -37.472 1.00 55.32  ? 204  SER A N     1 
ATOM   3767  C  CA    . SER G  4  204  ? 89.098  100.096 -36.643 1.00 55.02  ? 204  SER A CA    1 
ATOM   3768  C  C     . SER G  4  204  ? 90.372  99.354  -37.003 1.00 54.27  ? 204  SER A C     1 
ATOM   3769  O  O     . SER G  4  204  ? 91.387  99.961  -37.315 1.00 53.93  ? 204  SER A O     1 
ATOM   3770  C  CB    . SER G  4  204  ? 88.736  99.875  -35.176 1.00 56.00  ? 204  SER A CB    1 
ATOM   3771  O  OG    . SER G  4  204  ? 89.794  100.207 -34.310 1.00 58.82  ? 204  SER A OG    1 
ATOM   3772  N  N     . VAL G  4  205  ? 90.298  98.030  -36.954 1.00 53.82  ? 205  VAL A N     1 
ATOM   3773  C  CA    . VAL G  4  205  ? 91.407  97.165  -37.341 1.00 53.22  ? 205  VAL A CA    1 
ATOM   3774  C  C     . VAL G  4  205  ? 90.979  96.279  -38.503 1.00 53.40  ? 205  VAL A C     1 
ATOM   3775  O  O     . VAL G  4  205  ? 89.809  96.310  -38.893 1.00 52.77  ? 205  VAL A O     1 
ATOM   3776  C  CB    . VAL G  4  205  ? 91.891  96.249  -36.158 1.00 52.72  ? 205  VAL A CB    1 
ATOM   3777  C  CG1   . VAL G  4  205  ? 92.541  97.081  -35.065 1.00 52.10  ? 205  VAL A CG1   1 
ATOM   3778  C  CG2   . VAL G  4  205  ? 90.722  95.478  -35.600 1.00 52.53  ? 205  VAL A CG2   1 
ATOM   3779  N  N     . THR G  4  206  ? 91.891  95.505  -39.070 1.00 52.86  ? 206  THR A N     1 
ATOM   3780  C  CA    . THR G  4  206  ? 91.500  94.654  -40.179 1.00 53.19  ? 206  THR A CA    1 
ATOM   3781  C  C     . THR G  4  206  ? 91.430  93.206  -39.748 1.00 53.05  ? 206  THR A C     1 
ATOM   3782  O  O     . THR G  4  206  ? 92.100  92.829  -38.794 1.00 53.68  ? 206  THR A O     1 
ATOM   3783  C  CB    . THR G  4  206  ? 92.487  94.767  -41.373 1.00 54.01  ? 206  THR A CB    1 
ATOM   3784  O  OG1   . THR G  4  206  ? 91.779  94.460  -42.578 1.00 54.37  ? 206  THR A OG1   1 
ATOM   3785  C  CG2   . THR G  4  206  ? 93.635  93.776  -41.259 1.00 53.45  ? 206  THR A CG2   1 
ATOM   3786  N  N     . PRO G  4  207  ? 90.621  92.381  -40.433 1.00 52.34  ? 207  PRO A N     1 
ATOM   3787  C  CA    . PRO G  4  207  ? 90.515  90.968  -40.070 1.00 52.27  ? 207  PRO A CA    1 
ATOM   3788  C  C     . PRO G  4  207  ? 91.888  90.303  -39.936 1.00 52.50  ? 207  PRO A C     1 
ATOM   3789  O  O     . PRO G  4  207  ? 92.127  89.561  -38.983 1.00 51.16  ? 207  PRO A O     1 
ATOM   3790  C  CB    . PRO G  4  207  ? 89.666  90.397  -41.186 1.00 52.58  ? 207  PRO A CB    1 
ATOM   3791  C  CG    . PRO G  4  207  ? 88.704  91.501  -41.401 1.00 52.15  ? 207  PRO A CG    1 
ATOM   3792  C  CD    . PRO G  4  207  ? 89.592  92.719  -41.430 1.00 52.01  ? 207  PRO A CD    1 
ATOM   3793  N  N     . LEU G  4  208  ? 92.781  90.576  -40.890 1.00 53.85  ? 208  LEU A N     1 
ATOM   3794  C  CA    . LEU G  4  208  ? 94.133  90.019  -40.873 1.00 53.80  ? 208  LEU A CA    1 
ATOM   3795  C  C     . LEU G  4  208  ? 94.891  90.478  -39.629 1.00 54.14  ? 208  LEU A C     1 
ATOM   3796  O  O     . LEU G  4  208  ? 95.503  89.668  -38.928 1.00 54.39  ? 208  LEU A O     1 
ATOM   3797  C  CB    . LEU G  4  208  ? 94.913  90.449  -42.124 1.00 54.20  ? 208  LEU A CB    1 
ATOM   3798  C  CG    . LEU G  4  208  ? 95.886  89.414  -42.696 1.00 54.98  ? 208  LEU A CG    1 
ATOM   3799  C  CD1   . LEU G  4  208  ? 95.202  88.597  -43.782 1.00 54.67  ? 208  LEU A CD1   1 
ATOM   3800  C  CD2   . LEU G  4  208  ? 97.091  90.129  -43.270 1.00 55.89  ? 208  LEU A CD2   1 
ATOM   3801  N  N     . GLU G  4  209  ? 94.843  91.782  -39.358 1.00 53.85  ? 209  GLU A N     1 
ATOM   3802  C  CA    . GLU G  4  209  ? 95.499  92.341  -38.181 1.00 53.57  ? 209  GLU A CA    1 
ATOM   3803  C  C     . GLU G  4  209  ? 95.006  91.653  -36.911 1.00 52.82  ? 209  GLU A C     1 
ATOM   3804  O  O     . GLU G  4  209  ? 95.797  91.236  -36.064 1.00 51.98  ? 209  GLU A O     1 
ATOM   3805  C  CB    . GLU G  4  209  ? 95.217  93.842  -38.100 1.00 54.22  ? 209  GLU A CB    1 
ATOM   3806  C  CG    . GLU G  4  209  ? 95.984  94.651  -39.128 1.00 55.58  ? 209  GLU A CG    1 
ATOM   3807  C  CD    . GLU G  4  209  ? 95.495  96.080  -39.250 1.00 55.60  ? 209  GLU A CD    1 
ATOM   3808  O  OE1   . GLU G  4  209  ? 94.296  96.281  -39.537 1.00 54.78  ? 209  GLU A OE1   1 
ATOM   3809  O  OE2   . GLU G  4  209  ? 96.317  97.003  -39.060 1.00 56.12  ? 209  GLU A OE2   1 
ATOM   3810  N  N     . ALA G  4  210  ? 93.684  91.534  -36.808 1.00 52.36  ? 210  ALA A N     1 
ATOM   3811  C  CA    . ALA G  4  210  ? 93.013  90.891  -35.671 1.00 51.66  ? 210  ALA A CA    1 
ATOM   3812  C  C     . ALA G  4  210  ? 93.524  89.466  -35.451 1.00 49.86  ? 210  ALA A C     1 
ATOM   3813  O  O     . ALA G  4  210  ? 93.912  89.114  -34.333 1.00 49.38  ? 210  ALA A O     1 
ATOM   3814  C  CB    . ALA G  4  210  ? 91.492  90.867  -35.904 1.00 50.80  ? 210  ALA A CB    1 
ATOM   3815  N  N     . LEU G  4  211  ? 93.512  88.662  -36.520 1.00 48.09  ? 211  LEU A N     1 
ATOM   3816  C  CA    . LEU G  4  211  ? 93.987  87.272  -36.482 1.00 46.17  ? 211  LEU A CA    1 
ATOM   3817  C  C     . LEU G  4  211  ? 95.403  87.189  -35.918 1.00 45.46  ? 211  LEU A C     1 
ATOM   3818  O  O     . LEU G  4  211  ? 95.677  86.380  -35.025 1.00 45.51  ? 211  LEU A O     1 
ATOM   3819  C  CB    . LEU G  4  211  ? 93.985  86.658  -37.894 1.00 44.64  ? 211  LEU A CB    1 
ATOM   3820  C  CG    . LEU G  4  211  ? 94.686  85.312  -38.157 1.00 41.42  ? 211  LEU A CG    1 
ATOM   3821  C  CD1   . LEU G  4  211  ? 93.968  84.176  -37.471 1.00 39.44  ? 211  LEU A CD1   1 
ATOM   3822  C  CD2   . LEU G  4  211  ? 94.705  85.054  -39.648 1.00 41.51  ? 211  LEU A CD2   1 
ATOM   3823  N  N     . ASN G  4  212  ? 96.291  88.031  -36.458 1.00 44.72  ? 212  ASN A N     1 
ATOM   3824  C  CA    . ASN G  4  212  ? 97.683  88.098  -36.032 1.00 42.42  ? 212  ASN A CA    1 
ATOM   3825  C  C     . ASN G  4  212  ? 97.770  88.376  -34.537 1.00 42.89  ? 212  ASN A C     1 
ATOM   3826  O  O     . ASN G  4  212  ? 98.512  87.718  -33.826 1.00 42.92  ? 212  ASN A O     1 
ATOM   3827  C  CB    . ASN G  4  212  ? 98.420  89.205  -36.803 1.00 40.50  ? 212  ASN A CB    1 
ATOM   3828  C  CG    . ASN G  4  212  ? 98.596  88.897  -38.292 1.00 38.34  ? 212  ASN A CG    1 
ATOM   3829  O  OD1   . ASN G  4  212  ? 97.685  88.432  -38.957 1.00 35.60  ? 212  ASN A OD1   1 
ATOM   3830  N  ND2   . ASN G  4  212  ? 99.787  89.165  -38.811 1.00 37.40  ? 212  ASN A ND2   1 
ATOM   3831  N  N     . GLN G  4  213  ? 96.999  89.353  -34.068 1.00 43.63  ? 213  GLN A N     1 
ATOM   3832  C  CA    . GLN G  4  213  ? 96.973  89.702  -32.647 1.00 45.35  ? 213  GLN A CA    1 
ATOM   3833  C  C     . GLN G  4  213  ? 96.478  88.527  -31.796 1.00 45.83  ? 213  GLN A C     1 
ATOM   3834  O  O     . GLN G  4  213  ? 97.001  88.269  -30.708 1.00 45.75  ? 213  GLN A O     1 
ATOM   3835  C  CB    . GLN G  4  213  ? 96.067  90.931  -32.428 1.00 44.59  ? 213  GLN A CB    1 
ATOM   3836  C  CG    . GLN G  4  213  ? 96.521  92.137  -33.253 1.00 43.26  ? 213  GLN A CG    1 
ATOM   3837  C  CD    . GLN G  4  213  ? 96.044  93.458  -32.717 1.00 43.39  ? 213  GLN A CD    1 
ATOM   3838  O  OE1   . GLN G  4  213  ? 96.222  93.769  -31.541 1.00 44.71  ? 213  GLN A OE1   1 
ATOM   3839  N  NE2   . GLN G  4  213  ? 95.437  94.254  -33.580 1.00 44.58  ? 213  GLN A NE2   1 
ATOM   3840  N  N     . ALA G  4  214  ? 95.472  87.825  -32.317 1.00 47.46  ? 214  ALA A N     1 
ATOM   3841  C  CA    . ALA G  4  214  ? 94.855  86.664  -31.673 1.00 48.31  ? 214  ALA A CA    1 
ATOM   3842  C  C     . ALA G  4  214  ? 95.861  85.540  -31.455 1.00 49.15  ? 214  ALA A C     1 
ATOM   3843  O  O     . ALA G  4  214  ? 96.049  85.092  -30.324 1.00 49.67  ? 214  ALA A O     1 
ATOM   3844  C  CB    . ALA G  4  214  ? 93.718  86.158  -32.523 1.00 47.73  ? 214  ALA A CB    1 
ATOM   3845  N  N     . VAL G  4  215  ? 96.495  85.082  -32.535 1.00 50.10  ? 215  VAL A N     1 
ATOM   3846  C  CA    . VAL G  4  215  ? 97.510  84.020  -32.474 1.00 51.85  ? 215  VAL A CA    1 
ATOM   3847  C  C     . VAL G  4  215  ? 98.627  84.384  -31.500 1.00 53.07  ? 215  VAL A C     1 
ATOM   3848  O  O     . VAL G  4  215  ? 99.188  83.512  -30.841 1.00 52.90  ? 215  VAL A O     1 
ATOM   3849  C  CB    . VAL G  4  215  ? 98.157  83.772  -33.868 1.00 50.97  ? 215  VAL A CB    1 
ATOM   3850  C  CG1   . VAL G  4  215  ? 99.284  82.761  -33.768 1.00 52.22  ? 215  VAL A CG1   1 
ATOM   3851  C  CG2   . VAL G  4  215  ? 97.115  83.298  -34.833 1.00 51.55  ? 215  VAL A CG2   1 
ATOM   3852  N  N     . GLU G  4  216  ? 98.945  85.678  -31.428 1.00 55.35  ? 216  GLU A N     1 
ATOM   3853  C  CA    . GLU G  4  216  ? 99.985  86.187  -30.531 1.00 56.86  ? 216  GLU A CA    1 
ATOM   3854  C  C     . GLU G  4  216  ? 99.571  86.050  -29.069 1.00 58.29  ? 216  GLU A C     1 
ATOM   3855  O  O     . GLU G  4  216  ? 100.353 85.590  -28.235 1.00 57.03  ? 216  GLU A O     1 
ATOM   3856  C  CB    . GLU G  4  216  ? 100.283 87.665  -30.833 1.00 58.28  ? 216  GLU A CB    1 
ATOM   3857  C  CG    . GLU G  4  216  ? 100.840 87.942  -32.241 1.00 59.23  ? 216  GLU A CG    1 
ATOM   3858  C  CD    . GLU G  4  216  ? 101.735 86.830  -32.772 1.00 59.44  ? 216  GLU A CD    1 
ATOM   3859  O  OE1   . GLU G  4  216  ? 101.195 85.854  -33.341 1.00 59.45  ? 216  GLU A OE1   1 
ATOM   3860  O  OE2   . GLU G  4  216  ? 102.974 86.930  -32.614 1.00 60.46  ? 216  GLU A OE2   1 
ATOM   3861  N  N     . ILE G  4  217  ? 98.341  86.458  -28.767 1.00 60.55  ? 217  ILE A N     1 
ATOM   3862  C  CA    . ILE G  4  217  ? 97.809  86.350  -27.415 1.00 62.53  ? 217  ILE A CA    1 
ATOM   3863  C  C     . ILE G  4  217  ? 97.775  84.884  -26.971 1.00 63.76  ? 217  ILE A C     1 
ATOM   3864  O  O     . ILE G  4  217  ? 97.914  84.582  -25.794 1.00 63.59  ? 217  ILE A O     1 
ATOM   3865  C  CB    . ILE G  4  217  ? 96.382  86.977  -27.347 1.00 62.00  ? 217  ILE A CB    1 
ATOM   3866  C  CG1   . ILE G  4  217  ? 96.457  88.465  -27.747 1.00 60.37  ? 217  ILE A CG1   1 
ATOM   3867  C  CG2   . ILE G  4  217  ? 95.819  86.860  -25.936 1.00 61.53  ? 217  ILE A CG2   1 
ATOM   3868  C  CD1   . ILE G  4  217  ? 95.159  89.061  -28.264 1.00 59.71  ? 217  ILE A CD1   1 
ATOM   3869  N  N     . LEU G  4  218  ? 97.606  83.979  -27.932 1.00 65.71  ? 218  LEU A N     1 
ATOM   3870  C  CA    . LEU G  4  218  ? 97.595  82.537  -27.662 1.00 68.94  ? 218  LEU A CA    1 
ATOM   3871  C  C     . LEU G  4  218  ? 99.027  82.010  -27.394 1.00 70.06  ? 218  LEU A C     1 
ATOM   3872  O  O     . LEU G  4  218  ? 99.262  81.251  -26.437 1.00 69.16  ? 218  LEU A O     1 
ATOM   3873  C  CB    . LEU G  4  218  ? 96.986  81.810  -28.865 1.00 68.57  ? 218  LEU A CB    1 
ATOM   3874  C  CG    . LEU G  4  218  ? 96.406  80.402  -28.708 1.00 68.50  ? 218  LEU A CG    1 
ATOM   3875  C  CD1   . LEU G  4  218  ? 95.379  80.289  -27.601 1.00 68.35  ? 218  LEU A CD1   1 
ATOM   3876  C  CD2   . LEU G  4  218  ? 95.758  80.085  -30.012 1.00 67.46  ? 218  LEU A CD2   1 
ATOM   3877  N  N     . ARG G  4  219  ? 99.972  82.418  -28.246 1.00 71.16  ? 219  ARG A N     1 
ATOM   3878  C  CA    . ARG G  4  219  ? 101.371 82.023  -28.091 1.00 71.62  ? 219  ARG A CA    1 
ATOM   3879  C  C     . ARG G  4  219  ? 101.958 82.576  -26.777 1.00 71.91  ? 219  ARG A C     1 
ATOM   3880  O  O     . ARG G  4  219  ? 102.609 81.831  -26.029 1.00 72.93  ? 219  ARG A O     1 
ATOM   3881  C  CB    . ARG G  4  219  ? 102.183 82.514  -29.292 1.00 72.58  ? 219  ARG A CB    1 
ATOM   3882  C  CG    . ARG G  4  219  ? 101.812 81.820  -30.616 1.00 72.38  ? 219  ARG A CG    1 
ATOM   3883  C  CD    . ARG G  4  219  ? 102.837 82.175  -31.655 1.00 72.87  ? 219  ARG A CD    1 
ATOM   3884  N  NE    . ARG G  4  219  ? 104.163 81.859  -31.141 1.00 74.00  ? 219  ARG A NE    1 
ATOM   3885  C  CZ    . ARG G  4  219  ? 105.259 82.571  -31.385 1.00 74.20  ? 219  ARG A CZ    1 
ATOM   3886  N  NH1   . ARG G  4  219  ? 105.202 83.656  -32.153 1.00 74.66  ? 219  ARG A NH1   1 
ATOM   3887  N  NH2   . ARG G  4  219  ? 106.416 82.196  -30.852 1.00 74.33  ? 219  ARG A NH2   1 
ATOM   3888  N  N     . GLU G  4  220  ? 101.730 83.868  -26.501 1.00 71.50  ? 220  GLU A N     1 
ATOM   3889  C  CA    . GLU G  4  220  ? 102.196 84.486  -25.258 1.00 69.35  ? 220  GLU A CA    1 
ATOM   3890  C  C     . GLU G  4  220  ? 101.709 83.691  -24.056 1.00 68.55  ? 220  GLU A C     1 
ATOM   3891  O  O     . GLU G  4  220  ? 102.384 83.586  -23.040 1.00 68.93  ? 220  GLU A O     1 
ATOM   3892  C  CB    . GLU G  4  220  ? 101.670 85.921  -25.126 1.00 68.74  ? 220  GLU A CB    1 
ATOM   3893  C  CG    . GLU G  4  220  ? 102.379 86.968  -25.956 1.00 69.52  ? 220  GLU A CG    1 
ATOM   3894  C  CD    . GLU G  4  220  ? 101.967 88.397  -25.588 1.00 69.95  ? 220  GLU A CD    1 
ATOM   3895  O  OE1   . GLU G  4  220  ? 102.540 89.350  -26.163 1.00 69.68  ? 220  GLU A OE1   1 
ATOM   3896  O  OE2   . GLU G  4  220  ? 101.074 88.576  -24.728 1.00 69.74  ? 220  GLU A OE2   1 
ATOM   3897  N  N     . HIS G  4  221  ? 100.519 83.123  -24.184 1.00 67.23  ? 221  HIS A N     1 
ATOM   3898  C  CA    . HIS G  4  221  ? 99.950  82.352  -23.101 1.00 67.25  ? 221  HIS A CA    1 
ATOM   3899  C  C     . HIS G  4  221  ? 100.567 80.960  -23.021 1.00 66.19  ? 221  HIS A C     1 
ATOM   3900  O  O     . HIS G  4  221  ? 100.638 80.373  -21.943 1.00 65.46  ? 221  HIS A O     1 
ATOM   3901  C  CB    . HIS G  4  221  ? 98.428  82.318  -23.287 1.00 67.80  ? 221  HIS A CB    1 
ATOM   3902  C  CG    . HIS G  4  221  ? 97.799  83.670  -23.114 1.00 69.57  ? 221  HIS A CG    1 
ATOM   3903  N  ND1   . HIS G  4  221  ? 98.546  84.802  -22.848 1.00 70.94  ? 221  HIS A ND1   1 
ATOM   3904  C  CD2   . HIS G  4  221  ? 96.509  84.081  -23.173 1.00 70.41  ? 221  HIS A CD2   1 
ATOM   3905  C  CE1   . HIS G  4  221  ? 97.745  85.849  -22.749 1.00 70.85  ? 221  HIS A CE1   1 
ATOM   3906  N  NE2   . HIS G  4  221  ? 96.503  85.439  -22.943 1.00 70.75  ? 221  HIS A NE2   1 
ATOM   3907  N  N     . LEU G  4  222  ? 101.029 80.440  -24.156 1.00 64.85  ? 222  LEU A N     1 
ATOM   3908  C  CA    . LEU G  4  222  ? 101.660 79.129  -24.187 1.00 63.45  ? 222  LEU A CA    1 
ATOM   3909  C  C     . LEU G  4  222  ? 103.048 79.172  -23.560 1.00 63.18  ? 222  LEU A C     1 
ATOM   3910  O  O     . LEU G  4  222  ? 103.625 78.123  -23.254 1.00 62.42  ? 222  LEU A O     1 
ATOM   3911  C  CB    . LEU G  4  222  ? 101.769 78.629  -25.628 1.00 63.22  ? 222  LEU A CB    1 
ATOM   3912  C  CG    . LEU G  4  222  ? 100.670 77.695  -26.145 1.00 63.24  ? 222  LEU A CG    1 
ATOM   3913  C  CD1   . LEU G  4  222  ? 99.328  78.399  -26.157 1.00 62.71  ? 222  LEU A CD1   1 
ATOM   3914  C  CD2   . LEU G  4  222  ? 101.045 77.234  -27.543 1.00 62.77  ? 222  LEU A CD2   1 
ATOM   3915  N  N     . THR G  4  223  ? 103.580 80.386  -23.367 1.00 64.37  ? 223  THR A N     1 
ATOM   3916  C  CA    . THR G  4  223  ? 104.909 80.558  -22.750 1.00 64.56  ? 223  THR A CA    1 
ATOM   3917  C  C     . THR G  4  223  ? 104.806 80.644  -21.239 1.00 64.47  ? 223  THR A C     1 
ATOM   3918  O  O     . THR G  4  223  ? 105.785 80.423  -20.526 1.00 65.27  ? 223  THR A O     1 
ATOM   3919  C  CB    . THR G  4  223  ? 105.670 81.865  -23.207 1.00 64.43  ? 223  THR A CB    1 
ATOM   3920  O  OG1   . THR G  4  223  ? 107.026 81.813  -22.716 1.00 63.45  ? 223  THR A OG1   1 
ATOM   3921  C  CG2   . THR G  4  223  ? 105.053 83.131  -22.619 1.00 63.10  ? 223  THR A CG2   1 
ATOM   3922  N  N     . TYR G  4  224  ? 103.617 80.972  -20.755 1.00 64.15  ? 224  TYR A N     1 
ATOM   3923  C  CA    . TYR G  4  224  ? 103.408 81.101  -19.327 1.00 63.27  ? 224  TYR A CA    1 
ATOM   3924  C  C     . TYR G  4  224  ? 103.515 79.740  -18.599 1.00 62.99  ? 224  TYR A C     1 
ATOM   3925  O  O     . TYR G  4  224  ? 103.346 79.674  -17.382 1.00 63.82  ? 224  TYR A O     1 
ATOM   3926  C  CB    . TYR G  4  224  ? 102.043 81.752  -19.090 1.00 63.46  ? 224  TYR A CB    1 
ATOM   3927  C  CG    . TYR G  4  224  ? 101.999 83.247  -19.377 1.00 63.27  ? 224  TYR A CG    1 
ATOM   3928  C  CD1   . TYR G  4  224  ? 102.920 84.144  -18.767 1.00 63.24  ? 224  TYR A CD1   1 
ATOM   3929  C  CD2   . TYR G  4  224  ? 101.022 83.784  -20.240 1.00 62.96  ? 224  TYR A CD2   1 
ATOM   3930  C  CE1   . TYR G  4  224  ? 102.860 85.556  -19.015 1.00 62.75  ? 224  TYR A CE1   1 
ATOM   3931  C  CE2   . TYR G  4  224  ? 100.951 85.195  -20.499 1.00 62.97  ? 224  TYR A CE2   1 
ATOM   3932  C  CZ    . TYR G  4  224  ? 101.870 86.063  -19.883 1.00 62.97  ? 224  TYR A CZ    1 
ATOM   3933  O  OH    . TYR G  4  224  ? 101.790 87.410  -20.141 1.00 62.51  ? 224  TYR A OH    1 
ATOM   3934  N  N     . PHE G  4  225  ? 103.799 78.667  -19.342 1.00 61.73  ? 225  PHE A N     1 
ATOM   3935  C  CA    . PHE G  4  225  ? 103.961 77.314  -18.791 1.00 60.40  ? 225  PHE A CA    1 
ATOM   3936  C  C     . PHE G  4  225  ? 105.429 77.019  -18.505 1.00 60.62  ? 225  PHE A C     1 
ATOM   3937  O  O     . PHE G  4  225  ? 105.807 75.859  -18.366 1.00 61.64  ? 225  PHE A O     1 
ATOM   3938  C  CB    . PHE G  4  225  ? 103.484 76.258  -19.799 1.00 58.55  ? 225  PHE A CB    1 
ATOM   3939  C  CG    . PHE G  4  225  ? 102.031 76.381  -20.193 1.00 57.37  ? 225  PHE A CG    1 
ATOM   3940  C  CD1   . PHE G  4  225  ? 101.615 77.309  -21.162 1.00 56.61  ? 225  PHE A CD1   1 
ATOM   3941  C  CD2   . PHE G  4  225  ? 101.055 75.559  -19.584 1.00 56.85  ? 225  PHE A CD2   1 
ATOM   3942  C  CE1   . PHE G  4  225  ? 100.226 77.423  -21.529 1.00 54.71  ? 225  PHE A CE1   1 
ATOM   3943  C  CE2   . PHE G  4  225  ? 99.679  75.660  -19.935 1.00 54.75  ? 225  PHE A CE2   1 
ATOM   3944  C  CZ    . PHE G  4  225  ? 99.266  76.594  -20.910 1.00 53.81  ? 225  PHE A CZ    1 
ATOM   3945  N  N     . SER G  4  226  ? 106.238 78.070  -18.401 1.00 61.12  ? 226  SER A N     1 
ATOM   3946  C  CA    . SER G  4  226  ? 107.697 77.958  -18.289 1.00 61.19  ? 226  SER A CA    1 
ATOM   3947  C  C     . SER G  4  226  ? 108.220 77.547  -16.886 1.00 61.69  ? 226  SER A C     1 
ATOM   3948  O  O     . SER G  4  226  ? 108.773 76.440  -16.768 1.00 61.60  ? 226  SER A O     1 
ATOM   3949  C  CB    . SER G  4  226  ? 108.327 79.288  -18.703 1.00 62.27  ? 226  SER A CB    1 
ATOM   3950  O  OG    . SER G  4  226  ? 109.737 79.227  -18.726 1.00 64.92  ? 226  SER A OG    1 
ATOM   3951  N  N     . ASN G  4  227  ? 108.076 78.389  -15.847 1.00 60.28  ? 227  ASN A N     1 
ATOM   3952  C  CA    . ASN G  4  227  ? 108.693 78.088  -14.525 1.00 59.44  ? 227  ASN A CA    1 
ATOM   3953  C  C     . ASN G  4  227  ? 107.780 77.283  -13.557 1.00 58.10  ? 227  ASN A C     1 
ATOM   3954  O  O     . ASN G  4  227  ? 106.796 77.797  -13.011 1.00 58.85  ? 227  ASN A O     1 
ATOM   3955  C  CB    . ASN G  4  227  ? 109.176 79.403  -13.837 1.00 58.59  ? 227  ASN A CB    1 
ATOM   3956  C  CG    . ASN G  4  227  ? 108.061 80.408  -13.538 1.00 57.36  ? 227  ASN A CG    1 
ATOM   3957  O  OD1   . ASN G  4  227  ? 108.310 81.425  -12.878 1.00 54.59  ? 227  ASN A OD1   1 
ATOM   3958  N  ND2   . ASN G  4  227  ? 106.847 80.137  -14.015 1.00 58.17  ? 227  ASN A ND2   1 
ATOM   3959  N  N     . PRO G  4  228  ? 108.121 75.993  -13.323 1.00 56.12  ? 228  PRO A N     1 
ATOM   3960  C  CA    . PRO G  4  228  ? 107.318 75.175  -12.413 1.00 54.47  ? 228  PRO A CA    1 
ATOM   3961  C  C     . PRO G  4  228  ? 107.419 75.686  -10.968 1.00 53.09  ? 228  PRO A C     1 
ATOM   3962  O  O     . PRO G  4  228  ? 108.300 76.492  -10.643 1.00 52.74  ? 228  PRO A O     1 
ATOM   3963  C  CB    . PRO G  4  228  ? 107.900 73.771  -12.586 1.00 55.02  ? 228  PRO A CB    1 
ATOM   3964  C  CG    . PRO G  4  228  ? 108.460 73.785  -13.939 1.00 56.04  ? 228  PRO A CG    1 
ATOM   3965  C  CD    . PRO G  4  228  ? 109.102 75.144  -14.023 1.00 56.02  ? 228  PRO A CD    1 
ATOM   3966  N  N     . GLN G  4  229  ? 106.512 75.207  -10.116 1.00 51.36  ? 229  GLN A N     1 
ATOM   3967  C  CA    . GLN G  4  229  ? 106.452 75.582  -8.710  1.00 48.44  ? 229  GLN A CA    1 
ATOM   3968  C  C     . GLN G  4  229  ? 105.437 74.713  -7.983  1.00 48.13  ? 229  GLN A C     1 
ATOM   3969  O  O     . GLN G  4  229  ? 105.602 73.479  -7.993  1.00 46.80  ? 229  GLN A O     1 
ATOM   3970  C  CB    . GLN G  4  229  ? 106.065 77.064  -8.586  1.00 47.23  ? 229  GLN A CB    1 
ATOM   3971  C  CG    . GLN G  4  229  ? 106.156 77.624  -7.184  1.00 43.53  ? 229  GLN A CG    1 
ATOM   3972  C  CD    . GLN G  4  229  ? 106.613 79.065  -7.155  1.00 42.01  ? 229  GLN A CD    1 
ATOM   3973  O  OE1   . GLN G  4  229  ? 106.591 79.697  -6.105  1.00 41.30  ? 229  GLN A OE1   1 
ATOM   3974  N  NE2   . GLN G  4  229  ? 107.036 79.592  -8.302  1.00 39.84  ? 229  GLN A NE2   1 
ATOM   3975  N  N     . MET H  4  1    ? 110.291 92.023  -13.576 1.00 81.36  ? 1    MET B N     1 
ATOM   3976  C  CA    . MET H  4  1    ? 109.176 92.939  -13.951 1.00 81.66  ? 1    MET B CA    1 
ATOM   3977  C  C     . MET H  4  1    ? 108.219 93.098  -12.772 1.00 81.06  ? 1    MET B C     1 
ATOM   3978  O  O     . MET H  4  1    ? 108.339 92.325  -11.825 1.00 80.52  ? 1    MET B O     1 
ATOM   3979  C  CB    . MET H  4  1    ? 108.503 92.378  -15.202 1.00 82.55  ? 1    MET B CB    1 
ATOM   3980  C  CG    . MET H  4  1    ? 109.480 92.333  -16.395 1.00 83.36  ? 1    MET B CG    1 
ATOM   3981  S  SD    . MET H  4  1    ? 110.595 93.814  -16.542 1.00 84.69  ? 1    MET B SD    1 
ATOM   3982  C  CE    . MET H  4  1    ? 112.164 93.155  -15.822 1.00 84.81  ? 1    MET B CE    1 
ATOM   3983  N  N     . LEU H  4  2    ? 107.278 94.055  -12.797 1.00 80.64  ? 2    LEU B N     1 
ATOM   3984  C  CA    . LEU H  4  2    ? 106.496 94.262  -11.567 1.00 80.58  ? 2    LEU B CA    1 
ATOM   3985  C  C     . LEU H  4  2    ? 104.964 94.352  -11.763 1.00 79.98  ? 2    LEU B C     1 
ATOM   3986  O  O     . LEU H  4  2    ? 104.242 93.674  -11.039 1.00 79.47  ? 2    LEU B O     1 
ATOM   3987  C  CB    . LEU H  4  2    ? 106.988 95.541  -10.838 1.00 80.43  ? 2    LEU B CB    1 
ATOM   3988  C  CG    . LEU H  4  2    ? 106.927 96.991  -11.363 1.00 80.48  ? 2    LEU B CG    1 
ATOM   3989  C  CD1   . LEU H  4  2    ? 105.515 97.575  -11.278 1.00 80.27  ? 2    LEU B CD1   1 
ATOM   3990  C  CD2   . LEU H  4  2    ? 107.853 97.836  -10.496 1.00 79.74  ? 2    LEU B CD2   1 
ATOM   3991  N  N     . ASP H  4  3    ? 104.443 95.140  -12.697 1.00 80.13  ? 3    ASP B N     1 
ATOM   3992  C  CA    . ASP H  4  3    ? 102.981 95.350  -12.729 1.00 80.48  ? 3    ASP B CA    1 
ATOM   3993  C  C     . ASP H  4  3    ? 102.174 94.238  -13.431 1.00 80.45  ? 3    ASP B C     1 
ATOM   3994  O  O     . ASP H  4  3    ? 101.738 93.292  -12.766 1.00 81.82  ? 3    ASP B O     1 
ATOM   3995  C  CB    . ASP H  4  3    ? 102.647 96.692  -13.383 1.00 80.73  ? 3    ASP B CB    1 
ATOM   3996  C  CG    . ASP H  4  3    ? 101.151 96.902  -13.550 1.00 81.08  ? 3    ASP B CG    1 
ATOM   3997  O  OD1   . ASP H  4  3    ? 100.446 96.972  -12.521 1.00 82.32  ? 3    ASP B OD1   1 
ATOM   3998  O  OD2   . ASP H  4  3    ? 100.682 96.992  -14.707 1.00 80.65  ? 3    ASP B OD2   1 
ATOM   3999  N  N     . SER H  4  4    ? 101.953 94.358  -14.750 1.00 78.98  ? 4    SER B N     1 
ATOM   4000  C  CA    . SER H  4  4    ? 101.095 93.417  -15.503 1.00 76.36  ? 4    SER B CA    1 
ATOM   4001  C  C     . SER H  4  4    ? 101.832 92.146  -15.962 1.00 75.07  ? 4    SER B C     1 
ATOM   4002  O  O     . SER H  4  4    ? 101.214 91.079  -16.045 1.00 73.96  ? 4    SER B O     1 
ATOM   4003  C  CB    . SER H  4  4    ? 100.494 94.126  -16.717 1.00 76.95  ? 4    SER B CB    1 
ATOM   4004  O  OG    . SER H  4  4    ? 99.075  93.983  -16.712 1.00 76.77  ? 4    SER B OG    1 
ATOM   4005  N  N     . LYS H  4  5    ? 103.124 92.241  -16.269 1.00 74.39  ? 5    LYS B N     1 
ATOM   4006  C  CA    . LYS H  4  5    ? 103.897 91.066  -16.702 1.00 72.54  ? 5    LYS B CA    1 
ATOM   4007  C  C     . LYS H  4  5    ? 104.327 90.198  -15.497 1.00 71.85  ? 5    LYS B C     1 
ATOM   4008  O  O     . LYS H  4  5    ? 104.277 88.969  -15.598 1.00 71.45  ? 5    LYS B O     1 
ATOM   4009  C  CB    . LYS H  4  5    ? 105.136 91.505  -17.505 1.00 71.40  ? 5    LYS B CB    1 
ATOM   4010  C  CG    . LYS H  4  5    ? 105.993 90.343  -18.048 1.00 68.67  ? 5    LYS B CG    1 
ATOM   4011  C  CD    . LYS H  4  5    ? 105.653 89.939  -19.480 1.00 66.22  ? 5    LYS B CD    1 
ATOM   4012  C  CE    . LYS H  4  5    ? 104.320 89.230  -19.613 1.00 64.80  ? 5    LYS B CE    1 
ATOM   4013  N  NZ    . LYS H  4  5    ? 104.081 88.859  -21.039 1.00 64.71  ? 5    LYS B NZ    1 
ATOM   4014  N  N     . LEU H  4  6    ? 104.759 90.800  -14.378 1.00 71.08  ? 6    LEU B N     1 
ATOM   4015  C  CA    . LEU H  4  6    ? 105.085 89.958  -13.229 1.00 69.86  ? 6    LEU B CA    1 
ATOM   4016  C  C     . LEU H  4  6    ? 103.835 89.224  -12.779 1.00 68.46  ? 6    LEU B C     1 
ATOM   4017  O  O     . LEU H  4  6    ? 103.902 88.059  -12.364 1.00 67.64  ? 6    LEU B O     1 
ATOM   4018  C  CB    . LEU H  4  6    ? 105.680 90.764  -12.055 1.00 70.68  ? 6    LEU B CB    1 
ATOM   4019  C  CG    . LEU H  4  6    ? 106.627 89.810  -11.267 1.00 71.93  ? 6    LEU B CG    1 
ATOM   4020  C  CD1   . LEU H  4  6    ? 107.814 89.372  -12.153 1.00 71.66  ? 6    LEU B CD1   1 
ATOM   4021  C  CD2   . LEU H  4  6    ? 107.145 90.497  -10.012 1.00 72.50  ? 6    LEU B CD2   1 
ATOM   4022  N  N     . LYS H  4  7    ? 102.693 89.925  -12.863 1.00 66.36  ? 7    LYS B N     1 
ATOM   4023  C  CA    . LYS H  4  7    ? 101.408 89.269  -12.654 1.00 65.25  ? 7    LYS B CA    1 
ATOM   4024  C  C     . LYS H  4  7    ? 101.192 88.318  -13.816 1.00 65.55  ? 7    LYS B C     1 
ATOM   4025  O  O     . LYS H  4  7    ? 100.412 88.547  -14.749 1.00 66.16  ? 7    LYS B O     1 
ATOM   4026  C  CB    . LYS H  4  7    ? 100.246 90.291  -12.602 1.00 63.06  ? 7    LYS B CB    1 
ATOM   4027  C  CG    . LYS H  4  7    ? 98.814  89.679  -12.621 1.00 58.98  ? 7    LYS B CG    1 
ATOM   4028  C  CD    . LYS H  4  7    ? 98.042  90.024  -13.909 1.00 54.85  ? 7    LYS B CD    1 
ATOM   4029  C  CE    . LYS H  4  7    ? 96.925  91.005  -13.635 1.00 52.58  ? 7    LYS B CE    1 
ATOM   4030  N  NZ    . LYS H  4  7    ? 97.414  92.194  -12.908 1.00 50.39  ? 7    LYS B NZ    1 
ATOM   4031  N  N     . ALA H  4  8    ? 101.959 87.246  -13.762 1.00 64.48  ? 8    ALA B N     1 
ATOM   4032  C  CA    . ALA H  4  8    ? 101.941 86.285  -14.811 1.00 64.33  ? 8    ALA B CA    1 
ATOM   4033  C  C     . ALA H  4  8    ? 101.516 84.955  -14.301 1.00 63.84  ? 8    ALA B C     1 
ATOM   4034  O  O     . ALA H  4  8    ? 101.641 84.662  -13.113 1.00 64.07  ? 8    ALA B O     1 
ATOM   4035  C  CB    . ALA H  4  8    ? 103.314 86.185  -15.439 1.00 63.86  ? 8    ALA B CB    1 
ATOM   4036  N  N     . PRO H  4  9    ? 100.981 84.133  -15.199 1.00 63.52  ? 9    PRO B N     1 
ATOM   4037  C  CA    . PRO H  4  9    ? 100.540 82.810  -14.816 1.00 63.56  ? 9    PRO B CA    1 
ATOM   4038  C  C     . PRO H  4  9    ? 101.605 82.059  -14.056 1.00 64.14  ? 9    PRO B C     1 
ATOM   4039  O  O     . PRO H  4  9    ? 102.668 81.739  -14.591 1.00 64.25  ? 9    PRO B O     1 
ATOM   4040  C  CB    . PRO H  4  9    ? 100.181 82.173  -16.143 1.00 63.44  ? 9    PRO B CB    1 
ATOM   4041  C  CG    . PRO H  4  9    ? 99.542  83.305  -16.852 1.00 63.49  ? 9    PRO B CG    1 
ATOM   4042  C  CD    . PRO H  4  9    ? 100.477 84.466  -16.544 1.00 63.99  ? 9    PRO B CD    1 
ATOM   4043  N  N     . VAL H  4  10   ? 101.297 81.804  -12.790 1.00 65.56  ? 10   VAL B N     1 
ATOM   4044  C  CA    . VAL H  4  10   ? 102.160 81.023  -11.933 1.00 65.97  ? 10   VAL B CA    1 
ATOM   4045  C  C     . VAL H  4  10   ? 101.985 79.564  -12.256 1.00 66.04  ? 10   VAL B C     1 
ATOM   4046  O  O     . VAL H  4  10   ? 100.983 78.958  -11.860 1.00 66.59  ? 10   VAL B O     1 
ATOM   4047  C  CB    . VAL H  4  10   ? 101.817 81.213  -10.439 1.00 66.45  ? 10   VAL B CB    1 
ATOM   4048  C  CG1   . VAL H  4  10   ? 102.806 80.423  -9.574  1.00 66.78  ? 10   VAL B CG1   1 
ATOM   4049  C  CG2   . VAL H  4  10   ? 101.862 82.692  -10.088 1.00 67.29  ? 10   VAL B CG2   1 
ATOM   4050  N  N     . PHE H  4  11   ? 102.931 78.998  -12.994 1.00 66.00  ? 11   PHE B N     1 
ATOM   4051  C  CA    . PHE H  4  11   ? 102.803 77.600  -13.331 1.00 66.19  ? 11   PHE B CA    1 
ATOM   4052  C  C     . PHE H  4  11   ? 103.206 76.748  -12.157 1.00 66.69  ? 11   PHE B C     1 
ATOM   4053  O  O     . PHE H  4  11   ? 104.365 76.754  -11.738 1.00 65.85  ? 11   PHE B O     1 
ATOM   4054  C  CB    . PHE H  4  11   ? 103.648 77.249  -14.576 1.00 65.03  ? 11   PHE B CB    1 
ATOM   4055  C  CG    . PHE H  4  11   ? 103.103 76.075  -15.387 1.00 63.43  ? 11   PHE B CG    1 
ATOM   4056  C  CD1   . PHE H  4  11   ? 101.710 75.850  -15.501 1.00 62.28  ? 11   PHE B CD1   1 
ATOM   4057  C  CD2   . PHE H  4  11   ? 103.986 75.188  -16.040 1.00 62.62  ? 11   PHE B CD2   1 
ATOM   4058  C  CE1   . PHE H  4  11   ? 101.203 74.755  -16.254 1.00 61.95  ? 11   PHE B CE1   1 
ATOM   4059  C  CE2   . PHE H  4  11   ? 103.490 74.086  -16.801 1.00 62.26  ? 11   PHE B CE2   1 
ATOM   4060  C  CZ    . PHE H  4  11   ? 102.101 73.875  -16.902 1.00 61.76  ? 11   PHE B CZ    1 
ATOM   4061  N  N     . THR H  4  12   ? 102.219 76.041  -11.614 1.00 65.98  ? 12   THR B N     1 
ATOM   4062  C  CA    . THR H  4  12   ? 102.434 75.178  -10.472 1.00 65.75  ? 12   THR B CA    1 
ATOM   4063  C  C     . THR H  4  12   ? 102.251 73.722  -10.875 1.00 64.58  ? 12   THR B C     1 
ATOM   4064  O  O     . THR H  4  12   ? 101.294 73.394  -11.587 1.00 63.13  ? 12   THR B O     1 
ATOM   4065  C  CB    . THR H  4  12   ? 101.440 75.534  -9.336  1.00 67.12  ? 12   THR B CB    1 
ATOM   4066  O  OG1   . THR H  4  12   ? 100.208 74.834  -9.557  1.00 65.98  ? 12   THR B OG1   1 
ATOM   4067  C  CG2   . THR H  4  12   ? 101.123 77.051  -9.332  1.00 67.48  ? 12   THR B CG2   1 
ATOM   4068  N  N     . VAL H  4  13   ? 103.168 72.858  -10.424 1.00 63.92  ? 13   VAL B N     1 
ATOM   4069  C  CA    . VAL H  4  13   ? 103.121 71.444  -10.775 1.00 61.60  ? 13   VAL B CA    1 
ATOM   4070  C  C     . VAL H  4  13   ? 103.068 70.544  -9.537  1.00 60.50  ? 13   VAL B C     1 
ATOM   4071  O  O     . VAL H  4  13   ? 103.660 70.820  -8.490  1.00 59.74  ? 13   VAL B O     1 
ATOM   4072  C  CB    . VAL H  4  13   ? 104.356 71.049  -11.616 1.00 60.17  ? 13   VAL B CB    1 
ATOM   4073  C  CG1   . VAL H  4  13   ? 104.403 71.854  -12.899 1.00 59.47  ? 13   VAL B CG1   1 
ATOM   4074  C  CG2   . VAL H  4  13   ? 105.618 71.316  -10.818 1.00 59.54  ? 13   VAL B CG2   1 
ATOM   4075  N  N     . ARG H  4  14   ? 102.326 69.458  -9.706  1.00 60.37  ? 14   ARG B N     1 
ATOM   4076  C  CA    . ARG H  4  14   ? 102.141 68.407  -8.718  1.00 60.03  ? 14   ARG B CA    1 
ATOM   4077  C  C     . ARG H  4  14   ? 102.003 67.059  -9.418  1.00 61.29  ? 14   ARG B C     1 
ATOM   4078  O  O     . ARG H  4  14   ? 100.920 66.675  -9.873  1.00 59.87  ? 14   ARG B O     1 
ATOM   4079  C  CB    . ARG H  4  14   ? 100.901 68.700  -7.863  1.00 59.35  ? 14   ARG B CB    1 
ATOM   4080  C  CG    . ARG H  4  14   ? 101.059 69.986  -7.006  1.00 56.38  ? 14   ARG B CG    1 
ATOM   4081  C  CD    . ARG H  4  14   ? 99.983  70.113  -5.927  1.00 54.03  ? 14   ARG B CD    1 
ATOM   4082  N  NE    . ARG H  4  14   ? 98.627  70.223  -6.464  1.00 51.63  ? 14   ARG B NE    1 
ATOM   4083  C  CZ    . ARG H  4  14   ? 98.217  71.204  -7.262  1.00 50.50  ? 14   ARG B CZ    1 
ATOM   4084  N  NH1   . ARG H  4  14   ? 99.057  72.164  -7.622  1.00 49.79  ? 14   ARG B NH1   1 
ATOM   4085  N  NH2   . ARG H  4  14   ? 96.964  71.229  -7.695  1.00 50.89  ? 14   ARG B NH2   1 
ATOM   4086  N  N     . THR H  4  15   ? 103.124 66.349  -9.514  1.00 62.32  ? 15   THR B N     1 
ATOM   4087  C  CA    . THR H  4  15   ? 103.133 65.076  -10.204 1.00 63.89  ? 15   THR B CA    1 
ATOM   4088  C  C     . THR H  4  15   ? 103.696 63.967  -9.338  1.00 64.40  ? 15   THR B C     1 
ATOM   4089  O  O     . THR H  4  15   ? 104.797 64.073  -8.777  1.00 64.30  ? 15   THR B O     1 
ATOM   4090  C  CB    . THR H  4  15   ? 103.967 65.155  -11.508 1.00 64.44  ? 15   THR B CB    1 
ATOM   4091  O  OG1   . THR H  4  15   ? 104.042 63.851  -12.104 1.00 65.27  ? 15   THR B OG1   1 
ATOM   4092  C  CG2   . THR H  4  15   ? 105.395 65.647  -11.213 1.00 64.45  ? 15   THR B CG2   1 
ATOM   4093  N  N     . GLN H  4  16   ? 102.901 62.905  -9.243  1.00 65.60  ? 16   GLN B N     1 
ATOM   4094  C  CA    . GLN H  4  16   ? 103.258 61.695  -8.522  1.00 65.52  ? 16   GLN B CA    1 
ATOM   4095  C  C     . GLN H  4  16   ? 103.457 60.557  -9.523  1.00 66.06  ? 16   GLN B C     1 
ATOM   4096  O  O     . GLN H  4  16   ? 102.538 60.221  -10.271 1.00 65.57  ? 16   GLN B O     1 
ATOM   4097  C  CB    . GLN H  4  16   ? 102.149 61.344  -7.513  1.00 63.98  ? 16   GLN B CB    1 
ATOM   4098  C  CG    . GLN H  4  16   ? 101.564 62.566  -6.763  1.00 61.36  ? 16   GLN B CG    1 
ATOM   4099  C  CD    . GLN H  4  16   ? 102.497 63.158  -5.697  1.00 59.76  ? 16   GLN B CD    1 
ATOM   4100  O  OE1   . GLN H  4  16   ? 102.405 64.343  -5.362  1.00 58.20  ? 16   GLN B OE1   1 
ATOM   4101  N  NE2   . GLN H  4  16   ? 103.391 62.332  -5.162  1.00 57.72  ? 16   GLN B NE2   1 
ATOM   4102  N  N     . GLY H  4  17   ? 104.648 59.973  -9.552  1.00 66.35  ? 17   GLY B N     1 
ATOM   4103  C  CA    . GLY H  4  17   ? 104.887 58.928  -10.524 1.00 67.05  ? 17   GLY B CA    1 
ATOM   4104  C  C     . GLY H  4  17   ? 104.887 59.515  -11.926 1.00 67.61  ? 17   GLY B C     1 
ATOM   4105  O  O     . GLY H  4  17   ? 104.991 60.740  -12.088 1.00 66.76  ? 17   GLY B O     1 
ATOM   4106  N  N     . ARG H  4  18   ? 104.764 58.655  -12.933 1.00 67.56  ? 18   ARG B N     1 
ATOM   4107  C  CA    . ARG H  4  18   ? 104.760 59.086  -14.333 1.00 66.91  ? 18   ARG B CA    1 
ATOM   4108  C  C     . ARG H  4  18   ? 103.356 58.961  -14.942 1.00 66.05  ? 18   ARG B C     1 
ATOM   4109  O  O     . ARG H  4  18   ? 103.162 59.146  -16.148 1.00 65.87  ? 18   ARG B O     1 
ATOM   4110  C  CB    . ARG H  4  18   ? 105.750 58.224  -15.123 1.00 67.60  ? 18   ARG B CB    1 
ATOM   4111  C  CG    . ARG H  4  18   ? 107.145 58.120  -14.490 1.00 67.64  ? 18   ARG B CG    1 
ATOM   4112  C  CD    . ARG H  4  18   ? 107.966 56.949  -15.059 1.00 68.24  ? 18   ARG B CD    1 
ATOM   4113  N  NE    . ARG H  4  18   ? 108.187 57.021  -16.506 1.00 68.22  ? 18   ARG B NE    1 
ATOM   4114  C  CZ    . ARG H  4  18   ? 108.945 56.172  -17.202 1.00 67.83  ? 18   ARG B CZ    1 
ATOM   4115  N  NH1   . ARG H  4  18   ? 109.576 55.172  -16.602 1.00 68.19  ? 18   ARG B NH1   1 
ATOM   4116  N  NH2   . ARG H  4  18   ? 109.070 56.319  -18.511 1.00 68.16  ? 18   ARG B NH2   1 
ATOM   4117  N  N     . GLU H  4  19   ? 102.389 58.653  -14.081 1.00 65.28  ? 19   GLU B N     1 
ATOM   4118  C  CA    . GLU H  4  19   ? 100.998 58.441  -14.464 1.00 63.25  ? 19   GLU B CA    1 
ATOM   4119  C  C     . GLU H  4  19   ? 100.136 59.691  -14.217 1.00 62.38  ? 19   GLU B C     1 
ATOM   4120  O  O     . GLU H  4  19   ? 99.489  60.184  -15.137 1.00 61.91  ? 19   GLU B O     1 
ATOM   4121  C  CB    . GLU H  4  19   ? 100.458 57.239  -13.678 1.00 63.14  ? 19   GLU B CB    1 
ATOM   4122  C  CG    . GLU H  4  19   ? 101.332 55.958  -13.832 1.00 62.30  ? 19   GLU B CG    1 
ATOM   4123  C  CD    . GLU H  4  19   ? 102.703 56.027  -13.131 1.00 61.37  ? 19   GLU B CD    1 
ATOM   4124  O  OE1   . GLU H  4  19   ? 103.612 55.252  -13.518 1.00 61.47  ? 19   GLU B OE1   1 
ATOM   4125  O  OE2   . GLU H  4  19   ? 102.872 56.842  -12.196 1.00 58.45  ? 19   GLU B OE2   1 
ATOM   4126  N  N     . TYR H  4  20   ? 100.125 60.211  -12.991 1.00 62.40  ? 20   TYR B N     1 
ATOM   4127  C  CA    . TYR H  4  20   ? 99.310  61.386  -12.672 1.00 61.38  ? 20   TYR B CA    1 
ATOM   4128  C  C     . TYR H  4  20   ? 100.160 62.653  -12.536 1.00 61.36  ? 20   TYR B C     1 
ATOM   4129  O  O     . TYR H  4  20   ? 101.315 62.611  -12.101 1.00 61.38  ? 20   TYR B O     1 
ATOM   4130  C  CB    . TYR H  4  20   ? 98.541  61.137  -11.373 1.00 61.32  ? 20   TYR B CB    1 
ATOM   4131  C  CG    . TYR H  4  20   ? 97.655  62.267  -10.890 1.00 61.20  ? 20   TYR B CG    1 
ATOM   4132  C  CD1   . TYR H  4  20   ? 97.561  62.545  -9.513  1.00 62.01  ? 20   TYR B CD1   1 
ATOM   4133  C  CD2   . TYR H  4  20   ? 96.900  63.059  -11.788 1.00 61.19  ? 20   TYR B CD2   1 
ATOM   4134  C  CE1   . TYR H  4  20   ? 96.742  63.580  -9.028  1.00 61.83  ? 20   TYR B CE1   1 
ATOM   4135  C  CE2   . TYR H  4  20   ? 96.076  64.105  -11.318 1.00 61.37  ? 20   TYR B CE2   1 
ATOM   4136  C  CZ    . TYR H  4  20   ? 96.008  64.352  -9.934  1.00 62.06  ? 20   TYR B CZ    1 
ATOM   4137  O  OH    . TYR H  4  20   ? 95.228  65.356  -9.426  1.00 64.20  ? 20   TYR B OH    1 
ATOM   4138  N  N     . GLY H  4  21   ? 99.561  63.779  -12.915 1.00 61.08  ? 21   GLY B N     1 
ATOM   4139  C  CA    . GLY H  4  21   ? 100.236 65.056  -12.843 1.00 60.14  ? 21   GLY B CA    1 
ATOM   4140  C  C     . GLY H  4  21   ? 99.276  66.200  -13.046 1.00 59.88  ? 21   GLY B C     1 
ATOM   4141  O  O     . GLY H  4  21   ? 98.793  66.441  -14.153 1.00 60.16  ? 21   GLY B O     1 
ATOM   4142  N  N     . GLU H  4  22   ? 98.985  66.903  -11.963 1.00 60.13  ? 22   GLU B N     1 
ATOM   4143  C  CA    . GLU H  4  22   ? 98.105  68.052  -12.029 1.00 60.95  ? 22   GLU B CA    1 
ATOM   4144  C  C     . GLU H  4  22   ? 98.884  69.288  -12.441 1.00 62.65  ? 22   GLU B C     1 
ATOM   4145  O  O     . GLU H  4  22   ? 100.055 69.420  -12.095 1.00 63.02  ? 22   GLU B O     1 
ATOM   4146  C  CB    . GLU H  4  22   ? 97.443  68.305  -10.671 1.00 59.42  ? 22   GLU B CB    1 
ATOM   4147  C  CG    . GLU H  4  22   ? 96.001  67.852  -10.611 1.00 55.80  ? 22   GLU B CG    1 
ATOM   4148  C  CD    . GLU H  4  22   ? 95.160  68.636  -9.614  1.00 54.23  ? 22   GLU B CD    1 
ATOM   4149  O  OE1   . GLU H  4  22   ? 94.897  68.122  -8.502  1.00 53.31  ? 22   GLU B OE1   1 
ATOM   4150  O  OE2   . GLU H  4  22   ? 94.763  69.773  -9.950  1.00 51.73  ? 22   GLU B OE2   1 
ATOM   4151  N  N     . PHE H  4  23   ? 98.250  70.188  -13.184 1.00 64.27  ? 23   PHE B N     1 
ATOM   4152  C  CA    . PHE H  4  23   ? 98.928  71.392  -13.637 1.00 66.44  ? 23   PHE B CA    1 
ATOM   4153  C  C     . PHE H  4  23   ? 98.035  72.616  -13.466 1.00 68.70  ? 23   PHE B C     1 
ATOM   4154  O  O     . PHE H  4  23   ? 97.045  72.780  -14.192 1.00 68.93  ? 23   PHE B O     1 
ATOM   4155  C  CB    . PHE H  4  23   ? 99.333  71.241  -15.115 1.00 65.30  ? 23   PHE B CB    1 
ATOM   4156  C  CG    . PHE H  4  23   ? 100.172 70.019  -15.404 1.00 64.86  ? 23   PHE B CG    1 
ATOM   4157  C  CD1   . PHE H  4  23   ? 101.438 69.853  -14.793 1.00 64.91  ? 23   PHE B CD1   1 
ATOM   4158  C  CD2   . PHE H  4  23   ? 99.697  69.016  -16.274 1.00 64.73  ? 23   PHE B CD2   1 
ATOM   4159  C  CE1   . PHE H  4  23   ? 102.227 68.690  -15.044 1.00 64.44  ? 23   PHE B CE1   1 
ATOM   4160  C  CE2   . PHE H  4  23   ? 100.469 67.842  -16.541 1.00 64.60  ? 23   PHE B CE2   1 
ATOM   4161  C  CZ    . PHE H  4  23   ? 101.739 67.681  -15.922 1.00 65.12  ? 23   PHE B CZ    1 
ATOM   4162  N  N     . VAL H  4  24   ? 98.386  73.468  -12.500 1.00 70.87  ? 24   VAL B N     1 
ATOM   4163  C  CA    . VAL H  4  24   ? 97.619  74.687  -12.225 1.00 72.13  ? 24   VAL B CA    1 
ATOM   4164  C  C     . VAL H  4  24   ? 98.325  75.929  -12.777 1.00 72.60  ? 24   VAL B C     1 
ATOM   4165  O  O     . VAL H  4  24   ? 99.556  76.058  -12.695 1.00 71.95  ? 24   VAL B O     1 
ATOM   4166  C  CB    . VAL H  4  24   ? 97.401  74.863  -10.702 1.00 72.81  ? 24   VAL B CB    1 
ATOM   4167  C  CG1   . VAL H  4  24   ? 96.492  76.060  -10.450 1.00 72.65  ? 24   VAL B CG1   1 
ATOM   4168  C  CG2   . VAL H  4  24   ? 96.783  73.596  -10.111 1.00 71.78  ? 24   VAL B CG2   1 
ATOM   4169  N  N     . LEU H  4  25   ? 97.528  76.837  -13.336 1.00 73.17  ? 25   LEU B N     1 
ATOM   4170  C  CA    . LEU H  4  25   ? 98.057  78.052  -13.922 1.00 74.24  ? 25   LEU B CA    1 
ATOM   4171  C  C     . LEU H  4  25   ? 97.074  79.211  -13.802 1.00 75.49  ? 25   LEU B C     1 
ATOM   4172  O  O     . LEU H  4  25   ? 95.991  79.210  -14.410 1.00 74.61  ? 25   LEU B O     1 
ATOM   4173  C  CB    . LEU H  4  25   ? 98.401  77.788  -15.394 1.00 74.62  ? 25   LEU B CB    1 
ATOM   4174  C  CG    . LEU H  4  25   ? 98.148  78.822  -16.492 1.00 74.29  ? 25   LEU B CG    1 
ATOM   4175  C  CD1   . LEU H  4  25   ? 99.351  78.892  -17.439 1.00 74.33  ? 25   LEU B CD1   1 
ATOM   4176  C  CD2   . LEU H  4  25   ? 96.879  78.434  -17.236 1.00 74.05  ? 25   LEU B CD2   1 
ATOM   4177  N  N     . GLU H  4  26   ? 97.474  80.209  -13.018 1.00 76.98  ? 26   GLU B N     1 
ATOM   4178  C  CA    . GLU H  4  26   ? 96.659  81.400  -12.782 1.00 77.59  ? 26   GLU B CA    1 
ATOM   4179  C  C     . GLU H  4  26   ? 97.547  82.607  -12.402 1.00 78.17  ? 26   GLU B C     1 
ATOM   4180  O  O     . GLU H  4  26   ? 98.702  82.430  -11.997 1.00 78.96  ? 26   GLU B O     1 
ATOM   4181  C  CB    . GLU H  4  26   ? 95.636  81.100  -11.661 1.00 76.73  ? 26   GLU B CB    1 
ATOM   4182  C  CG    . GLU H  4  26   ? 96.059  81.494  -10.232 1.00 76.75  ? 26   GLU B CG    1 
ATOM   4183  C  CD    . GLU H  4  26   ? 97.486  81.068  -9.848  1.00 77.01  ? 26   GLU B CD    1 
ATOM   4184  O  OE1   . GLU H  4  26   ? 98.123  81.805  -9.061  1.00 77.87  ? 26   GLU B OE1   1 
ATOM   4185  O  OE2   . GLU H  4  26   ? 97.974  80.018  -10.318 1.00 76.03  ? 26   GLU B OE2   1 
ATOM   4186  N  N     . PRO H  4  27   ? 97.028  83.843  -12.538 1.00 78.05  ? 27   PRO B N     1 
ATOM   4187  C  CA    . PRO H  4  27   ? 95.691  84.195  -13.024 1.00 77.55  ? 27   PRO B CA    1 
ATOM   4188  C  C     . PRO H  4  27   ? 95.633  84.246  -14.555 1.00 77.36  ? 27   PRO B C     1 
ATOM   4189  O  O     . PRO H  4  27   ? 96.661  84.327  -15.242 1.00 77.89  ? 27   PRO B O     1 
ATOM   4190  C  CB    . PRO H  4  27   ? 95.430  85.553  -12.382 1.00 77.48  ? 27   PRO B CB    1 
ATOM   4191  C  CG    . PRO H  4  27   ? 96.319  85.558  -11.194 1.00 77.90  ? 27   PRO B CG    1 
ATOM   4192  C  CD    . PRO H  4  27   ? 97.565  84.953  -11.735 1.00 78.17  ? 27   PRO B CD    1 
ATOM   4193  N  N     . LEU H  4  28   ? 94.404  84.193  -15.062 1.00 76.16  ? 28   LEU B N     1 
ATOM   4194  C  CA    . LEU H  4  28   ? 94.086  84.269  -16.490 1.00 73.55  ? 28   LEU B CA    1 
ATOM   4195  C  C     . LEU H  4  28   ? 92.956  85.291  -16.701 1.00 71.35  ? 28   LEU B C     1 
ATOM   4196  O  O     . LEU H  4  28   ? 92.139  85.484  -15.800 1.00 71.25  ? 28   LEU B O     1 
ATOM   4197  C  CB    . LEU H  4  28   ? 93.681  82.865  -16.989 1.00 74.26  ? 28   LEU B CB    1 
ATOM   4198  C  CG    . LEU H  4  28   ? 94.341  81.659  -16.271 1.00 73.89  ? 28   LEU B CG    1 
ATOM   4199  C  CD1   . LEU H  4  28   ? 93.641  80.379  -16.677 1.00 73.64  ? 28   LEU B CD1   1 
ATOM   4200  C  CD2   . LEU H  4  28   ? 95.818  81.584  -16.604 1.00 73.81  ? 28   LEU B CD2   1 
ATOM   4201  N  N     . GLU H  4  29   ? 92.886  85.955  -17.847 1.00 68.30  ? 29   GLU B N     1 
ATOM   4202  C  CA    . GLU H  4  29   ? 91.854  86.968  -18.011 1.00 65.35  ? 29   GLU B CA    1 
ATOM   4203  C  C     . GLU H  4  29   ? 90.464  86.368  -18.035 1.00 62.41  ? 29   GLU B C     1 
ATOM   4204  O  O     . GLU H  4  29   ? 90.169  85.492  -17.247 1.00 61.57  ? 29   GLU B O     1 
ATOM   4205  C  CB    . GLU H  4  29   ? 92.161  87.793  -19.264 1.00 66.49  ? 29   GLU B CB    1 
ATOM   4206  C  CG    . GLU H  4  29   ? 93.343  88.676  -18.997 1.00 66.25  ? 29   GLU B CG    1 
ATOM   4207  C  CD    . GLU H  4  29   ? 93.170  89.406  -17.689 1.00 67.40  ? 29   GLU B CD    1 
ATOM   4208  O  OE1   . GLU H  4  29   ? 92.564  90.492  -17.694 1.00 69.48  ? 29   GLU B OE1   1 
ATOM   4209  O  OE2   . GLU H  4  29   ? 93.628  88.880  -16.651 1.00 67.52  ? 29   GLU B OE2   1 
ATOM   4210  N  N     . ARG H  4  30   ? 89.596  86.826  -18.921 1.00 60.54  ? 30   ARG B N     1 
ATOM   4211  C  CA    . ARG H  4  30   ? 88.234  86.308  -18.942 1.00 57.16  ? 30   ARG B CA    1 
ATOM   4212  C  C     . ARG H  4  30   ? 88.079  85.142  -19.923 1.00 56.80  ? 30   ARG B C     1 
ATOM   4213  O  O     . ARG H  4  30   ? 88.368  85.271  -21.110 1.00 56.72  ? 30   ARG B O     1 
ATOM   4214  C  CB    . ARG H  4  30   ? 87.267  87.436  -19.316 1.00 56.70  ? 30   ARG B CB    1 
ATOM   4215  C  CG    . ARG H  4  30   ? 85.813  87.196  -18.944 1.00 52.69  ? 30   ARG B CG    1 
ATOM   4216  C  CD    . ARG H  4  30   ? 85.496  87.578  -17.512 1.00 48.75  ? 30   ARG B CD    1 
ATOM   4217  N  NE    . ARG H  4  30   ? 84.084  87.893  -17.368 1.00 43.51  ? 30   ARG B NE    1 
ATOM   4218  C  CZ    . ARG H  4  30   ? 83.465  88.848  -18.051 1.00 42.80  ? 30   ARG B CZ    1 
ATOM   4219  N  NH1   . ARG H  4  30   ? 84.124  89.586  -18.931 1.00 41.32  ? 30   ARG B NH1   1 
ATOM   4220  N  NH2   . ARG H  4  30   ? 82.181  89.074  -17.855 1.00 42.81  ? 30   ARG B NH2   1 
ATOM   4221  N  N     . GLY H  4  31   ? 87.608  84.009  -19.403 1.00 56.17  ? 31   GLY B N     1 
ATOM   4222  C  CA    . GLY H  4  31   ? 87.368  82.812  -20.205 1.00 54.50  ? 31   GLY B CA    1 
ATOM   4223  C  C     . GLY H  4  31   ? 88.566  82.324  -21.000 1.00 53.06  ? 31   GLY B C     1 
ATOM   4224  O  O     . GLY H  4  31   ? 88.418  81.954  -22.166 1.00 51.54  ? 31   GLY B O     1 
ATOM   4225  N  N     . PHE H  4  32   ? 89.741  82.317  -20.377 1.00 52.40  ? 32   PHE B N     1 
ATOM   4226  C  CA    . PHE H  4  32   ? 90.948  81.868  -21.046 1.00 51.37  ? 32   PHE B CA    1 
ATOM   4227  C  C     . PHE H  4  32   ? 91.319  80.453  -20.627 1.00 51.68  ? 32   PHE B C     1 
ATOM   4228  O  O     . PHE H  4  32   ? 91.848  79.690  -21.435 1.00 51.11  ? 32   PHE B O     1 
ATOM   4229  C  CB    . PHE H  4  32   ? 92.097  82.826  -20.740 1.00 49.45  ? 32   PHE B CB    1 
ATOM   4230  C  CG    . PHE H  4  32   ? 92.065  84.086  -21.554 1.00 47.03  ? 32   PHE B CG    1 
ATOM   4231  C  CD1   . PHE H  4  32   ? 91.179  85.120  -21.232 1.00 44.93  ? 32   PHE B CD1   1 
ATOM   4232  C  CD2   . PHE H  4  32   ? 92.920  84.248  -22.664 1.00 46.65  ? 32   PHE B CD2   1 
ATOM   4233  C  CE1   . PHE H  4  32   ? 91.134  86.327  -22.015 1.00 44.06  ? 32   PHE B CE1   1 
ATOM   4234  C  CE2   . PHE H  4  32   ? 92.893  85.445  -23.458 1.00 44.83  ? 32   PHE B CE2   1 
ATOM   4235  C  CZ    . PHE H  4  32   ? 91.992  86.486  -23.124 1.00 43.02  ? 32   PHE B CZ    1 
ATOM   4236  N  N     . GLY H  4  33   ? 91.053  80.105  -19.371 1.00 51.36  ? 33   GLY B N     1 
ATOM   4237  C  CA    . GLY H  4  33   ? 91.346  78.752  -18.929 1.00 51.73  ? 33   GLY B CA    1 
ATOM   4238  C  C     . GLY H  4  33   ? 90.686  77.729  -19.848 1.00 51.45  ? 33   GLY B C     1 
ATOM   4239  O  O     . GLY H  4  33   ? 91.269  76.698  -20.189 1.00 51.97  ? 33   GLY B O     1 
ATOM   4240  N  N     . VAL H  4  34   ? 89.454  78.036  -20.251 1.00 50.23  ? 34   VAL B N     1 
ATOM   4241  C  CA    . VAL H  4  34   ? 88.665  77.193  -21.152 1.00 47.70  ? 34   VAL B CA    1 
ATOM   4242  C  C     . VAL H  4  34   ? 89.300  77.158  -22.541 1.00 46.88  ? 34   VAL B C     1 
ATOM   4243  O  O     . VAL H  4  34   ? 89.400  76.103  -23.174 1.00 45.43  ? 34   VAL B O     1 
ATOM   4244  C  CB    . VAL H  4  34   ? 87.196  77.744  -21.318 1.00 46.90  ? 34   VAL B CB    1 
ATOM   4245  C  CG1   . VAL H  4  34   ? 86.274  76.635  -21.714 1.00 44.90  ? 34   VAL B CG1   1 
ATOM   4246  C  CG2   . VAL H  4  34   ? 86.695  78.392  -20.032 1.00 45.31  ? 34   VAL B CG2   1 
ATOM   4247  N  N     . THR H  4  35   ? 89.720  78.343  -22.993 1.00 47.47  ? 35   THR B N     1 
ATOM   4248  C  CA    . THR H  4  35   ? 90.322  78.529  -24.307 1.00 46.66  ? 35   THR B CA    1 
ATOM   4249  C  C     . THR H  4  35   ? 91.631  77.773  -24.421 1.00 46.35  ? 35   THR B C     1 
ATOM   4250  O  O     . THR H  4  35   ? 92.003  77.350  -25.508 1.00 47.45  ? 35   THR B O     1 
ATOM   4251  C  CB    . THR H  4  35   ? 90.622  80.025  -24.622 1.00 47.37  ? 35   THR B CB    1 
ATOM   4252  O  OG1   . THR H  4  35   ? 89.683  80.874  -23.954 1.00 48.08  ? 35   THR B OG1   1 
ATOM   4253  C  CG2   . THR H  4  35   ? 90.480  80.274  -26.126 1.00 46.66  ? 35   THR B CG2   1 
ATOM   4254  N  N     . LEU H  4  36   ? 92.331  77.598  -23.306 1.00 45.14  ? 36   LEU B N     1 
ATOM   4255  C  CA    . LEU H  4  36   ? 93.605  76.903  -23.335 1.00 43.91  ? 36   LEU B CA    1 
ATOM   4256  C  C     . LEU H  4  36   ? 93.434  75.444  -23.000 1.00 42.99  ? 36   LEU B C     1 
ATOM   4257  O  O     . LEU H  4  36   ? 93.976  74.587  -23.672 1.00 43.39  ? 36   LEU B O     1 
ATOM   4258  C  CB    . LEU H  4  36   ? 94.578  77.567  -22.348 1.00 44.36  ? 36   LEU B CB    1 
ATOM   4259  C  CG    . LEU H  4  36   ? 94.640  79.115  -22.391 1.00 44.21  ? 36   LEU B CG    1 
ATOM   4260  C  CD1   . LEU H  4  36   ? 95.582  79.654  -21.293 1.00 42.66  ? 36   LEU B CD1   1 
ATOM   4261  C  CD2   . LEU H  4  36   ? 95.093  79.558  -23.782 1.00 43.97  ? 36   LEU B CD2   1 
ATOM   4262  N  N     . GLY H  4  37   ? 92.665  75.169  -21.961 1.00 43.95  ? 37   GLY B N     1 
ATOM   4263  C  CA    . GLY H  4  37   ? 92.434  73.802  -21.519 1.00 46.17  ? 37   GLY B CA    1 
ATOM   4264  C  C     . GLY H  4  37   ? 91.821  72.860  -22.552 1.00 47.48  ? 37   GLY B C     1 
ATOM   4265  O  O     . GLY H  4  37   ? 92.299  71.735  -22.699 1.00 47.69  ? 37   GLY B O     1 
ATOM   4266  N  N     . ASN H  4  38   ? 90.774  73.287  -23.258 1.00 48.09  ? 38   ASN B N     1 
ATOM   4267  C  CA    . ASN H  4  38   ? 90.128  72.413  -24.242 1.00 49.57  ? 38   ASN B CA    1 
ATOM   4268  C  C     . ASN H  4  38   ? 91.090  72.012  -25.374 1.00 50.03  ? 38   ASN B C     1 
ATOM   4269  O  O     . ASN H  4  38   ? 91.205  70.817  -25.680 1.00 50.96  ? 38   ASN B O     1 
ATOM   4270  C  CB    . ASN H  4  38   ? 88.894  73.091  -24.859 1.00 49.61  ? 38   ASN B CB    1 
ATOM   4271  C  CG    . ASN H  4  38   ? 88.157  72.186  -25.854 1.00 48.47  ? 38   ASN B CG    1 
ATOM   4272  O  OD1   . ASN H  4  38   ? 87.475  72.672  -26.763 1.00 47.35  ? 38   ASN B OD1   1 
ATOM   4273  N  ND2   . ASN H  4  38   ? 88.294  70.870  -25.682 1.00 46.82  ? 38   ASN B ND2   1 
ATOM   4274  N  N     . PRO H  4  39   ? 91.775  72.986  -26.020 1.00 49.42  ? 39   PRO B N     1 
ATOM   4275  C  CA    . PRO H  4  39   ? 92.707  72.636  -27.109 1.00 49.02  ? 39   PRO B CA    1 
ATOM   4276  C  C     . PRO H  4  39   ? 93.784  71.656  -26.653 1.00 48.22  ? 39   PRO B C     1 
ATOM   4277  O  O     . PRO H  4  39   ? 93.996  70.616  -27.281 1.00 48.63  ? 39   PRO B O     1 
ATOM   4278  C  CB    . PRO H  4  39   ? 93.272  73.979  -27.534 1.00 49.53  ? 39   PRO B CB    1 
ATOM   4279  C  CG    . PRO H  4  39   ? 92.107  74.884  -27.282 1.00 47.85  ? 39   PRO B CG    1 
ATOM   4280  C  CD    . PRO H  4  39   ? 91.609  74.452  -25.948 1.00 47.97  ? 39   PRO B CD    1 
ATOM   4281  N  N     . LEU H  4  40   ? 94.463  72.004  -25.566 1.00 47.29  ? 40   LEU B N     1 
ATOM   4282  C  CA    . LEU H  4  40   ? 95.486  71.146  -25.018 1.00 46.18  ? 40   LEU B CA    1 
ATOM   4283  C  C     . LEU H  4  40   ? 94.927  69.733  -24.773 1.00 48.30  ? 40   LEU B C     1 
ATOM   4284  O  O     . LEU H  4  40   ? 95.622  68.748  -25.012 1.00 48.55  ? 40   LEU B O     1 
ATOM   4285  C  CB    . LEU H  4  40   ? 96.031  71.752  -23.711 1.00 41.94  ? 40   LEU B CB    1 
ATOM   4286  C  CG    . LEU H  4  40   ? 96.565  73.193  -23.601 1.00 36.28  ? 40   LEU B CG    1 
ATOM   4287  C  CD1   . LEU H  4  40   ? 97.285  73.302  -22.303 1.00 33.38  ? 40   LEU B CD1   1 
ATOM   4288  C  CD2   . LEU H  4  40   ? 97.498  73.558  -24.719 1.00 36.52  ? 40   LEU B CD2   1 
ATOM   4289  N  N     . ARG H  4  41   ? 93.673  69.642  -24.311 1.00 49.99  ? 41   ARG B N     1 
ATOM   4290  C  CA    . ARG H  4  41   ? 93.005  68.345  -24.076 1.00 52.76  ? 41   ARG B CA    1 
ATOM   4291  C  C     . ARG H  4  41   ? 92.864  67.547  -25.406 1.00 52.92  ? 41   ARG B C     1 
ATOM   4292  O  O     . ARG H  4  41   ? 93.246  66.371  -25.488 1.00 53.06  ? 41   ARG B O     1 
ATOM   4293  C  CB    . ARG H  4  41   ? 91.605  68.578  -23.426 1.00 53.55  ? 41   ARG B CB    1 
ATOM   4294  C  CG    . ARG H  4  41   ? 90.714  67.309  -23.216 1.00 56.36  ? 41   ARG B CG    1 
ATOM   4295  C  CD    . ARG H  4  41   ? 89.315  67.550  -22.515 1.00 58.42  ? 41   ARG B CD    1 
ATOM   4296  N  NE    . ARG H  4  41   ? 88.307  66.489  -22.763 1.00 60.21  ? 41   ARG B NE    1 
ATOM   4297  C  CZ    . ARG H  4  41   ? 88.160  65.353  -22.068 1.00 61.07  ? 41   ARG B CZ    1 
ATOM   4298  N  NH1   . ARG H  4  41   ? 88.943  65.078  -21.031 1.00 61.91  ? 41   ARG B NH1   1 
ATOM   4299  N  NH2   . ARG H  4  41   ? 87.226  64.471  -22.419 1.00 61.71  ? 41   ARG B NH2   1 
ATOM   4300  N  N     . ARG H  4  42   ? 92.331  68.194  -26.440 1.00 52.89  ? 42   ARG B N     1 
ATOM   4301  C  CA    . ARG H  4  42   ? 92.145  67.568  -27.750 1.00 53.07  ? 42   ARG B CA    1 
ATOM   4302  C  C     . ARG H  4  42   ? 93.475  67.071  -28.323 1.00 52.20  ? 42   ARG B C     1 
ATOM   4303  O  O     . ARG H  4  42   ? 93.510  66.103  -29.076 1.00 50.73  ? 42   ARG B O     1 
ATOM   4304  C  CB    . ARG H  4  42   ? 91.510  68.569  -28.736 1.00 54.82  ? 42   ARG B CB    1 
ATOM   4305  C  CG    . ARG H  4  42   ? 90.026  68.899  -28.500 1.00 57.10  ? 42   ARG B CG    1 
ATOM   4306  C  CD    . ARG H  4  42   ? 89.473  69.960  -29.496 1.00 59.37  ? 42   ARG B CD    1 
ATOM   4307  N  NE    . ARG H  4  42   ? 89.348  69.516  -30.900 1.00 63.18  ? 42   ARG B NE    1 
ATOM   4308  C  CZ    . ARG H  4  42   ? 88.355  68.768  -31.409 1.00 63.30  ? 42   ARG B CZ    1 
ATOM   4309  N  NH1   . ARG H  4  42   ? 87.351  68.350  -30.642 1.00 62.86  ? 42   ARG B NH1   1 
ATOM   4310  N  NH2   . ARG H  4  42   ? 88.365  68.436  -32.701 1.00 62.41  ? 42   ARG B NH2   1 
ATOM   4311  N  N     . ILE H  4  43   ? 94.561  67.747  -27.961 1.00 53.14  ? 43   ILE B N     1 
ATOM   4312  C  CA    . ILE H  4  43   ? 95.919  67.408  -28.419 1.00 53.60  ? 43   ILE B CA    1 
ATOM   4313  C  C     . ILE H  4  43   ? 96.472  66.204  -27.648 1.00 54.69  ? 43   ILE B C     1 
ATOM   4314  O  O     . ILE H  4  43   ? 96.915  65.208  -28.218 1.00 53.57  ? 43   ILE B O     1 
ATOM   4315  C  CB    . ILE H  4  43   ? 96.918  68.624  -28.209 1.00 52.39  ? 43   ILE B CB    1 
ATOM   4316  C  CG1   . ILE H  4  43   ? 96.545  69.804  -29.127 1.00 50.91  ? 43   ILE B CG1   1 
ATOM   4317  C  CG2   . ILE H  4  43   ? 98.353  68.150  -28.398 1.00 51.53  ? 43   ILE B CG2   1 
ATOM   4318  C  CD1   . ILE H  4  43   ? 97.074  69.752  -30.552 1.00 50.27  ? 43   ILE B CD1   1 
ATOM   4319  N  N     . LEU H  4  44   ? 96.435  66.330  -26.333 1.00 55.50  ? 44   LEU B N     1 
ATOM   4320  C  CA    . LEU H  4  44   ? 96.931  65.325  -25.421 1.00 57.87  ? 44   LEU B CA    1 
ATOM   4321  C  C     . LEU H  4  44   ? 96.337  63.929  -25.703 1.00 60.02  ? 44   LEU B C     1 
ATOM   4322  O  O     . LEU H  4  44   ? 96.985  62.915  -25.405 1.00 60.80  ? 44   LEU B O     1 
ATOM   4323  C  CB    . LEU H  4  44   ? 96.625  65.793  -23.995 1.00 57.67  ? 44   LEU B CB    1 
ATOM   4324  C  CG    . LEU H  4  44   ? 97.557  66.990  -23.689 1.00 57.73  ? 44   LEU B CG    1 
ATOM   4325  C  CD1   . LEU H  4  44   ? 97.050  67.828  -22.521 1.00 57.56  ? 44   LEU B CD1   1 
ATOM   4326  C  CD2   . LEU H  4  44   ? 98.935  66.451  -23.396 1.00 59.12  ? 44   LEU B CD2   1 
ATOM   4327  N  N     . LEU H  4  45   ? 95.139  63.854  -26.282 1.00 61.39  ? 45   LEU B N     1 
ATOM   4328  C  CA    . LEU H  4  45   ? 94.517  62.549  -26.537 1.00 62.31  ? 45   LEU B CA    1 
ATOM   4329  C  C     . LEU H  4  45   ? 94.850  62.006  -27.922 1.00 63.07  ? 45   LEU B C     1 
ATOM   4330  O  O     . LEU H  4  45   ? 95.134  60.819  -28.062 1.00 63.88  ? 45   LEU B O     1 
ATOM   4331  C  CB    . LEU H  4  45   ? 92.995  62.644  -26.413 1.00 61.96  ? 45   LEU B CB    1 
ATOM   4332  C  CG    . LEU H  4  45   ? 92.302  62.064  -25.181 1.00 62.52  ? 45   LEU B CG    1 
ATOM   4333  C  CD1   . LEU H  4  45   ? 90.931  62.709  -24.999 1.00 62.80  ? 45   LEU B CD1   1 
ATOM   4334  C  CD2   . LEU H  4  45   ? 92.167  60.570  -25.352 1.00 62.52  ? 45   LEU B CD2   1 
ATOM   4335  N  N     . SER H  4  46   ? 94.819  62.856  -28.944 1.00 63.59  ? 46   SER B N     1 
ATOM   4336  C  CA    . SER H  4  46   ? 95.045  62.365  -30.301 1.00 64.35  ? 46   SER B CA    1 
ATOM   4337  C  C     . SER H  4  46   ? 96.499  62.574  -30.788 1.00 65.05  ? 46   SER B C     1 
ATOM   4338  O  O     . SER H  4  46   ? 97.088  61.662  -31.384 1.00 64.70  ? 46   SER B O     1 
ATOM   4339  C  CB    . SER H  4  46   ? 94.065  63.066  -31.260 1.00 63.85  ? 46   SER B CB    1 
ATOM   4340  O  OG    . SER H  4  46   ? 94.105  62.482  -32.555 1.00 63.01  ? 46   SER B OG    1 
ATOM   4341  N  N     . SER H  4  47   ? 97.067  63.754  -30.523 1.00 64.87  ? 47   SER B N     1 
ATOM   4342  C  CA    . SER H  4  47   ? 98.391  64.154  -31.022 1.00 63.62  ? 47   SER B CA    1 
ATOM   4343  C  C     . SER H  4  47   ? 99.528  63.306  -30.488 1.00 63.37  ? 47   SER B C     1 
ATOM   4344  O  O     . SER H  4  47   ? 100.282 62.758  -31.289 1.00 63.95  ? 47   SER B O     1 
ATOM   4345  C  CB    . SER H  4  47   ? 98.683  65.607  -30.673 1.00 63.17  ? 47   SER B CB    1 
ATOM   4346  O  OG    . SER H  4  47   ? 97.702  66.478  -31.190 1.00 63.65  ? 47   SER B OG    1 
ATOM   4347  N  N     . ILE H  4  48   ? 99.683  63.205  -29.170 1.00 63.04  ? 48   ILE B N     1 
ATOM   4348  C  CA    . ILE H  4  48   ? 100.805 62.436  -28.630 1.00 61.77  ? 48   ILE B CA    1 
ATOM   4349  C  C     . ILE H  4  48   ? 100.890 61.050  -29.302 1.00 61.19  ? 48   ILE B C     1 
ATOM   4350  O  O     . ILE H  4  48   ? 100.000 60.213  -29.112 1.00 61.17  ? 48   ILE B O     1 
ATOM   4351  C  CB    . ILE H  4  48   ? 100.697 62.293  -27.058 1.00 61.27  ? 48   ILE B CB    1 
ATOM   4352  C  CG1   . ILE H  4  48   ? 100.431 63.669  -26.417 1.00 60.20  ? 48   ILE B CG1   1 
ATOM   4353  C  CG2   . ILE H  4  48   ? 102.033 61.767  -26.486 1.00 60.89  ? 48   ILE B CG2   1 
ATOM   4354  C  CD1   . ILE H  4  48   ? 100.365 63.668  -24.906 1.00 57.80  ? 48   ILE B CD1   1 
ATOM   4355  N  N     . PRO H  4  49   ? 101.957 60.808  -30.113 1.00 60.66  ? 49   PRO B N     1 
ATOM   4356  C  CA    . PRO H  4  49   ? 102.221 59.559  -30.848 1.00 60.26  ? 49   PRO B CA    1 
ATOM   4357  C  C     . PRO H  4  49   ? 102.552 58.413  -29.913 1.00 60.03  ? 49   PRO B C     1 
ATOM   4358  O  O     . PRO H  4  49   ? 103.136 58.641  -28.846 1.00 58.69  ? 49   PRO B O     1 
ATOM   4359  C  CB    . PRO H  4  49   ? 103.392 59.906  -31.768 1.00 60.56  ? 49   PRO B CB    1 
ATOM   4360  C  CG    . PRO H  4  49   ? 103.438 61.402  -31.768 1.00 60.86  ? 49   PRO B CG    1 
ATOM   4361  C  CD    . PRO H  4  49   ? 103.056 61.756  -30.367 1.00 60.71  ? 49   PRO B CD    1 
ATOM   4362  N  N     . GLY H  4  50   ? 102.208 57.187  -30.309 1.00 60.46  ? 50   GLY B N     1 
ATOM   4363  C  CA    . GLY H  4  50   ? 102.475 56.074  -29.413 1.00 60.70  ? 50   GLY B CA    1 
ATOM   4364  C  C     . GLY H  4  50   ? 102.702 54.702  -30.038 1.00 60.33  ? 50   GLY B C     1 
ATOM   4365  O  O     . GLY H  4  50   ? 103.233 54.557  -31.151 1.00 60.31  ? 50   GLY B O     1 
ATOM   4366  N  N     . THR H  4  51   ? 102.272 53.686  -29.281 1.00 59.37  ? 51   THR B N     1 
ATOM   4367  C  CA    . THR H  4  51   ? 102.463 52.276  -29.629 1.00 56.72  ? 51   THR B CA    1 
ATOM   4368  C  C     . THR H  4  51   ? 101.291 51.378  -29.127 1.00 54.57  ? 51   THR B C     1 
ATOM   4369  O  O     . THR H  4  51   ? 101.004 51.334  -27.925 1.00 53.72  ? 51   THR B O     1 
ATOM   4370  C  CB    . THR H  4  51   ? 103.785 51.821  -28.995 1.00 57.45  ? 51   THR B CB    1 
ATOM   4371  O  OG1   . THR H  4  51   ? 103.797 52.212  -27.612 1.00 55.79  ? 51   THR B OG1   1 
ATOM   4372  C  CG2   . THR H  4  51   ? 104.974 52.499  -29.677 1.00 57.04  ? 51   THR B CG2   1 
ATOM   4373  N  N     . ALA H  4  52   ? 100.640 50.659  -30.048 1.00 51.77  ? 52   ALA B N     1 
ATOM   4374  C  CA    . ALA H  4  52   ? 99.527  49.768  -29.705 1.00 51.15  ? 52   ALA B CA    1 
ATOM   4375  C  C     . ALA H  4  52   ? 99.516  48.512  -30.587 1.00 48.91  ? 52   ALA B C     1 
ATOM   4376  O  O     . ALA H  4  52   ? 99.982  48.545  -31.727 1.00 47.46  ? 52   ALA B O     1 
ATOM   4377  C  CB    . ALA H  4  52   ? 98.203  50.499  -29.863 1.00 51.08  ? 52   ALA B CB    1 
ATOM   4378  N  N     . VAL H  4  53   ? 98.978  47.414  -30.054 1.00 46.73  ? 53   VAL B N     1 
ATOM   4379  C  CA    . VAL H  4  53   ? 98.900  46.174  -30.811 1.00 45.74  ? 53   VAL B CA    1 
ATOM   4380  C  C     . VAL H  4  53   ? 97.944  46.326  -31.985 1.00 45.94  ? 53   VAL B C     1 
ATOM   4381  O  O     . VAL H  4  53   ? 96.746  46.535  -31.811 1.00 44.78  ? 53   VAL B O     1 
ATOM   4382  C  CB    . VAL H  4  53   ? 98.434  45.004  -29.937 1.00 45.75  ? 53   VAL B CB    1 
ATOM   4383  C  CG1   . VAL H  4  53   ? 98.648  43.693  -30.688 1.00 45.47  ? 53   VAL B CG1   1 
ATOM   4384  C  CG2   . VAL H  4  53   ? 99.213  45.002  -28.640 1.00 45.44  ? 53   VAL B CG2   1 
ATOM   4385  N  N     . THR H  4  54   ? 98.494  46.213  -33.185 1.00 45.77  ? 54   THR B N     1 
ATOM   4386  C  CA    . THR H  4  54   ? 97.722  46.400  -34.400 1.00 45.99  ? 54   THR B CA    1 
ATOM   4387  C  C     . THR H  4  54   ? 97.180  45.069  -34.975 1.00 47.47  ? 54   THR B C     1 
ATOM   4388  O  O     . THR H  4  54   ? 96.162  45.086  -35.672 1.00 47.08  ? 54   THR B O     1 
ATOM   4389  C  CB    . THR H  4  54   ? 98.584  47.129  -35.421 1.00 44.42  ? 54   THR B CB    1 
ATOM   4390  O  OG1   . THR H  4  54   ? 99.172  48.276  -34.796 1.00 44.35  ? 54   THR B OG1   1 
ATOM   4391  C  CG2   . THR H  4  54   ? 97.724  47.617  -36.574 1.00 42.60  ? 54   THR B CG2   1 
ATOM   4392  N  N     . SER H  4  55   ? 97.824  43.930  -34.696 1.00 48.85  ? 55   SER B N     1 
ATOM   4393  C  CA    . SER H  4  55   ? 97.329  42.640  -35.190 1.00 49.54  ? 55   SER B CA    1 
ATOM   4394  C  C     . SER H  4  55   ? 97.933  41.483  -34.412 1.00 50.83  ? 55   SER B C     1 
ATOM   4395  O  O     . SER H  4  55   ? 98.958  41.630  -33.752 1.00 49.77  ? 55   SER B O     1 
ATOM   4396  C  CB    . SER H  4  55   ? 97.648  42.449  -36.675 1.00 49.64  ? 55   SER B CB    1 
ATOM   4397  O  OG    . SER H  4  55   ? 96.854  41.397  -37.227 1.00 48.49  ? 55   SER B OG    1 
ATOM   4398  N  N     . VAL H  4  56   ? 97.286  40.326  -34.485 1.00 52.73  ? 56   VAL B N     1 
ATOM   4399  C  CA    . VAL H  4  56   ? 97.767  39.142  -33.783 1.00 54.53  ? 56   VAL B CA    1 
ATOM   4400  C  C     . VAL H  4  56   ? 97.517  37.877  -34.598 1.00 56.44  ? 56   VAL B C     1 
ATOM   4401  O  O     . VAL H  4  56   ? 96.546  37.810  -35.370 1.00 57.92  ? 56   VAL B O     1 
ATOM   4402  C  CB    . VAL H  4  56   ? 97.062  38.968  -32.442 1.00 54.67  ? 56   VAL B CB    1 
ATOM   4403  C  CG1   . VAL H  4  56   ? 97.774  37.896  -31.645 1.00 55.21  ? 56   VAL B CG1   1 
ATOM   4404  C  CG2   . VAL H  4  56   ? 97.063  40.282  -31.673 1.00 54.29  ? 56   VAL B CG2   1 
ATOM   4405  N  N     . TYR H  4  57   ? 98.377  36.874  -34.424 1.00 56.86  ? 57   TYR B N     1 
ATOM   4406  C  CA    . TYR H  4  57   ? 98.212  35.636  -35.167 1.00 56.79  ? 57   TYR B CA    1 
ATOM   4407  C  C     . TYR H  4  57   ? 98.447  34.420  -34.298 1.00 56.37  ? 57   TYR B C     1 
ATOM   4408  O  O     . TYR H  4  57   ? 99.591  34.071  -34.032 1.00 57.28  ? 57   TYR B O     1 
ATOM   4409  C  CB    . TYR H  4  57   ? 99.186  35.598  -36.364 1.00 57.87  ? 57   TYR B CB    1 
ATOM   4410  C  CG    . TYR H  4  57   ? 99.045  34.408  -37.295 1.00 59.79  ? 57   TYR B CG    1 
ATOM   4411  C  CD1   . TYR H  4  57   ? 97.909  34.262  -38.115 1.00 60.87  ? 57   TYR B CD1   1 
ATOM   4412  C  CD2   . TYR H  4  57   ? 100.035 33.402  -37.340 1.00 60.63  ? 57   TYR B CD2   1 
ATOM   4413  C  CE1   . TYR H  4  57   ? 97.752  33.123  -38.971 1.00 62.37  ? 57   TYR B CE1   1 
ATOM   4414  C  CE2   . TYR H  4  57   ? 99.898  32.254  -38.190 1.00 61.74  ? 57   TYR B CE2   1 
ATOM   4415  C  CZ    . TYR H  4  57   ? 98.754  32.125  -38.997 1.00 62.77  ? 57   TYR B CZ    1 
ATOM   4416  O  OH    . TYR H  4  57   ? 98.619  31.019  -39.818 1.00 64.32  ? 57   TYR B OH    1 
ATOM   4417  N  N     . ILE H  4  58   ? 97.383  33.782  -33.826 1.00 56.69  ? 58   ILE B N     1 
ATOM   4418  C  CA    . ILE H  4  58   ? 97.593  32.526  -33.130 1.00 57.11  ? 58   ILE B CA    1 
ATOM   4419  C  C     . ILE H  4  58   ? 97.793  31.447  -34.179 1.00 58.58  ? 58   ILE B C     1 
ATOM   4420  O  O     . ILE H  4  58   ? 97.100  31.502  -35.191 1.00 59.30  ? 58   ILE B O     1 
ATOM   4421  C  CB    . ILE H  4  58   ? 96.402  32.172  -32.238 1.00 55.91  ? 58   ILE B CB    1 
ATOM   4422  C  CG1   . ILE H  4  58   ? 96.301  33.182  -31.085 1.00 54.51  ? 58   ILE B CG1   1 
ATOM   4423  C  CG2   . ILE H  4  58   ? 96.582  30.757  -31.684 1.00 56.17  ? 58   ILE B CG2   1 
ATOM   4424  C  CD1   . ILE H  4  58   ? 97.460  33.173  -30.111 1.00 53.00  ? 58   ILE B CD1   1 
ATOM   4425  N  N     . GLU H  4  59   ? 98.691  30.482  -33.986 1.00 60.28  ? 59   GLU B N     1 
ATOM   4426  C  CA    . GLU H  4  59   ? 98.987  29.550  -35.085 1.00 61.88  ? 59   GLU B CA    1 
ATOM   4427  C  C     . GLU H  4  59   ? 97.825  28.607  -35.446 1.00 63.61  ? 59   GLU B C     1 
ATOM   4428  O  O     . GLU H  4  59   ? 97.559  28.447  -36.648 1.00 64.59  ? 59   GLU B O     1 
ATOM   4429  C  CB    . GLU H  4  59   ? 100.248 28.735  -34.785 1.00 59.85  ? 59   GLU B CB    1 
ATOM   4430  C  CG    . GLU H  4  59   ? 101.537 29.323  -35.414 1.00 57.37  ? 59   GLU B CG    1 
ATOM   4431  C  CD    . GLU H  4  59   ? 101.479 29.583  -36.935 1.00 55.36  ? 59   GLU B CD    1 
ATOM   4432  O  OE1   . GLU H  4  59   ? 100.529 29.154  -37.617 1.00 54.37  ? 59   GLU B OE1   1 
ATOM   4433  O  OE2   . GLU H  4  59   ? 102.408 30.228  -37.461 1.00 53.88  ? 59   GLU B OE2   1 
ATOM   4434  N  N     . ASP H  4  60   ? 97.129  27.984  -34.499 1.00 64.98  ? 60   ASP B N     1 
ATOM   4435  C  CA    . ASP H  4  60   ? 96.052  27.071  -34.915 1.00 65.10  ? 60   ASP B CA    1 
ATOM   4436  C  C     . ASP H  4  60   ? 94.700  27.783  -35.067 1.00 65.77  ? 60   ASP B C     1 
ATOM   4437  O  O     . ASP H  4  60   ? 93.761  27.184  -35.592 1.00 67.19  ? 60   ASP B O     1 
ATOM   4438  C  CB    . ASP H  4  60   ? 95.913  25.908  -33.914 1.00 65.01  ? 60   ASP B CB    1 
ATOM   4439  C  CG    . ASP H  4  60   ? 95.611  26.367  -32.473 1.00 63.48  ? 60   ASP B CG    1 
ATOM   4440  O  OD1   . ASP H  4  60   ? 94.434  26.655  -32.149 1.00 63.12  ? 60   ASP B OD1   1 
ATOM   4441  O  OD2   . ASP H  4  60   ? 96.556  26.438  -31.661 1.00 62.63  ? 60   ASP B OD2   1 
ATOM   4442  N  N     . VAL H  4  61   ? 94.598  29.042  -34.629 1.00 67.24  ? 61   VAL B N     1 
ATOM   4443  C  CA    . VAL H  4  61   ? 93.336  29.788  -34.693 1.00 66.15  ? 61   VAL B CA    1 
ATOM   4444  C  C     . VAL H  4  61   ? 93.165  30.538  -36.029 1.00 65.47  ? 61   VAL B C     1 
ATOM   4445  O  O     . VAL H  4  61   ? 94.105  31.112  -36.585 1.00 64.60  ? 61   VAL B O     1 
ATOM   4446  C  CB    . VAL H  4  61   ? 93.241  30.778  -33.503 1.00 66.58  ? 61   VAL B CB    1 
ATOM   4447  C  CG1   . VAL H  4  61   ? 91.937  31.548  -33.564 1.00 67.84  ? 61   VAL B CG1   1 
ATOM   4448  C  CG2   . VAL H  4  61   ? 93.272  29.993  -32.187 1.00 65.72  ? 61   VAL B CG2   1 
ATOM   4449  N  N     . LEU H  4  62   ? 91.928  30.515  -36.522 1.00 65.57  ? 62   LEU B N     1 
ATOM   4450  C  CA    . LEU H  4  62   ? 91.568  31.148  -37.785 1.00 66.01  ? 62   LEU B CA    1 
ATOM   4451  C  C     . LEU H  4  62   ? 90.776  32.453  -37.576 1.00 65.75  ? 62   LEU B C     1 
ATOM   4452  O  O     . LEU H  4  62   ? 91.073  33.466  -38.228 1.00 65.46  ? 62   LEU B O     1 
ATOM   4453  C  CB    . LEU H  4  62   ? 90.733  30.178  -38.656 1.00 66.41  ? 62   LEU B CB    1 
ATOM   4454  C  CG    . LEU H  4  62   ? 90.039  28.883  -38.192 1.00 66.05  ? 62   LEU B CG    1 
ATOM   4455  C  CD1   . LEU H  4  62   ? 89.218  29.103  -36.945 1.00 66.06  ? 62   LEU B CD1   1 
ATOM   4456  C  CD2   . LEU H  4  62   ? 89.143  28.401  -39.325 1.00 65.64  ? 62   LEU B CD2   1 
ATOM   4457  N  N     . HIS H  4  63   ? 89.777  32.435  -36.686 1.00 64.91  ? 63   HIS B N     1 
ATOM   4458  C  CA    . HIS H  4  63   ? 88.935  33.621  -36.443 1.00 63.96  ? 63   HIS B CA    1 
ATOM   4459  C  C     . HIS H  4  63   ? 89.158  34.197  -35.034 1.00 63.80  ? 63   HIS B C     1 
ATOM   4460  O  O     . HIS H  4  63   ? 89.824  33.595  -34.191 1.00 63.95  ? 63   HIS B O     1 
ATOM   4461  C  CB    . HIS H  4  63   ? 87.434  33.276  -36.602 1.00 62.19  ? 63   HIS B CB    1 
ATOM   4462  C  CG    . HIS H  4  63   ? 87.052  32.682  -37.930 1.00 59.63  ? 63   HIS B CG    1 
ATOM   4463  N  ND1   . HIS H  4  63   ? 86.547  33.445  -38.961 1.00 57.31  ? 63   HIS B ND1   1 
ATOM   4464  C  CD2   . HIS H  4  63   ? 87.083  31.407  -38.388 1.00 57.92  ? 63   HIS B CD2   1 
ATOM   4465  C  CE1   . HIS H  4  63   ? 86.283  32.669  -39.995 1.00 57.48  ? 63   HIS B CE1   1 
ATOM   4466  N  NE2   . HIS H  4  63   ? 86.600  31.428  -39.674 1.00 57.32  ? 63   HIS B NE2   1 
ATOM   4467  N  N     . GLU H  4  64   ? 88.564  35.370  -34.805 1.00 63.07  ? 64   GLU B N     1 
ATOM   4468  C  CA    . GLU H  4  64   ? 88.673  36.125  -33.548 1.00 62.59  ? 64   GLU B CA    1 
ATOM   4469  C  C     . GLU H  4  64   ? 87.814  35.521  -32.431 1.00 63.26  ? 64   GLU B C     1 
ATOM   4470  O  O     . GLU H  4  64   ? 88.116  35.721  -31.258 1.00 63.91  ? 64   GLU B O     1 
ATOM   4471  C  CB    . GLU H  4  64   ? 88.230  37.584  -33.785 1.00 60.74  ? 64   GLU B CB    1 
ATOM   4472  C  CG    . GLU H  4  64   ? 88.853  38.663  -32.874 1.00 57.31  ? 64   GLU B CG    1 
ATOM   4473  C  CD    . GLU H  4  64   ? 88.055  38.953  -31.618 1.00 54.67  ? 64   GLU B CD    1 
ATOM   4474  O  OE1   . GLU H  4  64   ? 87.185  39.859  -31.612 1.00 51.74  ? 64   GLU B OE1   1 
ATOM   4475  O  OE2   . GLU H  4  64   ? 88.310  38.258  -30.625 1.00 52.97  ? 64   GLU B OE2   1 
ATOM   4476  N  N     . PHE H  4  65   ? 86.759  34.787  -32.778 1.00 63.59  ? 65   PHE B N     1 
ATOM   4477  C  CA    . PHE H  4  65   ? 85.850  34.241  -31.764 1.00 63.72  ? 65   PHE B CA    1 
ATOM   4478  C  C     . PHE H  4  65   ? 86.163  32.795  -31.403 1.00 65.18  ? 65   PHE B C     1 
ATOM   4479  O  O     . PHE H  4  65   ? 85.256  32.084  -30.977 1.00 65.53  ? 65   PHE B O     1 
ATOM   4480  C  CB    . PHE H  4  65   ? 84.406  34.300  -32.258 1.00 62.38  ? 65   PHE B CB    1 
ATOM   4481  C  CG    . PHE H  4  65   ? 83.798  35.668  -32.229 1.00 61.10  ? 65   PHE B CG    1 
ATOM   4482  C  CD1   . PHE H  4  65   ? 84.131  36.626  -33.214 1.00 60.90  ? 65   PHE B CD1   1 
ATOM   4483  C  CD2   . PHE H  4  65   ? 82.877  36.013  -31.228 1.00 59.47  ? 65   PHE B CD2   1 
ATOM   4484  C  CE1   . PHE H  4  65   ? 83.543  37.928  -33.201 1.00 59.19  ? 65   PHE B CE1   1 
ATOM   4485  C  CE2   . PHE H  4  65   ? 82.286  37.297  -31.199 1.00 59.37  ? 65   PHE B CE2   1 
ATOM   4486  C  CZ    . PHE H  4  65   ? 82.620  38.258  -32.190 1.00 58.15  ? 65   PHE B CZ    1 
ATOM   4487  N  N     . SER H  4  66   ? 87.405  32.343  -31.551 1.00 67.38  ? 66   SER B N     1 
ATOM   4488  C  CA    . SER H  4  66   ? 87.727  30.948  -31.215 1.00 70.04  ? 66   SER B CA    1 
ATOM   4489  C  C     . SER H  4  66   ? 88.299  30.821  -29.796 1.00 70.26  ? 66   SER B C     1 
ATOM   4490  O  O     . SER H  4  66   ? 88.609  31.808  -29.135 1.00 70.55  ? 66   SER B O     1 
ATOM   4491  C  CB    . SER H  4  66   ? 88.736  30.360  -32.230 1.00 71.12  ? 66   SER B CB    1 
ATOM   4492  O  OG    . SER H  4  66   ? 88.078  29.756  -33.347 1.00 73.16  ? 66   SER B OG    1 
ATOM   4493  N  N     . THR H  4  67   ? 88.415  29.576  -29.345 1.00 70.65  ? 67   THR B N     1 
ATOM   4494  C  CA    . THR H  4  67   ? 88.975  29.238  -28.043 1.00 71.06  ? 67   THR B CA    1 
ATOM   4495  C  C     . THR H  4  67   ? 90.090  28.214  -28.204 1.00 71.04  ? 67   THR B C     1 
ATOM   4496  O  O     . THR H  4  67   ? 89.931  27.225  -28.913 1.00 71.12  ? 67   THR B O     1 
ATOM   4497  C  CB    . THR H  4  67   ? 87.886  28.660  -27.103 1.00 71.69  ? 67   THR B CB    1 
ATOM   4498  O  OG1   . THR H  4  67   ? 88.501  28.115  -25.930 1.00 72.01  ? 67   THR B OG1   1 
ATOM   4499  C  CG2   . THR H  4  67   ? 87.073  27.588  -27.819 1.00 72.71  ? 67   THR B CG2   1 
ATOM   4500  N  N     . ILE H  4  68   ? 91.217  28.453  -27.555 1.00 70.47  ? 68   ILE B N     1 
ATOM   4501  C  CA    . ILE H  4  68   ? 92.353  27.548  -27.662 1.00 71.80  ? 68   ILE B CA    1 
ATOM   4502  C  C     . ILE H  4  68   ? 92.371  26.541  -26.500 1.00 73.18  ? 68   ILE B C     1 
ATOM   4503  O  O     . ILE H  4  68   ? 92.313  26.946  -25.339 1.00 73.00  ? 68   ILE B O     1 
ATOM   4504  C  CB    . ILE H  4  68   ? 93.695  28.331  -27.634 1.00 70.44  ? 68   ILE B CB    1 
ATOM   4505  C  CG1   . ILE H  4  68   ? 93.594  29.633  -28.428 1.00 69.79  ? 68   ILE B CG1   1 
ATOM   4506  C  CG2   . ILE H  4  68   ? 94.779  27.512  -28.270 1.00 71.02  ? 68   ILE B CG2   1 
ATOM   4507  C  CD1   . ILE H  4  68   ? 94.801  30.545  -28.230 1.00 68.88  ? 68   ILE B CD1   1 
ATOM   4508  N  N     . PRO H  4  69   ? 92.449  25.222  -26.794 1.00 74.82  ? 69   PRO B N     1 
ATOM   4509  C  CA    . PRO H  4  69   ? 92.481  24.226  -25.712 1.00 75.78  ? 69   PRO B CA    1 
ATOM   4510  C  C     . PRO H  4  69   ? 93.681  24.436  -24.775 1.00 77.05  ? 69   PRO B C     1 
ATOM   4511  O  O     . PRO H  4  69   ? 94.719  24.988  -25.176 1.00 77.24  ? 69   PRO B O     1 
ATOM   4512  C  CB    . PRO H  4  69   ? 92.514  22.901  -26.462 1.00 75.33  ? 69   PRO B CB    1 
ATOM   4513  C  CG    . PRO H  4  69   ? 91.668  23.203  -27.653 1.00 75.24  ? 69   PRO B CG    1 
ATOM   4514  C  CD    . PRO H  4  69   ? 92.231  24.547  -28.089 1.00 75.31  ? 69   PRO B CD    1 
ATOM   4515  N  N     . GLY H  4  70   ? 93.535  24.001  -23.526 1.00 77.63  ? 70   GLY B N     1 
ATOM   4516  C  CA    . GLY H  4  70   ? 94.608  24.171  -22.562 1.00 78.12  ? 70   GLY B CA    1 
ATOM   4517  C  C     . GLY H  4  70   ? 94.796  25.628  -22.174 1.00 78.43  ? 70   GLY B C     1 
ATOM   4518  O  O     . GLY H  4  70   ? 95.632  25.954  -21.334 1.00 78.30  ? 70   GLY B O     1 
ATOM   4519  N  N     . VAL H  4  71   ? 94.015  26.503  -22.797 1.00 78.70  ? 71   VAL B N     1 
ATOM   4520  C  CA    . VAL H  4  71   ? 94.051  27.934  -22.515 1.00 78.86  ? 71   VAL B CA    1 
ATOM   4521  C  C     . VAL H  4  71   ? 92.672  28.403  -22.008 1.00 79.11  ? 71   VAL B C     1 
ATOM   4522  O  O     . VAL H  4  71   ? 91.682  28.371  -22.748 1.00 79.65  ? 71   VAL B O     1 
ATOM   4523  C  CB    . VAL H  4  71   ? 94.466  28.752  -23.807 1.00 78.96  ? 71   VAL B CB    1 
ATOM   4524  C  CG1   . VAL H  4  71   ? 95.068  30.114  -23.403 1.00 77.61  ? 71   VAL B CG1   1 
ATOM   4525  C  CG2   . VAL H  4  71   ? 95.505  27.966  -24.626 1.00 78.37  ? 71   VAL B CG2   1 
ATOM   4526  N  N     . LYS H  4  72   ? 92.607  28.815  -20.744 1.00 78.06  ? 72   LYS B N     1 
ATOM   4527  C  CA    . LYS H  4  72   ? 91.348  29.265  -20.144 1.00 77.58  ? 72   LYS B CA    1 
ATOM   4528  C  C     . LYS H  4  72   ? 90.708  30.388  -20.974 1.00 77.28  ? 72   LYS B C     1 
ATOM   4529  O  O     . LYS H  4  72   ? 89.582  30.253  -21.478 1.00 76.50  ? 72   LYS B O     1 
ATOM   4530  C  CB    . LYS H  4  72   ? 91.600  29.765  -18.710 1.00 76.45  ? 72   LYS B CB    1 
ATOM   4531  C  CG    . LYS H  4  72   ? 90.326  30.039  -17.870 1.00 74.21  ? 72   LYS B CG    1 
ATOM   4532  C  CD    . LYS H  4  72   ? 89.769  28.786  -17.190 1.00 70.92  ? 72   LYS B CD    1 
ATOM   4533  C  CE    . LYS H  4  72   ? 88.630  29.140  -16.247 1.00 68.25  ? 72   LYS B CE    1 
ATOM   4534  N  NZ    . LYS H  4  72   ? 88.222  27.967  -15.449 1.00 66.50  ? 72   LYS B NZ    1 
ATOM   4535  N  N     . GLU H  4  73   ? 91.446  31.489  -21.105 1.00 76.17  ? 73   GLU B N     1 
ATOM   4536  C  CA    . GLU H  4  73   ? 90.995  32.656  -21.845 1.00 76.31  ? 73   GLU B CA    1 
ATOM   4537  C  C     . GLU H  4  73   ? 90.629  32.302  -23.287 1.00 76.37  ? 73   GLU B C     1 
ATOM   4538  O  O     . GLU H  4  73   ? 91.142  31.342  -23.860 1.00 76.52  ? 73   GLU B O     1 
ATOM   4539  C  CB    . GLU H  4  73   ? 92.091  33.739  -21.866 1.00 76.33  ? 73   GLU B CB    1 
ATOM   4540  C  CG    . GLU H  4  73   ? 93.398  33.361  -21.171 1.00 76.83  ? 73   GLU B CG    1 
ATOM   4541  C  CD    . GLU H  4  73   ? 93.400  33.737  -19.707 1.00 77.22  ? 73   GLU B CD    1 
ATOM   4542  O  OE1   . GLU H  4  73   ? 94.341  33.351  -18.984 1.00 77.18  ? 73   GLU B OE1   1 
ATOM   4543  O  OE2   . GLU H  4  73   ? 92.453  34.430  -19.280 1.00 78.02  ? 73   GLU B OE2   1 
ATOM   4544  N  N     . ASP H  4  74   ? 89.729  33.097  -23.857 1.00 75.81  ? 74   ASP B N     1 
ATOM   4545  C  CA    . ASP H  4  74   ? 89.297  32.956  -25.242 1.00 74.27  ? 74   ASP B CA    1 
ATOM   4546  C  C     . ASP H  4  74   ? 90.073  33.959  -26.118 1.00 74.20  ? 74   ASP B C     1 
ATOM   4547  O  O     . ASP H  4  74   ? 90.528  34.990  -25.600 1.00 73.08  ? 74   ASP B O     1 
ATOM   4548  C  CB    . ASP H  4  74   ? 87.775  33.212  -25.285 1.00 73.78  ? 74   ASP B CB    1 
ATOM   4549  C  CG    . ASP H  4  74   ? 87.089  32.612  -26.491 1.00 71.79  ? 74   ASP B CG    1 
ATOM   4550  O  OD1   . ASP H  4  74   ? 87.323  31.429  -26.777 1.00 71.39  ? 74   ASP B OD1   1 
ATOM   4551  O  OD2   . ASP H  4  74   ? 86.303  33.331  -27.146 1.00 71.23  ? 74   ASP B OD2   1 
ATOM   4552  N  N     . VAL H  4  75   ? 90.240  33.669  -27.409 1.00 74.86  ? 75   VAL B N     1 
ATOM   4553  C  CA    . VAL H  4  75   ? 90.971  34.567  -28.320 1.00 75.28  ? 75   VAL B CA    1 
ATOM   4554  C  C     . VAL H  4  75   ? 90.583  36.036  -28.089 1.00 75.64  ? 75   VAL B C     1 
ATOM   4555  O  O     . VAL H  4  75   ? 91.443  36.911  -28.053 1.00 76.47  ? 75   VAL B O     1 
ATOM   4556  C  CB    . VAL H  4  75   ? 90.697  34.212  -29.829 1.00 74.26  ? 75   VAL B CB    1 
ATOM   4557  C  CG1   . VAL H  4  75   ? 91.381  35.225  -30.751 1.00 73.44  ? 75   VAL B CG1   1 
ATOM   4558  C  CG2   . VAL H  4  75   ? 91.235  32.838  -30.143 1.00 74.40  ? 75   VAL B CG2   1 
ATOM   4559  N  N     . VAL H  4  76   ? 89.287  36.286  -27.918 1.00 76.49  ? 76   VAL B N     1 
ATOM   4560  C  CA    . VAL H  4  76   ? 88.753  37.632  -27.706 1.00 76.40  ? 76   VAL B CA    1 
ATOM   4561  C  C     . VAL H  4  76   ? 89.318  38.263  -26.424 1.00 75.50  ? 76   VAL B C     1 
ATOM   4562  O  O     . VAL H  4  76   ? 89.734  39.427  -26.434 1.00 74.92  ? 76   VAL B O     1 
ATOM   4563  C  CB    . VAL H  4  76   ? 87.184  37.592  -27.630 1.00 77.79  ? 76   VAL B CB    1 
ATOM   4564  C  CG1   . VAL H  4  76   ? 86.603  38.980  -27.891 1.00 78.86  ? 76   VAL B CG1   1 
ATOM   4565  C  CG2   . VAL H  4  76   ? 86.638  36.579  -28.643 1.00 78.40  ? 76   VAL B CG2   1 
ATOM   4566  N  N     . GLU H  4  77   ? 89.329  37.504  -25.331 1.00 74.90  ? 77   GLU B N     1 
ATOM   4567  C  CA    . GLU H  4  77   ? 89.863  37.998  -24.060 1.00 74.21  ? 77   GLU B CA    1 
ATOM   4568  C  C     . GLU H  4  77   ? 91.360  38.260  -24.171 1.00 73.14  ? 77   GLU B C     1 
ATOM   4569  O  O     . GLU H  4  77   ? 91.885  39.224  -23.605 1.00 72.82  ? 77   GLU B O     1 
ATOM   4570  C  CB    . GLU H  4  77   ? 89.593  36.982  -22.932 1.00 74.93  ? 77   GLU B CB    1 
ATOM   4571  C  CG    . GLU H  4  77   ? 90.566  37.029  -21.688 1.00 76.68  ? 77   GLU B CG    1 
ATOM   4572  C  CD    . GLU H  4  77   ? 90.862  38.444  -21.132 1.00 76.72  ? 77   GLU B CD    1 
ATOM   4573  O  OE1   . GLU H  4  77   ? 89.940  39.287  -21.057 1.00 78.01  ? 77   GLU B OE1   1 
ATOM   4574  O  OE2   . GLU H  4  77   ? 92.033  38.707  -20.768 1.00 75.54  ? 77   GLU B OE2   1 
ATOM   4575  N  N     . ILE H  4  78   ? 92.046  37.398  -24.901 1.00 71.09  ? 78   ILE B N     1 
ATOM   4576  C  CA    . ILE H  4  78   ? 93.463  37.576  -25.062 1.00 70.40  ? 78   ILE B CA    1 
ATOM   4577  C  C     . ILE H  4  78   ? 93.771  38.806  -25.911 1.00 70.14  ? 78   ILE B C     1 
ATOM   4578  O  O     . ILE H  4  78   ? 94.544  39.666  -25.478 1.00 70.69  ? 78   ILE B O     1 
ATOM   4579  C  CB    . ILE H  4  78   ? 94.087  36.286  -25.657 1.00 69.75  ? 78   ILE B CB    1 
ATOM   4580  C  CG1   . ILE H  4  78   ? 94.360  35.317  -24.486 1.00 69.20  ? 78   ILE B CG1   1 
ATOM   4581  C  CG2   . ILE H  4  78   ? 95.372  36.601  -26.445 1.00 70.16  ? 78   ILE B CG2   1 
ATOM   4582  C  CD1   . ILE H  4  78   ? 95.209  34.082  -24.806 1.00 69.03  ? 78   ILE B CD1   1 
ATOM   4583  N  N     . ILE H  4  79   ? 93.176  38.909  -27.101 1.00 69.53  ? 79   ILE B N     1 
ATOM   4584  C  CA    . ILE H  4  79   ? 93.441  40.065  -27.958 1.00 69.58  ? 79   ILE B CA    1 
ATOM   4585  C  C     . ILE H  4  79   ? 93.127  41.350  -27.228 1.00 69.90  ? 79   ILE B C     1 
ATOM   4586  O  O     . ILE H  4  79   ? 93.697  42.409  -27.509 1.00 70.56  ? 79   ILE B O     1 
ATOM   4587  C  CB    . ILE H  4  79   ? 92.605  40.057  -29.300 1.00 69.27  ? 79   ILE B CB    1 
ATOM   4588  C  CG1   . ILE H  4  79   ? 91.122  40.331  -29.016 1.00 68.27  ? 79   ILE B CG1   1 
ATOM   4589  C  CG2   . ILE H  4  79   ? 92.855  38.749  -30.052 1.00 69.31  ? 79   ILE B CG2   1 
ATOM   4590  C  CD1   . ILE H  4  79   ? 90.687  41.775  -29.288 1.00 66.34  ? 79   ILE B CD1   1 
ATOM   4591  N  N     . LEU H  4  80   ? 92.200  41.241  -26.286 1.00 69.15  ? 80   LEU B N     1 
ATOM   4592  C  CA    . LEU H  4  80   ? 91.813  42.375  -25.466 1.00 68.84  ? 80   LEU B CA    1 
ATOM   4593  C  C     . LEU H  4  80   ? 92.976  42.791  -24.563 1.00 67.62  ? 80   LEU B C     1 
ATOM   4594  O  O     . LEU H  4  80   ? 93.380  43.958  -24.510 1.00 67.50  ? 80   LEU B O     1 
ATOM   4595  C  CB    . LEU H  4  80   ? 90.606  41.973  -24.622 1.00 68.87  ? 80   LEU B CB    1 
ATOM   4596  C  CG    . LEU H  4  80   ? 89.775  43.068  -23.980 1.00 68.61  ? 80   LEU B CG    1 
ATOM   4597  C  CD1   . LEU H  4  80   ? 89.229  43.998  -25.063 1.00 68.34  ? 80   LEU B CD1   1 
ATOM   4598  C  CD2   . LEU H  4  80   ? 88.651  42.404  -23.180 1.00 68.92  ? 80   LEU B CD2   1 
ATOM   4599  N  N     . ASN H  4  81   ? 93.501  41.790  -23.862 1.00 66.10  ? 81   ASN B N     1 
ATOM   4600  C  CA    . ASN H  4  81   ? 94.624  41.923  -22.945 1.00 63.17  ? 81   ASN B CA    1 
ATOM   4601  C  C     . ASN H  4  81   ? 95.839  42.492  -23.675 1.00 62.16  ? 81   ASN B C     1 
ATOM   4602  O  O     . ASN H  4  81   ? 96.692  43.148  -23.074 1.00 62.34  ? 81   ASN B O     1 
ATOM   4603  C  CB    . ASN H  4  81   ? 94.946  40.535  -22.383 1.00 62.49  ? 81   ASN B CB    1 
ATOM   4604  C  CG    . ASN H  4  81   ? 95.055  40.497  -20.895 1.00 62.47  ? 81   ASN B CG    1 
ATOM   4605  O  OD1   . ASN H  4  81   ? 94.692  39.494  -20.277 1.00 61.69  ? 81   ASN B OD1   1 
ATOM   4606  N  ND2   . ASN H  4  81   ? 95.557  41.571  -20.298 1.00 63.40  ? 81   ASN B ND2   1 
ATOM   4607  N  N     . LEU H  4  82   ? 95.917  42.234  -24.976 1.00 59.71  ? 82   LEU B N     1 
ATOM   4608  C  CA    . LEU H  4  82   ? 97.035  42.731  -25.753 1.00 58.50  ? 82   LEU B CA    1 
ATOM   4609  C  C     . LEU H  4  82   ? 96.934  44.237  -25.941 1.00 57.47  ? 82   LEU B C     1 
ATOM   4610  O  O     . LEU H  4  82   ? 97.947  44.943  -25.974 1.00 57.18  ? 82   LEU B O     1 
ATOM   4611  C  CB    . LEU H  4  82   ? 97.074  42.013  -27.099 1.00 56.92  ? 82   LEU B CB    1 
ATOM   4612  C  CG    . LEU H  4  82   ? 97.250  40.493  -26.948 1.00 55.75  ? 82   LEU B CG    1 
ATOM   4613  C  CD1   . LEU H  4  82   ? 97.200  39.861  -28.313 1.00 55.68  ? 82   LEU B CD1   1 
ATOM   4614  C  CD2   . LEU H  4  82   ? 98.568  40.163  -26.265 1.00 54.14  ? 82   LEU B CD2   1 
ATOM   4615  N  N     . LYS H  4  83   ? 95.709  44.731  -26.062 1.00 56.22  ? 83   LYS B N     1 
ATOM   4616  C  CA    . LYS H  4  83   ? 95.524  46.160  -26.188 1.00 55.66  ? 83   LYS B CA    1 
ATOM   4617  C  C     . LYS H  4  83   ? 96.153  46.866  -24.994 1.00 55.78  ? 83   LYS B C     1 
ATOM   4618  O  O     . LYS H  4  83   ? 96.622  48.005  -25.088 1.00 56.44  ? 83   LYS B O     1 
ATOM   4619  C  CB    . LYS H  4  83   ? 94.030  46.500  -26.241 1.00 56.26  ? 83   LYS B CB    1 
ATOM   4620  C  CG    . LYS H  4  83   ? 93.267  45.988  -27.458 1.00 56.66  ? 83   LYS B CG    1 
ATOM   4621  C  CD    . LYS H  4  83   ? 91.763  46.255  -27.308 1.00 55.77  ? 83   LYS B CD    1 
ATOM   4622  C  CE    . LYS H  4  83   ? 91.162  46.822  -28.579 1.00 55.13  ? 83   LYS B CE    1 
ATOM   4623  N  NZ    . LYS H  4  83   ? 91.250  45.908  -29.756 1.00 55.01  ? 83   LYS B NZ    1 
ATOM   4624  N  N     . GLU H  4  84   ? 96.161  46.149  -23.872 1.00 55.31  ? 84   GLU B N     1 
ATOM   4625  C  CA    . GLU H  4  84   ? 96.693  46.643  -22.603 1.00 55.17  ? 84   GLU B CA    1 
ATOM   4626  C  C     . GLU H  4  84   ? 98.215  46.673  -22.615 1.00 54.15  ? 84   GLU B C     1 
ATOM   4627  O  O     . GLU H  4  84   ? 98.853  47.359  -21.811 1.00 53.34  ? 84   GLU B O     1 
ATOM   4628  C  CB    . GLU H  4  84   ? 96.190  45.752  -21.446 1.00 56.35  ? 84   GLU B CB    1 
ATOM   4629  C  CG    . GLU H  4  84   ? 96.596  46.198  -19.991 1.00 57.06  ? 84   GLU B CG    1 
ATOM   4630  C  CD    . GLU H  4  84   ? 95.652  47.239  -19.326 1.00 54.99  ? 84   GLU B CD    1 
ATOM   4631  O  OE1   . GLU H  4  84   ? 94.426  46.991  -19.228 1.00 53.27  ? 84   GLU B OE1   1 
ATOM   4632  O  OE2   . GLU H  4  84   ? 96.149  48.304  -18.893 1.00 53.95  ? 84   GLU B OE2   1 
ATOM   4633  N  N     . LEU H  4  85   ? 98.801  45.922  -23.530 1.00 53.21  ? 85   LEU B N     1 
ATOM   4634  C  CA    . LEU H  4  85   ? 100.245 45.890  -23.615 1.00 53.11  ? 85   LEU B CA    1 
ATOM   4635  C  C     . LEU H  4  85   ? 100.798 47.246  -24.061 1.00 54.16  ? 85   LEU B C     1 
ATOM   4636  O  O     . LEU H  4  85   ? 100.405 47.779  -25.107 1.00 53.35  ? 85   LEU B O     1 
ATOM   4637  C  CB    . LEU H  4  85   ? 100.682 44.805  -24.605 1.00 50.07  ? 85   LEU B CB    1 
ATOM   4638  C  CG    . LEU H  4  85   ? 102.138 44.360  -24.587 1.00 45.47  ? 85   LEU B CG    1 
ATOM   4639  C  CD1   . LEU H  4  85   ? 102.230 43.038  -23.897 1.00 44.44  ? 85   LEU B CD1   1 
ATOM   4640  C  CD2   . LEU H  4  85   ? 102.655 44.233  -25.981 1.00 45.28  ? 85   LEU B CD2   1 
ATOM   4641  N  N     . VAL H  4  86   ? 101.695 47.805  -23.250 1.00 54.73  ? 86   VAL B N     1 
ATOM   4642  C  CA    . VAL H  4  86   ? 102.348 49.058  -23.599 1.00 55.78  ? 86   VAL B CA    1 
ATOM   4643  C  C     . VAL H  4  86   ? 103.837 48.833  -23.875 1.00 55.90  ? 86   VAL B C     1 
ATOM   4644  O  O     . VAL H  4  86   ? 104.612 48.477  -22.980 1.00 56.25  ? 86   VAL B O     1 
ATOM   4645  C  CB    . VAL H  4  86   ? 102.224 50.139  -22.488 1.00 55.94  ? 86   VAL B CB    1 
ATOM   4646  C  CG1   . VAL H  4  86   ? 102.720 49.595  -21.155 1.00 56.85  ? 86   VAL B CG1   1 
ATOM   4647  C  CG2   . VAL H  4  86   ? 103.033 51.370  -22.901 1.00 54.25  ? 86   VAL B CG2   1 
ATOM   4648  N  N     . VAL H  4  87   ? 104.214 49.038  -25.134 1.00 56.14  ? 87   VAL B N     1 
ATOM   4649  C  CA    . VAL H  4  87   ? 105.591 48.880  -25.580 1.00 54.27  ? 87   VAL B CA    1 
ATOM   4650  C  C     . VAL H  4  87   ? 106.228 50.240  -25.834 1.00 52.95  ? 87   VAL B C     1 
ATOM   4651  O  O     . VAL H  4  87   ? 105.530 51.237  -26.033 1.00 53.07  ? 87   VAL B O     1 
ATOM   4652  C  CB    . VAL H  4  87   ? 105.651 48.029  -26.883 1.00 55.57  ? 87   VAL B CB    1 
ATOM   4653  C  CG1   . VAL H  4  87   ? 105.135 46.606  -26.610 1.00 55.53  ? 87   VAL B CG1   1 
ATOM   4654  C  CG2   . VAL H  4  87   ? 104.802 48.690  -27.964 1.00 55.21  ? 87   VAL B CG2   1 
ATOM   4655  N  N     . ARG H  4  88   ? 107.552 50.290  -25.832 1.00 51.65  ? 88   ARG B N     1 
ATOM   4656  C  CA    . ARG H  4  88   ? 108.226 51.557  -26.044 1.00 49.84  ? 88   ARG B CA    1 
ATOM   4657  C  C     . ARG H  4  88   ? 109.433 51.391  -26.968 1.00 49.34  ? 88   ARG B C     1 
ATOM   4658  O  O     . ARG H  4  88   ? 110.440 50.869  -26.515 1.00 49.09  ? 88   ARG B O     1 
ATOM   4659  C  CB    . ARG H  4  88   ? 108.657 52.098  -24.669 1.00 48.77  ? 88   ARG B CB    1 
ATOM   4660  C  CG    . ARG H  4  88   ? 108.757 53.595  -24.531 1.00 48.54  ? 88   ARG B CG    1 
ATOM   4661  C  CD    . ARG H  4  88   ? 110.186 54.049  -24.269 1.00 48.35  ? 88   ARG B CD    1 
ATOM   4662  N  NE    . ARG H  4  88   ? 110.298 55.509  -24.247 1.00 47.26  ? 88   ARG B NE    1 
ATOM   4663  C  CZ    . ARG H  4  88   ? 111.450 56.178  -24.256 1.00 47.63  ? 88   ARG B CZ    1 
ATOM   4664  N  NH1   . ARG H  4  88   ? 112.607 55.525  -24.288 1.00 48.26  ? 88   ARG B NH1   1 
ATOM   4665  N  NH2   . ARG H  4  88   ? 111.447 57.503  -24.236 1.00 47.42  ? 88   ARG B NH2   1 
ATOM   4666  N  N     . PHE H  4  89   ? 109.352 51.803  -28.243 1.00 49.90  ? 89   PHE B N     1 
ATOM   4667  C  CA    . PHE H  4  89   ? 110.544 51.707  -29.109 1.00 50.20  ? 89   PHE B CA    1 
ATOM   4668  C  C     . PHE H  4  89   ? 111.374 53.006  -29.021 1.00 51.76  ? 89   PHE B C     1 
ATOM   4669  O  O     . PHE H  4  89   ? 110.857 54.070  -28.665 1.00 49.42  ? 89   PHE B O     1 
ATOM   4670  C  CB    . PHE H  4  89   ? 110.280 51.449  -30.636 1.00 48.27  ? 89   PHE B CB    1 
ATOM   4671  C  CG    . PHE H  4  89   ? 108.885 50.979  -31.040 1.00 44.47  ? 89   PHE B CG    1 
ATOM   4672  C  CD1   . PHE H  4  89   ? 108.119 50.101  -30.255 1.00 43.47  ? 89   PHE B CD1   1 
ATOM   4673  C  CD2   . PHE H  4  89   ? 108.355 51.421  -32.278 1.00 41.53  ? 89   PHE B CD2   1 
ATOM   4674  C  CE1   . PHE H  4  89   ? 106.836 49.671  -30.701 1.00 41.48  ? 89   PHE B CE1   1 
ATOM   4675  C  CE2   . PHE H  4  89   ? 107.094 51.006  -32.733 1.00 39.03  ? 89   PHE B CE2   1 
ATOM   4676  C  CZ    . PHE H  4  89   ? 106.333 50.134  -31.947 1.00 39.73  ? 89   PHE B CZ    1 
ATOM   4677  N  N     . LEU H  4  90   ? 112.652 52.917  -29.383 1.00 54.49  ? 90   LEU B N     1 
ATOM   4678  C  CA    . LEU H  4  90   ? 113.579 54.036  -29.207 1.00 57.19  ? 90   LEU B CA    1 
ATOM   4679  C  C     . LEU H  4  90   ? 113.855 54.855  -30.497 1.00 59.11  ? 90   LEU B C     1 
ATOM   4680  O  O     . LEU H  4  90   ? 114.387 55.955  -30.357 1.00 59.67  ? 90   LEU B O     1 
ATOM   4681  C  CB    . LEU H  4  90   ? 114.891 53.477  -28.630 1.00 58.11  ? 90   LEU B CB    1 
ATOM   4682  C  CG    . LEU H  4  90   ? 115.900 54.338  -27.852 1.00 58.83  ? 90   LEU B CG    1 
ATOM   4683  C  CD1   . LEU H  4  90   ? 115.225 55.216  -26.806 1.00 59.02  ? 90   LEU B CD1   1 
ATOM   4684  C  CD2   . LEU H  4  90   ? 116.887 53.385  -27.175 1.00 59.79  ? 90   LEU B CD2   1 
ATOM   4685  N  N     . ASN H  4  91   ? 113.536 54.412  -31.722 1.00 62.20  ? 91   ASN B N     1 
ATOM   4686  C  CA    . ASN H  4  91   ? 113.867 55.275  -32.892 1.00 63.15  ? 91   ASN B CA    1 
ATOM   4687  C  C     . ASN H  4  91   ? 112.979 54.986  -34.145 1.00 64.23  ? 91   ASN B C     1 
ATOM   4688  O  O     . ASN H  4  91   ? 112.523 53.857  -34.362 1.00 65.14  ? 91   ASN B O     1 
ATOM   4689  C  CB    . ASN H  4  91   ? 115.364 55.116  -33.253 1.00 62.15  ? 91   ASN B CB    1 
ATOM   4690  C  CG    . ASN H  4  91   ? 115.814 53.646  -33.350 1.00 61.30  ? 91   ASN B CG    1 
ATOM   4691  O  OD1   . ASN H  4  91   ? 115.806 53.044  -34.430 1.00 59.67  ? 91   ASN B OD1   1 
ATOM   4692  N  ND2   . ASN H  4  91   ? 116.204 53.071  -32.214 1.00 60.30  ? 91   ASN B ND2   1 
ATOM   4693  N  N     . PRO H  4  92   ? 112.743 56.024  -34.989 1.00 64.19  ? 92   PRO B N     1 
ATOM   4694  C  CA    . PRO H  4  92   ? 111.940 55.986  -36.223 1.00 64.57  ? 92   PRO B CA    1 
ATOM   4695  C  C     . PRO H  4  92   ? 112.156 54.719  -37.053 1.00 64.75  ? 92   PRO B C     1 
ATOM   4696  O  O     . PRO H  4  92   ? 111.211 54.226  -37.677 1.00 65.14  ? 92   PRO B O     1 
ATOM   4697  C  CB    . PRO H  4  92   ? 112.358 57.251  -36.948 1.00 65.28  ? 92   PRO B CB    1 
ATOM   4698  C  CG    . PRO H  4  92   ? 112.534 58.196  -35.819 1.00 64.75  ? 92   PRO B CG    1 
ATOM   4699  C  CD    . PRO H  4  92   ? 113.271 57.388  -34.779 1.00 64.01  ? 92   PRO B CD    1 
ATOM   4700  N  N     . SER H  4  93   ? 113.379 54.194  -37.067 1.00 63.94  ? 93   SER B N     1 
ATOM   4701  C  CA    . SER H  4  93   ? 113.672 52.988  -37.842 1.00 63.35  ? 93   SER B CA    1 
ATOM   4702  C  C     . SER H  4  93   ? 112.681 51.854  -37.514 1.00 60.91  ? 93   SER B C     1 
ATOM   4703  O  O     . SER H  4  93   ? 112.431 50.970  -38.343 1.00 61.00  ? 93   SER B O     1 
ATOM   4704  C  CB    . SER H  4  93   ? 115.124 52.535  -37.579 1.00 64.86  ? 93   SER B CB    1 
ATOM   4705  O  OG    . SER H  4  93   ? 116.068 53.399  -38.218 1.00 64.66  ? 93   SER B OG    1 
ATOM   4706  N  N     . LEU H  4  94   ? 112.117 51.890  -36.309 1.00 58.50  ? 94   LEU B N     1 
ATOM   4707  C  CA    . LEU H  4  94   ? 111.139 50.894  -35.884 1.00 56.24  ? 94   LEU B CA    1 
ATOM   4708  C  C     . LEU H  4  94   ? 109.719 51.409  -36.066 1.00 57.09  ? 94   LEU B C     1 
ATOM   4709  O  O     . LEU H  4  94   ? 109.114 51.980  -35.143 1.00 55.94  ? 94   LEU B O     1 
ATOM   4710  C  CB    . LEU H  4  94   ? 111.332 50.529  -34.415 1.00 52.55  ? 94   LEU B CB    1 
ATOM   4711  C  CG    . LEU H  4  94   ? 112.723 50.190  -33.911 1.00 48.63  ? 94   LEU B CG    1 
ATOM   4712  C  CD1   . LEU H  4  94   ? 112.565 49.706  -32.517 1.00 47.22  ? 94   LEU B CD1   1 
ATOM   4713  C  CD2   . LEU H  4  94   ? 113.404 49.141  -34.763 1.00 47.98  ? 94   LEU B CD2   1 
ATOM   4714  N  N     . GLN H  4  95   ? 109.198 51.203  -37.266 1.00 57.86  ? 95   GLN B N     1 
ATOM   4715  C  CA    . GLN H  4  95   ? 107.854 51.624  -37.585 1.00 58.97  ? 95   GLN B CA    1 
ATOM   4716  C  C     . GLN H  4  95   ? 106.857 50.549  -37.185 1.00 58.50  ? 95   GLN B C     1 
ATOM   4717  O  O     . GLN H  4  95   ? 105.870 50.821  -36.501 1.00 57.85  ? 95   GLN B O     1 
ATOM   4718  C  CB    . GLN H  4  95   ? 107.773 51.933  -39.089 1.00 60.41  ? 95   GLN B CB    1 
ATOM   4719  C  CG    . GLN H  4  95   ? 108.718 53.061  -39.530 1.00 60.90  ? 95   GLN B CG    1 
ATOM   4720  C  CD    . GLN H  4  95   ? 109.840 52.604  -40.462 1.00 61.68  ? 95   GLN B CD    1 
ATOM   4721  O  OE1   . GLN H  4  95   ? 110.748 53.384  -40.790 1.00 62.55  ? 95   GLN B OE1   1 
ATOM   4722  N  NE2   . GLN H  4  95   ? 109.784 51.342  -40.897 1.00 60.81  ? 95   GLN B NE2   1 
ATOM   4723  N  N     . THR H  4  96   ? 107.141 49.324  -37.613 1.00 58.93  ? 96   THR B N     1 
ATOM   4724  C  CA    . THR H  4  96   ? 106.304 48.168  -37.301 1.00 58.70  ? 96   THR B CA    1 
ATOM   4725  C  C     . THR H  4  96   ? 107.152 46.984  -36.822 1.00 58.49  ? 96   THR B C     1 
ATOM   4726  O  O     . THR H  4  96   ? 107.922 46.381  -37.573 1.00 59.02  ? 96   THR B O     1 
ATOM   4727  C  CB    . THR H  4  96   ? 105.446 47.722  -38.538 1.00 59.02  ? 96   THR B CB    1 
ATOM   4728  O  OG1   . THR H  4  96   ? 104.836 46.451  -38.253 1.00 57.38  ? 96   THR B OG1   1 
ATOM   4729  C  CG2   . THR H  4  96   ? 106.296 47.649  -39.815 1.00 58.85  ? 96   THR B CG2   1 
ATOM   4730  N  N     . VAL H  4  97   ? 107.009 46.665  -35.547 1.00 58.43  ? 97   VAL B N     1 
ATOM   4731  C  CA    . VAL H  4  97   ? 107.746 45.566  -34.950 1.00 57.21  ? 97   VAL B CA    1 
ATOM   4732  C  C     . VAL H  4  97   ? 106.792 44.446  -34.552 1.00 56.10  ? 97   VAL B C     1 
ATOM   4733  O  O     . VAL H  4  97   ? 105.785 44.686  -33.884 1.00 56.45  ? 97   VAL B O     1 
ATOM   4734  C  CB    . VAL H  4  97   ? 108.540 46.052  -33.671 1.00 57.69  ? 97   VAL B CB    1 
ATOM   4735  C  CG1   . VAL H  4  97   ? 109.074 44.857  -32.875 1.00 56.58  ? 97   VAL B CG1   1 
ATOM   4736  C  CG2   . VAL H  4  97   ? 109.697 46.952  -34.080 1.00 58.36  ? 97   VAL B CG2   1 
ATOM   4737  N  N     . THR H  4  98   ? 107.095 43.225  -34.977 1.00 54.57  ? 98   THR B N     1 
ATOM   4738  C  CA    . THR H  4  98   ? 106.268 42.095  -34.600 1.00 51.54  ? 98   THR B CA    1 
ATOM   4739  C  C     . THR H  4  98   ? 106.922 41.309  -33.473 1.00 51.41  ? 98   THR B C     1 
ATOM   4740  O  O     . THR H  4  98   ? 107.992 40.717  -33.633 1.00 51.01  ? 98   THR B O     1 
ATOM   4741  C  CB    . THR H  4  98   ? 106.004 41.132  -35.799 1.00 51.18  ? 98   THR B CB    1 
ATOM   4742  O  OG1   . THR H  4  98   ? 105.145 41.780  -36.753 1.00 47.47  ? 98   THR B OG1   1 
ATOM   4743  C  CG2   . THR H  4  98   ? 105.284 39.854  -35.319 1.00 48.87  ? 98   THR B CG2   1 
ATOM   4744  N  N     . LEU H  4  99   ? 106.270 41.329  -32.321 1.00 51.05  ? 99   LEU B N     1 
ATOM   4745  C  CA    . LEU H  4  99   ? 106.754 40.601  -31.160 1.00 51.47  ? 99   LEU B CA    1 
ATOM   4746  C  C     . LEU H  4  99   ? 106.347 39.123  -31.231 1.00 50.03  ? 99   LEU B C     1 
ATOM   4747  O  O     . LEU H  4  99   ? 105.179 38.794  -31.479 1.00 49.57  ? 99   LEU B O     1 
ATOM   4748  C  CB    . LEU H  4  99   ? 106.191 41.252  -29.901 1.00 52.47  ? 99   LEU B CB    1 
ATOM   4749  C  CG    . LEU H  4  99   ? 106.859 42.501  -29.302 1.00 54.72  ? 99   LEU B CG    1 
ATOM   4750  C  CD1   . LEU H  4  99   ? 107.891 43.133  -30.237 1.00 54.73  ? 99   LEU B CD1   1 
ATOM   4751  C  CD2   . LEU H  4  99   ? 105.740 43.477  -28.981 1.00 54.92  ? 99   LEU B CD2   1 
ATOM   4752  N  N     . LEU H  4  100  ? 107.308 38.228  -31.016 1.00 47.53  ? 100  LEU B N     1 
ATOM   4753  C  CA    . LEU H  4  100  ? 107.031 36.799  -31.095 1.00 44.26  ? 100  LEU B CA    1 
ATOM   4754  C  C     . LEU H  4  100  ? 107.080 36.156  -29.735 1.00 43.65  ? 100  LEU B C     1 
ATOM   4755  O  O     . LEU H  4  100  ? 107.935 36.487  -28.927 1.00 43.58  ? 100  LEU B O     1 
ATOM   4756  C  CB    . LEU H  4  100  ? 108.052 36.096  -31.991 1.00 44.89  ? 100  LEU B CB    1 
ATOM   4757  C  CG    . LEU H  4  100  ? 108.165 36.407  -33.485 1.00 45.33  ? 100  LEU B CG    1 
ATOM   4758  C  CD1   . LEU H  4  100  ? 109.326 35.638  -34.098 1.00 44.39  ? 100  LEU B CD1   1 
ATOM   4759  C  CD2   . LEU H  4  100  ? 106.886 36.033  -34.164 1.00 45.32  ? 100  LEU B CD2   1 
ATOM   4760  N  N     . LEU H  4  101  ? 106.162 35.222  -29.496 1.00 44.04  ? 101  LEU B N     1 
ATOM   4761  C  CA    . LEU H  4  101  ? 106.080 34.507  -28.228 1.00 43.15  ? 101  LEU B CA    1 
ATOM   4762  C  C     . LEU H  4  101  ? 105.413 33.159  -28.386 1.00 42.34  ? 101  LEU B C     1 
ATOM   4763  O  O     . LEU H  4  101  ? 104.384 33.038  -29.047 1.00 41.35  ? 101  LEU B O     1 
ATOM   4764  C  CB    . LEU H  4  101  ? 105.275 35.310  -27.214 1.00 43.26  ? 101  LEU B CB    1 
ATOM   4765  C  CG    . LEU H  4  101  ? 104.648 34.503  -26.082 1.00 42.77  ? 101  LEU B CG    1 
ATOM   4766  C  CD1   . LEU H  4  101  ? 105.755 34.150  -25.087 1.00 43.23  ? 101  LEU B CD1   1 
ATOM   4767  C  CD2   . LEU H  4  101  ? 103.521 35.268  -25.441 1.00 41.45  ? 101  LEU B CD2   1 
ATOM   4768  N  N     . LYS H  4  102  ? 106.018 32.160  -27.749 1.00 43.67  ? 102  LYS B N     1 
ATOM   4769  C  CA    . LYS H  4  102  ? 105.517 30.793  -27.737 1.00 44.67  ? 102  LYS B CA    1 
ATOM   4770  C  C     . LYS H  4  102  ? 105.820 30.128  -26.411 1.00 46.36  ? 102  LYS B C     1 
ATOM   4771  O  O     . LYS H  4  102  ? 106.983 30.017  -26.016 1.00 44.19  ? 102  LYS B O     1 
ATOM   4772  C  CB    . LYS H  4  102  ? 106.143 29.950  -28.856 1.00 43.82  ? 102  LYS B CB    1 
ATOM   4773  C  CG    . LYS H  4  102  ? 105.598 28.505  -28.884 1.00 42.85  ? 102  LYS B CG    1 
ATOM   4774  C  CD    . LYS H  4  102  ? 105.849 27.829  -30.217 1.00 43.28  ? 102  LYS B CD    1 
ATOM   4775  C  CE    . LYS H  4  102  ? 104.855 26.717  -30.475 1.00 42.44  ? 102  LYS B CE    1 
ATOM   4776  N  NZ    . LYS H  4  102  ? 104.986 25.703  -29.432 1.00 45.68  ? 102  LYS B NZ    1 
ATOM   4777  N  N     . ALA H  4  103  ? 104.759 29.697  -25.734 1.00 48.00  ? 103  ALA B N     1 
ATOM   4778  C  CA    . ALA H  4  103  ? 104.860 29.027  -24.444 1.00 50.95  ? 103  ALA B CA    1 
ATOM   4779  C  C     . ALA H  4  103  ? 103.966 27.792  -24.407 1.00 53.23  ? 103  ALA B C     1 
ATOM   4780  O  O     . ALA H  4  103  ? 102.879 27.779  -24.979 1.00 52.45  ? 103  ALA B O     1 
ATOM   4781  C  CB    . ALA H  4  103  ? 104.468 29.989  -23.326 1.00 50.69  ? 103  ALA B CB    1 
ATOM   4782  N  N     . GLU H  4  104  ? 104.428 26.751  -23.724 1.00 56.58  ? 104  GLU B N     1 
ATOM   4783  C  CA    . GLU H  4  104  ? 103.681 25.503  -23.663 1.00 58.25  ? 104  GLU B CA    1 
ATOM   4784  C  C     . GLU H  4  104  ? 103.576 24.978  -22.240 1.00 59.26  ? 104  GLU B C     1 
ATOM   4785  O  O     . GLU H  4  104  ? 104.350 25.351  -21.355 1.00 60.05  ? 104  GLU B O     1 
ATOM   4786  C  CB    . GLU H  4  104  ? 104.380 24.442  -24.527 1.00 59.45  ? 104  GLU B CB    1 
ATOM   4787  C  CG    . GLU H  4  104  ? 103.459 23.497  -25.332 1.00 60.83  ? 104  GLU B CG    1 
ATOM   4788  C  CD    . GLU H  4  104  ? 103.278 23.912  -26.800 1.00 60.20  ? 104  GLU B CD    1 
ATOM   4789  O  OE1   . GLU H  4  104  ? 102.799 23.071  -27.601 1.00 59.73  ? 104  GLU B OE1   1 
ATOM   4790  O  OE2   . GLU H  4  104  ? 103.612 25.072  -27.148 1.00 60.15  ? 104  GLU B OE2   1 
ATOM   4791  N  N     . GLY H  4  105  ? 102.596 24.105  -22.042 1.00 60.95  ? 105  GLY B N     1 
ATOM   4792  C  CA    . GLY H  4  105  ? 102.399 23.450  -20.763 1.00 62.59  ? 105  GLY B CA    1 
ATOM   4793  C  C     . GLY H  4  105  ? 101.764 24.275  -19.643 1.00 63.97  ? 105  GLY B C     1 
ATOM   4794  O  O     . GLY H  4  105  ? 101.133 25.296  -19.895 1.00 64.66  ? 105  GLY B O     1 
ATOM   4795  N  N     . PRO H  4  106  ? 101.923 23.832  -18.373 1.00 64.51  ? 106  PRO B N     1 
ATOM   4796  C  CA    . PRO H  4  106  ? 101.423 24.414  -17.121 1.00 65.16  ? 106  PRO B CA    1 
ATOM   4797  C  C     . PRO H  4  106  ? 102.062 25.754  -16.760 1.00 66.27  ? 106  PRO B C     1 
ATOM   4798  O  O     . PRO H  4  106  ? 102.418 25.943  -15.599 1.00 67.42  ? 106  PRO B O     1 
ATOM   4799  C  CB    . PRO H  4  106  ? 101.737 23.343  -16.082 1.00 64.23  ? 106  PRO B CB    1 
ATOM   4800  C  CG    . PRO H  4  106  ? 101.717 22.132  -16.824 1.00 63.94  ? 106  PRO B CG    1 
ATOM   4801  C  CD    . PRO H  4  106  ? 102.434 22.477  -18.084 1.00 65.36  ? 106  PRO B CD    1 
ATOM   4802  N  N     . LYS H  4  107  ? 102.216 26.689  -17.691 1.00 67.43  ? 107  LYS B N     1 
ATOM   4803  C  CA    . LYS H  4  107  ? 102.824 27.966  -17.295 1.00 67.20  ? 107  LYS B CA    1 
ATOM   4804  C  C     . LYS H  4  107  ? 101.921 29.148  -17.627 1.00 67.03  ? 107  LYS B C     1 
ATOM   4805  O  O     . LYS H  4  107  ? 101.104 29.092  -18.558 1.00 66.92  ? 107  LYS B O     1 
ATOM   4806  C  CB    . LYS H  4  107  ? 104.176 28.179  -17.989 1.00 66.95  ? 107  LYS B CB    1 
ATOM   4807  C  CG    . LYS H  4  107  ? 105.045 29.262  -17.325 1.00 64.96  ? 107  LYS B CG    1 
ATOM   4808  C  CD    . LYS H  4  107  ? 106.021 29.903  -18.292 1.00 62.75  ? 107  LYS B CD    1 
ATOM   4809  C  CE    . LYS H  4  107  ? 106.840 28.882  -19.076 1.00 60.58  ? 107  LYS B CE    1 
ATOM   4810  N  NZ    . LYS H  4  107  ? 106.104 28.404  -20.282 1.00 57.99  ? 107  LYS B NZ    1 
ATOM   4811  N  N     . GLU H  4  108  ? 102.081 30.212  -16.838 1.00 66.78  ? 108  GLU B N     1 
ATOM   4812  C  CA    . GLU H  4  108  ? 101.343 31.450  -17.050 1.00 66.93  ? 108  GLU B CA    1 
ATOM   4813  C  C     . GLU H  4  108  ? 102.062 32.298  -18.067 1.00 65.88  ? 108  GLU B C     1 
ATOM   4814  O  O     . GLU H  4  108  ? 103.275 32.457  -17.975 1.00 65.82  ? 108  GLU B O     1 
ATOM   4815  C  CB    . GLU H  4  108  ? 101.221 32.258  -15.748 1.00 67.65  ? 108  GLU B CB    1 
ATOM   4816  C  CG    . GLU H  4  108  ? 100.303 31.663  -14.678 1.00 67.76  ? 108  GLU B CG    1 
ATOM   4817  C  CD    . GLU H  4  108  ? 99.440  32.716  -13.993 1.00 67.02  ? 108  GLU B CD    1 
ATOM   4818  O  OE1   . GLU H  4  108  ? 98.233  32.775  -14.296 1.00 66.72  ? 108  GLU B OE1   1 
ATOM   4819  O  OE2   . GLU H  4  108  ? 99.962  33.489  -13.160 1.00 67.10  ? 108  GLU B OE2   1 
ATOM   4820  N  N     . VAL H  4  109  ? 101.346 32.841  -19.038 1.00 64.47  ? 109  VAL B N     1 
ATOM   4821  C  CA    . VAL H  4  109  ? 102.037 33.626  -20.032 1.00 63.10  ? 109  VAL B CA    1 
ATOM   4822  C  C     . VAL H  4  109  ? 101.909 35.113  -19.751 1.00 61.74  ? 109  VAL B C     1 
ATOM   4823  O  O     . VAL H  4  109  ? 100.841 35.707  -19.865 1.00 61.31  ? 109  VAL B O     1 
ATOM   4824  C  CB    . VAL H  4  109  ? 101.517 33.270  -21.465 1.00 64.95  ? 109  VAL B CB    1 
ATOM   4825  C  CG1   . VAL H  4  109  ? 102.004 34.295  -22.501 1.00 64.67  ? 109  VAL B CG1   1 
ATOM   4826  C  CG2   . VAL H  4  109  ? 102.029 31.871  -21.846 1.00 64.83  ? 109  VAL B CG2   1 
ATOM   4827  N  N     . LYS H  4  110  ? 103.039 35.694  -19.367 1.00 60.29  ? 110  LYS B N     1 
ATOM   4828  C  CA    . LYS H  4  110  ? 103.144 37.109  -19.085 1.00 58.86  ? 110  LYS B CA    1 
ATOM   4829  C  C     . LYS H  4  110  ? 103.799 37.825  -20.243 1.00 59.01  ? 110  LYS B C     1 
ATOM   4830  O  O     . LYS H  4  110  ? 104.364 37.187  -21.119 1.00 58.11  ? 110  LYS B O     1 
ATOM   4831  C  CB    . LYS H  4  110  ? 103.957 37.323  -17.826 1.00 56.95  ? 110  LYS B CB    1 
ATOM   4832  C  CG    . LYS H  4  110  ? 103.221 37.005  -16.566 1.00 56.02  ? 110  LYS B CG    1 
ATOM   4833  C  CD    . LYS H  4  110  ? 104.210 36.960  -15.439 1.00 54.89  ? 110  LYS B CD    1 
ATOM   4834  C  CE    . LYS H  4  110  ? 103.573 36.590  -14.133 1.00 54.43  ? 110  LYS B CE    1 
ATOM   4835  N  NZ    . LYS H  4  110  ? 104.657 36.207  -13.192 1.00 54.71  ? 110  LYS B NZ    1 
ATOM   4836  N  N     . ALA H  4  111  ? 103.739 39.147  -20.251 1.00 60.58  ? 111  ALA B N     1 
ATOM   4837  C  CA    . ALA H  4  111  ? 104.294 39.917  -21.357 1.00 62.82  ? 111  ALA B CA    1 
ATOM   4838  C  C     . ALA H  4  111  ? 105.830 39.854  -21.413 1.00 64.92  ? 111  ALA B C     1 
ATOM   4839  O  O     . ALA H  4  111  ? 106.412 40.166  -22.465 1.00 65.24  ? 111  ALA B O     1 
ATOM   4840  C  CB    . ALA H  4  111  ? 103.843 41.342  -21.245 1.00 62.87  ? 111  ALA B CB    1 
ATOM   4841  N  N     . ARG H  4  112  ? 106.498 39.469  -20.328 1.00 65.68  ? 112  ARG B N     1 
ATOM   4842  C  CA    . ARG H  4  112  ? 107.957 39.406  -20.377 1.00 65.89  ? 112  ARG B CA    1 
ATOM   4843  C  C     . ARG H  4  112  ? 108.427 38.130  -21.058 1.00 67.59  ? 112  ARG B C     1 
ATOM   4844  O  O     . ARG H  4  112  ? 109.623 37.943  -21.250 1.00 68.76  ? 112  ARG B O     1 
ATOM   4845  C  CB    . ARG H  4  112  ? 108.544 39.483  -18.969 1.00 64.71  ? 112  ARG B CB    1 
ATOM   4846  C  CG    . ARG H  4  112  ? 108.112 38.389  -18.030 1.00 64.69  ? 112  ARG B CG    1 
ATOM   4847  C  CD    . ARG H  4  112  ? 107.862 38.978  -16.661 1.00 63.94  ? 112  ARG B CD    1 
ATOM   4848  N  NE    . ARG H  4  112  ? 109.041 39.670  -16.140 1.00 63.33  ? 112  ARG B NE    1 
ATOM   4849  C  CZ    . ARG H  4  112  ? 108.997 40.635  -15.225 1.00 61.78  ? 112  ARG B CZ    1 
ATOM   4850  N  NH1   . ARG H  4  112  ? 107.836 41.029  -14.729 1.00 61.28  ? 112  ARG B NH1   1 
ATOM   4851  N  NH2   . ARG H  4  112  ? 110.115 41.206  -14.808 1.00 60.49  ? 112  ARG B NH2   1 
ATOM   4852  N  N     . ASP H  4  113  ? 107.478 37.264  -21.424 1.00 69.94  ? 113  ASP B N     1 
ATOM   4853  C  CA    . ASP H  4  113  ? 107.766 35.983  -22.087 1.00 71.26  ? 113  ASP B CA    1 
ATOM   4854  C  C     . ASP H  4  113  ? 108.055 36.176  -23.592 1.00 71.69  ? 113  ASP B C     1 
ATOM   4855  O  O     . ASP H  4  113  ? 108.482 35.238  -24.286 1.00 72.01  ? 113  ASP B O     1 
ATOM   4856  C  CB    . ASP H  4  113  ? 106.577 35.016  -21.891 1.00 70.50  ? 113  ASP B CB    1 
ATOM   4857  C  CG    . ASP H  4  113  ? 106.295 34.712  -20.410 1.00 70.21  ? 113  ASP B CG    1 
ATOM   4858  O  OD1   . ASP H  4  113  ? 105.817 35.616  -19.683 1.00 68.90  ? 113  ASP B OD1   1 
ATOM   4859  O  OD2   . ASP H  4  113  ? 106.551 33.562  -19.973 1.00 70.24  ? 113  ASP B OD2   1 
ATOM   4860  N  N     . PHE H  4  114  ? 107.822 37.391  -24.089 1.00 71.95  ? 114  PHE B N     1 
ATOM   4861  C  CA    . PHE H  4  114  ? 108.091 37.691  -25.486 1.00 72.51  ? 114  PHE B CA    1 
ATOM   4862  C  C     . PHE H  4  114  ? 109.579 37.799  -25.732 1.00 73.34  ? 114  PHE B C     1 
ATOM   4863  O  O     . PHE H  4  114  ? 110.273 38.478  -24.982 1.00 73.87  ? 114  PHE B O     1 
ATOM   4864  C  CB    . PHE H  4  114  ? 107.395 39.000  -25.908 1.00 72.17  ? 114  PHE B CB    1 
ATOM   4865  C  CG    . PHE H  4  114  ? 106.020 38.766  -26.516 1.00 72.52  ? 114  PHE B CG    1 
ATOM   4866  C  CD1   . PHE H  4  114  ? 104.868 38.690  -25.699 1.00 71.94  ? 114  PHE B CD1   1 
ATOM   4867  C  CD2   . PHE H  4  114  ? 105.875 38.565  -27.909 1.00 72.15  ? 114  PHE B CD2   1 
ATOM   4868  C  CE1   . PHE H  4  114  ? 103.583 38.411  -26.263 1.00 71.03  ? 114  PHE B CE1   1 
ATOM   4869  C  CE2   . PHE H  4  114  ? 104.594 38.283  -28.492 1.00 71.63  ? 114  PHE B CE2   1 
ATOM   4870  C  CZ    . PHE H  4  114  ? 103.448 38.206  -27.655 1.00 71.30  ? 114  PHE B CZ    1 
ATOM   4871  N  N     . LEU H  4  115  ? 110.075 37.123  -26.769 1.00 73.63  ? 115  LEU B N     1 
ATOM   4872  C  CA    . LEU H  4  115  ? 111.495 37.211  -27.077 1.00 73.93  ? 115  LEU B CA    1 
ATOM   4873  C  C     . LEU H  4  115  ? 111.899 38.666  -27.308 1.00 74.07  ? 115  LEU B C     1 
ATOM   4874  O  O     . LEU H  4  115  ? 111.339 39.360  -28.161 1.00 73.08  ? 115  LEU B O     1 
ATOM   4875  C  CB    . LEU H  4  115  ? 111.849 36.348  -28.310 1.00 73.72  ? 115  LEU B CB    1 
ATOM   4876  C  CG    . LEU H  4  115  ? 111.027 36.365  -29.616 1.00 73.34  ? 115  LEU B CG    1 
ATOM   4877  C  CD1   . LEU H  4  115  ? 111.264 37.638  -30.443 1.00 71.58  ? 115  LEU B CD1   1 
ATOM   4878  C  CD2   . LEU H  4  115  ? 111.436 35.128  -30.421 1.00 72.28  ? 115  LEU B CD2   1 
ATOM   4879  N  N     . PRO H  4  116  ? 112.874 39.153  -26.523 1.00 74.99  ? 116  PRO B N     1 
ATOM   4880  C  CA    . PRO H  4  116  ? 113.363 40.528  -26.612 1.00 74.64  ? 116  PRO B CA    1 
ATOM   4881  C  C     . PRO H  4  116  ? 113.807 40.906  -27.998 1.00 73.67  ? 116  PRO B C     1 
ATOM   4882  O  O     . PRO H  4  116  ? 114.394 40.109  -28.740 1.00 73.56  ? 116  PRO B O     1 
ATOM   4883  C  CB    . PRO H  4  116  ? 114.502 40.569  -25.602 1.00 75.37  ? 116  PRO B CB    1 
ATOM   4884  C  CG    . PRO H  4  116  ? 114.029 39.611  -24.562 1.00 76.06  ? 116  PRO B CG    1 
ATOM   4885  C  CD    . PRO H  4  116  ? 113.549 38.452  -25.416 1.00 75.77  ? 116  PRO B CD    1 
ATOM   4886  N  N     . VAL H  4  117  ? 113.500 42.153  -28.316 1.00 72.12  ? 117  VAL B N     1 
ATOM   4887  C  CA    . VAL H  4  117  ? 113.891 42.770  -29.558 1.00 71.81  ? 117  VAL B CA    1 
ATOM   4888  C  C     . VAL H  4  117  ? 114.856 43.926  -29.273 1.00 72.17  ? 117  VAL B C     1 
ATOM   4889  O  O     . VAL H  4  117  ? 114.641 44.710  -28.346 1.00 71.99  ? 117  VAL B O     1 
ATOM   4890  C  CB    . VAL H  4  117  ? 112.641 43.258  -30.342 1.00 71.11  ? 117  VAL B CB    1 
ATOM   4891  C  CG1   . VAL H  4  117  ? 112.251 42.204  -31.375 1.00 70.43  ? 117  VAL B CG1   1 
ATOM   4892  C  CG2   . VAL H  4  117  ? 111.466 43.486  -29.389 1.00 70.67  ? 117  VAL B CG2   1 
ATOM   4893  N  N     . ALA H  4  118  ? 115.922 43.992  -30.075 1.00 72.52  ? 118  ALA B N     1 
ATOM   4894  C  CA    . ALA H  4  118  ? 117.033 44.954  -29.977 1.00 71.69  ? 118  ALA B CA    1 
ATOM   4895  C  C     . ALA H  4  118  ? 116.592 46.368  -29.555 1.00 71.20  ? 118  ALA B C     1 
ATOM   4896  O  O     . ALA H  4  118  ? 116.901 46.794  -28.443 1.00 71.84  ? 118  ALA B O     1 
ATOM   4897  C  CB    . ALA H  4  118  ? 117.789 45.024  -31.330 1.00 71.64  ? 118  ALA B CB    1 
ATOM   4898  N  N     . ASP H  4  119  ? 115.880 47.090  -30.417 1.00 70.41  ? 119  ASP B N     1 
ATOM   4899  C  CA    . ASP H  4  119  ? 115.536 48.489  -30.134 1.00 69.67  ? 119  ASP B CA    1 
ATOM   4900  C  C     . ASP H  4  119  ? 114.155 48.665  -29.451 1.00 69.02  ? 119  ASP B C     1 
ATOM   4901  O  O     . ASP H  4  119  ? 113.744 49.803  -29.231 1.00 69.07  ? 119  ASP B O     1 
ATOM   4902  C  CB    . ASP H  4  119  ? 115.611 49.259  -31.458 1.00 70.28  ? 119  ASP B CB    1 
ATOM   4903  C  CG    . ASP H  4  119  ? 116.677 48.667  -32.426 1.00 72.09  ? 119  ASP B CG    1 
ATOM   4904  O  OD1   . ASP H  4  119  ? 116.501 47.529  -32.935 1.00 70.84  ? 119  ASP B OD1   1 
ATOM   4905  O  OD2   . ASP H  4  119  ? 117.701 49.340  -32.678 1.00 73.93  ? 119  ASP B OD2   1 
ATOM   4906  N  N     . VAL H  4  120  ? 113.452 47.583  -29.107 1.00 67.39  ? 120  VAL B N     1 
ATOM   4907  C  CA    . VAL H  4  120  ? 112.133 47.695  -28.455 1.00 66.08  ? 120  VAL B CA    1 
ATOM   4908  C  C     . VAL H  4  120  ? 112.191 47.230  -26.977 1.00 66.34  ? 120  VAL B C     1 
ATOM   4909  O  O     . VAL H  4  120  ? 112.953 46.316  -26.624 1.00 66.25  ? 120  VAL B O     1 
ATOM   4910  C  CB    . VAL H  4  120  ? 111.045 46.845  -29.220 1.00 64.37  ? 120  VAL B CB    1 
ATOM   4911  C  CG1   . VAL H  4  120  ? 109.709 46.999  -28.560 1.00 63.74  ? 120  VAL B CG1   1 
ATOM   4912  C  CG2   . VAL H  4  120  ? 110.912 47.311  -30.654 1.00 63.32  ? 120  VAL B CG2   1 
ATOM   4913  N  N     . GLU H  4  121  ? 111.384 47.877  -26.125 1.00 65.13  ? 121  GLU B N     1 
ATOM   4914  C  CA    . GLU H  4  121  ? 111.295 47.569  -24.683 1.00 64.33  ? 121  GLU B CA    1 
ATOM   4915  C  C     . GLU H  4  121  ? 109.835 47.416  -24.243 1.00 64.46  ? 121  GLU B C     1 
ATOM   4916  O  O     . GLU H  4  121  ? 108.955 48.131  -24.730 1.00 64.14  ? 121  GLU B O     1 
ATOM   4917  C  CB    . GLU H  4  121  ? 111.962 48.688  -23.842 1.00 62.96  ? 121  GLU B CB    1 
ATOM   4918  C  CG    . GLU H  4  121  ? 111.354 48.881  -22.425 1.00 59.61  ? 121  GLU B CG    1 
ATOM   4919  C  CD    . GLU H  4  121  ? 111.476 50.300  -21.867 1.00 58.40  ? 121  GLU B CD    1 
ATOM   4920  O  OE1   . GLU H  4  121  ? 111.223 51.286  -22.600 1.00 57.92  ? 121  GLU B OE1   1 
ATOM   4921  O  OE2   . GLU H  4  121  ? 111.820 50.424  -20.676 1.00 56.85  ? 121  GLU B OE2   1 
ATOM   4922  N  N     . ILE H  4  122  ? 109.598 46.488  -23.314 1.00 65.75  ? 122  ILE B N     1 
ATOM   4923  C  CA    . ILE H  4  122  ? 108.260 46.216  -22.775 1.00 65.64  ? 122  ILE B CA    1 
ATOM   4924  C  C     . ILE H  4  122  ? 108.145 46.688  -21.309 1.00 66.09  ? 122  ILE B C     1 
ATOM   4925  O  O     . ILE H  4  122  ? 108.704 46.054  -20.400 1.00 65.91  ? 122  ILE B O     1 
ATOM   4926  C  CB    . ILE H  4  122  ? 107.952 44.699  -22.836 1.00 65.35  ? 122  ILE B CB    1 
ATOM   4927  C  CG1   . ILE H  4  122  ? 108.386 44.133  -24.201 1.00 64.92  ? 122  ILE B CG1   1 
ATOM   4928  C  CG2   . ILE H  4  122  ? 106.467 44.481  -22.576 1.00 64.61  ? 122  ILE B CG2   1 
ATOM   4929  C  CD1   . ILE H  4  122  ? 108.579 42.630  -24.232 1.00 64.07  ? 122  ILE B CD1   1 
ATOM   4930  N  N     . MET H  4  123  ? 107.427 47.797  -21.089 1.00 66.84  ? 123  MET B N     1 
ATOM   4931  C  CA    . MET H  4  123  ? 107.233 48.371  -19.744 1.00 66.93  ? 123  MET B CA    1 
ATOM   4932  C  C     . MET H  4  123  ? 106.047 47.725  -19.026 1.00 66.70  ? 123  MET B C     1 
ATOM   4933  O  O     . MET H  4  123  ? 105.746 48.069  -17.879 1.00 66.01  ? 123  MET B O     1 
ATOM   4934  C  CB    . MET H  4  123  ? 106.982 49.885  -19.825 1.00 65.85  ? 123  MET B CB    1 
ATOM   4935  C  CG    . MET H  4  123  ? 107.987 50.647  -20.680 1.00 66.41  ? 123  MET B CG    1 
ATOM   4936  S  SD    . MET H  4  123  ? 109.106 51.721  -19.783 1.00 66.42  ? 123  MET B SD    1 
ATOM   4937  C  CE    . MET H  4  123  ? 109.011 53.177  -20.752 1.00 65.13  ? 123  MET B CE    1 
ATOM   4938  N  N     . ASN H  4  124  ? 105.386 46.786  -19.708 1.00 66.63  ? 124  ASN B N     1 
ATOM   4939  C  CA    . ASN H  4  124  ? 104.230 46.052  -19.175 1.00 65.68  ? 124  ASN B CA    1 
ATOM   4940  C  C     . ASN H  4  124  ? 104.541 44.549  -19.090 1.00 63.89  ? 124  ASN B C     1 
ATOM   4941  O  O     . ASN H  4  124  ? 103.837 43.738  -19.681 1.00 63.02  ? 124  ASN B O     1 
ATOM   4942  C  CB    . ASN H  4  124  ? 103.022 46.286  -20.101 1.00 67.35  ? 124  ASN B CB    1 
ATOM   4943  C  CG    . ASN H  4  124  ? 101.680 46.170  -19.390 1.00 68.08  ? 124  ASN B CG    1 
ATOM   4944  O  OD1   . ASN H  4  124  ? 101.513 45.360  -18.476 1.00 69.03  ? 124  ASN B OD1   1 
ATOM   4945  N  ND2   . ASN H  4  124  ? 100.706 46.979  -19.823 1.00 67.68  ? 124  ASN B ND2   1 
ATOM   4946  N  N     . PRO H  4  125  ? 105.600 44.159  -18.348 1.00 62.28  ? 125  PRO B N     1 
ATOM   4947  C  CA    . PRO H  4  125  ? 106.016 42.757  -18.197 1.00 59.88  ? 125  PRO B CA    1 
ATOM   4948  C  C     . PRO H  4  125  ? 104.941 41.841  -17.612 1.00 57.34  ? 125  PRO B C     1 
ATOM   4949  O  O     . PRO H  4  125  ? 104.462 40.936  -18.287 1.00 56.36  ? 125  PRO B O     1 
ATOM   4950  C  CB    . PRO H  4  125  ? 107.261 42.851  -17.309 1.00 61.42  ? 125  PRO B CB    1 
ATOM   4951  C  CG    . PRO H  4  125  ? 107.799 44.221  -17.605 1.00 62.07  ? 125  PRO B CG    1 
ATOM   4952  C  CD    . PRO H  4  125  ? 106.522 45.022  -17.579 1.00 62.37  ? 125  PRO B CD    1 
ATOM   4953  N  N     . ASP H  4  126  ? 104.569 42.082  -16.361 1.00 55.19  ? 126  ASP B N     1 
ATOM   4954  C  CA    . ASP H  4  126  ? 103.646 41.213  -15.619 1.00 53.44  ? 126  ASP B CA    1 
ATOM   4955  C  C     . ASP H  4  126  ? 102.235 41.160  -16.210 1.00 50.75  ? 126  ASP B C     1 
ATOM   4956  O  O     . ASP H  4  126  ? 101.419 40.367  -15.723 1.00 50.46  ? 126  ASP B O     1 
ATOM   4957  C  CB    . ASP H  4  126  ? 103.623 41.670  -14.159 1.00 53.06  ? 126  ASP B CB    1 
ATOM   4958  C  CG    . ASP H  4  126  ? 105.033 41.800  -13.595 1.00 52.51  ? 126  ASP B CG    1 
ATOM   4959  O  OD1   . ASP H  4  126  ? 105.679 40.759  -13.328 1.00 52.26  ? 126  ASP B OD1   1 
ATOM   4960  O  OD2   . ASP H  4  126  ? 105.495 42.947  -13.431 1.00 52.01  ? 126  ASP B OD2   1 
ATOM   4961  N  N     . LEU H  4  127  ? 101.921 41.958  -17.228 1.00 46.60  ? 127  LEU B N     1 
ATOM   4962  C  CA    . LEU H  4  127  ? 100.584 41.851  -17.784 1.00 43.43  ? 127  LEU B CA    1 
ATOM   4963  C  C     . LEU H  4  127  ? 100.263 40.406  -18.090 1.00 42.08  ? 127  LEU B C     1 
ATOM   4964  O  O     . LEU H  4  127  ? 101.101 39.674  -18.620 1.00 40.77  ? 127  LEU B O     1 
ATOM   4965  C  CB    . LEU H  4  127  ? 100.452 42.679  -19.060 1.00 43.16  ? 127  LEU B CB    1 
ATOM   4966  C  CG    . LEU H  4  127  ? 99.091  42.656  -19.784 1.00 41.82  ? 127  LEU B CG    1 
ATOM   4967  C  CD1   . LEU H  4  127  ? 97.920  42.727  -18.794 1.00 41.50  ? 127  LEU B CD1   1 
ATOM   4968  C  CD2   . LEU H  4  127  ? 99.049  43.829  -20.737 1.00 40.70  ? 127  LEU B CD2   1 
ATOM   4969  N  N     . HIS H  4  128  ? 99.054  39.994  -17.747 1.00 40.45  ? 128  HIS B N     1 
ATOM   4970  C  CA    . HIS H  4  128  ? 98.682  38.612  -17.943 1.00 40.04  ? 128  HIS B CA    1 
ATOM   4971  C  C     . HIS H  4  128  ? 98.054  38.356  -19.294 1.00 39.97  ? 128  HIS B C     1 
ATOM   4972  O  O     . HIS H  4  128  ? 97.003  38.885  -19.634 1.00 38.51  ? 128  HIS B O     1 
ATOM   4973  C  CB    . HIS H  4  128  ? 97.744  38.158  -16.842 1.00 39.57  ? 128  HIS B CB    1 
ATOM   4974  C  CG    . HIS H  4  128  ? 98.336  37.059  -16.028 1.00 38.88  ? 128  HIS B CG    1 
ATOM   4975  N  ND1   . HIS H  4  128  ? 99.619  36.606  -16.246 1.00 38.09  ? 128  HIS B ND1   1 
ATOM   4976  C  CD2   . HIS H  4  128  ? 97.843  36.323  -15.007 1.00 39.26  ? 128  HIS B CD2   1 
ATOM   4977  C  CE1   . HIS H  4  128  ? 99.890  35.637  -15.392 1.00 39.01  ? 128  HIS B CE1   1 
ATOM   4978  N  NE2   . HIS H  4  128  ? 98.829  35.446  -14.628 1.00 38.60  ? 128  HIS B NE2   1 
ATOM   4979  N  N     . ILE H  4  129  ? 98.731  37.513  -20.059 1.00 40.32  ? 129  ILE B N     1 
ATOM   4980  C  CA    . ILE H  4  129  ? 98.264  37.123  -21.368 1.00 41.10  ? 129  ILE B CA    1 
ATOM   4981  C  C     . ILE H  4  129  ? 97.327  35.926  -21.258 1.00 42.73  ? 129  ILE B C     1 
ATOM   4982  O  O     . ILE H  4  129  ? 96.198  35.961  -21.760 1.00 42.90  ? 129  ILE B O     1 
ATOM   4983  C  CB    . ILE H  4  129  ? 99.474  36.756  -22.301 1.00 40.03  ? 129  ILE B CB    1 
ATOM   4984  C  CG1   . ILE H  4  129  ? 100.375 37.980  -22.505 1.00 38.71  ? 129  ILE B CG1   1 
ATOM   4985  C  CG2   . ILE H  4  129  ? 98.976  36.198  -23.624 1.00 40.50  ? 129  ILE B CG2   1 
ATOM   4986  C  CD1   . ILE H  4  129  ? 99.711  39.194  -23.156 1.00 37.75  ? 129  ILE B CD1   1 
ATOM   4987  N  N     . ALA H  4  130  ? 97.786  34.869  -20.593 1.00 43.40  ? 130  ALA B N     1 
ATOM   4988  C  CA    . ALA H  4  130  ? 96.945  33.692  -20.475 1.00 46.20  ? 130  ALA B CA    1 
ATOM   4989  C  C     . ALA H  4  130  ? 97.471  32.717  -19.447 1.00 46.81  ? 130  ALA B C     1 
ATOM   4990  O  O     . ALA H  4  130  ? 98.593  32.820  -18.943 1.00 45.69  ? 130  ALA B O     1 
ATOM   4991  C  CB    . ALA H  4  130  ? 96.827  32.981  -21.835 1.00 46.86  ? 130  ALA B CB    1 
ATOM   4992  N  N     . THR H  4  131  ? 96.595  31.757  -19.167 1.00 49.03  ? 131  THR B N     1 
ATOM   4993  C  CA    . THR H  4  131  ? 96.823  30.663  -18.244 1.00 50.82  ? 131  THR B CA    1 
ATOM   4994  C  C     . THR H  4  131  ? 96.838  29.345  -19.006 1.00 52.14  ? 131  THR B C     1 
ATOM   4995  O  O     . THR H  4  131  ? 95.795  28.900  -19.491 1.00 53.34  ? 131  THR B O     1 
ATOM   4996  C  CB    . THR H  4  131  ? 95.698  30.595  -17.182 1.00 50.78  ? 131  THR B CB    1 
ATOM   4997  O  OG1   . THR H  4  131  ? 94.437  30.468  -17.853 1.00 50.43  ? 131  THR B OG1   1 
ATOM   4998  C  CG2   . THR H  4  131  ? 95.658  31.866  -16.344 1.00 50.63  ? 131  THR B CG2   1 
ATOM   4999  N  N     . LEU H  4  132  ? 98.011  28.734  -19.125 1.00 52.90  ? 132  LEU B N     1 
ATOM   5000  C  CA    . LEU H  4  132  ? 98.137  27.484  -19.840 1.00 53.66  ? 132  LEU B CA    1 
ATOM   5001  C  C     . LEU H  4  132  ? 98.061  26.308  -18.878 1.00 56.24  ? 132  LEU B C     1 
ATOM   5002  O  O     . LEU H  4  132  ? 98.760  26.287  -17.867 1.00 56.20  ? 132  LEU B O     1 
ATOM   5003  C  CB    . LEU H  4  132  ? 99.452  27.505  -20.594 1.00 52.08  ? 132  LEU B CB    1 
ATOM   5004  C  CG    . LEU H  4  132  ? 99.562  26.958  -22.004 1.00 52.23  ? 132  LEU B CG    1 
ATOM   5005  C  CD1   . LEU H  4  132  ? 98.458  27.519  -22.886 1.00 52.88  ? 132  LEU B CD1   1 
ATOM   5006  C  CD2   . LEU H  4  132  ? 100.942 27.330  -22.533 1.00 51.96  ? 132  LEU B CD2   1 
ATOM   5007  N  N     . GLU H  4  133  ? 97.201  25.346  -19.209 1.00 58.92  ? 133  GLU B N     1 
ATOM   5008  C  CA    . GLU H  4  133  ? 96.913  24.150  -18.397 1.00 63.11  ? 133  GLU B CA    1 
ATOM   5009  C  C     . GLU H  4  133  ? 97.968  23.045  -18.602 1.00 65.26  ? 133  GLU B C     1 
ATOM   5010  O  O     . GLU H  4  133  ? 99.031  23.020  -17.967 1.00 66.08  ? 133  GLU B O     1 
ATOM   5011  C  CB    . GLU H  4  133  ? 95.513  23.632  -18.786 1.00 62.39  ? 133  GLU B CB    1 
ATOM   5012  C  CG    . GLU H  4  133  ? 94.890  22.607  -17.856 1.00 63.12  ? 133  GLU B CG    1 
ATOM   5013  C  CD    . GLU H  4  133  ? 93.425  22.918  -17.528 1.00 63.21  ? 133  GLU B CD    1 
ATOM   5014  O  OE1   . GLU H  4  133  ? 92.878  22.253  -16.619 1.00 62.50  ? 133  GLU B OE1   1 
ATOM   5015  O  OE2   . GLU H  4  133  ? 92.823  23.819  -18.166 1.00 61.50  ? 133  GLU B OE2   1 
ATOM   5016  N  N     . GLU H  4  134  ? 97.624  22.120  -19.487 1.00 65.92  ? 134  GLU B N     1 
ATOM   5017  C  CA    . GLU H  4  134  ? 98.457  20.995  -19.889 1.00 67.36  ? 134  GLU B CA    1 
ATOM   5018  C  C     . GLU H  4  134  ? 98.304  20.783  -21.382 1.00 67.68  ? 134  GLU B C     1 
ATOM   5019  O  O     . GLU H  4  134  ? 97.189  20.933  -21.897 1.00 67.48  ? 134  GLU B O     1 
ATOM   5020  C  CB    . GLU H  4  134  ? 98.033  19.716  -19.153 1.00 66.97  ? 134  GLU B CB    1 
ATOM   5021  C  CG    . GLU H  4  134  ? 97.912  19.858  -17.638 1.00 67.09  ? 134  GLU B CG    1 
ATOM   5022  C  CD    . GLU H  4  134  ? 99.251  20.087  -16.961 1.00 66.97  ? 134  GLU B CD    1 
ATOM   5023  O  OE1   . GLU H  4  134  ? 99.275  20.612  -15.832 1.00 66.46  ? 134  GLU B OE1   1 
ATOM   5024  O  OE2   . GLU H  4  134  ? 100.288 19.738  -17.558 1.00 68.24  ? 134  GLU B OE2   1 
ATOM   5025  N  N     . GLY H  4  135  ? 99.380  20.447  -22.085 1.00 67.15  ? 135  GLY B N     1 
ATOM   5026  C  CA    . GLY H  4  135  ? 99.236  20.314  -23.516 1.00 65.97  ? 135  GLY B CA    1 
ATOM   5027  C  C     . GLY H  4  135  ? 98.706  21.627  -24.050 1.00 65.06  ? 135  GLY B C     1 
ATOM   5028  O  O     . GLY H  4  135  ? 97.932  21.682  -25.006 1.00 65.54  ? 135  GLY B O     1 
ATOM   5029  N  N     . GLY H  4  136  ? 99.129  22.691  -23.373 1.00 63.64  ? 136  GLY B N     1 
ATOM   5030  C  CA    . GLY H  4  136  ? 98.729  24.029  -23.738 1.00 63.81  ? 136  GLY B CA    1 
ATOM   5031  C  C     . GLY H  4  136  ? 99.712  24.613  -24.725 1.00 64.30  ? 136  GLY B C     1 
ATOM   5032  O  O     . GLY H  4  136  ? 100.807 25.027  -24.347 1.00 65.14  ? 136  GLY B O     1 
ATOM   5033  N  N     . ARG H  4  137  ? 99.317  24.639  -25.994 1.00 64.02  ? 137  ARG B N     1 
ATOM   5034  C  CA    . ARG H  4  137  ? 100.165 25.138  -27.055 1.00 62.16  ? 137  ARG B CA    1 
ATOM   5035  C  C     . ARG H  4  137  ? 99.704  26.498  -27.544 1.00 61.50  ? 137  ARG B C     1 
ATOM   5036  O  O     . ARG H  4  137  ? 98.657  26.624  -28.184 1.00 60.70  ? 137  ARG B O     1 
ATOM   5037  C  CB    . ARG H  4  137  ? 100.167 24.141  -28.226 1.00 63.05  ? 137  ARG B CB    1 
ATOM   5038  C  CG    . ARG H  4  137  ? 100.916 24.610  -29.486 1.00 63.97  ? 137  ARG B CG    1 
ATOM   5039  C  CD    . ARG H  4  137  ? 100.743 23.637  -30.652 1.00 64.33  ? 137  ARG B CD    1 
ATOM   5040  N  NE    . ARG H  4  137  ? 101.234 24.170  -31.927 1.00 65.29  ? 137  ARG B NE    1 
ATOM   5041  C  CZ    . ARG H  4  137  ? 100.713 25.215  -32.570 1.00 65.64  ? 137  ARG B CZ    1 
ATOM   5042  N  NH1   . ARG H  4  137  ? 99.673  25.876  -32.072 1.00 65.85  ? 137  ARG B NH1   1 
ATOM   5043  N  NH2   . ARG H  4  137  ? 101.230 25.599  -33.730 1.00 66.76  ? 137  ARG B NH2   1 
ATOM   5044  N  N     . LEU H  4  138  ? 100.489 27.518  -27.228 1.00 61.04  ? 138  LEU B N     1 
ATOM   5045  C  CA    . LEU H  4  138  ? 100.182 28.840  -27.719 1.00 62.31  ? 138  LEU B CA    1 
ATOM   5046  C  C     . LEU H  4  138  ? 101.424 29.481  -28.358 1.00 63.37  ? 138  LEU B C     1 
ATOM   5047  O  O     . LEU H  4  138  ? 102.436 29.741  -27.708 1.00 64.92  ? 138  LEU B O     1 
ATOM   5048  C  CB    . LEU H  4  138  ? 99.588  29.708  -26.579 1.00 59.84  ? 138  LEU B CB    1 
ATOM   5049  C  CG    . LEU H  4  138  ? 100.231 30.736  -25.646 1.00 57.95  ? 138  LEU B CG    1 
ATOM   5050  C  CD1   . LEU H  4  138  ? 99.124  31.613  -25.101 1.00 55.80  ? 138  LEU B CD1   1 
ATOM   5051  C  CD2   . LEU H  4  138  ? 100.985 30.061  -24.522 1.00 57.08  ? 138  LEU B CD2   1 
ATOM   5052  N  N     . ASN H  4  139  ? 101.323 29.690  -29.667 1.00 62.68  ? 139  ASN B N     1 
ATOM   5053  C  CA    . ASN H  4  139  ? 102.369 30.288  -30.490 1.00 62.24  ? 139  ASN B CA    1 
ATOM   5054  C  C     . ASN H  4  139  ? 101.795 31.443  -31.278 1.00 61.95  ? 139  ASN B C     1 
ATOM   5055  O  O     . ASN H  4  139  ? 101.032 31.212  -32.219 1.00 62.59  ? 139  ASN B O     1 
ATOM   5056  C  CB    . ASN H  4  139  ? 102.933 29.230  -31.458 1.00 62.84  ? 139  ASN B CB    1 
ATOM   5057  C  CG    . ASN H  4  139  ? 103.918 29.808  -32.476 1.00 63.09  ? 139  ASN B CG    1 
ATOM   5058  O  OD1   . ASN H  4  139  ? 105.136 29.689  -32.327 1.00 62.50  ? 139  ASN B OD1   1 
ATOM   5059  N  ND2   . ASN H  4  139  ? 103.387 30.435  -33.516 1.00 62.63  ? 139  ASN B ND2   1 
ATOM   5060  N  N     . MET H  4  140  ? 102.141 32.677  -30.918 1.00 61.20  ? 140  MET B N     1 
ATOM   5061  C  CA    . MET H  4  140  ? 101.551 33.807  -31.626 1.00 59.83  ? 140  MET B CA    1 
ATOM   5062  C  C     . MET H  4  140  ? 102.571 34.864  -32.003 1.00 58.97  ? 140  MET B C     1 
ATOM   5063  O  O     . MET H  4  140  ? 103.669 34.936  -31.463 1.00 59.63  ? 140  MET B O     1 
ATOM   5064  C  CB    . MET H  4  140  ? 100.466 34.457  -30.766 1.00 59.48  ? 140  MET B CB    1 
ATOM   5065  C  CG    . MET H  4  140  ? 100.956 35.023  -29.438 1.00 57.93  ? 140  MET B CG    1 
ATOM   5066  S  SD    . MET H  4  140  ? 99.615  35.032  -28.256 1.00 55.69  ? 140  MET B SD    1 
ATOM   5067  C  CE    . MET H  4  140  ? 98.660  36.422  -28.834 1.00 57.59  ? 140  MET B CE    1 
ATOM   5068  N  N     . GLU H  4  141  ? 102.144 35.684  -32.961 1.00 58.71  ? 141  GLU B N     1 
ATOM   5069  C  CA    . GLU H  4  141  ? 102.881 36.830  -33.477 1.00 57.55  ? 141  GLU B CA    1 
ATOM   5070  C  C     . GLU H  4  141  ? 102.021 38.079  -33.360 1.00 57.37  ? 141  GLU B C     1 
ATOM   5071  O  O     . GLU H  4  141  ? 101.008 38.214  -34.050 1.00 55.54  ? 141  GLU B O     1 
ATOM   5072  C  CB    . GLU H  4  141  ? 103.262 36.628  -34.955 1.00 56.79  ? 141  GLU B CB    1 
ATOM   5073  C  CG    . GLU H  4  141  ? 103.869 35.269  -35.310 1.00 53.82  ? 141  GLU B CG    1 
ATOM   5074  C  CD    . GLU H  4  141  ? 104.491 35.211  -36.722 1.00 52.65  ? 141  GLU B CD    1 
ATOM   5075  O  OE1   . GLU H  4  141  ? 105.636 35.674  -36.902 1.00 52.17  ? 141  GLU B OE1   1 
ATOM   5076  O  OE2   . GLU H  4  141  ? 103.834 34.704  -37.655 1.00 49.70  ? 141  GLU B OE2   1 
ATOM   5077  N  N     . VAL H  4  142  ? 102.414 38.988  -32.478 1.00 58.17  ? 142  VAL B N     1 
ATOM   5078  C  CA    . VAL H  4  142  ? 101.630 40.195  -32.272 1.00 59.21  ? 142  VAL B CA    1 
ATOM   5079  C  C     . VAL H  4  142  ? 102.343 41.437  -32.812 1.00 58.67  ? 142  VAL B C     1 
ATOM   5080  O  O     . VAL H  4  142  ? 103.429 41.837  -32.360 1.00 58.04  ? 142  VAL B O     1 
ATOM   5081  C  CB    . VAL H  4  142  ? 101.294 40.387  -30.757 1.00 60.05  ? 142  VAL B CB    1 
ATOM   5082  C  CG1   . VAL H  4  142  ? 100.514 39.177  -30.253 1.00 60.45  ? 142  VAL B CG1   1 
ATOM   5083  C  CG2   . VAL H  4  142  ? 102.557 40.551  -29.945 1.00 60.81  ? 142  VAL B CG2   1 
ATOM   5084  N  N     . ARG H  4  143  ? 101.694 42.033  -33.804 1.00 57.14  ? 143  ARG B N     1 
ATOM   5085  C  CA    . ARG H  4  143  ? 102.177 43.228  -34.464 1.00 54.79  ? 143  ARG B CA    1 
ATOM   5086  C  C     . ARG H  4  143  ? 102.126 44.425  -33.514 1.00 55.11  ? 143  ARG B C     1 
ATOM   5087  O  O     . ARG H  4  143  ? 101.298 44.470  -32.598 1.00 54.52  ? 143  ARG B O     1 
ATOM   5088  C  CB    . ARG H  4  143  ? 101.299 43.469  -35.702 1.00 51.82  ? 143  ARG B CB    1 
ATOM   5089  C  CG    . ARG H  4  143  ? 101.503 44.767  -36.449 1.00 48.45  ? 143  ARG B CG    1 
ATOM   5090  C  CD    . ARG H  4  143  ? 100.435 44.957  -37.509 1.00 43.48  ? 143  ARG B CD    1 
ATOM   5091  N  NE    . ARG H  4  143  ? 100.969 45.484  -38.760 1.00 40.77  ? 143  ARG B NE    1 
ATOM   5092  C  CZ    . ARG H  4  143  ? 101.960 44.920  -39.452 1.00 39.54  ? 143  ARG B CZ    1 
ATOM   5093  N  NH1   . ARG H  4  143  ? 102.526 43.818  -39.019 1.00 38.80  ? 143  ARG B NH1   1 
ATOM   5094  N  NH2   . ARG H  4  143  ? 102.391 45.450  -40.584 1.00 38.82  ? 143  ARG B NH2   1 
ATOM   5095  N  N     . VAL H  4  144  ? 103.029 45.376  -33.729 1.00 55.22  ? 144  VAL B N     1 
ATOM   5096  C  CA    . VAL H  4  144  ? 103.087 46.608  -32.947 1.00 54.44  ? 144  VAL B CA    1 
ATOM   5097  C  C     . VAL H  4  144  ? 103.464 47.787  -33.835 1.00 54.84  ? 144  VAL B C     1 
ATOM   5098  O  O     . VAL H  4  144  ? 104.450 47.721  -34.563 1.00 54.15  ? 144  VAL B O     1 
ATOM   5099  C  CB    . VAL H  4  144  ? 104.104 46.492  -31.827 1.00 53.62  ? 144  VAL B CB    1 
ATOM   5100  C  CG1   . VAL H  4  144  ? 104.004 47.697  -30.947 1.00 54.24  ? 144  VAL B CG1   1 
ATOM   5101  C  CG2   . VAL H  4  144  ? 103.854 45.216  -31.012 1.00 51.60  ? 144  VAL B CG2   1 
ATOM   5102  N  N     . ASP H  4  145  ? 102.682 48.862  -33.784 1.00 56.08  ? 145  ASP B N     1 
ATOM   5103  C  CA    . ASP H  4  145  ? 102.961 50.002  -34.665 1.00 57.59  ? 145  ASP B CA    1 
ATOM   5104  C  C     . ASP H  4  145  ? 102.952 51.326  -33.912 1.00 56.62  ? 145  ASP B C     1 
ATOM   5105  O  O     . ASP H  4  145  ? 102.472 51.448  -32.784 1.00 55.98  ? 145  ASP B O     1 
ATOM   5106  C  CB    . ASP H  4  145  ? 101.905 50.137  -35.781 1.00 60.53  ? 145  ASP B CB    1 
ATOM   5107  C  CG    . ASP H  4  145  ? 101.749 48.886  -36.669 1.00 62.90  ? 145  ASP B CG    1 
ATOM   5108  O  OD1   . ASP H  4  145  ? 101.758 47.753  -36.140 1.00 64.83  ? 145  ASP B OD1   1 
ATOM   5109  O  OD2   . ASP H  4  145  ? 101.598 49.047  -37.915 1.00 62.63  ? 145  ASP B OD2   1 
ATOM   5110  N  N     . ARG H  4  146  ? 103.492 52.326  -34.591 1.00 54.61  ? 146  ARG B N     1 
ATOM   5111  C  CA    . ARG H  4  146  ? 103.521 53.676  -34.091 1.00 53.99  ? 146  ARG B CA    1 
ATOM   5112  C  C     . ARG H  4  146  ? 102.493 54.519  -34.836 1.00 53.64  ? 146  ARG B C     1 
ATOM   5113  O  O     . ARG H  4  146  ? 102.519 54.597  -36.073 1.00 53.54  ? 146  ARG B O     1 
ATOM   5114  C  CB    . ARG H  4  146  ? 104.921 54.284  -34.277 1.00 54.02  ? 146  ARG B CB    1 
ATOM   5115  C  CG    . ARG H  4  146  ? 105.380 54.390  -35.742 1.00 54.33  ? 146  ARG B CG    1 
ATOM   5116  C  CD    . ARG H  4  146  ? 106.619 55.252  -35.884 1.00 53.85  ? 146  ARG B CD    1 
ATOM   5117  N  NE    . ARG H  4  146  ? 107.744 54.671  -35.166 1.00 53.55  ? 146  ARG B NE    1 
ATOM   5118  C  CZ    . ARG H  4  146  ? 108.916 55.270  -35.024 1.00 53.09  ? 146  ARG B CZ    1 
ATOM   5119  N  NH1   . ARG H  4  146  ? 109.102 56.473  -35.561 1.00 52.51  ? 146  ARG B NH1   1 
ATOM   5120  N  NH2   . ARG H  4  146  ? 109.885 54.667  -34.341 1.00 51.27  ? 146  ARG B NH2   1 
ATOM   5121  N  N     . GLY H  4  147  ? 101.579 55.134  -34.090 1.00 52.15  ? 147  GLY B N     1 
ATOM   5122  C  CA    . GLY H  4  147  ? 100.562 55.950  -34.713 1.00 50.26  ? 147  GLY B CA    1 
ATOM   5123  C  C     . GLY H  4  147  ? 100.046 57.005  -33.773 1.00 49.80  ? 147  GLY B C     1 
ATOM   5124  O  O     . GLY H  4  147  ? 100.718 57.374  -32.809 1.00 47.98  ? 147  GLY B O     1 
ATOM   5125  N  N     . VAL H  4  148  ? 98.840  57.484  -34.060 1.00 50.15  ? 148  VAL B N     1 
ATOM   5126  C  CA    . VAL H  4  148  ? 98.200  58.516  -33.258 1.00 50.50  ? 148  VAL B CA    1 
ATOM   5127  C  C     . VAL H  4  148  ? 96.692  58.291  -33.156 1.00 50.21  ? 148  VAL B C     1 
ATOM   5128  O  O     . VAL H  4  148  ? 96.054  57.834  -34.106 1.00 51.12  ? 148  VAL B O     1 
ATOM   5129  C  CB    . VAL H  4  148  ? 98.451  59.929  -33.867 1.00 51.72  ? 148  VAL B CB    1 
ATOM   5130  C  CG1   . VAL H  4  148  ? 99.924  60.307  -33.715 1.00 51.09  ? 148  VAL B CG1   1 
ATOM   5131  C  CG2   . VAL H  4  148  ? 98.059  59.941  -35.342 1.00 52.29  ? 148  VAL B CG2   1 
ATOM   5132  N  N     . GLY H  4  149  ? 96.138  58.613  -31.991 1.00 50.36  ? 149  GLY B N     1 
ATOM   5133  C  CA    . GLY H  4  149  ? 94.706  58.491  -31.762 1.00 51.34  ? 149  GLY B CA    1 
ATOM   5134  C  C     . GLY H  4  149  ? 94.207  57.063  -31.682 1.00 51.92  ? 149  GLY B C     1 
ATOM   5135  O  O     . GLY H  4  149  ? 94.950  56.151  -31.314 1.00 52.82  ? 149  GLY B O     1 
ATOM   5136  N  N     . TYR H  4  150  ? 92.933  56.878  -32.029 1.00 52.07  ? 150  TYR B N     1 
ATOM   5137  C  CA    . TYR H  4  150  ? 92.284  55.557  -32.013 1.00 52.85  ? 150  TYR B CA    1 
ATOM   5138  C  C     . TYR H  4  150  ? 91.909  55.097  -33.430 1.00 53.94  ? 150  TYR B C     1 
ATOM   5139  O  O     . TYR H  4  150  ? 91.260  55.829  -34.200 1.00 55.00  ? 150  TYR B O     1 
ATOM   5140  C  CB    . TYR H  4  150  ? 91.011  55.597  -31.170 1.00 50.60  ? 150  TYR B CB    1 
ATOM   5141  C  CG    . TYR H  4  150  ? 90.431  54.232  -30.854 1.00 48.54  ? 150  TYR B CG    1 
ATOM   5142  C  CD1   . TYR H  4  150  ? 90.885  53.488  -29.743 1.00 48.55  ? 150  TYR B CD1   1 
ATOM   5143  C  CD2   . TYR H  4  150  ? 89.392  53.692  -31.637 1.00 47.82  ? 150  TYR B CD2   1 
ATOM   5144  C  CE1   . TYR H  4  150  ? 90.302  52.218  -29.405 1.00 48.17  ? 150  TYR B CE1   1 
ATOM   5145  C  CE2   . TYR H  4  150  ? 88.794  52.421  -31.316 1.00 47.74  ? 150  TYR B CE2   1 
ATOM   5146  C  CZ    . TYR H  4  150  ? 89.256  51.695  -30.196 1.00 48.26  ? 150  TYR B CZ    1 
ATOM   5147  O  OH    . TYR H  4  150  ? 88.666  50.483  -29.872 1.00 46.29  ? 150  TYR B OH    1 
ATOM   5148  N  N     . VAL H  4  151  ? 92.315  53.884  -33.782 1.00 52.86  ? 151  VAL B N     1 
ATOM   5149  C  CA    . VAL H  4  151  ? 91.988  53.373  -35.098 1.00 53.23  ? 151  VAL B CA    1 
ATOM   5150  C  C     . VAL H  4  151  ? 91.288  52.021  -34.995 1.00 54.91  ? 151  VAL B C     1 
ATOM   5151  O  O     . VAL H  4  151  ? 91.914  51.020  -34.632 1.00 54.98  ? 151  VAL B O     1 
ATOM   5152  C  CB    . VAL H  4  151  ? 93.268  53.235  -35.976 1.00 51.84  ? 151  VAL B CB    1 
ATOM   5153  C  CG1   . VAL H  4  151  ? 92.889  53.028  -37.434 1.00 50.83  ? 151  VAL B CG1   1 
ATOM   5154  C  CG2   . VAL H  4  151  ? 94.108  54.502  -35.869 1.00 52.03  ? 151  VAL B CG2   1 
ATOM   5155  N  N     . PRO H  4  152  ? 89.969  51.979  -35.286 1.00 56.57  ? 152  PRO B N     1 
ATOM   5156  C  CA    . PRO H  4  152  ? 89.251  50.706  -35.216 1.00 57.82  ? 152  PRO B CA    1 
ATOM   5157  C  C     . PRO H  4  152  ? 89.959  49.609  -36.024 1.00 59.04  ? 152  PRO B C     1 
ATOM   5158  O  O     . PRO H  4  152  ? 90.572  49.895  -37.055 1.00 58.51  ? 152  PRO B O     1 
ATOM   5159  C  CB    . PRO H  4  152  ? 87.859  51.070  -35.751 1.00 57.24  ? 152  PRO B CB    1 
ATOM   5160  C  CG    . PRO H  4  152  ? 87.642  52.403  -35.140 1.00 56.31  ? 152  PRO B CG    1 
ATOM   5161  C  CD    . PRO H  4  152  ? 88.999  53.092  -35.400 1.00 57.66  ? 152  PRO B CD    1 
ATOM   5162  N  N     . ALA H  4  153  ? 89.885  48.363  -35.544 1.00 60.53  ? 153  ALA B N     1 
ATOM   5163  C  CA    . ALA H  4  153  ? 90.485  47.222  -36.243 1.00 60.78  ? 153  ALA B CA    1 
ATOM   5164  C  C     . ALA H  4  153  ? 89.900  47.080  -37.646 1.00 61.55  ? 153  ALA B C     1 
ATOM   5165  O  O     . ALA H  4  153  ? 90.479  46.435  -38.525 1.00 61.71  ? 153  ALA B O     1 
ATOM   5166  C  CB    . ALA H  4  153  ? 90.239  45.930  -35.450 1.00 59.57  ? 153  ALA B CB    1 
ATOM   5167  N  N     . GLU H  4  154  ? 88.735  47.703  -37.831 1.00 62.41  ? 154  GLU B N     1 
ATOM   5168  C  CA    . GLU H  4  154  ? 88.007  47.707  -39.093 1.00 61.94  ? 154  GLU B CA    1 
ATOM   5169  C  C     . GLU H  4  154  ? 88.587  48.717  -40.074 1.00 61.92  ? 154  GLU B C     1 
ATOM   5170  O  O     . GLU H  4  154  ? 88.588  48.463  -41.269 1.00 62.33  ? 154  GLU B O     1 
ATOM   5171  C  CB    . GLU H  4  154  ? 86.536  48.050  -38.855 1.00 61.98  ? 154  GLU B CB    1 
ATOM   5172  C  CG    . GLU H  4  154  ? 85.578  46.924  -39.224 1.00 61.37  ? 154  GLU B CG    1 
ATOM   5173  C  CD    . GLU H  4  154  ? 84.444  47.382  -40.133 1.00 60.71  ? 154  GLU B CD    1 
ATOM   5174  O  OE1   . GLU H  4  154  ? 83.619  46.524  -40.509 1.00 61.72  ? 154  GLU B OE1   1 
ATOM   5175  O  OE2   . GLU H  4  154  ? 84.372  48.584  -40.475 1.00 59.81  ? 154  GLU B OE2   1 
ATOM   5176  N  N     . LYS H  4  155  ? 89.079  49.851  -39.573 1.00 62.72  ? 155  LYS B N     1 
ATOM   5177  C  CA    . LYS H  4  155  ? 89.646  50.912  -40.426 1.00 62.87  ? 155  LYS B CA    1 
ATOM   5178  C  C     . LYS H  4  155  ? 90.983  50.490  -41.079 1.00 63.15  ? 155  LYS B C     1 
ATOM   5179  O  O     . LYS H  4  155  ? 91.151  50.699  -42.281 1.00 62.99  ? 155  LYS B O     1 
ATOM   5180  C  CB    . LYS H  4  155  ? 89.864  52.210  -39.618 1.00 62.20  ? 155  LYS B CB    1 
ATOM   5181  C  CG    . LYS H  4  155  ? 89.927  53.481  -40.490 1.00 59.96  ? 155  LYS B CG    1 
ATOM   5182  C  CD    . LYS H  4  155  ? 89.918  54.766  -39.670 1.00 58.49  ? 155  LYS B CD    1 
ATOM   5183  C  CE    . LYS H  4  155  ? 89.796  55.984  -40.573 1.00 58.38  ? 155  LYS B CE    1 
ATOM   5184  N  NZ    . LYS H  4  155  ? 89.563  57.240  -39.808 1.00 58.67  ? 155  LYS B NZ    1 
ATOM   5185  N  N     . HIS H  4  156  ? 91.924  49.906  -40.322 1.00 63.00  ? 156  HIS B N     1 
ATOM   5186  C  CA    . HIS H  4  156  ? 93.213  49.519  -40.915 1.00 63.59  ? 156  HIS B CA    1 
ATOM   5187  C  C     . HIS H  4  156  ? 93.172  48.117  -41.547 1.00 64.89  ? 156  HIS B C     1 
ATOM   5188  O  O     . HIS H  4  156  ? 93.587  47.966  -42.705 1.00 65.77  ? 156  HIS B O     1 
ATOM   5189  C  CB    . HIS H  4  156  ? 94.359  49.606  -39.870 1.00 63.10  ? 156  HIS B CB    1 
ATOM   5190  C  CG    . HIS H  4  156  ? 94.228  48.683  -38.691 1.00 63.05  ? 156  HIS B CG    1 
ATOM   5191  N  ND1   . HIS H  4  156  ? 94.423  47.321  -38.783 1.00 63.28  ? 156  HIS B ND1   1 
ATOM   5192  C  CD2   . HIS H  4  156  ? 93.963  48.937  -37.383 1.00 63.47  ? 156  HIS B CD2   1 
ATOM   5193  C  CE1   . HIS H  4  156  ? 94.285  46.781  -37.583 1.00 62.56  ? 156  HIS B CE1   1 
ATOM   5194  N  NE2   . HIS H  4  156  ? 94.007  47.739  -36.717 1.00 62.25  ? 156  HIS B NE2   1 
ATOM   5195  N  N     . GLY H  4  157  ? 92.683  47.105  -40.826 1.00 65.49  ? 157  GLY B N     1 
ATOM   5196  C  CA    . GLY H  4  157  ? 92.632  45.750  -41.376 1.00 64.94  ? 157  GLY B CA    1 
ATOM   5197  C  C     . GLY H  4  157  ? 94.000  45.251  -41.808 1.00 63.88  ? 157  GLY B C     1 
ATOM   5198  O  O     . GLY H  4  157  ? 94.291  45.162  -43.001 1.00 62.76  ? 157  GLY B O     1 
ATOM   5199  N  N     . ILE H  4  158  ? 94.844  44.933  -40.828 1.00 63.69  ? 158  ILE B N     1 
ATOM   5200  C  CA    . ILE H  4  158  ? 96.188  44.460  -41.105 1.00 64.50  ? 158  ILE B CA    1 
ATOM   5201  C  C     . ILE H  4  158  ? 96.181  42.978  -41.460 1.00 65.73  ? 158  ILE B C     1 
ATOM   5202  O  O     . ILE H  4  158  ? 95.362  42.208  -40.953 1.00 66.40  ? 158  ILE B O     1 
ATOM   5203  C  CB    . ILE H  4  158  ? 97.119  44.754  -39.891 1.00 62.31  ? 158  ILE B CB    1 
ATOM   5204  C  CG1   . ILE H  4  158  ? 97.577  46.227  -39.935 1.00 61.67  ? 158  ILE B CG1   1 
ATOM   5205  C  CG2   . ILE H  4  158  ? 98.356  43.881  -39.939 1.00 63.42  ? 158  ILE B CG2   1 
ATOM   5206  C  CD1   . ILE H  4  158  ? 98.447  46.638  -41.142 1.00 58.77  ? 158  ILE B CD1   1 
ATOM   5207  N  N     . LYS H  4  159  ? 97.107  42.589  -42.333 1.00 66.73  ? 159  LYS B N     1 
ATOM   5208  C  CA    . LYS H  4  159  ? 97.152  41.229  -42.826 1.00 65.84  ? 159  LYS B CA    1 
ATOM   5209  C  C     . LYS H  4  159  ? 98.580  40.743  -43.053 1.00 66.54  ? 159  LYS B C     1 
ATOM   5210  O  O     . LYS H  4  159  ? 99.039  40.627  -44.192 1.00 66.50  ? 159  LYS B O     1 
ATOM   5211  C  CB    . LYS H  4  159  ? 96.364  41.166  -44.133 1.00 65.71  ? 159  LYS B CB    1 
ATOM   5212  C  CG    . LYS H  4  159  ? 96.839  42.214  -45.186 1.00 65.39  ? 159  LYS B CG    1 
ATOM   5213  C  CD    . LYS H  4  159  ? 96.441  43.680  -44.878 1.00 64.05  ? 159  LYS B CD    1 
ATOM   5214  C  CE    . LYS H  4  159  ? 97.633  44.668  -44.914 1.00 63.52  ? 159  LYS B CE    1 
ATOM   5215  N  NZ    . LYS H  4  159  ? 98.618  44.625  -43.782 1.00 61.68  ? 159  LYS B NZ    1 
ATOM   5216  N  N     . ASP H  4  160  ? 99.295  40.468  -41.973 1.00 67.29  ? 160  ASP B N     1 
ATOM   5217  C  CA    . ASP H  4  160  ? 100.620 39.900  -42.124 1.00 69.00  ? 160  ASP B CA    1 
ATOM   5218  C  C     . ASP H  4  160  ? 100.487 38.462  -42.602 1.00 68.98  ? 160  ASP B C     1 
ATOM   5219  O  O     . ASP H  4  160  ? 101.127 38.021  -43.560 1.00 69.53  ? 160  ASP B O     1 
ATOM   5220  C  CB    . ASP H  4  160  ? 101.367 39.943  -40.790 1.00 69.57  ? 160  ASP B CB    1 
ATOM   5221  C  CG    . ASP H  4  160  ? 101.834 41.329  -40.444 1.00 70.48  ? 160  ASP B CG    1 
ATOM   5222  O  OD1   . ASP H  4  160  ? 102.984 41.454  -39.963 1.00 70.47  ? 160  ASP B OD1   1 
ATOM   5223  O  OD2   . ASP H  4  160  ? 101.053 42.282  -40.654 1.00 70.46  ? 160  ASP B OD2   1 
ATOM   5224  N  N     . ARG H  4  161  ? 99.621  37.747  -41.895 1.00 68.50  ? 161  ARG B N     1 
ATOM   5225  C  CA    . ARG H  4  161  ? 99.251  36.393  -42.230 1.00 67.75  ? 161  ARG B CA    1 
ATOM   5226  C  C     . ARG H  4  161  ? 97.775  36.365  -42.565 1.00 67.93  ? 161  ARG B C     1 
ATOM   5227  O  O     . ARG H  4  161  ? 96.997  37.087  -41.949 1.00 67.35  ? 161  ARG B O     1 
ATOM   5228  C  CB    . ARG H  4  161  ? 99.561  35.441  -41.064 1.00 67.43  ? 161  ARG B CB    1 
ATOM   5229  C  CG    . ARG H  4  161  ? 99.829  33.999  -41.522 1.00 66.75  ? 161  ARG B CG    1 
ATOM   5230  C  CD    . ARG H  4  161  ? 101.025 33.885  -42.468 1.00 65.87  ? 161  ARG B CD    1 
ATOM   5231  N  NE    . ARG H  4  161  ? 100.840 32.833  -43.467 1.00 64.80  ? 161  ARG B NE    1 
ATOM   5232  C  CZ    . ARG H  4  161  ? 101.636 32.644  -44.516 1.00 64.62  ? 161  ARG B CZ    1 
ATOM   5233  N  NH1   . ARG H  4  161  ? 102.686 33.440  -44.708 1.00 63.87  ? 161  ARG B NH1   1 
ATOM   5234  N  NH2   . ARG H  4  161  ? 101.377 31.660  -45.375 1.00 62.58  ? 161  ARG B NH2   1 
ATOM   5235  N  N     . ILE H  4  162  ? 97.382  35.555  -43.537 1.00 68.94  ? 162  ILE B N     1 
ATOM   5236  C  CA    . ILE H  4  162  ? 95.993  35.526  -43.994 1.00 69.65  ? 162  ILE B CA    1 
ATOM   5237  C  C     . ILE H  4  162  ? 94.992  35.245  -42.857 1.00 70.00  ? 162  ILE B C     1 
ATOM   5238  O  O     . ILE H  4  162  ? 93.904  35.831  -42.867 1.00 69.50  ? 162  ILE B O     1 
ATOM   5239  C  CB    . ILE H  4  162  ? 95.807  34.463  -45.167 1.00 70.15  ? 162  ILE B CB    1 
ATOM   5240  C  CG1   . ILE H  4  162  ? 95.267  33.123  -44.640 1.00 70.37  ? 162  ILE B CG1   1 
ATOM   5241  C  CG2   . ILE H  4  162  ? 97.154  34.238  -45.875 1.00 69.33  ? 162  ILE B CG2   1 
ATOM   5242  C  CD1   . ILE H  4  162  ? 93.718  33.029  -44.603 1.00 70.36  ? 162  ILE B CD1   1 
ATOM   5243  N  N     . ASN H  4  163  ? 95.342  34.372  -41.899 1.00 70.56  ? 163  ASN B N     1 
ATOM   5244  C  CA    . ASN H  4  163  ? 94.410  33.998  -40.813 1.00 71.59  ? 163  ASN B CA    1 
ATOM   5245  C  C     . ASN H  4  163  ? 94.526  34.920  -39.595 1.00 72.90  ? 163  ASN B C     1 
ATOM   5246  O  O     . ASN H  4  163  ? 93.752  34.762  -38.639 1.00 73.30  ? 163  ASN B O     1 
ATOM   5247  C  CB    . ASN H  4  163  ? 94.641  32.573  -40.286 1.00 69.70  ? 163  ASN B CB    1 
ATOM   5248  C  CG    . ASN H  4  163  ? 95.331  31.683  -41.259 1.00 69.16  ? 163  ASN B CG    1 
ATOM   5249  O  OD1   . ASN H  4  163  ? 96.403  31.997  -41.758 1.00 68.96  ? 163  ASN B OD1   1 
ATOM   5250  N  ND2   . ASN H  4  163  ? 94.726  30.544  -41.531 1.00 70.14  ? 163  ASN B ND2   1 
ATOM   5251  N  N     . ALA H  4  164  ? 95.475  35.860  -39.608 1.00 73.63  ? 164  ALA B N     1 
ATOM   5252  C  CA    . ALA H  4  164  ? 95.641  36.791  -38.480 1.00 74.19  ? 164  ALA B CA    1 
ATOM   5253  C  C     . ALA H  4  164  ? 94.379  37.651  -38.274 1.00 74.20  ? 164  ALA B C     1 
ATOM   5254  O  O     . ALA H  4  164  ? 93.541  37.782  -39.178 1.00 75.38  ? 164  ALA B O     1 
ATOM   5255  C  CB    . ALA H  4  164  ? 96.860  37.698  -38.728 1.00 73.96  ? 164  ALA B CB    1 
ATOM   5256  N  N     . ILE H  4  165  ? 94.243  38.233  -37.088 1.00 72.58  ? 165  ILE B N     1 
ATOM   5257  C  CA    . ILE H  4  165  ? 93.082  39.060  -36.800 1.00 70.95  ? 165  ILE B CA    1 
ATOM   5258  C  C     . ILE H  4  165  ? 93.502  40.430  -36.292 1.00 70.62  ? 165  ILE B C     1 
ATOM   5259  O  O     . ILE H  4  165  ? 94.257  40.528  -35.321 1.00 71.50  ? 165  ILE B O     1 
ATOM   5260  C  CB    . ILE H  4  165  ? 92.183  38.387  -35.752 1.00 69.95  ? 165  ILE B CB    1 
ATOM   5261  C  CG1   . ILE H  4  165  ? 93.032  37.985  -34.532 1.00 69.38  ? 165  ILE B CG1   1 
ATOM   5262  C  CG2   . ILE H  4  165  ? 91.492  37.178  -36.392 1.00 69.76  ? 165  ILE B CG2   1 
ATOM   5263  C  CD1   . ILE H  4  165  ? 92.253  37.714  -33.270 1.00 67.85  ? 165  ILE B CD1   1 
ATOM   5264  N  N     . PRO H  4  166  ? 93.021  41.510  -36.949 1.00 69.95  ? 166  PRO B N     1 
ATOM   5265  C  CA    . PRO H  4  166  ? 93.383  42.861  -36.515 1.00 69.21  ? 166  PRO B CA    1 
ATOM   5266  C  C     . PRO H  4  166  ? 92.808  43.202  -35.133 1.00 69.11  ? 166  PRO B C     1 
ATOM   5267  O  O     . PRO H  4  166  ? 91.813  42.622  -34.677 1.00 68.61  ? 166  PRO B O     1 
ATOM   5268  C  CB    . PRO H  4  166  ? 92.826  43.753  -37.629 1.00 68.26  ? 166  PRO B CB    1 
ATOM   5269  C  CG    . PRO H  4  166  ? 92.732  42.864  -38.815 1.00 68.02  ? 166  PRO B CG    1 
ATOM   5270  C  CD    . PRO H  4  166  ? 92.241  41.580  -38.200 1.00 69.66  ? 166  PRO B CD    1 
ATOM   5271  N  N     . VAL H  4  167  ? 93.458  44.155  -34.474 1.00 68.27  ? 167  VAL B N     1 
ATOM   5272  C  CA    . VAL H  4  167  ? 93.022  44.622  -33.170 1.00 66.59  ? 167  VAL B CA    1 
ATOM   5273  C  C     . VAL H  4  167  ? 92.907  46.139  -33.152 1.00 66.04  ? 167  VAL B C     1 
ATOM   5274  O  O     . VAL H  4  167  ? 93.643  46.837  -33.863 1.00 66.17  ? 167  VAL B O     1 
ATOM   5275  C  CB    . VAL H  4  167  ? 93.998  44.165  -32.064 1.00 66.56  ? 167  VAL B CB    1 
ATOM   5276  C  CG1   . VAL H  4  167  ? 93.441  42.904  -31.403 1.00 65.82  ? 167  VAL B CG1   1 
ATOM   5277  C  CG2   . VAL H  4  167  ? 95.365  43.865  -32.646 1.00 65.38  ? 167  VAL B CG2   1 
ATOM   5278  N  N     . ASP H  4  168  ? 91.975  46.648  -32.351 1.00 65.33  ? 168  ASP B N     1 
ATOM   5279  C  CA    . ASP H  4  168  ? 91.766  48.087  -32.250 1.00 64.04  ? 168  ASP B CA    1 
ATOM   5280  C  C     . ASP H  4  168  ? 93.018  48.781  -31.732 1.00 63.09  ? 168  ASP B C     1 
ATOM   5281  O  O     . ASP H  4  168  ? 93.636  48.348  -30.751 1.00 62.39  ? 168  ASP B O     1 
ATOM   5282  C  CB    . ASP H  4  168  ? 90.585  48.381  -31.329 1.00 65.65  ? 168  ASP B CB    1 
ATOM   5283  C  CG    . ASP H  4  168  ? 89.430  47.398  -31.519 1.00 67.25  ? 168  ASP B CG    1 
ATOM   5284  O  OD1   . ASP H  4  168  ? 89.135  47.031  -32.677 1.00 67.89  ? 168  ASP B OD1   1 
ATOM   5285  O  OD2   . ASP H  4  168  ? 88.810  46.990  -30.510 1.00 67.40  ? 168  ASP B OD2   1 
ATOM   5286  N  N     . ALA H  4  169  ? 93.378  49.865  -32.408 1.00 61.82  ? 169  ALA B N     1 
ATOM   5287  C  CA    . ALA H  4  169  ? 94.591  50.606  -32.103 1.00 60.27  ? 169  ALA B CA    1 
ATOM   5288  C  C     . ALA H  4  169  ? 94.388  51.637  -31.002 1.00 59.71  ? 169  ALA B C     1 
ATOM   5289  O  O     . ALA H  4  169  ? 93.498  52.484  -31.076 1.00 59.62  ? 169  ALA B O     1 
ATOM   5290  C  CB    . ALA H  4  169  ? 95.071  51.281  -33.339 1.00 60.12  ? 169  ALA B CB    1 
ATOM   5291  N  N     . VAL H  4  170  ? 95.246  51.537  -29.986 1.00 58.41  ? 170  VAL B N     1 
ATOM   5292  C  CA    . VAL H  4  170  ? 95.289  52.436  -28.840 1.00 57.63  ? 170  VAL B CA    1 
ATOM   5293  C  C     . VAL H  4  170  ? 96.666  53.075  -28.760 1.00 56.98  ? 170  VAL B C     1 
ATOM   5294  O  O     . VAL H  4  170  ? 97.569  52.636  -28.051 1.00 56.43  ? 170  VAL B O     1 
ATOM   5295  C  CB    . VAL H  4  170  ? 94.941  51.660  -27.531 1.00 57.58  ? 170  VAL B CB    1 
ATOM   5296  C  CG1   . VAL H  4  170  ? 93.546  51.073  -27.666 1.00 57.96  ? 170  VAL B CG1   1 
ATOM   5297  C  CG2   . VAL H  4  170  ? 95.911  50.520  -27.286 1.00 58.36  ? 170  VAL B CG2   1 
ATOM   5298  N  N     . PHE H  4  171  ? 96.799  54.150  -29.513 1.00 57.18  ? 171  PHE B N     1 
ATOM   5299  C  CA    . PHE H  4  171  ? 98.079  54.804  -29.714 1.00 57.56  ? 171  PHE B CA    1 
ATOM   5300  C  C     . PHE H  4  171  ? 98.493  55.820  -28.606 1.00 56.68  ? 171  PHE B C     1 
ATOM   5301  O  O     . PHE H  4  171  ? 99.686  55.913  -28.324 1.00 54.93  ? 171  PHE B O     1 
ATOM   5302  C  CB    . PHE H  4  171  ? 98.033  55.473  -31.091 1.00 59.49  ? 171  PHE B CB    1 
ATOM   5303  C  CG    . PHE H  4  171  ? 98.110  54.493  -32.250 1.00 61.05  ? 171  PHE B CG    1 
ATOM   5304  C  CD1   . PHE H  4  171  ? 99.265  53.696  -32.434 1.00 61.98  ? 171  PHE B CD1   1 
ATOM   5305  C  CD2   . PHE H  4  171  ? 97.058  54.380  -33.184 1.00 60.56  ? 171  PHE B CD2   1 
ATOM   5306  C  CE1   . PHE H  4  171  ? 99.375  52.798  -33.540 1.00 62.36  ? 171  PHE B CE1   1 
ATOM   5307  C  CE2   . PHE H  4  171  ? 97.154  53.487  -34.300 1.00 60.58  ? 171  PHE B CE2   1 
ATOM   5308  C  CZ    . PHE H  4  171  ? 98.312  52.698  -34.474 1.00 61.62  ? 171  PHE B CZ    1 
ATOM   5309  N  N     . SER H  4  172  ? 97.605  56.565  -27.963 1.00 56.73  ? 172  SER B N     1 
ATOM   5310  C  CA    . SER H  4  172  ? 98.122  57.591  -27.041 1.00 57.34  ? 172  SER B CA    1 
ATOM   5311  C  C     . SER H  4  172  ? 98.489  57.042  -25.654 1.00 58.61  ? 172  SER B C     1 
ATOM   5312  O  O     . SER H  4  172  ? 97.782  56.194  -25.101 1.00 58.66  ? 172  SER B O     1 
ATOM   5313  C  CB    . SER H  4  172  ? 97.111  58.744  -26.884 1.00 55.58  ? 172  SER B CB    1 
ATOM   5314  O  OG    . SER H  4  172  ? 97.502  59.876  -27.650 1.00 52.47  ? 172  SER B OG    1 
ATOM   5315  N  N     . PRO H  4  173  ? 99.629  57.525  -25.088 1.00 59.25  ? 173  PRO B N     1 
ATOM   5316  C  CA    . PRO H  4  173  ? 100.147 57.156  -23.764 1.00 60.28  ? 173  PRO B CA    1 
ATOM   5317  C  C     . PRO H  4  173  ? 99.357  57.836  -22.622 1.00 62.32  ? 173  PRO B C     1 
ATOM   5318  O  O     . PRO H  4  173  ? 99.543  57.525  -21.444 1.00 62.32  ? 173  PRO B O     1 
ATOM   5319  C  CB    . PRO H  4  173  ? 101.602 57.582  -23.842 1.00 59.28  ? 173  PRO B CB    1 
ATOM   5320  C  CG    . PRO H  4  173  ? 101.925 57.227  -25.220 1.00 58.77  ? 173  PRO B CG    1 
ATOM   5321  C  CD    . PRO H  4  173  ? 100.775 57.893  -25.938 1.00 58.75  ? 173  PRO B CD    1 
ATOM   5322  N  N     . VAL H  4  174  ? 98.473  58.764  -22.986 1.00 63.86  ? 174  VAL B N     1 
ATOM   5323  C  CA    . VAL H  4  174  ? 97.608  59.467  -22.025 1.00 64.71  ? 174  VAL B CA    1 
ATOM   5324  C  C     . VAL H  4  174  ? 96.190  58.856  -22.028 1.00 64.73  ? 174  VAL B C     1 
ATOM   5325  O  O     . VAL H  4  174  ? 95.487  58.966  -23.028 1.00 64.81  ? 174  VAL B O     1 
ATOM   5326  C  CB    . VAL H  4  174  ? 97.511  60.978  -22.394 1.00 65.38  ? 174  VAL B CB    1 
ATOM   5327  C  CG1   . VAL H  4  174  ? 96.815  61.744  -21.280 1.00 65.09  ? 174  VAL B CG1   1 
ATOM   5328  C  CG2   . VAL H  4  174  ? 98.915  61.550  -22.642 1.00 65.56  ? 174  VAL B CG2   1 
ATOM   5329  N  N     . ARG H  4  175  ? 95.758  58.210  -20.944 1.00 65.18  ? 175  ARG B N     1 
ATOM   5330  C  CA    . ARG H  4  175  ? 94.423  57.611  -20.947 1.00 64.46  ? 175  ARG B CA    1 
ATOM   5331  C  C     . ARG H  4  175  ? 93.348  58.668  -20.840 1.00 64.42  ? 175  ARG B C     1 
ATOM   5332  O  O     . ARG H  4  175  ? 92.417  58.689  -21.638 1.00 64.53  ? 175  ARG B O     1 
ATOM   5333  C  CB    . ARG H  4  175  ? 94.279  56.613  -19.792 1.00 64.31  ? 175  ARG B CB    1 
ATOM   5334  C  CG    . ARG H  4  175  ? 95.400  55.584  -19.750 1.00 63.93  ? 175  ARG B CG    1 
ATOM   5335  C  CD    . ARG H  4  175  ? 95.342  54.667  -20.964 1.00 64.32  ? 175  ARG B CD    1 
ATOM   5336  N  NE    . ARG H  4  175  ? 96.654  54.443  -21.576 1.00 65.27  ? 175  ARG B NE    1 
ATOM   5337  C  CZ    . ARG H  4  175  ? 96.835  53.949  -22.804 1.00 65.10  ? 175  ARG B CZ    1 
ATOM   5338  N  NH1   . ARG H  4  175  ? 95.788  53.633  -23.552 1.00 66.24  ? 175  ARG B NH1   1 
ATOM   5339  N  NH2   . ARG H  4  175  ? 98.058  53.768  -23.289 1.00 64.34  ? 175  ARG B NH2   1 
ATOM   5340  N  N     . ARG H  4  176  ? 93.473  59.564  -19.868 1.00 66.06  ? 176  ARG B N     1 
ATOM   5341  C  CA    . ARG H  4  176  ? 92.436  60.585  -19.709 1.00 66.85  ? 176  ARG B CA    1 
ATOM   5342  C  C     . ARG H  4  176  ? 93.000  61.944  -19.255 1.00 67.26  ? 176  ARG B C     1 
ATOM   5343  O  O     . ARG H  4  176  ? 94.002  62.044  -18.532 1.00 67.82  ? 176  ARG B O     1 
ATOM   5344  C  CB    . ARG H  4  176  ? 91.393  60.100  -18.701 1.00 67.28  ? 176  ARG B CB    1 
ATOM   5345  C  CG    . ARG H  4  176  ? 91.988  59.604  -17.377 1.00 66.91  ? 176  ARG B CG    1 
ATOM   5346  C  CD    . ARG H  4  176  ? 91.220  60.198  -16.220 1.00 66.99  ? 176  ARG B CD    1 
ATOM   5347  N  NE    . ARG H  4  176  ? 90.979  59.244  -15.146 1.00 65.89  ? 176  ARG B NE    1 
ATOM   5348  C  CZ    . ARG H  4  176  ? 90.150  59.467  -14.133 1.00 66.01  ? 176  ARG B CZ    1 
ATOM   5349  N  NH1   . ARG H  4  176  ? 89.475  60.610  -14.049 1.00 66.10  ? 176  ARG B NH1   1 
ATOM   5350  N  NH2   . ARG H  4  176  ? 89.996  58.540  -13.202 1.00 67.05  ? 176  ARG B NH2   1 
ATOM   5351  N  N     . VAL H  4  177  ? 92.310  62.983  -19.709 1.00 66.06  ? 177  VAL B N     1 
ATOM   5352  C  CA    . VAL H  4  177  ? 92.626  64.364  -19.403 1.00 65.95  ? 177  VAL B CA    1 
ATOM   5353  C  C     . VAL H  4  177  ? 91.458  65.024  -18.699 1.00 64.70  ? 177  VAL B C     1 
ATOM   5354  O  O     . VAL H  4  177  ? 90.319  64.561  -18.820 1.00 64.81  ? 177  VAL B O     1 
ATOM   5355  C  CB    . VAL H  4  177  ? 92.955  65.150  -20.689 1.00 67.37  ? 177  VAL B CB    1 
ATOM   5356  C  CG1   . VAL H  4  177  ? 94.456  65.082  -20.961 1.00 68.29  ? 177  VAL B CG1   1 
ATOM   5357  C  CG2   . VAL H  4  177  ? 92.224  64.542  -21.867 1.00 69.23  ? 177  VAL B CG2   1 
ATOM   5358  N  N     . ALA H  4  178  ? 91.725  66.092  -17.964 1.00 63.04  ? 178  ALA B N     1 
ATOM   5359  C  CA    . ALA H  4  178  ? 90.663  66.768  -17.250 1.00 62.43  ? 178  ALA B CA    1 
ATOM   5360  C  C     . ALA H  4  178  ? 91.094  68.146  -16.826 1.00 61.72  ? 178  ALA B C     1 
ATOM   5361  O  O     . ALA H  4  178  ? 92.171  68.297  -16.275 1.00 61.04  ? 178  ALA B O     1 
ATOM   5362  C  CB    . ALA H  4  178  ? 90.268  65.952  -16.027 1.00 62.65  ? 178  ALA B CB    1 
ATOM   5363  N  N     . PHE H  4  179  ? 90.268  69.155  -17.082 1.00 61.88  ? 179  PHE B N     1 
ATOM   5364  C  CA    . PHE H  4  179  ? 90.638  70.508  -16.683 1.00 61.46  ? 179  PHE B CA    1 
ATOM   5365  C  C     . PHE H  4  179  ? 89.469  71.246  -16.062 1.00 61.02  ? 179  PHE B C     1 
ATOM   5366  O  O     . PHE H  4  179  ? 88.318  71.148  -16.521 1.00 60.33  ? 179  PHE B O     1 
ATOM   5367  C  CB    . PHE H  4  179  ? 91.178  71.302  -17.890 1.00 62.36  ? 179  PHE B CB    1 
ATOM   5368  C  CG    . PHE H  4  179  ? 90.180  71.508  -18.997 1.00 62.55  ? 179  PHE B CG    1 
ATOM   5369  C  CD1   . PHE H  4  179  ? 89.250  72.565  -18.947 1.00 62.37  ? 179  PHE B CD1   1 
ATOM   5370  C  CD2   . PHE H  4  179  ? 90.158  70.628  -20.100 1.00 63.39  ? 179  PHE B CD2   1 
ATOM   5371  C  CE1   . PHE H  4  179  ? 88.295  72.750  -19.986 1.00 64.26  ? 179  PHE B CE1   1 
ATOM   5372  C  CE2   . PHE H  4  179  ? 89.213  70.789  -21.155 1.00 63.72  ? 179  PHE B CE2   1 
ATOM   5373  C  CZ    . PHE H  4  179  ? 88.277  71.855  -21.098 1.00 64.56  ? 179  PHE B CZ    1 
ATOM   5374  N  N     . GLN H  4  180  ? 89.783  71.986  -15.004 1.00 58.99  ? 180  GLN B N     1 
ATOM   5375  C  CA    . GLN H  4  180  ? 88.779  72.765  -14.314 1.00 58.14  ? 180  GLN B CA    1 
ATOM   5376  C  C     . GLN H  4  180  ? 89.146  74.221  -14.310 1.00 56.57  ? 180  GLN B C     1 
ATOM   5377  O  O     . GLN H  4  180  ? 90.327  74.562  -14.204 1.00 56.24  ? 180  GLN B O     1 
ATOM   5378  C  CB    . GLN H  4  180  ? 88.622  72.300  -12.868 1.00 59.10  ? 180  GLN B CB    1 
ATOM   5379  C  CG    . GLN H  4  180  ? 87.620  71.175  -12.655 1.00 61.93  ? 180  GLN B CG    1 
ATOM   5380  C  CD    . GLN H  4  180  ? 88.221  69.792  -12.834 1.00 63.11  ? 180  GLN B CD    1 
ATOM   5381  O  OE1   . GLN H  4  180  ? 87.642  68.945  -13.518 1.00 63.42  ? 180  GLN B OE1   1 
ATOM   5382  N  NE2   . GLN H  4  180  ? 89.383  69.552  -12.212 1.00 63.81  ? 180  GLN B NE2   1 
ATOM   5383  N  N     . VAL H  4  181  ? 88.128  75.067  -14.430 1.00 54.40  ? 181  VAL B N     1 
ATOM   5384  C  CA    . VAL H  4  181  ? 88.304  76.511  -14.408 1.00 52.56  ? 181  VAL B CA    1 
ATOM   5385  C  C     . VAL H  4  181  ? 87.505  77.133  -13.256 1.00 51.09  ? 181  VAL B C     1 
ATOM   5386  O  O     . VAL H  4  181  ? 86.322  77.462  -13.396 1.00 50.49  ? 181  VAL B O     1 
ATOM   5387  C  CB    . VAL H  4  181  ? 87.850  77.130  -15.745 1.00 52.68  ? 181  VAL B CB    1 
ATOM   5388  C  CG1   . VAL H  4  181  ? 88.133  78.604  -15.759 1.00 52.06  ? 181  VAL B CG1   1 
ATOM   5389  C  CG2   . VAL H  4  181  ? 88.570  76.432  -16.894 1.00 51.48  ? 181  VAL B CG2   1 
ATOM   5390  N  N     . GLU H  4  182  ? 88.163  77.278  -12.113 1.00 48.80  ? 182  GLU B N     1 
ATOM   5391  C  CA    . GLU H  4  182  ? 87.528  77.858  -10.939 1.00 45.78  ? 182  GLU B CA    1 
ATOM   5392  C  C     . GLU H  4  182  ? 87.963  79.299  -10.749 1.00 43.77  ? 182  GLU B C     1 
ATOM   5393  O  O     . GLU H  4  182  ? 89.111  79.652  -11.024 1.00 42.53  ? 182  GLU B O     1 
ATOM   5394  C  CB    . GLU H  4  182  ? 87.882  77.030  -9.700  1.00 46.93  ? 182  GLU B CB    1 
ATOM   5395  C  CG    . GLU H  4  182  ? 89.210  76.270  -9.819  1.00 46.86  ? 182  GLU B CG    1 
ATOM   5396  C  CD    . GLU H  4  182  ? 89.505  75.380  -8.623  1.00 45.55  ? 182  GLU B CD    1 
ATOM   5397  O  OE1   . GLU H  4  182  ? 90.677  75.362  -8.192  1.00 44.99  ? 182  GLU B OE1   1 
ATOM   5398  O  OE2   . GLU H  4  182  ? 88.576  74.703  -8.123  1.00 45.10  ? 182  GLU B OE2   1 
ATOM   5399  N  N     . ASP H  4  183  ? 87.041  80.129  -10.290 1.00 42.22  ? 183  ASP B N     1 
ATOM   5400  C  CA    . ASP H  4  183  ? 87.347  81.527  -10.069 1.00 40.85  ? 183  ASP B CA    1 
ATOM   5401  C  C     . ASP H  4  183  ? 88.494  81.693  -9.067  1.00 41.76  ? 183  ASP B C     1 
ATOM   5402  O  O     . ASP H  4  183  ? 88.665  80.885  -8.150  1.00 41.33  ? 183  ASP B O     1 
ATOM   5403  C  CB    . ASP H  4  183  ? 86.122  82.276  -9.532  1.00 36.96  ? 183  ASP B CB    1 
ATOM   5404  C  CG    . ASP H  4  183  ? 85.151  82.665  -10.609 1.00 30.99  ? 183  ASP B CG    1 
ATOM   5405  O  OD1   . ASP H  4  183  ? 84.644  83.806  -10.548 1.00 25.47  ? 183  ASP B OD1   1 
ATOM   5406  O  OD2   . ASP H  4  183  ? 84.901  81.831  -11.495 1.00 28.89  ? 183  ASP B OD2   1 
ATOM   5407  N  N     . THR H  4  184  ? 89.275  82.750  -9.269  1.00 43.89  ? 184  THR B N     1 
ATOM   5408  C  CA    . THR H  4  184  ? 90.393  83.114  -8.397  1.00 45.19  ? 184  THR B CA    1 
ATOM   5409  C  C     . THR H  4  184  ? 90.346  84.595  -8.102  1.00 45.06  ? 184  THR B C     1 
ATOM   5410  O  O     . THR H  4  184  ? 89.845  85.362  -8.930  1.00 45.53  ? 184  THR B O     1 
ATOM   5411  C  CB    . THR H  4  184  ? 91.801  82.758  -9.032  1.00 47.23  ? 184  THR B CB    1 
ATOM   5412  O  OG1   . THR H  4  184  ? 92.841  83.244  -8.165  1.00 47.38  ? 184  THR B OG1   1 
ATOM   5413  C  CG2   . THR H  4  184  ? 91.980  83.380  -10.432 1.00 47.26  ? 184  THR B CG2   1 
ATOM   5414  N  N     . ARG H  4  185  ? 90.848  85.023  -6.951  1.00 43.87  ? 185  ARG B N     1 
ATOM   5415  C  CA    . ARG H  4  185  ? 90.721  86.438  -6.667  1.00 42.90  ? 185  ARG B CA    1 
ATOM   5416  C  C     . ARG H  4  185  ? 92.044  87.179  -6.689  1.00 44.61  ? 185  ARG B C     1 
ATOM   5417  O  O     . ARG H  4  185  ? 92.999  86.872  -5.966  1.00 45.45  ? 185  ARG B O     1 
ATOM   5418  C  CB    . ARG H  4  185  ? 90.051  86.679  -5.308  1.00 40.25  ? 185  ARG B CB    1 
ATOM   5419  C  CG    . ARG H  4  185  ? 88.985  87.798  -5.398  1.00 34.44  ? 185  ARG B CG    1 
ATOM   5420  C  CD    . ARG H  4  185  ? 88.583  88.422  -4.048  1.00 30.45  ? 185  ARG B CD    1 
ATOM   5421  N  NE    . ARG H  4  185  ? 89.301  89.676  -3.761  1.00 24.72  ? 185  ARG B NE    1 
ATOM   5422  C  CZ    . ARG H  4  185  ? 89.203  90.376  -2.628  1.00 21.93  ? 185  ARG B CZ    1 
ATOM   5423  N  NH1   . ARG H  4  185  ? 88.413  89.972  -1.643  1.00 22.61  ? 185  ARG B NH1   1 
ATOM   5424  N  NH2   . ARG H  4  185  ? 89.912  91.481  -2.466  1.00 19.56  ? 185  ARG B NH2   1 
ATOM   5425  N  N     . LEU H  4  186  ? 92.060  88.167  -7.568  1.00 45.26  ? 186  LEU B N     1 
ATOM   5426  C  CA    . LEU H  4  186  ? 93.123  89.128  -7.663  1.00 46.53  ? 186  LEU B CA    1 
ATOM   5427  C  C     . LEU H  4  186  ? 92.583  90.443  -7.155  1.00 48.35  ? 186  LEU B C     1 
ATOM   5428  O  O     . LEU H  4  186  ? 91.634  90.983  -7.731  1.00 47.85  ? 186  LEU B O     1 
ATOM   5429  C  CB    . LEU H  4  186  ? 93.607  89.275  -9.111  1.00 46.45  ? 186  LEU B CB    1 
ATOM   5430  C  CG    . LEU H  4  186  ? 95.093  88.997  -9.417  1.00 46.61  ? 186  LEU B CG    1 
ATOM   5431  C  CD1   . LEU H  4  186  ? 95.612  87.748  -8.696  1.00 46.39  ? 186  LEU B CD1   1 
ATOM   5432  C  CD2   . LEU H  4  186  ? 95.225  88.818  -10.916 1.00 47.51  ? 186  LEU B CD2   1 
ATOM   5433  N  N     . GLY H  4  187  ? 93.154  90.913  -6.055  1.00 49.82  ? 187  GLY B N     1 
ATOM   5434  C  CA    . GLY H  4  187  ? 92.734  92.135  -5.384  1.00 52.11  ? 187  GLY B CA    1 
ATOM   5435  C  C     . GLY H  4  187  ? 91.596  92.968  -5.990  1.00 53.26  ? 187  GLY B C     1 
ATOM   5436  O  O     . GLY H  4  187  ? 90.505  93.055  -5.425  1.00 52.66  ? 187  GLY B O     1 
ATOM   5437  N  N     . GLN H  4  188  ? 91.864  93.565  -7.151  1.00 55.36  ? 188  GLN B N     1 
ATOM   5438  C  CA    . GLN H  4  188  ? 90.979  94.517  -7.846  1.00 55.86  ? 188  GLN B CA    1 
ATOM   5439  C  C     . GLN H  4  188  ? 89.699  93.873  -8.470  1.00 56.16  ? 188  GLN B C     1 
ATOM   5440  O  O     . GLN H  4  188  ? 88.584  94.187  -8.022  1.00 57.80  ? 188  GLN B O     1 
ATOM   5441  C  CB    . GLN H  4  188  ? 91.799  95.247  -8.935  1.00 54.83  ? 188  GLN B CB    1 
ATOM   5442  C  CG    . GLN H  4  188  ? 93.121  95.906  -8.456  1.00 52.85  ? 188  GLN B CG    1 
ATOM   5443  C  CD    . GLN H  4  188  ? 93.969  96.473  -9.604  1.00 52.90  ? 188  GLN B CD    1 
ATOM   5444  O  OE1   . GLN H  4  188  ? 94.542  95.723  -10.402 1.00 52.14  ? 188  GLN B OE1   1 
ATOM   5445  N  NE2   . GLN H  4  188  ? 94.046  97.801  -9.688  1.00 50.51  ? 188  GLN B NE2   1 
ATOM   5446  N  N     . ARG H  4  189  ? 89.829  93.016  -9.486  1.00 54.08  ? 189  ARG B N     1 
ATOM   5447  C  CA    . ARG H  4  189  ? 88.657  92.444  -10.165 1.00 52.55  ? 189  ARG B CA    1 
ATOM   5448  C  C     . ARG H  4  189  ? 88.508  90.957  -9.874  1.00 54.49  ? 189  ARG B C     1 
ATOM   5449  O  O     . ARG H  4  189  ? 89.446  90.193  -10.104 1.00 54.66  ? 189  ARG B O     1 
ATOM   5450  C  CB    . ARG H  4  189  ? 88.804  92.685  -11.667 1.00 48.54  ? 189  ARG B CB    1 
ATOM   5451  C  CG    . ARG H  4  189  ? 90.227  92.345  -12.183 1.00 42.33  ? 189  ARG B CG    1 
ATOM   5452  C  CD    . ARG H  4  189  ? 90.581  93.028  -13.514 1.00 37.58  ? 189  ARG B CD    1 
ATOM   5453  N  NE    . ARG H  4  189  ? 90.032  92.329  -14.674 1.00 31.41  ? 189  ARG B NE    1 
ATOM   5454  C  CZ    . ARG H  4  189  ? 90.484  91.168  -15.118 1.00 28.16  ? 189  ARG B CZ    1 
ATOM   5455  N  NH1   . ARG H  4  189  ? 91.497  90.580  -14.511 1.00 28.65  ? 189  ARG B NH1   1 
ATOM   5456  N  NH2   . ARG H  4  189  ? 89.919  90.590  -16.154 1.00 27.37  ? 189  ARG B NH2   1 
ATOM   5457  N  N     . THR H  4  190  ? 87.324  90.561  -9.392  1.00 55.51  ? 190  THR B N     1 
ATOM   5458  C  CA    . THR H  4  190  ? 87.001  89.176  -9.001  1.00 56.29  ? 190  THR B CA    1 
ATOM   5459  C  C     . THR H  4  190  ? 86.800  88.237  -10.205 1.00 56.35  ? 190  THR B C     1 
ATOM   5460  O  O     . THR H  4  190  ? 87.031  87.037  -10.072 1.00 56.21  ? 190  THR B O     1 
ATOM   5461  C  CB    . THR H  4  190  ? 85.725  89.147  -8.142  1.00 56.90  ? 190  THR B CB    1 
ATOM   5462  O  OG1   . THR H  4  190  ? 84.653  89.772  -8.860  1.00 55.92  ? 190  THR B OG1   1 
ATOM   5463  C  CG2   . THR H  4  190  ? 85.945  89.915  -6.840  1.00 57.19  ? 190  THR B CG2   1 
ATOM   5464  N  N     . ASP H  4  191  ? 86.370  88.750  -11.358 1.00 57.72  ? 191  ASP B N     1 
ATOM   5465  C  CA    . ASP H  4  191  ? 86.146  87.882  -12.527 1.00 58.60  ? 191  ASP B CA    1 
ATOM   5466  C  C     . ASP H  4  191  ? 87.473  87.363  -13.132 1.00 59.00  ? 191  ASP B C     1 
ATOM   5467  O  O     . ASP H  4  191  ? 88.074  88.003  -13.999 1.00 58.46  ? 191  ASP B O     1 
ATOM   5468  C  CB    . ASP H  4  191  ? 85.318  88.628  -13.610 1.00 59.79  ? 191  ASP B CB    1 
ATOM   5469  C  CG    . ASP H  4  191  ? 85.975  89.899  -14.116 1.00 59.86  ? 191  ASP B CG    1 
ATOM   5470  O  OD1   . ASP H  4  191  ? 86.384  90.718  -13.275 1.00 61.99  ? 191  ASP B OD1   1 
ATOM   5471  O  OD2   . ASP H  4  191  ? 86.075  90.086  -15.353 1.00 60.06  ? 191  ASP B OD2   1 
ATOM   5472  N  N     . LEU H  4  192  ? 87.923  86.188  -12.679 1.00 59.23  ? 192  LEU B N     1 
ATOM   5473  C  CA    . LEU H  4  192  ? 89.180  85.615  -13.165 1.00 58.13  ? 192  LEU B CA    1 
ATOM   5474  C  C     . LEU H  4  192  ? 89.080  84.119  -13.380 1.00 58.31  ? 192  LEU B C     1 
ATOM   5475  O  O     . LEU H  4  192  ? 88.247  83.427  -12.790 1.00 58.27  ? 192  LEU B O     1 
ATOM   5476  C  CB    . LEU H  4  192  ? 90.294  85.855  -12.174 1.00 58.07  ? 192  LEU B CB    1 
ATOM   5477  C  CG    . LEU H  4  192  ? 90.572  87.278  -11.749 1.00 59.51  ? 192  LEU B CG    1 
ATOM   5478  C  CD1   . LEU H  4  192  ? 91.465  87.255  -10.555 1.00 60.27  ? 192  LEU B CD1   1 
ATOM   5479  C  CD2   . LEU H  4  192  ? 91.219  88.035  -12.877 1.00 61.52  ? 192  LEU B CD2   1 
ATOM   5480  N  N     . ASP H  4  193  ? 89.977  83.631  -14.225 1.00 57.82  ? 193  ASP B N     1 
ATOM   5481  C  CA    . ASP H  4  193  ? 90.034  82.225  -14.564 1.00 58.51  ? 193  ASP B CA    1 
ATOM   5482  C  C     . ASP H  4  193  ? 91.290  81.560  -14.007 1.00 57.50  ? 193  ASP B C     1 
ATOM   5483  O  O     . ASP H  4  193  ? 92.378  82.128  -14.016 1.00 56.63  ? 193  ASP B O     1 
ATOM   5484  C  CB    . ASP H  4  193  ? 90.000  82.062  -16.093 1.00 60.05  ? 193  ASP B CB    1 
ATOM   5485  C  CG    . ASP H  4  193  ? 88.687  82.547  -16.701 1.00 61.45  ? 193  ASP B CG    1 
ATOM   5486  O  OD1   . ASP H  4  193  ? 88.290  83.705  -16.430 1.00 63.22  ? 193  ASP B OD1   1 
ATOM   5487  O  OD2   . ASP H  4  193  ? 88.051  81.771  -17.452 1.00 61.63  ? 193  ASP B OD2   1 
ATOM   5488  N  N     . LYS H  4  194  ? 91.100  80.345  -13.504 1.00 57.48  ? 194  LYS B N     1 
ATOM   5489  C  CA    . LYS H  4  194  ? 92.172  79.495  -13.001 1.00 57.03  ? 194  LYS B CA    1 
ATOM   5490  C  C     . LYS H  4  194  ? 92.097  78.138  -13.666 1.00 56.80  ? 194  LYS B C     1 
ATOM   5491  O  O     . LYS H  4  194  ? 91.140  77.404  -13.429 1.00 56.39  ? 194  LYS B O     1 
ATOM   5492  C  CB    . LYS H  4  194  ? 92.079  79.259  -11.496 1.00 57.43  ? 194  LYS B CB    1 
ATOM   5493  C  CG    . LYS H  4  194  ? 93.022  78.111  -11.049 1.00 57.20  ? 194  LYS B CG    1 
ATOM   5494  C  CD    . LYS H  4  194  ? 92.469  77.285  -9.919  1.00 56.56  ? 194  LYS B CD    1 
ATOM   5495  C  CE    . LYS H  4  194  ? 93.011  77.740  -8.568  1.00 56.73  ? 194  LYS B CE    1 
ATOM   5496  N  NZ    . LYS H  4  194  ? 92.573  79.103  -8.162  1.00 55.82  ? 194  LYS B NZ    1 
ATOM   5497  N  N     . LEU H  4  195  ? 93.095  77.799  -14.475 1.00 56.30  ? 195  LEU B N     1 
ATOM   5498  C  CA    . LEU H  4  195  ? 93.062  76.536  -15.189 1.00 55.20  ? 195  LEU B CA    1 
ATOM   5499  C  C     . LEU H  4  195  ? 94.012  75.510  -14.602 1.00 53.46  ? 195  LEU B C     1 
ATOM   5500  O  O     . LEU H  4  195  ? 95.224  75.689  -14.499 1.00 52.59  ? 195  LEU B O     1 
ATOM   5501  C  CB    . LEU H  4  195  ? 93.400  76.750  -16.670 1.00 56.85  ? 195  LEU B CB    1 
ATOM   5502  C  CG    . LEU H  4  195  ? 93.748  75.524  -17.520 1.00 58.12  ? 195  LEU B CG    1 
ATOM   5503  C  CD1   . LEU H  4  195  ? 92.523  74.597  -17.589 1.00 59.87  ? 195  LEU B CD1   1 
ATOM   5504  C  CD2   . LEU H  4  195  ? 94.198  75.972  -18.915 1.00 57.67  ? 195  LEU B CD2   1 
ATOM   5505  N  N     . THR H  4  196  ? 93.402  74.409  -14.223 1.00 52.22  ? 196  THR B N     1 
ATOM   5506  C  CA    . THR H  4  196  ? 94.106  73.281  -13.713 1.00 51.68  ? 196  THR B CA    1 
ATOM   5507  C  C     . THR H  4  196  ? 93.695  72.049  -14.496 1.00 51.65  ? 196  THR B C     1 
ATOM   5508  O  O     . THR H  4  196  ? 92.525  71.659  -14.495 1.00 50.46  ? 196  THR B O     1 
ATOM   5509  C  CB    . THR H  4  196  ? 93.801  73.100  -12.226 1.00 52.48  ? 196  THR B CB    1 
ATOM   5510  O  OG1   . THR H  4  196  ? 92.488  72.556  -12.065 1.00 53.68  ? 196  THR B OG1   1 
ATOM   5511  C  CG2   . THR H  4  196  ? 93.833  74.446  -11.523 1.00 52.24  ? 196  THR B CG2   1 
ATOM   5512  N  N     . LEU H  4  197  ? 94.649  71.454  -15.193 1.00 51.33  ? 197  LEU B N     1 
ATOM   5513  C  CA    . LEU H  4  197  ? 94.365  70.281  -15.998 1.00 51.10  ? 197  LEU B CA    1 
ATOM   5514  C  C     . LEU H  4  197  ? 95.110  69.075  -15.468 1.00 51.38  ? 197  LEU B C     1 
ATOM   5515  O  O     . LEU H  4  197  ? 96.325  69.098  -15.300 1.00 50.74  ? 197  LEU B O     1 
ATOM   5516  C  CB    . LEU H  4  197  ? 94.751  70.564  -17.468 1.00 51.41  ? 197  LEU B CB    1 
ATOM   5517  C  CG    . LEU H  4  197  ? 94.824  69.546  -18.626 1.00 51.76  ? 197  LEU B CG    1 
ATOM   5518  C  CD1   . LEU H  4  197  ? 93.721  69.787  -19.653 1.00 51.96  ? 197  LEU B CD1   1 
ATOM   5519  C  CD2   . LEU H  4  197  ? 96.167  69.713  -19.332 1.00 50.89  ? 197  LEU B CD2   1 
ATOM   5520  N  N     . ARG H  4  198  ? 94.355  68.027  -15.192 1.00 51.46  ? 198  ARG B N     1 
ATOM   5521  C  CA    . ARG H  4  198  ? 94.901  66.787  -14.697 1.00 53.12  ? 198  ARG B CA    1 
ATOM   5522  C  C     . ARG H  4  198  ? 95.127  65.823  -15.832 1.00 53.67  ? 198  ARG B C     1 
ATOM   5523  O  O     . ARG H  4  198  ? 94.216  65.570  -16.621 1.00 52.86  ? 198  ARG B O     1 
ATOM   5524  C  CB    . ARG H  4  198  ? 93.946  66.143  -13.707 1.00 53.58  ? 198  ARG B CB    1 
ATOM   5525  C  CG    . ARG H  4  198  ? 93.482  67.024  -12.591 1.00 54.41  ? 198  ARG B CG    1 
ATOM   5526  C  CD    . ARG H  4  198  ? 92.922  66.189  -11.449 1.00 54.31  ? 198  ARG B CD    1 
ATOM   5527  N  NE    . ARG H  4  198  ? 91.462  66.175  -11.397 1.00 53.27  ? 198  ARG B NE    1 
ATOM   5528  C  CZ    . ARG H  4  198  ? 90.758  65.573  -10.442 1.00 53.86  ? 198  ARG B CZ    1 
ATOM   5529  N  NH1   . ARG H  4  198  ? 91.376  64.930  -9.454  1.00 53.83  ? 198  ARG B NH1   1 
ATOM   5530  N  NH2   . ARG H  4  198  ? 89.432  65.617  -10.471 1.00 53.62  ? 198  ARG B NH2   1 
ATOM   5531  N  N     . ILE H  4  199  ? 96.332  65.285  -15.920 1.00 54.45  ? 199  ILE B N     1 
ATOM   5532  C  CA    . ILE H  4  199  ? 96.625  64.360  -16.992 1.00 56.09  ? 199  ILE B CA    1 
ATOM   5533  C  C     . ILE H  4  199  ? 97.060  63.022  -16.449 1.00 57.23  ? 199  ILE B C     1 
ATOM   5534  O  O     . ILE H  4  199  ? 97.866  62.949  -15.527 1.00 57.54  ? 199  ILE B O     1 
ATOM   5535  C  CB    . ILE H  4  199  ? 97.751  64.906  -17.913 1.00 55.91  ? 199  ILE B CB    1 
ATOM   5536  C  CG1   . ILE H  4  199  ? 97.390  66.316  -18.395 1.00 53.87  ? 199  ILE B CG1   1 
ATOM   5537  C  CG2   . ILE H  4  199  ? 97.965  63.963  -19.098 1.00 55.66  ? 199  ILE B CG2   1 
ATOM   5538  C  CD1   . ILE H  4  199  ? 98.464  66.977  -19.253 1.00 51.92  ? 199  ILE B CD1   1 
ATOM   5539  N  N     . TRP H  4  200  ? 96.513  61.965  -17.034 1.00 59.78  ? 200  TRP B N     1 
ATOM   5540  C  CA    . TRP H  4  200  ? 96.855  60.604  -16.656 1.00 61.04  ? 200  TRP B CA    1 
ATOM   5541  C  C     . TRP H  4  200  ? 97.599  59.900  -17.799 1.00 63.06  ? 200  TRP B C     1 
ATOM   5542  O  O     . TRP H  4  200  ? 97.173  59.984  -18.956 1.00 62.61  ? 200  TRP B O     1 
ATOM   5543  C  CB    . TRP H  4  200  ? 95.570  59.854  -16.285 1.00 61.06  ? 200  TRP B CB    1 
ATOM   5544  C  CG    . TRP H  4  200  ? 95.200  59.988  -14.813 1.00 60.89  ? 200  TRP B CG    1 
ATOM   5545  C  CD1   . TRP H  4  200  ? 95.557  59.132  -13.798 1.00 60.24  ? 200  TRP B CD1   1 
ATOM   5546  C  CD2   . TRP H  4  200  ? 94.444  61.044  -14.196 1.00 61.06  ? 200  TRP B CD2   1 
ATOM   5547  N  NE1   . TRP H  4  200  ? 95.072  59.590  -12.590 1.00 60.32  ? 200  TRP B NE1   1 
ATOM   5548  C  CE2   . TRP H  4  200  ? 94.386  60.759  -12.797 1.00 60.62  ? 200  TRP B CE2   1 
ATOM   5549  C  CE3   . TRP H  4  200  ? 93.806  62.204  -14.683 1.00 61.57  ? 200  TRP B CE3   1 
ATOM   5550  C  CZ2   . TRP H  4  200  ? 93.710  61.604  -11.868 1.00 59.97  ? 200  TRP B CZ2   1 
ATOM   5551  C  CZ3   . TRP H  4  200  ? 93.123  63.053  -13.750 1.00 60.97  ? 200  TRP B CZ3   1 
ATOM   5552  C  CH2   . TRP H  4  200  ? 93.089  62.738  -12.360 1.00 59.74  ? 200  TRP B CH2   1 
ATOM   5553  N  N     . THR H  4  201  ? 98.701  59.217  -17.473 1.00 64.57  ? 201  THR B N     1 
ATOM   5554  C  CA    . THR H  4  201  ? 99.534  58.549  -18.475 1.00 66.18  ? 201  THR B CA    1 
ATOM   5555  C  C     . THR H  4  201  ? 99.801  57.076  -18.105 1.00 66.57  ? 201  THR B C     1 
ATOM   5556  O  O     . THR H  4  201  ? 99.960  56.738  -16.926 1.00 66.85  ? 201  THR B O     1 
ATOM   5557  C  CB    . THR H  4  201  ? 100.900 59.296  -18.615 1.00 66.72  ? 201  THR B CB    1 
ATOM   5558  O  OG1   . THR H  4  201  ? 100.727 60.684  -18.263 1.00 66.85  ? 201  THR B OG1   1 
ATOM   5559  C  CG2   . THR H  4  201  ? 101.425 59.208  -20.045 1.00 66.37  ? 201  THR B CG2   1 
ATOM   5560  N  N     . ASP H  4  202  ? 99.857  56.212  -19.125 1.00 67.56  ? 202  ASP B N     1 
ATOM   5561  C  CA    . ASP H  4  202  ? 100.109 54.764  -18.972 1.00 67.45  ? 202  ASP B CA    1 
ATOM   5562  C  C     . ASP H  4  202  ? 101.508 54.474  -18.395 1.00 66.97  ? 202  ASP B C     1 
ATOM   5563  O  O     . ASP H  4  202  ? 101.772 53.364  -17.927 1.00 65.73  ? 202  ASP B O     1 
ATOM   5564  C  CB    . ASP H  4  202  ? 99.973  54.060  -20.334 1.00 69.00  ? 202  ASP B CB    1 
ATOM   5565  C  CG    . ASP H  4  202  ? 101.087 54.426  -21.318 1.00 70.19  ? 202  ASP B CG    1 
ATOM   5566  O  OD1   . ASP H  4  202  ? 101.513 55.596  -21.350 1.00 71.96  ? 202  ASP B OD1   1 
ATOM   5567  O  OD2   . ASP H  4  202  ? 101.536 53.545  -22.075 1.00 69.93  ? 202  ASP B OD2   1 
ATOM   5568  N  N     . GLY H  4  203  ? 102.395 55.466  -18.433 1.00 66.92  ? 203  GLY B N     1 
ATOM   5569  C  CA    . GLY H  4  203  ? 103.740 55.282  -17.916 1.00 65.72  ? 203  GLY B CA    1 
ATOM   5570  C  C     . GLY H  4  203  ? 104.809 55.523  -18.966 1.00 64.68  ? 203  GLY B C     1 
ATOM   5571  O  O     . GLY H  4  203  ? 105.899 55.995  -18.632 1.00 64.18  ? 203  GLY B O     1 
ATOM   5572  N  N     . SER H  4  204  ? 104.502 55.196  -20.225 1.00 64.63  ? 204  SER B N     1 
ATOM   5573  C  CA    . SER H  4  204  ? 105.437 55.393  -21.341 1.00 64.07  ? 204  SER B CA    1 
ATOM   5574  C  C     . SER H  4  204  ? 106.077 56.778  -21.267 1.00 64.42  ? 204  SER B C     1 
ATOM   5575  O  O     . SER H  4  204  ? 107.302 56.915  -21.264 1.00 64.89  ? 204  SER B O     1 
ATOM   5576  C  CB    . SER H  4  204  ? 104.699 55.228  -22.681 1.00 63.35  ? 204  SER B CB    1 
ATOM   5577  O  OG    . SER H  4  204  ? 105.524 55.529  -23.797 1.00 61.93  ? 204  SER B OG    1 
ATOM   5578  N  N     . VAL H  4  205  ? 105.227 57.799  -21.205 1.00 65.13  ? 205  VAL B N     1 
ATOM   5579  C  CA    . VAL H  4  205  ? 105.665 59.181  -21.071 1.00 65.03  ? 205  VAL B CA    1 
ATOM   5580  C  C     . VAL H  4  205  ? 105.133 59.766  -19.756 1.00 65.45  ? 205  VAL B C     1 
ATOM   5581  O  O     . VAL H  4  205  ? 104.313 59.122  -19.091 1.00 65.54  ? 205  VAL B O     1 
ATOM   5582  C  CB    . VAL H  4  205  ? 105.177 60.077  -22.303 1.00 64.80  ? 205  VAL B CB    1 
ATOM   5583  C  CG1   . VAL H  4  205  ? 105.802 59.566  -23.599 1.00 64.95  ? 205  VAL B CG1   1 
ATOM   5584  C  CG2   . VAL H  4  205  ? 103.641 60.070  -22.421 1.00 62.37  ? 205  VAL B CG2   1 
ATOM   5585  N  N     . THR H  4  206  ? 105.584 60.956  -19.361 1.00 65.24  ? 206  THR B N     1 
ATOM   5586  C  CA    . THR H  4  206  ? 105.092 61.548  -18.117 1.00 65.44  ? 206  THR B CA    1 
ATOM   5587  C  C     . THR H  4  206  ? 104.055 62.646  -18.400 1.00 65.49  ? 206  THR B C     1 
ATOM   5588  O  O     . THR H  4  206  ? 104.049 63.223  -19.493 1.00 65.31  ? 206  THR B O     1 
ATOM   5589  C  CB    . THR H  4  206  ? 106.286 62.127  -17.274 1.00 64.99  ? 206  THR B CB    1 
ATOM   5590  O  OG1   . THR H  4  206  ? 105.926 62.155  -15.886 1.00 65.16  ? 206  THR B OG1   1 
ATOM   5591  C  CG2   . THR H  4  206  ? 106.627 63.533  -17.686 1.00 64.72  ? 206  THR B CG2   1 
ATOM   5592  N  N     . PRO H  4  207  ? 103.159 62.937  -17.434 1.00 65.02  ? 207  PRO B N     1 
ATOM   5593  C  CA    . PRO H  4  207  ? 102.162 63.979  -17.673 1.00 65.45  ? 207  PRO B CA    1 
ATOM   5594  C  C     . PRO H  4  207  ? 102.802 65.274  -18.119 1.00 66.09  ? 207  PRO B C     1 
ATOM   5595  O  O     . PRO H  4  207  ? 102.329 65.899  -19.065 1.00 67.92  ? 207  PRO B O     1 
ATOM   5596  C  CB    . PRO H  4  207  ? 101.456 64.091  -16.340 1.00 64.39  ? 207  PRO B CB    1 
ATOM   5597  C  CG    . PRO H  4  207  ? 101.463 62.670  -15.879 1.00 63.96  ? 207  PRO B CG    1 
ATOM   5598  C  CD    . PRO H  4  207  ? 102.883 62.254  -16.157 1.00 64.12  ? 207  PRO B CD    1 
ATOM   5599  N  N     . LEU H  4  208  ? 103.884 65.664  -17.446 1.00 66.79  ? 208  LEU B N     1 
ATOM   5600  C  CA    . LEU H  4  208  ? 104.588 66.894  -17.797 1.00 67.14  ? 208  LEU B CA    1 
ATOM   5601  C  C     . LEU H  4  208  ? 105.137 66.827  -19.229 1.00 68.39  ? 208  LEU B C     1 
ATOM   5602  O  O     . LEU H  4  208  ? 104.947 67.755  -20.019 1.00 68.44  ? 208  LEU B O     1 
ATOM   5603  C  CB    . LEU H  4  208  ? 105.730 67.150  -16.812 1.00 65.63  ? 208  LEU B CB    1 
ATOM   5604  C  CG    . LEU H  4  208  ? 106.222 68.608  -16.791 1.00 64.36  ? 208  LEU B CG    1 
ATOM   5605  C  CD1   . LEU H  4  208  ? 105.107 69.545  -16.373 1.00 63.40  ? 208  LEU B CD1   1 
ATOM   5606  C  CD2   . LEU H  4  208  ? 107.387 68.715  -15.832 1.00 64.12  ? 208  LEU B CD2   1 
ATOM   5607  N  N     . GLU H  4  209  ? 105.817 65.732  -19.561 1.00 69.39  ? 209  GLU B N     1 
ATOM   5608  C  CA    . GLU H  4  209  ? 106.345 65.556  -20.909 1.00 70.46  ? 209  GLU B CA    1 
ATOM   5609  C  C     . GLU H  4  209  ? 105.231 65.714  -21.948 1.00 71.11  ? 209  GLU B C     1 
ATOM   5610  O  O     . GLU H  4  209  ? 105.384 66.443  -22.928 1.00 71.47  ? 209  GLU B O     1 
ATOM   5611  C  CB    . GLU H  4  209  ? 106.986 64.166  -21.049 1.00 70.65  ? 209  GLU B CB    1 
ATOM   5612  C  CG    . GLU H  4  209  ? 108.517 64.136  -20.904 1.00 69.83  ? 209  GLU B CG    1 
ATOM   5613  C  CD    . GLU H  4  209  ? 108.997 64.444  -19.497 1.00 69.54  ? 209  GLU B CD    1 
ATOM   5614  O  OE1   . GLU H  4  209  ? 108.779 65.574  -19.021 1.00 68.46  ? 209  GLU B OE1   1 
ATOM   5615  O  OE2   . GLU H  4  209  ? 109.591 63.550  -18.861 1.00 70.39  ? 209  GLU B OE2   1 
ATOM   5616  N  N     . ALA H  4  210  ? 104.112 65.030  -21.705 1.00 72.38  ? 210  ALA B N     1 
ATOM   5617  C  CA    . ALA H  4  210  ? 102.944 65.062  -22.582 1.00 72.66  ? 210  ALA B CA    1 
ATOM   5618  C  C     . ALA H  4  210  ? 102.472 66.497  -22.823 1.00 73.15  ? 210  ALA B C     1 
ATOM   5619  O  O     . ALA H  4  210  ? 102.309 66.910  -23.975 1.00 73.79  ? 210  ALA B O     1 
ATOM   5620  C  CB    . ALA H  4  210  ? 101.820 64.235  -21.964 1.00 73.12  ? 210  ALA B CB    1 
ATOM   5621  N  N     . LEU H  4  211  ? 102.253 67.242  -21.739 1.00 73.82  ? 211  LEU B N     1 
ATOM   5622  C  CA    . LEU H  4  211  ? 101.812 68.650  -21.795 1.00 74.85  ? 211  LEU B CA    1 
ATOM   5623  C  C     . LEU H  4  211  ? 102.706 69.472  -22.716 1.00 75.95  ? 211  LEU B C     1 
ATOM   5624  O  O     . LEU H  4  211  ? 102.227 70.217  -23.577 1.00 75.32  ? 211  LEU B O     1 
ATOM   5625  C  CB    . LEU H  4  211  ? 101.851 69.283  -20.389 1.00 74.07  ? 211  LEU B CB    1 
ATOM   5626  C  CG    . LEU H  4  211  ? 102.139 70.798  -20.232 1.00 72.33  ? 211  LEU B CG    1 
ATOM   5627  C  CD1   . LEU H  4  211  ? 100.934 71.587  -20.691 1.00 71.26  ? 211  LEU B CD1   1 
ATOM   5628  C  CD2   . LEU H  4  211  ? 102.478 71.128  -18.784 1.00 71.74  ? 211  LEU B CD2   1 
ATOM   5629  N  N     . ASN H  4  212  ? 104.010 69.329  -22.496 1.00 76.85  ? 212  ASN B N     1 
ATOM   5630  C  CA    . ASN H  4  212  ? 105.023 70.029  -23.268 1.00 77.39  ? 212  ASN B CA    1 
ATOM   5631  C  C     . ASN H  4  212  ? 104.880 69.711  -24.744 1.00 77.03  ? 212  ASN B C     1 
ATOM   5632  O  O     . ASN H  4  212  ? 104.880 70.616  -25.571 1.00 78.53  ? 212  ASN B O     1 
ATOM   5633  C  CB    . ASN H  4  212  ? 106.424 69.618  -22.788 1.00 79.75  ? 212  ASN B CB    1 
ATOM   5634  C  CG    . ASN H  4  212  ? 106.595 69.712  -21.265 1.00 81.66  ? 212  ASN B CG    1 
ATOM   5635  O  OD1   . ASN H  4  212  ? 107.556 69.163  -20.711 1.00 81.95  ? 212  ASN B OD1   1 
ATOM   5636  N  ND2   . ASN H  4  212  ? 105.672 70.404  -20.587 1.00 82.55  ? 212  ASN B ND2   1 
ATOM   5637  N  N     . GLN H  4  213  ? 104.764 68.423  -25.067 1.00 74.88  ? 213  GLN B N     1 
ATOM   5638  C  CA    . GLN H  4  213  ? 104.584 67.997  -26.449 1.00 73.42  ? 213  GLN B CA    1 
ATOM   5639  C  C     . GLN H  4  213  ? 103.335 68.633  -27.044 1.00 71.69  ? 213  GLN B C     1 
ATOM   5640  O  O     . GLN H  4  213  ? 103.340 69.100  -28.182 1.00 71.02  ? 213  GLN B O     1 
ATOM   5641  C  CB    . GLN H  4  213  ? 104.453 66.473  -26.523 1.00 74.68  ? 213  GLN B CB    1 
ATOM   5642  C  CG    . GLN H  4  213  ? 105.774 65.710  -26.671 1.00 76.43  ? 213  GLN B CG    1 
ATOM   5643  C  CD    . GLN H  4  213  ? 106.488 65.434  -25.355 1.00 77.24  ? 213  GLN B CD    1 
ATOM   5644  O  OE1   . GLN H  4  213  ? 106.418 64.319  -24.819 1.00 77.23  ? 213  GLN B OE1   1 
ATOM   5645  N  NE2   . GLN H  4  213  ? 107.183 66.448  -24.828 1.00 76.55  ? 213  GLN B NE2   1 
ATOM   5646  N  N     . ALA H  4  214  ? 102.271 68.641  -26.241 1.00 69.90  ? 214  ALA B N     1 
ATOM   5647  C  CA    . ALA H  4  214  ? 100.964 69.189  -26.611 1.00 69.05  ? 214  ALA B CA    1 
ATOM   5648  C  C     . ALA H  4  214  ? 101.052 70.669  -26.991 1.00 68.19  ? 214  ALA B C     1 
ATOM   5649  O  O     . ALA H  4  214  ? 100.669 71.042  -28.098 1.00 68.40  ? 214  ALA B O     1 
ATOM   5650  C  CB    . ALA H  4  214  ? 99.988  69.014  -25.453 1.00 68.10  ? 214  ALA B CB    1 
ATOM   5651  N  N     . VAL H  4  215  ? 101.546 71.512  -26.080 1.00 66.31  ? 215  VAL B N     1 
ATOM   5652  C  CA    . VAL H  4  215  ? 101.673 72.949  -26.354 1.00 65.41  ? 215  VAL B CA    1 
ATOM   5653  C  C     . VAL H  4  215  ? 102.542 73.211  -27.599 1.00 65.68  ? 215  VAL B C     1 
ATOM   5654  O  O     . VAL H  4  215  ? 102.345 74.206  -28.296 1.00 64.81  ? 215  VAL B O     1 
ATOM   5655  C  CB    . VAL H  4  215  ? 102.291 73.730  -25.124 1.00 64.56  ? 215  VAL B CB    1 
ATOM   5656  C  CG1   . VAL H  4  215  ? 101.666 73.227  -23.830 1.00 63.59  ? 215  VAL B CG1   1 
ATOM   5657  C  CG2   . VAL H  4  215  ? 103.801 73.597  -25.085 1.00 63.55  ? 215  VAL B CG2   1 
ATOM   5658  N  N     . GLU H  4  216  ? 103.499 72.318  -27.860 1.00 65.83  ? 216  GLU B N     1 
ATOM   5659  C  CA    . GLU H  4  216  ? 104.381 72.423  -29.029 1.00 66.42  ? 216  GLU B CA    1 
ATOM   5660  C  C     . GLU H  4  216  ? 103.603 72.148  -30.318 1.00 65.94  ? 216  GLU B C     1 
ATOM   5661  O  O     . GLU H  4  216  ? 103.745 72.882  -31.296 1.00 66.09  ? 216  GLU B O     1 
ATOM   5662  C  CB    . GLU H  4  216  ? 105.545 71.421  -28.929 1.00 67.37  ? 216  GLU B CB    1 
ATOM   5663  C  CG    . GLU H  4  216  ? 106.490 71.366  -30.161 1.00 68.53  ? 216  GLU B CG    1 
ATOM   5664  C  CD    . GLU H  4  216  ? 107.544 72.483  -30.204 1.00 69.43  ? 216  GLU B CD    1 
ATOM   5665  O  OE1   . GLU H  4  216  ? 108.282 72.672  -29.213 1.00 70.59  ? 216  GLU B OE1   1 
ATOM   5666  O  OE2   . GLU H  4  216  ? 107.644 73.171  -31.241 1.00 69.57  ? 216  GLU B OE2   1 
ATOM   5667  N  N     . ILE H  4  217  ? 102.792 71.086  -30.318 1.00 64.33  ? 217  ILE B N     1 
ATOM   5668  C  CA    . ILE H  4  217  ? 101.977 70.747  -31.485 1.00 62.60  ? 217  ILE B CA    1 
ATOM   5669  C  C     . ILE H  4  217  ? 101.018 71.894  -31.815 1.00 63.33  ? 217  ILE B C     1 
ATOM   5670  O  O     . ILE H  4  217  ? 100.649 72.109  -32.973 1.00 62.58  ? 217  ILE B O     1 
ATOM   5671  C  CB    . ILE H  4  217  ? 101.154 69.467  -31.227 1.00 61.33  ? 217  ILE B CB    1 
ATOM   5672  C  CG1   . ILE H  4  217  ? 102.065 68.365  -30.700 1.00 60.77  ? 217  ILE B CG1   1 
ATOM   5673  C  CG2   . ILE H  4  217  ? 100.499 69.008  -32.509 1.00 60.73  ? 217  ILE B CG2   1 
ATOM   5674  C  CD1   . ILE H  4  217  ? 101.362 67.299  -29.897 1.00 59.34  ? 217  ILE B CD1   1 
ATOM   5675  N  N     . LEU H  4  218  ? 100.625 72.629  -30.776 1.00 64.34  ? 218  LEU B N     1 
ATOM   5676  C  CA    . LEU H  4  218  ? 99.734  73.788  -30.912 1.00 66.02  ? 218  LEU B CA    1 
ATOM   5677  C  C     . LEU H  4  218  ? 100.484 74.994  -31.493 1.00 64.78  ? 218  LEU B C     1 
ATOM   5678  O  O     . LEU H  4  218  ? 100.006 75.654  -32.413 1.00 64.79  ? 218  LEU B O     1 
ATOM   5679  C  CB    . LEU H  4  218  ? 99.144  74.170  -29.538 1.00 67.39  ? 218  LEU B CB    1 
ATOM   5680  C  CG    . LEU H  4  218  ? 98.402  75.509  -29.376 1.00 68.61  ? 218  LEU B CG    1 
ATOM   5681  C  CD1   . LEU H  4  218  ? 97.319  75.598  -30.461 1.00 69.92  ? 218  LEU B CD1   1 
ATOM   5682  C  CD2   . LEU H  4  218  ? 97.787  75.624  -27.972 1.00 68.47  ? 218  LEU B CD2   1 
ATOM   5683  N  N     . ARG H  4  219  ? 101.656 75.276  -30.940 1.00 64.78  ? 219  ARG B N     1 
ATOM   5684  C  CA    . ARG H  4  219  ? 102.471 76.381  -31.418 1.00 64.00  ? 219  ARG B CA    1 
ATOM   5685  C  C     . ARG H  4  219  ? 102.889 76.151  -32.873 1.00 63.79  ? 219  ARG B C     1 
ATOM   5686  O  O     . ARG H  4  219  ? 102.772 77.062  -33.697 1.00 63.98  ? 219  ARG B O     1 
ATOM   5687  C  CB    . ARG H  4  219  ? 103.708 76.531  -30.532 1.00 63.74  ? 219  ARG B CB    1 
ATOM   5688  C  CG    . ARG H  4  219  ? 104.416 77.859  -30.711 1.00 62.24  ? 219  ARG B CG    1 
ATOM   5689  C  CD    . ARG H  4  219  ? 105.725 77.830  -29.973 1.00 62.64  ? 219  ARG B CD    1 
ATOM   5690  N  NE    . ARG H  4  219  ? 106.696 76.962  -30.630 1.00 62.24  ? 219  ARG B NE    1 
ATOM   5691  C  CZ    . ARG H  4  219  ? 107.744 76.414  -30.019 1.00 62.93  ? 219  ARG B CZ    1 
ATOM   5692  N  NH1   . ARG H  4  219  ? 107.958 76.630  -28.731 1.00 62.82  ? 219  ARG B NH1   1 
ATOM   5693  N  NH2   . ARG H  4  219  ? 108.590 75.646  -30.693 1.00 63.84  ? 219  ARG B NH2   1 
ATOM   5694  N  N     . GLU H  4  220  ? 103.367 74.937  -33.179 1.00 63.23  ? 220  GLU B N     1 
ATOM   5695  C  CA    . GLU H  4  220  ? 103.777 74.569  -34.544 1.00 62.27  ? 220  GLU B CA    1 
ATOM   5696  C  C     . GLU H  4  220  ? 102.630 74.801  -35.529 1.00 62.28  ? 220  GLU B C     1 
ATOM   5697  O  O     . GLU H  4  220  ? 102.849 75.171  -36.684 1.00 61.80  ? 220  GLU B O     1 
ATOM   5698  C  CB    . GLU H  4  220  ? 104.207 73.089  -34.606 1.00 61.44  ? 220  GLU B CB    1 
ATOM   5699  C  CG    . GLU H  4  220  ? 104.413 72.514  -36.039 1.00 60.40  ? 220  GLU B CG    1 
ATOM   5700  C  CD    . GLU H  4  220  ? 105.676 73.006  -36.748 1.00 58.59  ? 220  GLU B CD    1 
ATOM   5701  O  OE1   . GLU H  4  220  ? 106.749 72.973  -36.113 1.00 58.26  ? 220  GLU B OE1   1 
ATOM   5702  O  OE2   . GLU H  4  220  ? 105.596 73.414  -37.933 1.00 56.03  ? 220  GLU B OE2   1 
ATOM   5703  N  N     . HIS H  4  221  ? 101.409 74.581  -35.056 1.00 62.31  ? 221  HIS B N     1 
ATOM   5704  C  CA    . HIS H  4  221  ? 100.225 74.794  -35.876 1.00 62.12  ? 221  HIS B CA    1 
ATOM   5705  C  C     . HIS H  4  221  ? 99.914  76.296  -36.030 1.00 62.01  ? 221  HIS B C     1 
ATOM   5706  O  O     . HIS H  4  221  ? 99.321  76.710  -37.037 1.00 62.35  ? 221  HIS B O     1 
ATOM   5707  C  CB    . HIS H  4  221  ? 99.014  74.086  -35.255 1.00 61.79  ? 221  HIS B CB    1 
ATOM   5708  C  CG    . HIS H  4  221  ? 98.795  72.692  -35.746 1.00 60.13  ? 221  HIS B CG    1 
ATOM   5709  N  ND1   . HIS H  4  221  ? 99.581  71.633  -35.350 1.00 59.08  ? 221  HIS B ND1   1 
ATOM   5710  C  CD2   . HIS H  4  221  ? 97.888  72.187  -36.615 1.00 59.25  ? 221  HIS B CD2   1 
ATOM   5711  C  CE1   . HIS H  4  221  ? 99.170  70.533  -35.957 1.00 59.14  ? 221  HIS B CE1   1 
ATOM   5712  N  NE2   . HIS H  4  221  ? 98.144  70.843  -36.730 1.00 58.18  ? 221  HIS B NE2   1 
ATOM   5713  N  N     . LEU H  4  222  ? 100.308 77.098  -35.036 1.00 61.81  ? 222  LEU B N     1 
ATOM   5714  C  CA    . LEU H  4  222  ? 100.059 78.540  -35.056 1.00 60.88  ? 222  LEU B CA    1 
ATOM   5715  C  C     . LEU H  4  222  ? 101.004 79.247  -36.002 1.00 61.41  ? 222  LEU B C     1 
ATOM   5716  O  O     . LEU H  4  222  ? 100.784 80.396  -36.377 1.00 61.77  ? 222  LEU B O     1 
ATOM   5717  C  CB    . LEU H  4  222  ? 100.214 79.138  -33.658 1.00 58.00  ? 222  LEU B CB    1 
ATOM   5718  C  CG    . LEU H  4  222  ? 99.205  78.735  -32.580 1.00 55.64  ? 222  LEU B CG    1 
ATOM   5719  C  CD1   . LEU H  4  222  ? 99.414  79.676  -31.429 1.00 55.39  ? 222  LEU B CD1   1 
ATOM   5720  C  CD2   . LEU H  4  222  ? 97.756  78.807  -33.067 1.00 53.00  ? 222  LEU B CD2   1 
ATOM   5721  N  N     . THR H  4  223  ? 102.060 78.554  -36.387 1.00 63.08  ? 223  THR B N     1 
ATOM   5722  C  CA    . THR H  4  223  ? 103.027 79.122  -37.314 1.00 65.07  ? 223  THR B CA    1 
ATOM   5723  C  C     . THR H  4  223  ? 102.600 78.866  -38.769 1.00 66.28  ? 223  THR B C     1 
ATOM   5724  O  O     . THR H  4  223  ? 103.035 79.567  -39.685 1.00 67.23  ? 223  THR B O     1 
ATOM   5725  C  CB    . THR H  4  223  ? 104.460 78.500  -37.086 1.00 64.97  ? 223  THR B CB    1 
ATOM   5726  O  OG1   . THR H  4  223  ? 104.732 78.395  -35.684 1.00 63.15  ? 223  THR B OG1   1 
ATOM   5727  C  CG2   . THR H  4  223  ? 105.548 79.387  -37.701 1.00 65.12  ? 223  THR B CG2   1 
ATOM   5728  N  N     . TYR H  4  224  ? 101.738 77.866  -38.968 1.00 67.08  ? 224  TYR B N     1 
ATOM   5729  C  CA    . TYR H  4  224  ? 101.286 77.479  -40.300 1.00 67.10  ? 224  TYR B CA    1 
ATOM   5730  C  C     . TYR H  4  224  ? 100.427 78.562  -40.957 1.00 67.80  ? 224  TYR B C     1 
ATOM   5731  O  O     . TYR H  4  224  ? 99.999  78.407  -42.097 1.00 67.77  ? 224  TYR B O     1 
ATOM   5732  C  CB    . TYR H  4  224  ? 100.521 76.161  -40.221 1.00 67.53  ? 224  TYR B CB    1 
ATOM   5733  C  CG    . TYR H  4  224  ? 101.395 74.940  -40.032 1.00 68.49  ? 224  TYR B CG    1 
ATOM   5734  C  CD1   . TYR H  4  224  ? 102.503 74.687  -40.886 1.00 69.18  ? 224  TYR B CD1   1 
ATOM   5735  C  CD2   . TYR H  4  224  ? 101.117 74.010  -39.009 1.00 68.77  ? 224  TYR B CD2   1 
ATOM   5736  C  CE1   . TYR H  4  224  ? 103.327 73.503  -40.717 1.00 70.30  ? 224  TYR B CE1   1 
ATOM   5737  C  CE2   . TYR H  4  224  ? 101.921 72.835  -38.823 1.00 69.13  ? 224  TYR B CE2   1 
ATOM   5738  C  CZ    . TYR H  4  224  ? 103.023 72.582  -39.677 1.00 70.05  ? 224  TYR B CZ    1 
ATOM   5739  O  OH    . TYR H  4  224  ? 103.786 71.439  -39.495 1.00 68.18  ? 224  TYR B OH    1 
ATOM   5740  N  N     . PHE H  4  225  ? 100.193 79.658  -40.236 1.00 68.72  ? 225  PHE B N     1 
ATOM   5741  C  CA    . PHE H  4  225  ? 99.416  80.806  -40.724 1.00 68.91  ? 225  PHE B CA    1 
ATOM   5742  C  C     . PHE H  4  225  ? 100.344 81.856  -41.367 1.00 68.78  ? 225  PHE B C     1 
ATOM   5743  O  O     . PHE H  4  225  ? 99.959  83.013  -41.534 1.00 68.72  ? 225  PHE B O     1 
ATOM   5744  C  CB    . PHE H  4  225  ? 98.696  81.496  -39.553 1.00 68.57  ? 225  PHE B CB    1 
ATOM   5745  C  CG    . PHE H  4  225  ? 97.968  80.563  -38.600 1.00 68.21  ? 225  PHE B CG    1 
ATOM   5746  C  CD1   . PHE H  4  225  ? 97.852  80.914  -37.235 1.00 68.18  ? 225  PHE B CD1   1 
ATOM   5747  C  CD2   . PHE H  4  225  ? 97.370  79.358  -39.038 1.00 67.57  ? 225  PHE B CD2   1 
ATOM   5748  C  CE1   . PHE H  4  225  ? 97.146  80.082  -36.308 1.00 68.42  ? 225  PHE B CE1   1 
ATOM   5749  C  CE2   . PHE H  4  225  ? 96.660  78.513  -38.124 1.00 67.55  ? 225  PHE B CE2   1 
ATOM   5750  C  CZ    . PHE H  4  225  ? 96.550  78.879  -36.758 1.00 68.07  ? 225  PHE B CZ    1 
ATOM   5751  N  N     . SER H  4  226  ? 101.550 81.439  -41.740 1.00 69.41  ? 226  SER B N     1 
ATOM   5752  C  CA    . SER H  4  226  ? 102.580 82.358  -42.214 1.00 69.96  ? 226  SER B CA    1 
ATOM   5753  C  C     . SER H  4  226  ? 102.377 82.871  -43.649 1.00 71.09  ? 226  SER B C     1 
ATOM   5754  O  O     . SER H  4  226  ? 102.113 84.064  -43.816 1.00 71.48  ? 226  SER B O     1 
ATOM   5755  C  CB    . SER H  4  226  ? 103.961 81.696  -42.098 1.00 69.65  ? 226  SER B CB    1 
ATOM   5756  O  OG    . SER H  4  226  ? 104.026 80.480  -42.820 1.00 69.30  ? 226  SER B OG    1 
ATOM   5757  N  N     . ASN H  4  227  ? 102.496 82.016  -44.669 1.00 71.67  ? 227  ASN B N     1 
ATOM   5758  C  CA    . ASN H  4  227  ? 102.488 82.485  -46.075 1.00 72.71  ? 227  ASN B CA    1 
ATOM   5759  C  C     . ASN H  4  227  ? 101.089 82.544  -46.713 1.00 72.61  ? 227  ASN B C     1 
ATOM   5760  O  O     . ASN H  4  227  ? 100.480 81.505  -46.977 1.00 72.40  ? 227  ASN B O     1 
ATOM   5761  C  CB    . ASN H  4  227  ? 103.415 81.581  -46.892 1.00 73.44  ? 227  ASN B CB    1 
ATOM   5762  C  CG    . ASN H  4  227  ? 104.832 81.561  -46.331 1.00 73.22  ? 227  ASN B CG    1 
ATOM   5763  O  OD1   . ASN H  4  227  ? 105.694 82.326  -46.769 1.00 73.86  ? 227  ASN B OD1   1 
ATOM   5764  N  ND2   . ASN H  4  227  ? 105.075 80.689  -45.348 1.00 72.98  ? 227  ASN B ND2   1 
ATOM   5765  N  N     . PRO H  4  228  ? 100.586 83.778  -46.998 1.00 72.58  ? 228  PRO B N     1 
ATOM   5766  C  CA    . PRO H  4  228  ? 99.265  83.940  -47.608 1.00 72.75  ? 228  PRO B CA    1 
ATOM   5767  C  C     . PRO H  4  228  ? 99.262  83.443  -49.059 1.00 72.89  ? 228  PRO B C     1 
ATOM   5768  O  O     . PRO H  4  228  ? 100.335 83.284  -49.650 1.00 72.71  ? 228  PRO B O     1 
ATOM   5769  C  CB    . PRO H  4  228  ? 98.986  85.448  -47.481 1.00 72.73  ? 228  PRO B CB    1 
ATOM   5770  C  CG    . PRO H  4  228  ? 100.168 86.025  -46.677 1.00 71.90  ? 228  PRO B CG    1 
ATOM   5771  C  CD    . PRO H  4  228  ? 101.284 85.078  -46.988 1.00 72.32  ? 228  PRO B CD    1 
ATOM   5772  N  N     . GLN H  4  229  ? 98.075  83.203  -49.626 1.00 73.22  ? 229  GLN B N     1 
ATOM   5773  C  CA    . GLN H  4  229  ? 97.961  82.715  -51.001 1.00 72.28  ? 229  GLN B CA    1 
ATOM   5774  C  C     . GLN H  4  229  ? 96.548  82.916  -51.550 1.00 73.08  ? 229  GLN B C     1 
ATOM   5775  O  O     . GLN H  4  229  ? 95.831  83.823  -51.073 1.00 73.33  ? 229  GLN B O     1 
ATOM   5776  C  CB    . GLN H  4  229  ? 98.328  81.214  -51.077 1.00 72.01  ? 229  GLN B CB    1 
ATOM   5777  C  CG    . GLN H  4  229  ? 99.827  80.848  -51.021 1.00 70.43  ? 229  GLN B CG    1 
ATOM   5778  C  CD    . GLN H  4  229  ? 100.085 79.371  -50.716 1.00 68.91  ? 229  GLN B CD    1 
ATOM   5779  O  OE1   . GLN H  4  229  ? 99.910  78.503  -51.571 1.00 68.84  ? 229  GLN B OE1   1 
ATOM   5780  N  NE2   . GLN H  4  229  ? 100.501 79.089  -49.488 1.00 68.28  ? 229  GLN B NE2   1 
ATOM   5781  N  N     . MET I  5  1    ? 60.928  96.983  -42.893 1.00 58.84  ? 1    MET C N     1 
ATOM   5782  C  CA    . MET I  5  1    ? 60.238  95.801  -42.296 1.00 59.39  ? 1    MET C CA    1 
ATOM   5783  C  C     . MET I  5  1    ? 58.808  95.654  -42.799 1.00 58.61  ? 1    MET C C     1 
ATOM   5784  O  O     . MET I  5  1    ? 58.097  96.647  -42.962 1.00 58.31  ? 1    MET C O     1 
ATOM   5785  C  CB    . MET I  5  1    ? 60.215  95.927  -40.777 1.00 61.50  ? 1    MET C CB    1 
ATOM   5786  C  CG    . MET I  5  1    ? 61.614  95.988  -40.186 1.00 62.42  ? 1    MET C CG    1 
ATOM   5787  S  SD    . MET I  5  1    ? 61.578  95.770  -38.410 1.00 62.91  ? 1    MET C SD    1 
ATOM   5788  C  CE    . MET I  5  1    ? 61.857  97.494  -37.841 1.00 63.13  ? 1    MET C CE    1 
ATOM   5789  N  N     . GLU I  5  2    ? 58.402  94.404  -43.033 1.00 56.82  ? 2    GLU C N     1 
ATOM   5790  C  CA    . GLU I  5  2    ? 57.061  94.070  -43.515 1.00 54.07  ? 2    GLU C CA    1 
ATOM   5791  C  C     . GLU I  5  2    ? 56.251  93.353  -42.439 1.00 51.70  ? 2    GLU C C     1 
ATOM   5792  O  O     . GLU I  5  2    ? 56.801  92.777  -41.506 1.00 51.39  ? 2    GLU C O     1 
ATOM   5793  C  CB    . GLU I  5  2    ? 57.142  93.177  -44.770 1.00 54.23  ? 2    GLU C CB    1 
ATOM   5794  C  CG    . GLU I  5  2    ? 57.258  93.952  -46.093 1.00 53.41  ? 2    GLU C CG    1 
ATOM   5795  C  CD    . GLU I  5  2    ? 57.338  93.037  -47.310 1.00 52.98  ? 2    GLU C CD    1 
ATOM   5796  O  OE1   . GLU I  5  2    ? 56.718  91.950  -47.278 1.00 52.08  ? 2    GLU C OE1   1 
ATOM   5797  O  OE2   . GLU I  5  2    ? 58.014  93.409  -48.298 1.00 53.44  ? 2    GLU C OE2   1 
ATOM   5798  N  N     . ILE I  5  3    ? 54.936  93.393  -42.582 1.00 49.71  ? 3    ILE C N     1 
ATOM   5799  C  CA    . ILE I  5  3    ? 54.068  92.772  -41.615 1.00 47.63  ? 3    ILE C CA    1 
ATOM   5800  C  C     . ILE I  5  3    ? 53.024  91.929  -42.283 1.00 47.26  ? 3    ILE C C     1 
ATOM   5801  O  O     . ILE I  5  3    ? 52.360  92.392  -43.205 1.00 47.82  ? 3    ILE C O     1 
ATOM   5802  C  CB    . ILE I  5  3    ? 53.381  93.839  -40.776 1.00 47.77  ? 3    ILE C CB    1 
ATOM   5803  C  CG1   . ILE I  5  3    ? 54.443  94.571  -39.964 1.00 47.27  ? 3    ILE C CG1   1 
ATOM   5804  C  CG2   . ILE I  5  3    ? 52.330  93.208  -39.856 1.00 47.68  ? 3    ILE C CG2   1 
ATOM   5805  C  CD1   . ILE I  5  3    ? 55.182  93.701  -39.007 1.00 46.92  ? 3    ILE C CD1   1 
ATOM   5806  N  N     . LYS I  5  4    ? 52.877  90.692  -41.817 1.00 45.76  ? 4    LYS C N     1 
ATOM   5807  C  CA    . LYS I  5  4    ? 51.860  89.801  -42.365 1.00 44.85  ? 4    LYS C CA    1 
ATOM   5808  C  C     . LYS I  5  4    ? 50.980  89.203  -41.243 1.00 42.26  ? 4    LYS C C     1 
ATOM   5809  O  O     . LYS I  5  4    ? 51.490  88.550  -40.338 1.00 42.00  ? 4    LYS C O     1 
ATOM   5810  C  CB    . LYS I  5  4    ? 52.518  88.682  -43.171 1.00 46.66  ? 4    LYS C CB    1 
ATOM   5811  C  CG    . LYS I  5  4    ? 51.506  87.970  -44.076 1.00 46.29  ? 4    LYS C CG    1 
ATOM   5812  C  CD    . LYS I  5  4    ? 51.615  86.452  -43.981 1.00 44.91  ? 4    LYS C CD    1 
ATOM   5813  C  CE    . LYS I  5  4    ? 50.535  85.818  -44.816 1.00 44.67  ? 4    LYS C CE    1 
ATOM   5814  N  NZ    . LYS I  5  4    ? 50.525  86.410  -46.187 1.00 44.70  ? 4    LYS C NZ    1 
ATOM   5815  N  N     . ARG I  5  5    ? 49.664  89.438  -41.329 1.00 39.94  ? 5    ARG C N     1 
ATOM   5816  C  CA    . ARG I  5  5    ? 48.649  89.001  -40.341 1.00 35.90  ? 5    ARG C CA    1 
ATOM   5817  C  C     . ARG I  5  5    ? 47.837  87.805  -40.868 1.00 33.65  ? 5    ARG C C     1 
ATOM   5818  O  O     . ARG I  5  5    ? 47.050  87.946  -41.792 1.00 32.31  ? 5    ARG C O     1 
ATOM   5819  C  CB    . ARG I  5  5    ? 47.711  90.173  -40.042 1.00 36.54  ? 5    ARG C CB    1 
ATOM   5820  C  CG    . ARG I  5  5    ? 48.387  91.534  -40.093 1.00 37.55  ? 5    ARG C CG    1 
ATOM   5821  C  CD    . ARG I  5  5    ? 47.443  92.613  -40.605 1.00 38.73  ? 5    ARG C CD    1 
ATOM   5822  N  NE    . ARG I  5  5    ? 46.337  92.870  -39.691 1.00 39.49  ? 5    ARG C NE    1 
ATOM   5823  C  CZ    . ARG I  5  5    ? 46.479  93.450  -38.505 1.00 39.50  ? 5    ARG C CZ    1 
ATOM   5824  N  NH1   . ARG I  5  5    ? 47.684  93.829  -38.106 1.00 39.18  ? 5    ARG C NH1   1 
ATOM   5825  N  NH2   . ARG I  5  5    ? 45.421  93.654  -37.724 1.00 39.61  ? 5    ARG C NH2   1 
ATOM   5826  N  N     . PHE I  5  6    ? 48.026  86.651  -40.235 1.00 31.78  ? 6    PHE C N     1 
ATOM   5827  C  CA    . PHE I  5  6    ? 47.488  85.328  -40.618 1.00 29.57  ? 6    PHE C CA    1 
ATOM   5828  C  C     . PHE I  5  6    ? 45.954  85.167  -40.485 1.00 29.62  ? 6    PHE C C     1 
ATOM   5829  O  O     . PHE I  5  6    ? 45.264  85.052  -41.479 1.00 27.99  ? 6    PHE C O     1 
ATOM   5830  C  CB    . PHE I  5  6    ? 48.103  84.230  -39.760 1.00 27.71  ? 6    PHE C CB    1 
ATOM   5831  C  CG    . PHE I  5  6    ? 49.565  84.356  -39.540 1.00 23.63  ? 6    PHE C CG    1 
ATOM   5832  C  CD1   . PHE I  5  6    ? 50.067  85.320  -38.656 1.00 19.73  ? 6    PHE C CD1   1 
ATOM   5833  C  CD2   . PHE I  5  6    ? 50.458  83.491  -40.202 1.00 23.11  ? 6    PHE C CD2   1 
ATOM   5834  C  CE1   . PHE I  5  6    ? 51.428  85.427  -38.429 1.00 20.62  ? 6    PHE C CE1   1 
ATOM   5835  C  CE2   . PHE I  5  6    ? 51.838  83.579  -39.990 1.00 21.49  ? 6    PHE C CE2   1 
ATOM   5836  C  CZ    . PHE I  5  6    ? 52.326  84.554  -39.097 1.00 21.79  ? 6    PHE C CZ    1 
ATOM   5837  N  N     . GLY I  5  7    ? 45.447  85.113  -39.257 1.00 31.71  ? 7    GLY C N     1 
ATOM   5838  C  CA    . GLY I  5  7    ? 44.039  84.810  -39.000 1.00 34.97  ? 7    GLY C CA    1 
ATOM   5839  C  C     . GLY I  5  7    ? 42.974  85.661  -39.658 1.00 36.57  ? 7    GLY C C     1 
ATOM   5840  O  O     . GLY I  5  7    ? 43.112  86.889  -39.699 1.00 36.24  ? 7    GLY C O     1 
ATOM   5841  N  N     . ARG I  5  8    ? 41.895  85.024  -40.148 1.00 38.12  ? 8    ARG C N     1 
ATOM   5842  C  CA    . ARG I  5  8    ? 40.841  85.819  -40.776 1.00 42.13  ? 8    ARG C CA    1 
ATOM   5843  C  C     . ARG I  5  8    ? 39.410  85.462  -40.346 1.00 41.67  ? 8    ARG C C     1 
ATOM   5844  O  O     . ARG I  5  8    ? 38.741  84.531  -40.814 1.00 40.49  ? 8    ARG C O     1 
ATOM   5845  C  CB    . ARG I  5  8    ? 40.932  85.778  -42.307 1.00 44.53  ? 8    ARG C CB    1 
ATOM   5846  C  CG    . ARG I  5  8    ? 41.801  86.957  -42.854 1.00 45.29  ? 8    ARG C CG    1 
ATOM   5847  C  CD    . ARG I  5  8    ? 41.533  88.340  -42.130 1.00 45.72  ? 8    ARG C CD    1 
ATOM   5848  N  NE    . ARG I  5  8    ? 42.778  89.025  -41.737 1.00 45.89  ? 8    ARG C NE    1 
ATOM   5849  C  CZ    . ARG I  5  8    ? 42.847  90.192  -41.101 1.00 43.94  ? 8    ARG C CZ    1 
ATOM   5850  N  NH1   . ARG I  5  8    ? 41.739  90.829  -40.768 1.00 44.28  ? 8    ARG C NH1   1 
ATOM   5851  N  NH2   . ARG I  5  8    ? 44.026  90.726  -40.804 1.00 43.91  ? 8    ARG C NH2   1 
ATOM   5852  N  N     . ILE I  5  9    ? 39.001  86.318  -39.431 1.00 42.39  ? 9    ILE C N     1 
ATOM   5853  C  CA    . ILE I  5  9    ? 37.680  86.497  -38.875 1.00 43.68  ? 9    ILE C CA    1 
ATOM   5854  C  C     . ILE I  5  9    ? 37.367  87.963  -39.020 1.00 45.07  ? 9    ILE C C     1 
ATOM   5855  O  O     . ILE I  5  9    ? 38.004  88.788  -38.372 1.00 44.65  ? 9    ILE C O     1 
ATOM   5856  C  CB    . ILE I  5  9    ? 37.573  86.142  -37.363 1.00 43.19  ? 9    ILE C CB    1 
ATOM   5857  C  CG1   . ILE I  5  9    ? 38.965  86.053  -36.753 1.00 42.84  ? 9    ILE C CG1   1 
ATOM   5858  C  CG2   . ILE I  5  9    ? 36.721  84.881  -37.198 1.00 44.18  ? 9    ILE C CG2   1 
ATOM   5859  C  CD1   . ILE I  5  9    ? 38.966  85.775  -35.277 1.00 42.57  ? 9    ILE C CD1   1 
ATOM   5860  N  N     . ARG I  5  10   ? 36.429  88.301  -39.883 1.00 46.17  ? 10   ARG C N     1 
ATOM   5861  C  CA    . ARG I  5  10   ? 36.196  89.694  -40.158 1.00 47.86  ? 10   ARG C CA    1 
ATOM   5862  C  C     . ARG I  5  10   ? 35.807  90.473  -38.932 1.00 47.52  ? 10   ARG C C     1 
ATOM   5863  O  O     . ARG I  5  10   ? 34.649  90.461  -38.511 1.00 48.08  ? 10   ARG C O     1 
ATOM   5864  C  CB    . ARG I  5  10   ? 35.142  89.829  -41.257 1.00 50.79  ? 10   ARG C CB    1 
ATOM   5865  C  CG    . ARG I  5  10   ? 35.699  89.468  -42.680 1.00 54.05  ? 10   ARG C CG    1 
ATOM   5866  C  CD    . ARG I  5  10   ? 36.900  90.356  -43.123 1.00 55.57  ? 10   ARG C CD    1 
ATOM   5867  N  NE    . ARG I  5  10   ? 37.877  89.644  -43.957 1.00 57.64  ? 10   ARG C NE    1 
ATOM   5868  C  CZ    . ARG I  5  10   ? 39.086  90.115  -44.277 1.00 58.65  ? 10   ARG C CZ    1 
ATOM   5869  N  NH1   . ARG I  5  10   ? 39.473  91.310  -43.835 1.00 59.42  ? 10   ARG C NH1   1 
ATOM   5870  N  NH2   . ARG I  5  10   ? 39.913  89.391  -45.035 1.00 57.61  ? 10   ARG C NH2   1 
ATOM   5871  N  N     . GLU I  5  11   ? 36.804  91.153  -38.356 1.00 46.49  ? 11   GLU C N     1 
ATOM   5872  C  CA    . GLU I  5  11   ? 36.549  92.007  -37.208 1.00 46.87  ? 11   GLU C CA    1 
ATOM   5873  C  C     . GLU I  5  11   ? 35.555  93.047  -37.605 1.00 46.74  ? 11   GLU C C     1 
ATOM   5874  O  O     . GLU I  5  11   ? 35.900  94.045  -38.229 1.00 47.40  ? 11   GLU C O     1 
ATOM   5875  C  CB    . GLU I  5  11   ? 37.831  92.685  -36.737 1.00 46.82  ? 11   GLU C CB    1 
ATOM   5876  C  CG    . GLU I  5  11   ? 37.662  93.483  -35.456 1.00 47.04  ? 11   GLU C CG    1 
ATOM   5877  C  CD    . GLU I  5  11   ? 38.924  94.230  -35.067 1.00 47.87  ? 11   GLU C CD    1 
ATOM   5878  O  OE1   . GLU I  5  11   ? 39.323  95.149  -35.809 1.00 47.30  ? 11   GLU C OE1   1 
ATOM   5879  O  OE2   . GLU I  5  11   ? 39.520  93.901  -34.019 1.00 49.88  ? 11   GLU C OE2   1 
ATOM   5880  N  N     . VAL I  5  12   ? 34.305  92.796  -37.243 1.00 46.64  ? 12   VAL C N     1 
ATOM   5881  C  CA    . VAL I  5  12   ? 33.212  93.627  -37.680 1.00 45.19  ? 12   VAL C CA    1 
ATOM   5882  C  C     . VAL I  5  12   ? 33.216  94.996  -37.048 1.00 44.61  ? 12   VAL C C     1 
ATOM   5883  O  O     . VAL I  5  12   ? 32.845  95.940  -37.725 1.00 45.32  ? 12   VAL C O     1 
ATOM   5884  C  CB    . VAL I  5  12   ? 31.869  92.933  -37.430 1.00 45.19  ? 12   VAL C CB    1 
ATOM   5885  C  CG1   . VAL I  5  12   ? 31.463  93.005  -35.976 1.00 45.81  ? 12   VAL C CG1   1 
ATOM   5886  C  CG2   . VAL I  5  12   ? 30.840  93.593  -38.322 1.00 45.59  ? 12   VAL C CG2   1 
ATOM   5887  N  N     . ILE I  5  13   ? 33.606  95.146  -35.789 1.00 44.99  ? 13   ILE C N     1 
ATOM   5888  C  CA    . ILE I  5  13   ? 33.603  96.494  -35.215 1.00 46.33  ? 13   ILE C CA    1 
ATOM   5889  C  C     . ILE I  5  13   ? 34.875  96.780  -34.433 1.00 46.18  ? 13   ILE C C     1 
ATOM   5890  O  O     . ILE I  5  13   ? 35.481  95.881  -33.856 1.00 46.13  ? 13   ILE C O     1 
ATOM   5891  C  CB    . ILE I  5  13   ? 32.388  96.768  -34.254 1.00 45.89  ? 13   ILE C CB    1 
ATOM   5892  C  CG1   . ILE I  5  13   ? 32.340  95.738  -33.129 1.00 45.37  ? 13   ILE C CG1   1 
ATOM   5893  C  CG2   . ILE I  5  13   ? 31.097  96.789  -35.057 1.00 45.12  ? 13   ILE C CG2   1 
ATOM   5894  C  CD1   . ILE I  5  13   ? 31.500  96.201  -31.947 1.00 47.09  ? 13   ILE C CD1   1 
ATOM   5895  N  N     . PRO I  5  14   ? 35.292  98.052  -34.408 1.00 47.09  ? 14   PRO C N     1 
ATOM   5896  C  CA    . PRO I  5  14   ? 36.504  98.421  -33.679 1.00 48.30  ? 14   PRO C CA    1 
ATOM   5897  C  C     . PRO I  5  14   ? 36.346  98.240  -32.172 1.00 48.03  ? 14   PRO C C     1 
ATOM   5898  O  O     . PRO I  5  14   ? 35.229  98.152  -31.672 1.00 48.96  ? 14   PRO C O     1 
ATOM   5899  C  CB    . PRO I  5  14   ? 36.723  99.884  -34.082 1.00 49.14  ? 14   PRO C CB    1 
ATOM   5900  C  CG    . PRO I  5  14   ? 36.129  99.960  -35.456 1.00 48.30  ? 14   PRO C CG    1 
ATOM   5901  C  CD    . PRO I  5  14   ? 34.842  99.179  -35.249 1.00 47.83  ? 14   PRO C CD    1 
ATOM   5902  N  N     . LEU I  5  15   ? 37.463  98.165  -31.460 1.00 46.37  ? 15   LEU C N     1 
ATOM   5903  C  CA    . LEU I  5  15   ? 37.410  98.093  -30.022 1.00 46.76  ? 15   LEU C CA    1 
ATOM   5904  C  C     . LEU I  5  15   ? 36.919  99.429  -29.485 1.00 46.84  ? 15   LEU C C     1 
ATOM   5905  O  O     . LEU I  5  15   ? 37.413  100.478 -29.891 1.00 47.70  ? 15   LEU C O     1 
ATOM   5906  C  CB    . LEU I  5  15   ? 38.795  97.738  -29.475 1.00 44.56  ? 15   LEU C CB    1 
ATOM   5907  C  CG    . LEU I  5  15   ? 39.272  96.402  -30.063 1.00 41.84  ? 15   LEU C CG    1 
ATOM   5908  C  CD1   . LEU I  5  15   ? 40.015  96.590  -31.365 1.00 42.08  ? 15   LEU C CD1   1 
ATOM   5909  C  CD2   . LEU I  5  15   ? 40.164  95.762  -29.082 1.00 42.23  ? 15   LEU C CD2   1 
ATOM   5910  N  N     . PRO I  5  16   ? 35.933  99.417  -28.575 1.00 46.76  ? 16   PRO C N     1 
ATOM   5911  C  CA    . PRO I  5  16   ? 35.390  100.671 -28.035 1.00 46.78  ? 16   PRO C CA    1 
ATOM   5912  C  C     . PRO I  5  16   ? 36.446  101.562 -27.381 1.00 44.83  ? 16   PRO C C     1 
ATOM   5913  O  O     . PRO I  5  16   ? 37.649  101.261 -27.391 1.00 43.89  ? 16   PRO C O     1 
ATOM   5914  C  CB    . PRO I  5  16   ? 34.323  100.188 -27.040 1.00 46.96  ? 16   PRO C CB    1 
ATOM   5915  C  CG    . PRO I  5  16   ? 33.922  98.829  -27.581 1.00 46.14  ? 16   PRO C CG    1 
ATOM   5916  C  CD    . PRO I  5  16   ? 35.257  98.252  -27.964 1.00 46.46  ? 16   PRO C CD    1 
ATOM   5917  N  N     . PRO I  5  17   ? 35.995  102.712 -26.848 1.00 43.73  ? 17   PRO C N     1 
ATOM   5918  C  CA    . PRO I  5  17   ? 36.938  103.588 -26.157 1.00 44.73  ? 17   PRO C CA    1 
ATOM   5919  C  C     . PRO I  5  17   ? 37.330  102.929 -24.829 1.00 43.29  ? 17   PRO C C     1 
ATOM   5920  O  O     . PRO I  5  17   ? 36.506  102.855 -23.930 1.00 43.28  ? 17   PRO C O     1 
ATOM   5921  C  CB    . PRO I  5  17   ? 36.143  104.883 -25.959 1.00 44.99  ? 17   PRO C CB    1 
ATOM   5922  C  CG    . PRO I  5  17   ? 35.166  104.880 -27.069 1.00 44.07  ? 17   PRO C CG    1 
ATOM   5923  C  CD    . PRO I  5  17   ? 34.745  103.441 -27.147 1.00 44.06  ? 17   PRO C CD    1 
ATOM   5924  N  N     . LEU I  5  18   ? 38.552  102.443 -24.690 1.00 41.62  ? 18   LEU C N     1 
ATOM   5925  C  CA    . LEU I  5  18   ? 38.882  101.727 -23.478 1.00 40.05  ? 18   LEU C CA    1 
ATOM   5926  C  C     . LEU I  5  18   ? 38.431  102.453 -22.201 1.00 39.97  ? 18   LEU C C     1 
ATOM   5927  O  O     . LEU I  5  18   ? 37.613  101.909 -21.466 1.00 40.45  ? 18   LEU C O     1 
ATOM   5928  C  CB    . LEU I  5  18   ? 40.374  101.426 -23.446 1.00 38.66  ? 18   LEU C CB    1 
ATOM   5929  C  CG    . LEU I  5  18   ? 40.387  99.928  -23.716 1.00 37.99  ? 18   LEU C CG    1 
ATOM   5930  C  CD1   . LEU I  5  18   ? 40.320  99.694  -25.205 1.00 39.22  ? 18   LEU C CD1   1 
ATOM   5931  C  CD2   . LEU I  5  18   ? 41.621  99.310  -23.163 1.00 39.02  ? 18   LEU C CD2   1 
ATOM   5932  N  N     . THR I  5  19   ? 38.909  103.659 -21.935 1.00 39.79  ? 19   THR C N     1 
ATOM   5933  C  CA    . THR I  5  19   ? 38.577  104.349 -20.681 1.00 39.85  ? 19   THR C CA    1 
ATOM   5934  C  C     . THR I  5  19   ? 37.103  104.763 -20.589 1.00 39.62  ? 19   THR C C     1 
ATOM   5935  O  O     . THR I  5  19   ? 36.711  105.434 -19.616 1.00 38.61  ? 19   THR C O     1 
ATOM   5936  C  CB    . THR I  5  19   ? 39.453  105.597 -20.503 1.00 41.04  ? 19   THR C CB    1 
ATOM   5937  O  OG1   . THR I  5  19   ? 39.961  106.027 -21.779 1.00 40.93  ? 19   THR C OG1   1 
ATOM   5938  C  CG2   . THR I  5  19   ? 40.598  105.284 -19.567 1.00 43.13  ? 19   THR C CG2   1 
ATOM   5939  N  N     . GLU I  5  20   ? 36.304  104.365 -21.574 1.00 38.46  ? 20   GLU C N     1 
ATOM   5940  C  CA    . GLU I  5  20   ? 34.874  104.692 -21.649 1.00 38.14  ? 20   GLU C CA    1 
ATOM   5941  C  C     . GLU I  5  20   ? 34.219  104.699 -20.282 1.00 37.56  ? 20   GLU C C     1 
ATOM   5942  O  O     . GLU I  5  20   ? 33.678  105.720 -19.847 1.00 39.31  ? 20   GLU C O     1 
ATOM   5943  C  CB    . GLU I  5  20   ? 34.188  103.679 -22.550 1.00 38.01  ? 20   GLU C CB    1 
ATOM   5944  C  CG    . GLU I  5  20   ? 32.743  103.410 -22.326 1.00 38.07  ? 20   GLU C CG    1 
ATOM   5945  C  CD    . GLU I  5  20   ? 32.391  102.067 -22.873 1.00 36.44  ? 20   GLU C CD    1 
ATOM   5946  O  OE1   . GLU I  5  20   ? 31.817  101.988 -23.976 1.00 37.65  ? 20   GLU C OE1   1 
ATOM   5947  O  OE2   . GLU I  5  20   ? 32.712  101.083 -22.184 1.00 37.17  ? 20   GLU C OE2   1 
ATOM   5948  N  N     . ILE I  5  21   ? 34.272  103.557 -19.620 1.00 35.89  ? 21   ILE C N     1 
ATOM   5949  C  CA    . ILE I  5  21   ? 33.674  103.410 -18.314 1.00 34.24  ? 21   ILE C CA    1 
ATOM   5950  C  C     . ILE I  5  21   ? 33.914  104.615 -17.442 1.00 33.83  ? 21   ILE C C     1 
ATOM   5951  O  O     . ILE I  5  21   ? 32.999  105.338 -17.098 1.00 32.87  ? 21   ILE C O     1 
ATOM   5952  C  CB    . ILE I  5  21   ? 34.225  102.204 -17.558 1.00 34.91  ? 21   ILE C CB    1 
ATOM   5953  C  CG1   . ILE I  5  21   ? 35.407  101.576 -18.301 1.00 34.40  ? 21   ILE C CG1   1 
ATOM   5954  C  CG2   . ILE I  5  21   ? 33.117  101.215 -17.379 1.00 35.76  ? 21   ILE C CG2   1 
ATOM   5955  C  CD1   . ILE I  5  21   ? 36.667  102.378 -18.253 1.00 33.98  ? 21   ILE C CD1   1 
ATOM   5956  N  N     . GLN I  5  22   ? 35.163  104.833 -17.098 1.00 34.49  ? 22   GLN C N     1 
ATOM   5957  C  CA    . GLN I  5  22   ? 35.534  105.894 -16.185 1.00 37.58  ? 22   GLN C CA    1 
ATOM   5958  C  C     . GLN I  5  22   ? 35.208  107.284 -16.721 1.00 39.08  ? 22   GLN C C     1 
ATOM   5959  O  O     . GLN I  5  22   ? 34.721  108.144 -15.968 1.00 39.59  ? 22   GLN C O     1 
ATOM   5960  C  CB    . GLN I  5  22   ? 37.017  105.815 -15.912 1.00 36.09  ? 22   GLN C CB    1 
ATOM   5961  C  CG    . GLN I  5  22   ? 37.421  105.064 -14.703 1.00 33.99  ? 22   GLN C CG    1 
ATOM   5962  C  CD    . GLN I  5  22   ? 38.237  105.954 -13.814 1.00 33.43  ? 22   GLN C CD    1 
ATOM   5963  O  OE1   . GLN I  5  22   ? 39.126  105.496 -13.097 1.00 32.54  ? 22   GLN C OE1   1 
ATOM   5964  N  NE2   . GLN I  5  22   ? 37.936  107.251 -13.853 1.00 31.31  ? 22   GLN C NE2   1 
ATOM   5965  N  N     . VAL I  5  23   ? 35.472  107.515 -17.999 1.00 37.65  ? 23   VAL C N     1 
ATOM   5966  C  CA    . VAL I  5  23   ? 35.289  108.850 -18.544 1.00 38.08  ? 23   VAL C CA    1 
ATOM   5967  C  C     . VAL I  5  23   ? 33.819  109.260 -18.617 1.00 37.22  ? 23   VAL C C     1 
ATOM   5968  O  O     . VAL I  5  23   ? 33.418  110.290 -18.058 1.00 36.63  ? 23   VAL C O     1 
ATOM   5969  C  CB    . VAL I  5  23   ? 35.912  108.942 -19.935 1.00 39.56  ? 23   VAL C CB    1 
ATOM   5970  C  CG1   . VAL I  5  23   ? 35.861  110.408 -20.422 1.00 41.49  ? 23   VAL C CG1   1 
ATOM   5971  C  CG2   . VAL I  5  23   ? 37.350  108.396 -19.884 1.00 37.82  ? 23   VAL C CG2   1 
ATOM   5972  N  N     . GLU I  5  24   ? 33.015  108.475 -19.309 1.00 36.18  ? 24   GLU C N     1 
ATOM   5973  C  CA    . GLU I  5  24   ? 31.625  108.850 -19.441 1.00 35.75  ? 24   GLU C CA    1 
ATOM   5974  C  C     . GLU I  5  24   ? 30.917  108.808 -18.097 1.00 35.45  ? 24   GLU C C     1 
ATOM   5975  O  O     . GLU I  5  24   ? 30.019  109.616 -17.845 1.00 35.22  ? 24   GLU C O     1 
ATOM   5976  C  CB    . GLU I  5  24   ? 30.907  107.927 -20.439 1.00 35.81  ? 24   GLU C CB    1 
ATOM   5977  C  CG    . GLU I  5  24   ? 30.737  108.469 -21.900 1.00 35.19  ? 24   GLU C CG    1 
ATOM   5978  C  CD    . GLU I  5  24   ? 29.814  109.705 -22.076 1.00 32.91  ? 24   GLU C CD    1 
ATOM   5979  O  OE1   . GLU I  5  24   ? 28.701  109.760 -21.504 1.00 31.51  ? 24   GLU C OE1   1 
ATOM   5980  O  OE2   . GLU I  5  24   ? 30.212  110.631 -22.814 1.00 32.74  ? 24   GLU C OE2   1 
ATOM   5981  N  N     . SER I  5  25   ? 31.309  107.881 -17.233 1.00 35.37  ? 25   SER C N     1 
ATOM   5982  C  CA    . SER I  5  25   ? 30.647  107.801 -15.945 1.00 35.81  ? 25   SER C CA    1 
ATOM   5983  C  C     . SER I  5  25   ? 30.713  109.136 -15.215 1.00 33.76  ? 25   SER C C     1 
ATOM   5984  O  O     . SER I  5  25   ? 29.711  109.619 -14.675 1.00 31.40  ? 25   SER C O     1 
ATOM   5985  C  CB    . SER I  5  25   ? 31.292  106.720 -15.092 1.00 37.08  ? 25   SER C CB    1 
ATOM   5986  O  OG    . SER I  5  25   ? 30.380  106.275 -14.109 1.00 41.90  ? 25   SER C OG    1 
ATOM   5987  N  N     . TYR I  5  26   ? 31.899  109.730 -15.212 1.00 32.74  ? 26   TYR C N     1 
ATOM   5988  C  CA    . TYR I  5  26   ? 32.051  111.001 -14.551 1.00 32.50  ? 26   TYR C CA    1 
ATOM   5989  C  C     . TYR I  5  26   ? 31.416  112.112 -15.375 1.00 33.95  ? 26   TYR C C     1 
ATOM   5990  O  O     . TYR I  5  26   ? 31.106  113.196 -14.866 1.00 33.04  ? 26   TYR C O     1 
ATOM   5991  C  CB    . TYR I  5  26   ? 33.541  111.300 -14.284 1.00 31.04  ? 26   TYR C CB    1 
ATOM   5992  C  CG    . TYR I  5  26   ? 33.770  111.972 -12.920 1.00 28.49  ? 26   TYR C CG    1 
ATOM   5993  C  CD1   . TYR I  5  26   ? 33.154  111.451 -11.754 1.00 26.48  ? 26   TYR C CD1   1 
ATOM   5994  C  CD2   . TYR I  5  26   ? 34.556  113.149 -12.786 1.00 25.15  ? 26   TYR C CD2   1 
ATOM   5995  C  CE1   . TYR I  5  26   ? 33.296  112.077 -10.489 1.00 23.85  ? 26   TYR C CE1   1 
ATOM   5996  C  CE2   . TYR I  5  26   ? 34.704  113.786 -11.505 1.00 24.01  ? 26   TYR C CE2   1 
ATOM   5997  C  CZ    . TYR I  5  26   ? 34.055  113.228 -10.366 1.00 22.10  ? 26   TYR C CZ    1 
ATOM   5998  O  OH    . TYR I  5  26   ? 34.099  113.796 -9.124  1.00 17.24  ? 26   TYR C OH    1 
ATOM   5999  N  N     . ARG I  5  27   ? 31.211  111.858 -16.657 1.00 36.97  ? 27   ARG C N     1 
ATOM   6000  C  CA    . ARG I  5  27   ? 30.556  112.880 -17.448 1.00 39.00  ? 27   ARG C CA    1 
ATOM   6001  C  C     . ARG I  5  27   ? 29.093  112.996 -17.036 1.00 39.37  ? 27   ARG C C     1 
ATOM   6002  O  O     . ARG I  5  27   ? 28.633  114.075 -16.656 1.00 38.54  ? 27   ARG C O     1 
ATOM   6003  C  CB    . ARG I  5  27   ? 30.658  112.550 -18.944 1.00 40.53  ? 27   ARG C CB    1 
ATOM   6004  C  CG    . ARG I  5  27   ? 31.603  113.488 -19.722 1.00 41.24  ? 27   ARG C CG    1 
ATOM   6005  C  CD    . ARG I  5  27   ? 30.914  114.158 -20.937 1.00 41.66  ? 27   ARG C CD    1 
ATOM   6006  N  NE    . ARG I  5  27   ? 29.916  115.153 -20.536 1.00 41.00  ? 27   ARG C NE    1 
ATOM   6007  C  CZ    . ARG I  5  27   ? 28.983  115.668 -21.337 1.00 40.44  ? 27   ARG C CZ    1 
ATOM   6008  N  NH1   . ARG I  5  27   ? 28.897  115.294 -22.609 1.00 39.91  ? 27   ARG C NH1   1 
ATOM   6009  N  NH2   . ARG I  5  27   ? 28.127  116.559 -20.855 1.00 39.78  ? 27   ARG C NH2   1 
ATOM   6010  N  N     . ARG I  5  28   ? 28.379  111.868 -17.099 1.00 39.67  ? 28   ARG C N     1 
ATOM   6011  C  CA    . ARG I  5  28   ? 26.977  111.824 -16.721 1.00 39.44  ? 28   ARG C CA    1 
ATOM   6012  C  C     . ARG I  5  28   ? 26.805  112.153 -15.251 1.00 41.50  ? 28   ARG C C     1 
ATOM   6013  O  O     . ARG I  5  28   ? 25.824  112.788 -14.864 1.00 42.18  ? 28   ARG C O     1 
ATOM   6014  C  CB    . ARG I  5  28   ? 26.405  110.446 -17.015 1.00 37.03  ? 28   ARG C CB    1 
ATOM   6015  C  CG    . ARG I  5  28   ? 24.916  110.358 -16.822 1.00 33.63  ? 28   ARG C CG    1 
ATOM   6016  C  CD    . ARG I  5  28   ? 24.375  109.118 -17.446 1.00 30.29  ? 28   ARG C CD    1 
ATOM   6017  N  NE    . ARG I  5  28   ? 24.827  109.003 -18.820 1.00 30.19  ? 28   ARG C NE    1 
ATOM   6018  C  CZ    . ARG I  5  28   ? 24.353  108.110 -19.676 1.00 31.28  ? 28   ARG C CZ    1 
ATOM   6019  N  NH1   . ARG I  5  28   ? 23.412  107.265 -19.289 1.00 33.03  ? 28   ARG C NH1   1 
ATOM   6020  N  NH2   . ARG I  5  28   ? 24.820  108.058 -20.914 1.00 32.41  ? 28   ARG C NH2   1 
ATOM   6021  N  N     . ALA I  5  29   ? 27.761  111.715 -14.435 1.00 44.17  ? 29   ALA C N     1 
ATOM   6022  C  CA    . ALA I  5  29   ? 27.739  112.028 -13.004 1.00 47.45  ? 29   ALA C CA    1 
ATOM   6023  C  C     . ALA I  5  29   ? 27.631  113.549 -12.802 1.00 47.66  ? 29   ALA C C     1 
ATOM   6024  O  O     . ALA I  5  29   ? 26.644  114.056 -12.269 1.00 47.15  ? 29   ALA C O     1 
ATOM   6025  C  CB    . ALA I  5  29   ? 29.018  111.484 -12.331 1.00 49.35  ? 29   ALA C CB    1 
ATOM   6026  N  N     . LEU I  5  30   ? 28.658  114.267 -13.229 1.00 49.06  ? 30   LEU C N     1 
ATOM   6027  C  CA    . LEU I  5  30   ? 28.607  115.708 -13.194 1.00 51.15  ? 30   LEU C CA    1 
ATOM   6028  C  C     . LEU I  5  30   ? 28.440  116.246 -14.613 1.00 52.45  ? 30   LEU C C     1 
ATOM   6029  O  O     . LEU I  5  30   ? 29.385  116.329 -15.395 1.00 53.02  ? 30   LEU C O     1 
ATOM   6030  C  CB    . LEU I  5  30   ? 29.864  116.278 -12.522 1.00 51.51  ? 30   LEU C CB    1 
ATOM   6031  C  CG    . LEU I  5  30   ? 31.242  115.622 -12.561 1.00 53.47  ? 30   LEU C CG    1 
ATOM   6032  C  CD1   . LEU I  5  30   ? 31.991  115.994 -13.841 1.00 53.89  ? 30   LEU C CD1   1 
ATOM   6033  C  CD2   . LEU I  5  30   ? 32.031  116.115 -11.336 1.00 54.01  ? 30   LEU C CD2   1 
ATOM   6034  N  N     . GLN I  5  31   ? 27.195  116.585 -14.926 1.00 52.02  ? 31   GLN C N     1 
ATOM   6035  C  CA    . GLN I  5  31   ? 26.761  117.074 -16.233 1.00 52.47  ? 31   GLN C CA    1 
ATOM   6036  C  C     . GLN I  5  31   ? 27.220  118.530 -16.491 1.00 52.51  ? 31   GLN C C     1 
ATOM   6037  O  O     . GLN I  5  31   ? 26.747  119.182 -17.408 1.00 52.61  ? 31   GLN C O     1 
ATOM   6038  C  CB    . GLN I  5  31   ? 25.227  116.943 -16.252 1.00 52.53  ? 31   GLN C CB    1 
ATOM   6039  C  CG    . GLN I  5  31   ? 24.500  117.106 -17.586 1.00 54.14  ? 31   GLN C CG    1 
ATOM   6040  C  CD    . GLN I  5  31   ? 23.807  118.474 -17.763 1.00 55.06  ? 31   GLN C CD    1 
ATOM   6041  O  OE1   . GLN I  5  31   ? 22.936  118.652 -18.633 1.00 53.84  ? 31   GLN C OE1   1 
ATOM   6042  N  NE2   . GLN I  5  31   ? 24.197  119.439 -16.943 1.00 56.76  ? 31   GLN C NE2   1 
ATOM   6043  N  N     . ALA I  5  32   ? 28.164  119.012 -15.692 1.00 52.59  ? 32   ALA C N     1 
ATOM   6044  C  CA    . ALA I  5  32   ? 28.672  120.389 -15.715 1.00 53.47  ? 32   ALA C CA    1 
ATOM   6045  C  C     . ALA I  5  32   ? 29.014  120.918 -17.113 1.00 54.13  ? 32   ALA C C     1 
ATOM   6046  O  O     . ALA I  5  32   ? 28.805  122.108 -17.362 1.00 54.76  ? 32   ALA C O     1 
ATOM   6047  C  CB    . ALA I  5  32   ? 29.902  120.490 -14.844 1.00 54.24  ? 32   ALA C CB    1 
ATOM   6048  N  N     . ASP I  5  33   ? 29.531  120.103 -18.024 1.00 54.64  ? 33   ASP C N     1 
ATOM   6049  C  CA    . ASP I  5  33   ? 29.932  120.652 -19.328 1.00 55.04  ? 33   ASP C CA    1 
ATOM   6050  C  C     . ASP I  5  33   ? 28.759  121.306 -20.071 1.00 55.60  ? 33   ASP C C     1 
ATOM   6051  O  O     . ASP I  5  33   ? 28.955  122.234 -20.849 1.00 55.63  ? 33   ASP C O     1 
ATOM   6052  C  CB    . ASP I  5  33   ? 30.548  119.547 -20.192 1.00 54.95  ? 33   ASP C CB    1 
ATOM   6053  C  CG    . ASP I  5  33   ? 31.430  120.091 -21.300 1.00 54.70  ? 33   ASP C CG    1 
ATOM   6054  O  OD1   . ASP I  5  33   ? 32.372  120.852 -20.982 1.00 53.45  ? 33   ASP C OD1   1 
ATOM   6055  O  OD2   . ASP I  5  33   ? 31.175  119.748 -22.481 1.00 54.15  ? 33   ASP C OD2   1 
ATOM   6056  N  N     . VAL I  5  34   ? 27.547  120.836 -19.827 1.00 56.72  ? 34   VAL C N     1 
ATOM   6057  C  CA    . VAL I  5  34   ? 26.377  121.379 -20.517 1.00 57.20  ? 34   VAL C CA    1 
ATOM   6058  C  C     . VAL I  5  34   ? 25.472  122.176 -19.567 1.00 59.41  ? 34   VAL C C     1 
ATOM   6059  O  O     . VAL I  5  34   ? 25.265  121.770 -18.423 1.00 59.62  ? 34   VAL C O     1 
ATOM   6060  C  CB    . VAL I  5  34   ? 25.536  120.253 -21.162 1.00 58.97  ? 34   VAL C CB    1 
ATOM   6061  C  CG1   . VAL I  5  34   ? 25.630  120.369 -22.688 1.00 59.39  ? 34   VAL C CG1   1 
ATOM   6062  C  CG2   . VAL I  5  34   ? 26.044  118.885 -20.710 1.00 59.33  ? 34   VAL C CG2   1 
ATOM   6063  N  N     . PRO I  5  35   ? 24.929  123.324 -20.029 1.00 59.80  ? 35   PRO C N     1 
ATOM   6064  C  CA    . PRO I  5  35   ? 24.051  124.156 -19.205 1.00 57.05  ? 35   PRO C CA    1 
ATOM   6065  C  C     . PRO I  5  35   ? 23.004  123.335 -18.462 1.00 59.63  ? 35   PRO C C     1 
ATOM   6066  O  O     . PRO I  5  35   ? 22.726  122.191 -18.835 1.00 59.07  ? 35   PRO C O     1 
ATOM   6067  C  CB    . PRO I  5  35   ? 23.458  125.118 -20.205 1.00 58.62  ? 35   PRO C CB    1 
ATOM   6068  C  CG    . PRO I  5  35   ? 24.648  125.410 -21.069 1.00 58.25  ? 35   PRO C CG    1 
ATOM   6069  C  CD    . PRO I  5  35   ? 25.312  124.053 -21.260 1.00 57.80  ? 35   PRO C CD    1 
ATOM   6070  N  N     . PRO I  5  36   ? 22.410  123.913 -17.399 1.00 61.78  ? 36   PRO C N     1 
ATOM   6071  C  CA    . PRO I  5  36   ? 21.384  123.221 -16.595 1.00 60.37  ? 36   PRO C CA    1 
ATOM   6072  C  C     . PRO I  5  36   ? 20.176  122.842 -17.434 1.00 61.60  ? 36   PRO C C     1 
ATOM   6073  O  O     . PRO I  5  36   ? 19.361  121.993 -17.059 1.00 61.26  ? 36   PRO C O     1 
ATOM   6074  C  CB    . PRO I  5  36   ? 21.056  124.223 -15.496 1.00 61.93  ? 36   PRO C CB    1 
ATOM   6075  C  CG    . PRO I  5  36   ? 22.321  125.066 -15.411 1.00 61.63  ? 36   PRO C CG    1 
ATOM   6076  C  CD    . PRO I  5  36   ? 22.686  125.253 -16.849 1.00 60.21  ? 36   PRO C CD    1 
ATOM   6077  N  N     . GLU I  5  37   ? 20.075  123.497 -18.581 1.00 62.82  ? 37   GLU C N     1 
ATOM   6078  C  CA    . GLU I  5  37   ? 19.007  123.233 -19.509 1.00 61.91  ? 37   GLU C CA    1 
ATOM   6079  C  C     . GLU I  5  37   ? 19.036  121.783 -19.956 1.00 61.86  ? 37   GLU C C     1 
ATOM   6080  O  O     . GLU I  5  37   ? 18.013  121.108 -19.880 1.00 61.75  ? 37   GLU C O     1 
ATOM   6081  C  CB    . GLU I  5  37   ? 19.139  124.155 -20.718 1.00 63.64  ? 37   GLU C CB    1 
ATOM   6082  C  CG    . GLU I  5  37   ? 18.392  125.471 -20.586 1.00 64.96  ? 37   GLU C CG    1 
ATOM   6083  C  CD    . GLU I  5  37   ? 18.276  126.199 -21.924 1.00 66.34  ? 37   GLU C CD    1 
ATOM   6084  O  OE1   . GLU I  5  37   ? 17.192  126.754 -22.217 1.00 65.62  ? 37   GLU C OE1   1 
ATOM   6085  O  OE2   . GLU I  5  37   ? 19.269  126.217 -22.685 1.00 67.38  ? 37   GLU C OE2   1 
ATOM   6086  N  N     . LYS I  5  38   ? 20.207  121.306 -20.401 1.00 62.83  ? 38   LYS C N     1 
ATOM   6087  C  CA    . LYS I  5  38   ? 20.350  119.925 -20.884 1.00 62.18  ? 38   LYS C CA    1 
ATOM   6088  C  C     . LYS I  5  38   ? 19.822  118.919 -19.871 1.00 60.39  ? 38   LYS C C     1 
ATOM   6089  O  O     . LYS I  5  38   ? 20.204  118.886 -18.709 1.00 59.02  ? 38   LYS C O     1 
ATOM   6090  C  CB    . LYS I  5  38   ? 21.813  119.622 -21.259 1.00 62.69  ? 38   LYS C CB    1 
ATOM   6091  C  CG    . LYS I  5  38   ? 22.158  120.052 -22.698 1.00 63.99  ? 38   LYS C CG    1 
ATOM   6092  C  CD    . LYS I  5  38   ? 21.170  119.472 -23.752 1.00 65.00  ? 38   LYS C CD    1 
ATOM   6093  C  CE    . LYS I  5  38   ? 21.302  120.114 -25.140 1.00 64.61  ? 38   LYS C CE    1 
ATOM   6094  N  NZ    . LYS I  5  38   ? 20.299  119.546 -26.097 1.00 64.87  ? 38   LYS C NZ    1 
ATOM   6095  N  N     . ARG I  5  39   ? 18.917  118.111 -20.403 1.00 59.51  ? 39   ARG C N     1 
ATOM   6096  C  CA    . ARG I  5  39   ? 18.092  117.094 -19.761 1.00 59.41  ? 39   ARG C CA    1 
ATOM   6097  C  C     . ARG I  5  39   ? 18.845  116.103 -18.844 1.00 58.54  ? 39   ARG C C     1 
ATOM   6098  O  O     . ARG I  5  39   ? 18.385  115.945 -17.720 1.00 57.63  ? 39   ARG C O     1 
ATOM   6099  C  CB    . ARG I  5  39   ? 17.330  116.347 -20.853 1.00 61.93  ? 39   ARG C CB    1 
ATOM   6100  C  CG    . ARG I  5  39   ? 16.153  117.159 -21.368 1.00 64.21  ? 39   ARG C CG    1 
ATOM   6101  C  CD    . ARG I  5  39   ? 16.320  117.696 -22.788 1.00 65.13  ? 39   ARG C CD    1 
ATOM   6102  N  NE    . ARG I  5  39   ? 15.059  118.276 -23.249 1.00 65.48  ? 39   ARG C NE    1 
ATOM   6103  C  CZ    . ARG I  5  39   ? 14.868  118.866 -24.428 1.00 66.56  ? 39   ARG C CZ    1 
ATOM   6104  N  NH1   . ARG I  5  39   ? 15.859  118.971 -25.305 1.00 67.16  ? 39   ARG C NH1   1 
ATOM   6105  N  NH2   . ARG I  5  39   ? 13.674  119.356 -24.731 1.00 66.65  ? 39   ARG C NH2   1 
ATOM   6106  N  N     . GLU I  5  40   ? 19.928  115.429 -19.272 1.00 56.47  ? 40   GLU C N     1 
ATOM   6107  C  CA    . GLU I  5  40   ? 20.620  114.428 -18.415 1.00 53.55  ? 40   GLU C CA    1 
ATOM   6108  C  C     . GLU I  5  40   ? 20.791  114.946 -16.993 1.00 52.27  ? 40   GLU C C     1 
ATOM   6109  O  O     . GLU I  5  40   ? 21.781  115.602 -16.658 1.00 51.49  ? 40   GLU C O     1 
ATOM   6110  C  CB    . GLU I  5  40   ? 21.992  114.060 -19.006 1.00 53.27  ? 40   GLU C CB    1 
ATOM   6111  C  CG    . GLU I  5  40   ? 22.346  112.569 -18.849 1.00 54.17  ? 40   GLU C CG    1 
ATOM   6112  C  CD    . GLU I  5  40   ? 21.531  111.615 -19.744 1.00 52.66  ? 40   GLU C CD    1 
ATOM   6113  O  OE1   . GLU I  5  40   ? 21.921  111.397 -20.911 1.00 53.62  ? 40   GLU C OE1   1 
ATOM   6114  O  OE2   . GLU I  5  40   ? 20.502  111.077 -19.284 1.00 50.92  ? 40   GLU C OE2   1 
ATOM   6115  N  N     . ASN I  5  41   ? 19.808  114.614 -16.157 1.00 51.84  ? 41   ASN C N     1 
ATOM   6116  C  CA    . ASN I  5  41   ? 19.727  115.131 -14.791 1.00 51.72  ? 41   ASN C CA    1 
ATOM   6117  C  C     . ASN I  5  41   ? 20.178  114.130 -13.727 1.00 49.40  ? 41   ASN C C     1 
ATOM   6118  O  O     . ASN I  5  41   ? 19.806  114.311 -12.562 1.00 49.31  ? 41   ASN C O     1 
ATOM   6119  C  CB    . ASN I  5  41   ? 18.279  115.558 -14.501 1.00 53.33  ? 41   ASN C CB    1 
ATOM   6120  C  CG    . ASN I  5  41   ? 17.274  114.402 -14.666 1.00 53.29  ? 41   ASN C CG    1 
ATOM   6121  O  OD1   . ASN I  5  41   ? 17.346  113.381 -13.974 1.00 53.14  ? 41   ASN C OD1   1 
ATOM   6122  N  ND2   . ASN I  5  41   ? 16.332  114.574 -15.587 1.00 55.33  ? 41   ASN C ND2   1 
ATOM   6123  N  N     . VAL I  5  42   ? 20.956  113.105 -14.079 1.00 47.15  ? 42   VAL C N     1 
ATOM   6124  C  CA    . VAL I  5  42   ? 21.403  112.136 -13.079 1.00 42.24  ? 42   VAL C CA    1 
ATOM   6125  C  C     . VAL I  5  42   ? 22.638  112.638 -12.354 1.00 40.80  ? 42   VAL C C     1 
ATOM   6126  O  O     . VAL I  5  42   ? 23.208  113.667 -12.725 1.00 39.23  ? 42   VAL C O     1 
ATOM   6127  C  CB    . VAL I  5  42   ? 21.730  110.780 -13.709 1.00 40.94  ? 42   VAL C CB    1 
ATOM   6128  C  CG1   . VAL I  5  42   ? 21.606  109.703 -12.668 1.00 40.93  ? 42   VAL C CG1   1 
ATOM   6129  C  CG2   . VAL I  5  42   ? 20.786  110.495 -14.837 1.00 41.85  ? 42   VAL C CG2   1 
ATOM   6130  N  N     . GLY I  5  43   ? 23.033  111.918 -11.308 1.00 40.42  ? 43   GLY C N     1 
ATOM   6131  C  CA    . GLY I  5  43   ? 24.203  112.292 -10.540 1.00 38.57  ? 43   GLY C CA    1 
ATOM   6132  C  C     . GLY I  5  43   ? 24.016  113.551 -9.720  1.00 37.49  ? 43   GLY C C     1 
ATOM   6133  O  O     . GLY I  5  43   ? 23.043  113.674 -8.981  1.00 34.88  ? 43   GLY C O     1 
ATOM   6134  N  N     . ILE I  5  44   ? 24.967  114.474 -9.872  1.00 38.28  ? 44   ILE C N     1 
ATOM   6135  C  CA    . ILE I  5  44   ? 25.019  115.756 -9.158  1.00 40.42  ? 44   ILE C CA    1 
ATOM   6136  C  C     . ILE I  5  44   ? 23.665  116.400 -9.062  1.00 41.84  ? 44   ILE C C     1 
ATOM   6137  O  O     . ILE I  5  44   ? 23.060  116.472 -7.989  1.00 41.61  ? 44   ILE C O     1 
ATOM   6138  C  CB    . ILE I  5  44   ? 25.953  116.762 -9.863  1.00 40.70  ? 44   ILE C CB    1 
ATOM   6139  C  CG1   . ILE I  5  44   ? 27.389  116.252 -9.777  1.00 43.05  ? 44   ILE C CG1   1 
ATOM   6140  C  CG2   . ILE I  5  44   ? 25.848  118.160 -9.202  1.00 39.64  ? 44   ILE C CG2   1 
ATOM   6141  C  CD1   . ILE I  5  44   ? 27.919  116.111 -8.348  1.00 44.23  ? 44   ILE C CD1   1 
ATOM   6142  N  N     . GLN I  5  45   ? 23.201  116.883 -10.200 1.00 43.82  ? 45   GLN C N     1 
ATOM   6143  C  CA    . GLN I  5  45   ? 21.926  117.551 -10.259 1.00 45.46  ? 45   GLN C CA    1 
ATOM   6144  C  C     . GLN I  5  45   ? 20.824  116.694 -9.674  1.00 46.56  ? 45   GLN C C     1 
ATOM   6145  O  O     . GLN I  5  45   ? 19.977  117.227 -8.989  1.00 48.95  ? 45   GLN C O     1 
ATOM   6146  C  CB    . GLN I  5  45   ? 21.561  117.897 -11.688 1.00 46.30  ? 45   GLN C CB    1 
ATOM   6147  C  CG    . GLN I  5  45   ? 20.221  118.574 -11.756 1.00 48.03  ? 45   GLN C CG    1 
ATOM   6148  C  CD    . GLN I  5  45   ? 19.849  118.978 -13.142 1.00 49.88  ? 45   GLN C CD    1 
ATOM   6149  O  OE1   . GLN I  5  45   ? 19.988  118.196 -14.084 1.00 51.31  ? 45   GLN C OE1   1 
ATOM   6150  N  NE2   . GLN I  5  45   ? 19.365  120.213 -13.290 1.00 51.20  ? 45   GLN C NE2   1 
ATOM   6151  N  N     . ALA I  5  46   ? 20.819  115.389 -9.932  1.00 48.27  ? 46   ALA C N     1 
ATOM   6152  C  CA    . ALA I  5  46   ? 19.768  114.511 -9.390  1.00 48.85  ? 46   ALA C CA    1 
ATOM   6153  C  C     . ALA I  5  46   ? 19.801  114.478 -7.862  1.00 49.81  ? 46   ALA C C     1 
ATOM   6154  O  O     . ALA I  5  46   ? 18.785  114.741 -7.203  1.00 49.70  ? 46   ALA C O     1 
ATOM   6155  C  CB    . ALA I  5  46   ? 19.938  113.108 -9.915  1.00 50.03  ? 46   ALA C CB    1 
ATOM   6156  N  N     . ALA I  5  47   ? 20.968  114.140 -7.310  1.00 50.07  ? 47   ALA C N     1 
ATOM   6157  C  CA    . ALA I  5  47   ? 21.144  114.087 -5.864  1.00 49.92  ? 47   ALA C CA    1 
ATOM   6158  C  C     . ALA I  5  47   ? 20.798  115.443 -5.234  1.00 50.28  ? 47   ALA C C     1 
ATOM   6159  O  O     . ALA I  5  47   ? 20.306  115.533 -4.105  1.00 50.95  ? 47   ALA C O     1 
ATOM   6160  C  CB    . ALA I  5  47   ? 22.603  113.693 -5.531  1.00 49.30  ? 47   ALA C CB    1 
ATOM   6161  N  N     . PHE I  5  48   ? 21.058  116.494 -5.998  1.00 48.54  ? 48   PHE C N     1 
ATOM   6162  C  CA    . PHE I  5  48   ? 20.809  117.842 -5.561  1.00 47.76  ? 48   PHE C CA    1 
ATOM   6163  C  C     . PHE I  5  48   ? 19.332  118.109 -5.379  1.00 46.25  ? 48   PHE C C     1 
ATOM   6164  O  O     . PHE I  5  48   ? 18.957  118.765 -4.427  1.00 46.73  ? 48   PHE C O     1 
ATOM   6165  C  CB    . PHE I  5  48   ? 21.380  118.825 -6.567  1.00 50.07  ? 48   PHE C CB    1 
ATOM   6166  C  CG    . PHE I  5  48   ? 22.277  119.869 -5.950  1.00 51.95  ? 48   PHE C CG    1 
ATOM   6167  C  CD1   . PHE I  5  48   ? 22.078  120.311 -4.609  1.00 52.42  ? 48   PHE C CD1   1 
ATOM   6168  C  CD2   . PHE I  5  48   ? 23.319  120.440 -6.705  1.00 52.10  ? 48   PHE C CD2   1 
ATOM   6169  C  CE1   . PHE I  5  48   ? 22.907  121.311 -4.024  1.00 51.84  ? 48   PHE C CE1   1 
ATOM   6170  C  CE2   . PHE I  5  48   ? 24.163  121.448 -6.138  1.00 52.91  ? 48   PHE C CE2   1 
ATOM   6171  C  CZ    . PHE I  5  48   ? 23.954  121.884 -4.791  1.00 52.19  ? 48   PHE C CZ    1 
ATOM   6172  N  N     . ARG I  5  49   ? 18.500  117.620 -6.293  1.00 46.59  ? 49   ARG C N     1 
ATOM   6173  C  CA    . ARG I  5  49   ? 17.046  117.790 -6.206  1.00 47.49  ? 49   ARG C CA    1 
ATOM   6174  C  C     . ARG I  5  49   ? 16.457  116.756 -5.276  1.00 49.33  ? 49   ARG C C     1 
ATOM   6175  O  O     . ARG I  5  49   ? 15.339  116.899 -4.755  1.00 49.90  ? 49   ARG C O     1 
ATOM   6176  C  CB    . ARG I  5  49   ? 16.390  117.618 -7.571  1.00 45.62  ? 49   ARG C CB    1 
ATOM   6177  C  CG    . ARG I  5  49   ? 15.064  118.304 -7.705  1.00 44.68  ? 49   ARG C CG    1 
ATOM   6178  C  CD    . ARG I  5  49   ? 15.177  119.414 -8.715  1.00 42.48  ? 49   ARG C CD    1 
ATOM   6179  N  NE    . ARG I  5  49   ? 15.457  118.876 -10.044 1.00 41.91  ? 49   ARG C NE    1 
ATOM   6180  C  CZ    . ARG I  5  49   ? 16.344  119.378 -10.905 1.00 40.93  ? 49   ARG C CZ    1 
ATOM   6181  N  NH1   . ARG I  5  49   ? 17.067  120.440 -10.593 1.00 40.54  ? 49   ARG C NH1   1 
ATOM   6182  N  NH2   . ARG I  5  49   ? 16.510  118.821 -12.094 1.00 40.38  ? 49   ARG C NH2   1 
ATOM   6183  N  N     . GLU I  5  50   ? 17.236  115.701 -5.092  1.00 49.79  ? 50   GLU C N     1 
ATOM   6184  C  CA    . GLU I  5  50   ? 16.888  114.613 -4.210  1.00 51.12  ? 50   GLU C CA    1 
ATOM   6185  C  C     . GLU I  5  50   ? 16.679  115.123 -2.789  1.00 53.04  ? 50   GLU C C     1 
ATOM   6186  O  O     . GLU I  5  50   ? 15.770  114.682 -2.083  1.00 52.89  ? 50   GLU C O     1 
ATOM   6187  C  CB    . GLU I  5  50   ? 18.015  113.589 -4.236  1.00 51.86  ? 50   GLU C CB    1 
ATOM   6188  C  CG    . GLU I  5  50   ? 18.205  112.809 -2.935  1.00 56.59  ? 50   GLU C CG    1 
ATOM   6189  C  CD    . GLU I  5  50   ? 19.576  112.163 -2.815  1.00 58.43  ? 50   GLU C CD    1 
ATOM   6190  O  OE1   . GLU I  5  50   ? 19.960  111.761 -1.687  1.00 58.28  ? 50   GLU C OE1   1 
ATOM   6191  O  OE2   . GLU I  5  50   ? 20.267  112.054 -3.853  1.00 60.18  ? 50   GLU C OE2   1 
ATOM   6192  N  N     . THR I  5  51   ? 17.538  116.062 -2.384  1.00 54.47  ? 51   THR C N     1 
ATOM   6193  C  CA    . THR I  5  51   ? 17.523  116.623 -1.030  1.00 55.71  ? 51   THR C CA    1 
ATOM   6194  C  C     . THR I  5  51   ? 17.478  118.174 -1.019  1.00 56.47  ? 51   THR C C     1 
ATOM   6195  O  O     . THR I  5  51   ? 17.764  118.761 0.025   1.00 57.40  ? 51   THR C O     1 
ATOM   6196  C  CB    . THR I  5  51   ? 18.798  116.160 -0.216  1.00 55.16  ? 51   THR C CB    1 
ATOM   6197  O  OG1   . THR I  5  51   ? 19.869  115.821 -1.112  1.00 54.22  ? 51   THR C OG1   1 
ATOM   6198  C  CG2   . THR I  5  51   ? 18.481  114.932 0.635   1.00 55.24  ? 51   THR C CG2   1 
ATOM   6199  N  N     . PHE I  5  52   ? 17.125  118.861 -2.111  1.00 56.57  ? 52   PHE C N     1 
ATOM   6200  C  CA    . PHE I  5  52   ? 17.144  120.327 -2.010  1.00 57.49  ? 52   PHE C CA    1 
ATOM   6201  C  C     . PHE I  5  52   ? 15.828  120.885 -1.483  1.00 57.95  ? 52   PHE C C     1 
ATOM   6202  O  O     . PHE I  5  52   ? 15.855  121.651 -0.521  1.00 57.57  ? 52   PHE C O     1 
ATOM   6203  C  CB    . PHE I  5  52   ? 17.469  121.014 -3.349  1.00 57.41  ? 52   PHE C CB    1 
ATOM   6204  C  CG    . PHE I  5  52   ? 18.119  122.379 -3.188  1.00 56.90  ? 52   PHE C CG    1 
ATOM   6205  C  CD1   . PHE I  5  52   ? 17.420  123.448 -2.598  1.00 56.95  ? 52   PHE C CD1   1 
ATOM   6206  C  CD2   . PHE I  5  52   ? 19.446  122.602 -3.616  1.00 56.28  ? 52   PHE C CD2   1 
ATOM   6207  C  CE1   . PHE I  5  52   ? 18.027  124.731 -2.432  1.00 56.25  ? 52   PHE C CE1   1 
ATOM   6208  C  CE2   . PHE I  5  52   ? 20.064  123.870 -3.460  1.00 56.08  ? 52   PHE C CE2   1 
ATOM   6209  C  CZ    . PHE I  5  52   ? 19.353  124.936 -2.867  1.00 56.19  ? 52   PHE C CZ    1 
ATOM   6210  N  N     . PRO I  5  53   ? 14.672  120.544 -2.097  1.00 58.25  ? 53   PRO C N     1 
ATOM   6211  C  CA    . PRO I  5  53   ? 13.454  121.126 -1.514  1.00 57.85  ? 53   PRO C CA    1 
ATOM   6212  C  C     . PRO I  5  53   ? 13.283  120.733 -0.028  1.00 57.28  ? 53   PRO C C     1 
ATOM   6213  O  O     . PRO I  5  53   ? 12.680  119.700 0.300   1.00 56.49  ? 53   PRO C O     1 
ATOM   6214  C  CB    . PRO I  5  53   ? 12.349  120.599 -2.422  1.00 58.36  ? 53   PRO C CB    1 
ATOM   6215  C  CG    . PRO I  5  53   ? 13.025  120.540 -3.755  1.00 58.00  ? 53   PRO C CG    1 
ATOM   6216  C  CD    . PRO I  5  53   ? 14.374  119.932 -3.409  1.00 57.71  ? 53   PRO C CD    1 
ATOM   6217  N  N     . ILE I  5  54   ? 13.829  121.576 0.853   1.00 56.13  ? 54   ILE C N     1 
ATOM   6218  C  CA    . ILE I  5  54   ? 13.788  121.351 2.290   1.00 56.46  ? 54   ILE C CA    1 
ATOM   6219  C  C     . ILE I  5  54   ? 12.489  121.856 2.883   1.00 56.50  ? 54   ILE C C     1 
ATOM   6220  O  O     . ILE I  5  54   ? 12.294  123.052 3.105   1.00 56.11  ? 54   ILE C O     1 
ATOM   6221  C  CB    . ILE I  5  54   ? 15.053  122.028 2.994   1.00 55.44  ? 54   ILE C CB    1 
ATOM   6222  C  CG1   . ILE I  5  54   ? 15.113  121.642 4.473   1.00 55.17  ? 54   ILE C CG1   1 
ATOM   6223  C  CG2   . ILE I  5  54   ? 15.022  123.540 2.834   1.00 54.76  ? 54   ILE C CG2   1 
ATOM   6224  C  CD1   . ILE I  5  54   ? 16.537  121.581 5.014   1.00 52.31  ? 54   ILE C CD1   1 
ATOM   6225  N  N     . GLU I  5  55   ? 11.578  120.924 3.124   1.00 56.97  ? 55   GLU C N     1 
ATOM   6226  C  CA    . GLU I  5  55   ? 10.306  121.304 3.695   1.00 58.40  ? 55   GLU C CA    1 
ATOM   6227  C  C     . GLU I  5  55   ? 10.286  121.047 5.190   1.00 61.13  ? 55   GLU C C     1 
ATOM   6228  O  O     . GLU I  5  55   ? 10.305  119.897 5.643   1.00 62.17  ? 55   GLU C O     1 
ATOM   6229  C  CB    . GLU I  5  55   ? 9.143   120.541 3.023   1.00 56.69  ? 55   GLU C CB    1 
ATOM   6230  C  CG    . GLU I  5  55   ? 7.715   120.956 3.495   1.00 54.60  ? 55   GLU C CG    1 
ATOM   6231  C  CD    . GLU I  5  55   ? 7.236   122.330 2.989   1.00 53.13  ? 55   GLU C CD    1 
ATOM   6232  O  OE1   . GLU I  5  55   ? 6.054   122.668 3.240   1.00 50.65  ? 55   GLU C OE1   1 
ATOM   6233  O  OE2   . GLU I  5  55   ? 8.024   123.064 2.345   1.00 52.82  ? 55   GLU C OE2   1 
ATOM   6234  N  N     . GLU I  5  56   ? 10.268  122.153 5.932   1.00 63.71  ? 56   GLU C N     1 
ATOM   6235  C  CA    . GLU I  5  56   ? 10.178  122.197 7.390   1.00 64.34  ? 56   GLU C CA    1 
ATOM   6236  C  C     . GLU I  5  56   ? 8.996   123.069 7.780   1.00 64.62  ? 56   GLU C C     1 
ATOM   6237  O  O     . GLU I  5  56   ? 9.060   124.294 7.642   1.00 64.39  ? 56   GLU C O     1 
ATOM   6238  C  CB    . GLU I  5  56   ? 11.472  122.766 7.967   1.00 64.79  ? 56   GLU C CB    1 
ATOM   6239  C  CG    . GLU I  5  56   ? 12.242  121.808 8.840   1.00 62.94  ? 56   GLU C CG    1 
ATOM   6240  C  CD    . GLU I  5  56   ? 12.105  122.143 10.303  1.00 63.77  ? 56   GLU C CD    1 
ATOM   6241  O  OE1   . GLU I  5  56   ? 12.429  123.290 10.677  1.00 64.15  ? 56   GLU C OE1   1 
ATOM   6242  O  OE2   . GLU I  5  56   ? 11.677  121.266 11.077  1.00 62.86  ? 56   GLU C OE2   1 
ATOM   6243  N  N     . GLU I  5  57   ? 7.918   122.453 8.262   1.00 66.11  ? 57   GLU C N     1 
ATOM   6244  C  CA    . GLU I  5  57   ? 6.700   123.224 8.493   1.00 67.94  ? 57   GLU C CA    1 
ATOM   6245  C  C     . GLU I  5  57   ? 6.404   123.534 9.968   1.00 68.69  ? 57   GLU C C     1 
ATOM   6246  O  O     . GLU I  5  57   ? 6.696   124.655 10.409  1.00 69.25  ? 57   GLU C O     1 
ATOM   6247  C  CB    . GLU I  5  57   ? 5.488   122.500 7.864   1.00 67.72  ? 57   GLU C CB    1 
ATOM   6248  C  CG    . GLU I  5  57   ? 4.049   122.990 8.301   1.00 68.77  ? 57   GLU C CG    1 
ATOM   6249  C  CD    . GLU I  5  57   ? 3.686   124.456 7.933   1.00 69.15  ? 57   GLU C CD    1 
ATOM   6250  O  OE1   . GLU I  5  57   ? 3.979   124.901 6.800   1.00 69.21  ? 57   GLU C OE1   1 
ATOM   6251  O  OE2   . GLU I  5  57   ? 3.090   125.166 8.782   1.00 68.78  ? 57   GLU C OE2   1 
ATOM   6252  N  N     . ASP I  5  58   ? 5.846   122.610 10.751  1.00 68.37  ? 58   ASP C N     1 
ATOM   6253  C  CA    . ASP I  5  58   ? 5.431   123.106 12.052  1.00 68.40  ? 58   ASP C CA    1 
ATOM   6254  C  C     . ASP I  5  58   ? 5.913   122.299 13.250  1.00 68.29  ? 58   ASP C C     1 
ATOM   6255  O  O     . ASP I  5  58   ? 5.753   121.086 13.416  1.00 68.37  ? 58   ASP C O     1 
ATOM   6256  C  CB    . ASP I  5  58   ? 3.913   123.258 12.041  1.00 68.55  ? 58   ASP C CB    1 
ATOM   6257  C  CG    . ASP I  5  58   ? 3.470   124.694 11.679  1.00 68.99  ? 58   ASP C CG    1 
ATOM   6258  O  OD1   . ASP I  5  58   ? 4.236   125.436 11.018  1.00 67.44  ? 58   ASP C OD1   1 
ATOM   6259  O  OD2   . ASP I  5  58   ? 2.348   125.085 12.054  1.00 70.14  ? 58   ASP C OD2   1 
ATOM   6260  N  N     . LYS I  5  59   ? 6.484   123.163 14.074  1.00 67.64  ? 59   LYS C N     1 
ATOM   6261  C  CA    . LYS I  5  59   ? 7.121   123.092 15.372  1.00 67.11  ? 59   LYS C CA    1 
ATOM   6262  C  C     . LYS I  5  59   ? 7.624   124.485 15.674  1.00 67.17  ? 59   LYS C C     1 
ATOM   6263  O  O     . LYS I  5  59   ? 8.778   124.817 15.419  1.00 67.00  ? 59   LYS C O     1 
ATOM   6264  C  CB    . LYS I  5  59   ? 8.308   122.125 15.371  1.00 67.40  ? 59   LYS C CB    1 
ATOM   6265  C  CG    . LYS I  5  59   ? 7.977   120.651 15.169  1.00 67.64  ? 59   LYS C CG    1 
ATOM   6266  C  CD    . LYS I  5  59   ? 9.204   119.868 14.702  1.00 66.77  ? 59   LYS C CD    1 
ATOM   6267  C  CE    . LYS I  5  59   ? 8.853   118.436 14.326  1.00 65.94  ? 59   LYS C CE    1 
ATOM   6268  N  NZ    . LYS I  5  59   ? 10.066  117.675 13.929  1.00 65.20  ? 59   LYS C NZ    1 
ATOM   6269  N  N     . GLY I  5  60   ? 6.729   125.312 16.193  1.00 68.78  ? 60   GLY C N     1 
ATOM   6270  C  CA    . GLY I  5  60   ? 7.038   126.719 16.374  1.00 69.50  ? 60   GLY C CA    1 
ATOM   6271  C  C     . GLY I  5  60   ? 6.634   127.394 15.068  1.00 68.94  ? 60   GLY C C     1 
ATOM   6272  O  O     . GLY I  5  60   ? 5.465   127.333 14.704  1.00 69.65  ? 60   GLY C O     1 
ATOM   6273  N  N     . LYS I  5  61   ? 7.555   128.018 14.345  1.00 67.86  ? 61   LYS C N     1 
ATOM   6274  C  CA    . LYS I  5  61   ? 7.190   128.613 13.059  1.00 66.91  ? 61   LYS C CA    1 
ATOM   6275  C  C     . LYS I  5  61   ? 8.030   128.019 11.932  1.00 66.71  ? 61   LYS C C     1 
ATOM   6276  O  O     . LYS I  5  61   ? 9.250   127.850 12.070  1.00 65.89  ? 61   LYS C O     1 
ATOM   6277  C  CB    . LYS I  5  61   ? 7.363   130.153 13.100  1.00 65.87  ? 61   LYS C CB    1 
ATOM   6278  C  CG    . LYS I  5  61   ? 7.085   130.911 11.741  1.00 64.26  ? 61   LYS C CG    1 
ATOM   6279  C  CD    . LYS I  5  61   ? 8.313   130.922 10.779  1.00 62.50  ? 61   LYS C CD    1 
ATOM   6280  C  CE    . LYS I  5  61   ? 7.986   131.320 9.333   1.00 60.33  ? 61   LYS C CE    1 
ATOM   6281  N  NZ    . LYS I  5  61   ? 9.115   131.015 8.401   1.00 58.10  ? 61   LYS C NZ    1 
ATOM   6282  N  N     . GLY I  5  62   ? 7.367   127.704 10.822  1.00 65.60  ? 62   GLY C N     1 
ATOM   6283  C  CA    . GLY I  5  62   ? 8.058   127.138 9.678   1.00 64.68  ? 62   GLY C CA    1 
ATOM   6284  C  C     . GLY I  5  62   ? 7.466   127.555 8.347   1.00 63.73  ? 62   GLY C C     1 
ATOM   6285  O  O     . GLY I  5  62   ? 7.081   128.714 8.141   1.00 64.73  ? 62   GLY C O     1 
ATOM   6286  N  N     . GLY I  5  63   ? 7.379   126.593 7.440   1.00 62.08  ? 63   GLY C N     1 
ATOM   6287  C  CA    . GLY I  5  63   ? 6.883   126.890 6.113   1.00 60.36  ? 63   GLY C CA    1 
ATOM   6288  C  C     . GLY I  5  63   ? 8.073   127.243 5.267   1.00 58.80  ? 63   GLY C C     1 
ATOM   6289  O  O     . GLY I  5  63   ? 8.006   128.049 4.335   1.00 59.03  ? 63   GLY C O     1 
ATOM   6290  N  N     . LEU I  5  64   ? 9.178   126.603 5.654   1.00 57.47  ? 64   LEU C N     1 
ATOM   6291  C  CA    . LEU I  5  64   ? 10.500  126.747 5.042   1.00 56.56  ? 64   LEU C CA    1 
ATOM   6292  C  C     . LEU I  5  64   ? 10.565  126.087 3.672   1.00 55.10  ? 64   LEU C C     1 
ATOM   6293  O  O     . LEU I  5  64   ? 10.234  124.896 3.529   1.00 54.71  ? 64   LEU C O     1 
ATOM   6294  C  CB    . LEU I  5  64   ? 11.577  126.097 5.923   1.00 56.77  ? 64   LEU C CB    1 
ATOM   6295  C  CG    . LEU I  5  64   ? 12.915  125.794 5.237   1.00 54.54  ? 64   LEU C CG    1 
ATOM   6296  C  CD1   . LEU I  5  64   ? 13.767  127.033 5.272   1.00 55.60  ? 64   LEU C CD1   1 
ATOM   6297  C  CD2   . LEU I  5  64   ? 13.610  124.638 5.907   1.00 54.20  ? 64   LEU C CD2   1 
ATOM   6298  N  N     . VAL I  5  65   ? 11.010  126.857 2.678   1.00 51.71  ? 65   VAL C N     1 
ATOM   6299  C  CA    . VAL I  5  65   ? 11.135  126.324 1.340   1.00 47.58  ? 65   VAL C CA    1 
ATOM   6300  C  C     . VAL I  5  65   ? 12.382  126.855 0.655   1.00 45.21  ? 65   VAL C C     1 
ATOM   6301  O  O     . VAL I  5  65   ? 12.429  127.982 0.192   1.00 42.18  ? 65   VAL C O     1 
ATOM   6302  C  CB    . VAL I  5  65   ? 9.865   126.652 0.455   1.00 47.90  ? 65   VAL C CB    1 
ATOM   6303  C  CG1   . VAL I  5  65   ? 9.233   125.349 -0.040  1.00 46.33  ? 65   VAL C CG1   1 
ATOM   6304  C  CG2   . VAL I  5  65   ? 8.809   127.400 1.259   1.00 47.04  ? 65   VAL C CG2   1 
ATOM   6305  N  N     . LEU I  5  66   ? 13.411  126.025 0.617   1.00 44.44  ? 66   LEU C N     1 
ATOM   6306  C  CA    . LEU I  5  66   ? 14.644  126.382 -0.080  1.00 44.91  ? 66   LEU C CA    1 
ATOM   6307  C  C     . LEU I  5  66   ? 14.741  125.593 -1.384  1.00 44.03  ? 66   LEU C C     1 
ATOM   6308  O  O     . LEU I  5  66   ? 14.634  124.366 -1.364  1.00 43.69  ? 66   LEU C O     1 
ATOM   6309  C  CB    . LEU I  5  66   ? 15.871  126.079 0.796   1.00 44.91  ? 66   LEU C CB    1 
ATOM   6310  C  CG    . LEU I  5  66   ? 17.249  126.543 0.318   1.00 45.24  ? 66   LEU C CG    1 
ATOM   6311  C  CD1   . LEU I  5  66   ? 17.356  128.052 0.270   1.00 45.44  ? 66   LEU C CD1   1 
ATOM   6312  C  CD2   . LEU I  5  66   ? 18.280  126.009 1.277   1.00 46.86  ? 66   LEU C CD2   1 
ATOM   6313  N  N     . ASP I  5  67   ? 14.929  126.261 -2.518  1.00 41.53  ? 67   ASP C N     1 
ATOM   6314  C  CA    . ASP I  5  67   ? 14.945  125.492 -3.751  1.00 39.87  ? 67   ASP C CA    1 
ATOM   6315  C  C     . ASP I  5  67   ? 16.129  125.828 -4.637  1.00 39.01  ? 67   ASP C C     1 
ATOM   6316  O  O     . ASP I  5  67   ? 16.703  126.926 -4.595  1.00 36.33  ? 67   ASP C O     1 
ATOM   6317  C  CB    . ASP I  5  67   ? 13.612  125.667 -4.502  1.00 37.63  ? 67   ASP C CB    1 
ATOM   6318  C  CG    . ASP I  5  67   ? 12.490  124.748 -3.932  1.00 33.79  ? 67   ASP C CG    1 
ATOM   6319  O  OD1   . ASP I  5  67   ? 12.766  123.603 -3.492  1.00 30.19  ? 67   ASP C OD1   1 
ATOM   6320  O  OD2   . ASP I  5  67   ? 11.320  125.177 -3.926  1.00 30.82  ? 67   ASP C OD2   1 
ATOM   6321  N  N     . PHE I  5  68   ? 16.458  124.797 -5.423  1.00 38.87  ? 68   PHE C N     1 
ATOM   6322  C  CA    . PHE I  5  68   ? 17.575  124.726 -6.356  1.00 37.86  ? 68   PHE C CA    1 
ATOM   6323  C  C     . PHE I  5  68   ? 17.208  125.239 -7.723  1.00 38.52  ? 68   PHE C C     1 
ATOM   6324  O  O     . PHE I  5  68   ? 16.187  124.870 -8.294  1.00 39.93  ? 68   PHE C O     1 
ATOM   6325  C  CB    . PHE I  5  68   ? 18.034  123.289 -6.533  1.00 37.72  ? 68   PHE C CB    1 
ATOM   6326  C  CG    . PHE I  5  68   ? 18.951  123.097 -7.703  1.00 37.80  ? 68   PHE C CG    1 
ATOM   6327  C  CD1   . PHE I  5  68   ? 20.322  123.391 -7.591  1.00 37.47  ? 68   PHE C CD1   1 
ATOM   6328  C  CD2   . PHE I  5  68   ? 18.450  122.650 -8.936  1.00 37.70  ? 68   PHE C CD2   1 
ATOM   6329  C  CE1   . PHE I  5  68   ? 21.189  123.243 -8.688  1.00 34.90  ? 68   PHE C CE1   1 
ATOM   6330  C  CE2   . PHE I  5  68   ? 19.306  122.499 -10.045 1.00 37.35  ? 68   PHE C CE2   1 
ATOM   6331  C  CZ    . PHE I  5  68   ? 20.679  122.799 -9.910  1.00 36.53  ? 68   PHE C CZ    1 
ATOM   6332  N  N     . LEU I  5  69   ? 18.087  126.066 -8.264  1.00 37.84  ? 69   LEU C N     1 
ATOM   6333  C  CA    . LEU I  5  69   ? 17.884  126.598 -9.586  1.00 38.12  ? 69   LEU C CA    1 
ATOM   6334  C  C     . LEU I  5  69   ? 18.793  125.903 -10.599 1.00 39.17  ? 69   LEU C C     1 
ATOM   6335  O  O     . LEU I  5  69   ? 18.339  125.086 -11.399 1.00 39.75  ? 69   LEU C O     1 
ATOM   6336  C  CB    . LEU I  5  69   ? 18.175  128.104 -9.615  1.00 36.29  ? 69   LEU C CB    1 
ATOM   6337  C  CG    . LEU I  5  69   ? 17.434  129.112 -8.738  1.00 34.40  ? 69   LEU C CG    1 
ATOM   6338  C  CD1   . LEU I  5  69   ? 17.999  130.489 -9.047  1.00 31.15  ? 69   LEU C CD1   1 
ATOM   6339  C  CD2   . LEU I  5  69   ? 15.919  129.040 -8.977  1.00 33.66  ? 69   LEU C CD2   1 
ATOM   6340  N  N     . GLU I  5  70   ? 20.086  126.224 -10.556 1.00 40.38  ? 70   GLU C N     1 
ATOM   6341  C  CA    . GLU I  5  70   ? 21.051  125.687 -11.515 1.00 41.55  ? 70   GLU C CA    1 
ATOM   6342  C  C     . GLU I  5  70   ? 22.425  125.458 -10.864 1.00 41.06  ? 70   GLU C C     1 
ATOM   6343  O  O     . GLU I  5  70   ? 22.947  126.327 -10.170 1.00 41.07  ? 70   GLU C O     1 
ATOM   6344  C  CB    . GLU I  5  70   ? 21.191  126.676 -12.691 1.00 43.91  ? 70   GLU C CB    1 
ATOM   6345  C  CG    . GLU I  5  70   ? 19.845  127.269 -13.222 1.00 46.89  ? 70   GLU C CG    1 
ATOM   6346  C  CD    . GLU I  5  70   ? 19.985  128.474 -14.166 1.00 47.66  ? 70   GLU C CD    1 
ATOM   6347  O  OE1   . GLU I  5  70   ? 18.946  129.114 -14.462 1.00 46.95  ? 70   GLU C OE1   1 
ATOM   6348  O  OE2   . GLU I  5  70   ? 21.118  128.778 -14.611 1.00 49.08  ? 70   GLU C OE2   1 
ATOM   6349  N  N     . TYR I  5  71   ? 23.005  124.286 -11.102 1.00 39.64  ? 71   TYR C N     1 
ATOM   6350  C  CA    . TYR I  5  71   ? 24.309  123.920 -10.554 1.00 39.27  ? 71   TYR C CA    1 
ATOM   6351  C  C     . TYR I  5  71   ? 25.425  124.310 -11.493 1.00 40.39  ? 71   TYR C C     1 
ATOM   6352  O  O     . TYR I  5  71   ? 25.450  123.875 -12.645 1.00 41.02  ? 71   TYR C O     1 
ATOM   6353  C  CB    . TYR I  5  71   ? 24.374  122.410 -10.319 1.00 37.77  ? 71   TYR C CB    1 
ATOM   6354  C  CG    . TYR I  5  71   ? 24.087  121.521 -11.538 1.00 34.58  ? 71   TYR C CG    1 
ATOM   6355  C  CD1   . TYR I  5  71   ? 25.072  120.641 -12.055 1.00 34.06  ? 71   TYR C CD1   1 
ATOM   6356  C  CD2   . TYR I  5  71   ? 22.823  121.525 -12.157 1.00 32.92  ? 71   TYR C CD2   1 
ATOM   6357  C  CE1   . TYR I  5  71   ? 24.785  119.770 -13.172 1.00 32.51  ? 71   TYR C CE1   1 
ATOM   6358  C  CE2   . TYR I  5  71   ? 22.530  120.677 -13.259 1.00 31.48  ? 71   TYR C CE2   1 
ATOM   6359  C  CZ    . TYR I  5  71   ? 23.505  119.808 -13.751 1.00 31.44  ? 71   TYR C CZ    1 
ATOM   6360  O  OH    . TYR I  5  71   ? 23.170  118.978 -14.780 1.00 29.37  ? 71   TYR C OH    1 
ATOM   6361  N  N     . ARG I  5  72   ? 26.358  125.122 -11.026 1.00 40.45  ? 72   ARG C N     1 
ATOM   6362  C  CA    . ARG I  5  72   ? 27.431  125.514 -11.915 1.00 41.52  ? 72   ARG C CA    1 
ATOM   6363  C  C     . ARG I  5  72   ? 28.745  125.601 -11.194 1.00 42.10  ? 72   ARG C C     1 
ATOM   6364  O  O     . ARG I  5  72   ? 28.891  126.288 -10.185 1.00 41.51  ? 72   ARG C O     1 
ATOM   6365  C  CB    . ARG I  5  72   ? 27.121  126.861 -12.589 1.00 42.69  ? 72   ARG C CB    1 
ATOM   6366  C  CG    . ARG I  5  72   ? 26.718  127.986 -11.639 1.00 43.50  ? 72   ARG C CG    1 
ATOM   6367  C  CD    . ARG I  5  72   ? 27.362  129.319 -12.039 1.00 43.67  ? 72   ARG C CD    1 
ATOM   6368  N  NE    . ARG I  5  72   ? 26.822  130.433 -11.257 1.00 43.78  ? 72   ARG C NE    1 
ATOM   6369  C  CZ    . ARG I  5  72   ? 27.209  131.704 -11.363 1.00 42.97  ? 72   ARG C CZ    1 
ATOM   6370  N  NH1   . ARG I  5  72   ? 28.155  132.059 -12.221 1.00 44.12  ? 72   ARG C NH1   1 
ATOM   6371  N  NH2   . ARG I  5  72   ? 26.640  132.626 -10.603 1.00 42.41  ? 72   ARG C NH2   1 
ATOM   6372  N  N     . LEU I  5  73   ? 29.697  124.871 -11.757 1.00 43.32  ? 73   LEU C N     1 
ATOM   6373  C  CA    . LEU I  5  73   ? 31.075  124.785 -11.289 1.00 44.47  ? 73   LEU C CA    1 
ATOM   6374  C  C     . LEU I  5  73   ? 32.023  125.016 -12.454 1.00 45.16  ? 73   LEU C C     1 
ATOM   6375  O  O     . LEU I  5  73   ? 31.799  124.425 -13.508 1.00 44.57  ? 73   LEU C O     1 
ATOM   6376  C  CB    . LEU I  5  73   ? 31.311  123.401 -10.679 1.00 43.88  ? 73   LEU C CB    1 
ATOM   6377  C  CG    . LEU I  5  73   ? 31.009  122.188 -11.558 1.00 42.97  ? 73   LEU C CG    1 
ATOM   6378  C  CD1   . LEU I  5  73   ? 32.248  121.797 -12.359 1.00 43.09  ? 73   LEU C CD1   1 
ATOM   6379  C  CD2   . LEU I  5  73   ? 30.573  121.031 -10.671 1.00 42.18  ? 73   LEU C CD2   1 
ATOM   6380  N  N     . GLY I  5  74   ? 33.069  125.836 -12.325 1.00 46.03  ? 74   GLY C N     1 
ATOM   6381  C  CA    . GLY I  5  74   ? 33.847  126.013 -13.536 1.00 47.54  ? 74   GLY C CA    1 
ATOM   6382  C  C     . GLY I  5  74   ? 35.271  126.528 -13.487 1.00 48.70  ? 74   GLY C C     1 
ATOM   6383  O  O     . GLY I  5  74   ? 36.020  126.196 -14.410 1.00 47.87  ? 74   GLY C O     1 
ATOM   6384  N  N     . GLU I  5  75   ? 35.701  127.304 -12.501 1.00 49.76  ? 75   GLU C N     1 
ATOM   6385  C  CA    . GLU I  5  75   ? 37.075  127.784 -12.612 1.00 51.42  ? 75   GLU C CA    1 
ATOM   6386  C  C     . GLU I  5  75   ? 38.009  127.145 -11.581 1.00 50.69  ? 75   GLU C C     1 
ATOM   6387  O  O     . GLU I  5  75   ? 38.112  127.626 -10.450 1.00 50.38  ? 75   GLU C O     1 
ATOM   6388  C  CB    . GLU I  5  75   ? 37.110  129.308 -12.479 1.00 53.38  ? 75   GLU C CB    1 
ATOM   6389  C  CG    . GLU I  5  75   ? 37.695  130.026 -13.697 1.00 56.35  ? 75   GLU C CG    1 
ATOM   6390  C  CD    . GLU I  5  75   ? 36.636  130.644 -14.598 1.00 57.91  ? 75   GLU C CD    1 
ATOM   6391  O  OE1   . GLU I  5  75   ? 36.126  129.955 -15.523 1.00 57.54  ? 75   GLU C OE1   1 
ATOM   6392  O  OE2   . GLU I  5  75   ? 36.317  131.833 -14.365 1.00 59.30  ? 75   GLU C OE2   1 
ATOM   6393  N  N     . PRO I  5  76   ? 38.718  126.055 -11.975 1.00 49.60  ? 76   PRO C N     1 
ATOM   6394  C  CA    . PRO I  5  76   ? 39.656  125.325 -11.111 1.00 48.09  ? 76   PRO C CA    1 
ATOM   6395  C  C     . PRO I  5  76   ? 40.644  126.258 -10.405 1.00 46.23  ? 76   PRO C C     1 
ATOM   6396  O  O     . PRO I  5  76   ? 41.193  127.197 -10.996 1.00 45.83  ? 76   PRO C O     1 
ATOM   6397  C  CB    . PRO I  5  76   ? 40.330  124.346 -12.062 1.00 48.78  ? 76   PRO C CB    1 
ATOM   6398  C  CG    . PRO I  5  76   ? 39.250  124.043 -13.038 1.00 49.68  ? 76   PRO C CG    1 
ATOM   6399  C  CD    . PRO I  5  76   ? 38.653  125.408 -13.303 1.00 49.54  ? 76   PRO C CD    1 
ATOM   6400  N  N     . PRO I  5  77   ? 40.887  125.994 -9.121  1.00 44.26  ? 77   PRO C N     1 
ATOM   6401  C  CA    . PRO I  5  77   ? 41.795  126.807 -8.331  1.00 43.60  ? 77   PRO C CA    1 
ATOM   6402  C  C     . PRO I  5  77   ? 43.170  126.876 -8.951  1.00 43.28  ? 77   PRO C C     1 
ATOM   6403  O  O     . PRO I  5  77   ? 43.671  127.955 -9.256  1.00 43.57  ? 77   PRO C O     1 
ATOM   6404  C  CB    . PRO I  5  77   ? 41.777  126.119 -6.964  1.00 44.13  ? 77   PRO C CB    1 
ATOM   6405  C  CG    . PRO I  5  77   ? 40.553  125.261 -6.984  1.00 43.33  ? 77   PRO C CG    1 
ATOM   6406  C  CD    . PRO I  5  77   ? 40.557  124.767 -8.387  1.00 43.90  ? 77   PRO C CD    1 
ATOM   6407  N  N     . PHE I  5  78   ? 43.780  125.711 -9.136  1.00 42.64  ? 78   PHE C N     1 
ATOM   6408  C  CA    . PHE I  5  78   ? 45.112  125.645 -9.710  1.00 43.38  ? 78   PHE C CA    1 
ATOM   6409  C  C     . PHE I  5  78   ? 45.184  124.573 -10.816 1.00 44.94  ? 78   PHE C C     1 
ATOM   6410  O  O     . PHE I  5  78   ? 44.176  123.900 -11.083 1.00 45.86  ? 78   PHE C O     1 
ATOM   6411  C  CB    . PHE I  5  78   ? 46.113  125.351 -8.607  1.00 43.45  ? 78   PHE C CB    1 
ATOM   6412  C  CG    . PHE I  5  78   ? 45.891  126.153 -7.349  1.00 43.67  ? 78   PHE C CG    1 
ATOM   6413  C  CD1   . PHE I  5  78   ? 44.911  125.762 -6.412  1.00 43.19  ? 78   PHE C CD1   1 
ATOM   6414  C  CD2   . PHE I  5  78   ? 46.670  127.296 -7.076  1.00 44.81  ? 78   PHE C CD2   1 
ATOM   6415  C  CE1   . PHE I  5  78   ? 44.693  126.489 -5.203  1.00 42.66  ? 78   PHE C CE1   1 
ATOM   6416  C  CE2   . PHE I  5  78   ? 46.476  128.049 -5.872  1.00 44.77  ? 78   PHE C CE2   1 
ATOM   6417  C  CZ    . PHE I  5  78   ? 45.479  127.638 -4.931  1.00 43.89  ? 78   PHE C CZ    1 
ATOM   6418  N  N     . PRO I  5  79   ? 46.362  124.396 -11.477 1.00 44.59  ? 79   PRO C N     1 
ATOM   6419  C  CA    . PRO I  5  79   ? 46.436  123.388 -12.547 1.00 43.36  ? 79   PRO C CA    1 
ATOM   6420  C  C     . PRO I  5  79   ? 47.116  122.088 -12.129 1.00 41.81  ? 79   PRO C C     1 
ATOM   6421  O  O     . PRO I  5  79   ? 47.830  122.006 -11.135 1.00 41.26  ? 79   PRO C O     1 
ATOM   6422  C  CB    . PRO I  5  79   ? 47.184  124.109 -13.654 1.00 44.11  ? 79   PRO C CB    1 
ATOM   6423  C  CG    . PRO I  5  79   ? 48.202  124.876 -12.898 1.00 44.18  ? 79   PRO C CG    1 
ATOM   6424  C  CD    . PRO I  5  79   ? 47.424  125.408 -11.676 1.00 45.23  ? 79   PRO C CD    1 
ATOM   6425  N  N     . GLN I  5  80   ? 46.864  121.088 -12.969 1.00 41.07  ? 80   GLN C N     1 
ATOM   6426  C  CA    . GLN I  5  80   ? 47.322  119.694 -12.872 1.00 39.97  ? 80   GLN C CA    1 
ATOM   6427  C  C     . GLN I  5  80   ? 48.724  119.561 -12.290 1.00 40.49  ? 80   GLN C C     1 
ATOM   6428  O  O     . GLN I  5  80   ? 48.909  119.139 -11.155 1.00 37.98  ? 80   GLN C O     1 
ATOM   6429  C  CB    . GLN I  5  80   ? 47.308  119.054 -14.260 1.00 36.95  ? 80   GLN C CB    1 
ATOM   6430  C  CG    . GLN I  5  80   ? 45.943  118.943 -14.870 1.00 31.31  ? 80   GLN C CG    1 
ATOM   6431  C  CD    . GLN I  5  80   ? 45.407  117.555 -14.758 1.00 25.84  ? 80   GLN C CD    1 
ATOM   6432  O  OE1   . GLN I  5  80   ? 45.343  117.003 -13.688 1.00 21.70  ? 80   GLN C OE1   1 
ATOM   6433  N  NE2   . GLN I  5  80   ? 45.017  116.983 -15.870 1.00 27.31  ? 80   GLN C NE2   1 
ATOM   6434  N  N     . ASP I  5  81   ? 49.714  119.901 -13.091 1.00 41.83  ? 81   ASP C N     1 
ATOM   6435  C  CA    . ASP I  5  81   ? 51.079  119.762 -12.654 1.00 45.22  ? 81   ASP C CA    1 
ATOM   6436  C  C     . ASP I  5  81   ? 51.381  120.641 -11.459 1.00 47.62  ? 81   ASP C C     1 
ATOM   6437  O  O     . ASP I  5  81   ? 52.250  120.299 -10.652 1.00 47.02  ? 81   ASP C O     1 
ATOM   6438  C  CB    . ASP I  5  81   ? 51.978  120.030 -13.848 1.00 45.42  ? 81   ASP C CB    1 
ATOM   6439  C  CG    . ASP I  5  81   ? 51.983  118.825 -14.808 1.00 43.72  ? 81   ASP C CG    1 
ATOM   6440  O  OD1   . ASP I  5  81   ? 50.917  118.167 -14.927 1.00 40.18  ? 81   ASP C OD1   1 
ATOM   6441  O  OD2   . ASP I  5  81   ? 53.035  118.532 -15.427 1.00 44.38  ? 81   ASP C OD2   1 
ATOM   6442  N  N     . GLU I  5  82   ? 50.668  121.758 -11.337 1.00 50.40  ? 82   GLU C N     1 
ATOM   6443  C  CA    . GLU I  5  82   ? 50.845  122.617 -10.178 1.00 53.65  ? 82   GLU C CA    1 
ATOM   6444  C  C     . GLU I  5  82   ? 50.334  121.918 -8.930  1.00 53.63  ? 82   GLU C C     1 
ATOM   6445  O  O     . GLU I  5  82   ? 50.722  122.217 -7.790  1.00 53.49  ? 82   GLU C O     1 
ATOM   6446  C  CB    . GLU I  5  82   ? 50.079  123.914 -10.365 1.00 56.33  ? 82   GLU C CB    1 
ATOM   6447  C  CG    . GLU I  5  82   ? 50.971  125.125 -10.424 1.00 61.11  ? 82   GLU C CG    1 
ATOM   6448  C  CD    . GLU I  5  82   ? 51.708  125.333 -9.118  1.00 63.22  ? 82   GLU C CD    1 
ATOM   6449  O  OE1   . GLU I  5  82   ? 51.006  125.481 -8.086  1.00 65.59  ? 82   GLU C OE1   1 
ATOM   6450  O  OE2   . GLU I  5  82   ? 52.967  125.346 -9.129  1.00 63.47  ? 82   GLU C OE2   1 
ATOM   6451  N  N     . CYS I  5  83   ? 49.445  120.967 -9.184  1.00 54.22  ? 83   CYS C N     1 
ATOM   6452  C  CA    . CYS I  5  83   ? 48.857  120.171 -8.133  1.00 54.06  ? 83   CYS C CA    1 
ATOM   6453  C  C     . CYS I  5  83   ? 49.797  119.047 -7.712  1.00 55.74  ? 83   CYS C C     1 
ATOM   6454  O  O     . CYS I  5  83   ? 49.648  118.470 -6.635  1.00 55.19  ? 83   CYS C O     1 
ATOM   6455  C  CB    . CYS I  5  83   ? 47.527  119.588 -8.618  1.00 54.03  ? 83   CYS C CB    1 
ATOM   6456  S  SG    . CYS I  5  83   ? 46.231  120.835 -8.900  1.00 49.04  ? 83   CYS C SG    1 
ATOM   6457  N  N     . ARG I  5  84   ? 50.773  118.743 -8.565  1.00 56.82  ? 84   ARG C N     1 
ATOM   6458  C  CA    . ARG I  5  84   ? 51.717  117.664 -8.291  1.00 57.82  ? 84   ARG C CA    1 
ATOM   6459  C  C     . ARG I  5  84   ? 53.024  118.197 -7.723  1.00 58.18  ? 84   ARG C C     1 
ATOM   6460  O  O     . ARG I  5  84   ? 53.603  117.587 -6.822  1.00 57.97  ? 84   ARG C O     1 
ATOM   6461  C  CB    . ARG I  5  84   ? 51.971  116.882 -9.572  1.00 58.92  ? 84   ARG C CB    1 
ATOM   6462  C  CG    . ARG I  5  84   ? 50.705  116.699 -10.395 1.00 59.09  ? 84   ARG C CG    1 
ATOM   6463  C  CD    . ARG I  5  84   ? 50.887  115.619 -11.410 1.00 60.61  ? 84   ARG C CD    1 
ATOM   6464  N  NE    . ARG I  5  84   ? 49.751  115.548 -12.308 1.00 60.18  ? 84   ARG C NE    1 
ATOM   6465  C  CZ    . ARG I  5  84   ? 49.558  114.558 -13.169 1.00 60.75  ? 84   ARG C CZ    1 
ATOM   6466  N  NH1   . ARG I  5  84   ? 50.424  113.559 -13.250 1.00 61.80  ? 84   ARG C NH1   1 
ATOM   6467  N  NH2   . ARG I  5  84   ? 48.497  114.567 -13.948 1.00 61.90  ? 84   ARG C NH2   1 
ATOM   6468  N  N     . GLU I  5  85   ? 53.506  119.319 -8.248  1.00 58.41  ? 85   GLU C N     1 
ATOM   6469  C  CA    . GLU I  5  85   ? 54.711  119.911 -7.683  1.00 59.39  ? 85   GLU C CA    1 
ATOM   6470  C  C     . GLU I  5  85   ? 54.451  120.282 -6.235  1.00 59.93  ? 85   GLU C C     1 
ATOM   6471  O  O     . GLU I  5  85   ? 55.204  119.933 -5.329  1.00 60.88  ? 85   GLU C O     1 
ATOM   6472  C  CB    . GLU I  5  85   ? 55.117  121.153 -8.481  1.00 58.44  ? 85   GLU C CB    1 
ATOM   6473  C  CG    . GLU I  5  85   ? 56.598  121.426 -8.443  1.00 56.04  ? 85   GLU C CG    1 
ATOM   6474  C  CD    . GLU I  5  85   ? 57.412  120.280 -9.007  1.00 55.51  ? 85   GLU C CD    1 
ATOM   6475  O  OE1   . GLU I  5  85   ? 58.634  120.442 -9.094  1.00 55.66  ? 85   GLU C OE1   1 
ATOM   6476  O  OE2   . GLU I  5  85   ? 56.858  119.221 -9.368  1.00 54.67  ? 85   GLU C OE2   1 
ATOM   6477  N  N     . LYS I  5  86   ? 53.354  121.001 -6.043  1.00 59.18  ? 86   LYS C N     1 
ATOM   6478  C  CA    . LYS I  5  86   ? 52.862  121.350 -4.733  1.00 58.39  ? 86   LYS C CA    1 
ATOM   6479  C  C     . LYS I  5  86   ? 51.872  120.305 -4.311  1.00 57.73  ? 86   LYS C C     1 
ATOM   6480  O  O     . LYS I  5  86   ? 51.178  119.796 -5.169  1.00 58.65  ? 86   LYS C O     1 
ATOM   6481  C  CB    . LYS I  5  86   ? 52.224  122.729 -4.810  1.00 59.16  ? 86   LYS C CB    1 
ATOM   6482  C  CG    . LYS I  5  86   ? 53.337  123.755 -4.987  1.00 60.86  ? 86   LYS C CG    1 
ATOM   6483  C  CD    . LYS I  5  86   ? 53.134  124.797 -6.086  1.00 62.02  ? 86   LYS C CD    1 
ATOM   6484  C  CE    . LYS I  5  86   ? 54.362  125.764 -6.128  1.00 61.92  ? 86   LYS C CE    1 
ATOM   6485  N  NZ    . LYS I  5  86   ? 54.393  126.804 -7.222  1.00 60.98  ? 86   LYS C NZ    1 
ATOM   6486  N  N     . ASP I  5  87   ? 51.796  119.943 -3.040  1.00 56.50  ? 87   ASP C N     1 
ATOM   6487  C  CA    . ASP I  5  87   ? 50.838  118.899 -2.668  1.00 55.48  ? 87   ASP C CA    1 
ATOM   6488  C  C     . ASP I  5  87   ? 49.406  119.413 -2.739  1.00 54.38  ? 87   ASP C C     1 
ATOM   6489  O  O     . ASP I  5  87   ? 48.827  119.798 -1.738  1.00 54.57  ? 87   ASP C O     1 
ATOM   6490  C  CB    . ASP I  5  87   ? 51.123  118.381 -1.256  1.00 55.58  ? 87   ASP C CB    1 
ATOM   6491  C  CG    . ASP I  5  87   ? 52.094  117.225 -1.254  1.00 55.03  ? 87   ASP C CG    1 
ATOM   6492  O  OD1   . ASP I  5  87   ? 53.308  117.475 -1.106  1.00 56.95  ? 87   ASP C OD1   1 
ATOM   6493  O  OD2   . ASP I  5  87   ? 51.647  116.065 -1.404  1.00 53.45  ? 87   ASP C OD2   1 
ATOM   6494  N  N     . LEU I  5  88   ? 48.820  119.388 -3.930  1.00 52.80  ? 88   LEU C N     1 
ATOM   6495  C  CA    . LEU I  5  88   ? 47.480  119.917 -4.097  1.00 50.98  ? 88   LEU C CA    1 
ATOM   6496  C  C     . LEU I  5  88   ? 46.508  118.868 -4.603  1.00 50.03  ? 88   LEU C C     1 
ATOM   6497  O  O     . LEU I  5  88   ? 46.883  117.844 -5.167  1.00 49.85  ? 88   LEU C O     1 
ATOM   6498  C  CB    . LEU I  5  88   ? 47.540  121.078 -5.074  1.00 52.06  ? 88   LEU C CB    1 
ATOM   6499  C  CG    . LEU I  5  88   ? 46.408  122.053 -5.416  1.00 52.02  ? 88   LEU C CG    1 
ATOM   6500  C  CD1   . LEU I  5  88   ? 45.301  122.176 -4.381  1.00 50.02  ? 88   LEU C CD1   1 
ATOM   6501  C  CD2   . LEU I  5  88   ? 47.135  123.368 -5.614  1.00 53.17  ? 88   LEU C CD2   1 
ATOM   6502  N  N     . THR I  5  89   ? 45.234  119.165 -4.381  1.00 49.61  ? 89   THR C N     1 
ATOM   6503  C  CA    . THR I  5  89   ? 44.141  118.328 -4.823  1.00 47.42  ? 89   THR C CA    1 
ATOM   6504  C  C     . THR I  5  89   ? 43.331  119.054 -5.902  1.00 45.95  ? 89   THR C C     1 
ATOM   6505  O  O     . THR I  5  89   ? 42.590  119.996 -5.608  1.00 46.29  ? 89   THR C O     1 
ATOM   6506  C  CB    . THR I  5  89   ? 43.262  117.894 -3.551  1.00 48.05  ? 89   THR C CB    1 
ATOM   6507  O  OG1   . THR I  5  89   ? 42.174  117.059 -3.972  1.00 46.87  ? 89   THR C OG1   1 
ATOM   6508  C  CG2   . THR I  5  89   ? 42.763  119.094 -2.770  1.00 47.11  ? 89   THR C CG2   1 
ATOM   6509  N  N     . TYR I  5  90   ? 43.517  118.623 -7.153  1.00 43.72  ? 90   TYR C N     1 
ATOM   6510  C  CA    . TYR I  5  90   ? 42.860  119.207 -8.333  1.00 41.36  ? 90   TYR C CA    1 
ATOM   6511  C  C     . TYR I  5  90   ? 41.353  118.983 -8.299  1.00 40.99  ? 90   TYR C C     1 
ATOM   6512  O  O     . TYR I  5  90   ? 40.877  117.876 -8.555  1.00 41.88  ? 90   TYR C O     1 
ATOM   6513  C  CB    . TYR I  5  90   ? 43.467  118.590 -9.597  1.00 38.43  ? 90   TYR C CB    1 
ATOM   6514  C  CG    . TYR I  5  90   ? 43.004  119.126 -10.960 1.00 36.58  ? 90   TYR C CG    1 
ATOM   6515  C  CD1   . TYR I  5  90   ? 42.211  120.290 -11.095 1.00 35.32  ? 90   TYR C CD1   1 
ATOM   6516  C  CD2   . TYR I  5  90   ? 43.387  118.453 -12.145 1.00 35.59  ? 90   TYR C CD2   1 
ATOM   6517  C  CE1   . TYR I  5  90   ? 41.817  120.762 -12.398 1.00 34.21  ? 90   TYR C CE1   1 
ATOM   6518  C  CE2   . TYR I  5  90   ? 43.001  118.907 -13.422 1.00 32.85  ? 90   TYR C CE2   1 
ATOM   6519  C  CZ    . TYR I  5  90   ? 42.229  120.045 -13.548 1.00 33.23  ? 90   TYR C CZ    1 
ATOM   6520  O  OH    . TYR I  5  90   ? 41.880  120.441 -14.816 1.00 32.65  ? 90   TYR C OH    1 
ATOM   6521  N  N     . GLN I  5  91   ? 40.617  120.053 -7.990  1.00 40.95  ? 91   GLN C N     1 
ATOM   6522  C  CA    . GLN I  5  91   ? 39.166  120.017 -7.853  1.00 39.76  ? 91   GLN C CA    1 
ATOM   6523  C  C     . GLN I  5  91   ? 38.524  121.274 -8.401  1.00 38.85  ? 91   GLN C C     1 
ATOM   6524  O  O     . GLN I  5  91   ? 39.053  122.350 -8.242  1.00 38.89  ? 91   GLN C O     1 
ATOM   6525  C  CB    . GLN I  5  91   ? 38.787  119.926 -6.388  1.00 42.24  ? 91   GLN C CB    1 
ATOM   6526  C  CG    . GLN I  5  91   ? 39.746  119.095 -5.570  1.00 45.60  ? 91   GLN C CG    1 
ATOM   6527  C  CD    . GLN I  5  91   ? 39.749  119.474 -4.107  1.00 47.67  ? 91   GLN C CD    1 
ATOM   6528  O  OE1   . GLN I  5  91   ? 39.759  120.666 -3.767  1.00 47.83  ? 91   GLN C OE1   1 
ATOM   6529  N  NE2   . GLN I  5  91   ? 39.747  118.463 -3.226  1.00 48.55  ? 91   GLN C NE2   1 
ATOM   6530  N  N     . ALA I  5  92   ? 37.372  121.133 -9.033  1.00 37.04  ? 92   ALA C N     1 
ATOM   6531  C  CA    . ALA I  5  92   ? 36.648  122.279 -9.554  1.00 35.32  ? 92   ALA C CA    1 
ATOM   6532  C  C     . ALA I  5  92   ? 35.771  122.881 -8.467  1.00 33.94  ? 92   ALA C C     1 
ATOM   6533  O  O     . ALA I  5  92   ? 35.318  122.171 -7.600  1.00 36.18  ? 92   ALA C O     1 
ATOM   6534  C  CB    . ALA I  5  92   ? 35.787  121.857 -10.722 1.00 35.60  ? 92   ALA C CB    1 
ATOM   6535  N  N     . PRO I  5  93   ? 35.523  124.193 -8.496  1.00 33.49  ? 93   PRO C N     1 
ATOM   6536  C  CA    . PRO I  5  93   ? 34.687  124.834 -7.474  1.00 33.75  ? 93   PRO C CA    1 
ATOM   6537  C  C     . PRO I  5  93   ? 33.218  124.756 -7.829  1.00 33.98  ? 93   PRO C C     1 
ATOM   6538  O  O     . PRO I  5  93   ? 32.878  125.007 -8.957  1.00 34.21  ? 93   PRO C O     1 
ATOM   6539  C  CB    . PRO I  5  93   ? 35.195  126.273 -7.442  1.00 34.37  ? 93   PRO C CB    1 
ATOM   6540  C  CG    . PRO I  5  93   ? 36.144  126.385 -8.658  1.00 35.26  ? 93   PRO C CG    1 
ATOM   6541  C  CD    . PRO I  5  93   ? 35.934  125.175 -9.505  1.00 33.37  ? 93   PRO C CD    1 
ATOM   6542  N  N     . LEU I  5  94   ? 32.340  124.423 -6.895  1.00 32.73  ? 94   LEU C N     1 
ATOM   6543  C  CA    . LEU I  5  94   ? 30.941  124.381 -7.266  1.00 33.86  ? 94   LEU C CA    1 
ATOM   6544  C  C     . LEU I  5  94   ? 30.072  125.210 -6.329  1.00 37.00  ? 94   LEU C C     1 
ATOM   6545  O  O     . LEU I  5  94   ? 30.145  125.095 -5.108  1.00 38.20  ? 94   LEU C O     1 
ATOM   6546  C  CB    . LEU I  5  94   ? 30.459  122.946 -7.284  1.00 30.54  ? 94   LEU C CB    1 
ATOM   6547  C  CG    . LEU I  5  94   ? 30.494  122.071 -6.064  1.00 28.23  ? 94   LEU C CG    1 
ATOM   6548  C  CD1   . LEU I  5  94   ? 29.152  122.140 -5.376  1.00 25.82  ? 94   LEU C CD1   1 
ATOM   6549  C  CD2   . LEU I  5  94   ? 30.814  120.660 -6.489  1.00 25.97  ? 94   LEU C CD2   1 
ATOM   6550  N  N     . TYR I  5  95   ? 29.242  126.050 -6.938  1.00 39.39  ? 95   TYR C N     1 
ATOM   6551  C  CA    . TYR I  5  95   ? 28.304  126.920 -6.231  1.00 42.87  ? 95   TYR C CA    1 
ATOM   6552  C  C     . TYR I  5  95   ? 27.005  127.053 -7.007  1.00 44.18  ? 95   TYR C C     1 
ATOM   6553  O  O     . TYR I  5  95   ? 26.963  127.749 -8.025  1.00 45.13  ? 95   TYR C O     1 
ATOM   6554  C  CB    . TYR I  5  95   ? 28.881  128.337 -6.021  1.00 43.62  ? 95   TYR C CB    1 
ATOM   6555  C  CG    . TYR I  5  95   ? 30.085  128.726 -6.889  1.00 44.45  ? 95   TYR C CG    1 
ATOM   6556  C  CD1   . TYR I  5  95   ? 30.063  128.586 -8.296  1.00 44.28  ? 95   TYR C CD1   1 
ATOM   6557  C  CD2   . TYR I  5  95   ? 31.281  129.220 -6.289  1.00 44.49  ? 95   TYR C CD2   1 
ATOM   6558  C  CE1   . TYR I  5  95   ? 31.199  128.921 -9.081  1.00 43.19  ? 95   TYR C CE1   1 
ATOM   6559  C  CE2   . TYR I  5  95   ? 32.425  129.557 -7.071  1.00 42.78  ? 95   TYR C CE2   1 
ATOM   6560  C  CZ    . TYR I  5  95   ? 32.367  129.399 -8.458  1.00 42.90  ? 95   TYR C CZ    1 
ATOM   6561  O  OH    . TYR I  5  95   ? 33.466  129.694 -9.214  1.00 42.79  ? 95   TYR C OH    1 
ATOM   6562  N  N     . ALA I  5  96   ? 25.949  126.387 -6.536  1.00 46.36  ? 96   ALA C N     1 
ATOM   6563  C  CA    . ALA I  5  96   ? 24.646  126.446 -7.204  1.00 46.80  ? 96   ALA C CA    1 
ATOM   6564  C  C     . ALA I  5  96   ? 23.793  127.554 -6.629  1.00 47.43  ? 96   ALA C C     1 
ATOM   6565  O  O     . ALA I  5  96   ? 23.971  127.944 -5.484  1.00 45.96  ? 96   ALA C O     1 
ATOM   6566  C  CB    . ALA I  5  96   ? 23.914  125.121 -7.057  1.00 45.87  ? 96   ALA C CB    1 
ATOM   6567  N  N     . ARG I  5  97   ? 22.867  128.057 -7.442  1.00 49.75  ? 97   ARG C N     1 
ATOM   6568  C  CA    . ARG I  5  97   ? 21.961  129.129 -7.034  1.00 50.75  ? 97   ARG C CA    1 
ATOM   6569  C  C     . ARG I  5  97   ? 20.942  128.613 -6.050  1.00 51.46  ? 97   ARG C C     1 
ATOM   6570  O  O     . ARG I  5  97   ? 20.440  127.503 -6.196  1.00 51.68  ? 97   ARG C O     1 
ATOM   6571  C  CB    . ARG I  5  97   ? 21.240  129.729 -8.264  1.00 50.40  ? 97   ARG C CB    1 
ATOM   6572  C  CG    . ARG I  5  97   ? 22.156  130.473 -9.210  1.00 49.91  ? 97   ARG C CG    1 
ATOM   6573  C  CD    . ARG I  5  97   ? 21.441  131.216 -10.313 1.00 48.85  ? 97   ARG C CD    1 
ATOM   6574  N  NE    . ARG I  5  97   ? 22.421  131.997 -11.062 1.00 50.62  ? 97   ARG C NE    1 
ATOM   6575  C  CZ    . ARG I  5  97   ? 22.199  132.569 -12.241 1.00 50.73  ? 97   ARG C CZ    1 
ATOM   6576  N  NH1   . ARG I  5  97   ? 21.014  132.457 -12.825 1.00 51.35  ? 97   ARG C NH1   1 
ATOM   6577  N  NH2   . ARG I  5  97   ? 23.166  133.253 -12.840 1.00 51.18  ? 97   ARG C NH2   1 
ATOM   6578  N  N     . LEU I  5  98   ? 20.634  129.413 -5.044  1.00 51.95  ? 98   LEU C N     1 
ATOM   6579  C  CA    . LEU I  5  98   ? 19.669  128.993 -4.048  1.00 54.36  ? 98   LEU C CA    1 
ATOM   6580  C  C     . LEU I  5  98   ? 18.814  130.157 -3.612  1.00 54.66  ? 98   LEU C C     1 
ATOM   6581  O  O     . LEU I  5  98   ? 19.276  131.290 -3.588  1.00 55.36  ? 98   LEU C O     1 
ATOM   6582  C  CB    . LEU I  5  98   ? 20.366  128.421 -2.805  1.00 55.88  ? 98   LEU C CB    1 
ATOM   6583  C  CG    . LEU I  5  98   ? 21.799  127.879 -2.739  1.00 58.10  ? 98   LEU C CG    1 
ATOM   6584  C  CD1   . LEU I  5  98   ? 22.800  128.940 -3.127  1.00 58.13  ? 98   LEU C CD1   1 
ATOM   6585  C  CD2   . LEU I  5  98   ? 22.078  127.452 -1.295  1.00 58.61  ? 98   LEU C CD2   1 
ATOM   6586  N  N     . GLN I  5  99   ? 17.564  129.877 -3.269  1.00 55.30  ? 99   GLN C N     1 
ATOM   6587  C  CA    . GLN I  5  99   ? 16.655  130.915 -2.792  1.00 54.84  ? 99   GLN C CA    1 
ATOM   6588  C  C     . GLN I  5  99   ? 15.710  130.357 -1.728  1.00 54.41  ? 99   GLN C C     1 
ATOM   6589  O  O     . GLN I  5  99   ? 15.058  129.336 -1.942  1.00 54.84  ? 99   GLN C O     1 
ATOM   6590  C  CB    . GLN I  5  99   ? 15.872  131.508 -3.989  1.00 54.72  ? 99   GLN C CB    1 
ATOM   6591  C  CG    . GLN I  5  99   ? 15.292  130.477 -5.002  1.00 52.45  ? 99   GLN C CG    1 
ATOM   6592  C  CD    . GLN I  5  99   ? 14.718  131.112 -6.276  1.00 48.49  ? 99   GLN C CD    1 
ATOM   6593  O  OE1   . GLN I  5  99   ? 15.405  131.852 -6.979  1.00 44.79  ? 99   GLN C OE1   1 
ATOM   6594  N  NE2   . GLN I  5  99   ? 13.456  130.811 -6.571  1.00 48.06  ? 99   GLN C NE2   1 
ATOM   6595  N  N     . LEU I  5  100  ? 15.654  131.026 -0.577  1.00 54.93  ? 100  LEU C N     1 
ATOM   6596  C  CA    . LEU I  5  100  ? 14.819  130.587 0.538   1.00 56.43  ? 100  LEU C CA    1 
ATOM   6597  C  C     . LEU I  5  100  ? 13.500  131.343 0.580   1.00 58.85  ? 100  LEU C C     1 
ATOM   6598  O  O     . LEU I  5  100  ? 13.480  132.574 0.513   1.00 59.02  ? 100  LEU C O     1 
ATOM   6599  C  CB    . LEU I  5  100  ? 15.582  130.780 1.855   1.00 54.29  ? 100  LEU C CB    1 
ATOM   6600  C  CG    . LEU I  5  100  ? 14.899  130.855 3.223   1.00 52.96  ? 100  LEU C CG    1 
ATOM   6601  C  CD1   . LEU I  5  100  ? 13.882  129.747 3.387   1.00 51.07  ? 100  LEU C CD1   1 
ATOM   6602  C  CD2   . LEU I  5  100  ? 15.973  130.740 4.289   1.00 51.88  ? 100  LEU C CD2   1 
ATOM   6603  N  N     . ILE I  5  101  ? 12.410  130.582 0.697   1.00 62.16  ? 101  ILE C N     1 
ATOM   6604  C  CA    . ILE I  5  101  ? 11.043  131.112 0.734   1.00 64.31  ? 101  ILE C CA    1 
ATOM   6605  C  C     . ILE I  5  101  ? 10.570  131.332 2.165   1.00 65.66  ? 101  ILE C C     1 
ATOM   6606  O  O     . ILE I  5  101  ? 11.019  130.662 3.096   1.00 66.55  ? 101  ILE C O     1 
ATOM   6607  C  CB    . ILE I  5  101  ? 10.028  130.144 0.079   1.00 65.06  ? 101  ILE C CB    1 
ATOM   6608  C  CG1   . ILE I  5  101  ? 10.562  129.630 -1.263  1.00 65.18  ? 101  ILE C CG1   1 
ATOM   6609  C  CG2   . ILE I  5  101  ? 8.685   130.857 -0.101  1.00 65.60  ? 101  ILE C CG2   1 
ATOM   6610  C  CD1   . ILE I  5  101  ? 10.719  130.676 -2.350  1.00 66.73  ? 101  ILE C CD1   1 
ATOM   6611  N  N     . HIS I  5  102  ? 9.646   132.268 2.326   1.00 65.93  ? 102  HIS C N     1 
ATOM   6612  C  CA    . HIS I  5  102  ? 9.102   132.571 3.629   1.00 66.93  ? 102  HIS C CA    1 
ATOM   6613  C  C     . HIS I  5  102  ? 7.578   132.512 3.619   1.00 67.03  ? 102  HIS C C     1 
ATOM   6614  O  O     . HIS I  5  102  ? 6.943   132.660 2.571   1.00 67.93  ? 102  HIS C O     1 
ATOM   6615  C  CB    . HIS I  5  102  ? 9.583   133.965 4.068   1.00 66.65  ? 102  HIS C CB    1 
ATOM   6616  C  CG    . HIS I  5  102  ? 10.755  133.937 5.015   1.00 66.94  ? 102  HIS C CG    1 
ATOM   6617  N  ND1   . HIS I  5  102  ? 10.616  133.714 6.372   1.00 66.90  ? 102  HIS C ND1   1 
ATOM   6618  C  CD2   . HIS I  5  102  ? 12.083  134.104 4.800   1.00 66.23  ? 102  HIS C CD2   1 
ATOM   6619  C  CE1   . HIS I  5  102  ? 11.804  133.746 6.948   1.00 65.35  ? 102  HIS C CE1   1 
ATOM   6620  N  NE2   . HIS I  5  102  ? 12.711  133.980 6.019   1.00 65.67  ? 102  HIS C NE2   1 
ATOM   6621  N  N     . LYS I  5  103  ? 6.999   132.275 4.792   1.00 66.83  ? 103  LYS C N     1 
ATOM   6622  C  CA    . LYS I  5  103  ? 5.556   132.262 4.912   1.00 65.65  ? 103  LYS C CA    1 
ATOM   6623  C  C     . LYS I  5  103  ? 5.028   133.698 4.965   1.00 67.37  ? 103  LYS C C     1 
ATOM   6624  O  O     . LYS I  5  103  ? 3.830   133.948 4.796   1.00 67.97  ? 103  LYS C O     1 
ATOM   6625  C  CB    . LYS I  5  103  ? 5.154   131.470 6.162   1.00 63.35  ? 103  LYS C CB    1 
ATOM   6626  C  CG    . LYS I  5  103  ? 4.084   130.403 5.884   1.00 58.78  ? 103  LYS C CG    1 
ATOM   6627  C  CD    . LYS I  5  103  ? 4.059   129.347 6.965   1.00 53.83  ? 103  LYS C CD    1 
ATOM   6628  C  CE    . LYS I  5  103  ? 2.688   129.235 7.563   1.00 51.86  ? 103  LYS C CE    1 
ATOM   6629  N  NZ    . LYS I  5  103  ? 2.276   130.520 8.169   1.00 49.99  ? 103  LYS C NZ    1 
ATOM   6630  N  N     . ASP I  5  104  ? 5.956   134.634 5.208   1.00 68.77  ? 104  ASP C N     1 
ATOM   6631  C  CA    . ASP I  5  104  ? 5.681   136.075 5.214   1.00 69.60  ? 104  ASP C CA    1 
ATOM   6632  C  C     . ASP I  5  104  ? 6.288   136.713 3.961   1.00 69.79  ? 104  ASP C C     1 
ATOM   6633  O  O     . ASP I  5  104  ? 7.256   136.177 3.420   1.00 69.12  ? 104  ASP C O     1 
ATOM   6634  C  CB    . ASP I  5  104  ? 6.269   136.761 6.469   1.00 71.47  ? 104  ASP C CB    1 
ATOM   6635  C  CG    . ASP I  5  104  ? 6.826   135.770 7.497   1.00 72.97  ? 104  ASP C CG    1 
ATOM   6636  O  OD1   . ASP I  5  104  ? 6.073   134.890 7.973   1.00 73.71  ? 104  ASP C OD1   1 
ATOM   6637  O  OD2   . ASP I  5  104  ? 8.030   135.874 7.835   1.00 74.17  ? 104  ASP C OD2   1 
ATOM   6638  N  N     . THR I  5  105  ? 5.736   137.833 3.499   1.00 70.67  ? 105  THR C N     1 
ATOM   6639  C  CA    . THR I  5  105  ? 6.212   138.477 2.273   1.00 71.89  ? 105  THR C CA    1 
ATOM   6640  C  C     . THR I  5  105  ? 7.718   138.642 2.265   1.00 72.61  ? 105  THR C C     1 
ATOM   6641  O  O     . THR I  5  105  ? 8.278   139.511 2.935   1.00 72.91  ? 105  THR C O     1 
ATOM   6642  C  CB    . THR I  5  105  ? 5.579   139.861 2.073   1.00 72.52  ? 105  THR C CB    1 
ATOM   6643  O  OG1   . THR I  5  105  ? 6.133   140.789 3.018   1.00 71.46  ? 105  THR C OG1   1 
ATOM   6644  C  CG2   . THR I  5  105  ? 4.068   139.775 2.272   1.00 72.47  ? 105  THR C CG2   1 
ATOM   6645  N  N     . GLY I  5  106  ? 8.362   137.784 1.486   1.00 73.20  ? 106  GLY C N     1 
ATOM   6646  C  CA    . GLY I  5  106  ? 9.802   137.818 1.368   1.00 74.46  ? 106  GLY C CA    1 
ATOM   6647  C  C     . GLY I  5  106  ? 10.371  136.491 0.915   1.00 75.98  ? 106  GLY C C     1 
ATOM   6648  O  O     . GLY I  5  106  ? 10.045  135.449 1.480   1.00 75.89  ? 106  GLY C O     1 
ATOM   6649  N  N     . LEU I  5  107  ? 11.212  136.550 -0.117  1.00 77.14  ? 107  LEU C N     1 
ATOM   6650  C  CA    . LEU I  5  107  ? 11.923  135.398 -0.691  1.00 77.82  ? 107  LEU C CA    1 
ATOM   6651  C  C     . LEU I  5  107  ? 13.377  135.798 -1.001  1.00 78.85  ? 107  LEU C C     1 
ATOM   6652  O  O     . LEU I  5  107  ? 13.662  136.315 -2.091  1.00 79.59  ? 107  LEU C O     1 
ATOM   6653  C  CB    . LEU I  5  107  ? 11.241  134.928 -2.000  1.00 77.06  ? 107  LEU C CB    1 
ATOM   6654  C  CG    . LEU I  5  107  ? 9.790   135.287 -2.395  1.00 75.10  ? 107  LEU C CG    1 
ATOM   6655  C  CD1   . LEU I  5  107  ? 9.705   135.452 -3.900  1.00 74.82  ? 107  LEU C CD1   1 
ATOM   6656  C  CD2   . LEU I  5  107  ? 8.831   134.217 -1.937  1.00 74.81  ? 107  LEU C CD2   1 
ATOM   6657  N  N     . ILE I  5  108  ? 14.296  135.579 -0.060  1.00 78.34  ? 108  ILE C N     1 
ATOM   6658  C  CA    . ILE I  5  108  ? 15.672  136.018 -0.276  1.00 78.20  ? 108  ILE C CA    1 
ATOM   6659  C  C     . ILE I  5  108  ? 16.478  134.996 -1.039  1.00 78.37  ? 108  ILE C C     1 
ATOM   6660  O  O     . ILE I  5  108  ? 16.522  133.808 -0.692  1.00 78.42  ? 108  ILE C O     1 
ATOM   6661  C  CB    . ILE I  5  108  ? 16.413  136.302 1.055   1.00 77.35  ? 108  ILE C CB    1 
ATOM   6662  C  CG1   . ILE I  5  108  ? 15.466  136.943 2.062   1.00 75.85  ? 108  ILE C CG1   1 
ATOM   6663  C  CG2   . ILE I  5  108  ? 17.622  137.195 0.791   1.00 77.69  ? 108  ILE C CG2   1 
ATOM   6664  C  CD1   . ILE I  5  108  ? 14.936  135.974 3.061   1.00 74.48  ? 108  ILE C CD1   1 
ATOM   6665  N  N     . LYS I  5  109  ? 17.129  135.481 -2.086  1.00 78.93  ? 109  LYS C N     1 
ATOM   6666  C  CA    . LYS I  5  109  ? 17.959  134.618 -2.900  1.00 79.22  ? 109  LYS C CA    1 
ATOM   6667  C  C     . LYS I  5  109  ? 19.430  134.967 -2.759  1.00 79.25  ? 109  LYS C C     1 
ATOM   6668  O  O     . LYS I  5  109  ? 19.869  136.015 -3.259  1.00 79.29  ? 109  LYS C O     1 
ATOM   6669  C  CB    . LYS I  5  109  ? 17.599  134.718 -4.394  1.00 78.84  ? 109  LYS C CB    1 
ATOM   6670  C  CG    . LYS I  5  109  ? 18.337  133.678 -5.249  1.00 78.27  ? 109  LYS C CG    1 
ATOM   6671  C  CD    . LYS I  5  109  ? 18.667  134.167 -6.648  1.00 78.72  ? 109  LYS C CD    1 
ATOM   6672  C  CE    . LYS I  5  109  ? 19.612  133.185 -7.340  1.00 78.51  ? 109  LYS C CE    1 
ATOM   6673  N  NZ    . LYS I  5  109  ? 20.203  133.728 -8.597  1.00 78.76  ? 109  LYS C NZ    1 
ATOM   6674  N  N     . GLU I  5  110  ? 20.185  134.109 -2.067  1.00 79.03  ? 110  GLU C N     1 
ATOM   6675  C  CA    . GLU I  5  110  ? 21.635  134.285 -2.024  1.00 77.15  ? 110  GLU C CA    1 
ATOM   6676  C  C     . GLU I  5  110  ? 22.288  133.316 -3.011  1.00 76.59  ? 110  GLU C C     1 
ATOM   6677  O  O     . GLU I  5  110  ? 22.530  132.140 -2.738  1.00 76.47  ? 110  GLU C O     1 
ATOM   6678  C  CB    . GLU I  5  110  ? 22.210  134.075 -0.621  1.00 76.59  ? 110  GLU C CB    1 
ATOM   6679  C  CG    . GLU I  5  110  ? 23.249  135.199 -0.309  1.00 75.21  ? 110  GLU C CG    1 
ATOM   6680  C  CD    . GLU I  5  110  ? 24.618  135.054 -1.011  1.00 73.58  ? 110  GLU C CD    1 
ATOM   6681  O  OE1   . GLU I  5  110  ? 24.670  134.811 -2.235  1.00 73.13  ? 110  GLU C OE1   1 
ATOM   6682  O  OE2   . GLU I  5  110  ? 25.655  135.196 -0.326  1.00 72.72  ? 110  GLU C OE2   1 
ATOM   6683  N  N     . ASP I  5  111  ? 22.528  133.891 -4.181  1.00 75.80  ? 111  ASP C N     1 
ATOM   6684  C  CA    . ASP I  5  111  ? 23.044  133.283 -5.397  1.00 75.22  ? 111  ASP C CA    1 
ATOM   6685  C  C     . ASP I  5  111  ? 24.119  132.224 -5.166  1.00 73.47  ? 111  ASP C C     1 
ATOM   6686  O  O     . ASP I  5  111  ? 23.871  131.040 -5.418  1.00 73.13  ? 111  ASP C O     1 
ATOM   6687  C  CB    . ASP I  5  111  ? 23.579  134.386 -6.315  1.00 77.24  ? 111  ASP C CB    1 
ATOM   6688  C  CG    . ASP I  5  111  ? 22.457  135.152 -7.013  1.00 78.98  ? 111  ASP C CG    1 
ATOM   6689  O  OD1   . ASP I  5  111  ? 21.390  135.339 -6.382  1.00 79.28  ? 111  ASP C OD1   1 
ATOM   6690  O  OD2   . ASP I  5  111  ? 22.644  135.564 -8.185  1.00 80.11  ? 111  ASP C OD2   1 
ATOM   6691  N  N     . GLU I  5  112  ? 25.302  132.604 -4.704  1.00 70.77  ? 112  GLU C N     1 
ATOM   6692  C  CA    . GLU I  5  112  ? 26.340  131.594 -4.619  1.00 68.54  ? 112  GLU C CA    1 
ATOM   6693  C  C     . GLU I  5  112  ? 26.768  131.285 -3.210  1.00 67.44  ? 112  GLU C C     1 
ATOM   6694  O  O     . GLU I  5  112  ? 26.719  132.118 -2.308  1.00 67.68  ? 112  GLU C O     1 
ATOM   6695  C  CB    . GLU I  5  112  ? 27.566  132.024 -5.438  1.00 67.19  ? 112  GLU C CB    1 
ATOM   6696  C  CG    . GLU I  5  112  ? 27.353  132.017 -6.952  1.00 64.19  ? 112  GLU C CG    1 
ATOM   6697  C  CD    . GLU I  5  112  ? 26.304  131.006 -7.395  1.00 62.66  ? 112  GLU C CD    1 
ATOM   6698  O  OE1   . GLU I  5  112  ? 26.290  129.872 -6.870  1.00 61.03  ? 112  GLU C OE1   1 
ATOM   6699  O  OE2   . GLU I  5  112  ? 25.493  131.355 -8.273  1.00 62.10  ? 112  GLU C OE2   1 
ATOM   6700  N  N     . VAL I  5  113  ? 27.192  130.031 -3.078  1.00 65.39  ? 113  VAL C N     1 
ATOM   6701  C  CA    . VAL I  5  113  ? 27.750  129.433 -1.872  1.00 64.09  ? 113  VAL C CA    1 
ATOM   6702  C  C     . VAL I  5  113  ? 28.726  128.324 -2.267  1.00 62.68  ? 113  VAL C C     1 
ATOM   6703  O  O     . VAL I  5  113  ? 28.290  127.212 -2.586  1.00 61.89  ? 113  VAL C O     1 
ATOM   6704  C  CB    . VAL I  5  113  ? 26.654  128.801 -0.924  1.00 64.46  ? 113  VAL C CB    1 
ATOM   6705  C  CG1   . VAL I  5  113  ? 27.326  128.317 0.352   1.00 65.40  ? 113  VAL C CG1   1 
ATOM   6706  C  CG2   . VAL I  5  113  ? 25.581  129.825 -0.547  1.00 63.05  ? 113  VAL C CG2   1 
ATOM   6707  N  N     . PHE I  5  114  ? 30.036  128.608 -2.270  1.00 61.71  ? 114  PHE C N     1 
ATOM   6708  C  CA    . PHE I  5  114  ? 30.962  127.553 -2.682  1.00 60.44  ? 114  PHE C CA    1 
ATOM   6709  C  C     . PHE I  5  114  ? 31.264  126.596 -1.581  1.00 59.42  ? 114  PHE C C     1 
ATOM   6710  O  O     . PHE I  5  114  ? 32.179  126.747 -0.765  1.00 59.12  ? 114  PHE C O     1 
ATOM   6711  C  CB    . PHE I  5  114  ? 32.315  128.041 -3.281  1.00 60.00  ? 114  PHE C CB    1 
ATOM   6712  C  CG    . PHE I  5  114  ? 33.002  129.207 -2.585  1.00 59.89  ? 114  PHE C CG    1 
ATOM   6713  C  CD1   . PHE I  5  114  ? 32.695  129.624 -1.263  1.00 59.52  ? 114  PHE C CD1   1 
ATOM   6714  C  CD2   . PHE I  5  114  ? 34.012  129.896 -3.303  1.00 59.58  ? 114  PHE C CD2   1 
ATOM   6715  C  CE1   . PHE I  5  114  ? 33.393  130.723 -0.665  1.00 58.99  ? 114  PHE C CE1   1 
ATOM   6716  C  CE2   . PHE I  5  114  ? 34.719  130.983 -2.739  1.00 58.63  ? 114  PHE C CE2   1 
ATOM   6717  C  CZ    . PHE I  5  114  ? 34.414  131.404 -1.416  1.00 59.71  ? 114  PHE C CZ    1 
ATOM   6718  N  N     . LEU I  5  115  ? 30.420  125.585 -1.603  1.00 58.99  ? 115  LEU C N     1 
ATOM   6719  C  CA    . LEU I  5  115  ? 30.508  124.464 -0.726  1.00 57.92  ? 115  LEU C CA    1 
ATOM   6720  C  C     . LEU I  5  115  ? 30.958  123.271 -1.519  1.00 56.53  ? 115  LEU C C     1 
ATOM   6721  O  O     . LEU I  5  115  ? 30.362  122.951 -2.546  1.00 56.88  ? 115  LEU C O     1 
ATOM   6722  C  CB    . LEU I  5  115  ? 29.142  124.174 -0.082  1.00 59.06  ? 115  LEU C CB    1 
ATOM   6723  C  CG    . LEU I  5  115  ? 27.929  123.908 -1.002  1.00 59.33  ? 115  LEU C CG    1 
ATOM   6724  C  CD1   . LEU I  5  115  ? 27.163  122.703 -0.515  1.00 59.09  ? 115  LEU C CD1   1 
ATOM   6725  C  CD2   . LEU I  5  115  ? 27.026  125.104 -1.026  1.00 59.16  ? 115  LEU C CD2   1 
ATOM   6726  N  N     . GLY I  5  116  ? 32.023  122.628 -1.089  1.00 55.73  ? 116  GLY C N     1 
ATOM   6727  C  CA    . GLY I  5  116  ? 32.438  121.469 -1.827  1.00 53.03  ? 116  GLY C CA    1 
ATOM   6728  C  C     . GLY I  5  116  ? 33.270  121.744 -3.051  1.00 50.67  ? 116  GLY C C     1 
ATOM   6729  O  O     . GLY I  5  116  ? 32.838  122.333 -4.050  1.00 49.73  ? 116  GLY C O     1 
ATOM   6730  N  N     . HIS I  5  117  ? 34.509  121.297 -2.924  1.00 48.64  ? 117  HIS C N     1 
ATOM   6731  C  CA    . HIS I  5  117  ? 35.473  121.304 -4.001  1.00 46.86  ? 117  HIS C CA    1 
ATOM   6732  C  C     . HIS I  5  117  ? 35.674  119.865 -4.476  1.00 45.12  ? 117  HIS C C     1 
ATOM   6733  O  O     . HIS I  5  117  ? 36.355  119.080 -3.818  1.00 45.13  ? 117  HIS C O     1 
ATOM   6734  C  CB    . HIS I  5  117  ? 36.794  121.951 -3.518  1.00 46.75  ? 117  HIS C CB    1 
ATOM   6735  C  CG    . HIS I  5  117  ? 36.752  123.460 -3.518  1.00 46.39  ? 117  HIS C CG    1 
ATOM   6736  N  ND1   . HIS I  5  117  ? 36.439  124.200 -4.642  1.00 45.92  ? 117  HIS C ND1   1 
ATOM   6737  C  CD2   . HIS I  5  117  ? 36.964  124.361 -2.529  1.00 45.64  ? 117  HIS C CD2   1 
ATOM   6738  C  CE1   . HIS I  5  117  ? 36.459  125.487 -4.344  1.00 45.25  ? 117  HIS C CE1   1 
ATOM   6739  N  NE2   . HIS I  5  117  ? 36.775  125.612 -3.068  1.00 45.30  ? 117  HIS C NE2   1 
ATOM   6740  N  N     . ILE I  5  118  ? 35.055  119.511 -5.595  1.00 41.54  ? 118  ILE C N     1 
ATOM   6741  C  CA    . ILE I  5  118  ? 35.122  118.146 -6.063  1.00 40.42  ? 118  ILE C CA    1 
ATOM   6742  C  C     . ILE I  5  118  ? 36.189  117.954 -7.090  1.00 41.30  ? 118  ILE C C     1 
ATOM   6743  O  O     . ILE I  5  118  ? 36.393  118.798 -7.955  1.00 40.66  ? 118  ILE C O     1 
ATOM   6744  C  CB    . ILE I  5  118  ? 33.816  117.699 -6.656  1.00 39.39  ? 118  ILE C CB    1 
ATOM   6745  C  CG1   . ILE I  5  118  ? 33.354  118.706 -7.715  1.00 39.01  ? 118  ILE C CG1   1 
ATOM   6746  C  CG2   . ILE I  5  118  ? 32.847  117.474 -5.551  1.00 38.68  ? 118  ILE C CG2   1 
ATOM   6747  C  CD1   . ILE I  5  118  ? 33.809  118.404 -9.136  1.00 36.28  ? 118  ILE C CD1   1 
ATOM   6748  N  N     . PRO I  5  119  ? 36.877  116.803 -7.020  1.00 42.60  ? 119  PRO C N     1 
ATOM   6749  C  CA    . PRO I  5  119  ? 37.956  116.477 -7.944  1.00 43.00  ? 119  PRO C CA    1 
ATOM   6750  C  C     . PRO I  5  119  ? 37.467  116.406 -9.349  1.00 42.91  ? 119  PRO C C     1 
ATOM   6751  O  O     . PRO I  5  119  ? 36.296  116.138 -9.589  1.00 43.14  ? 119  PRO C O     1 
ATOM   6752  C  CB    . PRO I  5  119  ? 38.467  115.117 -7.458  1.00 43.48  ? 119  PRO C CB    1 
ATOM   6753  C  CG    . PRO I  5  119  ? 37.790  114.902 -6.139  1.00 44.02  ? 119  PRO C CG    1 
ATOM   6754  C  CD    . PRO I  5  119  ? 36.478  115.580 -6.306  1.00 43.10  ? 119  PRO C CD    1 
ATOM   6755  N  N     . LEU I  5  120  ? 38.364  116.662 -10.280 1.00 43.31  ? 120  LEU C N     1 
ATOM   6756  C  CA    . LEU I  5  120  ? 38.003  116.536 -11.658 1.00 42.51  ? 120  LEU C CA    1 
ATOM   6757  C  C     . LEU I  5  120  ? 38.695  115.340 -12.230 1.00 41.31  ? 120  LEU C C     1 
ATOM   6758  O  O     . LEU I  5  120  ? 39.517  114.747 -11.526 1.00 41.16  ? 120  LEU C O     1 
ATOM   6759  C  CB    . LEU I  5  120  ? 38.382  117.814 -12.432 1.00 44.26  ? 120  LEU C CB    1 
ATOM   6760  C  CG    . LEU I  5  120  ? 37.326  118.364 -13.434 1.00 43.71  ? 120  LEU C CG    1 
ATOM   6761  C  CD1   . LEU I  5  120  ? 37.781  119.699 -13.977 1.00 43.57  ? 120  LEU C CD1   1 
ATOM   6762  C  CD2   . LEU I  5  120  ? 37.113  117.391 -14.596 1.00 45.48  ? 120  LEU C CD2   1 
ATOM   6763  N  N     . MET I  5  121  ? 38.388  114.964 -13.465 1.00 40.04  ? 121  MET C N     1 
ATOM   6764  C  CA    . MET I  5  121  ? 39.049  113.810 -14.042 1.00 39.77  ? 121  MET C CA    1 
ATOM   6765  C  C     . MET I  5  121  ? 40.026  114.214 -15.113 1.00 40.71  ? 121  MET C C     1 
ATOM   6766  O  O     . MET I  5  121  ? 39.775  115.169 -15.850 1.00 38.46  ? 121  MET C O     1 
ATOM   6767  C  CB    . MET I  5  121  ? 38.038  112.840 -14.647 1.00 36.55  ? 121  MET C CB    1 
ATOM   6768  C  CG    . MET I  5  121  ? 38.636  111.465 -14.867 1.00 30.03  ? 121  MET C CG    1 
ATOM   6769  S  SD    . MET I  5  121  ? 37.401  110.354 -15.412 1.00 24.18  ? 121  MET C SD    1 
ATOM   6770  C  CE    . MET I  5  121  ? 36.606  109.938 -13.917 1.00 29.56  ? 121  MET C CE    1 
ATOM   6771  N  N     . THR I  5  122  ? 41.145  113.493 -15.187 1.00 43.77  ? 122  THR C N     1 
ATOM   6772  C  CA    . THR I  5  122  ? 42.125  113.770 -16.232 1.00 47.93  ? 122  THR C CA    1 
ATOM   6773  C  C     . THR I  5  122  ? 41.598  113.261 -17.557 1.00 50.01  ? 122  THR C C     1 
ATOM   6774  O  O     . THR I  5  122  ? 40.751  112.365 -17.587 1.00 49.97  ? 122  THR C O     1 
ATOM   6775  C  CB    . THR I  5  122  ? 43.537  113.079 -15.986 1.00 48.47  ? 122  THR C CB    1 
ATOM   6776  O  OG1   . THR I  5  122  ? 44.000  113.347 -14.657 1.00 48.43  ? 122  THR C OG1   1 
ATOM   6777  C  CG2   . THR I  5  122  ? 44.597  113.628 -16.955 1.00 47.50  ? 122  THR C CG2   1 
ATOM   6778  N  N     . GLU I  5  123  ? 42.084  113.832 -18.644 1.00 52.52  ? 123  GLU C N     1 
ATOM   6779  C  CA    . GLU I  5  123  ? 41.639  113.417 -19.949 1.00 54.97  ? 123  GLU C CA    1 
ATOM   6780  C  C     . GLU I  5  123  ? 41.798  111.906 -20.126 1.00 55.01  ? 123  GLU C C     1 
ATOM   6781  O  O     . GLU I  5  123  ? 41.010  111.285 -20.836 1.00 56.06  ? 123  GLU C O     1 
ATOM   6782  C  CB    . GLU I  5  123  ? 42.437  114.188 -21.016 1.00 57.13  ? 123  GLU C CB    1 
ATOM   6783  C  CG    . GLU I  5  123  ? 42.142  115.715 -21.017 1.00 59.30  ? 123  GLU C CG    1 
ATOM   6784  C  CD    . GLU I  5  123  ? 41.217  116.159 -22.157 1.00 60.67  ? 123  GLU C CD    1 
ATOM   6785  O  OE1   . GLU I  5  123  ? 40.406  117.104 -21.966 1.00 59.46  ? 123  GLU C OE1   1 
ATOM   6786  O  OE2   . GLU I  5  123  ? 41.312  115.560 -23.253 1.00 62.47  ? 123  GLU C OE2   1 
ATOM   6787  N  N     . ASP I  5  124  ? 42.797  111.317 -19.467 1.00 54.04  ? 124  ASP C N     1 
ATOM   6788  C  CA    . ASP I  5  124  ? 43.055  109.879 -19.584 1.00 53.91  ? 124  ASP C CA    1 
ATOM   6789  C  C     . ASP I  5  124  ? 42.036  109.040 -18.795 1.00 53.51  ? 124  ASP C C     1 
ATOM   6790  O  O     . ASP I  5  124  ? 41.671  107.943 -19.227 1.00 53.35  ? 124  ASP C O     1 
ATOM   6791  C  CB    . ASP I  5  124  ? 44.477  109.555 -19.105 1.00 53.74  ? 124  ASP C CB    1 
ATOM   6792  C  CG    . ASP I  5  124  ? 44.849  110.276 -17.835 1.00 52.18  ? 124  ASP C CG    1 
ATOM   6793  O  OD1   . ASP I  5  124  ? 44.061  110.218 -16.885 1.00 52.20  ? 124  ASP C OD1   1 
ATOM   6794  O  OD2   . ASP I  5  124  ? 45.930  110.897 -17.782 1.00 53.74  ? 124  ASP C OD2   1 
ATOM   6795  N  N     . GLY I  5  125  ? 41.584  109.541 -17.651 1.00 53.05  ? 125  GLY C N     1 
ATOM   6796  C  CA    . GLY I  5  125  ? 40.615  108.799 -16.865 1.00 51.39  ? 125  GLY C CA    1 
ATOM   6797  C  C     . GLY I  5  125  ? 40.962  108.758 -15.396 1.00 50.34  ? 125  GLY C C     1 
ATOM   6798  O  O     . GLY I  5  125  ? 40.124  108.421 -14.568 1.00 49.99  ? 125  GLY C O     1 
ATOM   6799  N  N     . SER I  5  126  ? 42.200  109.100 -15.067 1.00 49.72  ? 126  SER C N     1 
ATOM   6800  C  CA    . SER I  5  126  ? 42.631  109.091 -13.677 1.00 48.36  ? 126  SER C CA    1 
ATOM   6801  C  C     . SER I  5  126  ? 42.459  110.475 -13.030 1.00 47.04  ? 126  SER C C     1 
ATOM   6802  O  O     . SER I  5  126  ? 42.179  111.459 -13.714 1.00 48.59  ? 126  SER C O     1 
ATOM   6803  C  CB    . SER I  5  126  ? 44.098  108.613 -13.586 1.00 48.65  ? 126  SER C CB    1 
ATOM   6804  O  OG    . SER I  5  126  ? 45.000  109.417 -14.310 1.00 50.39  ? 126  SER C OG    1 
ATOM   6805  N  N     . PHE I  5  127  ? 42.612  110.538 -11.705 1.00 45.28  ? 127  PHE C N     1 
ATOM   6806  C  CA    . PHE I  5  127  ? 42.478  111.789 -10.950 1.00 40.91  ? 127  PHE C CA    1 
ATOM   6807  C  C     . PHE I  5  127  ? 43.814  112.222 -10.363 1.00 38.46  ? 127  PHE C C     1 
ATOM   6808  O  O     . PHE I  5  127  ? 44.851  111.624 -10.612 1.00 37.36  ? 127  PHE C O     1 
ATOM   6809  C  CB    . PHE I  5  127  ? 41.522  111.641 -9.756  1.00 40.80  ? 127  PHE C CB    1 
ATOM   6810  C  CG    . PHE I  5  127  ? 40.189  111.008 -10.075 1.00 38.92  ? 127  PHE C CG    1 
ATOM   6811  C  CD1   . PHE I  5  127  ? 40.101  109.627 -10.348 1.00 36.75  ? 127  PHE C CD1   1 
ATOM   6812  C  CD2   . PHE I  5  127  ? 39.006  111.787 -10.078 1.00 38.45  ? 127  PHE C CD2   1 
ATOM   6813  C  CE1   . PHE I  5  127  ? 38.853  109.018 -10.619 1.00 36.55  ? 127  PHE C CE1   1 
ATOM   6814  C  CE2   . PHE I  5  127  ? 37.748  111.196 -10.348 1.00 37.20  ? 127  PHE C CE2   1 
ATOM   6815  C  CZ    . PHE I  5  127  ? 37.672  109.805 -10.619 1.00 37.48  ? 127  PHE C CZ    1 
ATOM   6816  N  N     . ILE I  5  128  ? 43.745  113.285 -9.577  1.00 36.34  ? 128  ILE C N     1 
ATOM   6817  C  CA    . ILE I  5  128  ? 44.868  113.841 -8.834  1.00 34.37  ? 128  ILE C CA    1 
ATOM   6818  C  C     . ILE I  5  128  ? 44.379  114.285 -7.468  1.00 33.92  ? 128  ILE C C     1 
ATOM   6819  O  O     . ILE I  5  128  ? 43.952  115.424 -7.278  1.00 34.99  ? 128  ILE C O     1 
ATOM   6820  C  CB    . ILE I  5  128  ? 45.537  115.064 -9.572  1.00 33.71  ? 128  ILE C CB    1 
ATOM   6821  C  CG1   . ILE I  5  128  ? 46.148  114.599 -10.896 1.00 33.91  ? 128  ILE C CG1   1 
ATOM   6822  C  CG2   . ILE I  5  128  ? 46.683  115.631 -8.758  1.00 29.89  ? 128  ILE C CG2   1 
ATOM   6823  C  CD1   . ILE I  5  128  ? 46.874  115.681 -11.680 1.00 33.50  ? 128  ILE C CD1   1 
ATOM   6824  N  N     . ILE I  5  129  ? 44.415  113.363 -6.518  1.00 32.33  ? 129  ILE C N     1 
ATOM   6825  C  CA    . ILE I  5  129  ? 43.948  113.656 -5.177  1.00 30.68  ? 129  ILE C CA    1 
ATOM   6826  C  C     . ILE I  5  129  ? 44.974  114.464 -4.428  1.00 32.32  ? 129  ILE C C     1 
ATOM   6827  O  O     . ILE I  5  129  ? 44.843  115.663 -4.322  1.00 33.59  ? 129  ILE C O     1 
ATOM   6828  C  CB    . ILE I  5  129  ? 43.629  112.356 -4.420  1.00 25.93  ? 129  ILE C CB    1 
ATOM   6829  C  CG1   . ILE I  5  129  ? 42.330  111.744 -4.933  1.00 23.97  ? 129  ILE C CG1   1 
ATOM   6830  C  CG2   . ILE I  5  129  ? 43.416  112.651 -2.956  1.00 25.01  ? 129  ILE C CG2   1 
ATOM   6831  C  CD1   . ILE I  5  129  ? 42.209  111.527 -6.426  1.00 21.77  ? 129  ILE C CD1   1 
ATOM   6832  N  N     . ASN I  5  130  ? 46.007  113.823 -3.900  1.00 33.93  ? 130  ASN C N     1 
ATOM   6833  C  CA    . ASN I  5  130  ? 47.043  114.589 -3.212  1.00 32.44  ? 130  ASN C CA    1 
ATOM   6834  C  C     . ASN I  5  130  ? 48.433  114.178 -3.694  1.00 34.30  ? 130  ASN C C     1 
ATOM   6835  O  O     . ASN I  5  130  ? 48.987  113.174 -3.252  1.00 34.13  ? 130  ASN C O     1 
ATOM   6836  C  CB    . ASN I  5  130  ? 46.940  114.416 -1.688  1.00 31.09  ? 130  ASN C CB    1 
ATOM   6837  C  CG    . ASN I  5  130  ? 45.669  115.018 -1.115  1.00 29.64  ? 130  ASN C CG    1 
ATOM   6838  O  OD1   . ASN I  5  130  ? 45.350  116.189 -1.361  1.00 26.36  ? 130  ASN C OD1   1 
ATOM   6839  N  ND2   . ASN I  5  130  ? 44.937  114.220 -0.336  1.00 29.35  ? 130  ASN C ND2   1 
ATOM   6840  N  N     . GLY I  5  131  ? 48.978  114.966 -4.621  1.00 35.87  ? 131  GLY C N     1 
ATOM   6841  C  CA    . GLY I  5  131  ? 50.295  114.712 -5.195  1.00 36.07  ? 131  GLY C CA    1 
ATOM   6842  C  C     . GLY I  5  131  ? 50.326  113.566 -6.206  1.00 36.04  ? 131  GLY C C     1 
ATOM   6843  O  O     . GLY I  5  131  ? 50.995  113.639 -7.253  1.00 35.18  ? 131  GLY C O     1 
ATOM   6844  N  N     . ALA I  5  132  ? 49.587  112.502 -5.900  1.00 35.79  ? 132  ALA C N     1 
ATOM   6845  C  CA    . ALA I  5  132  ? 49.587  111.321 -6.740  1.00 33.45  ? 132  ALA C CA    1 
ATOM   6846  C  C     . ALA I  5  132  ? 48.237  111.063 -7.380  1.00 32.19  ? 132  ALA C C     1 
ATOM   6847  O  O     . ALA I  5  132  ? 47.175  111.161 -6.752  1.00 31.40  ? 132  ALA C O     1 
ATOM   6848  C  CB    . ALA I  5  132  ? 49.985  110.131 -5.918  1.00 34.75  ? 132  ALA C CB    1 
ATOM   6849  N  N     . ASP I  5  133  ? 48.323  110.715 -8.654  1.00 31.28  ? 133  ASP C N     1 
ATOM   6850  C  CA    . ASP I  5  133  ? 47.172  110.382 -9.447  1.00 29.29  ? 133  ASP C CA    1 
ATOM   6851  C  C     . ASP I  5  133  ? 46.466  109.189 -8.842  1.00 29.54  ? 133  ASP C C     1 
ATOM   6852  O  O     . ASP I  5  133  ? 47.118  108.209 -8.459  1.00 30.33  ? 133  ASP C O     1 
ATOM   6853  C  CB    . ASP I  5  133  ? 47.552  109.999 -10.893 1.00 30.47  ? 133  ASP C CB    1 
ATOM   6854  C  CG    . ASP I  5  133  ? 48.647  110.868 -11.507 1.00 30.14  ? 133  ASP C CG    1 
ATOM   6855  O  OD1   . ASP I  5  133  ? 48.749  110.826 -12.747 1.00 29.24  ? 133  ASP C OD1   1 
ATOM   6856  O  OD2   . ASP I  5  133  ? 49.398  111.572 -10.800 1.00 30.49  ? 133  ASP C OD2   1 
ATOM   6857  N  N     . ARG I  5  134  ? 45.152  109.231 -8.748  1.00 28.58  ? 134  ARG C N     1 
ATOM   6858  C  CA    . ARG I  5  134  ? 44.469  108.087 -8.177  1.00 26.74  ? 134  ARG C CA    1 
ATOM   6859  C  C     . ARG I  5  134  ? 43.349  107.609 -9.067  1.00 25.59  ? 134  ARG C C     1 
ATOM   6860  O  O     . ARG I  5  134  ? 42.953  108.294 -9.996  1.00 24.87  ? 134  ARG C O     1 
ATOM   6861  C  CB    . ARG I  5  134  ? 43.931  108.439 -6.794  1.00 28.19  ? 134  ARG C CB    1 
ATOM   6862  C  CG    . ARG I  5  134  ? 44.927  108.265 -5.649  1.00 26.38  ? 134  ARG C CG    1 
ATOM   6863  C  CD    . ARG I  5  134  ? 44.163  108.151 -4.370  1.00 23.04  ? 134  ARG C CD    1 
ATOM   6864  N  NE    . ARG I  5  134  ? 44.984  107.810 -3.229  1.00 21.66  ? 134  ARG C NE    1 
ATOM   6865  C  CZ    . ARG I  5  134  ? 44.466  107.325 -2.110  1.00 24.51  ? 134  ARG C CZ    1 
ATOM   6866  N  NH1   . ARG I  5  134  ? 43.154  107.142 -2.028  1.00 26.26  ? 134  ARG C NH1   1 
ATOM   6867  N  NH2   . ARG I  5  134  ? 45.241  107.018 -1.080  1.00 25.56  ? 134  ARG C NH2   1 
ATOM   6868  N  N     . VAL I  5  135  ? 42.837  106.423 -8.768  1.00 25.91  ? 135  VAL C N     1 
ATOM   6869  C  CA    . VAL I  5  135  ? 41.774  105.826 -9.572  1.00 26.65  ? 135  VAL C CA    1 
ATOM   6870  C  C     . VAL I  5  135  ? 40.639  105.263 -8.709  1.00 25.35  ? 135  VAL C C     1 
ATOM   6871  O  O     . VAL I  5  135  ? 40.843  104.711 -7.629  1.00 25.22  ? 135  VAL C O     1 
ATOM   6872  C  CB    . VAL I  5  135  ? 42.321  104.679 -10.441 1.00 28.80  ? 135  VAL C CB    1 
ATOM   6873  C  CG1   . VAL I  5  135  ? 41.198  104.061 -11.260 1.00 28.89  ? 135  VAL C CG1   1 
ATOM   6874  C  CG2   . VAL I  5  135  ? 43.399  105.220 -11.383 1.00 32.44  ? 135  VAL C CG2   1 
ATOM   6875  N  N     . ILE I  5  136  ? 39.430  105.412 -9.228  1.00 23.62  ? 136  ILE C N     1 
ATOM   6876  C  CA    . ILE I  5  136  ? 38.212  104.928 -8.590  1.00 21.15  ? 136  ILE C CA    1 
ATOM   6877  C  C     . ILE I  5  136  ? 37.760  103.607 -9.235  1.00 18.63  ? 136  ILE C C     1 
ATOM   6878  O  O     . ILE I  5  136  ? 37.207  103.610 -10.324 1.00 18.65  ? 136  ILE C O     1 
ATOM   6879  C  CB    . ILE I  5  136  ? 37.089  106.007 -8.748  1.00 23.01  ? 136  ILE C CB    1 
ATOM   6880  C  CG1   . ILE I  5  136  ? 37.526  107.309 -8.044  1.00 20.97  ? 136  ILE C CG1   1 
ATOM   6881  C  CG2   . ILE I  5  136  ? 35.742  105.442 -8.278  1.00 22.56  ? 136  ILE C CG2   1 
ATOM   6882  C  CD1   . ILE I  5  136  ? 37.557  107.277 -6.533  1.00 20.46  ? 136  ILE C CD1   1 
ATOM   6883  N  N     . VAL I  5  137  ? 37.980  102.476 -8.582  1.00 17.22  ? 137  VAL C N     1 
ATOM   6884  C  CA    . VAL I  5  137  ? 37.595  101.226 -9.227  1.00 15.91  ? 137  VAL C CA    1 
ATOM   6885  C  C     . VAL I  5  137  ? 36.095  100.970 -9.132  1.00 13.06  ? 137  VAL C C     1 
ATOM   6886  O  O     . VAL I  5  137  ? 35.454  101.260 -8.137  1.00 12.71  ? 137  VAL C O     1 
ATOM   6887  C  CB    . VAL I  5  137  ? 38.385  99.978  -8.633  1.00 17.17  ? 137  VAL C CB    1 
ATOM   6888  C  CG1   . VAL I  5  137  ? 39.884  100.244 -8.662  1.00 18.25  ? 137  VAL C CG1   1 
ATOM   6889  C  CG2   . VAL I  5  137  ? 37.947  99.689  -7.233  1.00 17.69  ? 137  VAL C CG2   1 
ATOM   6890  N  N     . SER I  5  138  ? 35.556  100.419 -10.209 1.00 10.19  ? 138  SER C N     1 
ATOM   6891  C  CA    . SER I  5  138  ? 34.158  100.062 -10.295 1.00 8.66   ? 138  SER C CA    1 
ATOM   6892  C  C     . SER I  5  138  ? 33.851  98.899  -9.372  1.00 10.06  ? 138  SER C C     1 
ATOM   6893  O  O     . SER I  5  138  ? 34.771  98.248  -8.915  1.00 11.34  ? 138  SER C O     1 
ATOM   6894  C  CB    . SER I  5  138  ? 33.859  99.712  -11.732 1.00 8.82   ? 138  SER C CB    1 
ATOM   6895  O  OG    . SER I  5  138  ? 34.657  100.534 -12.567 1.00 4.06   ? 138  SER C OG    1 
ATOM   6896  N  N     . GLN I  5  139  ? 32.589  98.604  -9.100  1.00 11.12  ? 139  GLN C N     1 
ATOM   6897  C  CA    . GLN I  5  139  ? 32.276  97.547  -8.140  1.00 10.86  ? 139  GLN C CA    1 
ATOM   6898  C  C     . GLN I  5  139  ? 31.109  96.718  -8.580  1.00 11.98  ? 139  GLN C C     1 
ATOM   6899  O  O     . GLN I  5  139  ? 30.445  97.093  -9.528  1.00 13.39  ? 139  GLN C O     1 
ATOM   6900  C  CB    . GLN I  5  139  ? 31.929  98.196  -6.852  1.00 11.34  ? 139  GLN C CB    1 
ATOM   6901  C  CG    . GLN I  5  139  ? 32.196  97.416  -5.685  1.00 12.37  ? 139  GLN C CG    1 
ATOM   6902  C  CD    . GLN I  5  139  ? 32.231  98.334  -4.537  1.00 13.04  ? 139  GLN C CD    1 
ATOM   6903  O  OE1   . GLN I  5  139  ? 33.228  98.433  -3.828  1.00 15.15  ? 139  GLN C OE1   1 
ATOM   6904  N  NE2   . GLN I  5  139  ? 31.142  99.043  -4.337  1.00 12.82  ? 139  GLN C NE2   1 
ATOM   6905  N  N     . ILE I  5  140  ? 30.853  95.611  -7.867  1.00 11.70  ? 140  ILE C N     1 
ATOM   6906  C  CA    . ILE I  5  140  ? 29.722  94.692  -8.155  1.00 9.92   ? 140  ILE C CA    1 
ATOM   6907  C  C     . ILE I  5  140  ? 28.894  94.393  -6.897  1.00 10.72  ? 140  ILE C C     1 
ATOM   6908  O  O     . ILE I  5  140  ? 29.403  94.302  -5.789  1.00 8.10   ? 140  ILE C O     1 
ATOM   6909  C  CB    . ILE I  5  140  ? 30.191  93.296  -8.737  1.00 8.05   ? 140  ILE C CB    1 
ATOM   6910  C  CG1   . ILE I  5  140  ? 31.083  92.581  -7.723  1.00 3.48   ? 140  ILE C CG1   1 
ATOM   6911  C  CG2   . ILE I  5  140  ? 30.962  93.481  -10.037 1.00 4.62   ? 140  ILE C CG2   1 
ATOM   6912  C  CD1   . ILE I  5  140  ? 30.497  91.333  -7.232  1.00 2.80   ? 140  ILE C CD1   1 
ATOM   6913  N  N     . HIS I  5  141  ? 27.603  94.223  -7.072  1.00 12.56  ? 141  HIS C N     1 
ATOM   6914  C  CA    . HIS I  5  141  ? 26.781  93.912  -5.927  1.00 14.89  ? 141  HIS C CA    1 
ATOM   6915  C  C     . HIS I  5  141  ? 25.542  93.263  -6.331  1.00 18.77  ? 141  HIS C C     1 
ATOM   6916  O  O     . HIS I  5  141  ? 25.261  93.113  -7.519  1.00 20.15  ? 141  HIS C O     1 
ATOM   6917  C  CB    . HIS I  5  141  ? 26.354  95.154  -5.146  1.00 13.29  ? 141  HIS C CB    1 
ATOM   6918  C  CG    . HIS I  5  141  ? 25.822  96.283  -5.977  1.00 9.98   ? 141  HIS C CG    1 
ATOM   6919  N  ND1   . HIS I  5  141  ? 24.649  96.934  -5.668  1.00 8.03   ? 141  HIS C ND1   1 
ATOM   6920  C  CD2   . HIS I  5  141  ? 26.315  96.904  -7.073  1.00 10.24  ? 141  HIS C CD2   1 
ATOM   6921  C  CE1   . HIS I  5  141  ? 24.445  97.909  -6.534  1.00 8.44   ? 141  HIS C CE1   1 
ATOM   6922  N  NE2   . HIS I  5  141  ? 25.442  97.915  -7.399  1.00 6.97   ? 141  HIS C NE2   1 
ATOM   6923  N  N     . ARG I  5  142  ? 24.781  92.852  -5.340  1.00 22.21  ? 142  ARG C N     1 
ATOM   6924  C  CA    . ARG I  5  142  ? 23.492  92.397  -5.726  1.00 26.83  ? 142  ARG C CA    1 
ATOM   6925  C  C     . ARG I  5  142  ? 22.748  93.567  -6.292  1.00 27.62  ? 142  ARG C C     1 
ATOM   6926  O  O     . ARG I  5  142  ? 22.543  94.515  -5.553  1.00 27.87  ? 142  ARG C O     1 
ATOM   6927  C  CB    . ARG I  5  142  ? 22.711  91.884  -4.530  1.00 26.35  ? 142  ARG C CB    1 
ATOM   6928  C  CG    . ARG I  5  142  ? 22.550  90.390  -4.440  1.00 26.86  ? 142  ARG C CG    1 
ATOM   6929  C  CD    . ARG I  5  142  ? 22.078  90.100  -3.056  1.00 29.17  ? 142  ARG C CD    1 
ATOM   6930  N  NE    . ARG I  5  142  ? 21.317  88.871  -2.935  1.00 32.28  ? 142  ARG C NE    1 
ATOM   6931  C  CZ    . ARG I  5  142  ? 20.634  88.544  -1.844  1.00 33.81  ? 142  ARG C CZ    1 
ATOM   6932  N  NH1   . ARG I  5  142  ? 20.642  89.364  -0.802  1.00 35.34  ? 142  ARG C NH1   1 
ATOM   6933  N  NH2   . ARG I  5  142  ? 19.943  87.412  -1.796  1.00 34.49  ? 142  ARG C NH2   1 
ATOM   6934  N  N     . SER I  5  143  ? 22.408  93.585  -7.570  1.00 27.92  ? 143  SER C N     1 
ATOM   6935  C  CA    . SER I  5  143  ? 21.588  94.687  -7.949  1.00 31.80  ? 143  SER C CA    1 
ATOM   6936  C  C     . SER I  5  143  ? 20.398  94.671  -7.025  1.00 34.64  ? 143  SER C C     1 
ATOM   6937  O  O     . SER I  5  143  ? 19.612  93.744  -7.117  1.00 34.52  ? 143  SER C O     1 
ATOM   6938  C  CB    . SER I  5  143  ? 21.139  94.532  -9.403  1.00 34.71  ? 143  SER C CB    1 
ATOM   6939  O  OG    . SER I  5  143  ? 20.120  93.547  -9.543  1.00 37.82  ? 143  SER C OG    1 
ATOM   6940  N  N     . PRO I  5  144  ? 20.278  95.652  -6.095  1.00 36.35  ? 144  PRO C N     1 
ATOM   6941  C  CA    . PRO I  5  144  ? 19.163  95.685  -5.132  1.00 36.41  ? 144  PRO C CA    1 
ATOM   6942  C  C     . PRO I  5  144  ? 17.911  94.997  -5.664  1.00 35.13  ? 144  PRO C C     1 
ATOM   6943  O  O     . PRO I  5  144  ? 17.144  95.627  -6.358  1.00 35.52  ? 144  PRO C O     1 
ATOM   6944  C  CB    . PRO I  5  144  ? 18.996  97.179  -4.848  1.00 36.68  ? 144  PRO C CB    1 
ATOM   6945  C  CG    . PRO I  5  144  ? 20.408  97.677  -4.857  1.00 36.89  ? 144  PRO C CG    1 
ATOM   6946  C  CD    . PRO I  5  144  ? 20.960  96.969  -6.115  1.00 37.00  ? 144  PRO C CD    1 
ATOM   6947  N  N     . GLY I  5  145  ? 17.719  93.712  -5.335  1.00 35.38  ? 145  GLY C N     1 
ATOM   6948  C  CA    . GLY I  5  145  ? 16.563  92.961  -5.845  1.00 36.33  ? 145  GLY C CA    1 
ATOM   6949  C  C     . GLY I  5  145  ? 15.985  91.900  -4.902  1.00 37.41  ? 145  GLY C C     1 
ATOM   6950  O  O     . GLY I  5  145  ? 16.116  92.034  -3.694  1.00 38.62  ? 145  GLY C O     1 
ATOM   6951  N  N     . VAL I  5  146  ? 15.339  90.854  -5.439  1.00 37.38  ? 146  VAL C N     1 
ATOM   6952  C  CA    . VAL I  5  146  ? 14.727  89.781  -4.630  1.00 37.70  ? 146  VAL C CA    1 
ATOM   6953  C  C     . VAL I  5  146  ? 15.049  88.409  -5.193  1.00 40.72  ? 146  VAL C C     1 
ATOM   6954  O  O     . VAL I  5  146  ? 14.698  88.110  -6.332  1.00 41.26  ? 146  VAL C O     1 
ATOM   6955  C  CB    . VAL I  5  146  ? 13.202  89.914  -4.592  1.00 36.28  ? 146  VAL C CB    1 
ATOM   6956  C  CG1   . VAL I  5  146  ? 12.539  88.606  -4.107  1.00 32.84  ? 146  VAL C CG1   1 
ATOM   6957  C  CG2   . VAL I  5  146  ? 12.845  91.026  -3.673  1.00 37.14  ? 146  VAL C CG2   1 
ATOM   6958  N  N     . TYR I  5  147  ? 15.688  87.567  -4.380  1.00 43.07  ? 147  TYR C N     1 
ATOM   6959  C  CA    . TYR I  5  147  ? 16.105  86.234  -4.825  1.00 46.06  ? 147  TYR C CA    1 
ATOM   6960  C  C     . TYR I  5  147  ? 15.722  85.142  -3.795  1.00 48.74  ? 147  TYR C C     1 
ATOM   6961  O  O     . TYR I  5  147  ? 15.657  85.405  -2.588  1.00 50.25  ? 147  TYR C O     1 
ATOM   6962  C  CB    . TYR I  5  147  ? 17.622  86.262  -5.073  1.00 44.30  ? 147  TYR C CB    1 
ATOM   6963  C  CG    . TYR I  5  147  ? 18.101  87.569  -5.684  1.00 43.04  ? 147  TYR C CG    1 
ATOM   6964  C  CD1   . TYR I  5  147  ? 18.474  88.658  -4.862  1.00 42.82  ? 147  TYR C CD1   1 
ATOM   6965  C  CD2   . TYR I  5  147  ? 18.161  87.743  -7.074  1.00 42.33  ? 147  TYR C CD2   1 
ATOM   6966  C  CE1   . TYR I  5  147  ? 18.902  89.909  -5.431  1.00 41.22  ? 147  TYR C CE1   1 
ATOM   6967  C  CE2   . TYR I  5  147  ? 18.586  88.993  -7.651  1.00 41.76  ? 147  TYR C CE2   1 
ATOM   6968  C  CZ    . TYR I  5  147  ? 18.954  90.060  -6.818  1.00 40.98  ? 147  TYR C CZ    1 
ATOM   6969  O  OH    . TYR I  5  147  ? 19.375  91.250  -7.368  1.00 38.60  ? 147  TYR C OH    1 
ATOM   6970  N  N     . PHE I  5  148  ? 15.485  83.918  -4.279  1.00 50.58  ? 148  PHE C N     1 
ATOM   6971  C  CA    . PHE I  5  148  ? 15.056  82.781  -3.439  1.00 53.58  ? 148  PHE C CA    1 
ATOM   6972  C  C     . PHE I  5  148  ? 16.132  81.690  -3.354  1.00 56.71  ? 148  PHE C C     1 
ATOM   6973  O  O     . PHE I  5  148  ? 16.388  80.982  -4.332  1.00 56.86  ? 148  PHE C O     1 
ATOM   6974  C  CB    . PHE I  5  148  ? 13.779  82.176  -4.020  1.00 51.76  ? 148  PHE C CB    1 
ATOM   6975  C  CG    . PHE I  5  148  ? 12.860  83.196  -4.655  1.00 50.85  ? 148  PHE C CG    1 
ATOM   6976  C  CD1   . PHE I  5  148  ? 13.127  83.718  -5.932  1.00 51.49  ? 148  PHE C CD1   1 
ATOM   6977  C  CD2   . PHE I  5  148  ? 11.739  83.668  -3.958  1.00 50.53  ? 148  PHE C CD2   1 
ATOM   6978  C  CE1   . PHE I  5  148  ? 12.288  84.702  -6.506  1.00 50.70  ? 148  PHE C CE1   1 
ATOM   6979  C  CE2   . PHE I  5  148  ? 10.884  84.656  -4.519  1.00 50.52  ? 148  PHE C CE2   1 
ATOM   6980  C  CZ    . PHE I  5  148  ? 11.163  85.170  -5.791  1.00 51.09  ? 148  PHE C CZ    1 
ATOM   6981  N  N     . THR I  5  149  ? 16.752  81.534  -2.187  1.00 59.43  ? 149  THR C N     1 
ATOM   6982  C  CA    . THR I  5  149  ? 17.809  80.533  -2.037  1.00 62.92  ? 149  THR C CA    1 
ATOM   6983  C  C     . THR I  5  149  ? 17.432  79.447  -1.002  1.00 64.25  ? 149  THR C C     1 
ATOM   6984  O  O     . THR I  5  149  ? 16.685  79.711  -0.055  1.00 64.42  ? 149  THR C O     1 
ATOM   6985  C  CB    . THR I  5  149  ? 19.179  81.224  -1.626  1.00 64.12  ? 149  THR C CB    1 
ATOM   6986  O  OG1   . THR I  5  149  ? 20.271  80.480  -2.192  1.00 64.74  ? 149  THR C OG1   1 
ATOM   6987  C  CG2   . THR I  5  149  ? 19.355  81.293  -0.090  1.00 64.56  ? 149  THR C CG2   1 
ATOM   6988  N  N     . PRO I  5  150  ? 17.941  78.207  -1.185  1.00 65.78  ? 150  PRO C N     1 
ATOM   6989  C  CA    . PRO I  5  150  ? 17.687  77.070  -0.286  1.00 66.04  ? 150  PRO C CA    1 
ATOM   6990  C  C     . PRO I  5  150  ? 17.961  77.403  1.191   1.00 65.63  ? 150  PRO C C     1 
ATOM   6991  O  O     . PRO I  5  150  ? 18.871  78.181  1.522   1.00 64.28  ? 150  PRO C O     1 
ATOM   6992  C  CB    . PRO I  5  150  ? 18.597  75.985  -0.847  1.00 66.35  ? 150  PRO C CB    1 
ATOM   6993  C  CG    . PRO I  5  150  ? 18.397  76.188  -2.321  1.00 66.04  ? 150  PRO C CG    1 
ATOM   6994  C  CD    . PRO I  5  150  ? 18.519  77.708  -2.455  1.00 66.27  ? 150  PRO C CD    1 
ATOM   6995  N  N     . ASP I  5  151  ? 17.155  76.792  2.067   1.00 65.75  ? 151  ASP C N     1 
ATOM   6996  C  CA    . ASP I  5  151  ? 17.261  76.992  3.515   1.00 65.36  ? 151  ASP C CA    1 
ATOM   6997  C  C     . ASP I  5  151  ? 18.563  76.407  4.043   1.00 66.41  ? 151  ASP C C     1 
ATOM   6998  O  O     . ASP I  5  151  ? 18.970  75.321  3.617   1.00 65.89  ? 151  ASP C O     1 
ATOM   6999  C  CB    . ASP I  5  151  ? 16.078  76.338  4.254   1.00 62.46  ? 151  ASP C CB    1 
ATOM   7000  C  CG    . ASP I  5  151  ? 15.764  77.005  5.613   1.00 60.08  ? 151  ASP C CG    1 
ATOM   7001  O  OD1   . ASP I  5  151  ? 16.601  76.979  6.532   1.00 59.56  ? 151  ASP C OD1   1 
ATOM   7002  O  OD2   . ASP I  5  151  ? 14.666  77.560  5.777   1.00 58.17  ? 151  ASP C OD2   1 
ATOM   7003  N  N     . PRO I  5  152  ? 19.229  77.126  4.978   1.00 67.74  ? 152  PRO C N     1 
ATOM   7004  C  CA    . PRO I  5  152  ? 20.493  76.744  5.610   1.00 69.05  ? 152  PRO C CA    1 
ATOM   7005  C  C     . PRO I  5  152  ? 20.616  75.231  5.924   1.00 70.08  ? 152  PRO C C     1 
ATOM   7006  O  O     . PRO I  5  152  ? 21.013  74.443  5.060   1.00 70.09  ? 152  PRO C O     1 
ATOM   7007  C  CB    . PRO I  5  152  ? 20.536  77.650  6.843   1.00 68.82  ? 152  PRO C CB    1 
ATOM   7008  C  CG    . PRO I  5  152  ? 20.026  78.922  6.307   1.00 67.97  ? 152  PRO C CG    1 
ATOM   7009  C  CD    . PRO I  5  152  ? 18.828  78.471  5.464   1.00 68.05  ? 152  PRO C CD    1 
ATOM   7010  N  N     . ALA I  5  153  ? 20.280  74.828  7.149   1.00 70.72  ? 153  ALA C N     1 
ATOM   7011  C  CA    . ALA I  5  153  ? 20.447  73.438  7.583   1.00 72.26  ? 153  ALA C CA    1 
ATOM   7012  C  C     . ALA I  5  153  ? 19.330  72.512  7.076   1.00 72.97  ? 153  ALA C C     1 
ATOM   7013  O  O     . ALA I  5  153  ? 19.614  71.531  6.384   1.00 73.96  ? 153  ALA C O     1 
ATOM   7014  C  CB    . ALA I  5  153  ? 20.513  73.387  9.104   1.00 71.30  ? 153  ALA C CB    1 
ATOM   7015  N  N     . ARG I  5  154  ? 18.082  72.807  7.428   1.00 73.99  ? 154  ARG C N     1 
ATOM   7016  C  CA    . ARG I  5  154  ? 16.919  71.994  7.039   1.00 73.48  ? 154  ARG C CA    1 
ATOM   7017  C  C     . ARG I  5  154  ? 16.870  71.748  5.515   1.00 73.83  ? 154  ARG C C     1 
ATOM   7018  O  O     . ARG I  5  154  ? 16.765  72.689  4.729   1.00 73.31  ? 154  ARG C O     1 
ATOM   7019  C  CB    . ARG I  5  154  ? 15.647  72.710  7.496   1.00 73.36  ? 154  ARG C CB    1 
ATOM   7020  C  CG    . ARG I  5  154  ? 14.365  71.904  7.487   1.00 72.02  ? 154  ARG C CG    1 
ATOM   7021  C  CD    . ARG I  5  154  ? 13.397  72.553  8.459   1.00 71.32  ? 154  ARG C CD    1 
ATOM   7022  N  NE    . ARG I  5  154  ? 12.019  72.102  8.312   1.00 70.32  ? 154  ARG C NE    1 
ATOM   7023  C  CZ    . ARG I  5  154  ? 11.002  72.603  9.004   1.00 70.13  ? 154  ARG C CZ    1 
ATOM   7024  N  NH1   . ARG I  5  154  ? 11.210  73.566  9.890   1.00 70.20  ? 154  ARG C NH1   1 
ATOM   7025  N  NH2   . ARG I  5  154  ? 9.771   72.148  8.807   1.00 70.69  ? 154  ARG C NH2   1 
ATOM   7026  N  N     . PRO I  5  155  ? 16.948  70.469  5.082   1.00 74.74  ? 155  PRO C N     1 
ATOM   7027  C  CA    . PRO I  5  155  ? 16.909  70.139  3.643   1.00 74.74  ? 155  PRO C CA    1 
ATOM   7028  C  C     . PRO I  5  155  ? 15.564  70.512  2.997   1.00 73.63  ? 155  PRO C C     1 
ATOM   7029  O  O     . PRO I  5  155  ? 15.456  70.592  1.774   1.00 72.99  ? 155  PRO C O     1 
ATOM   7030  C  CB    . PRO I  5  155  ? 17.184  68.624  3.614   1.00 76.02  ? 155  PRO C CB    1 
ATOM   7031  C  CG    . PRO I  5  155  ? 18.007  68.399  4.866   1.00 75.42  ? 155  PRO C CG    1 
ATOM   7032  C  CD    . PRO I  5  155  ? 17.275  69.270  5.880   1.00 75.40  ? 155  PRO C CD    1 
ATOM   7033  N  N     . GLY I  5  156  ? 14.565  70.740  3.845   1.00 72.48  ? 156  GLY C N     1 
ATOM   7034  C  CA    . GLY I  5  156  ? 13.206  71.058  3.430   1.00 70.80  ? 156  GLY C CA    1 
ATOM   7035  C  C     . GLY I  5  156  ? 13.009  72.060  2.295   1.00 69.36  ? 156  GLY C C     1 
ATOM   7036  O  O     . GLY I  5  156  ? 13.367  71.812  1.144   1.00 69.40  ? 156  GLY C O     1 
ATOM   7037  N  N     . ARG I  5  157  ? 12.411  73.200  2.636   1.00 68.17  ? 157  ARG C N     1 
ATOM   7038  C  CA    . ARG I  5  157  ? 12.072  74.244  1.673   1.00 67.21  ? 157  ARG C CA    1 
ATOM   7039  C  C     . ARG I  5  157  ? 13.004  75.425  1.770   1.00 68.12  ? 157  ARG C C     1 
ATOM   7040  O  O     . ARG I  5  157  ? 13.715  75.562  2.749   1.00 69.36  ? 157  ARG C O     1 
ATOM   7041  C  CB    . ARG I  5  157  ? 10.644  74.732  1.900   1.00 64.97  ? 157  ARG C CB    1 
ATOM   7042  C  CG    . ARG I  5  157  ? 9.554   73.860  1.282   1.00 63.53  ? 157  ARG C CG    1 
ATOM   7043  C  CD    . ARG I  5  157  ? 9.258   72.623  2.137   1.00 62.16  ? 157  ARG C CD    1 
ATOM   7044  N  NE    . ARG I  5  157  ? 7.819   72.377  2.286   1.00 59.00  ? 157  ARG C NE    1 
ATOM   7045  C  CZ    . ARG I  5  157  ? 7.265   71.821  3.358   1.00 56.90  ? 157  ARG C CZ    1 
ATOM   7046  N  NH1   . ARG I  5  157  ? 8.023   71.443  4.381   1.00 56.52  ? 157  ARG C NH1   1 
ATOM   7047  N  NH2   . ARG I  5  157  ? 5.955   71.655  3.413   1.00 55.36  ? 157  ARG C NH2   1 
ATOM   7048  N  N     . TYR I  5  158  ? 12.963  76.279  0.745   1.00 69.10  ? 158  TYR C N     1 
ATOM   7049  C  CA    . TYR I  5  158  ? 13.821  77.471  0.615   1.00 69.95  ? 158  TYR C CA    1 
ATOM   7050  C  C     . TYR I  5  158  ? 13.133  78.754  1.138   1.00 68.74  ? 158  TYR C C     1 
ATOM   7051  O  O     . TYR I  5  158  ? 11.911  78.800  1.334   1.00 68.39  ? 158  TYR C O     1 
ATOM   7052  C  CB    . TYR I  5  158  ? 14.236  77.681  -0.859  1.00 72.33  ? 158  TYR C CB    1 
ATOM   7053  C  CG    . TYR I  5  158  ? 13.838  76.581  -1.845  1.00 75.82  ? 158  TYR C CG    1 
ATOM   7054  C  CD1   . TYR I  5  158  ? 12.472  76.310  -2.131  1.00 77.21  ? 158  TYR C CD1   1 
ATOM   7055  C  CD2   . TYR I  5  158  ? 14.823  75.802  -2.507  1.00 76.80  ? 158  TYR C CD2   1 
ATOM   7056  C  CE1   . TYR I  5  158  ? 12.093  75.284  -3.056  1.00 77.32  ? 158  TYR C CE1   1 
ATOM   7057  C  CE2   . TYR I  5  158  ? 14.447  74.762  -3.444  1.00 76.92  ? 158  TYR C CE2   1 
ATOM   7058  C  CZ    . TYR I  5  158  ? 13.081  74.523  -3.701  1.00 77.04  ? 158  TYR C CZ    1 
ATOM   7059  O  OH    . TYR I  5  158  ? 12.700  73.545  -4.583  1.00 77.13  ? 158  TYR C OH    1 
ATOM   7060  N  N     . ILE I  5  159  ? 13.949  79.795  1.350   1.00 66.48  ? 159  ILE C N     1 
ATOM   7061  C  CA    . ILE I  5  159  ? 13.500  81.090  1.887   1.00 65.36  ? 159  ILE C CA    1 
ATOM   7062  C  C     . ILE I  5  159  ? 13.799  82.249  0.920   1.00 64.82  ? 159  ILE C C     1 
ATOM   7063  O  O     . ILE I  5  159  ? 14.722  82.166  0.111   1.00 65.67  ? 159  ILE C O     1 
ATOM   7064  C  CB    . ILE I  5  159  ? 14.187  81.376  3.238   1.00 65.09  ? 159  ILE C CB    1 
ATOM   7065  C  CG1   . ILE I  5  159  ? 15.705  81.210  3.117   1.00 65.31  ? 159  ILE C CG1   1 
ATOM   7066  C  CG2   . ILE I  5  159  ? 13.634  80.446  4.271   1.00 66.80  ? 159  ILE C CG2   1 
ATOM   7067  C  CD1   . ILE I  5  159  ? 16.478  81.488  4.418   1.00 65.11  ? 159  ILE C CD1   1 
ATOM   7068  N  N     . ALA I  5  160  ? 13.019  83.332  1.025   1.00 63.91  ? 160  ALA C N     1 
ATOM   7069  C  CA    . ALA I  5  160  ? 13.146  84.502  0.144   1.00 62.76  ? 160  ALA C CA    1 
ATOM   7070  C  C     . ALA I  5  160  ? 13.954  85.614  0.782   1.00 62.07  ? 160  ALA C C     1 
ATOM   7071  O  O     . ALA I  5  160  ? 14.050  85.704  1.995   1.00 61.85  ? 160  ALA C O     1 
ATOM   7072  C  CB    . ALA I  5  160  ? 11.772  85.028  -0.206  1.00 63.06  ? 160  ALA C CB    1 
ATOM   7073  N  N     . SER I  5  161  ? 14.524  86.473  -0.061  1.00 62.14  ? 161  SER C N     1 
ATOM   7074  C  CA    . SER I  5  161  ? 15.333  87.589  0.420   1.00 63.35  ? 161  SER C CA    1 
ATOM   7075  C  C     . SER I  5  161  ? 15.194  88.831  -0.470  1.00 63.21  ? 161  SER C C     1 
ATOM   7076  O  O     . SER I  5  161  ? 15.341  88.762  -1.690  1.00 63.22  ? 161  SER C O     1 
ATOM   7077  C  CB    . SER I  5  161  ? 16.804  87.166  0.485   1.00 64.03  ? 161  SER C CB    1 
ATOM   7078  O  OG    . SER I  5  161  ? 17.066  86.137  -0.458  1.00 64.50  ? 161  SER C OG    1 
ATOM   7079  N  N     . ILE I  5  162  ? 14.893  89.964  0.165   1.00 62.83  ? 162  ILE C N     1 
ATOM   7080  C  CA    . ILE I  5  162  ? 14.785  91.263  -0.498  1.00 63.12  ? 162  ILE C CA    1 
ATOM   7081  C  C     . ILE I  5  162  ? 16.005  92.099  -0.164  1.00 64.06  ? 162  ILE C C     1 
ATOM   7082  O  O     . ILE I  5  162  ? 16.164  92.498  0.984   1.00 64.20  ? 162  ILE C O     1 
ATOM   7083  C  CB    . ILE I  5  162  ? 13.551  92.068  -0.024  1.00 62.73  ? 162  ILE C CB    1 
ATOM   7084  C  CG1   . ILE I  5  162  ? 12.264  91.363  -0.437  1.00 62.54  ? 162  ILE C CG1   1 
ATOM   7085  C  CG2   . ILE I  5  162  ? 13.600  93.488  -0.624  1.00 61.48  ? 162  ILE C CG2   1 
ATOM   7086  C  CD1   . ILE I  5  162  ? 11.016  92.122  -0.010  1.00 61.91  ? 162  ILE C CD1   1 
ATOM   7087  N  N     . ILE I  5  163  ? 16.859  92.374  -1.140  1.00 65.33  ? 163  ILE C N     1 
ATOM   7088  C  CA    . ILE I  5  163  ? 18.074  93.110  -0.850  1.00 66.13  ? 163  ILE C CA    1 
ATOM   7089  C  C     . ILE I  5  163  ? 18.007  94.546  -1.331  1.00 67.21  ? 163  ILE C C     1 
ATOM   7090  O  O     . ILE I  5  163  ? 17.928  94.828  -2.516  1.00 66.43  ? 163  ILE C O     1 
ATOM   7091  C  CB    . ILE I  5  163  ? 19.345  92.374  -1.454  1.00 66.53  ? 163  ILE C CB    1 
ATOM   7092  C  CG1   . ILE I  5  163  ? 20.454  93.377  -1.842  1.00 66.29  ? 163  ILE C CG1   1 
ATOM   7093  C  CG2   . ILE I  5  163  ? 18.919  91.526  -2.610  1.00 66.24  ? 163  ILE C CG2   1 
ATOM   7094  C  CD1   . ILE I  5  163  ? 21.199  94.042  -0.678  1.00 64.86  ? 163  ILE C CD1   1 
ATOM   7095  N  N     . PRO I  5  164  ? 18.006  95.479  -0.378  1.00 69.89  ? 164  PRO C N     1 
ATOM   7096  C  CA    . PRO I  5  164  ? 17.973  96.913  -0.667  1.00 72.06  ? 164  PRO C CA    1 
ATOM   7097  C  C     . PRO I  5  164  ? 19.262  97.623  -0.195  1.00 72.71  ? 164  PRO C C     1 
ATOM   7098  O  O     . PRO I  5  164  ? 19.541  97.700  1.009   1.00 72.52  ? 164  PRO C O     1 
ATOM   7099  C  CB    . PRO I  5  164  ? 16.722  97.408  0.082   1.00 73.28  ? 164  PRO C CB    1 
ATOM   7100  C  CG    . PRO I  5  164  ? 15.991  96.115  0.512   1.00 73.04  ? 164  PRO C CG    1 
ATOM   7101  C  CD    . PRO I  5  164  ? 17.150  95.218  0.793   1.00 71.26  ? 164  PRO C CD    1 
ATOM   7102  N  N     . LEU I  5  165  ? 20.052  98.121  -1.141  1.00 72.79  ? 165  LEU C N     1 
ATOM   7103  C  CA    . LEU I  5  165  ? 21.255  98.887  -0.814  1.00 72.08  ? 165  LEU C CA    1 
ATOM   7104  C  C     . LEU I  5  165  ? 21.029  100.362 -1.180  1.00 72.51  ? 165  LEU C C     1 
ATOM   7105  O  O     . LEU I  5  165  ? 20.316  100.610 -2.168  1.00 73.16  ? 165  LEU C O     1 
ATOM   7106  C  CB    . LEU I  5  165  ? 22.443  98.310  -1.590  1.00 71.04  ? 165  LEU C CB    1 
ATOM   7107  C  CG    . LEU I  5  165  ? 23.829  98.865  -1.279  1.00 70.44  ? 165  LEU C CG    1 
ATOM   7108  C  CD1   . LEU I  5  165  ? 24.188  98.590  0.157   1.00 69.82  ? 165  LEU C CD1   1 
ATOM   7109  C  CD2   . LEU I  5  165  ? 24.836  98.215  -2.170  1.00 69.82  ? 165  LEU C CD2   1 
ATOM   7110  N  N     . PRO I  5  166  ? 21.606  101.360 -0.440  1.00 72.08  ? 166  PRO C N     1 
ATOM   7111  C  CA    . PRO I  5  166  ? 22.484  101.624 0.720   1.00 71.55  ? 166  PRO C CA    1 
ATOM   7112  C  C     . PRO I  5  166  ? 22.263  100.679 1.891   1.00 71.11  ? 166  PRO C C     1 
ATOM   7113  O  O     . PRO I  5  166  ? 21.205  100.054 2.018   1.00 71.63  ? 166  PRO C O     1 
ATOM   7114  C  CB    . PRO I  5  166  ? 22.154  103.064 1.092   1.00 71.62  ? 166  PRO C CB    1 
ATOM   7115  C  CG    . PRO I  5  166  ? 21.819  103.652 -0.163  1.00 71.80  ? 166  PRO C CG    1 
ATOM   7116  C  CD    . PRO I  5  166  ? 20.921  102.625 -0.775  1.00 72.67  ? 166  PRO C CD    1 
ATOM   7117  N  N     . LYS I  5  167  ? 23.290  100.604 2.743   1.00 70.56  ? 167  LYS C N     1 
ATOM   7118  C  CA    . LYS I  5  167  ? 23.270  99.794  3.962   1.00 70.45  ? 167  LYS C CA    1 
ATOM   7119  C  C     . LYS I  5  167  ? 22.053  100.118 4.780   1.00 70.56  ? 167  LYS C C     1 
ATOM   7120  O  O     . LYS I  5  167  ? 21.258  99.222  5.089   1.00 71.96  ? 167  LYS C O     1 
ATOM   7121  C  CB    . LYS I  5  167  ? 24.525  100.037 4.796   1.00 69.77  ? 167  LYS C CB    1 
ATOM   7122  C  CG    . LYS I  5  167  ? 25.754  99.263  4.289   1.00 68.62  ? 167  LYS C CG    1 
ATOM   7123  C  CD    . LYS I  5  167  ? 26.927  99.344  5.254   1.00 67.51  ? 167  LYS C CD    1 
ATOM   7124  C  CE    . LYS I  5  167  ? 27.501  97.960  5.498   1.00 67.40  ? 167  LYS C CE    1 
ATOM   7125  N  NZ    . LYS I  5  167  ? 28.599  98.025  6.510   1.00 66.95  ? 167  LYS C NZ    1 
ATOM   7126  N  N     . ARG I  5  168  ? 21.908  101.388 5.155   1.00 71.11  ? 168  ARG C N     1 
ATOM   7127  C  CA    . ARG I  5  168  ? 20.668  101.764 5.802   1.00 70.12  ? 168  ARG C CA    1 
ATOM   7128  C  C     . ARG I  5  168  ? 19.549  101.550 4.802   1.00 70.50  ? 168  ARG C C     1 
ATOM   7129  O  O     . ARG I  5  168  ? 19.582  102.068 3.676   1.00 70.54  ? 168  ARG C O     1 
ATOM   7130  C  CB    . ARG I  5  168  ? 20.700  103.227 6.274   1.00 69.55  ? 168  ARG C CB    1 
ATOM   7131  C  CG    . ARG I  5  168  ? 21.678  103.468 7.422   1.00 68.98  ? 168  ARG C CG    1 
ATOM   7132  C  CD    . ARG I  5  168  ? 21.325  104.735 8.199   1.00 68.70  ? 168  ARG C CD    1 
ATOM   7133  N  NE    . ARG I  5  168  ? 21.148  104.472 9.626   1.00 66.86  ? 168  ARG C NE    1 
ATOM   7134  C  CZ    . ARG I  5  168  ? 20.329  105.159 10.413  1.00 65.56  ? 168  ARG C CZ    1 
ATOM   7135  N  NH1   . ARG I  5  168  ? 19.603  106.153 9.914   1.00 65.50  ? 168  ARG C NH1   1 
ATOM   7136  N  NH2   . ARG I  5  168  ? 20.234  104.849 11.698  1.00 66.62  ? 168  ARG C NH2   1 
ATOM   7137  N  N     . GLY I  5  169  ? 18.580  100.752 5.209   1.00 70.16  ? 169  GLY C N     1 
ATOM   7138  C  CA    . GLY I  5  169  ? 17.530  100.345 4.313   1.00 68.95  ? 169  GLY C CA    1 
ATOM   7139  C  C     . GLY I  5  169  ? 17.415  98.848  4.512   1.00 67.76  ? 169  GLY C C     1 
ATOM   7140  O  O     . GLY I  5  169  ? 18.309  98.105  4.093   1.00 66.85  ? 169  GLY C O     1 
ATOM   7141  N  N     . PRO I  5  170  ? 16.339  98.387  5.172   1.00 66.40  ? 170  PRO C N     1 
ATOM   7142  C  CA    . PRO I  5  170  ? 15.962  97.015  5.528   1.00 65.05  ? 170  PRO C CA    1 
ATOM   7143  C  C     . PRO I  5  170  ? 16.541  95.918  4.606   1.00 63.32  ? 170  PRO C C     1 
ATOM   7144  O  O     . PRO I  5  170  ? 17.019  96.153  3.507   1.00 62.37  ? 170  PRO C O     1 
ATOM   7145  C  CB    . PRO I  5  170  ? 14.449  97.092  5.531   1.00 65.73  ? 170  PRO C CB    1 
ATOM   7146  C  CG    . PRO I  5  170  ? 14.243  98.407  6.226   1.00 65.76  ? 170  PRO C CG    1 
ATOM   7147  C  CD    . PRO I  5  170  ? 15.235  99.310  5.543   1.00 65.54  ? 170  PRO C CD    1 
ATOM   7148  N  N     . TRP I  5  171  ? 16.462  94.698  5.138   1.00 61.80  ? 171  TRP C N     1 
ATOM   7149  C  CA    . TRP I  5  171  ? 16.894  93.439  4.526   1.00 60.61  ? 171  TRP C CA    1 
ATOM   7150  C  C     . TRP I  5  171  ? 15.918  92.318  4.920   1.00 59.44  ? 171  TRP C C     1 
ATOM   7151  O  O     . TRP I  5  171  ? 16.063  91.705  5.978   1.00 58.59  ? 171  TRP C O     1 
ATOM   7152  C  CB    . TRP I  5  171  ? 18.296  93.107  5.025   1.00 60.91  ? 171  TRP C CB    1 
ATOM   7153  C  CG    . TRP I  5  171  ? 18.988  91.957  4.336   1.00 60.88  ? 171  TRP C CG    1 
ATOM   7154  C  CD1   . TRP I  5  171  ? 18.545  90.659  4.201   1.00 59.82  ? 171  TRP C CD1   1 
ATOM   7155  C  CD2   . TRP I  5  171  ? 20.285  92.002  3.734   1.00 60.53  ? 171  TRP C CD2   1 
ATOM   7156  N  NE1   . TRP I  5  171  ? 19.495  89.899  3.559   1.00 59.26  ? 171  TRP C NE1   1 
ATOM   7157  C  CE2   . TRP I  5  171  ? 20.574  90.693  3.260   1.00 60.18  ? 171  TRP C CE2   1 
ATOM   7158  C  CE3   . TRP I  5  171  ? 21.244  93.024  3.552   1.00 59.87  ? 171  TRP C CE3   1 
ATOM   7159  C  CZ2   . TRP I  5  171  ? 21.794  90.375  2.608   1.00 59.71  ? 171  TRP C CZ2   1 
ATOM   7160  C  CZ3   . TRP I  5  171  ? 22.461  92.713  2.904   1.00 59.55  ? 171  TRP C CZ3   1 
ATOM   7161  C  CH2   . TRP I  5  171  ? 22.720  91.396  2.442   1.00 59.42  ? 171  TRP C CH2   1 
ATOM   7162  N  N     . ILE I  5  172  ? 14.939  92.050  4.061   1.00 57.66  ? 172  ILE C N     1 
ATOM   7163  C  CA    . ILE I  5  172  ? 13.863  91.107  4.365   1.00 56.34  ? 172  ILE C CA    1 
ATOM   7164  C  C     . ILE I  5  172  ? 14.177  89.665  3.944   1.00 55.25  ? 172  ILE C C     1 
ATOM   7165  O  O     . ILE I  5  172  ? 15.003  89.401  3.072   1.00 54.03  ? 172  ILE C O     1 
ATOM   7166  C  CB    . ILE I  5  172  ? 12.548  91.611  3.684   1.00 57.84  ? 172  ILE C CB    1 
ATOM   7167  C  CG1   . ILE I  5  172  ? 12.018  92.833  4.454   1.00 58.44  ? 172  ILE C CG1   1 
ATOM   7168  C  CG2   . ILE I  5  172  ? 11.489  90.515  3.634   1.00 58.37  ? 172  ILE C CG2   1 
ATOM   7169  C  CD1   . ILE I  5  172  ? 12.858  94.115  4.321   1.00 58.55  ? 172  ILE C CD1   1 
ATOM   7170  N  N     . ASP I  5  173  ? 13.474  88.751  4.620   1.00 54.36  ? 173  ASP C N     1 
ATOM   7171  C  CA    . ASP I  5  173  ? 13.549  87.315  4.410   1.00 54.10  ? 173  ASP C CA    1 
ATOM   7172  C  C     . ASP I  5  173  ? 12.222  86.653  4.762   1.00 54.51  ? 173  ASP C C     1 
ATOM   7173  O  O     . ASP I  5  173  ? 11.641  86.957  5.800   1.00 55.78  ? 173  ASP C O     1 
ATOM   7174  C  CB    . ASP I  5  173  ? 14.677  86.706  5.262   1.00 52.45  ? 173  ASP C CB    1 
ATOM   7175  C  CG    . ASP I  5  173  ? 14.467  86.888  6.736   1.00 49.63  ? 173  ASP C CG    1 
ATOM   7176  O  OD1   . ASP I  5  173  ? 13.619  86.179  7.294   1.00 49.95  ? 173  ASP C OD1   1 
ATOM   7177  O  OD2   . ASP I  5  173  ? 15.150  87.736  7.332   1.00 47.99  ? 173  ASP C OD2   1 
ATOM   7178  N  N     . LEU I  5  174  ? 11.741  85.757  3.898   1.00 54.53  ? 174  LEU C N     1 
ATOM   7179  C  CA    . LEU I  5  174  ? 10.472  85.062  4.119   1.00 53.10  ? 174  LEU C CA    1 
ATOM   7180  C  C     . LEU I  5  174  ? 10.690  83.567  4.335   1.00 53.77  ? 174  LEU C C     1 
ATOM   7181  O  O     . LEU I  5  174  ? 11.011  82.837  3.406   1.00 54.65  ? 174  LEU C O     1 
ATOM   7182  C  CB    . LEU I  5  174  ? 9.556   85.306  2.916   1.00 51.49  ? 174  LEU C CB    1 
ATOM   7183  C  CG    . LEU I  5  174  ? 9.245   86.796  2.765   1.00 50.75  ? 174  LEU C CG    1 
ATOM   7184  C  CD1   . LEU I  5  174  ? 10.101  87.410  1.686   1.00 50.59  ? 174  LEU C CD1   1 
ATOM   7185  C  CD2   . LEU I  5  174  ? 7.789   86.966  2.433   1.00 51.68  ? 174  LEU C CD2   1 
ATOM   7186  N  N     . GLU I  5  175  ? 10.510  83.117  5.573   1.00 55.13  ? 175  GLU C N     1 
ATOM   7187  C  CA    . GLU I  5  175  ? 10.707  81.712  5.941   1.00 56.33  ? 175  GLU C CA    1 
ATOM   7188  C  C     . GLU I  5  175  ? 9.457   81.134  6.620   1.00 57.73  ? 175  GLU C C     1 
ATOM   7189  O  O     . GLU I  5  175  ? 8.916   81.755  7.516   1.00 58.07  ? 175  GLU C O     1 
ATOM   7190  C  CB    . GLU I  5  175  ? 11.918  81.632  6.879   1.00 55.75  ? 175  GLU C CB    1 
ATOM   7191  C  CG    . GLU I  5  175  ? 12.268  80.270  7.455   1.00 56.11  ? 175  GLU C CG    1 
ATOM   7192  C  CD    . GLU I  5  175  ? 13.648  80.246  8.111   1.00 55.64  ? 175  GLU C CD    1 
ATOM   7193  O  OE1   . GLU I  5  175  ? 13.880  81.039  9.053   1.00 54.22  ? 175  GLU C OE1   1 
ATOM   7194  O  OE2   . GLU I  5  175  ? 14.499  79.431  7.682   1.00 55.51  ? 175  GLU C OE2   1 
ATOM   7195  N  N     . VAL I  5  176  ? 9.003   79.950  6.203   1.00 58.99  ? 176  VAL C N     1 
ATOM   7196  C  CA    . VAL I  5  176  ? 7.799   79.354  6.787   1.00 60.30  ? 176  VAL C CA    1 
ATOM   7197  C  C     . VAL I  5  176  ? 8.110   78.088  7.574   1.00 60.88  ? 176  VAL C C     1 
ATOM   7198  O  O     . VAL I  5  176  ? 8.657   77.123  7.029   1.00 60.94  ? 176  VAL C O     1 
ATOM   7199  C  CB    . VAL I  5  176  ? 6.769   79.001  5.690   1.00 61.26  ? 176  VAL C CB    1 
ATOM   7200  C  CG1   . VAL I  5  176  ? 6.074   80.290  5.210   1.00 61.11  ? 176  VAL C CG1   1 
ATOM   7201  C  CG2   . VAL I  5  176  ? 7.479   78.301  4.507   1.00 60.01  ? 176  VAL C CG2   1 
ATOM   7202  N  N     . GLU I  5  177  ? 7.761   78.103  8.861   1.00 60.62  ? 177  GLU C N     1 
ATOM   7203  C  CA    . GLU I  5  177  ? 7.946   76.937  9.710   1.00 61.32  ? 177  GLU C CA    1 
ATOM   7204  C  C     . GLU I  5  177  ? 6.592   76.538  10.365  1.00 62.79  ? 177  GLU C C     1 
ATOM   7205  O  O     . GLU I  5  177  ? 6.362   76.818  11.537  1.00 62.54  ? 177  GLU C O     1 
ATOM   7206  C  CB    . GLU I  5  177  ? 9.039   77.235  10.742  1.00 60.63  ? 177  GLU C CB    1 
ATOM   7207  C  CG    . GLU I  5  177  ? 10.291  76.304  10.580  1.00 58.85  ? 177  GLU C CG    1 
ATOM   7208  C  CD    . GLU I  5  177  ? 11.230  76.621  9.381   1.00 56.43  ? 177  GLU C CD    1 
ATOM   7209  O  OE1   . GLU I  5  177  ? 10.802  77.217  8.383   1.00 54.66  ? 177  GLU C OE1   1 
ATOM   7210  O  OE2   . GLU I  5  177  ? 12.425  76.262  9.438   1.00 55.09  ? 177  GLU C OE2   1 
ATOM   7211  N  N     . PRO I  5  178  ? 5.686   75.876  9.571   1.00 64.82  ? 178  PRO C N     1 
ATOM   7212  C  CA    . PRO I  5  178  ? 4.325   75.299  9.597   1.00 65.76  ? 178  PRO C CA    1 
ATOM   7213  C  C     . PRO I  5  178  ? 3.771   74.791  10.950  1.00 65.83  ? 178  PRO C C     1 
ATOM   7214  O  O     . PRO I  5  178  ? 2.538   74.852  11.078  1.00 66.30  ? 178  PRO C O     1 
ATOM   7215  C  CB    . PRO I  5  178  ? 4.387   74.214  8.535   1.00 66.39  ? 178  PRO C CB    1 
ATOM   7216  C  CG    . PRO I  5  178  ? 5.140   74.865  7.497   1.00 66.89  ? 178  PRO C CG    1 
ATOM   7217  C  CD    . PRO I  5  178  ? 6.310   75.379  8.314   1.00 66.48  ? 178  PRO C CD    1 
ATOM   7218  N  N     . ASN I  5  179  ? 4.522   74.292  11.937  1.00 64.82  ? 179  ASN C N     1 
ATOM   7219  C  CA    . ASN I  5  179  ? 3.796   73.838  13.154  1.00 64.64  ? 179  ASN C CA    1 
ATOM   7220  C  C     . ASN I  5  179  ? 2.887   74.970  13.711  1.00 64.78  ? 179  ASN C C     1 
ATOM   7221  O  O     . ASN I  5  179  ? 1.942   74.720  14.482  1.00 66.06  ? 179  ASN C O     1 
ATOM   7222  C  CB    . ASN I  5  179  ? 4.771   73.366  14.263  1.00 63.27  ? 179  ASN C CB    1 
ATOM   7223  C  CG    . ASN I  5  179  ? 4.746   71.851  14.492  1.00 61.02  ? 179  ASN C CG    1 
ATOM   7224  O  OD1   . ASN I  5  179  ? 3.758   71.298  14.963  1.00 60.43  ? 179  ASN C OD1   1 
ATOM   7225  N  ND2   . ASN I  5  179  ? 5.842   71.185  14.163  1.00 60.15  ? 179  ASN C ND2   1 
ATOM   7226  N  N     . GLY I  5  180  ? 3.178   76.209  13.294  1.00 63.61  ? 180  GLY C N     1 
ATOM   7227  C  CA    . GLY I  5  180  ? 2.385   77.347  13.707  1.00 61.66  ? 180  GLY C CA    1 
ATOM   7228  C  C     . GLY I  5  180  ? 3.010   78.714  13.438  1.00 60.45  ? 180  GLY C C     1 
ATOM   7229  O  O     . GLY I  5  180  ? 2.461   79.698  13.937  1.00 62.19  ? 180  GLY C O     1 
ATOM   7230  N  N     . VAL I  5  181  ? 4.110   78.832  12.683  1.00 58.78  ? 181  VAL C N     1 
ATOM   7231  C  CA    . VAL I  5  181  ? 4.701   80.172  12.473  1.00 55.91  ? 181  VAL C CA    1 
ATOM   7232  C  C     . VAL I  5  181  ? 5.362   80.339  11.079  1.00 54.39  ? 181  VAL C C     1 
ATOM   7233  O  O     . VAL I  5  181  ? 5.901   79.402  10.476  1.00 53.27  ? 181  VAL C O     1 
ATOM   7234  C  CB    . VAL I  5  181  ? 5.803   80.504  13.572  1.00 56.35  ? 181  VAL C CB    1 
ATOM   7235  C  CG1   . VAL I  5  181  ? 6.410   81.887  13.322  1.00 55.44  ? 181  VAL C CG1   1 
ATOM   7236  C  CG2   . VAL I  5  181  ? 5.184   80.463  14.989  1.00 54.74  ? 181  VAL C CG2   1 
ATOM   7237  N  N     . VAL I  5  182  ? 5.287   81.586  10.610  1.00 52.30  ? 182  VAL C N     1 
ATOM   7238  C  CA    . VAL I  5  182  ? 5.896   82.093  9.375   1.00 52.46  ? 182  VAL C CA    1 
ATOM   7239  C  C     . VAL I  5  182  ? 6.898   83.204  9.731   1.00 52.44  ? 182  VAL C C     1 
ATOM   7240  O  O     . VAL I  5  182  ? 6.694   83.878  10.734  1.00 54.10  ? 182  VAL C O     1 
ATOM   7241  C  CB    . VAL I  5  182  ? 4.843   82.683  8.407   1.00 52.00  ? 182  VAL C CB    1 
ATOM   7242  C  CG1   . VAL I  5  182  ? 5.497   83.001  7.072   1.00 51.68  ? 182  VAL C CG1   1 
ATOM   7243  C  CG2   . VAL I  5  182  ? 3.721   81.681  8.169   1.00 52.48  ? 182  VAL C CG2   1 
ATOM   7244  N  N     . SER I  5  183  ? 7.950   83.440  8.958   1.00 50.74  ? 183  SER C N     1 
ATOM   7245  C  CA    . SER I  5  183  ? 8.926   84.405  9.439   1.00 49.86  ? 183  SER C CA    1 
ATOM   7246  C  C     . SER I  5  183  ? 9.371   85.380  8.393   1.00 49.74  ? 183  SER C C     1 
ATOM   7247  O  O     . SER I  5  183  ? 9.956   85.014  7.388   1.00 49.25  ? 183  SER C O     1 
ATOM   7248  C  CB    . SER I  5  183  ? 10.160  83.678  9.968   1.00 50.20  ? 183  SER C CB    1 
ATOM   7249  O  OG    . SER I  5  183  ? 11.257  83.766  9.070   1.00 50.06  ? 183  SER C OG    1 
ATOM   7250  N  N     . MET I  5  184  ? 9.082   86.643  8.664   1.00 50.97  ? 184  MET C N     1 
ATOM   7251  C  CA    . MET I  5  184  ? 9.542   87.757  7.841   1.00 52.19  ? 184  MET C CA    1 
ATOM   7252  C  C     . MET I  5  184  ? 10.425  88.680  8.695   1.00 51.77  ? 184  MET C C     1 
ATOM   7253  O  O     . MET I  5  184  ? 9.959   89.306  9.649   1.00 51.38  ? 184  MET C O     1 
ATOM   7254  C  CB    . MET I  5  184  ? 8.352   88.548  7.266   1.00 53.19  ? 184  MET C CB    1 
ATOM   7255  C  CG    . MET I  5  184  ? 8.741   89.699  6.306   1.00 53.95  ? 184  MET C CG    1 
ATOM   7256  S  SD    . MET I  5  184  ? 8.533   89.428  4.501   1.00 52.43  ? 184  MET C SD    1 
ATOM   7257  C  CE    . MET I  5  184  ? 8.155   91.148  3.944   1.00 53.76  ? 184  MET C CE    1 
ATOM   7258  N  N     . LYS I  5  185  ? 11.703  88.770  8.362   1.00 51.09  ? 185  LYS C N     1 
ATOM   7259  C  CA    . LYS I  5  185  ? 12.579  89.533  9.211   1.00 51.41  ? 185  LYS C CA    1 
ATOM   7260  C  C     . LYS I  5  185  ? 13.150  90.724  8.513   1.00 51.94  ? 185  LYS C C     1 
ATOM   7261  O  O     . LYS I  5  185  ? 13.768  90.620  7.463   1.00 51.56  ? 185  LYS C O     1 
ATOM   7262  C  CB    . LYS I  5  185  ? 13.697  88.619  9.708   1.00 50.81  ? 185  LYS C CB    1 
ATOM   7263  C  CG    . LYS I  5  185  ? 13.153  87.352  10.379  1.00 50.09  ? 185  LYS C CG    1 
ATOM   7264  C  CD    . LYS I  5  185  ? 14.238  86.424  10.914  1.00 51.30  ? 185  LYS C CD    1 
ATOM   7265  C  CE    . LYS I  5  185  ? 14.382  85.161  10.073  1.00 53.62  ? 185  LYS C CE    1 
ATOM   7266  N  NZ    . LYS I  5  185  ? 15.215  84.103  10.730  1.00 53.74  ? 185  LYS C NZ    1 
ATOM   7267  N  N     . VAL I  5  186  ? 12.930  91.871  9.125   1.00 53.06  ? 186  VAL C N     1 
ATOM   7268  C  CA    . VAL I  5  186  ? 13.475  93.103  8.611   1.00 55.52  ? 186  VAL C CA    1 
ATOM   7269  C  C     . VAL I  5  186  ? 14.903  93.327  9.178   1.00 56.64  ? 186  VAL C C     1 
ATOM   7270  O  O     . VAL I  5  186  ? 15.876  93.092  8.450   1.00 56.82  ? 186  VAL C O     1 
ATOM   7271  C  CB    . VAL I  5  186  ? 12.474  94.260  8.930   1.00 56.64  ? 186  VAL C CB    1 
ATOM   7272  C  CG1   . VAL I  5  186  ? 11.464  94.390  7.765   1.00 55.43  ? 186  VAL C CG1   1 
ATOM   7273  C  CG2   . VAL I  5  186  ? 11.678  93.945  10.228  1.00 57.39  ? 186  VAL C CG2   1 
ATOM   7274  N  N     . ASN I  5  187  ? 15.070  93.760  10.428  1.00 57.75  ? 187  ASN C N     1 
ATOM   7275  C  CA    . ASN I  5  187  ? 16.436  93.826  10.952  1.00 59.40  ? 187  ASN C CA    1 
ATOM   7276  C  C     . ASN I  5  187  ? 16.819  92.481  11.577  1.00 60.85  ? 187  ASN C C     1 
ATOM   7277  O  O     . ASN I  5  187  ? 17.963  92.041  11.445  1.00 59.99  ? 187  ASN C O     1 
ATOM   7278  C  CB    . ASN I  5  187  ? 16.604  94.932  12.005  1.00 58.50  ? 187  ASN C CB    1 
ATOM   7279  C  CG    . ASN I  5  187  ? 18.026  94.981  12.594  1.00 58.09  ? 187  ASN C CG    1 
ATOM   7280  O  OD1   . ASN I  5  187  ? 18.565  93.972  13.066  1.00 56.62  ? 187  ASN C OD1   1 
ATOM   7281  N  ND2   . ASN I  5  187  ? 18.632  96.165  12.568  1.00 58.21  ? 187  ASN C ND2   1 
ATOM   7282  N  N     . LYS I  5  188  ? 15.858  91.833  12.249  1.00 63.52  ? 188  LYS C N     1 
ATOM   7283  C  CA    . LYS I  5  188  ? 16.122  90.526  12.862  1.00 66.35  ? 188  LYS C CA    1 
ATOM   7284  C  C     . LYS I  5  188  ? 14.841  89.766  13.295  1.00 68.10  ? 188  LYS C C     1 
ATOM   7285  O  O     . LYS I  5  188  ? 14.437  88.853  12.585  1.00 69.63  ? 188  LYS C O     1 
ATOM   7286  C  CB    . LYS I  5  188  ? 17.056  90.671  14.062  1.00 66.38  ? 188  LYS C CB    1 
ATOM   7287  C  CG    . LYS I  5  188  ? 18.461  90.190  13.712  1.00 66.83  ? 188  LYS C CG    1 
ATOM   7288  C  CD    . LYS I  5  188  ? 19.485  90.435  14.793  1.00 67.83  ? 188  LYS C CD    1 
ATOM   7289  C  CE    . LYS I  5  188  ? 20.882  90.105  14.261  1.00 68.46  ? 188  LYS C CE    1 
ATOM   7290  N  NZ    . LYS I  5  188  ? 21.963  90.588  15.168  1.00 69.35  ? 188  LYS C NZ    1 
ATOM   7291  N  N     . ARG I  5  189  ? 14.207  90.102  14.427  1.00 69.28  ? 189  ARG C N     1 
ATOM   7292  C  CA    . ARG I  5  189  ? 13.030  89.330  14.922  1.00 69.83  ? 189  ARG C CA    1 
ATOM   7293  C  C     . ARG I  5  189  ? 11.847  89.278  13.886  1.00 68.98  ? 189  ARG C C     1 
ATOM   7294  O  O     . ARG I  5  189  ? 11.340  90.308  13.397  1.00 68.81  ? 189  ARG C O     1 
ATOM   7295  C  CB    . ARG I  5  189  ? 12.536  89.919  16.278  1.00 72.55  ? 189  ARG C CB    1 
ATOM   7296  C  CG    . ARG I  5  189  ? 12.286  88.901  17.467  1.00 73.58  ? 189  ARG C CG    1 
ATOM   7297  C  CD    . ARG I  5  189  ? 13.527  88.651  18.383  1.00 73.74  ? 189  ARG C CD    1 
ATOM   7298  N  NE    . ARG I  5  189  ? 13.250  87.765  19.530  1.00 73.06  ? 189  ARG C NE    1 
ATOM   7299  C  CZ    . ARG I  5  189  ? 14.176  87.298  20.373  1.00 73.15  ? 189  ARG C CZ    1 
ATOM   7300  N  NH1   . ARG I  5  189  ? 15.455  87.619  20.222  1.00 73.87  ? 189  ARG C NH1   1 
ATOM   7301  N  NH2   . ARG I  5  189  ? 13.827  86.496  21.370  1.00 72.33  ? 189  ARG C NH2   1 
ATOM   7302  N  N     . LYS I  5  190  ? 11.433  88.037  13.585  1.00 66.75  ? 190  LYS C N     1 
ATOM   7303  C  CA    . LYS I  5  190  ? 10.345  87.697  12.656  1.00 64.46  ? 190  LYS C CA    1 
ATOM   7304  C  C     . LYS I  5  190  ? 9.022   88.191  13.175  1.00 63.96  ? 190  LYS C C     1 
ATOM   7305  O  O     . LYS I  5  190  ? 8.826   88.256  14.387  1.00 64.83  ? 190  LYS C O     1 
ATOM   7306  C  CB    . LYS I  5  190  ? 10.253  86.190  12.502  1.00 61.75  ? 190  LYS C CB    1 
ATOM   7307  C  CG    . LYS I  5  190  ? 11.596  85.515  12.674  1.00 59.56  ? 190  LYS C CG    1 
ATOM   7308  C  CD    . LYS I  5  190  ? 11.478  84.034  12.842  1.00 59.35  ? 190  LYS C CD    1 
ATOM   7309  C  CE    . LYS I  5  190  ? 12.730  83.352  12.338  1.00 57.88  ? 190  LYS C CE    1 
ATOM   7310  N  NZ    . LYS I  5  190  ? 12.479  81.974  11.843  1.00 56.68  ? 190  LYS C NZ    1 
ATOM   7311  N  N     . PHE I  5  191  ? 8.104   88.531  12.283  1.00 62.68  ? 191  PHE C N     1 
ATOM   7312  C  CA    . PHE I  5  191  ? 6.834   89.022  12.761  1.00 62.20  ? 191  PHE C CA    1 
ATOM   7313  C  C     . PHE I  5  191  ? 5.704   88.484  11.944  1.00 62.51  ? 191  PHE C C     1 
ATOM   7314  O  O     . PHE I  5  191  ? 5.938   87.898  10.885  1.00 61.49  ? 191  PHE C O     1 
ATOM   7315  C  CB    . PHE I  5  191  ? 6.816   90.570  12.752  1.00 61.32  ? 191  PHE C CB    1 
ATOM   7316  C  CG    . PHE I  5  191  ? 6.647   91.185  11.388  1.00 59.24  ? 191  PHE C CG    1 
ATOM   7317  C  CD1   . PHE I  5  191  ? 7.523   90.868  10.335  1.00 58.07  ? 191  PHE C CD1   1 
ATOM   7318  C  CD2   . PHE I  5  191  ? 5.609   92.108  11.158  1.00 58.32  ? 191  PHE C CD2   1 
ATOM   7319  C  CE1   . PHE I  5  191  ? 7.380   91.457  9.065   1.00 56.52  ? 191  PHE C CE1   1 
ATOM   7320  C  CE2   . PHE I  5  191  ? 5.450   92.710  9.885   1.00 57.55  ? 191  PHE C CE2   1 
ATOM   7321  C  CZ    . PHE I  5  191  ? 6.343   92.380  8.839   1.00 56.89  ? 191  PHE C CZ    1 
ATOM   7322  N  N     . PRO I  5  192  ? 4.457   88.655  12.443  1.00 63.82  ? 192  PRO C N     1 
ATOM   7323  C  CA    . PRO I  5  192  ? 3.388   88.143  11.616  1.00 63.39  ? 192  PRO C CA    1 
ATOM   7324  C  C     . PRO I  5  192  ? 3.460   88.775  10.288  1.00 63.21  ? 192  PRO C C     1 
ATOM   7325  O  O     . PRO I  5  192  ? 3.449   90.002  10.192  1.00 63.27  ? 192  PRO C O     1 
ATOM   7326  C  CB    . PRO I  5  192  ? 2.118   88.524  12.364  1.00 64.46  ? 192  PRO C CB    1 
ATOM   7327  C  CG    . PRO I  5  192  ? 2.555   88.606  13.780  1.00 65.13  ? 192  PRO C CG    1 
ATOM   7328  C  CD    . PRO I  5  192  ? 3.901   89.287  13.652  1.00 64.96  ? 192  PRO C CD    1 
ATOM   7329  N  N     . LEU I  5  193  ? 3.582   87.958  9.263   1.00 62.39  ? 193  LEU C N     1 
ATOM   7330  C  CA    . LEU I  5  193  ? 3.638   88.526  7.947   1.00 61.89  ? 193  LEU C CA    1 
ATOM   7331  C  C     . LEU I  5  193  ? 2.299   89.227  7.621   1.00 60.78  ? 193  LEU C C     1 
ATOM   7332  O  O     . LEU I  5  193  ? 2.204   90.099  6.746   1.00 60.11  ? 193  LEU C O     1 
ATOM   7333  C  CB    . LEU I  5  193  ? 4.001   87.387  6.973   1.00 60.31  ? 193  LEU C CB    1 
ATOM   7334  C  CG    . LEU I  5  193  ? 5.481   86.949  7.055   1.00 57.70  ? 193  LEU C CG    1 
ATOM   7335  C  CD1   . LEU I  5  193  ? 5.796   86.181  8.335   1.00 56.67  ? 193  LEU C CD1   1 
ATOM   7336  C  CD2   . LEU I  5  193  ? 5.762   86.095  5.866   1.00 57.94  ? 193  LEU C CD2   1 
ATOM   7337  N  N     . VAL I  5  194  ? 1.282   88.839  8.392   1.00 60.02  ? 194  VAL C N     1 
ATOM   7338  C  CA    . VAL I  5  194  ? -0.092  89.316  8.269   1.00 59.23  ? 194  VAL C CA    1 
ATOM   7339  C  C     . VAL I  5  194  ? -0.303  90.627  9.015   1.00 59.37  ? 194  VAL C C     1 
ATOM   7340  O  O     . VAL I  5  194  ? -1.014  91.492  8.523   1.00 59.00  ? 194  VAL C O     1 
ATOM   7341  C  CB    . VAL I  5  194  ? -1.076  88.245  8.813   1.00 59.03  ? 194  VAL C CB    1 
ATOM   7342  C  CG1   . VAL I  5  194  ? -2.537  88.721  8.705   1.00 58.64  ? 194  VAL C CG1   1 
ATOM   7343  C  CG2   . VAL I  5  194  ? -0.873  86.986  8.033   1.00 58.42  ? 194  VAL C CG2   1 
ATOM   7344  N  N     . LEU I  5  195  ? 0.301   90.770  10.196  1.00 59.46  ? 195  LEU C N     1 
ATOM   7345  C  CA    . LEU I  5  195  ? 0.164   91.992  11.001  1.00 58.58  ? 195  LEU C CA    1 
ATOM   7346  C  C     . LEU I  5  195  ? 0.481   93.239  10.172  1.00 57.71  ? 195  LEU C C     1 
ATOM   7347  O  O     . LEU I  5  195  ? -0.099  94.308  10.400  1.00 57.96  ? 195  LEU C O     1 
ATOM   7348  C  CB    . LEU I  5  195  ? 1.096   91.922  12.214  1.00 58.34  ? 195  LEU C CB    1 
ATOM   7349  C  CG    . LEU I  5  195  ? 1.898   93.154  12.626  1.00 58.08  ? 195  LEU C CG    1 
ATOM   7350  C  CD1   . LEU I  5  195  ? 1.002   94.219  13.241  1.00 58.54  ? 195  LEU C CD1   1 
ATOM   7351  C  CD2   . LEU I  5  195  ? 2.943   92.715  13.610  1.00 59.49  ? 195  LEU C CD2   1 
ATOM   7352  N  N     . LEU I  5  196  ? 1.400   93.102  9.219   1.00 56.52  ? 196  LEU C N     1 
ATOM   7353  C  CA    . LEU I  5  196  ? 1.748   94.223  8.375   1.00 55.04  ? 196  LEU C CA    1 
ATOM   7354  C  C     . LEU I  5  196  ? 0.772   94.370  7.222   1.00 56.10  ? 196  LEU C C     1 
ATOM   7355  O  O     . LEU I  5  196  ? 0.355   95.484  6.917   1.00 56.42  ? 196  LEU C O     1 
ATOM   7356  C  CB    . LEU I  5  196  ? 3.154   94.072  7.834   1.00 51.95  ? 196  LEU C CB    1 
ATOM   7357  C  CG    . LEU I  5  196  ? 3.940   95.394  7.914   1.00 50.03  ? 196  LEU C CG    1 
ATOM   7358  C  CD1   . LEU I  5  196  ? 5.236   95.168  7.183   1.00 49.34  ? 196  LEU C CD1   1 
ATOM   7359  C  CD2   . LEU I  5  196  ? 3.194   96.579  7.295   1.00 47.80  ? 196  LEU C CD2   1 
ATOM   7360  N  N     . LEU I  5  197  ? 0.404   93.268  6.575   1.00 57.63  ? 197  LEU C N     1 
ATOM   7361  C  CA    . LEU I  5  197  ? -0.566  93.358  5.481   1.00 59.78  ? 197  LEU C CA    1 
ATOM   7362  C  C     . LEU I  5  197  ? -1.902  93.940  5.976   1.00 61.01  ? 197  LEU C C     1 
ATOM   7363  O  O     . LEU I  5  197  ? -2.532  94.729  5.281   1.00 62.14  ? 197  LEU C O     1 
ATOM   7364  C  CB    . LEU I  5  197  ? -0.808  91.978  4.851   1.00 59.29  ? 197  LEU C CB    1 
ATOM   7365  C  CG    . LEU I  5  197  ? 0.243   91.455  3.866   1.00 59.87  ? 197  LEU C CG    1 
ATOM   7366  C  CD1   . LEU I  5  197  ? -0.306  90.166  3.289   1.00 60.14  ? 197  LEU C CD1   1 
ATOM   7367  C  CD2   . LEU I  5  197  ? 0.550   92.465  2.728   1.00 60.16  ? 197  LEU C CD2   1 
ATOM   7368  N  N     . ARG I  5  198  ? -2.332  93.549  7.173   1.00 62.19  ? 198  ARG C N     1 
ATOM   7369  C  CA    . ARG I  5  198  ? -3.571  94.074  7.736   1.00 61.74  ? 198  ARG C CA    1 
ATOM   7370  C  C     . ARG I  5  198  ? -3.469  95.593  7.914   1.00 62.04  ? 198  ARG C C     1 
ATOM   7371  O  O     . ARG I  5  198  ? -4.453  96.318  7.744   1.00 62.01  ? 198  ARG C O     1 
ATOM   7372  C  CB    . ARG I  5  198  ? -3.861  93.399  9.091   1.00 62.15  ? 198  ARG C CB    1 
ATOM   7373  C  CG    . ARG I  5  198  ? -3.891  91.867  9.035   1.00 61.21  ? 198  ARG C CG    1 
ATOM   7374  C  CD    . ARG I  5  198  ? -5.202  91.265  9.484   1.00 60.36  ? 198  ARG C CD    1 
ATOM   7375  N  NE    . ARG I  5  198  ? -6.338  91.615  8.631   1.00 60.63  ? 198  ARG C NE    1 
ATOM   7376  C  CZ    . ARG I  5  198  ? -7.061  92.730  8.745   1.00 59.38  ? 198  ARG C CZ    1 
ATOM   7377  N  NH1   . ARG I  5  198  ? -6.778  93.633  9.678   1.00 57.63  ? 198  ARG C NH1   1 
ATOM   7378  N  NH2   . ARG I  5  198  ? -8.087  92.943  7.931   1.00 58.70  ? 198  ARG C NH2   1 
ATOM   7379  N  N     . VAL I  5  199  ? -2.257  96.050  8.245   1.00 61.17  ? 199  VAL C N     1 
ATOM   7380  C  CA    . VAL I  5  199  ? -1.956  97.463  8.446   1.00 61.24  ? 199  VAL C CA    1 
ATOM   7381  C  C     . VAL I  5  199  ? -2.167  98.260  7.174   1.00 62.71  ? 199  VAL C C     1 
ATOM   7382  O  O     . VAL I  5  199  ? -2.746  99.345  7.204   1.00 62.90  ? 199  VAL C O     1 
ATOM   7383  C  CB    . VAL I  5  199  ? -0.510  97.623  8.944   1.00 59.74  ? 199  VAL C CB    1 
ATOM   7384  C  CG1   . VAL I  5  199  ? 0.081   98.967  8.557   1.00 58.94  ? 199  VAL C CG1   1 
ATOM   7385  C  CG2   . VAL I  5  199  ? -0.533  97.509  10.446  1.00 59.20  ? 199  VAL C CG2   1 
ATOM   7386  N  N     . LEU I  5  200  ? -1.686  97.718  6.060   1.00 64.45  ? 200  LEU C N     1 
ATOM   7387  C  CA    . LEU I  5  200  ? -1.840  98.370  4.768   1.00 66.67  ? 200  LEU C CA    1 
ATOM   7388  C  C     . LEU I  5  200  ? -3.265  98.214  4.226   1.00 69.37  ? 200  LEU C C     1 
ATOM   7389  O  O     . LEU I  5  200  ? -3.699  99.036  3.417   1.00 70.77  ? 200  LEU C O     1 
ATOM   7390  C  CB    . LEU I  5  200  ? -0.833  97.794  3.778   1.00 65.26  ? 200  LEU C CB    1 
ATOM   7391  C  CG    . LEU I  5  200  ? 0.562   98.374  4.005   1.00 65.66  ? 200  LEU C CG    1 
ATOM   7392  C  CD1   . LEU I  5  200  ? 1.588   97.265  4.069   1.00 65.58  ? 200  LEU C CD1   1 
ATOM   7393  C  CD2   . LEU I  5  200  ? 0.882   99.350  2.894   1.00 65.51  ? 200  LEU C CD2   1 
ATOM   7394  N  N     . GLY I  5  201  ? -3.993  97.176  4.655   1.00 70.85  ? 201  GLY C N     1 
ATOM   7395  C  CA    . GLY I  5  201  ? -5.377  97.010  4.203   1.00 72.55  ? 201  GLY C CA    1 
ATOM   7396  C  C     . GLY I  5  201  ? -5.798  95.599  3.780   1.00 73.86  ? 201  GLY C C     1 
ATOM   7397  O  O     . GLY I  5  201  ? -6.988  95.383  3.497   1.00 74.10  ? 201  GLY C O     1 
ATOM   7398  N  N     . TYR I  5  202  ? -4.858  94.646  3.730   1.00 74.44  ? 202  TYR C N     1 
ATOM   7399  C  CA    . TYR I  5  202  ? -5.152  93.257  3.322   1.00 73.43  ? 202  TYR C CA    1 
ATOM   7400  C  C     . TYR I  5  202  ? -5.805  92.465  4.468   1.00 71.61  ? 202  TYR C C     1 
ATOM   7401  O  O     . TYR I  5  202  ? -5.178  92.164  5.492   1.00 70.65  ? 202  TYR C O     1 
ATOM   7402  C  CB    . TYR I  5  202  ? -3.856  92.542  2.874   1.00 73.84  ? 202  TYR C CB    1 
ATOM   7403  C  CG    . TYR I  5  202  ? -3.246  93.007  1.557   1.00 73.47  ? 202  TYR C CG    1 
ATOM   7404  C  CD1   . TYR I  5  202  ? -3.621  92.397  0.341   1.00 73.46  ? 202  TYR C CD1   1 
ATOM   7405  C  CD2   . TYR I  5  202  ? -2.286  94.058  1.516   1.00 72.45  ? 202  TYR C CD2   1 
ATOM   7406  C  CE1   . TYR I  5  202  ? -3.052  92.820  -0.910  1.00 73.70  ? 202  TYR C CE1   1 
ATOM   7407  C  CE2   . TYR I  5  202  ? -1.712  94.492  0.274   1.00 73.05  ? 202  TYR C CE2   1 
ATOM   7408  C  CZ    . TYR I  5  202  ? -2.109  93.861  -0.926  1.00 73.01  ? 202  TYR C CZ    1 
ATOM   7409  O  OH    . TYR I  5  202  ? -1.601  94.260  -2.131  1.00 71.93  ? 202  TYR C OH    1 
ATOM   7410  N  N     . ASP I  5  203  ? -7.075  92.139  4.283   1.00 69.96  ? 203  ASP C N     1 
ATOM   7411  C  CA    . ASP I  5  203  ? -7.791  91.403  5.289   1.00 68.32  ? 203  ASP C CA    1 
ATOM   7412  C  C     . ASP I  5  203  ? -7.622  89.920  5.079   1.00 67.98  ? 203  ASP C C     1 
ATOM   7413  O  O     . ASP I  5  203  ? -7.384  89.467  3.960   1.00 66.15  ? 203  ASP C O     1 
ATOM   7414  C  CB    . ASP I  5  203  ? -9.290  91.772  5.270   1.00 68.17  ? 203  ASP C CB    1 
ATOM   7415  C  CG    . ASP I  5  203  ? -9.626  92.906  4.280   1.00 66.21  ? 203  ASP C CG    1 
ATOM   7416  O  OD1   . ASP I  5  203  ? -9.474  92.711  3.067   1.00 65.15  ? 203  ASP C OD1   1 
ATOM   7417  O  OD2   . ASP I  5  203  ? -10.048 94.001  4.710   1.00 65.40  ? 203  ASP C OD2   1 
ATOM   7418  N  N     . GLN I  5  204  ? -7.751  89.184  6.171   1.00 67.34  ? 204  GLN C N     1 
ATOM   7419  C  CA    . GLN I  5  204  ? -7.609  87.743  6.192   1.00 67.23  ? 204  GLN C CA    1 
ATOM   7420  C  C     . GLN I  5  204  ? -8.356  87.065  5.031   1.00 68.07  ? 204  GLN C C     1 
ATOM   7421  O  O     . GLN I  5  204  ? -7.742  86.324  4.258   1.00 68.72  ? 204  GLN C O     1 
ATOM   7422  C  CB    . GLN I  5  204  ? -8.124  87.228  7.533   1.00 65.60  ? 204  GLN C CB    1 
ATOM   7423  C  CG    . GLN I  5  204  ? -7.457  87.912  8.717   1.00 62.22  ? 204  GLN C CG    1 
ATOM   7424  C  CD    . GLN I  5  204  ? -6.543  86.978  9.462   1.00 60.98  ? 204  GLN C CD    1 
ATOM   7425  O  OE1   . GLN I  5  204  ? -7.000  86.036  10.089  1.00 59.80  ? 204  GLN C OE1   1 
ATOM   7426  N  NE2   . GLN I  5  204  ? -5.244  87.231  9.399   1.00 60.57  ? 204  GLN C NE2   1 
ATOM   7427  N  N     . GLU I  5  205  ? -9.660  87.323  4.899   1.00 68.02  ? 205  GLU C N     1 
ATOM   7428  C  CA    . GLU I  5  205  ? -10.494 86.669  3.876   1.00 68.12  ? 205  GLU C CA    1 
ATOM   7429  C  C     . GLU I  5  205  ? -9.978  86.888  2.444   1.00 67.82  ? 205  GLU C C     1 
ATOM   7430  O  O     . GLU I  5  205  ? -9.632  85.909  1.764   1.00 67.89  ? 205  GLU C O     1 
ATOM   7431  C  CB    . GLU I  5  205  ? -11.946 87.152  3.981   1.00 67.37  ? 205  GLU C CB    1 
ATOM   7432  C  CG    . GLU I  5  205  ? -12.126 88.647  3.895   1.00 66.92  ? 205  GLU C CG    1 
ATOM   7433  C  CD    . GLU I  5  205  ? -13.151 89.027  2.849   1.00 67.90  ? 205  GLU C CD    1 
ATOM   7434  O  OE1   . GLU I  5  205  ? -12.914 88.735  1.653   1.00 68.03  ? 205  GLU C OE1   1 
ATOM   7435  O  OE2   . GLU I  5  205  ? -14.194 89.614  3.221   1.00 67.40  ? 205  GLU C OE2   1 
ATOM   7436  N  N     . THR I  5  206  ? -9.918  88.134  1.974   1.00 66.10  ? 206  THR C N     1 
ATOM   7437  C  CA    . THR I  5  206  ? -9.481  88.380  0.601   1.00 64.02  ? 206  THR C CA    1 
ATOM   7438  C  C     . THR I  5  206  ? -8.065  87.888  0.372   1.00 63.35  ? 206  THR C C     1 
ATOM   7439  O  O     . THR I  5  206  ? -7.784  87.209  -0.607  1.00 63.88  ? 206  THR C O     1 
ATOM   7440  C  CB    . THR I  5  206  ? -9.534  89.876  0.247   1.00 63.56  ? 206  THR C CB    1 
ATOM   7441  O  OG1   . THR I  5  206  ? -9.135  90.044  -1.117  1.00 62.95  ? 206  THR C OG1   1 
ATOM   7442  C  CG2   . THR I  5  206  ? -8.621  90.681  1.162   1.00 62.97  ? 206  THR C CG2   1 
ATOM   7443  N  N     . LEU I  5  207  ? -7.191  88.236  1.297   1.00 62.29  ? 207  LEU C N     1 
ATOM   7444  C  CA    . LEU I  5  207  ? -5.781  87.899  1.264   1.00 62.63  ? 207  LEU C CA    1 
ATOM   7445  C  C     . LEU I  5  207  ? -5.561  86.411  1.018   1.00 63.02  ? 207  LEU C C     1 
ATOM   7446  O  O     . LEU I  5  207  ? -4.848  85.997  0.105   1.00 62.01  ? 207  LEU C O     1 
ATOM   7447  C  CB    . LEU I  5  207  ? -5.182  88.308  2.608   1.00 60.38  ? 207  LEU C CB    1 
ATOM   7448  C  CG    . LEU I  5  207  ? -3.729  88.714  2.824   1.00 57.82  ? 207  LEU C CG    1 
ATOM   7449  C  CD1   . LEU I  5  207  ? -3.604  89.394  4.164   1.00 55.76  ? 207  LEU C CD1   1 
ATOM   7450  C  CD2   . LEU I  5  207  ? -2.840  87.497  2.734   1.00 57.62  ? 207  LEU C CD2   1 
ATOM   7451  N  N     . ALA I  5  208  ? -6.202  85.625  1.866   1.00 65.66  ? 208  ALA C N     1 
ATOM   7452  C  CA    . ALA I  5  208  ? -6.103  84.177  1.879   1.00 67.94  ? 208  ALA C CA    1 
ATOM   7453  C  C     . ALA I  5  208  ? -6.596  83.533  0.579   1.00 70.13  ? 208  ALA C C     1 
ATOM   7454  O  O     . ALA I  5  208  ? -5.875  82.731  -0.016  1.00 70.25  ? 208  ALA C O     1 
ATOM   7455  C  CB    . ALA I  5  208  ? -6.905  83.640  3.048   1.00 66.89  ? 208  ALA C CB    1 
ATOM   7456  N  N     . ARG I  5  209  ? -7.810  83.876  0.144   1.00 72.41  ? 209  ARG C N     1 
ATOM   7457  C  CA    . ARG I  5  209  ? -8.428  83.254  -1.037  1.00 74.79  ? 209  ARG C CA    1 
ATOM   7458  C  C     . ARG I  5  209  ? -7.775  83.684  -2.370  1.00 76.15  ? 209  ARG C C     1 
ATOM   7459  O  O     . ARG I  5  209  ? -7.882  82.947  -3.355  1.00 76.64  ? 209  ARG C O     1 
ATOM   7460  C  CB    . ARG I  5  209  ? -9.936  83.573  -1.066  1.00 75.68  ? 209  ARG C CB    1 
ATOM   7461  C  CG    . ARG I  5  209  ? -10.840 82.574  -0.273  1.00 76.25  ? 209  ARG C CG    1 
ATOM   7462  C  CD    . ARG I  5  209  ? -11.344 83.118  1.081   1.00 76.31  ? 209  ARG C CD    1 
ATOM   7463  N  NE    . ARG I  5  209  ? -12.306 82.209  1.727   1.00 75.95  ? 209  ARG C NE    1 
ATOM   7464  C  CZ    . ARG I  5  209  ? -12.950 82.464  2.871   1.00 75.85  ? 209  ARG C CZ    1 
ATOM   7465  N  NH1   . ARG I  5  209  ? -12.746 83.606  3.520   1.00 75.55  ? 209  ARG C NH1   1 
ATOM   7466  N  NH2   . ARG I  5  209  ? -13.805 81.576  3.370   1.00 74.29  ? 209  ARG C NH2   1 
ATOM   7467  N  N     . GLU I  5  210  ? -7.109  84.835  -2.433  1.00 77.70  ? 210  GLU C N     1 
ATOM   7468  C  CA    . GLU I  5  210  ? -6.495  85.262  -3.702  1.00 78.49  ? 210  GLU C CA    1 
ATOM   7469  C  C     . GLU I  5  210  ? -5.020  84.825  -3.798  1.00 78.36  ? 210  GLU C C     1 
ATOM   7470  O  O     . GLU I  5  210  ? -4.552  84.473  -4.883  1.00 79.11  ? 210  GLU C O     1 
ATOM   7471  C  CB    . GLU I  5  210  ? -6.601  86.786  -3.851  1.00 79.76  ? 210  GLU C CB    1 
ATOM   7472  C  CG    . GLU I  5  210  ? -6.804  87.244  -5.288  1.00 81.60  ? 210  GLU C CG    1 
ATOM   7473  C  CD    . GLU I  5  210  ? -7.056  88.744  -5.423  1.00 82.00  ? 210  GLU C CD    1 
ATOM   7474  O  OE1   . GLU I  5  210  ? -6.081  89.525  -5.295  1.00 82.18  ? 210  GLU C OE1   1 
ATOM   7475  O  OE2   . GLU I  5  210  ? -8.229  89.133  -5.658  1.00 81.44  ? 210  GLU C OE2   1 
ATOM   7476  N  N     . LEU I  5  211  ? -4.294  84.849  -2.677  1.00 77.71  ? 211  LEU C N     1 
ATOM   7477  C  CA    . LEU I  5  211  ? -2.883  84.431  -2.650  1.00 77.12  ? 211  LEU C CA    1 
ATOM   7478  C  C     . LEU I  5  211  ? -2.756  82.911  -2.463  1.00 76.43  ? 211  LEU C C     1 
ATOM   7479  O  O     . LEU I  5  211  ? -1.788  82.288  -2.915  1.00 75.89  ? 211  LEU C O     1 
ATOM   7480  C  CB    . LEU I  5  211  ? -2.129  85.162  -1.508  1.00 76.54  ? 211  LEU C CB    1 
ATOM   7481  C  CG    . LEU I  5  211  ? -0.759  84.645  -1.007  1.00 75.08  ? 211  LEU C CG    1 
ATOM   7482  C  CD1   . LEU I  5  211  ? 0.152   84.390  -2.189  1.00 74.82  ? 211  LEU C CD1   1 
ATOM   7483  C  CD2   . LEU I  5  211  ? -0.130  85.654  -0.048  1.00 74.41  ? 211  LEU C CD2   1 
ATOM   7484  N  N     . GLY I  5  212  ? -3.745  82.316  -1.806  1.00 74.96  ? 212  GLY C N     1 
ATOM   7485  C  CA    . GLY I  5  212  ? -3.680  80.896  -1.566  1.00 74.01  ? 212  GLY C CA    1 
ATOM   7486  C  C     . GLY I  5  212  ? -4.711  80.077  -2.284  1.00 74.34  ? 212  GLY C C     1 
ATOM   7487  O  O     . GLY I  5  212  ? -4.953  78.955  -1.857  1.00 74.79  ? 212  GLY C O     1 
ATOM   7488  N  N     . ALA I  5  213  ? -5.340  80.589  -3.336  1.00 73.43  ? 213  ALA C N     1 
ATOM   7489  C  CA    . ALA I  5  213  ? -6.269  79.722  -4.039  1.00 73.31  ? 213  ALA C CA    1 
ATOM   7490  C  C     . ALA I  5  213  ? -5.517  78.508  -4.541  1.00 72.79  ? 213  ALA C C     1 
ATOM   7491  O  O     . ALA I  5  213  ? -6.006  77.380  -4.513  1.00 72.61  ? 213  ALA C O     1 
ATOM   7492  C  CB    . ALA I  5  213  ? -6.923  80.466  -5.227  1.00 73.88  ? 213  ALA C CB    1 
ATOM   7493  N  N     . TYR I  5  214  ? -4.286  78.782  -4.969  1.00 71.87  ? 214  TYR C N     1 
ATOM   7494  C  CA    . TYR I  5  214  ? -3.384  77.767  -5.496  1.00 71.82  ? 214  TYR C CA    1 
ATOM   7495  C  C     . TYR I  5  214  ? -2.663  77.011  -4.376  1.00 71.13  ? 214  TYR C C     1 
ATOM   7496  O  O     . TYR I  5  214  ? -2.344  75.831  -4.544  1.00 70.72  ? 214  TYR C O     1 
ATOM   7497  C  CB    . TYR I  5  214  ? -2.339  78.411  -6.450  1.00 71.70  ? 214  TYR C CB    1 
ATOM   7498  C  CG    . TYR I  5  214  ? -1.251  79.313  -5.832  1.00 72.13  ? 214  TYR C CG    1 
ATOM   7499  C  CD1   . TYR I  5  214  ? -0.176  78.778  -5.064  1.00 71.76  ? 214  TYR C CD1   1 
ATOM   7500  C  CD2   . TYR I  5  214  ? -1.274  80.712  -6.052  1.00 73.13  ? 214  TYR C CD2   1 
ATOM   7501  C  CE1   . TYR I  5  214  ? 0.856   79.624  -4.533  1.00 71.98  ? 214  TYR C CE1   1 
ATOM   7502  C  CE2   . TYR I  5  214  ? -0.246  81.572  -5.525  1.00 73.37  ? 214  TYR C CE2   1 
ATOM   7503  C  CZ    . TYR I  5  214  ? 0.805   81.017  -4.776  1.00 72.65  ? 214  TYR C CZ    1 
ATOM   7504  O  OH    . TYR I  5  214  ? 1.782   81.858  -4.310  1.00 72.36  ? 214  TYR C OH    1 
ATOM   7505  N  N     . GLY I  5  215  ? -2.420  77.674  -3.241  1.00 70.24  ? 215  GLY C N     1 
ATOM   7506  C  CA    . GLY I  5  215  ? -1.672  77.041  -2.157  1.00 70.11  ? 215  GLY C CA    1 
ATOM   7507  C  C     . GLY I  5  215  ? -2.397  76.844  -0.824  1.00 69.81  ? 215  GLY C C     1 
ATOM   7508  O  O     . GLY I  5  215  ? -3.577  77.166  -0.668  1.00 69.01  ? 215  GLY C O     1 
ATOM   7509  N  N     . GLU I  5  216  ? -1.653  76.319  0.160   1.00 68.87  ? 216  GLU C N     1 
ATOM   7510  C  CA    . GLU I  5  216  ? -2.199  75.994  1.496   1.00 68.85  ? 216  GLU C CA    1 
ATOM   7511  C  C     . GLU I  5  216  ? -1.533  76.813  2.641   1.00 67.83  ? 216  GLU C C     1 
ATOM   7512  O  O     . GLU I  5  216  ? -2.110  76.920  3.731   1.00 67.06  ? 216  GLU C O     1 
ATOM   7513  C  CB    . GLU I  5  216  ? -2.007  74.490  1.788   1.00 68.46  ? 216  GLU C CB    1 
ATOM   7514  C  CG    . GLU I  5  216  ? -0.648  74.077  2.371   1.00 67.32  ? 216  GLU C CG    1 
ATOM   7515  C  CD    . GLU I  5  216  ? 0.502   74.198  1.385   1.00 66.95  ? 216  GLU C CD    1 
ATOM   7516  O  OE1   . GLU I  5  216  ? 0.675   75.288  0.796   1.00 66.41  ? 216  GLU C OE1   1 
ATOM   7517  O  OE2   . GLU I  5  216  ? 1.235   73.197  1.206   1.00 65.54  ? 216  GLU C OE2   1 
ATOM   7518  N  N     . LEU I  5  217  ? -0.347  77.373  2.403   1.00 65.56  ? 217  LEU C N     1 
ATOM   7519  C  CA    . LEU I  5  217  ? 0.409   78.143  3.409   1.00 63.57  ? 217  LEU C CA    1 
ATOM   7520  C  C     . LEU I  5  217  ? -0.411  79.291  3.990   1.00 62.26  ? 217  LEU C C     1 
ATOM   7521  O  O     . LEU I  5  217  ? -0.048  79.886  5.011   1.00 60.42  ? 217  LEU C O     1 
ATOM   7522  C  CB    . LEU I  5  217  ? 1.660   78.707  2.764   1.00 65.34  ? 217  LEU C CB    1 
ATOM   7523  C  CG    . LEU I  5  217  ? 2.265   77.680  1.809   1.00 66.18  ? 217  LEU C CG    1 
ATOM   7524  C  CD1   . LEU I  5  217  ? 2.857   78.392  0.649   1.00 67.72  ? 217  LEU C CD1   1 
ATOM   7525  C  CD2   . LEU I  5  217  ? 3.299   76.839  2.526   1.00 67.02  ? 217  LEU C CD2   1 
ATOM   7526  N  N     . VAL I  5  218  ? -1.508  79.589  3.307   1.00 61.76  ? 218  VAL C N     1 
ATOM   7527  C  CA    . VAL I  5  218  ? -2.447  80.634  3.666   1.00 61.42  ? 218  VAL C CA    1 
ATOM   7528  C  C     . VAL I  5  218  ? -2.924  80.496  5.120   1.00 61.34  ? 218  VAL C C     1 
ATOM   7529  O  O     . VAL I  5  218  ? -3.200  81.491  5.792   1.00 60.60  ? 218  VAL C O     1 
ATOM   7530  C  CB    . VAL I  5  218  ? -3.635  80.567  2.664   1.00 60.81  ? 218  VAL C CB    1 
ATOM   7531  C  CG1   . VAL I  5  218  ? -4.907  81.068  3.269   1.00 61.29  ? 218  VAL C CG1   1 
ATOM   7532  C  CG2   . VAL I  5  218  ? -3.284  81.378  1.477   1.00 60.35  ? 218  VAL C CG2   1 
ATOM   7533  N  N     . GLN I  5  219  ? -3.009  79.266  5.604   1.00 62.04  ? 219  GLN C N     1 
ATOM   7534  C  CA    . GLN I  5  219  ? -3.505  79.022  6.951   1.00 62.77  ? 219  GLN C CA    1 
ATOM   7535  C  C     . GLN I  5  219  ? -2.595  79.626  8.033   1.00 64.46  ? 219  GLN C C     1 
ATOM   7536  O  O     . GLN I  5  219  ? -3.070  79.933  9.123   1.00 64.15  ? 219  GLN C O     1 
ATOM   7537  C  CB    . GLN I  5  219  ? -3.703  77.506  7.147   1.00 61.79  ? 219  GLN C CB    1 
ATOM   7538  C  CG    . GLN I  5  219  ? -5.041  77.045  6.535   1.00 61.09  ? 219  GLN C CG    1 
ATOM   7539  C  CD    . GLN I  5  219  ? -5.408  75.589  6.794   1.00 60.10  ? 219  GLN C CD    1 
ATOM   7540  O  OE1   . GLN I  5  219  ? -5.367  75.109  7.932   1.00 58.73  ? 219  GLN C OE1   1 
ATOM   7541  N  NE2   . GLN I  5  219  ? -5.781  74.881  5.731   1.00 59.68  ? 219  GLN C NE2   1 
ATOM   7542  N  N     . GLY I  5  220  ? -1.306  79.807  7.759   1.00 65.60  ? 220  GLY C N     1 
ATOM   7543  C  CA    . GLY I  5  220  ? -0.448  80.394  8.770   1.00 66.96  ? 220  GLY C CA    1 
ATOM   7544  C  C     . GLY I  5  220  ? -0.730  81.875  8.907   1.00 68.86  ? 220  GLY C C     1 
ATOM   7545  O  O     . GLY I  5  220  ? -0.476  82.497  9.942   1.00 69.56  ? 220  GLY C O     1 
ATOM   7546  N  N     . LEU I  5  221  ? -1.286  82.430  7.837   1.00 69.50  ? 221  LEU C N     1 
ATOM   7547  C  CA    . LEU I  5  221  ? -1.598  83.851  7.747   1.00 71.19  ? 221  LEU C CA    1 
ATOM   7548  C  C     . LEU I  5  221  ? -2.855  84.243  8.575   1.00 72.08  ? 221  LEU C C     1 
ATOM   7549  O  O     . LEU I  5  221  ? -2.832  85.220  9.336   1.00 71.35  ? 221  LEU C O     1 
ATOM   7550  C  CB    . LEU I  5  221  ? -1.787  84.217  6.258   1.00 72.82  ? 221  LEU C CB    1 
ATOM   7551  C  CG    . LEU I  5  221  ? -3.145  84.596  5.636   1.00 74.69  ? 221  LEU C CG    1 
ATOM   7552  C  CD1   . LEU I  5  221  ? -3.450  86.062  5.934   1.00 76.22  ? 221  LEU C CD1   1 
ATOM   7553  C  CD2   . LEU I  5  221  ? -3.110  84.380  4.121   1.00 73.84  ? 221  LEU C CD2   1 
ATOM   7554  N  N     . MET I  5  222  ? -3.945  83.489  8.435   1.00 71.82  ? 222  MET C N     1 
ATOM   7555  C  CA    . MET I  5  222  ? -5.190  83.818  9.138   1.00 71.98  ? 222  MET C CA    1 
ATOM   7556  C  C     . MET I  5  222  ? -5.172  83.341  10.610  1.00 71.64  ? 222  MET C C     1 
ATOM   7557  O  O     . MET I  5  222  ? -6.152  83.508  11.348  1.00 71.83  ? 222  MET C O     1 
ATOM   7558  C  CB    . MET I  5  222  ? -6.384  83.202  8.381   1.00 71.76  ? 222  MET C CB    1 
ATOM   7559  C  CG    . MET I  5  222  ? -6.279  81.731  7.995   1.00 71.22  ? 222  MET C CG    1 
ATOM   7560  S  SD    . MET I  5  222  ? -7.900  81.097  7.420   1.00 70.83  ? 222  MET C SD    1 
ATOM   7561  C  CE    . MET I  5  222  ? -8.429  80.198  8.837   1.00 70.88  ? 222  MET C CE    1 
ATOM   7562  N  N     . ASP I  5  223  ? -4.045  82.768  11.020  1.00 69.85  ? 223  ASP C N     1 
ATOM   7563  C  CA    . ASP I  5  223  ? -3.834  82.213  12.360  1.00 67.83  ? 223  ASP C CA    1 
ATOM   7564  C  C     . ASP I  5  223  ? -4.338  83.131  13.462  1.00 65.57  ? 223  ASP C C     1 
ATOM   7565  O  O     . ASP I  5  223  ? -5.453  82.967  13.937  1.00 64.66  ? 223  ASP C O     1 
ATOM   7566  C  CB    . ASP I  5  223  ? -2.349  81.941  12.572  1.00 68.62  ? 223  ASP C CB    1 
ATOM   7567  C  CG    . ASP I  5  223  ? -1.940  80.585  12.089  1.00 69.29  ? 223  ASP C CG    1 
ATOM   7568  O  OD1   . ASP I  5  223  ? -0.757  80.433  11.725  1.00 68.69  ? 223  ASP C OD1   1 
ATOM   7569  O  OD2   . ASP I  5  223  ? -2.806  79.681  12.083  1.00 70.42  ? 223  ASP C OD2   1 
ATOM   7570  N  N     . GLU I  5  224  ? -3.502  84.082  13.866  1.00 63.94  ? 224  GLU C N     1 
ATOM   7571  C  CA    . GLU I  5  224  ? -3.823  85.011  14.947  1.00 62.18  ? 224  GLU C CA    1 
ATOM   7572  C  C     . GLU I  5  224  ? -4.953  85.959  14.553  1.00 62.26  ? 224  GLU C C     1 
ATOM   7573  O  O     . GLU I  5  224  ? -4.709  87.138  14.302  1.00 61.64  ? 224  GLU C O     1 
ATOM   7574  C  CB    . GLU I  5  224  ? -2.584  85.835  15.314  1.00 61.13  ? 224  GLU C CB    1 
ATOM   7575  C  CG    . GLU I  5  224  ? -1.346  85.057  15.700  1.00 59.72  ? 224  GLU C CG    1 
ATOM   7576  C  CD    . GLU I  5  224  ? -1.230  84.835  17.191  1.00 58.74  ? 224  GLU C CD    1 
ATOM   7577  O  OE1   . GLU I  5  224  ? -1.882  83.906  17.712  1.00 59.26  ? 224  GLU C OE1   1 
ATOM   7578  O  OE2   . GLU I  5  224  ? -0.485  85.599  17.840  1.00 57.27  ? 224  GLU C OE2   1 
ATOM   7579  N  N     . SER I  5  225  ? -6.184  85.433  14.514  1.00 62.55  ? 225  SER C N     1 
ATOM   7580  C  CA    . SER I  5  225  ? -7.402  86.180  14.139  1.00 62.71  ? 225  SER C CA    1 
ATOM   7581  C  C     . SER I  5  225  ? -7.678  87.346  15.091  1.00 63.20  ? 225  SER C C     1 
ATOM   7582  O  O     . SER I  5  225  ? -8.224  88.366  14.666  1.00 62.04  ? 225  SER C O     1 
ATOM   7583  C  CB    . SER I  5  225  ? -8.634  85.256  14.140  1.00 61.02  ? 225  SER C CB    1 
ATOM   7584  O  OG    . SER I  5  225  ? -8.732  84.480  12.960  1.00 59.49  ? 225  SER C OG    1 
ATOM   7585  N  N     . VAL I  5  226  ? -7.305  87.181  16.364  1.00 64.78  ? 226  VAL C N     1 
ATOM   7586  C  CA    . VAL I  5  226  ? -7.506  88.177  17.427  1.00 65.46  ? 226  VAL C CA    1 
ATOM   7587  C  C     . VAL I  5  226  ? -6.993  89.565  17.017  1.00 66.58  ? 226  VAL C C     1 
ATOM   7588  O  O     . VAL I  5  226  ? -7.714  90.553  17.172  1.00 66.19  ? 226  VAL C O     1 
ATOM   7589  C  CB    . VAL I  5  226  ? -6.793  87.710  18.773  1.00 65.82  ? 226  VAL C CB    1 
ATOM   7590  C  CG1   . VAL I  5  226  ? -5.296  87.451  18.515  1.00 64.90  ? 226  VAL C CG1   1 
ATOM   7591  C  CG2   . VAL I  5  226  ? -6.933  88.763  19.856  1.00 64.71  ? 226  VAL C CG2   1 
ATOM   7592  N  N     . PHE I  5  227  ? -5.768  89.645  16.498  1.00 67.61  ? 227  PHE C N     1 
ATOM   7593  C  CA    . PHE I  5  227  ? -5.183  90.930  16.092  1.00 69.23  ? 227  PHE C CA    1 
ATOM   7594  C  C     . PHE I  5  227  ? -5.584  91.319  14.671  1.00 70.66  ? 227  PHE C C     1 
ATOM   7595  O  O     . PHE I  5  227  ? -5.465  92.491  14.293  1.00 70.52  ? 227  PHE C O     1 
ATOM   7596  C  CB    . PHE I  5  227  ? -3.665  90.863  16.147  1.00 67.72  ? 227  PHE C CB    1 
ATOM   7597  C  CG    . PHE I  5  227  ? -3.141  90.249  17.392  1.00 67.35  ? 227  PHE C CG    1 
ATOM   7598  C  CD1   . PHE I  5  227  ? -2.305  89.119  17.322  1.00 67.87  ? 227  PHE C CD1   1 
ATOM   7599  C  CD2   . PHE I  5  227  ? -3.473  90.782  18.648  1.00 66.42  ? 227  PHE C CD2   1 
ATOM   7600  C  CE1   . PHE I  5  227  ? -1.799  88.516  18.502  1.00 66.93  ? 227  PHE C CE1   1 
ATOM   7601  C  CE2   . PHE I  5  227  ? -2.981  90.199  19.841  1.00 66.07  ? 227  PHE C CE2   1 
ATOM   7602  C  CZ    . PHE I  5  227  ? -2.139  89.059  19.767  1.00 66.19  ? 227  PHE C CZ    1 
ATOM   7603  N  N     . ALA I  5  228  ? -6.053  90.336  13.900  1.00 72.79  ? 228  ALA C N     1 
ATOM   7604  C  CA    . ALA I  5  228  ? -6.443  90.511  12.499  1.00 73.57  ? 228  ALA C CA    1 
ATOM   7605  C  C     . ALA I  5  228  ? -7.843  91.135  12.344  1.00 75.13  ? 228  ALA C C     1 
ATOM   7606  O  O     . ALA I  5  228  ? -8.243  91.440  11.217  1.00 75.87  ? 228  ALA C O     1 
ATOM   7607  C  CB    . ALA I  5  228  ? -6.407  89.170  11.796  1.00 73.91  ? 228  ALA C CB    1 
ATOM   7608  N  N     . MET I  5  229  ? -8.586  91.327  13.436  1.00 75.45  ? 229  MET C N     1 
ATOM   7609  C  CA    . MET I  5  229  ? -9.928  91.915  13.340  1.00 75.44  ? 229  MET C CA    1 
ATOM   7610  C  C     . MET I  5  229  ? -9.914  93.427  13.603  1.00 75.91  ? 229  MET C C     1 
ATOM   7611  O  O     . MET I  5  229  ? -10.976 94.051  13.633  1.00 76.25  ? 229  MET C O     1 
ATOM   7612  C  CB    . MET I  5  229  ? -10.886 91.235  14.328  1.00 75.43  ? 229  MET C CB    1 
ATOM   7613  C  CG    . MET I  5  229  ? -11.275 89.804  13.962  1.00 76.11  ? 229  MET C CG    1 
ATOM   7614  S  SD    . MET I  5  229  ? -12.170 89.662  12.397  1.00 75.85  ? 229  MET C SD    1 
ATOM   7615  C  CE    . MET I  5  229  ? -13.721 90.321  12.865  1.00 76.00  ? 229  MET C CE    1 
ATOM   7616  N  N     . ARG I  5  230  ? -8.730  94.016  13.796  1.00 77.15  ? 230  ARG C N     1 
ATOM   7617  C  CA    . ARG I  5  230  ? -8.594  95.472  14.015  1.00 77.78  ? 230  ARG C CA    1 
ATOM   7618  C  C     . ARG I  5  230  ? -7.455  96.067  13.129  1.00 78.59  ? 230  ARG C C     1 
ATOM   7619  O  O     . ARG I  5  230  ? -6.260  95.889  13.440  1.00 79.22  ? 230  ARG C O     1 
ATOM   7620  C  CB    . ARG I  5  230  ? -8.325  95.772  15.502  1.00 77.14  ? 230  ARG C CB    1 
ATOM   7621  C  CG    . ARG I  5  230  ? -7.231  94.941  16.152  1.00 76.31  ? 230  ARG C CG    1 
ATOM   7622  C  CD    . ARG I  5  230  ? -7.780  93.649  16.696  1.00 75.73  ? 230  ARG C CD    1 
ATOM   7623  N  NE    . ARG I  5  230  ? -6.807  93.022  17.574  1.00 76.15  ? 230  ARG C NE    1 
ATOM   7624  C  CZ    . ARG I  5  230  ? -6.995  92.801  18.871  1.00 76.26  ? 230  ARG C CZ    1 
ATOM   7625  N  NH1   . ARG I  5  230  ? -8.134  93.151  19.456  1.00 75.80  ? 230  ARG C NH1   1 
ATOM   7626  N  NH2   . ARG I  5  230  ? -6.037  92.228  19.589  1.00 76.53  ? 230  ARG C NH2   1 
ATOM   7627  N  N     . PRO I  5  231  ? -7.824  96.788  12.019  1.00 78.07  ? 231  PRO C N     1 
ATOM   7628  C  CA    . PRO I  5  231  ? -6.995  97.451  10.988  1.00 76.95  ? 231  PRO C CA    1 
ATOM   7629  C  C     . PRO I  5  231  ? -5.966  98.470  11.539  1.00 76.04  ? 231  PRO C C     1 
ATOM   7630  O  O     . PRO I  5  231  ? -4.902  98.093  12.022  1.00 76.04  ? 231  PRO C O     1 
ATOM   7631  C  CB    . PRO I  5  231  ? -8.033  98.088  10.061  1.00 76.45  ? 231  PRO C CB    1 
ATOM   7632  C  CG    . PRO I  5  231  ? -9.230  97.229  10.226  1.00 76.66  ? 231  PRO C CG    1 
ATOM   7633  C  CD    . PRO I  5  231  ? -9.250  97.045  11.711  1.00 77.56  ? 231  PRO C CD    1 
ATOM   7634  N  N     . GLU I  5  232  ? -6.301  99.759  11.423  1.00 74.97  ? 232  GLU C N     1 
ATOM   7635  C  CA    . GLU I  5  232  ? -5.477  100.903 11.830  1.00 73.72  ? 232  GLU C CA    1 
ATOM   7636  C  C     . GLU I  5  232  ? -4.815  100.692 13.201  1.00 73.62  ? 232  GLU C C     1 
ATOM   7637  O  O     . GLU I  5  232  ? -3.742  101.240 13.474  1.00 73.06  ? 232  GLU C O     1 
ATOM   7638  C  CB    . GLU I  5  232  ? -6.358  102.158 11.855  1.00 74.20  ? 232  GLU C CB    1 
ATOM   7639  C  CG    . GLU I  5  232  ? -5.676  103.444 12.346  1.00 74.62  ? 232  GLU C CG    1 
ATOM   7640  C  CD    . GLU I  5  232  ? -6.662  104.593 12.609  1.00 73.79  ? 232  GLU C CD    1 
ATOM   7641  O  OE1   . GLU I  5  232  ? -6.226  105.694 13.022  1.00 73.02  ? 232  GLU C OE1   1 
ATOM   7642  O  OE2   . GLU I  5  232  ? -7.880  104.393 12.406  1.00 72.57  ? 232  GLU C OE2   1 
ATOM   7643  N  N     . GLU I  5  233  ? -5.449  99.911  14.066  1.00 73.29  ? 233  GLU C N     1 
ATOM   7644  C  CA    . GLU I  5  233  ? -4.889  99.645  15.388  1.00 72.45  ? 233  GLU C CA    1 
ATOM   7645  C  C     . GLU I  5  233  ? -3.667  98.742  15.277  1.00 71.83  ? 233  GLU C C     1 
ATOM   7646  O  O     . GLU I  5  233  ? -2.743  98.823  16.083  1.00 71.16  ? 233  GLU C O     1 
ATOM   7647  C  CB    . GLU I  5  233  ? -5.961  99.000  16.285  1.00 71.38  ? 233  GLU C CB    1 
ATOM   7648  C  CG    . GLU I  5  233  ? -5.520  98.706  17.717  1.00 68.60  ? 233  GLU C CG    1 
ATOM   7649  C  CD    . GLU I  5  233  ? -5.375  97.224  17.955  1.00 66.99  ? 233  GLU C CD    1 
ATOM   7650  O  OE1   . GLU I  5  233  ? -4.598  96.582  17.216  1.00 64.56  ? 233  GLU C OE1   1 
ATOM   7651  O  OE2   . GLU I  5  233  ? -6.040  96.710  18.874  1.00 66.09  ? 233  GLU C OE2   1 
ATOM   7652  N  N     . ALA I  5  234  ? -3.676  97.880  14.265  1.00 71.67  ? 234  ALA C N     1 
ATOM   7653  C  CA    . ALA I  5  234  ? -2.549  97.008  14.014  1.00 71.36  ? 234  ALA C CA    1 
ATOM   7654  C  C     . ALA I  5  234  ? -1.320  97.844  13.722  1.00 70.53  ? 234  ALA C C     1 
ATOM   7655  O  O     . ALA I  5  234  ? -0.192  97.413  13.932  1.00 70.06  ? 234  ALA C O     1 
ATOM   7656  C  CB    . ALA I  5  234  ? -2.857  96.068  12.828  1.00 71.49  ? 234  ALA C CB    1 
ATOM   7657  N  N     . LEU I  5  235  ? -1.569  99.055  13.231  1.00 70.22  ? 235  LEU C N     1 
ATOM   7658  C  CA    . LEU I  5  235  ? -0.497  100.002 12.940  1.00 70.79  ? 235  LEU C CA    1 
ATOM   7659  C  C     . LEU I  5  235  ? 0.216   100.381 14.217  1.00 70.41  ? 235  LEU C C     1 
ATOM   7660  O  O     . LEU I  5  235  ? 1.448   100.425 14.280  1.00 70.13  ? 235  LEU C O     1 
ATOM   7661  C  CB    . LEU I  5  235  ? -1.045  101.290 12.295  1.00 72.05  ? 235  LEU C CB    1 
ATOM   7662  C  CG    . LEU I  5  235  ? -1.345  101.430 10.788  1.00 72.94  ? 235  LEU C CG    1 
ATOM   7663  C  CD1   . LEU I  5  235  ? -2.542  102.376 10.601  1.00 73.21  ? 235  LEU C CD1   1 
ATOM   7664  C  CD2   . LEU I  5  235  ? -0.108  101.970 10.047  1.00 72.30  ? 235  LEU C CD2   1 
ATOM   7665  N  N     . ILE I  5  236  ? -0.594  100.659 15.233  1.00 68.94  ? 236  ILE C N     1 
ATOM   7666  C  CA    . ILE I  5  236  ? -0.087  101.027 16.541  1.00 67.81  ? 236  ILE C CA    1 
ATOM   7667  C  C     . ILE I  5  236  ? 0.496   99.799  17.252  1.00 67.61  ? 236  ILE C C     1 
ATOM   7668  O  O     . ILE I  5  236  ? 1.476   99.919  17.990  1.00 67.75  ? 236  ILE C O     1 
ATOM   7669  C  CB    . ILE I  5  236  ? -1.223  101.640 17.425  1.00 66.63  ? 236  ILE C CB    1 
ATOM   7670  C  CG1   . ILE I  5  236  ? -2.272  102.340 16.546  1.00 65.27  ? 236  ILE C CG1   1 
ATOM   7671  C  CG2   . ILE I  5  236  ? -0.627  102.644 18.390  1.00 66.05  ? 236  ILE C CG2   1 
ATOM   7672  C  CD1   . ILE I  5  236  ? -3.535  102.701 17.279  1.00 63.73  ? 236  ILE C CD1   1 
ATOM   7673  N  N     . ARG I  5  237  ? -0.107  98.627  16.999  1.00 67.76  ? 237  ARG C N     1 
ATOM   7674  C  CA    . ARG I  5  237  ? 0.289   97.338  17.617  1.00 68.19  ? 237  ARG C CA    1 
ATOM   7675  C  C     . ARG I  5  237  ? 1.668   96.874  17.161  1.00 68.23  ? 237  ARG C C     1 
ATOM   7676  O  O     . ARG I  5  237  ? 2.415   96.276  17.950  1.00 67.71  ? 237  ARG C O     1 
ATOM   7677  C  CB    . ARG I  5  237  ? -0.731  96.231  17.296  1.00 67.65  ? 237  ARG C CB    1 
ATOM   7678  C  CG    . ARG I  5  237  ? -1.352  95.605  18.561  1.00 65.93  ? 237  ARG C CG    1 
ATOM   7679  C  CD    . ARG I  5  237  ? -2.187  96.663  19.302  1.00 65.70  ? 237  ARG C CD    1 
ATOM   7680  N  NE    . ARG I  5  237  ? -2.456  96.387  20.718  1.00 64.21  ? 237  ARG C NE    1 
ATOM   7681  C  CZ    . ARG I  5  237  ? -3.119  97.219  21.531  1.00 62.45  ? 237  ARG C CZ    1 
ATOM   7682  N  NH1   . ARG I  5  237  ? -3.584  98.386  21.086  1.00 61.27  ? 237  ARG C NH1   1 
ATOM   7683  N  NH2   . ARG I  5  237  ? -3.321  96.888  22.799  1.00 61.01  ? 237  ARG C NH2   1 
ATOM   7684  N  N     . LEU I  5  238  ? 2.008   97.113  15.898  1.00 67.96  ? 238  LEU C N     1 
ATOM   7685  C  CA    . LEU I  5  238  ? 3.341   96.762  15.443  1.00 67.90  ? 238  LEU C CA    1 
ATOM   7686  C  C     . LEU I  5  238  ? 4.357   97.780  15.983  1.00 68.11  ? 238  LEU C C     1 
ATOM   7687  O  O     . LEU I  5  238  ? 5.477   97.417  16.353  1.00 68.69  ? 238  LEU C O     1 
ATOM   7688  C  CB    . LEU I  5  238  ? 3.391   96.713  13.909  1.00 67.98  ? 238  LEU C CB    1 
ATOM   7689  C  CG    . LEU I  5  238  ? 4.467   95.770  13.347  1.00 67.62  ? 238  LEU C CG    1 
ATOM   7690  C  CD1   . LEU I  5  238  ? 4.210   95.492  11.886  1.00 68.12  ? 238  LEU C CD1   1 
ATOM   7691  C  CD2   . LEU I  5  238  ? 5.839   96.388  13.501  1.00 68.03  ? 238  LEU C CD2   1 
ATOM   7692  N  N     . PHE I  5  239  ? 3.951   99.053  16.025  1.00 67.75  ? 239  PHE C N     1 
ATOM   7693  C  CA    . PHE I  5  239  ? 4.771   100.118 16.585  1.00 67.03  ? 239  PHE C CA    1 
ATOM   7694  C  C     . PHE I  5  239  ? 5.213   99.726  17.979  1.00 67.17  ? 239  PHE C C     1 
ATOM   7695  O  O     . PHE I  5  239  ? 6.324   100.026 18.419  1.00 68.81  ? 239  PHE C O     1 
ATOM   7696  C  CB    . PHE I  5  239  ? 3.954   101.412 16.663  1.00 68.41  ? 239  PHE C CB    1 
ATOM   7697  C  CG    . PHE I  5  239  ? 4.579   102.598 15.950  1.00 69.79  ? 239  PHE C CG    1 
ATOM   7698  C  CD1   . PHE I  5  239  ? 5.849   103.100 16.341  1.00 70.47  ? 239  PHE C CD1   1 
ATOM   7699  C  CD2   . PHE I  5  239  ? 3.883   103.252 14.904  1.00 68.94  ? 239  PHE C CD2   1 
ATOM   7700  C  CE1   . PHE I  5  239  ? 6.425   104.243 15.707  1.00 69.77  ? 239  PHE C CE1   1 
ATOM   7701  C  CE2   . PHE I  5  239  ? 4.438   104.392 14.261  1.00 69.32  ? 239  PHE C CE2   1 
ATOM   7702  C  CZ    . PHE I  5  239  ? 5.711   104.888 14.665  1.00 69.68  ? 239  PHE C CZ    1 
ATOM   7703  N  N     . THR I  5  240  ? 4.296   99.036  18.651  1.00 67.13  ? 240  THR C N     1 
ATOM   7704  C  CA    . THR I  5  240  ? 4.481   98.506  19.994  1.00 66.87  ? 240  THR C CA    1 
ATOM   7705  C  C     . THR I  5  240  ? 5.477   97.338  19.976  1.00 65.85  ? 240  THR C C     1 
ATOM   7706  O  O     . THR I  5  240  ? 6.319   97.205  20.873  1.00 66.08  ? 240  THR C O     1 
ATOM   7707  C  CB    . THR I  5  240  ? 3.113   98.032  20.571  1.00 67.61  ? 240  THR C CB    1 
ATOM   7708  O  OG1   . THR I  5  240  ? 2.183   99.127  20.530  1.00 68.67  ? 240  THR C OG1   1 
ATOM   7709  C  CG2   . THR I  5  240  ? 3.259   97.571  22.021  1.00 67.59  ? 240  THR C CG2   1 
ATOM   7710  N  N     . LEU I  5  241  ? 5.375   96.504  18.943  1.00 63.53  ? 241  LEU C N     1 
ATOM   7711  C  CA    . LEU I  5  241  ? 6.268   95.364  18.773  1.00 63.64  ? 241  LEU C CA    1 
ATOM   7712  C  C     . LEU I  5  241  ? 7.735   95.823  18.733  1.00 63.36  ? 241  LEU C C     1 
ATOM   7713  O  O     . LEU I  5  241  ? 8.595   95.173  19.336  1.00 62.35  ? 241  LEU C O     1 
ATOM   7714  C  CB    . LEU I  5  241  ? 5.887   94.614  17.491  1.00 63.57  ? 241  LEU C CB    1 
ATOM   7715  C  CG    . LEU I  5  241  ? 6.398   93.189  17.205  1.00 63.93  ? 241  LEU C CG    1 
ATOM   7716  C  CD1   . LEU I  5  241  ? 5.588   92.650  16.040  1.00 63.06  ? 241  LEU C CD1   1 
ATOM   7717  C  CD2   . LEU I  5  241  ? 7.895   93.157  16.871  1.00 63.41  ? 241  LEU C CD2   1 
ATOM   7718  N  N     . LEU I  5  242  ? 8.024   96.926  18.025  1.00 63.26  ? 242  LEU C N     1 
ATOM   7719  C  CA    . LEU I  5  242  ? 9.385   97.493  18.027  1.00 63.88  ? 242  LEU C CA    1 
ATOM   7720  C  C     . LEU I  5  242  ? 9.787   97.765  19.469  1.00 65.29  ? 242  LEU C C     1 
ATOM   7721  O  O     . LEU I  5  242  ? 8.892   97.687  20.325  1.00 66.91  ? 242  LEU C O     1 
ATOM   7722  C  CB    . LEU I  5  242  ? 9.429   98.804  17.213  1.00 63.03  ? 242  LEU C CB    1 
ATOM   7723  C  CG    . LEU I  5  242  ? 9.085   98.703  15.711  1.00 63.74  ? 242  LEU C CG    1 
ATOM   7724  C  CD1   . LEU I  5  242  ? 8.915   100.106 15.115  1.00 62.39  ? 242  LEU C CD1   1 
ATOM   7725  C  CD2   . LEU I  5  242  ? 10.193  97.936  14.973  1.00 62.81  ? 242  LEU C CD2   1 
ATOM   7726  N  N     . ARG I  5  243  ? 11.030  98.084  19.830  1.00 66.44  ? 243  ARG C N     1 
ATOM   7727  C  CA    . ARG I  5  243  ? 11.148  98.203  21.279  1.00 66.17  ? 243  ARG C CA    1 
ATOM   7728  C  C     . ARG I  5  243  ? 12.143  99.263  21.776  1.00 66.52  ? 243  ARG C C     1 
ATOM   7729  O  O     . ARG I  5  243  ? 13.351  99.189  21.543  1.00 66.35  ? 243  ARG C O     1 
ATOM   7730  C  CB    . ARG I  5  243  ? 11.488  96.841  21.890  1.00 64.74  ? 243  ARG C CB    1 
ATOM   7731  C  CG    . ARG I  5  243  ? 12.782  96.232  21.454  1.00 62.63  ? 243  ARG C CG    1 
ATOM   7732  C  CD    . ARG I  5  243  ? 13.429  95.554  22.639  1.00 60.76  ? 243  ARG C CD    1 
ATOM   7733  N  NE    . ARG I  5  243  ? 14.340  94.511  22.199  1.00 59.68  ? 243  ARG C NE    1 
ATOM   7734  C  CZ    . ARG I  5  243  ? 13.948  93.398  21.583  1.00 58.86  ? 243  ARG C CZ    1 
ATOM   7735  N  NH1   . ARG I  5  243  ? 12.660  93.179  21.341  1.00 57.85  ? 243  ARG C NH1   1 
ATOM   7736  N  NH2   . ARG I  5  243  ? 14.844  92.500  21.198  1.00 57.88  ? 243  ARG C NH2   1 
ATOM   7737  N  N     . PRO I  5  244  ? 11.594  100.288 22.468  1.00 67.28  ? 244  PRO C N     1 
ATOM   7738  C  CA    . PRO I  5  244  ? 12.121  101.466 23.156  1.00 67.90  ? 244  PRO C CA    1 
ATOM   7739  C  C     . PRO I  5  244  ? 11.210  101.869 24.338  1.00 68.22  ? 244  PRO C C     1 
ATOM   7740  O  O     . PRO I  5  244  ? 11.670  102.124 25.451  1.00 68.50  ? 244  PRO C O     1 
ATOM   7741  C  CB    . PRO I  5  244  ? 12.174  102.544 22.062  1.00 68.76  ? 244  PRO C CB    1 
ATOM   7742  C  CG    . PRO I  5  244  ? 11.309  101.961 20.897  1.00 68.59  ? 244  PRO C CG    1 
ATOM   7743  C  CD    . PRO I  5  244  ? 10.562  100.816 21.545  1.00 68.07  ? 244  PRO C CD    1 
ATOM   7744  N  N     . GLY I  5  245  ? 9.906   101.874 24.062  1.00 68.08  ? 245  GLY C N     1 
ATOM   7745  C  CA    . GLY I  5  245  ? 8.893   102.336 24.987  1.00 68.77  ? 245  GLY C CA    1 
ATOM   7746  C  C     . GLY I  5  245  ? 8.498   103.694 24.450  1.00 69.26  ? 245  GLY C C     1 
ATOM   7747  O  O     . GLY I  5  245  ? 8.661   104.735 25.087  1.00 68.71  ? 245  GLY C O     1 
ATOM   7748  N  N     . ASP I  5  246  ? 7.992   103.653 23.223  1.00 69.84  ? 246  ASP C N     1 
ATOM   7749  C  CA    . ASP I  5  246  ? 7.647   104.850 22.473  1.00 71.28  ? 246  ASP C CA    1 
ATOM   7750  C  C     . ASP I  5  246  ? 6.167   105.195 22.580  1.00 72.48  ? 246  ASP C C     1 
ATOM   7751  O  O     . ASP I  5  246  ? 5.330   104.351 22.934  1.00 72.74  ? 246  ASP C O     1 
ATOM   7752  C  CB    . ASP I  5  246  ? 7.963   104.675 20.969  1.00 70.13  ? 246  ASP C CB    1 
ATOM   7753  C  CG    . ASP I  5  246  ? 9.417   104.947 20.596  1.00 69.28  ? 246  ASP C CG    1 
ATOM   7754  O  OD1   . ASP I  5  246  ? 10.150  105.543 21.415  1.00 69.52  ? 246  ASP C OD1   1 
ATOM   7755  O  OD2   . ASP I  5  246  ? 9.814   104.565 19.464  1.00 66.26  ? 246  ASP C OD2   1 
ATOM   7756  N  N     . PRO I  5  247  ? 5.831   106.461 22.259  1.00 73.28  ? 247  PRO C N     1 
ATOM   7757  C  CA    . PRO I  5  247  ? 4.447   106.935 22.292  1.00 72.88  ? 247  PRO C CA    1 
ATOM   7758  C  C     . PRO I  5  247  ? 3.567   106.148 21.325  1.00 71.80  ? 247  PRO C C     1 
ATOM   7759  O  O     . PRO I  5  247  ? 3.896   106.013 20.136  1.00 70.42  ? 247  PRO C O     1 
ATOM   7760  C  CB    . PRO I  5  247  ? 4.573   108.405 21.924  1.00 74.24  ? 247  PRO C CB    1 
ATOM   7761  C  CG    . PRO I  5  247  ? 5.881   108.769 22.565  1.00 73.91  ? 247  PRO C CG    1 
ATOM   7762  C  CD    . PRO I  5  247  ? 6.764   107.608 22.205  1.00 73.33  ? 247  PRO C CD    1 
ATOM   7763  N  N     . PRO I  5  248  ? 2.445   105.605 21.828  1.00 71.90  ? 248  PRO C N     1 
ATOM   7764  C  CA    . PRO I  5  248  ? 1.561   104.845 20.948  1.00 72.59  ? 248  PRO C CA    1 
ATOM   7765  C  C     . PRO I  5  248  ? 1.115   105.687 19.761  1.00 73.16  ? 248  PRO C C     1 
ATOM   7766  O  O     . PRO I  5  248  ? 1.005   105.188 18.628  1.00 74.27  ? 248  PRO C O     1 
ATOM   7767  C  CB    . PRO I  5  248  ? 0.402   104.451 21.864  1.00 72.18  ? 248  PRO C CB    1 
ATOM   7768  C  CG    . PRO I  5  248  ? 1.039   104.379 23.218  1.00 71.92  ? 248  PRO C CG    1 
ATOM   7769  C  CD    . PRO I  5  248  ? 1.946   105.584 23.220  1.00 71.84  ? 248  PRO C CD    1 
ATOM   7770  N  N     . LYS I  5  249  ? 0.875   106.971 20.038  1.00 72.80  ? 249  LYS C N     1 
ATOM   7771  C  CA    . LYS I  5  249  ? 0.397   107.900 19.024  1.00 71.54  ? 249  LYS C CA    1 
ATOM   7772  C  C     . LYS I  5  249  ? 1.542   108.585 18.265  1.00 72.86  ? 249  LYS C C     1 
ATOM   7773  O  O     . LYS I  5  249  ? 2.373   109.350 18.793  1.00 73.08  ? 249  LYS C O     1 
ATOM   7774  C  CB    . LYS I  5  249  ? -0.541  108.948 19.650  1.00 69.59  ? 249  LYS C CB    1 
ATOM   7775  C  CG    . LYS I  5  249  ? 0.064   109.853 20.719  1.00 66.65  ? 249  LYS C CG    1 
ATOM   7776  C  CD    . LYS I  5  249  ? -0.977  110.793 21.290  1.00 62.59  ? 249  LYS C CD    1 
ATOM   7777  C  CE    . LYS I  5  249  ? -1.924  110.076 22.216  1.00 60.94  ? 249  LYS C CE    1 
ATOM   7778  N  NZ    . LYS I  5  249  ? -2.906  111.024 22.781  1.00 59.99  ? 249  LYS C NZ    1 
ATOM   7779  N  N     . ARG I  5  250  ? 1.511   108.237 16.984  1.00 73.48  ? 250  ARG C N     1 
ATOM   7780  C  CA    . ARG I  5  250  ? 2.342   108.669 15.868  1.00 73.85  ? 250  ARG C CA    1 
ATOM   7781  C  C     . ARG I  5  250  ? 1.656   108.254 14.570  1.00 73.32  ? 250  ARG C C     1 
ATOM   7782  O  O     . ARG I  5  250  ? 1.914   107.185 14.011  1.00 73.54  ? 250  ARG C O     1 
ATOM   7783  C  CB    . ARG I  5  250  ? 3.756   108.063 15.959  1.00 73.06  ? 250  ARG C CB    1 
ATOM   7784  C  CG    . ARG I  5  250  ? 4.744   109.020 16.575  1.00 71.66  ? 250  ARG C CG    1 
ATOM   7785  C  CD    . ARG I  5  250  ? 5.599   108.328 17.570  1.00 71.53  ? 250  ARG C CD    1 
ATOM   7786  N  NE    . ARG I  5  250  ? 6.122   109.271 18.542  1.00 71.35  ? 250  ARG C NE    1 
ATOM   7787  C  CZ    . ARG I  5  250  ? 7.164   109.018 19.326  1.00 72.52  ? 250  ARG C CZ    1 
ATOM   7788  N  NH1   . ARG I  5  250  ? 7.788   107.850 19.239  1.00 73.22  ? 250  ARG C NH1   1 
ATOM   7789  N  NH2   . ARG I  5  250  ? 7.588   109.924 20.198  1.00 72.76  ? 250  ARG C NH2   1 
ATOM   7790  N  N     . ASP I  5  251  ? 0.749   109.137 14.155  1.00 73.04  ? 251  ASP C N     1 
ATOM   7791  C  CA    . ASP I  5  251  ? -0.136  109.035 12.992  1.00 73.11  ? 251  ASP C CA    1 
ATOM   7792  C  C     . ASP I  5  251  ? 0.424   108.154 11.885  1.00 73.96  ? 251  ASP C C     1 
ATOM   7793  O  O     . ASP I  5  251  ? 0.027   106.991 11.757  1.00 74.11  ? 251  ASP C O     1 
ATOM   7794  C  CB    . ASP I  5  251  ? -0.429  110.431 12.436  1.00 71.63  ? 251  ASP C CB    1 
ATOM   7795  C  CG    . ASP I  5  251  ? -1.739  110.977 12.924  1.00 69.71  ? 251  ASP C CG    1 
ATOM   7796  O  OD1   . ASP I  5  251  ? -2.794  110.510 12.446  1.00 68.65  ? 251  ASP C OD1   1 
ATOM   7797  O  OD2   . ASP I  5  251  ? -1.704  111.865 13.791  1.00 69.46  ? 251  ASP C OD2   1 
ATOM   7798  N  N     . LYS I  5  252  ? 1.335   108.715 11.087  1.00 74.40  ? 252  LYS C N     1 
ATOM   7799  C  CA    . LYS I  5  252  ? 1.912   108.021 9.935   1.00 74.34  ? 252  LYS C CA    1 
ATOM   7800  C  C     . LYS I  5  252  ? 3.411   108.316 9.796   1.00 75.96  ? 252  LYS C C     1 
ATOM   7801  O  O     . LYS I  5  252  ? 3.889   108.404 8.671   1.00 76.55  ? 252  LYS C O     1 
ATOM   7802  C  CB    . LYS I  5  252  ? 1.176   108.492 8.672   1.00 72.78  ? 252  LYS C CB    1 
ATOM   7803  C  CG    . LYS I  5  252  ? 1.097   110.033 8.566   1.00 69.98  ? 252  LYS C CG    1 
ATOM   7804  C  CD    . LYS I  5  252  ? 0.043   110.530 7.571   1.00 67.02  ? 252  LYS C CD    1 
ATOM   7805  C  CE    . LYS I  5  252  ? -1.365  110.302 8.093   1.00 64.68  ? 252  LYS C CE    1 
ATOM   7806  N  NZ    . LYS I  5  252  ? -2.401  110.849 7.188   1.00 62.41  ? 252  LYS C NZ    1 
ATOM   7807  N  N     . ALA I  5  253  ? 4.139   108.437 10.918  1.00 77.25  ? 253  ALA C N     1 
ATOM   7808  C  CA    . ALA I  5  253  ? 5.586   108.815 10.953  1.00 78.22  ? 253  ALA C CA    1 
ATOM   7809  C  C     . ALA I  5  253  ? 6.568   107.655 10.571  1.00 77.74  ? 253  ALA C C     1 
ATOM   7810  O  O     . ALA I  5  253  ? 7.232   107.754 9.531   1.00 77.83  ? 253  ALA C O     1 
ATOM   7811  C  CB    . ALA I  5  253  ? 5.945   109.362 12.351  1.00 77.59  ? 253  ALA C CB    1 
ATOM   7812  N  N     . VAL I  5  254  ? 6.705   106.592 11.373  1.00 76.48  ? 254  VAL C N     1 
ATOM   7813  C  CA    . VAL I  5  254  ? 7.667   105.535 11.012  1.00 75.68  ? 254  VAL C CA    1 
ATOM   7814  C  C     . VAL I  5  254  ? 7.208   104.737 9.778   1.00 76.86  ? 254  VAL C C     1 
ATOM   7815  O  O     . VAL I  5  254  ? 8.057   104.270 9.016   1.00 76.08  ? 254  VAL C O     1 
ATOM   7816  C  CB    . VAL I  5  254  ? 7.926   104.573 12.212  1.00 73.68  ? 254  VAL C CB    1 
ATOM   7817  C  CG1   . VAL I  5  254  ? 8.717   103.356 11.774  1.00 72.57  ? 254  VAL C CG1   1 
ATOM   7818  C  CG2   . VAL I  5  254  ? 8.709   105.298 13.275  1.00 72.50  ? 254  VAL C CG2   1 
ATOM   7819  N  N     . ALA I  5  255  ? 5.892   104.580 9.573   1.00 78.57  ? 255  ALA C N     1 
ATOM   7820  C  CA    . ALA I  5  255  ? 5.379   103.874 8.383   1.00 78.53  ? 255  ALA C CA    1 
ATOM   7821  C  C     . ALA I  5  255  ? 5.783   104.617 7.088   1.00 78.97  ? 255  ALA C C     1 
ATOM   7822  O  O     . ALA I  5  255  ? 5.734   104.047 5.984   1.00 79.24  ? 255  ALA C O     1 
ATOM   7823  C  CB    . ALA I  5  255  ? 3.844   103.737 8.464   1.00 78.67  ? 255  ALA C CB    1 
ATOM   7824  N  N     . TYR I  5  256  ? 6.173   105.891 7.246   1.00 78.91  ? 256  TYR C N     1 
ATOM   7825  C  CA    . TYR I  5  256  ? 6.669   106.726 6.142   1.00 77.70  ? 256  TYR C CA    1 
ATOM   7826  C  C     . TYR I  5  256  ? 8.049   106.254 5.718   1.00 78.20  ? 256  TYR C C     1 
ATOM   7827  O  O     . TYR I  5  256  ? 8.330   106.096 4.529   1.00 78.80  ? 256  TYR C O     1 
ATOM   7828  C  CB    . TYR I  5  256  ? 6.879   108.201 6.530   1.00 76.36  ? 256  TYR C CB    1 
ATOM   7829  C  CG    . TYR I  5  256  ? 5.718   109.178 6.470   1.00 75.15  ? 256  TYR C CG    1 
ATOM   7830  C  CD1   . TYR I  5  256  ? 4.652   109.023 5.558   1.00 74.04  ? 256  TYR C CD1   1 
ATOM   7831  C  CD2   . TYR I  5  256  ? 5.695   110.293 7.341   1.00 74.84  ? 256  TYR C CD2   1 
ATOM   7832  C  CE1   . TYR I  5  256  ? 3.583   109.961 5.516   1.00 73.12  ? 256  TYR C CE1   1 
ATOM   7833  C  CE2   . TYR I  5  256  ? 4.634   111.237 7.307   1.00 74.75  ? 256  TYR C CE2   1 
ATOM   7834  C  CZ    . TYR I  5  256  ? 3.580   111.063 6.390   1.00 74.57  ? 256  TYR C CZ    1 
ATOM   7835  O  OH    . TYR I  5  256  ? 2.547   111.986 6.356   1.00 74.58  ? 256  TYR C OH    1 
ATOM   7836  N  N     . VAL I  5  257  ? 8.897   106.049 6.733   1.00 78.04  ? 257  VAL C N     1 
ATOM   7837  C  CA    . VAL I  5  257  ? 10.301  105.648 6.592   1.00 77.94  ? 257  VAL C CA    1 
ATOM   7838  C  C     . VAL I  5  257  ? 10.456  104.394 5.729   1.00 78.02  ? 257  VAL C C     1 
ATOM   7839  O  O     . VAL I  5  257  ? 11.335  104.333 4.874   1.00 78.11  ? 257  VAL C O     1 
ATOM   7840  C  CB    . VAL I  5  257  ? 10.942  105.383 7.988   1.00 77.84  ? 257  VAL C CB    1 
ATOM   7841  C  CG1   . VAL I  5  257  ? 12.452  105.559 7.919   1.00 77.21  ? 257  VAL C CG1   1 
ATOM   7842  C  CG2   . VAL I  5  257  ? 10.345  106.325 9.019   1.00 77.83  ? 257  VAL C CG2   1 
ATOM   7843  N  N     . TYR I  5  258  ? 9.617   103.390 5.948   1.00 78.17  ? 258  TYR C N     1 
ATOM   7844  C  CA    . TYR I  5  258  ? 9.691   102.171 5.149   1.00 77.65  ? 258  TYR C CA    1 
ATOM   7845  C  C     . TYR I  5  258  ? 8.650   102.205 4.079   1.00 77.24  ? 258  TYR C C     1 
ATOM   7846  O  O     . TYR I  5  258  ? 8.150   101.210 3.551   1.00 77.57  ? 258  TYR C O     1 
ATOM   7847  C  CB    . TYR I  5  258  ? 9.568   100.995 6.107   1.00 77.81  ? 258  TYR C CB    1 
ATOM   7848  C  CG    . TYR I  5  258  ? 10.661  101.194 7.142   1.00 77.21  ? 258  TYR C CG    1 
ATOM   7849  C  CD1   . TYR I  5  258  ? 10.377  101.776 8.403   1.00 77.28  ? 258  TYR C CD1   1 
ATOM   7850  C  CD2   . TYR I  5  258  ? 12.005  100.894 6.829   1.00 75.69  ? 258  TYR C CD2   1 
ATOM   7851  C  CE1   . TYR I  5  258  ? 11.419  102.063 9.332   1.00 76.76  ? 258  TYR C CE1   1 
ATOM   7852  C  CE2   . TYR I  5  258  ? 13.041  101.172 7.736   1.00 75.52  ? 258  TYR C CE2   1 
ATOM   7853  C  CZ    . TYR I  5  258  ? 12.746  101.757 8.981   1.00 76.51  ? 258  TYR C CZ    1 
ATOM   7854  O  OH    . TYR I  5  258  ? 13.773  102.040 9.853   1.00 76.68  ? 258  TYR C OH    1 
ATOM   7855  N  N     . GLY I  5  259  ? 8.370   103.464 3.787   1.00 76.71  ? 259  GLY C N     1 
ATOM   7856  C  CA    . GLY I  5  259  ? 7.424   103.849 2.794   1.00 75.58  ? 259  GLY C CA    1 
ATOM   7857  C  C     . GLY I  5  259  ? 8.076   104.548 1.621   1.00 75.01  ? 259  GLY C C     1 
ATOM   7858  O  O     . GLY I  5  259  ? 8.595   103.875 0.738   1.00 75.30  ? 259  GLY C O     1 
ATOM   7859  N  N     . LEU I  5  260  ? 8.129   105.884 1.631   1.00 74.53  ? 260  LEU C N     1 
ATOM   7860  C  CA    . LEU I  5  260  ? 8.507   106.603 0.402   1.00 73.36  ? 260  LEU C CA    1 
ATOM   7861  C  C     . LEU I  5  260  ? 9.925   107.199 0.330   1.00 72.59  ? 260  LEU C C     1 
ATOM   7862  O  O     . LEU I  5  260  ? 10.506  107.088 -0.748  1.00 71.63  ? 260  LEU C O     1 
ATOM   7863  C  CB    . LEU I  5  260  ? 7.472   107.730 0.149   1.00 72.90  ? 260  LEU C CB    1 
ATOM   7864  C  CG    . LEU I  5  260  ? 7.441   108.749 -1.006  1.00 71.29  ? 260  LEU C CG    1 
ATOM   7865  C  CD1   . LEU I  5  260  ? 8.280   108.347 -2.216  1.00 70.46  ? 260  LEU C CD1   1 
ATOM   7866  C  CD2   . LEU I  5  260  ? 5.979   108.884 -1.399  1.00 70.66  ? 260  LEU C CD2   1 
ATOM   7867  N  N     . ILE I  5  261  ? 10.535  107.777 1.356   1.00 71.82  ? 261  ILE C N     1 
ATOM   7868  C  CA    . ILE I  5  261  ? 11.717  108.575 0.987   1.00 72.24  ? 261  ILE C CA    1 
ATOM   7869  C  C     . ILE I  5  261  ? 13.116  107.956 1.250   1.00 73.74  ? 261  ILE C C     1 
ATOM   7870  O  O     . ILE I  5  261  ? 13.797  107.580 0.294   1.00 74.35  ? 261  ILE C O     1 
ATOM   7871  C  CB    . ILE I  5  261  ? 11.676  109.962 1.672   1.00 70.57  ? 261  ILE C CB    1 
ATOM   7872  C  CG1   . ILE I  5  261  ? 10.348  110.160 2.419   1.00 69.00  ? 261  ILE C CG1   1 
ATOM   7873  C  CG2   . ILE I  5  261  ? 11.869  111.035 0.621   1.00 71.30  ? 261  ILE C CG2   1 
ATOM   7874  C  CD1   . ILE I  5  261  ? 10.345  111.306 3.414   1.00 66.61  ? 261  ILE C CD1   1 
ATOM   7875  N  N     . ALA I  5  262  ? 13.559  107.868 2.501   1.00 74.88  ? 262  ALA C N     1 
ATOM   7876  C  CA    . ALA I  5  262  ? 14.968  107.526 2.813   1.00 76.95  ? 262  ALA C CA    1 
ATOM   7877  C  C     . ALA I  5  262  ? 15.382  106.068 2.547   1.00 78.24  ? 262  ALA C C     1 
ATOM   7878  O  O     . ALA I  5  262  ? 15.920  105.797 1.482   1.00 79.25  ? 262  ALA C O     1 
ATOM   7879  C  CB    . ALA I  5  262  ? 15.267  107.889 4.252   1.00 76.32  ? 262  ALA C CB    1 
ATOM   7880  N  N     . ASP I  5  263  ? 15.181  105.167 3.521   1.00 79.97  ? 263  ASP C N     1 
ATOM   7881  C  CA    . ASP I  5  263  ? 15.606  103.736 3.479   1.00 80.86  ? 263  ASP C CA    1 
ATOM   7882  C  C     . ASP I  5  263  ? 15.305  103.076 2.120   1.00 81.43  ? 263  ASP C C     1 
ATOM   7883  O  O     . ASP I  5  263  ? 16.234  102.512 1.504   1.00 81.92  ? 263  ASP C O     1 
ATOM   7884  C  CB    . ASP I  5  263  ? 14.958  102.976 4.648   1.00 81.22  ? 263  ASP C CB    1 
ATOM   7885  C  CG    . ASP I  5  263  ? 15.281  103.607 6.000   1.00 81.47  ? 263  ASP C CG    1 
ATOM   7886  O  OD1   . ASP I  5  263  ? 15.195  102.899 7.026   1.00 82.42  ? 263  ASP C OD1   1 
ATOM   7887  O  OD2   . ASP I  5  263  ? 15.620  104.812 6.040   1.00 80.98  ? 263  ASP C OD2   1 
ATOM   7888  N  N     . PRO I  5  264  ? 14.028  103.079 1.650   1.00 81.15  ? 264  PRO C N     1 
ATOM   7889  C  CA    . PRO I  5  264  ? 13.875  102.483 0.324   1.00 80.68  ? 264  PRO C CA    1 
ATOM   7890  C  C     . PRO I  5  264  ? 14.686  103.324 -0.668  1.00 80.68  ? 264  PRO C C     1 
ATOM   7891  O  O     . PRO I  5  264  ? 15.280  104.273 -0.189  1.00 81.22  ? 264  PRO C O     1 
ATOM   7892  C  CB    . PRO I  5  264  ? 12.380  102.515 0.144   1.00 80.60  ? 264  PRO C CB    1 
ATOM   7893  C  CG    . PRO I  5  264  ? 11.900  102.151 1.506   1.00 80.86  ? 264  PRO C CG    1 
ATOM   7894  C  CD    . PRO I  5  264  ? 12.714  103.118 2.327   1.00 81.36  ? 264  PRO C CD    1 
ATOM   7895  N  N     . ARG I  5  265  ? 14.778  103.138 -1.976  1.00 80.64  ? 265  ARG C N     1 
ATOM   7896  C  CA    . ARG I  5  265  ? 15.785  104.060 -2.536  1.00 79.94  ? 265  ARG C CA    1 
ATOM   7897  C  C     . ARG I  5  265  ? 15.300  104.931 -3.693  1.00 79.00  ? 265  ARG C C     1 
ATOM   7898  O  O     . ARG I  5  265  ? 14.308  104.675 -4.393  1.00 78.50  ? 265  ARG C O     1 
ATOM   7899  C  CB    . ARG I  5  265  ? 17.029  103.260 -2.944  1.00 79.54  ? 265  ARG C CB    1 
ATOM   7900  C  CG    . ARG I  5  265  ? 18.315  104.064 -3.052  1.00 78.64  ? 265  ARG C CG    1 
ATOM   7901  C  CD    . ARG I  5  265  ? 19.383  103.224 -3.720  1.00 77.62  ? 265  ARG C CD    1 
ATOM   7902  N  NE    . ARG I  5  265  ? 20.536  103.986 -4.198  1.00 75.75  ? 265  ARG C NE    1 
ATOM   7903  C  CZ    . ARG I  5  265  ? 21.558  103.442 -4.854  1.00 74.68  ? 265  ARG C CZ    1 
ATOM   7904  N  NH1   . ARG I  5  265  ? 21.577  102.137 -5.112  1.00 73.64  ? 265  ARG C NH1   1 
ATOM   7905  N  NH2   . ARG I  5  265  ? 22.563  104.201 -5.255  1.00 74.26  ? 265  ARG C NH2   1 
ATOM   7906  N  N     . ARG I  5  266  ? 16.087  106.000 -3.839  1.00 78.35  ? 266  ARG C N     1 
ATOM   7907  C  CA    . ARG I  5  266  ? 15.924  106.990 -4.875  1.00 77.61  ? 266  ARG C CA    1 
ATOM   7908  C  C     . ARG I  5  266  ? 16.624  106.546 -6.132  1.00 77.19  ? 266  ARG C C     1 
ATOM   7909  O  O     . ARG I  5  266  ? 16.881  107.364 -7.021  1.00 76.97  ? 266  ARG C O     1 
ATOM   7910  C  CB    . ARG I  5  266  ? 16.496  108.351 -4.457  1.00 77.75  ? 266  ARG C CB    1 
ATOM   7911  C  CG    . ARG I  5  266  ? 15.691  109.510 -5.040  1.00 77.39  ? 266  ARG C CG    1 
ATOM   7912  C  CD    . ARG I  5  266  ? 16.393  110.850 -4.913  1.00 76.77  ? 266  ARG C CD    1 
ATOM   7913  N  NE    . ARG I  5  266  ? 15.470  111.986 -5.030  1.00 77.43  ? 266  ARG C NE    1 
ATOM   7914  C  CZ    . ARG I  5  266  ? 14.764  112.293 -6.119  1.00 77.43  ? 266  ARG C CZ    1 
ATOM   7915  N  NH1   . ARG I  5  266  ? 14.863  111.560 -7.221  1.00 76.99  ? 266  ARG C NH1   1 
ATOM   7916  N  NH2   . ARG I  5  266  ? 13.947  113.339 -6.107  1.00 77.83  ? 266  ARG C NH2   1 
ATOM   7917  N  N     . TYR I  5  267  ? 16.965  105.254 -6.196  1.00 76.03  ? 267  TYR C N     1 
ATOM   7918  C  CA    . TYR I  5  267  ? 17.534  104.746 -7.431  1.00 74.82  ? 267  TYR C CA    1 
ATOM   7919  C  C     . TYR I  5  267  ? 16.521  104.963 -8.552  1.00 75.54  ? 267  TYR C C     1 
ATOM   7920  O  O     . TYR I  5  267  ? 15.333  104.677 -8.352  1.00 75.88  ? 267  TYR C O     1 
ATOM   7921  C  CB    . TYR I  5  267  ? 17.931  103.246 -7.286  1.00 71.36  ? 267  TYR C CB    1 
ATOM   7922  C  CG    . TYR I  5  267  ? 16.933  102.227 -6.674  1.00 68.01  ? 267  TYR C CG    1 
ATOM   7923  C  CD1   . TYR I  5  267  ? 17.381  101.269 -5.726  1.00 67.15  ? 267  TYR C CD1   1 
ATOM   7924  C  CD2   . TYR I  5  267  ? 15.567  102.188 -7.038  1.00 65.88  ? 267  TYR C CD2   1 
ATOM   7925  C  CE1   . TYR I  5  267  ? 16.488  100.299 -5.155  1.00 64.43  ? 267  TYR C CE1   1 
ATOM   7926  C  CE2   . TYR I  5  267  ? 14.672  101.225 -6.477  1.00 63.65  ? 267  TYR C CE2   1 
ATOM   7927  C  CZ    . TYR I  5  267  ? 15.144  100.296 -5.542  1.00 63.61  ? 267  TYR C CZ    1 
ATOM   7928  O  OH    . TYR I  5  267  ? 14.278  99.390  -4.988  1.00 62.24  ? 267  TYR C OH    1 
ATOM   7929  N  N     . ASP I  5  268  ? 16.977  105.492 -9.690  1.00 75.18  ? 268  ASP C N     1 
ATOM   7930  C  CA    . ASP I  5  268  ? 16.123  105.866 -10.842 1.00 74.64  ? 268  ASP C CA    1 
ATOM   7931  C  C     . ASP I  5  268  ? 14.784  105.115 -10.875 1.00 73.55  ? 268  ASP C C     1 
ATOM   7932  O  O     . ASP I  5  268  ? 14.739  103.887 -10.983 1.00 73.27  ? 268  ASP C O     1 
ATOM   7933  C  CB    . ASP I  5  268  ? 16.872  105.639 -12.160 1.00 74.55  ? 268  ASP C CB    1 
ATOM   7934  C  CG    . ASP I  5  268  ? 17.353  106.929 -12.779 1.00 74.38  ? 268  ASP C CG    1 
ATOM   7935  O  OD1   . ASP I  5  268  ? 16.500  107.742 -13.181 1.00 74.65  ? 268  ASP C OD1   1 
ATOM   7936  O  OD2   . ASP I  5  268  ? 18.580  107.130 -12.861 1.00 74.44  ? 268  ASP C OD2   1 
ATOM   7937  N  N     . LEU I  5  269  ? 13.696  105.881 -10.771 1.00 72.34  ? 269  LEU C N     1 
ATOM   7938  C  CA    . LEU I  5  269  ? 12.343  105.324 -10.825 1.00 71.48  ? 269  LEU C CA    1 
ATOM   7939  C  C     . LEU I  5  269  ? 12.126  104.601 -12.134 1.00 70.59  ? 269  LEU C C     1 
ATOM   7940  O  O     . LEU I  5  269  ? 12.123  105.233 -13.194 1.00 70.55  ? 269  LEU C O     1 
ATOM   7941  C  CB    . LEU I  5  269  ? 11.271  106.442 -10.698 1.00 70.68  ? 269  LEU C CB    1 
ATOM   7942  C  CG    . LEU I  5  269  ? 9.804   106.170 -11.116 1.00 68.68  ? 269  LEU C CG    1 
ATOM   7943  C  CD1   . LEU I  5  269  ? 9.073   105.527 -9.966  1.00 68.58  ? 269  LEU C CD1   1 
ATOM   7944  C  CD2   . LEU I  5  269  ? 9.101   107.471 -11.499 1.00 66.81  ? 269  LEU C CD2   1 
ATOM   7945  N  N     . GLY I  5  270  ? 11.961  103.285 -12.077 1.00 69.75  ? 270  GLY C N     1 
ATOM   7946  C  CA    . GLY I  5  270  ? 11.719  102.566 -13.309 1.00 69.04  ? 270  GLY C CA    1 
ATOM   7947  C  C     . GLY I  5  270  ? 12.590  101.349 -13.557 1.00 68.01  ? 270  GLY C C     1 
ATOM   7948  O  O     . GLY I  5  270  ? 12.073  100.237 -13.627 1.00 68.88  ? 270  GLY C O     1 
ATOM   7949  N  N     . GLU I  5  271  ? 13.900  101.518 -13.694 1.00 66.84  ? 271  GLU C N     1 
ATOM   7950  C  CA    . GLU I  5  271  ? 14.714  100.350 -13.999 1.00 64.16  ? 271  GLU C CA    1 
ATOM   7951  C  C     . GLU I  5  271  ? 15.649  99.956  -12.881 1.00 61.49  ? 271  GLU C C     1 
ATOM   7952  O  O     . GLU I  5  271  ? 16.054  98.795  -12.821 1.00 61.51  ? 271  GLU C O     1 
ATOM   7953  C  CB    . GLU I  5  271  ? 15.493  100.578 -15.288 1.00 66.11  ? 271  GLU C CB    1 
ATOM   7954  C  CG    . GLU I  5  271  ? 14.707  99.997  -16.454 1.00 68.13  ? 271  GLU C CG    1 
ATOM   7955  C  CD    . GLU I  5  271  ? 14.076  98.638  -16.127 1.00 68.75  ? 271  GLU C CD    1 
ATOM   7956  O  OE1   . GLU I  5  271  ? 13.043  98.584  -15.416 1.00 68.18  ? 271  GLU C OE1   1 
ATOM   7957  O  OE2   . GLU I  5  271  ? 14.624  97.616  -16.587 1.00 70.98  ? 271  GLU C OE2   1 
ATOM   7958  N  N     . ALA I  5  272  ? 16.004  100.882 -12.002 1.00 58.05  ? 272  ALA C N     1 
ATOM   7959  C  CA    . ALA I  5  272  ? 16.901  100.537 -10.928 1.00 52.94  ? 272  ALA C CA    1 
ATOM   7960  C  C     . ALA I  5  272  ? 16.410  99.304  -10.199 1.00 50.20  ? 272  ALA C C     1 
ATOM   7961  O  O     . ALA I  5  272  ? 16.966  98.244  -10.372 1.00 50.24  ? 272  ALA C O     1 
ATOM   7962  C  CB    . ALA I  5  272  ? 17.014  101.676 -9.999  1.00 52.28  ? 272  ALA C CB    1 
ATOM   7963  N  N     . GLY I  5  273  ? 15.358  99.423  -9.409  1.00 48.19  ? 273  GLY C N     1 
ATOM   7964  C  CA    . GLY I  5  273  ? 14.894  98.255  -8.698  1.00 45.84  ? 273  GLY C CA    1 
ATOM   7965  C  C     . GLY I  5  273  ? 13.715  97.542  -9.342  1.00 45.18  ? 273  GLY C C     1 
ATOM   7966  O  O     . GLY I  5  273  ? 13.620  96.326  -9.261  1.00 44.41  ? 273  GLY C O     1 
ATOM   7967  N  N     . ARG I  5  274  ? 12.813  98.266  -9.990  1.00 45.53  ? 274  ARG C N     1 
ATOM   7968  C  CA    . ARG I  5  274  ? 11.627  97.636  -10.569 1.00 45.22  ? 274  ARG C CA    1 
ATOM   7969  C  C     . ARG I  5  274  ? 11.987  96.595  -11.629 1.00 46.31  ? 274  ARG C C     1 
ATOM   7970  O  O     . ARG I  5  274  ? 11.108  95.889  -12.136 1.00 47.81  ? 274  ARG C O     1 
ATOM   7971  C  CB    . ARG I  5  274  ? 10.730  98.694  -11.187 1.00 45.84  ? 274  ARG C CB    1 
ATOM   7972  C  CG    . ARG I  5  274  ? 9.305   98.221  -11.420 1.00 46.63  ? 274  ARG C CG    1 
ATOM   7973  C  CD    . ARG I  5  274  ? 8.990   97.909  -12.878 1.00 45.16  ? 274  ARG C CD    1 
ATOM   7974  N  NE    . ARG I  5  274  ? 7.551   97.738  -13.034 1.00 45.77  ? 274  ARG C NE    1 
ATOM   7975  C  CZ    . ARG I  5  274  ? 6.674   98.735  -13.014 1.00 45.18  ? 274  ARG C CZ    1 
ATOM   7976  N  NH1   . ARG I  5  274  ? 7.081   99.987  -12.857 1.00 44.62  ? 274  ARG C NH1   1 
ATOM   7977  N  NH2   . ARG I  5  274  ? 5.382   98.474  -13.144 1.00 45.86  ? 274  ARG C NH2   1 
ATOM   7978  N  N     . TYR I  5  275  ? 13.270  96.511  -11.968 1.00 46.48  ? 275  TYR C N     1 
ATOM   7979  C  CA    . TYR I  5  275  ? 13.785  95.538  -12.939 1.00 44.66  ? 275  TYR C CA    1 
ATOM   7980  C  C     . TYR I  5  275  ? 13.789  94.156  -12.327 1.00 44.22  ? 275  TYR C C     1 
ATOM   7981  O  O     . TYR I  5  275  ? 13.323  93.165  -12.893 1.00 44.57  ? 275  TYR C O     1 
ATOM   7982  C  CB    . TYR I  5  275  ? 15.212  95.966  -13.339 1.00 42.83  ? 275  TYR C CB    1 
ATOM   7983  C  CG    . TYR I  5  275  ? 16.198  94.888  -13.740 1.00 39.28  ? 275  TYR C CG    1 
ATOM   7984  C  CD1   . TYR I  5  275  ? 16.349  94.520  -15.091 1.00 37.37  ? 275  TYR C CD1   1 
ATOM   7985  C  CD2   . TYR I  5  275  ? 16.986  94.231  -12.773 1.00 37.94  ? 275  TYR C CD2   1 
ATOM   7986  C  CE1   . TYR I  5  275  ? 17.270  93.511  -15.483 1.00 35.62  ? 275  TYR C CE1   1 
ATOM   7987  C  CE2   . TYR I  5  275  ? 17.908  93.221  -13.142 1.00 35.41  ? 275  TYR C CE2   1 
ATOM   7988  C  CZ    . TYR I  5  275  ? 18.040  92.870  -14.505 1.00 35.14  ? 275  TYR C CZ    1 
ATOM   7989  O  OH    . TYR I  5  275  ? 18.923  91.892  -14.894 1.00 32.53  ? 275  TYR C OH    1 
ATOM   7990  N  N     . LYS I  5  276  ? 14.346  94.116  -11.137 1.00 42.79  ? 276  LYS C N     1 
ATOM   7991  C  CA    . LYS I  5  276  ? 14.383  92.890  -10.411 1.00 42.77  ? 276  LYS C CA    1 
ATOM   7992  C  C     . LYS I  5  276  ? 12.978  92.516  -9.953  1.00 42.14  ? 276  LYS C C     1 
ATOM   7993  O  O     . LYS I  5  276  ? 12.740  91.420  -9.482  1.00 41.25  ? 276  LYS C O     1 
ATOM   7994  C  CB    . LYS I  5  276  ? 15.323  93.032  -9.204  1.00 44.14  ? 276  LYS C CB    1 
ATOM   7995  C  CG    . LYS I  5  276  ? 16.733  93.626  -9.496  1.00 44.12  ? 276  LYS C CG    1 
ATOM   7996  C  CD    . LYS I  5  276  ? 16.707  95.160  -9.350  1.00 45.90  ? 276  LYS C CD    1 
ATOM   7997  C  CE    . LYS I  5  276  ? 18.085  95.761  -9.136  1.00 45.74  ? 276  LYS C CE    1 
ATOM   7998  N  NZ    . LYS I  5  276  ? 18.011  97.058  -8.380  1.00 46.73  ? 276  LYS C NZ    1 
ATOM   7999  N  N     . ALA I  5  277  ? 12.047  93.449  -10.105 1.00 41.33  ? 277  ALA C N     1 
ATOM   8000  C  CA    . ALA I  5  277  ? 10.676  93.226  -9.691  1.00 43.08  ? 277  ALA C CA    1 
ATOM   8001  C  C     . ALA I  5  277  ? 9.890   92.458  -10.743 1.00 45.27  ? 277  ALA C C     1 
ATOM   8002  O  O     . ALA I  5  277  ? 9.866   91.236  -10.732 1.00 45.95  ? 277  ALA C O     1 
ATOM   8003  C  CB    . ALA I  5  277  ? 10.007  94.561  -9.409  1.00 42.50  ? 277  ALA C CB    1 
ATOM   8004  N  N     . GLU I  5  278  ? 9.259   93.182  -11.655 1.00 47.12  ? 278  GLU C N     1 
ATOM   8005  C  CA    . GLU I  5  278  ? 8.428   92.613  -12.718 1.00 49.67  ? 278  GLU C CA    1 
ATOM   8006  C  C     . GLU I  5  278  ? 8.935   91.231  -13.203 1.00 50.93  ? 278  GLU C C     1 
ATOM   8007  O  O     . GLU I  5  278  ? 8.155   90.285  -13.216 1.00 50.13  ? 278  GLU C O     1 
ATOM   8008  C  CB    . GLU I  5  278  ? 8.354   93.591  -13.909 1.00 50.01  ? 278  GLU C CB    1 
ATOM   8009  C  CG    . GLU I  5  278  ? 7.040   93.486  -14.725 1.00 51.44  ? 278  GLU C CG    1 
ATOM   8010  C  CD    . GLU I  5  278  ? 7.050   94.226  -16.078 1.00 51.36  ? 278  GLU C CD    1 
ATOM   8011  O  OE1   . GLU I  5  278  ? 7.743   93.756  -17.018 1.00 50.96  ? 278  GLU C OE1   1 
ATOM   8012  O  OE2   . GLU I  5  278  ? 6.360   95.272  -16.196 1.00 50.80  ? 278  GLU C OE2   1 
ATOM   8013  N  N     . GLU I  5  279  ? 10.211  91.102  -13.584 1.00 54.57  ? 279  GLU C N     1 
ATOM   8014  C  CA    . GLU I  5  279  ? 10.749  89.820  -14.109 1.00 57.94  ? 279  GLU C CA    1 
ATOM   8015  C  C     . GLU I  5  279  ? 10.868  88.748  -13.026 1.00 58.88  ? 279  GLU C C     1 
ATOM   8016  O  O     . GLU I  5  279  ? 10.292  87.658  -13.150 1.00 60.63  ? 279  GLU C O     1 
ATOM   8017  C  CB    . GLU I  5  279  ? 12.140  90.029  -14.786 1.00 59.48  ? 279  GLU C CB    1 
ATOM   8018  C  CG    . GLU I  5  279  ? 13.325  89.053  -14.423 1.00 61.50  ? 279  GLU C CG    1 
ATOM   8019  C  CD    . GLU I  5  279  ? 13.175  87.595  -14.883 1.00 61.90  ? 279  GLU C CD    1 
ATOM   8020  O  OE1   . GLU I  5  279  ? 13.376  87.309  -16.087 1.00 62.25  ? 279  GLU C OE1   1 
ATOM   8021  O  OE2   . GLU I  5  279  ? 12.860  86.734  -14.028 1.00 62.33  ? 279  GLU C OE2   1 
ATOM   8022  N  N     . LYS I  5  280  ? 11.612  89.038  -11.970 1.00 58.46  ? 280  LYS C N     1 
ATOM   8023  C  CA    . LYS I  5  280  ? 11.814  88.043  -10.935 1.00 57.09  ? 280  LYS C CA    1 
ATOM   8024  C  C     . LYS I  5  280  ? 10.527  87.782  -10.129 1.00 55.86  ? 280  LYS C C     1 
ATOM   8025  O  O     . LYS I  5  280  ? 10.192  86.623  -9.899  1.00 54.37  ? 280  LYS C O     1 
ATOM   8026  C  CB    . LYS I  5  280  ? 12.977  88.497  -10.034 1.00 57.62  ? 280  LYS C CB    1 
ATOM   8027  C  CG    . LYS I  5  280  ? 14.366  88.574  -10.745 1.00 55.82  ? 280  LYS C CG    1 
ATOM   8028  C  CD    . LYS I  5  280  ? 14.567  89.861  -11.542 1.00 54.90  ? 280  LYS C CD    1 
ATOM   8029  C  CE    . LYS I  5  280  ? 15.943  89.951  -12.199 1.00 54.94  ? 280  LYS C CE    1 
ATOM   8030  N  NZ    . LYS I  5  280  ? 17.021  90.416  -11.278 1.00 54.07  ? 280  LYS C NZ    1 
ATOM   8031  N  N     . LEU I  5  281  ? 9.805   88.829  -9.715  1.00 55.61  ? 281  LEU C N     1 
ATOM   8032  C  CA    . LEU I  5  281  ? 8.578   88.637  -8.929  1.00 54.74  ? 281  LEU C CA    1 
ATOM   8033  C  C     . LEU I  5  281  ? 7.712   89.894  -8.904  1.00 52.67  ? 281  LEU C C     1 
ATOM   8034  O  O     . LEU I  5  281  ? 8.205   91.007  -8.996  1.00 52.45  ? 281  LEU C O     1 
ATOM   8035  C  CB    . LEU I  5  281  ? 8.926   88.247  -7.467  1.00 57.39  ? 281  LEU C CB    1 
ATOM   8036  C  CG    . LEU I  5  281  ? 9.121   89.243  -6.293  1.00 57.78  ? 281  LEU C CG    1 
ATOM   8037  C  CD1   . LEU I  5  281  ? 9.371   88.448  -5.001  1.00 56.51  ? 281  LEU C CD1   1 
ATOM   8038  C  CD2   . LEU I  5  281  ? 10.280  90.190  -6.580  1.00 57.67  ? 281  LEU C CD2   1 
ATOM   8039  N  N     . GLY I  5  282  ? 6.408   89.706  -8.760  1.00 51.08  ? 282  GLY C N     1 
ATOM   8040  C  CA    . GLY I  5  282  ? 5.530   90.851  -8.670  1.00 50.19  ? 282  GLY C CA    1 
ATOM   8041  C  C     . GLY I  5  282  ? 5.520   91.663  -9.936  1.00 49.73  ? 282  GLY C C     1 
ATOM   8042  O  O     . GLY I  5  282  ? 6.508   91.750  -10.659 1.00 49.04  ? 282  GLY C O     1 
ATOM   8043  N  N     . ILE I  5  283  ? 4.385   92.284  -10.194 1.00 49.33  ? 283  ILE C N     1 
ATOM   8044  C  CA    . ILE I  5  283  ? 4.219   93.039  -11.414 1.00 50.09  ? 283  ILE C CA    1 
ATOM   8045  C  C     . ILE I  5  283  ? 4.500   94.541  -11.229 1.00 49.26  ? 283  ILE C C     1 
ATOM   8046  O  O     . ILE I  5  283  ? 5.392   95.092  -11.877 1.00 48.01  ? 283  ILE C O     1 
ATOM   8047  C  CB    . ILE I  5  283  ? 2.767   92.878  -11.968 1.00 51.22  ? 283  ILE C CB    1 
ATOM   8048  C  CG1   . ILE I  5  283  ? 2.383   91.395  -12.023 1.00 52.57  ? 283  ILE C CG1   1 
ATOM   8049  C  CG2   . ILE I  5  283  ? 2.656   93.512  -13.348 1.00 52.28  ? 283  ILE C CG2   1 
ATOM   8050  C  CD1   . ILE I  5  283  ? 1.761   90.840  -10.757 1.00 52.51  ? 283  ILE C CD1   1 
ATOM   8051  N  N     . ARG I  5  284  ? 3.765   95.214  -10.354 1.00 48.20  ? 284  ARG C N     1 
ATOM   8052  C  CA    . ARG I  5  284  ? 3.938   96.654  -10.313 1.00 46.64  ? 284  ARG C CA    1 
ATOM   8053  C  C     . ARG I  5  284  ? 4.568   97.164  -9.040  1.00 46.69  ? 284  ARG C C     1 
ATOM   8054  O  O     . ARG I  5  284  ? 4.732   96.497  -8.025  1.00 47.65  ? 284  ARG C O     1 
ATOM   8055  C  CB    . ARG I  5  284  ? 2.598   97.338  -10.494 1.00 46.66  ? 284  ARG C CB    1 
ATOM   8056  C  CG    . ARG I  5  284  ? 2.682   98.824  -10.906 1.00 46.31  ? 284  ARG C CG    1 
ATOM   8057  C  CD    . ARG I  5  284  ? 1.399   99.532  -10.599 1.00 46.26  ? 284  ARG C CD    1 
ATOM   8058  N  NE    . ARG I  5  284  ? 0.299   98.576  -10.690 1.00 47.66  ? 284  ARG C NE    1 
ATOM   8059  C  CZ    . ARG I  5  284  ? -0.422  98.341  -11.783 1.00 47.63  ? 284  ARG C CZ    1 
ATOM   8060  N  NH1   . ARG I  5  284  ? -0.191  99.012  -12.912 1.00 46.25  ? 284  ARG C NH1   1 
ATOM   8061  N  NH2   . ARG I  5  284  ? -1.371  97.408  -11.746 1.00 47.71  ? 284  ARG C NH2   1 
ATOM   8062  N  N     . LEU I  5  285  ? 4.906   98.432  -9.177  1.00 45.44  ? 285  LEU C N     1 
ATOM   8063  C  CA    . LEU I  5  285  ? 5.504   99.266  -8.188  1.00 44.79  ? 285  LEU C CA    1 
ATOM   8064  C  C     . LEU I  5  285  ? 4.927   100.656 -8.287  1.00 45.28  ? 285  LEU C C     1 
ATOM   8065  O  O     . LEU I  5  285  ? 5.123   101.350 -9.277  1.00 44.69  ? 285  LEU C O     1 
ATOM   8066  C  CB    . LEU I  5  285  ? 7.031   99.297  -8.406  1.00 43.10  ? 285  LEU C CB    1 
ATOM   8067  C  CG    . LEU I  5  285  ? 7.905   100.504 -8.806  1.00 40.27  ? 285  LEU C CG    1 
ATOM   8068  C  CD1   . LEU I  5  285  ? 9.333   100.105 -8.590  1.00 40.79  ? 285  LEU C CD1   1 
ATOM   8069  C  CD2   . LEU I  5  285  ? 7.722   100.911 -10.238 1.00 38.31  ? 285  LEU C CD2   1 
ATOM   8070  N  N     . SER I  5  286  ? 4.169   101.069 -7.293  1.00 46.24  ? 286  SER C N     1 
ATOM   8071  C  CA    . SER I  5  286  ? 3.690   102.432 -7.348  1.00 48.68  ? 286  SER C CA    1 
ATOM   8072  C  C     . SER I  5  286  ? 4.630   103.318 -6.537  1.00 49.87  ? 286  SER C C     1 
ATOM   8073  O  O     . SER I  5  286  ? 4.725   103.140 -5.318  1.00 50.77  ? 286  SER C O     1 
ATOM   8074  C  CB    . SER I  5  286  ? 2.265   102.489 -6.811  1.00 49.43  ? 286  SER C CB    1 
ATOM   8075  O  OG    . SER I  5  286  ? 1.455   101.514 -7.441  1.00 50.97  ? 286  SER C OG    1 
ATOM   8076  N  N     . GLY I  5  287  ? 5.327   104.245 -7.203  1.00 49.50  ? 287  GLY C N     1 
ATOM   8077  C  CA    . GLY I  5  287  ? 6.321   105.065 -6.524  1.00 50.61  ? 287  GLY C CA    1 
ATOM   8078  C  C     . GLY I  5  287  ? 7.582   104.226 -6.355  1.00 51.58  ? 287  GLY C C     1 
ATOM   8079  O  O     . GLY I  5  287  ? 7.433   103.070 -5.964  1.00 52.73  ? 287  GLY C O     1 
ATOM   8080  N  N     . ARG I  5  288  ? 8.774   104.773 -6.640  1.00 52.12  ? 288  ARG C N     1 
ATOM   8081  C  CA    . ARG I  5  288  ? 10.081  104.070 -6.569  1.00 52.82  ? 288  ARG C CA    1 
ATOM   8082  C  C     . ARG I  5  288  ? 10.002  102.783 -5.747  1.00 54.18  ? 288  ARG C C     1 
ATOM   8083  O  O     . ARG I  5  288  ? 9.704   101.735 -6.301  1.00 55.74  ? 288  ARG C O     1 
ATOM   8084  C  CB    . ARG I  5  288  ? 11.145  104.998 -5.991  1.00 52.32  ? 288  ARG C CB    1 
ATOM   8085  C  CG    . ARG I  5  288  ? 11.414  106.188 -6.876  1.00 52.31  ? 288  ARG C CG    1 
ATOM   8086  C  CD    . ARG I  5  288  ? 12.883  106.529 -6.889  1.00 53.46  ? 288  ARG C CD    1 
ATOM   8087  N  NE    . ARG I  5  288  ? 13.296  107.205 -8.123  1.00 53.24  ? 288  ARG C NE    1 
ATOM   8088  C  CZ    . ARG I  5  288  ? 12.899  108.419 -8.496  1.00 53.38  ? 288  ARG C CZ    1 
ATOM   8089  N  NH1   . ARG I  5  288  ? 12.066  109.108 -7.727  1.00 54.08  ? 288  ARG C NH1   1 
ATOM   8090  N  NH2   . ARG I  5  288  ? 13.337  108.948 -9.635  1.00 52.43  ? 288  ARG C NH2   1 
ATOM   8091  N  N     . THR I  5  289  ? 10.271  102.829 -4.451  1.00 54.35  ? 289  THR C N     1 
ATOM   8092  C  CA    . THR I  5  289  ? 10.107  101.627 -3.632  1.00 54.68  ? 289  THR C CA    1 
ATOM   8093  C  C     . THR I  5  289  ? 8.725   101.664 -2.961  1.00 55.81  ? 289  THR C C     1 
ATOM   8094  O  O     . THR I  5  289  ? 8.073   102.677 -3.142  1.00 55.90  ? 289  THR C O     1 
ATOM   8095  C  CB    . THR I  5  289  ? 11.222  101.589 -2.605  1.00 53.92  ? 289  THR C CB    1 
ATOM   8096  O  OG1   . THR I  5  289  ? 11.896  102.853 -2.618  1.00 52.95  ? 289  THR C OG1   1 
ATOM   8097  C  CG2   . THR I  5  289  ? 12.224  100.489 -2.921  1.00 52.92  ? 289  THR C CG2   1 
ATOM   8098  N  N     . LEU I  5  290  ? 8.259   100.632 -2.236  1.00 58.34  ? 290  LEU C N     1 
ATOM   8099  C  CA    . LEU I  5  290  ? 6.911   100.642 -1.560  1.00 60.87  ? 290  LEU C CA    1 
ATOM   8100  C  C     . LEU I  5  290  ? 6.639   101.997 -0.863  1.00 63.68  ? 290  LEU C C     1 
ATOM   8101  O  O     . LEU I  5  290  ? 6.855   102.137 0.341   1.00 63.70  ? 290  LEU C O     1 
ATOM   8102  C  CB    . LEU I  5  290  ? 6.828   99.526  -0.509  1.00 59.11  ? 290  LEU C CB    1 
ATOM   8103  C  CG    . LEU I  5  290  ? 7.905   99.364  0.576   1.00 57.70  ? 290  LEU C CG    1 
ATOM   8104  C  CD1   . LEU I  5  290  ? 7.508   98.218  1.447   1.00 57.02  ? 290  LEU C CD1   1 
ATOM   8105  C  CD2   . LEU I  5  290  ? 9.269   99.081  -0.023  1.00 56.34  ? 290  LEU C CD2   1 
ATOM   8106  N  N     . ALA I  5  291  ? 6.117   102.968 -1.621  1.00 67.42  ? 291  ALA C N     1 
ATOM   8107  C  CA    . ALA I  5  291  ? 6.001   104.358 -1.149  1.00 69.12  ? 291  ALA C CA    1 
ATOM   8108  C  C     . ALA I  5  291  ? 4.597   104.988 -1.344  1.00 71.30  ? 291  ALA C C     1 
ATOM   8109  O  O     . ALA I  5  291  ? 3.874   104.691 -2.301  1.00 71.71  ? 291  ALA C O     1 
ATOM   8110  C  CB    . ALA I  5  291  ? 7.012   105.170 -1.913  1.00 69.49  ? 291  ALA C CB    1 
ATOM   8111  N  N     . ARG I  5  292  ? 4.258   105.891 -0.414  1.00 72.07  ? 292  ARG C N     1 
ATOM   8112  C  CA    . ARG I  5  292  ? 3.021   106.671 -0.446  1.00 73.27  ? 292  ARG C CA    1 
ATOM   8113  C  C     . ARG I  5  292  ? 2.816   107.455 0.833   1.00 74.47  ? 292  ARG C C     1 
ATOM   8114  O  O     . ARG I  5  292  ? 3.017   106.939 1.933   1.00 74.03  ? 292  ARG C O     1 
ATOM   8115  C  CB    . ARG I  5  292  ? 1.770   105.811 -0.628  1.00 72.78  ? 292  ARG C CB    1 
ATOM   8116  C  CG    . ARG I  5  292  ? 0.521   106.673 -0.850  1.00 71.86  ? 292  ARG C CG    1 
ATOM   8117  C  CD    . ARG I  5  292  ? -0.761  105.896 -0.688  1.00 71.16  ? 292  ARG C CD    1 
ATOM   8118  N  NE    . ARG I  5  292  ? -1.924  106.661 -1.127  1.00 70.82  ? 292  ARG C NE    1 
ATOM   8119  C  CZ    . ARG I  5  292  ? -2.968  106.122 -1.750  1.00 71.03  ? 292  ARG C CZ    1 
ATOM   8120  N  NH1   . ARG I  5  292  ? -2.983  104.824 -2.003  1.00 71.32  ? 292  ARG C NH1   1 
ATOM   8121  N  NH2   . ARG I  5  292  ? -3.999  106.862 -2.120  1.00 70.96  ? 292  ARG C NH2   1 
ATOM   8122  N  N     . PHE I  5  293  ? 2.403   108.708 0.668   1.00 76.34  ? 293  PHE C N     1 
ATOM   8123  C  CA    . PHE I  5  293  ? 2.093   109.574 1.793   1.00 79.01  ? 293  PHE C CA    1 
ATOM   8124  C  C     . PHE I  5  293  ? 1.009   110.609 1.426   1.00 79.08  ? 293  PHE C C     1 
ATOM   8125  O  O     . PHE I  5  293  ? 1.060   111.769 1.861   1.00 79.11  ? 293  PHE C O     1 
ATOM   8126  C  CB    . PHE I  5  293  ? 3.384   110.274 2.339   1.00 81.27  ? 293  PHE C CB    1 
ATOM   8127  C  CG    . PHE I  5  293  ? 4.329   110.885 1.298   1.00 82.39  ? 293  PHE C CG    1 
ATOM   8128  C  CD1   . PHE I  5  293  ? 3.867   111.454 0.090   1.00 82.23  ? 293  PHE C CD1   1 
ATOM   8129  C  CD2   . PHE I  5  293  ? 5.718   110.944 1.582   1.00 81.54  ? 293  PHE C CD2   1 
ATOM   8130  C  CE1   . PHE I  5  293  ? 4.783   112.081 -0.822  1.00 81.63  ? 293  PHE C CE1   1 
ATOM   8131  C  CE2   . PHE I  5  293  ? 6.638   111.566 0.684   1.00 81.65  ? 293  PHE C CE2   1 
ATOM   8132  C  CZ    . PHE I  5  293  ? 6.166   112.135 -0.519  1.00 81.11  ? 293  PHE C CZ    1 
ATOM   8133  N  N     . GLU I  5  294  ? 0.014   110.162 0.645   1.00 79.22  ? 294  GLU C N     1 
ATOM   8134  C  CA    . GLU I  5  294  ? -1.075  111.026 0.154   1.00 78.66  ? 294  GLU C CA    1 
ATOM   8135  C  C     . GLU I  5  294  ? -2.330  110.983 1.054   1.00 79.67  ? 294  GLU C C     1 
ATOM   8136  O  O     . GLU I  5  294  ? -2.894  112.047 1.362   1.00 79.79  ? 294  GLU C O     1 
ATOM   8137  C  CB    . GLU I  5  294  ? -1.460  110.628 -1.295  1.00 76.77  ? 294  GLU C CB    1 
ATOM   8138  C  CG    . GLU I  5  294  ? -2.610  109.622 -1.485  1.00 72.89  ? 294  GLU C CG    1 
ATOM   8139  C  CD    . GLU I  5  294  ? -3.010  109.467 -2.941  1.00 71.12  ? 294  GLU C CD    1 
ATOM   8140  O  OE1   . GLU I  5  294  ? -4.172  109.105 -3.220  1.00 70.25  ? 294  GLU C OE1   1 
ATOM   8141  O  OE2   . GLU I  5  294  ? -2.155  109.709 -3.815  1.00 70.60  ? 294  GLU C OE2   1 
ATOM   8142  N  N     . ASP I  5  295  ? -2.771  109.793 1.477   1.00 81.11  ? 295  ASP C N     1 
ATOM   8143  C  CA    . ASP I  5  295  ? -4.001  109.681 2.279   1.00 81.08  ? 295  ASP C CA    1 
ATOM   8144  C  C     . ASP I  5  295  ? -3.728  109.186 3.709   1.00 81.21  ? 295  ASP C C     1 
ATOM   8145  O  O     . ASP I  5  295  ? -4.660  109.094 4.509   1.00 81.98  ? 295  ASP C O     1 
ATOM   8146  C  CB    . ASP I  5  295  ? -4.987  108.726 1.575   1.00 81.97  ? 295  ASP C CB    1 
ATOM   8147  C  CG    . ASP I  5  295  ? -6.445  108.904 2.032   1.00 82.68  ? 295  ASP C CG    1 
ATOM   8148  O  OD1   . ASP I  5  295  ? -7.342  108.301 1.392   1.00 82.10  ? 295  ASP C OD1   1 
ATOM   8149  O  OD2   . ASP I  5  295  ? -6.700  109.634 3.015   1.00 82.44  ? 295  ASP C OD2   1 
ATOM   8150  N  N     . GLY I  5  296  ? -2.477  108.875 4.047   1.00 81.39  ? 296  GLY C N     1 
ATOM   8151  C  CA    . GLY I  5  296  ? -2.195  108.388 5.390   1.00 80.69  ? 296  GLY C CA    1 
ATOM   8152  C  C     . GLY I  5  296  ? -2.318  106.882 5.433   1.00 80.54  ? 296  GLY C C     1 
ATOM   8153  O  O     . GLY I  5  296  ? -1.806  106.210 6.331   1.00 80.71  ? 296  GLY C O     1 
ATOM   8154  N  N     . GLU I  5  297  ? -3.037  106.375 4.432   1.00 80.34  ? 297  GLU C N     1 
ATOM   8155  C  CA    . GLU I  5  297  ? -3.248  104.951 4.189   1.00 79.11  ? 297  GLU C CA    1 
ATOM   8156  C  C     . GLU I  5  297  ? -2.238  104.471 3.152   1.00 78.36  ? 297  GLU C C     1 
ATOM   8157  O  O     . GLU I  5  297  ? -2.247  104.927 2.007   1.00 78.67  ? 297  GLU C O     1 
ATOM   8158  C  CB    . GLU I  5  297  ? -4.696  104.745 3.717   1.00 79.58  ? 297  GLU C CB    1 
ATOM   8159  C  CG    . GLU I  5  297  ? -4.938  103.677 2.653   1.00 79.87  ? 297  GLU C CG    1 
ATOM   8160  C  CD    . GLU I  5  297  ? -5.753  104.231 1.490   1.00 80.51  ? 297  GLU C CD    1 
ATOM   8161  O  OE1   . GLU I  5  297  ? -5.293  105.204 0.857   1.00 81.20  ? 297  GLU C OE1   1 
ATOM   8162  O  OE2   . GLU I  5  297  ? -6.851  103.708 1.205   1.00 81.32  ? 297  GLU C OE2   1 
ATOM   8163  N  N     . PHE I  5  298  ? -1.367  103.560 3.556   1.00 76.98  ? 298  PHE C N     1 
ATOM   8164  C  CA    . PHE I  5  298  ? -0.273  103.139 2.699   1.00 75.79  ? 298  PHE C CA    1 
ATOM   8165  C  C     . PHE I  5  298  ? -0.663  102.054 1.736   1.00 74.12  ? 298  PHE C C     1 
ATOM   8166  O  O     . PHE I  5  298  ? -1.614  101.299 1.935   1.00 73.83  ? 298  PHE C O     1 
ATOM   8167  C  CB    . PHE I  5  298  ? 0.895   102.683 3.575   1.00 76.35  ? 298  PHE C CB    1 
ATOM   8168  C  CG    . PHE I  5  298  ? 1.197   103.644 4.690   1.00 77.01  ? 298  PHE C CG    1 
ATOM   8169  C  CD1   . PHE I  5  298  ? 0.513   103.551 5.923   1.00 77.06  ? 298  PHE C CD1   1 
ATOM   8170  C  CD2   . PHE I  5  298  ? 2.124   104.690 4.500   1.00 77.53  ? 298  PHE C CD2   1 
ATOM   8171  C  CE1   . PHE I  5  298  ? 0.746   104.499 6.962   1.00 77.65  ? 298  PHE C CE1   1 
ATOM   8172  C  CE2   . PHE I  5  298  ? 2.373   105.650 5.524   1.00 77.08  ? 298  PHE C CE2   1 
ATOM   8173  C  CZ    . PHE I  5  298  ? 1.682   105.555 6.759   1.00 76.91  ? 298  PHE C CZ    1 
ATOM   8174  N  N     . LYS I  5  299  ? 0.129   102.016 0.672   1.00 71.77  ? 299  LYS C N     1 
ATOM   8175  C  CA    . LYS I  5  299  ? 0.024   101.047 -0.394  1.00 69.68  ? 299  LYS C CA    1 
ATOM   8176  C  C     . LYS I  5  299  ? 1.330   100.264 -0.510  1.00 68.82  ? 299  LYS C C     1 
ATOM   8177  O  O     . LYS I  5  299  ? 2.410   100.844 -0.504  1.00 69.36  ? 299  LYS C O     1 
ATOM   8178  C  CB    . LYS I  5  299  ? -0.296  101.773 -1.713  1.00 68.41  ? 299  LYS C CB    1 
ATOM   8179  C  CG    . LYS I  5  299  ? 0.654   102.904 -2.057  1.00 66.09  ? 299  LYS C CG    1 
ATOM   8180  C  CD    . LYS I  5  299  ? 0.137   103.761 -3.202  1.00 65.14  ? 299  LYS C CD    1 
ATOM   8181  C  CE    . LYS I  5  299  ? -0.054  102.979 -4.488  1.00 63.97  ? 299  LYS C CE    1 
ATOM   8182  N  NZ    . LYS I  5  299  ? -0.297  103.865 -5.667  1.00 64.57  ? 299  LYS C NZ    1 
ATOM   8183  N  N     . ASP I  5  300  ? 1.233   98.948  -0.598  1.00 67.03  ? 300  ASP C N     1 
ATOM   8184  C  CA    . ASP I  5  300  ? 2.417   98.120  -0.698  1.00 65.68  ? 300  ASP C CA    1 
ATOM   8185  C  C     . ASP I  5  300  ? 2.260   97.075  -1.791  1.00 66.19  ? 300  ASP C C     1 
ATOM   8186  O  O     . ASP I  5  300  ? 1.793   95.968  -1.532  1.00 67.28  ? 300  ASP C O     1 
ATOM   8187  C  CB    . ASP I  5  300  ? 2.669   97.429  0.645   1.00 64.59  ? 300  ASP C CB    1 
ATOM   8188  C  CG    . ASP I  5  300  ? 1.537   96.481  1.044   1.00 64.58  ? 300  ASP C CG    1 
ATOM   8189  O  OD1   . ASP I  5  300  ? 0.391   96.948  1.160   1.00 65.48  ? 300  ASP C OD1   1 
ATOM   8190  O  OD2   . ASP I  5  300  ? 1.782   95.270  1.235   1.00 62.44  ? 300  ASP C OD2   1 
ATOM   8191  N  N     . GLU I  5  301  ? 2.634   97.402  -3.021  1.00 65.79  ? 301  GLU C N     1 
ATOM   8192  C  CA    . GLU I  5  301  ? 2.507   96.402  -4.083  1.00 65.76  ? 301  GLU C CA    1 
ATOM   8193  C  C     . GLU I  5  301  ? 3.723   95.460  -4.094  1.00 65.08  ? 301  GLU C C     1 
ATOM   8194  O  O     . GLU I  5  301  ? 3.864   94.634  -4.999  1.00 65.39  ? 301  GLU C O     1 
ATOM   8195  C  CB    . GLU I  5  301  ? 2.368   97.090  -5.461  1.00 66.02  ? 301  GLU C CB    1 
ATOM   8196  C  CG    . GLU I  5  301  ? 1.108   97.946  -5.644  1.00 64.90  ? 301  GLU C CG    1 
ATOM   8197  C  CD    . GLU I  5  301  ? 1.024   98.602  -7.020  1.00 64.70  ? 301  GLU C CD    1 
ATOM   8198  O  OE1   . GLU I  5  301  ? 2.070   99.044  -7.554  1.00 64.04  ? 301  GLU C OE1   1 
ATOM   8199  O  OE2   . GLU I  5  301  ? -0.100  98.678  -7.562  1.00 64.48  ? 301  GLU C OE2   1 
ATOM   8200  N  N     . VAL I  5  302  ? 4.583   95.581  -3.076  1.00 63.45  ? 302  VAL C N     1 
ATOM   8201  C  CA    . VAL I  5  302  ? 5.810   94.785  -2.980  1.00 61.19  ? 302  VAL C CA    1 
ATOM   8202  C  C     . VAL I  5  302  ? 5.758   93.755  -1.828  1.00 60.82  ? 302  VAL C C     1 
ATOM   8203  O  O     . VAL I  5  302  ? 6.250   92.628  -1.973  1.00 59.94  ? 302  VAL C O     1 
ATOM   8204  C  CB    . VAL I  5  302  ? 7.030   95.727  -2.780  1.00 60.04  ? 302  VAL C CB    1 
ATOM   8205  C  CG1   . VAL I  5  302  ? 6.838   96.546  -1.550  1.00 58.45  ? 302  VAL C CG1   1 
ATOM   8206  C  CG2   . VAL I  5  302  ? 8.301   94.929  -2.669  1.00 61.08  ? 302  VAL C CG2   1 
ATOM   8207  N  N     . PHE I  5  303  ? 5.165   94.134  -0.699  1.00 59.63  ? 303  PHE C N     1 
ATOM   8208  C  CA    . PHE I  5  303  ? 5.092   93.267  0.471   1.00 59.12  ? 303  PHE C CA    1 
ATOM   8209  C  C     . PHE I  5  303  ? 4.344   91.962  0.185   1.00 59.25  ? 303  PHE C C     1 
ATOM   8210  O  O     . PHE I  5  303  ? 4.834   90.881  0.517   1.00 59.61  ? 303  PHE C O     1 
ATOM   8211  C  CB    . PHE I  5  303  ? 4.411   94.011  1.614   1.00 57.83  ? 303  PHE C CB    1 
ATOM   8212  C  CG    . PHE I  5  303  ? 5.357   94.718  2.532   1.00 56.71  ? 303  PHE C CG    1 
ATOM   8213  C  CD1   . PHE I  5  303  ? 5.031   95.995  3.033   1.00 56.74  ? 303  PHE C CD1   1 
ATOM   8214  C  CD2   . PHE I  5  303  ? 6.565   94.104  2.938   1.00 55.83  ? 303  PHE C CD2   1 
ATOM   8215  C  CE1   . PHE I  5  303  ? 5.894   96.671  3.942   1.00 56.65  ? 303  PHE C CE1   1 
ATOM   8216  C  CE2   . PHE I  5  303  ? 7.446   94.754  3.843   1.00 56.82  ? 303  PHE C CE2   1 
ATOM   8217  C  CZ    . PHE I  5  303  ? 7.110   96.046  4.352   1.00 56.72  ? 303  PHE C CZ    1 
ATOM   8218  N  N     . LEU I  5  304  ? 3.167   92.044  -0.417  1.00 58.52  ? 304  LEU C N     1 
ATOM   8219  C  CA    . LEU I  5  304  ? 2.408   90.836  -0.699  1.00 58.35  ? 304  LEU C CA    1 
ATOM   8220  C  C     . LEU I  5  304  ? 3.117   89.927  -1.744  1.00 58.50  ? 304  LEU C C     1 
ATOM   8221  O  O     . LEU I  5  304  ? 3.220   88.716  -1.531  1.00 58.50  ? 304  LEU C O     1 
ATOM   8222  C  CB    . LEU I  5  304  ? 0.976   91.211  -1.173  1.00 57.00  ? 304  LEU C CB    1 
ATOM   8223  C  CG    . LEU I  5  304  ? 0.516   91.192  -2.647  1.00 56.52  ? 304  LEU C CG    1 
ATOM   8224  C  CD1   . LEU I  5  304  ? -0.861  90.560  -2.730  1.00 56.35  ? 304  LEU C CD1   1 
ATOM   8225  C  CD2   . LEU I  5  304  ? 0.486   92.590  -3.222  1.00 55.87  ? 304  LEU C CD2   1 
ATOM   8226  N  N     . PRO I  5  305  ? 3.631   90.489  -2.865  1.00 58.44  ? 305  PRO C N     1 
ATOM   8227  C  CA    . PRO I  5  305  ? 4.292   89.692  -3.911  1.00 58.36  ? 305  PRO C CA    1 
ATOM   8228  C  C     . PRO I  5  305  ? 5.434   88.838  -3.401  1.00 56.88  ? 305  PRO C C     1 
ATOM   8229  O  O     . PRO I  5  305  ? 5.583   87.688  -3.824  1.00 55.23  ? 305  PRO C O     1 
ATOM   8230  C  CB    . PRO I  5  305  ? 4.743   90.745  -4.925  1.00 59.09  ? 305  PRO C CB    1 
ATOM   8231  C  CG    . PRO I  5  305  ? 3.727   91.793  -4.771  1.00 58.79  ? 305  PRO C CG    1 
ATOM   8232  C  CD    . PRO I  5  305  ? 3.659   91.905  -3.273  1.00 58.81  ? 305  PRO C CD    1 
ATOM   8233  N  N     . THR I  5  306  ? 6.248   89.387  -2.517  1.00 57.43  ? 306  THR C N     1 
ATOM   8234  C  CA    . THR I  5  306  ? 7.351   88.596  -2.041  1.00 58.53  ? 306  THR C CA    1 
ATOM   8235  C  C     . THR I  5  306  ? 6.842   87.299  -1.465  1.00 60.01  ? 306  THR C C     1 
ATOM   8236  O  O     . THR I  5  306  ? 7.291   86.218  -1.851  1.00 61.21  ? 306  THR C O     1 
ATOM   8237  C  CB    . THR I  5  306  ? 8.162   89.368  -0.995  1.00 58.44  ? 306  THR C CB    1 
ATOM   8238  O  OG1   . THR I  5  306  ? 7.366   89.597  0.171   1.00 58.68  ? 306  THR C OG1   1 
ATOM   8239  C  CG2   . THR I  5  306  ? 8.598   90.696  -1.584  1.00 57.98  ? 306  THR C CG2   1 
ATOM   8240  N  N     . LEU I  5  307  ? 5.879   87.410  -0.558  1.00 60.37  ? 307  LEU C N     1 
ATOM   8241  C  CA    . LEU I  5  307  ? 5.294   86.229  0.056   1.00 60.17  ? 307  LEU C CA    1 
ATOM   8242  C  C     . LEU I  5  307  ? 4.624   85.373  -0.998  1.00 58.85  ? 307  LEU C C     1 
ATOM   8243  O  O     . LEU I  5  307  ? 4.681   84.144  -0.946  1.00 56.37  ? 307  LEU C O     1 
ATOM   8244  C  CB    . LEU I  5  307  ? 4.288   86.670  1.136   1.00 59.71  ? 307  LEU C CB    1 
ATOM   8245  C  CG    . LEU I  5  307  ? 3.811   85.711  2.213   1.00 58.94  ? 307  LEU C CG    1 
ATOM   8246  C  CD1   . LEU I  5  307  ? 4.947   84.809  2.703   1.00 59.87  ? 307  LEU C CD1   1 
ATOM   8247  C  CD2   . LEU I  5  307  ? 3.270   86.538  3.342   1.00 57.71  ? 307  LEU C CD2   1 
ATOM   8248  N  N     . ARG I  5  308  ? 4.003   86.062  -1.954  1.00 59.77  ? 308  ARG C N     1 
ATOM   8249  C  CA    . ARG I  5  308  ? 3.313   85.430  -3.067  1.00 61.06  ? 308  ARG C CA    1 
ATOM   8250  C  C     . ARG I  5  308  ? 4.238   84.486  -3.793  1.00 62.05  ? 308  ARG C C     1 
ATOM   8251  O  O     . ARG I  5  308  ? 3.863   83.368  -4.177  1.00 61.97  ? 308  ARG C O     1 
ATOM   8252  C  CB    . ARG I  5  308  ? 2.810   86.487  -4.056  1.00 61.08  ? 308  ARG C CB    1 
ATOM   8253  C  CG    . ARG I  5  308  ? 1.451   87.078  -3.746  1.00 61.16  ? 308  ARG C CG    1 
ATOM   8254  C  CD    . ARG I  5  308  ? 1.218   88.346  -4.540  1.00 62.23  ? 308  ARG C CD    1 
ATOM   8255  N  NE    . ARG I  5  308  ? 1.688   88.244  -5.923  1.00 62.48  ? 308  ARG C NE    1 
ATOM   8256  C  CZ    . ARG I  5  308  ? 1.105   87.510  -6.869  1.00 62.65  ? 308  ARG C CZ    1 
ATOM   8257  N  NH1   . ARG I  5  308  ? 0.013   86.798  -6.585  1.00 62.77  ? 308  ARG C NH1   1 
ATOM   8258  N  NH2   . ARG I  5  308  ? 1.613   87.490  -8.100  1.00 61.75  ? 308  ARG C NH2   1 
ATOM   8259  N  N     . TYR I  5  309  ? 5.464   84.947  -3.979  1.00 62.32  ? 309  TYR C N     1 
ATOM   8260  C  CA    . TYR I  5  309  ? 6.418   84.120  -4.656  1.00 62.79  ? 309  TYR C CA    1 
ATOM   8261  C  C     . TYR I  5  309  ? 7.021   83.112  -3.713  1.00 62.25  ? 309  TYR C C     1 
ATOM   8262  O  O     . TYR I  5  309  ? 7.631   82.146  -4.160  1.00 62.64  ? 309  TYR C O     1 
ATOM   8263  C  CB    . TYR I  5  309  ? 7.486   84.984  -5.319  1.00 64.32  ? 309  TYR C CB    1 
ATOM   8264  C  CG    . TYR I  5  309  ? 7.420   84.839  -6.823  1.00 65.96  ? 309  TYR C CG    1 
ATOM   8265  C  CD1   . TYR I  5  309  ? 6.310   85.333  -7.557  1.00 65.83  ? 309  TYR C CD1   1 
ATOM   8266  C  CD2   . TYR I  5  309  ? 8.442   84.169  -7.523  1.00 66.75  ? 309  TYR C CD2   1 
ATOM   8267  C  CE1   . TYR I  5  309  ? 6.223   85.155  -8.967  1.00 65.87  ? 309  TYR C CE1   1 
ATOM   8268  C  CE2   . TYR I  5  309  ? 8.369   83.985  -8.926  1.00 67.71  ? 309  TYR C CE2   1 
ATOM   8269  C  CZ    . TYR I  5  309  ? 7.261   84.478  -9.638  1.00 67.20  ? 309  TYR C CZ    1 
ATOM   8270  O  OH    . TYR I  5  309  ? 7.214   84.284  -11.000 1.00 68.24  ? 309  TYR C OH    1 
ATOM   8271  N  N     . LEU I  5  310  ? 6.867   83.326  -2.405  1.00 61.99  ? 310  LEU C N     1 
ATOM   8272  C  CA    . LEU I  5  310  ? 7.332   82.294  -1.491  1.00 61.91  ? 310  LEU C CA    1 
ATOM   8273  C  C     . LEU I  5  310  ? 6.340   81.149  -1.503  1.00 61.17  ? 310  LEU C C     1 
ATOM   8274  O  O     . LEU I  5  310  ? 6.722   79.984  -1.560  1.00 61.75  ? 310  LEU C O     1 
ATOM   8275  C  CB    . LEU I  5  310  ? 7.500   82.806  -0.048  1.00 61.12  ? 310  LEU C CB    1 
ATOM   8276  C  CG    . LEU I  5  310  ? 8.062   81.687  0.875   1.00 61.01  ? 310  LEU C CG    1 
ATOM   8277  C  CD1   . LEU I  5  310  ? 9.396   81.138  0.366   1.00 59.85  ? 310  LEU C CD1   1 
ATOM   8278  C  CD2   . LEU I  5  310  ? 8.244   82.249  2.255   1.00 61.71  ? 310  LEU C CD2   1 
ATOM   8279  N  N     . PHE I  5  311  ? 5.053   81.505  -1.460  1.00 58.76  ? 311  PHE C N     1 
ATOM   8280  C  CA    . PHE I  5  311  ? 3.977   80.524  -1.553  1.00 55.86  ? 311  PHE C CA    1 
ATOM   8281  C  C     . PHE I  5  311  ? 4.080   79.770  -2.863  1.00 53.89  ? 311  PHE C C     1 
ATOM   8282  O  O     . PHE I  5  311  ? 3.733   78.591  -2.979  1.00 53.28  ? 311  PHE C O     1 
ATOM   8283  C  CB    . PHE I  5  311  ? 2.594   81.188  -1.547  1.00 56.84  ? 311  PHE C CB    1 
ATOM   8284  C  CG    . PHE I  5  311  ? 2.113   81.683  -0.212  1.00 57.19  ? 311  PHE C CG    1 
ATOM   8285  C  CD1   . PHE I  5  311  ? 0.722   81.732  0.033   1.00 57.03  ? 311  PHE C CD1   1 
ATOM   8286  C  CD2   . PHE I  5  311  ? 2.998   82.137  0.787   1.00 57.59  ? 311  PHE C CD2   1 
ATOM   8287  C  CE1   . PHE I  5  311  ? 0.207   82.227  1.248   1.00 57.63  ? 311  PHE C CE1   1 
ATOM   8288  C  CE2   . PHE I  5  311  ? 2.501   82.637  2.013   1.00 58.16  ? 311  PHE C CE2   1 
ATOM   8289  C  CZ    . PHE I  5  311  ? 1.095   82.683  2.243   1.00 58.74  ? 311  PHE C CZ    1 
ATOM   8290  N  N     . ALA I  5  312  ? 4.557   80.515  -3.853  1.00 50.78  ? 312  ALA C N     1 
ATOM   8291  C  CA    . ALA I  5  312  ? 4.739   80.034  -5.196  1.00 48.59  ? 312  ALA C CA    1 
ATOM   8292  C  C     . ALA I  5  312  ? 5.965   79.155  -5.295  1.00 47.31  ? 312  ALA C C     1 
ATOM   8293  O  O     . ALA I  5  312  ? 5.875   78.019  -5.751  1.00 45.92  ? 312  ALA C O     1 
ATOM   8294  C  CB    . ALA I  5  312  ? 4.867   81.208  -6.125  1.00 48.23  ? 312  ALA C CB    1 
ATOM   8295  N  N     . LEU I  5  313  ? 7.111   79.677  -4.868  1.00 47.19  ? 313  LEU C N     1 
ATOM   8296  C  CA    . LEU I  5  313  ? 8.356   78.906  -4.911  1.00 47.90  ? 313  LEU C CA    1 
ATOM   8297  C  C     . LEU I  5  313  ? 8.253   77.654  -4.064  1.00 48.46  ? 313  LEU C C     1 
ATOM   8298  O  O     . LEU I  5  313  ? 8.935   76.662  -4.304  1.00 48.52  ? 313  LEU C O     1 
ATOM   8299  C  CB    . LEU I  5  313  ? 9.557   79.704  -4.379  1.00 47.23  ? 313  LEU C CB    1 
ATOM   8300  C  CG    . LEU I  5  313  ? 10.730  78.802  -3.897  1.00 45.28  ? 313  LEU C CG    1 
ATOM   8301  C  CD1   . LEU I  5  313  ? 11.313  78.067  -5.088  1.00 44.04  ? 313  LEU C CD1   1 
ATOM   8302  C  CD2   . LEU I  5  313  ? 11.791  79.611  -3.198  1.00 45.97  ? 313  LEU C CD2   1 
ATOM   8303  N  N     . THR I  5  314  ? 7.410   77.698  -3.057  1.00 48.61  ? 314  THR C N     1 
ATOM   8304  C  CA    . THR I  5  314  ? 7.298   76.547  -2.207  1.00 50.21  ? 314  THR C CA    1 
ATOM   8305  C  C     . THR I  5  314  ? 6.352   75.491  -2.779  1.00 51.54  ? 314  THR C C     1 
ATOM   8306  O  O     . THR I  5  314  ? 6.566   74.303  -2.545  1.00 51.70  ? 314  THR C O     1 
ATOM   8307  C  CB    . THR I  5  314  ? 6.773   76.929  -0.802  1.00 50.41  ? 314  THR C CB    1 
ATOM   8308  O  OG1   . THR I  5  314  ? 5.583   77.721  -0.939  1.00 51.29  ? 314  THR C OG1   1 
ATOM   8309  C  CG2   . THR I  5  314  ? 7.788   77.717  -0.023  1.00 51.24  ? 314  THR C CG2   1 
ATOM   8310  N  N     . ALA I  5  315  ? 5.340   75.910  -3.542  1.00 53.70  ? 315  ALA C N     1 
ATOM   8311  C  CA    . ALA I  5  315  ? 4.260   75.013  -4.008  1.00 55.50  ? 315  ALA C CA    1 
ATOM   8312  C  C     . ALA I  5  315  ? 4.537   74.312  -5.331  1.00 57.88  ? 315  ALA C C     1 
ATOM   8313  O  O     . ALA I  5  315  ? 4.109   73.170  -5.504  1.00 58.13  ? 315  ALA C O     1 
ATOM   8314  C  CB    . ALA I  5  315  ? 2.970   75.792  -4.124  1.00 52.90  ? 315  ALA C CB    1 
ATOM   8315  N  N     . GLY I  5  316  ? 5.206   74.932  -6.282  1.00 60.99  ? 316  GLY C N     1 
ATOM   8316  C  CA    . GLY I  5  316  ? 5.399   74.195  -7.514  1.00 65.05  ? 316  GLY C CA    1 
ATOM   8317  C  C     . GLY I  5  316  ? 6.222   74.936  -8.520  1.00 67.91  ? 316  GLY C C     1 
ATOM   8318  O  O     . GLY I  5  316  ? 7.207   75.579  -8.160  1.00 68.17  ? 316  GLY C O     1 
ATOM   8319  N  N     . VAL I  5  317  ? 5.822   74.863  -9.786  1.00 70.62  ? 317  VAL C N     1 
ATOM   8320  C  CA    . VAL I  5  317  ? 6.598   75.540  -10.801 1.00 72.07  ? 317  VAL C CA    1 
ATOM   8321  C  C     . VAL I  5  317  ? 5.849   76.734  -11.430 1.00 72.65  ? 317  VAL C C     1 
ATOM   8322  O  O     . VAL I  5  317  ? 5.330   76.624  -12.551 1.00 72.75  ? 317  VAL C O     1 
ATOM   8323  C  CB    . VAL I  5  317  ? 7.048   74.531  -11.944 1.00 73.24  ? 317  VAL C CB    1 
ATOM   8324  C  CG1   . VAL I  5  317  ? 8.116   75.168  -12.843 1.00 73.03  ? 317  VAL C CG1   1 
ATOM   8325  C  CG2   . VAL I  5  317  ? 7.636   73.254  -11.317 1.00 72.19  ? 317  VAL C CG2   1 
ATOM   8326  N  N     . PRO I  5  318  ? 5.734   77.878  -10.704 1.00 72.84  ? 318  PRO C N     1 
ATOM   8327  C  CA    . PRO I  5  318  ? 5.054   78.954  -11.444 1.00 73.22  ? 318  PRO C CA    1 
ATOM   8328  C  C     . PRO I  5  318  ? 5.989   79.371  -12.586 1.00 73.12  ? 318  PRO C C     1 
ATOM   8329  O  O     . PRO I  5  318  ? 5.643   79.883  -13.655 1.00 72.06  ? 318  PRO C O     1 
ATOM   8330  C  CB    . PRO I  5  318  ? 4.872   80.048  -10.392 1.00 73.03  ? 318  PRO C CB    1 
ATOM   8331  C  CG    . PRO I  5  318  ? 4.889   79.289  -9.080  1.00 72.45  ? 318  PRO C CG    1 
ATOM   8332  C  CD    . PRO I  5  318  ? 5.977   78.274  -9.306  1.00 72.72  ? 318  PRO C CD    1 
ATOM   8333  N  N     . GLY I  5  319  ? 7.219   79.038  -12.208 1.00 72.37  ? 319  GLY C N     1 
ATOM   8334  C  CA    . GLY I  5  319  ? 8.496   79.136  -12.880 1.00 72.48  ? 319  GLY C CA    1 
ATOM   8335  C  C     . GLY I  5  319  ? 9.441   78.494  -11.874 1.00 72.46  ? 319  GLY C C     1 
ATOM   8336  O  O     . GLY I  5  319  ? 8.955   78.224  -10.778 1.00 73.05  ? 319  GLY C O     1 
ATOM   8337  N  N     . HIS I  5  320  ? 10.711  78.211  -12.144 1.00 71.24  ? 320  HIS C N     1 
ATOM   8338  C  CA    . HIS I  5  320  ? 11.533  77.641  -11.058 1.00 70.70  ? 320  HIS C CA    1 
ATOM   8339  C  C     . HIS I  5  320  ? 12.339  78.753  -10.374 1.00 68.73  ? 320  HIS C C     1 
ATOM   8340  O  O     . HIS I  5  320  ? 13.420  79.134  -10.822 1.00 68.38  ? 320  HIS C O     1 
ATOM   8341  C  CB    . HIS I  5  320  ? 12.454  76.528  -11.602 1.00 72.65  ? 320  HIS C CB    1 
ATOM   8342  C  CG    . HIS I  5  320  ? 11.840  75.147  -11.556 1.00 74.40  ? 320  HIS C CG    1 
ATOM   8343  N  ND1   . HIS I  5  320  ? 11.283  74.610  -10.410 1.00 74.58  ? 320  HIS C ND1   1 
ATOM   8344  C  CD2   . HIS I  5  320  ? 11.714  74.192  -12.512 1.00 74.66  ? 320  HIS C CD2   1 
ATOM   8345  C  CE1   . HIS I  5  320  ? 10.844  73.389  -10.666 1.00 74.39  ? 320  HIS C CE1   1 
ATOM   8346  N  NE2   . HIS I  5  320  ? 11.093  73.111  -11.932 1.00 74.44  ? 320  HIS C NE2   1 
ATOM   8347  N  N     . GLU I  5  321  ? 11.768  79.253  -9.272  1.00 65.61  ? 321  GLU C N     1 
ATOM   8348  C  CA    . GLU I  5  321  ? 12.260  80.416  -8.520  1.00 62.51  ? 321  GLU C CA    1 
ATOM   8349  C  C     . GLU I  5  321  ? 13.420  80.110  -7.576  1.00 62.16  ? 321  GLU C C     1 
ATOM   8350  O  O     . GLU I  5  321  ? 13.305  80.165  -6.347  1.00 61.97  ? 321  GLU C O     1 
ATOM   8351  C  CB    . GLU I  5  321  ? 11.093  81.042  -7.747  1.00 60.61  ? 321  GLU C CB    1 
ATOM   8352  C  CG    . GLU I  5  321  ? 9.735   80.941  -8.474  1.00 57.12  ? 321  GLU C CG    1 
ATOM   8353  C  CD    . GLU I  5  321  ? 9.783   81.208  -9.993  1.00 54.95  ? 321  GLU C CD    1 
ATOM   8354  O  OE1   . GLU I  5  321  ? 8.743   80.998  -10.629 1.00 54.33  ? 321  GLU C OE1   1 
ATOM   8355  O  OE2   . GLU I  5  321  ? 10.814  81.617  -10.567 1.00 53.30  ? 321  GLU C OE2   1 
ATOM   8356  N  N     . VAL I  5  322  ? 14.550  79.803  -8.178  1.00 60.90  ? 322  VAL C N     1 
ATOM   8357  C  CA    . VAL I  5  322  ? 15.788  79.602  -7.466  1.00 59.33  ? 322  VAL C CA    1 
ATOM   8358  C  C     . VAL I  5  322  ? 16.837  80.519  -8.069  1.00 59.37  ? 322  VAL C C     1 
ATOM   8359  O  O     . VAL I  5  322  ? 17.159  80.398  -9.252  1.00 59.34  ? 322  VAL C O     1 
ATOM   8360  C  CB    . VAL I  5  322  ? 16.227  78.122  -7.543  1.00 58.24  ? 322  VAL C CB    1 
ATOM   8361  C  CG1   . VAL I  5  322  ? 15.999  77.471  -6.201  1.00 57.65  ? 322  VAL C CG1   1 
ATOM   8362  C  CG2   . VAL I  5  322  ? 15.407  77.368  -8.612  1.00 55.72  ? 322  VAL C CG2   1 
ATOM   8363  N  N     . ASP I  5  323  ? 17.360  81.452  -7.291  1.00 58.91  ? 323  ASP C N     1 
ATOM   8364  C  CA    . ASP I  5  323  ? 18.274  82.410  -7.886  1.00 59.13  ? 323  ASP C CA    1 
ATOM   8365  C  C     . ASP I  5  323  ? 19.726  82.132  -7.570  1.00 58.94  ? 323  ASP C C     1 
ATOM   8366  O  O     . ASP I  5  323  ? 20.145  82.107  -6.405  1.00 59.85  ? 323  ASP C O     1 
ATOM   8367  C  CB    . ASP I  5  323  ? 17.889  83.821  -7.451  1.00 59.01  ? 323  ASP C CB    1 
ATOM   8368  C  CG    . ASP I  5  323  ? 16.826  84.410  -8.357  1.00 59.69  ? 323  ASP C CG    1 
ATOM   8369  O  OD1   . ASP I  5  323  ? 17.198  84.837  -9.474  1.00 60.42  ? 323  ASP C OD1   1 
ATOM   8370  O  OD2   . ASP I  5  323  ? 15.632  84.432  -7.972  1.00 58.86  ? 323  ASP C OD2   1 
ATOM   8371  N  N     . ASP I  5  324  ? 20.486  81.910  -8.643  1.00 56.93  ? 324  ASP C N     1 
ATOM   8372  C  CA    . ASP I  5  324  ? 21.916  81.744  -8.531  1.00 54.83  ? 324  ASP C CA    1 
ATOM   8373  C  C     . ASP I  5  324  ? 22.536  83.120  -8.277  1.00 53.63  ? 324  ASP C C     1 
ATOM   8374  O  O     . ASP I  5  324  ? 22.602  83.942  -9.190  1.00 53.15  ? 324  ASP C O     1 
ATOM   8375  C  CB    . ASP I  5  324  ? 22.450  81.129  -9.833  1.00 54.34  ? 324  ASP C CB    1 
ATOM   8376  C  CG    . ASP I  5  324  ? 23.429  79.986  -9.601  1.00 54.22  ? 324  ASP C CG    1 
ATOM   8377  O  OD1   . ASP I  5  324  ? 24.462  80.221  -8.954  1.00 54.39  ? 324  ASP C OD1   1 
ATOM   8378  O  OD2   . ASP I  5  324  ? 23.177  78.851  -10.064 1.00 53.50  ? 324  ASP C OD2   1 
ATOM   8379  N  N     . ILE I  5  325  ? 22.953  83.373  -7.036  1.00 51.75  ? 325  ILE C N     1 
ATOM   8380  C  CA    . ILE I  5  325  ? 23.493  84.673  -6.620  1.00 50.05  ? 325  ILE C CA    1 
ATOM   8381  C  C     . ILE I  5  325  ? 24.473  85.226  -7.623  1.00 47.86  ? 325  ILE C C     1 
ATOM   8382  O  O     . ILE I  5  325  ? 24.299  86.330  -8.132  1.00 47.34  ? 325  ILE C O     1 
ATOM   8383  C  CB    . ILE I  5  325  ? 24.254  84.608  -5.247  1.00 50.90  ? 325  ILE C CB    1 
ATOM   8384  C  CG1   . ILE I  5  325  ? 23.303  84.181  -4.114  1.00 51.94  ? 325  ILE C CG1   1 
ATOM   8385  C  CG2   . ILE I  5  325  ? 24.816  85.998  -4.903  1.00 51.58  ? 325  ILE C CG2   1 
ATOM   8386  C  CD1   . ILE I  5  325  ? 23.984  83.971  -2.740  1.00 49.92  ? 325  ILE C CD1   1 
ATOM   8387  N  N     . ASP I  5  326  ? 25.500  84.436  -7.893  1.00 45.68  ? 326  ASP C N     1 
ATOM   8388  C  CA    . ASP I  5  326  ? 26.585  84.826  -8.767  1.00 43.97  ? 326  ASP C CA    1 
ATOM   8389  C  C     . ASP I  5  326  ? 26.141  85.079  -10.187 1.00 44.02  ? 326  ASP C C     1 
ATOM   8390  O  O     . ASP I  5  326  ? 26.988  85.357  -11.035 1.00 44.13  ? 326  ASP C O     1 
ATOM   8391  C  CB    . ASP I  5  326  ? 27.670  83.766  -8.729  1.00 44.32  ? 326  ASP C CB    1 
ATOM   8392  C  CG    . ASP I  5  326  ? 28.335  83.698  -7.375  1.00 44.33  ? 326  ASP C CG    1 
ATOM   8393  O  OD1   . ASP I  5  326  ? 28.871  84.727  -6.924  1.00 43.57  ? 326  ASP C OD1   1 
ATOM   8394  O  OD2   . ASP I  5  326  ? 28.318  82.624  -6.754  1.00 45.04  ? 326  ASP C OD2   1 
ATOM   8395  N  N     . HIS I  5  327  ? 24.846  84.979  -10.479 1.00 43.94  ? 327  HIS C N     1 
ATOM   8396  C  CA    . HIS I  5  327  ? 24.400  85.334  -11.830 1.00 44.04  ? 327  HIS C CA    1 
ATOM   8397  C  C     . HIS I  5  327  ? 24.566  86.840  -12.017 1.00 42.59  ? 327  HIS C C     1 
ATOM   8398  O  O     . HIS I  5  327  ? 24.149  87.603  -11.148 1.00 41.68  ? 327  HIS C O     1 
ATOM   8399  C  CB    . HIS I  5  327  ? 22.921  84.927  -12.030 1.00 44.02  ? 327  HIS C CB    1 
ATOM   8400  C  CG    . HIS I  5  327  ? 22.488  84.814  -13.466 1.00 44.07  ? 327  HIS C CG    1 
ATOM   8401  N  ND1   . HIS I  5  327  ? 22.686  85.819  -14.393 1.00 44.13  ? 327  HIS C ND1   1 
ATOM   8402  C  CD2   . HIS I  5  327  ? 21.856  83.814  -14.128 1.00 43.26  ? 327  HIS C CD2   1 
ATOM   8403  C  CE1   . HIS I  5  327  ? 22.195  85.440  -15.561 1.00 43.58  ? 327  HIS C CE1   1 
ATOM   8404  N  NE2   . HIS I  5  327  ? 21.687  84.228  -15.427 1.00 43.10  ? 327  HIS C NE2   1 
ATOM   8405  N  N     . LEU I  5  328  ? 25.160  87.275  -13.124 1.00 42.21  ? 328  LEU C N     1 
ATOM   8406  C  CA    . LEU I  5  328  ? 25.428  88.702  -13.292 1.00 43.44  ? 328  LEU C CA    1 
ATOM   8407  C  C     . LEU I  5  328  ? 24.147  89.543  -13.357 1.00 43.95  ? 328  LEU C C     1 
ATOM   8408  O  O     . LEU I  5  328  ? 24.205  90.770  -13.182 1.00 44.23  ? 328  LEU C O     1 
ATOM   8409  C  CB    . LEU I  5  328  ? 26.315  88.918  -14.527 1.00 42.87  ? 328  LEU C CB    1 
ATOM   8410  C  CG    . LEU I  5  328  ? 27.782  88.608  -14.208 1.00 41.88  ? 328  LEU C CG    1 
ATOM   8411  C  CD1   . LEU I  5  328  ? 27.931  87.108  -13.937 1.00 41.97  ? 328  LEU C CD1   1 
ATOM   8412  C  CD2   . LEU I  5  328  ? 28.669  89.048  -15.349 1.00 40.59  ? 328  LEU C CD2   1 
ATOM   8413  N  N     . GLY I  5  329  ? 23.000  88.913  -13.597 1.00 44.23  ? 329  GLY C N     1 
ATOM   8414  C  CA    . GLY I  5  329  ? 21.759  89.668  -13.592 1.00 42.28  ? 329  GLY C CA    1 
ATOM   8415  C  C     . GLY I  5  329  ? 21.466  90.137  -12.177 1.00 41.93  ? 329  GLY C C     1 
ATOM   8416  O  O     . GLY I  5  329  ? 20.640  91.008  -11.917 1.00 42.09  ? 329  GLY C O     1 
ATOM   8417  N  N     . ASN I  5  330  ? 22.156  89.514  -11.235 1.00 42.14  ? 330  ASN C N     1 
ATOM   8418  C  CA    . ASN I  5  330  ? 22.050  89.870  -9.831  1.00 40.36  ? 330  ASN C CA    1 
ATOM   8419  C  C     . ASN I  5  330  ? 23.236  90.744  -9.438  1.00 37.74  ? 330  ASN C C     1 
ATOM   8420  O  O     . ASN I  5  330  ? 23.243  91.376  -8.389  1.00 37.64  ? 330  ASN C O     1 
ATOM   8421  C  CB    . ASN I  5  330  ? 22.042  88.602  -8.932  1.00 42.54  ? 330  ASN C CB    1 
ATOM   8422  C  CG    . ASN I  5  330  ? 20.990  87.574  -9.349  1.00 44.97  ? 330  ASN C CG    1 
ATOM   8423  O  OD1   . ASN I  5  330  ? 19.961  87.929  -9.955  1.00 46.49  ? 330  ASN C OD1   1 
ATOM   8424  N  ND2   . ASN I  5  330  ? 21.237  86.291  -9.021  1.00 43.58  ? 330  ASN C ND2   1 
ATOM   8425  N  N     . ARG I  5  331  ? 24.239  90.771  -10.318 1.00 34.01  ? 331  ARG C N     1 
ATOM   8426  C  CA    . ARG I  5  331  ? 25.457  91.525  -10.067 1.00 29.38  ? 331  ARG C CA    1 
ATOM   8427  C  C     . ARG I  5  331  ? 25.694  92.594  -11.124 1.00 27.86  ? 331  ARG C C     1 
ATOM   8428  O  O     . ARG I  5  331  ? 26.079  92.323  -12.252 1.00 27.77  ? 331  ARG C O     1 
ATOM   8429  C  CB    . ARG I  5  331  ? 26.638  90.546  -9.972  1.00 25.78  ? 331  ARG C CB    1 
ATOM   8430  C  CG    . ARG I  5  331  ? 26.535  89.726  -8.687  1.00 21.60  ? 331  ARG C CG    1 
ATOM   8431  C  CD    . ARG I  5  331  ? 27.306  88.468  -8.759  1.00 18.43  ? 331  ARG C CD    1 
ATOM   8432  N  NE    . ARG I  5  331  ? 28.717  88.743  -8.905  1.00 15.14  ? 331  ARG C NE    1 
ATOM   8433  C  CZ    . ARG I  5  331  ? 29.492  88.104  -9.756  1.00 12.26  ? 331  ARG C CZ    1 
ATOM   8434  N  NH1   . ARG I  5  331  ? 28.984  87.164  -10.530 1.00 11.62  ? 331  ARG C NH1   1 
ATOM   8435  N  NH2   . ARG I  5  331  ? 30.768  88.407  -9.827  1.00 12.53  ? 331  ARG C NH2   1 
ATOM   8436  N  N     . ARG I  5  332  ? 25.443  93.824  -10.703 1.00 25.33  ? 332  ARG C N     1 
ATOM   8437  C  CA    . ARG I  5  332  ? 25.620  94.994  -11.509 1.00 23.96  ? 332  ARG C CA    1 
ATOM   8438  C  C     . ARG I  5  332  ? 26.954  95.642  -11.208 1.00 23.38  ? 332  ARG C C     1 
ATOM   8439  O  O     . ARG I  5  332  ? 27.470  95.460  -10.121 1.00 22.85  ? 332  ARG C O     1 
ATOM   8440  C  CB    . ARG I  5  332  ? 24.470  95.978  -11.246 1.00 26.04  ? 332  ARG C CB    1 
ATOM   8441  C  CG    . ARG I  5  332  ? 24.180  96.320  -9.784  1.00 28.66  ? 332  ARG C CG    1 
ATOM   8442  C  CD    . ARG I  5  332  ? 23.057  97.375  -9.628  1.00 30.58  ? 332  ARG C CD    1 
ATOM   8443  N  NE    . ARG I  5  332  ? 23.374  98.601  -10.354 1.00 33.62  ? 332  ARG C NE    1 
ATOM   8444  C  CZ    . ARG I  5  332  ? 23.668  99.773  -9.791  1.00 34.68  ? 332  ARG C CZ    1 
ATOM   8445  N  NH1   . ARG I  5  332  ? 23.678  99.908  -8.472  1.00 33.20  ? 332  ARG C NH1   1 
ATOM   8446  N  NH2   . ARG I  5  332  ? 23.972  100.813 -10.563 1.00 35.38  ? 332  ARG C NH2   1 
ATOM   8447  N  N     . ILE I  5  333  ? 27.516  96.386  -12.160 1.00 21.95  ? 333  ILE C N     1 
ATOM   8448  C  CA    . ILE I  5  333  ? 28.809  97.051  -11.971 1.00 22.81  ? 333  ILE C CA    1 
ATOM   8449  C  C     . ILE I  5  333  ? 28.635  98.541  -11.783 1.00 22.89  ? 333  ILE C C     1 
ATOM   8450  O  O     . ILE I  5  333  ? 27.945  99.231  -12.524 1.00 22.50  ? 333  ILE C O     1 
ATOM   8451  C  CB    . ILE I  5  333  ? 29.816  96.839  -13.177 1.00 22.28  ? 333  ILE C CB    1 
ATOM   8452  C  CG1   . ILE I  5  333  ? 30.457  95.434  -13.149 1.00 22.49  ? 333  ILE C CG1   1 
ATOM   8453  C  CG2   . ILE I  5  333  ? 30.988  97.819  -13.048 1.00 20.53  ? 333  ILE C CG2   1 
ATOM   8454  C  CD1   . ILE I  5  333  ? 29.504  94.236  -13.136 1.00 21.01  ? 333  ILE C CD1   1 
ATOM   8455  N  N     . ARG I  5  334  ? 29.313  99.030  -10.773 1.00 20.97  ? 334  ARG C N     1 
ATOM   8456  C  CA    . ARG I  5  334  ? 29.219  100.413 -10.422 1.00 20.38  ? 334  ARG C CA    1 
ATOM   8457  C  C     . ARG I  5  334  ? 30.386  101.221 -10.972 1.00 22.46  ? 334  ARG C C     1 
ATOM   8458  O  O     . ARG I  5  334  ? 31.469  101.224 -10.413 1.00 23.24  ? 334  ARG C O     1 
ATOM   8459  C  CB    . ARG I  5  334  ? 29.165  100.469 -8.930  1.00 16.83  ? 334  ARG C CB    1 
ATOM   8460  C  CG    . ARG I  5  334  ? 28.343  99.323  -8.416  1.00 12.03  ? 334  ARG C CG    1 
ATOM   8461  C  CD    . ARG I  5  334  ? 28.305  99.418  -6.963  1.00 14.62  ? 334  ARG C CD    1 
ATOM   8462  N  NE    . ARG I  5  334  ? 27.690  100.663 -6.535  1.00 16.02  ? 334  ARG C NE    1 
ATOM   8463  C  CZ    . ARG I  5  334  ? 27.755  101.146 -5.296  1.00 16.23  ? 334  ARG C CZ    1 
ATOM   8464  N  NH1   . ARG I  5  334  ? 28.420  100.488 -4.353  1.00 16.51  ? 334  ARG C NH1   1 
ATOM   8465  N  NH2   . ARG I  5  334  ? 27.150  102.290 -4.995  1.00 18.23  ? 334  ARG C NH2   1 
ATOM   8466  N  N     . THR I  5  335  ? 30.169  101.908 -12.084 1.00 23.88  ? 335  THR C N     1 
ATOM   8467  C  CA    . THR I  5  335  ? 31.226  102.738 -12.641 1.00 24.19  ? 335  THR C CA    1 
ATOM   8468  C  C     . THR I  5  335  ? 31.496  103.908 -11.731 1.00 22.94  ? 335  THR C C     1 
ATOM   8469  O  O     . THR I  5  335  ? 30.689  104.194 -10.857 1.00 22.97  ? 335  THR C O     1 
ATOM   8470  C  CB    . THR I  5  335  ? 30.841  103.257 -14.013 1.00 25.43  ? 335  THR C CB    1 
ATOM   8471  O  OG1   . THR I  5  335  ? 29.510  103.790 -13.968 1.00 28.81  ? 335  THR C OG1   1 
ATOM   8472  C  CG2   . THR I  5  335  ? 30.926  102.154 -15.013 1.00 24.77  ? 335  THR C CG2   1 
ATOM   8473  N  N     . VAL I  5  336  ? 32.613  104.584 -11.939 1.00 22.98  ? 336  VAL C N     1 
ATOM   8474  C  CA    . VAL I  5  336  ? 33.037  105.692 -11.078 1.00 23.81  ? 336  VAL C CA    1 
ATOM   8475  C  C     . VAL I  5  336  ? 31.912  106.687 -10.751 1.00 26.71  ? 336  VAL C C     1 
ATOM   8476  O  O     . VAL I  5  336  ? 31.690  106.986 -9.580  1.00 27.35  ? 336  VAL C O     1 
ATOM   8477  C  CB    . VAL I  5  336  ? 34.150  106.470 -11.697 1.00 21.57  ? 336  VAL C CB    1 
ATOM   8478  C  CG1   . VAL I  5  336  ? 34.605  107.571 -10.740 1.00 20.51  ? 336  VAL C CG1   1 
ATOM   8479  C  CG2   . VAL I  5  336  ? 35.276  105.549 -11.985 1.00 21.37  ? 336  VAL C CG2   1 
ATOM   8480  N  N     . GLY I  5  337  ? 31.227  107.216 -11.760 1.00 29.08  ? 337  GLY C N     1 
ATOM   8481  C  CA    . GLY I  5  337  ? 30.165  108.197 -11.532 1.00 30.25  ? 337  GLY C CA    1 
ATOM   8482  C  C     . GLY I  5  337  ? 29.272  107.839 -10.364 1.00 31.06  ? 337  GLY C C     1 
ATOM   8483  O  O     . GLY I  5  337  ? 29.034  108.651 -9.460  1.00 29.65  ? 337  GLY C O     1 
ATOM   8484  N  N     . GLU I  5  338  ? 28.794  106.600 -10.392 1.00 31.88  ? 338  GLU C N     1 
ATOM   8485  C  CA    . GLU I  5  338  ? 27.923  106.099 -9.355  1.00 33.14  ? 338  GLU C CA    1 
ATOM   8486  C  C     . GLU I  5  338  ? 28.601  106.167 -7.998  1.00 34.59  ? 338  GLU C C     1 
ATOM   8487  O  O     . GLU I  5  338  ? 28.007  106.606 -7.023  1.00 37.46  ? 338  GLU C O     1 
ATOM   8488  C  CB    . GLU I  5  338  ? 27.523  104.656 -9.684  1.00 31.40  ? 338  GLU C CB    1 
ATOM   8489  C  CG    . GLU I  5  338  ? 26.325  104.150 -8.918  1.00 27.84  ? 338  GLU C CG    1 
ATOM   8490  C  CD    . GLU I  5  338  ? 25.831  102.792 -9.398  1.00 25.84  ? 338  GLU C CD    1 
ATOM   8491  O  OE1   . GLU I  5  338  ? 24.966  102.233 -8.707  1.00 25.62  ? 338  GLU C OE1   1 
ATOM   8492  O  OE2   . GLU I  5  338  ? 26.285  102.284 -10.443 1.00 22.88  ? 338  GLU C OE2   1 
ATOM   8493  N  N     . LEU I  5  339  ? 29.855  105.754 -7.927  1.00 35.69  ? 339  LEU C N     1 
ATOM   8494  C  CA    . LEU I  5  339  ? 30.558  105.759 -6.643  1.00 36.76  ? 339  LEU C CA    1 
ATOM   8495  C  C     . LEU I  5  339  ? 30.815  107.181 -6.131  1.00 36.82  ? 339  LEU C C     1 
ATOM   8496  O  O     . LEU I  5  339  ? 30.957  107.373 -4.927  1.00 34.78  ? 339  LEU C O     1 
ATOM   8497  C  CB    . LEU I  5  339  ? 31.873  104.986 -6.771  1.00 35.73  ? 339  LEU C CB    1 
ATOM   8498  C  CG    . LEU I  5  339  ? 31.527  103.523 -7.011  1.00 32.85  ? 339  LEU C CG    1 
ATOM   8499  C  CD1   . LEU I  5  339  ? 32.064  103.127 -8.348  1.00 33.96  ? 339  LEU C CD1   1 
ATOM   8500  C  CD2   . LEU I  5  339  ? 32.083  102.666 -5.932  1.00 31.53  ? 339  LEU C CD2   1 
ATOM   8501  N  N     . MET I  5  340  ? 30.878  108.166 -7.026  1.00 38.18  ? 340  MET C N     1 
ATOM   8502  C  CA    . MET I  5  340  ? 31.098  109.554 -6.607  1.00 38.41  ? 340  MET C CA    1 
ATOM   8503  C  C     . MET I  5  340  ? 29.774  110.223 -6.274  1.00 38.73  ? 340  MET C C     1 
ATOM   8504  O  O     . MET I  5  340  ? 29.660  110.944 -5.277  1.00 39.84  ? 340  MET C O     1 
ATOM   8505  C  CB    . MET I  5  340  ? 31.803  110.369 -7.717  1.00 38.51  ? 340  MET C CB    1 
ATOM   8506  C  CG    . MET I  5  340  ? 31.825  111.927 -7.529  1.00 38.38  ? 340  MET C CG    1 
ATOM   8507  S  SD    . MET I  5  340  ? 30.319  112.952 -7.918  1.00 32.83  ? 340  MET C SD    1 
ATOM   8508  C  CE    . MET I  5  340  ? 30.812  114.532 -7.142  1.00 38.03  ? 340  MET C CE    1 
ATOM   8509  N  N     . THR I  5  341  ? 28.768  109.989 -7.108  1.00 37.47  ? 341  THR C N     1 
ATOM   8510  C  CA    . THR I  5  341  ? 27.498  110.608 -6.855  1.00 35.00  ? 341  THR C CA    1 
ATOM   8511  C  C     . THR I  5  341  ? 26.927  110.176 -5.500  1.00 36.46  ? 341  THR C C     1 
ATOM   8512  O  O     . THR I  5  341  ? 26.252  110.972 -4.848  1.00 37.38  ? 341  THR C O     1 
ATOM   8513  C  CB    . THR I  5  341  ? 26.527  110.271 -7.940  1.00 32.46  ? 341  THR C CB    1 
ATOM   8514  O  OG1   . THR I  5  341  ? 25.307  110.958 -7.673  1.00 31.37  ? 341  THR C OG1   1 
ATOM   8515  C  CG2   . THR I  5  341  ? 26.283  108.806 -8.002  1.00 32.82  ? 341  THR C CG2   1 
ATOM   8516  N  N     . ASP I  5  342  ? 27.205  108.934 -5.074  1.00 36.93  ? 342  ASP C N     1 
ATOM   8517  C  CA    . ASP I  5  342  ? 26.699  108.425 -3.794  1.00 38.41  ? 342  ASP C CA    1 
ATOM   8518  C  C     . ASP I  5  342  ? 27.333  109.167 -2.618  1.00 40.18  ? 342  ASP C C     1 
ATOM   8519  O  O     . ASP I  5  342  ? 26.626  109.613 -1.722  1.00 39.62  ? 342  ASP C O     1 
ATOM   8520  C  CB    . ASP I  5  342  ? 26.980  106.918 -3.670  1.00 37.62  ? 342  ASP C CB    1 
ATOM   8521  C  CG    . ASP I  5  342  ? 25.997  106.190 -2.753  1.00 38.31  ? 342  ASP C CG    1 
ATOM   8522  O  OD1   . ASP I  5  342  ? 25.652  106.711 -1.675  1.00 38.95  ? 342  ASP C OD1   1 
ATOM   8523  O  OD2   . ASP I  5  342  ? 25.574  105.074 -3.115  1.00 38.24  ? 342  ASP C OD2   1 
ATOM   8524  N  N     . GLN I  5  343  ? 28.660  109.298 -2.613  1.00 42.24  ? 343  GLN C N     1 
ATOM   8525  C  CA    . GLN I  5  343  ? 29.342  110.027 -1.540  1.00 44.78  ? 343  GLN C CA    1 
ATOM   8526  C  C     . GLN I  5  343  ? 28.947  111.495 -1.577  1.00 47.56  ? 343  GLN C C     1 
ATOM   8527  O  O     . GLN I  5  343  ? 28.998  112.213 -0.563  1.00 47.81  ? 343  GLN C O     1 
ATOM   8528  C  CB    . GLN I  5  343  ? 30.859  109.904 -1.699  1.00 43.72  ? 343  GLN C CB    1 
ATOM   8529  C  CG    . GLN I  5  343  ? 31.582  109.229 -0.563  1.00 42.98  ? 343  GLN C CG    1 
ATOM   8530  C  CD    . GLN I  5  343  ? 30.929  107.923 -0.102  1.00 43.29  ? 343  GLN C CD    1 
ATOM   8531  O  OE1   . GLN I  5  343  ? 29.868  107.923 0.515   1.00 43.05  ? 343  GLN C OE1   1 
ATOM   8532  N  NE2   . GLN I  5  343  ? 31.576  106.800 -0.408  1.00 43.34  ? 343  GLN C NE2   1 
ATOM   8533  N  N     . PHE I  5  344  ? 28.556  111.923 -2.782  1.00 48.95  ? 344  PHE C N     1 
ATOM   8534  C  CA    . PHE I  5  344  ? 28.092  113.277 -3.017  1.00 51.28  ? 344  PHE C CA    1 
ATOM   8535  C  C     . PHE I  5  344  ? 26.750  113.490 -2.356  1.00 52.18  ? 344  PHE C C     1 
ATOM   8536  O  O     . PHE I  5  344  ? 26.485  114.535 -1.769  1.00 51.71  ? 344  PHE C O     1 
ATOM   8537  C  CB    . PHE I  5  344  ? 27.963  113.563 -4.517  1.00 51.54  ? 344  PHE C CB    1 
ATOM   8538  C  CG    . PHE I  5  344  ? 27.277  114.857 -4.805  1.00 51.74  ? 344  PHE C CG    1 
ATOM   8539  C  CD1   . PHE I  5  344  ? 25.889  114.900 -4.999  1.00 51.50  ? 344  PHE C CD1   1 
ATOM   8540  C  CD2   . PHE I  5  344  ? 28.018  116.062 -4.838  1.00 52.49  ? 344  PHE C CD2   1 
ATOM   8541  C  CE1   . PHE I  5  344  ? 25.228  116.131 -5.221  1.00 53.39  ? 344  PHE C CE1   1 
ATOM   8542  C  CE2   . PHE I  5  344  ? 27.377  117.320 -5.062  1.00 52.14  ? 344  PHE C CE2   1 
ATOM   8543  C  CZ    . PHE I  5  344  ? 25.978  117.355 -5.254  1.00 52.68  ? 344  PHE C CZ    1 
ATOM   8544  N  N     . ARG I  5  345  ? 25.890  112.491 -2.470  1.00 54.58  ? 345  ARG C N     1 
ATOM   8545  C  CA    . ARG I  5  345  ? 24.622  112.604 -1.801  1.00 57.04  ? 345  ARG C CA    1 
ATOM   8546  C  C     . ARG I  5  345  ? 24.783  112.294 -0.319  1.00 57.45  ? 345  ARG C C     1 
ATOM   8547  O  O     . ARG I  5  345  ? 23.974  112.741 0.500   1.00 58.73  ? 345  ARG C O     1 
ATOM   8548  C  CB    . ARG I  5  345  ? 23.566  111.683 -2.440  1.00 57.84  ? 345  ARG C CB    1 
ATOM   8549  C  CG    . ARG I  5  345  ? 23.912  110.217 -2.556  1.00 58.02  ? 345  ARG C CG    1 
ATOM   8550  C  CD    . ARG I  5  345  ? 22.700  109.429 -3.028  1.00 58.58  ? 345  ARG C CD    1 
ATOM   8551  N  NE    . ARG I  5  345  ? 23.065  108.201 -3.730  1.00 59.71  ? 345  ARG C NE    1 
ATOM   8552  C  CZ    . ARG I  5  345  ? 23.657  108.171 -4.923  1.00 60.20  ? 345  ARG C CZ    1 
ATOM   8553  N  NH1   . ARG I  5  345  ? 23.952  109.303 -5.546  1.00 61.47  ? 345  ARG C NH1   1 
ATOM   8554  N  NH2   . ARG I  5  345  ? 23.957  107.012 -5.500  1.00 59.71  ? 345  ARG C NH2   1 
ATOM   8555  N  N     . VAL I  5  346  ? 25.817  111.526 0.041   1.00 58.07  ? 346  VAL C N     1 
ATOM   8556  C  CA    . VAL I  5  346  ? 26.048  111.309 1.466   1.00 58.20  ? 346  VAL C CA    1 
ATOM   8557  C  C     . VAL I  5  346  ? 26.372  112.640 2.106   1.00 57.77  ? 346  VAL C C     1 
ATOM   8558  O  O     . VAL I  5  346  ? 25.840  112.992 3.157   1.00 58.30  ? 346  VAL C O     1 
ATOM   8559  C  CB    . VAL I  5  346  ? 27.256  110.344 1.789   1.00 58.43  ? 346  VAL C CB    1 
ATOM   8560  C  CG1   . VAL I  5  346  ? 27.259  110.011 3.276   1.00 58.52  ? 346  VAL C CG1   1 
ATOM   8561  C  CG2   . VAL I  5  346  ? 27.141  109.059 1.034   1.00 59.91  ? 346  VAL C CG2   1 
ATOM   8562  N  N     . GLY I  5  347  ? 27.243  113.378 1.418   1.00 56.40  ? 347  GLY C N     1 
ATOM   8563  C  CA    . GLY I  5  347  ? 27.650  114.691 1.868   1.00 55.67  ? 347  GLY C CA    1 
ATOM   8564  C  C     . GLY I  5  347  ? 26.493  115.678 1.881   1.00 55.54  ? 347  GLY C C     1 
ATOM   8565  O  O     . GLY I  5  347  ? 26.408  116.507 2.789   1.00 55.27  ? 347  GLY C O     1 
ATOM   8566  N  N     . LEU I  5  348  ? 25.606  115.593 0.883   1.00 54.89  ? 348  LEU C N     1 
ATOM   8567  C  CA    . LEU I  5  348  ? 24.447  116.482 0.790   1.00 53.59  ? 348  LEU C CA    1 
ATOM   8568  C  C     . LEU I  5  348  ? 23.516  116.295 1.978   1.00 54.15  ? 348  LEU C C     1 
ATOM   8569  O  O     . LEU I  5  348  ? 22.967  117.263 2.507   1.00 54.47  ? 348  LEU C O     1 
ATOM   8570  C  CB    . LEU I  5  348  ? 23.681  116.214 -0.495  1.00 52.22  ? 348  LEU C CB    1 
ATOM   8571  C  CG    . LEU I  5  348  ? 23.722  117.339 -1.522  1.00 50.22  ? 348  LEU C CG    1 
ATOM   8572  C  CD1   . LEU I  5  348  ? 25.138  117.654 -1.904  1.00 49.20  ? 348  LEU C CD1   1 
ATOM   8573  C  CD2   . LEU I  5  348  ? 22.920  116.911 -2.733  1.00 51.29  ? 348  LEU C CD2   1 
ATOM   8574  N  N     . ALA I  5  349  ? 23.337  115.042 2.386   1.00 54.28  ? 349  ALA C N     1 
ATOM   8575  C  CA    . ALA I  5  349  ? 22.519  114.735 3.541   1.00 55.23  ? 349  ALA C CA    1 
ATOM   8576  C  C     . ALA I  5  349  ? 23.144  115.325 4.807   1.00 56.75  ? 349  ALA C C     1 
ATOM   8577  O  O     . ALA I  5  349  ? 22.433  115.859 5.660   1.00 56.53  ? 349  ALA C O     1 
ATOM   8578  C  CB    . ALA I  5  349  ? 22.381  113.232 3.680   1.00 54.22  ? 349  ALA C CB    1 
ATOM   8579  N  N     . ARG I  5  350  ? 24.476  115.220 4.914   1.00 59.12  ? 350  ARG C N     1 
ATOM   8580  C  CA    . ARG I  5  350  ? 25.254  115.760 6.049   1.00 61.13  ? 350  ARG C CA    1 
ATOM   8581  C  C     . ARG I  5  350  ? 25.090  117.278 6.151   1.00 62.82  ? 350  ARG C C     1 
ATOM   8582  O  O     . ARG I  5  350  ? 25.082  117.846 7.247   1.00 64.14  ? 350  ARG C O     1 
ATOM   8583  C  CB    . ARG I  5  350  ? 26.761  115.478 5.898   1.00 61.23  ? 350  ARG C CB    1 
ATOM   8584  C  CG    . ARG I  5  350  ? 27.191  114.031 5.663   1.00 61.93  ? 350  ARG C CG    1 
ATOM   8585  C  CD    . ARG I  5  350  ? 28.736  113.871 5.716   1.00 60.67  ? 350  ARG C CD    1 
ATOM   8586  N  NE    . ARG I  5  350  ? 29.200  112.513 5.394   1.00 59.69  ? 350  ARG C NE    1 
ATOM   8587  C  CZ    . ARG I  5  350  ? 28.795  111.392 6.000   1.00 58.92  ? 350  ARG C CZ    1 
ATOM   8588  N  NH1   . ARG I  5  350  ? 27.898  111.412 6.985   1.00 57.79  ? 350  ARG C NH1   1 
ATOM   8589  N  NH2   . ARG I  5  350  ? 29.297  110.228 5.612   1.00 59.44  ? 350  ARG C NH2   1 
ATOM   8590  N  N     . LEU I  5  351  ? 24.979  117.924 4.988   1.00 64.24  ? 351  LEU C N     1 
ATOM   8591  C  CA    . LEU I  5  351  ? 24.776  119.372 4.891   1.00 63.95  ? 351  LEU C CA    1 
ATOM   8592  C  C     . LEU I  5  351  ? 23.329  119.741 5.225   1.00 62.73  ? 351  LEU C C     1 
ATOM   8593  O  O     . LEU I  5  351  ? 23.068  120.642 6.028   1.00 61.31  ? 351  LEU C O     1 
ATOM   8594  C  CB    . LEU I  5  351  ? 25.093  119.852 3.474   1.00 64.58  ? 351  LEU C CB    1 
ATOM   8595  C  CG    . LEU I  5  351  ? 24.764  121.334 3.229   1.00 64.48  ? 351  LEU C CG    1 
ATOM   8596  C  CD1   . LEU I  5  351  ? 25.736  122.199 4.008   1.00 64.77  ? 351  LEU C CD1   1 
ATOM   8597  C  CD2   . LEU I  5  351  ? 24.846  121.651 1.750   1.00 64.65  ? 351  LEU C CD2   1 
ATOM   8598  N  N     . ALA I  5  352  ? 22.402  119.032 4.581   1.00 62.14  ? 352  ALA C N     1 
ATOM   8599  C  CA    . ALA I  5  352  ? 20.974  119.213 4.809   1.00 62.08  ? 352  ALA C CA    1 
ATOM   8600  C  C     . ALA I  5  352  ? 20.628  118.943 6.275   1.00 61.80  ? 352  ALA C C     1 
ATOM   8601  O  O     . ALA I  5  352  ? 19.647  119.453 6.819   1.00 61.50  ? 352  ALA C O     1 
ATOM   8602  C  CB    . ALA I  5  352  ? 20.173  118.268 3.893   1.00 59.54  ? 352  ALA C CB    1 
ATOM   8603  N  N     . ARG I  5  353  ? 21.452  118.123 6.909   1.00 61.40  ? 353  ARG C N     1 
ATOM   8604  C  CA    . ARG I  5  353  ? 21.265  117.808 8.312   1.00 61.44  ? 353  ARG C CA    1 
ATOM   8605  C  C     . ARG I  5  353  ? 21.469  119.055 9.169   1.00 62.42  ? 353  ARG C C     1 
ATOM   8606  O  O     . ARG I  5  353  ? 20.617  119.416 9.982   1.00 62.68  ? 353  ARG C O     1 
ATOM   8607  C  CB    . ARG I  5  353  ? 22.258  116.714 8.726   1.00 58.87  ? 353  ARG C CB    1 
ATOM   8608  C  CG    . ARG I  5  353  ? 21.600  115.400 9.103   1.00 55.55  ? 353  ARG C CG    1 
ATOM   8609  C  CD    . ARG I  5  353  ? 22.628  114.333 9.400   1.00 52.28  ? 353  ARG C CD    1 
ATOM   8610  N  NE    . ARG I  5  353  ? 23.325  113.893 8.198   1.00 48.70  ? 353  ARG C NE    1 
ATOM   8611  C  CZ    . ARG I  5  353  ? 24.095  112.808 8.148   1.00 47.67  ? 353  ARG C CZ    1 
ATOM   8612  N  NH1   . ARG I  5  353  ? 24.254  112.073 9.240   1.00 48.20  ? 353  ARG C NH1   1 
ATOM   8613  N  NH2   . ARG I  5  353  ? 24.699  112.447 7.018   1.00 44.28  ? 353  ARG C NH2   1 
ATOM   8614  N  N     . GLY I  5  354  ? 22.607  119.711 8.960   1.00 63.52  ? 354  GLY C N     1 
ATOM   8615  C  CA    . GLY I  5  354  ? 22.932  120.909 9.707   1.00 64.66  ? 354  GLY C CA    1 
ATOM   8616  C  C     . GLY I  5  354  ? 22.118  122.132 9.306   1.00 65.20  ? 354  GLY C C     1 
ATOM   8617  O  O     . GLY I  5  354  ? 21.881  123.004 10.143  1.00 65.01  ? 354  GLY C O     1 
ATOM   8618  N  N     . VAL I  5  355  ? 21.685  122.218 8.048   1.00 65.47  ? 355  VAL C N     1 
ATOM   8619  C  CA    . VAL I  5  355  ? 20.912  123.382 7.603   1.00 65.59  ? 355  VAL C CA    1 
ATOM   8620  C  C     . VAL I  5  355  ? 19.562  123.448 8.308   1.00 65.52  ? 355  VAL C C     1 
ATOM   8621  O  O     . VAL I  5  355  ? 19.058  124.535 8.624   1.00 64.20  ? 355  VAL C O     1 
ATOM   8622  C  CB    . VAL I  5  355  ? 20.669  123.365 6.053   1.00 65.71  ? 355  VAL C CB    1 
ATOM   8623  C  CG1   . VAL I  5  355  ? 19.841  122.186 5.650   1.00 64.14  ? 355  VAL C CG1   1 
ATOM   8624  C  CG2   . VAL I  5  355  ? 19.928  124.620 5.634   1.00 64.42  ? 355  VAL C CG2   1 
ATOM   8625  N  N     . ARG I  5  356  ? 18.986  122.275 8.545   1.00 65.59  ? 356  ARG C N     1 
ATOM   8626  C  CA    . ARG I  5  356  ? 17.703  122.183 9.216   1.00 65.78  ? 356  ARG C CA    1 
ATOM   8627  C  C     . ARG I  5  356  ? 17.775  122.813 10.593  1.00 65.36  ? 356  ARG C C     1 
ATOM   8628  O  O     . ARG I  5  356  ? 16.805  123.410 11.061  1.00 66.31  ? 356  ARG C O     1 
ATOM   8629  C  CB    . ARG I  5  356  ? 17.271  120.716 9.365   1.00 66.79  ? 356  ARG C CB    1 
ATOM   8630  C  CG    . ARG I  5  356  ? 17.011  119.948 8.056   1.00 66.07  ? 356  ARG C CG    1 
ATOM   8631  C  CD    . ARG I  5  356  ? 15.527  119.634 7.850   1.00 64.63  ? 356  ARG C CD    1 
ATOM   8632  N  NE    . ARG I  5  356  ? 15.286  118.878 6.622   1.00 62.89  ? 356  ARG C NE    1 
ATOM   8633  C  CZ    . ARG I  5  356  ? 14.088  118.453 6.231   1.00 62.29  ? 356  ARG C CZ    1 
ATOM   8634  N  NH1   . ARG I  5  356  ? 13.019  118.709 6.974   1.00 62.18  ? 356  ARG C NH1   1 
ATOM   8635  N  NH2   . ARG I  5  356  ? 13.957  117.775 5.097   1.00 61.63  ? 356  ARG C NH2   1 
ATOM   8636  N  N     . GLU I  5  357  ? 18.931  122.670 11.237  1.00 64.87  ? 357  GLU C N     1 
ATOM   8637  C  CA    . GLU I  5  357  ? 19.144  123.231 12.568  1.00 63.83  ? 357  GLU C CA    1 
ATOM   8638  C  C     . GLU I  5  357  ? 19.223  124.754 12.522  1.00 63.51  ? 357  GLU C C     1 
ATOM   8639  O  O     . GLU I  5  357  ? 18.822  125.418 13.481  1.00 63.14  ? 357  GLU C O     1 
ATOM   8640  C  CB    . GLU I  5  357  ? 20.439  122.694 13.193  1.00 62.84  ? 357  GLU C CB    1 
ATOM   8641  C  CG    . GLU I  5  357  ? 20.322  121.390 13.977  1.00 63.20  ? 357  GLU C CG    1 
ATOM   8642  C  CD    . GLU I  5  357  ? 19.392  121.483 15.194  1.00 63.32  ? 357  GLU C CD    1 
ATOM   8643  O  OE1   . GLU I  5  357  ? 18.174  121.263 15.021  1.00 62.86  ? 357  GLU C OE1   1 
ATOM   8644  O  OE2   . GLU I  5  357  ? 19.872  121.775 16.319  1.00 62.88  ? 357  GLU C OE2   1 
ATOM   8645  N  N     . ARG I  5  358  ? 19.729  125.306 11.418  1.00 62.73  ? 358  ARG C N     1 
ATOM   8646  C  CA    . ARG I  5  358  ? 19.880  126.758 11.293  1.00 62.82  ? 358  ARG C CA    1 
ATOM   8647  C  C     . ARG I  5  358  ? 18.575  127.452 10.858  1.00 63.12  ? 358  ARG C C     1 
ATOM   8648  O  O     . ARG I  5  358  ? 18.482  128.685 10.859  1.00 62.39  ? 358  ARG C O     1 
ATOM   8649  C  CB    . ARG I  5  358  ? 20.990  127.068 10.311  1.00 62.05  ? 358  ARG C CB    1 
ATOM   8650  C  CG    . ARG I  5  358  ? 22.296  127.487 10.987  1.00 61.98  ? 358  ARG C CG    1 
ATOM   8651  C  CD    . ARG I  5  358  ? 23.365  126.427 10.836  1.00 61.66  ? 358  ARG C CD    1 
ATOM   8652  N  NE    . ARG I  5  358  ? 23.409  125.914 9.466   1.00 62.30  ? 358  ARG C NE    1 
ATOM   8653  C  CZ    . ARG I  5  358  ? 24.329  125.069 9.004   1.00 61.65  ? 358  ARG C CZ    1 
ATOM   8654  N  NH1   . ARG I  5  358  ? 25.300  124.638 9.801   1.00 61.33  ? 358  ARG C NH1   1 
ATOM   8655  N  NH2   . ARG I  5  358  ? 24.279  124.653 7.742   1.00 60.53  ? 358  ARG C NH2   1 
ATOM   8656  N  N     . MET I  5  359  ? 17.571  126.664 10.483  1.00 63.84  ? 359  MET C N     1 
ATOM   8657  C  CA    . MET I  5  359  ? 16.270  127.214 10.114  1.00 63.24  ? 359  MET C CA    1 
ATOM   8658  C  C     . MET I  5  359  ? 15.604  127.825 11.343  1.00 61.97  ? 359  MET C C     1 
ATOM   8659  O  O     . MET I  5  359  ? 14.790  128.746 11.263  1.00 61.39  ? 359  MET C O     1 
ATOM   8660  C  CB    . MET I  5  359  ? 15.395  126.090 9.540   1.00 63.91  ? 359  MET C CB    1 
ATOM   8661  C  CG    . MET I  5  359  ? 14.437  126.508 8.470   1.00 64.88  ? 359  MET C CG    1 
ATOM   8662  S  SD    . MET I  5  359  ? 12.731  126.705 9.033   1.00 67.93  ? 359  MET C SD    1 
ATOM   8663  C  CE    . MET I  5  359  ? 12.584  128.535 9.133   1.00 66.72  ? 359  MET C CE    1 
ATOM   8664  N  N     . LEU I  5  360  ? 16.005  127.274 12.486  1.00 61.13  ? 360  LEU C N     1 
ATOM   8665  C  CA    . LEU I  5  360  ? 15.534  127.659 13.806  1.00 60.72  ? 360  LEU C CA    1 
ATOM   8666  C  C     . LEU I  5  360  ? 16.504  128.643 14.479  1.00 61.81  ? 360  LEU C C     1 
ATOM   8667  O  O     . LEU I  5  360  ? 16.094  129.437 15.331  1.00 61.47  ? 360  LEU C O     1 
ATOM   8668  C  CB    . LEU I  5  360  ? 15.388  126.404 14.692  1.00 58.97  ? 360  LEU C CB    1 
ATOM   8669  C  CG    . LEU I  5  360  ? 15.523  124.970 14.131  1.00 57.53  ? 360  LEU C CG    1 
ATOM   8670  C  CD1   . LEU I  5  360  ? 15.567  124.026 15.310  1.00 56.67  ? 360  LEU C CD1   1 
ATOM   8671  C  CD2   . LEU I  5  360  ? 14.369  124.589 13.212  1.00 55.04  ? 360  LEU C CD2   1 
ATOM   8672  N  N     . MET I  5  361  ? 17.783  128.589 14.091  1.00 62.58  ? 361  MET C N     1 
ATOM   8673  C  CA    . MET I  5  361  ? 18.820  129.450 14.676  1.00 63.49  ? 361  MET C CA    1 
ATOM   8674  C  C     . MET I  5  361  ? 18.734  130.875 14.158  1.00 64.28  ? 361  MET C C     1 
ATOM   8675  O  O     . MET I  5  361  ? 18.748  131.816 14.948  1.00 64.43  ? 361  MET C O     1 
ATOM   8676  C  CB    . MET I  5  361  ? 20.233  128.889 14.399  1.00 62.16  ? 361  MET C CB    1 
ATOM   8677  C  CG    . MET I  5  361  ? 20.869  128.236 15.667  1.00 61.38  ? 361  MET C CG    1 
ATOM   8678  S  SD    . MET I  5  361  ? 22.689  128.030 15.704  1.00 59.27  ? 361  MET C SD    1 
ATOM   8679  C  CE    . MET I  5  361  ? 23.206  129.727 15.273  1.00 59.61  ? 361  MET C CE    1 
ATOM   8680  N  N     . GLY I  5  362  ? 18.647  131.043 12.846  1.00 65.91  ? 362  GLY C N     1 
ATOM   8681  C  CA    . GLY I  5  362  ? 18.562  132.385 12.300  1.00 68.46  ? 362  GLY C CA    1 
ATOM   8682  C  C     . GLY I  5  362  ? 17.397  133.176 12.876  1.00 70.14  ? 362  GLY C C     1 
ATOM   8683  O  O     . GLY I  5  362  ? 16.248  132.718 12.874  1.00 71.41  ? 362  GLY C O     1 
ATOM   8684  N  N     . SER I  5  363  ? 17.700  134.370 13.371  1.00 70.85  ? 363  SER C N     1 
ATOM   8685  C  CA    . SER I  5  363  ? 16.698  135.241 13.961  1.00 72.30  ? 363  SER C CA    1 
ATOM   8686  C  C     . SER I  5  363  ? 15.529  135.458 13.007  1.00 73.02  ? 363  SER C C     1 
ATOM   8687  O  O     . SER I  5  363  ? 14.517  134.756 13.092  1.00 73.29  ? 363  SER C O     1 
ATOM   8688  C  CB    . SER I  5  363  ? 17.326  136.590 14.311  1.00 72.62  ? 363  SER C CB    1 
ATOM   8689  O  OG    . SER I  5  363  ? 18.623  136.424 14.852  1.00 73.34  ? 363  SER C OG    1 
ATOM   8690  N  N     . GLU I  5  364  ? 15.674  136.426 12.097  1.00 73.40  ? 364  GLU C N     1 
ATOM   8691  C  CA    . GLU I  5  364  ? 14.613  136.723 11.144  1.00 74.81  ? 364  GLU C CA    1 
ATOM   8692  C  C     . GLU I  5  364  ? 15.006  136.311 9.696   1.00 76.64  ? 364  GLU C C     1 
ATOM   8693  O  O     . GLU I  5  364  ? 15.968  135.581 9.514   1.00 76.80  ? 364  GLU C O     1 
ATOM   8694  C  CB    . GLU I  5  364  ? 14.242  138.210 11.256  1.00 72.91  ? 364  GLU C CB    1 
ATOM   8695  C  CG    . GLU I  5  364  ? 13.897  138.661 12.705  1.00 72.61  ? 364  GLU C CG    1 
ATOM   8696  C  CD    . GLU I  5  364  ? 12.951  137.713 13.479  1.00 71.46  ? 364  GLU C CD    1 
ATOM   8697  O  OE1   . GLU I  5  364  ? 11.805  137.500 13.049  1.00 72.13  ? 364  GLU C OE1   1 
ATOM   8698  O  OE2   . GLU I  5  364  ? 13.350  137.176 14.532  1.00 71.15  ? 364  GLU C OE2   1 
ATOM   8699  N  N     . ASP I  5  365  ? 14.267  136.790 8.691   1.00 78.23  ? 365  ASP C N     1 
ATOM   8700  C  CA    . ASP I  5  365  ? 14.388  136.388 7.270   1.00 79.36  ? 365  ASP C CA    1 
ATOM   8701  C  C     . ASP I  5  365  ? 15.827  136.401 6.705   1.00 79.15  ? 365  ASP C C     1 
ATOM   8702  O  O     . ASP I  5  365  ? 16.126  135.535 5.878   1.00 78.73  ? 365  ASP C O     1 
ATOM   8703  C  CB    . ASP I  5  365  ? 13.444  137.265 6.397   1.00 81.41  ? 365  ASP C CB    1 
ATOM   8704  C  CG    . ASP I  5  365  ? 14.139  138.449 5.720   1.00 82.02  ? 365  ASP C CG    1 
ATOM   8705  O  OD1   . ASP I  5  365  ? 14.659  139.351 6.421   1.00 82.68  ? 365  ASP C OD1   1 
ATOM   8706  O  OD2   . ASP I  5  365  ? 14.150  138.471 4.467   1.00 82.40  ? 365  ASP C OD2   1 
ATOM   8707  N  N     . SER I  5  366  ? 16.715  137.318 7.090   1.00 79.58  ? 366  SER C N     1 
ATOM   8708  C  CA    . SER I  5  366  ? 18.056  137.298 6.482   1.00 79.62  ? 366  SER C CA    1 
ATOM   8709  C  C     . SER I  5  366  ? 18.825  136.045 6.893   1.00 78.43  ? 366  SER C C     1 
ATOM   8710  O  O     . SER I  5  366  ? 19.643  136.093 7.817   1.00 78.21  ? 366  SER C O     1 
ATOM   8711  C  CB    . SER I  5  366  ? 18.851  138.552 6.888   1.00 80.80  ? 366  SER C CB    1 
ATOM   8712  O  OG    . SER I  5  366  ? 18.254  139.737 6.375   1.00 82.82  ? 366  SER C OG    1 
ATOM   8713  N  N     . LEU I  5  367  ? 18.565  134.932 6.194   1.00 76.91  ? 367  LEU C N     1 
ATOM   8714  C  CA    . LEU I  5  367  ? 19.189  133.645 6.531   1.00 75.30  ? 367  LEU C CA    1 
ATOM   8715  C  C     . LEU I  5  367  ? 19.523  132.795 5.284   1.00 74.16  ? 367  LEU C C     1 
ATOM   8716  O  O     . LEU I  5  367  ? 19.791  131.601 5.415   1.00 73.52  ? 367  LEU C O     1 
ATOM   8717  C  CB    . LEU I  5  367  ? 18.250  132.813 7.429   1.00 75.56  ? 367  LEU C CB    1 
ATOM   8718  C  CG    . LEU I  5  367  ? 17.034  133.385 8.146   1.00 75.75  ? 367  LEU C CG    1 
ATOM   8719  C  CD1   . LEU I  5  367  ? 15.728  133.057 7.407   1.00 75.19  ? 367  LEU C CD1   1 
ATOM   8720  C  CD2   . LEU I  5  367  ? 16.983  132.778 9.519   1.00 74.92  ? 367  LEU C CD2   1 
ATOM   8721  N  N     . THR I  5  368  ? 19.530  133.375 4.091   1.00 72.50  ? 368  THR C N     1 
ATOM   8722  C  CA    . THR I  5  368  ? 19.767  132.568 2.879   1.00 70.35  ? 368  THR C CA    1 
ATOM   8723  C  C     . THR I  5  368  ? 21.222  132.050 2.750   1.00 67.97  ? 368  THR C C     1 
ATOM   8724  O  O     . THR I  5  368  ? 21.434  130.835 2.696   1.00 67.69  ? 368  THR C O     1 
ATOM   8725  C  CB    . THR I  5  368  ? 19.457  133.357 1.565   1.00 70.71  ? 368  THR C CB    1 
ATOM   8726  O  OG1   . THR I  5  368  ? 18.170  133.980 1.647   1.00 71.41  ? 368  THR C OG1   1 
ATOM   8727  C  CG2   . THR I  5  368  ? 19.448  132.409 0.374   1.00 70.49  ? 368  THR C CG2   1 
ATOM   8728  N  N     . PRO I  5  369  ? 22.230  132.953 2.715   1.00 66.34  ? 369  PRO C N     1 
ATOM   8729  C  CA    . PRO I  5  369  ? 23.659  132.620 2.548   1.00 64.79  ? 369  PRO C CA    1 
ATOM   8730  C  C     . PRO I  5  369  ? 24.226  131.635 3.572   1.00 62.86  ? 369  PRO C C     1 
ATOM   8731  O  O     . PRO I  5  369  ? 24.123  130.410 3.449   1.00 61.42  ? 369  PRO C O     1 
ATOM   8732  C  CB    . PRO I  5  369  ? 24.377  133.975 2.619   1.00 65.87  ? 369  PRO C CB    1 
ATOM   8733  C  CG    . PRO I  5  369  ? 23.308  135.006 2.970   1.00 66.24  ? 369  PRO C CG    1 
ATOM   8734  C  CD    . PRO I  5  369  ? 22.110  134.256 3.407   1.00 66.03  ? 369  PRO C CD    1 
ATOM   8735  N  N     . ALA I  5  370  ? 24.861  132.254 4.564   1.00 60.73  ? 370  ALA C N     1 
ATOM   8736  C  CA    . ALA I  5  370  ? 25.583  131.634 5.652   1.00 59.12  ? 370  ALA C CA    1 
ATOM   8737  C  C     . ALA I  5  370  ? 24.666  130.942 6.655   1.00 57.57  ? 370  ALA C C     1 
ATOM   8738  O  O     . ALA I  5  370  ? 25.069  129.942 7.254   1.00 58.54  ? 370  ALA C O     1 
ATOM   8739  C  CB    . ALA I  5  370  ? 26.417  132.701 6.354   1.00 58.93  ? 370  ALA C CB    1 
ATOM   8740  N  N     . LYS I  5  371  ? 23.454  131.443 6.861   1.00 54.80  ? 371  LYS C N     1 
ATOM   8741  C  CA    . LYS I  5  371  ? 22.584  130.808 7.841   1.00 52.37  ? 371  LYS C CA    1 
ATOM   8742  C  C     . LYS I  5  371  ? 22.253  129.370 7.457   1.00 51.39  ? 371  LYS C C     1 
ATOM   8743  O  O     . LYS I  5  371  ? 22.219  128.517 8.319   1.00 50.58  ? 371  LYS C O     1 
ATOM   8744  C  CB    . LYS I  5  371  ? 21.283  131.588 8.005   1.00 50.72  ? 371  LYS C CB    1 
ATOM   8745  C  CG    . LYS I  5  371  ? 21.252  132.653 9.112   1.00 48.09  ? 371  LYS C CG    1 
ATOM   8746  C  CD    . LYS I  5  371  ? 21.752  134.025 8.672   1.00 46.66  ? 371  LYS C CD    1 
ATOM   8747  C  CE    . LYS I  5  371  ? 21.606  135.038 9.810   1.00 45.53  ? 371  LYS C CE    1 
ATOM   8748  N  NZ    . LYS I  5  371  ? 21.976  136.423 9.434   1.00 44.85  ? 371  LYS C NZ    1 
ATOM   8749  N  N     . LEU I  5  372  ? 22.033  129.086 6.177   1.00 51.07  ? 372  LEU C N     1 
ATOM   8750  C  CA    . LEU I  5  372  ? 21.657  127.729 5.774   1.00 50.73  ? 372  LEU C CA    1 
ATOM   8751  C  C     . LEU I  5  372  ? 22.849  126.874 5.241   1.00 51.19  ? 372  LEU C C     1 
ATOM   8752  O  O     . LEU I  5  372  ? 22.781  125.652 5.367   1.00 51.23  ? 372  LEU C O     1 
ATOM   8753  C  CB    . LEU I  5  372  ? 20.545  127.807 4.717   1.00 50.72  ? 372  LEU C CB    1 
ATOM   8754  C  CG    . LEU I  5  372  ? 19.090  127.818 5.250   1.00 50.24  ? 372  LEU C CG    1 
ATOM   8755  C  CD1   . LEU I  5  372  ? 18.853  128.990 6.154   1.00 49.43  ? 372  LEU C CD1   1 
ATOM   8756  C  CD2   . LEU I  5  372  ? 18.127  127.888 4.099   1.00 50.67  ? 372  LEU C CD2   1 
ATOM   8757  N  N     . VAL I  5  373  ? 23.927  127.439 4.680   1.00 51.24  ? 373  VAL C N     1 
ATOM   8758  C  CA    . VAL I  5  373  ? 24.974  126.557 4.115   1.00 50.86  ? 373  VAL C CA    1 
ATOM   8759  C  C     . VAL I  5  373  ? 26.354  126.662 4.814   1.00 51.48  ? 373  VAL C C     1 
ATOM   8760  O  O     . VAL I  5  373  ? 26.874  127.741 5.119   1.00 51.59  ? 373  VAL C O     1 
ATOM   8761  C  CB    . VAL I  5  373  ? 25.192  126.849 2.645   1.00 50.29  ? 373  VAL C CB    1 
ATOM   8762  C  CG1   . VAL I  5  373  ? 26.088  125.772 2.048   1.00 49.65  ? 373  VAL C CG1   1 
ATOM   8763  C  CG2   . VAL I  5  373  ? 23.832  126.888 1.930   1.00 49.14  ? 373  VAL C CG2   1 
ATOM   8764  N  N     . ASN I  5  374  ? 26.927  125.469 5.019   1.00 51.86  ? 374  ASN C N     1 
ATOM   8765  C  CA    . ASN I  5  374  ? 28.252  125.232 5.592   1.00 51.56  ? 374  ASN C CA    1 
ATOM   8766  C  C     . ASN I  5  374  ? 28.989  124.186 4.766   1.00 50.63  ? 374  ASN C C     1 
ATOM   8767  O  O     . ASN I  5  374  ? 28.559  123.060 4.659   1.00 49.98  ? 374  ASN C O     1 
ATOM   8768  C  CB    . ASN I  5  374  ? 28.141  124.780 7.072   1.00 53.41  ? 374  ASN C CB    1 
ATOM   8769  C  CG    . ASN I  5  374  ? 27.486  123.399 7.247   1.00 54.28  ? 374  ASN C CG    1 
ATOM   8770  O  OD1   . ASN I  5  374  ? 26.364  123.154 6.797   1.00 53.93  ? 374  ASN C OD1   1 
ATOM   8771  N  ND2   . ASN I  5  374  ? 28.197  122.497 7.919   1.00 54.91  ? 374  ASN C ND2   1 
ATOM   8772  N  N     . SER I  5  375  ? 30.102  124.582 4.172   1.00 50.29  ? 375  SER C N     1 
ATOM   8773  C  CA    . SER I  5  375  ? 30.868  123.732 3.262   1.00 50.71  ? 375  SER C CA    1 
ATOM   8774  C  C     . SER I  5  375  ? 31.663  122.664 3.974   1.00 51.22  ? 375  SER C C     1 
ATOM   8775  O  O     . SER I  5  375  ? 32.235  121.810 3.314   1.00 50.02  ? 375  SER C O     1 
ATOM   8776  C  CB    . SER I  5  375  ? 31.844  124.577 2.452   1.00 51.11  ? 375  SER C CB    1 
ATOM   8777  O  OG    . SER I  5  375  ? 32.899  125.067 3.272   1.00 50.13  ? 375  SER C OG    1 
ATOM   8778  N  N     . ARG I  5  376  ? 31.723  122.690 5.290   1.00 51.91  ? 376  ARG C N     1 
ATOM   8779  C  CA    . ARG I  5  376  ? 32.540  121.702 5.977   1.00 54.83  ? 376  ARG C CA    1 
ATOM   8780  C  C     . ARG I  5  376  ? 32.123  120.246 5.633   1.00 55.01  ? 376  ARG C C     1 
ATOM   8781  O  O     . ARG I  5  376  ? 33.006  119.425 5.341   1.00 56.16  ? 376  ARG C O     1 
ATOM   8782  C  CB    . ARG I  5  376  ? 32.484  121.928 7.507   1.00 56.56  ? 376  ARG C CB    1 
ATOM   8783  C  CG    . ARG I  5  376  ? 33.857  122.212 8.199   1.00 58.35  ? 376  ARG C CG    1 
ATOM   8784  C  CD    . ARG I  5  376  ? 34.470  123.553 7.761   1.00 62.02  ? 376  ARG C CD    1 
ATOM   8785  N  NE    . ARG I  5  376  ? 35.659  123.956 8.526   1.00 65.21  ? 376  ARG C NE    1 
ATOM   8786  C  CZ    . ARG I  5  376  ? 36.484  124.950 8.176   1.00 66.80  ? 376  ARG C CZ    1 
ATOM   8787  N  NH1   . ARG I  5  376  ? 36.265  125.655 7.067   1.00 67.55  ? 376  ARG C NH1   1 
ATOM   8788  N  NH2   . ARG I  5  376  ? 37.533  125.247 8.936   1.00 67.11  ? 376  ARG C NH2   1 
ATOM   8789  N  N     . PRO I  5  377  ? 30.805  119.904 5.636   1.00 54.23  ? 377  PRO C N     1 
ATOM   8790  C  CA    . PRO I  5  377  ? 30.376  118.528 5.342   1.00 53.05  ? 377  PRO C CA    1 
ATOM   8791  C  C     . PRO I  5  377  ? 30.845  118.019 3.987   1.00 51.16  ? 377  PRO C C     1 
ATOM   8792  O  O     . PRO I  5  377  ? 31.601  117.047 3.885   1.00 51.21  ? 377  PRO C O     1 
ATOM   8793  C  CB    . PRO I  5  377  ? 28.844  118.589 5.430   1.00 53.51  ? 377  PRO C CB    1 
ATOM   8794  C  CG    . PRO I  5  377  ? 28.558  119.784 6.232   1.00 52.86  ? 377  PRO C CG    1 
ATOM   8795  C  CD    . PRO I  5  377  ? 29.614  120.756 5.768   1.00 54.22  ? 377  PRO C CD    1 
ATOM   8796  N  N     . LEU I  5  378  ? 30.374  118.680 2.948   1.00 48.39  ? 378  LEU C N     1 
ATOM   8797  C  CA    . LEU I  5  378  ? 30.670  118.250 1.615   1.00 46.66  ? 378  LEU C CA    1 
ATOM   8798  C  C     . LEU I  5  378  ? 32.145  118.047 1.402   1.00 45.41  ? 378  LEU C C     1 
ATOM   8799  O  O     . LEU I  5  378  ? 32.550  117.067 0.778   1.00 45.70  ? 378  LEU C O     1 
ATOM   8800  C  CB    . LEU I  5  378  ? 30.131  119.261 0.628   1.00 46.51  ? 378  LEU C CB    1 
ATOM   8801  C  CG    . LEU I  5  378  ? 29.964  118.628 -0.755  1.00 46.54  ? 378  LEU C CG    1 
ATOM   8802  C  CD1   . LEU I  5  378  ? 29.100  117.391 -0.657  1.00 46.99  ? 378  LEU C CD1   1 
ATOM   8803  C  CD2   . LEU I  5  378  ? 29.348  119.632 -1.700  1.00 47.42  ? 378  LEU C CD2   1 
ATOM   8804  N  N     . GLU I  5  379  ? 32.946  118.966 1.926   1.00 44.04  ? 379  GLU C N     1 
ATOM   8805  C  CA    . GLU I  5  379  ? 34.388  118.878 1.784   1.00 41.43  ? 379  GLU C CA    1 
ATOM   8806  C  C     . GLU I  5  379  ? 34.907  117.556 2.278   1.00 41.25  ? 379  GLU C C     1 
ATOM   8807  O  O     . GLU I  5  379  ? 35.345  116.722 1.494   1.00 40.84  ? 379  GLU C O     1 
ATOM   8808  C  CB    . GLU I  5  379  ? 35.073  120.002 2.563   1.00 40.39  ? 379  GLU C CB    1 
ATOM   8809  C  CG    . GLU I  5  379  ? 36.075  120.723 1.716   1.00 39.99  ? 379  GLU C CG    1 
ATOM   8810  C  CD    . GLU I  5  379  ? 35.606  120.801 0.283   1.00 39.48  ? 379  GLU C CD    1 
ATOM   8811  O  OE1   . GLU I  5  379  ? 34.470  121.251 0.056   1.00 36.87  ? 379  GLU C OE1   1 
ATOM   8812  O  OE2   . GLU I  5  379  ? 36.368  120.404 -0.611  1.00 41.63  ? 379  GLU C OE2   1 
ATOM   8813  N  N     . ALA I  5  380  ? 34.840  117.376 3.587   1.00 41.03  ? 380  ALA C N     1 
ATOM   8814  C  CA    . ALA I  5  380  ? 35.320  116.172 4.253   1.00 40.05  ? 380  ALA C CA    1 
ATOM   8815  C  C     . ALA I  5  380  ? 34.722  114.901 3.641   1.00 38.68  ? 380  ALA C C     1 
ATOM   8816  O  O     . ALA I  5  380  ? 35.403  113.888 3.585   1.00 39.22  ? 380  ALA C O     1 
ATOM   8817  C  CB    . ALA I  5  380  ? 34.986  116.245 5.751   1.00 40.76  ? 380  ALA C CB    1 
ATOM   8818  N  N     . ALA I  5  381  ? 33.467  114.950 3.189   1.00 36.94  ? 381  ALA C N     1 
ATOM   8819  C  CA    . ALA I  5  381  ? 32.796  113.785 2.617   1.00 33.69  ? 381  ALA C CA    1 
ATOM   8820  C  C     . ALA I  5  381  ? 33.462  113.346 1.343   1.00 32.50  ? 381  ALA C C     1 
ATOM   8821  O  O     . ALA I  5  381  ? 33.979  112.238 1.239   1.00 32.16  ? 381  ALA C O     1 
ATOM   8822  C  CB    . ALA I  5  381  ? 31.339  114.112 2.347   1.00 33.17  ? 381  ALA C CB    1 
ATOM   8823  N  N     . ILE I  5  382  ? 33.438  114.224 0.361   1.00 31.50  ? 382  ILE C N     1 
ATOM   8824  C  CA    . ILE I  5  382  ? 34.042  113.932 -0.919  1.00 32.28  ? 382  ILE C CA    1 
ATOM   8825  C  C     . ILE I  5  382  ? 35.540  113.652 -0.769  1.00 33.04  ? 382  ILE C C     1 
ATOM   8826  O  O     . ILE I  5  382  ? 36.017  112.588 -1.172  1.00 32.08  ? 382  ILE C O     1 
ATOM   8827  C  CB    . ILE I  5  382  ? 33.795  115.115 -1.865  1.00 31.43  ? 382  ILE C CB    1 
ATOM   8828  C  CG1   . ILE I  5  382  ? 32.306  115.431 -1.846  1.00 31.05  ? 382  ILE C CG1   1 
ATOM   8829  C  CG2   . ILE I  5  382  ? 34.170  114.766 -3.289  1.00 31.23  ? 382  ILE C CG2   1 
ATOM   8830  C  CD1   . ILE I  5  382  ? 31.999  116.734 -2.407  1.00 32.20  ? 382  ILE C CD1   1 
ATOM   8831  N  N     . ARG I  5  383  ? 36.260  114.614 -0.178  1.00 34.93  ? 383  ARG C N     1 
ATOM   8832  C  CA    . ARG I  5  383  ? 37.705  114.527 0.051   1.00 35.45  ? 383  ARG C CA    1 
ATOM   8833  C  C     . ARG I  5  383  ? 38.091  113.158 0.598   1.00 36.94  ? 383  ARG C C     1 
ATOM   8834  O  O     . ARG I  5  383  ? 39.070  112.550 0.168   1.00 36.49  ? 383  ARG C O     1 
ATOM   8835  C  CB    . ARG I  5  383  ? 38.123  115.671 1.002   1.00 34.06  ? 383  ARG C CB    1 
ATOM   8836  C  CG    . ARG I  5  383  ? 39.017  115.345 2.178   1.00 33.53  ? 383  ARG C CG    1 
ATOM   8837  C  CD    . ARG I  5  383  ? 39.869  116.558 2.609   1.00 32.55  ? 383  ARG C CD    1 
ATOM   8838  N  NE    . ARG I  5  383  ? 41.040  116.783 1.754   1.00 28.78  ? 383  ARG C NE    1 
ATOM   8839  C  CZ    . ARG I  5  383  ? 40.998  117.404 0.585   1.00 27.19  ? 383  ARG C CZ    1 
ATOM   8840  N  NH1   . ARG I  5  383  ? 39.849  117.875 0.130   1.00 25.66  ? 383  ARG C NH1   1 
ATOM   8841  N  NH2   . ARG I  5  383  ? 42.102  117.549 -0.132  1.00 27.60  ? 383  ARG C NH2   1 
ATOM   8842  N  N     . GLU I  5  384  ? 37.295  112.677 1.541   1.00 39.72  ? 384  GLU C N     1 
ATOM   8843  C  CA    . GLU I  5  384  ? 37.521  111.377 2.147   1.00 41.31  ? 384  GLU C CA    1 
ATOM   8844  C  C     . GLU I  5  384  ? 37.473  110.275 1.095   1.00 41.91  ? 384  GLU C C     1 
ATOM   8845  O  O     . GLU I  5  384  ? 38.295  109.358 1.088   1.00 42.17  ? 384  GLU C O     1 
ATOM   8846  C  CB    . GLU I  5  384  ? 36.455  111.101 3.236   1.00 42.28  ? 384  GLU C CB    1 
ATOM   8847  C  CG    . GLU I  5  384  ? 36.798  109.911 4.174   1.00 41.16  ? 384  GLU C CG    1 
ATOM   8848  C  CD    . GLU I  5  384  ? 36.473  110.172 5.645   1.00 40.52  ? 384  GLU C CD    1 
ATOM   8849  O  OE1   . GLU I  5  384  ? 36.969  109.401 6.505   1.00 39.99  ? 384  GLU C OE1   1 
ATOM   8850  O  OE2   . GLU I  5  384  ? 35.729  111.139 5.936   1.00 38.99  ? 384  GLU C OE2   1 
ATOM   8851  N  N     . PHE I  5  385  ? 36.513  110.382 0.190   1.00 42.21  ? 385  PHE C N     1 
ATOM   8852  C  CA    . PHE I  5  385  ? 36.329  109.354 -0.813  1.00 42.54  ? 385  PHE C CA    1 
ATOM   8853  C  C     . PHE I  5  385  ? 37.509  109.230 -1.752  1.00 43.48  ? 385  PHE C C     1 
ATOM   8854  O  O     . PHE I  5  385  ? 37.932  108.133 -2.076  1.00 43.83  ? 385  PHE C O     1 
ATOM   8855  C  CB    . PHE I  5  385  ? 35.088  109.629 -1.648  1.00 39.87  ? 385  PHE C CB    1 
ATOM   8856  C  CG    . PHE I  5  385  ? 34.704  108.481 -2.522  1.00 37.49  ? 385  PHE C CG    1 
ATOM   8857  C  CD1   . PHE I  5  385  ? 34.509  107.192 -1.960  1.00 35.91  ? 385  PHE C CD1   1 
ATOM   8858  C  CD2   . PHE I  5  385  ? 34.554  108.660 -3.916  1.00 36.32  ? 385  PHE C CD2   1 
ATOM   8859  C  CE1   . PHE I  5  385  ? 34.172  106.082 -2.761  1.00 33.79  ? 385  PHE C CE1   1 
ATOM   8860  C  CE2   . PHE I  5  385  ? 34.211  107.551 -4.750  1.00 36.00  ? 385  PHE C CE2   1 
ATOM   8861  C  CZ    . PHE I  5  385  ? 34.020  106.252 -4.161  1.00 34.65  ? 385  PHE C CZ    1 
ATOM   8862  N  N     . PHE I  5  386  ? 38.055  110.343 -2.200  1.00 45.88  ? 386  PHE C N     1 
ATOM   8863  C  CA    . PHE I  5  386  ? 39.128  110.255 -3.170  1.00 47.89  ? 386  PHE C CA    1 
ATOM   8864  C  C     . PHE I  5  386  ? 40.482  109.981 -2.520  1.00 49.94  ? 386  PHE C C     1 
ATOM   8865  O  O     . PHE I  5  386  ? 41.379  109.473 -3.190  1.00 49.53  ? 386  PHE C O     1 
ATOM   8866  C  CB    . PHE I  5  386  ? 39.129  111.540 -4.010  1.00 47.60  ? 386  PHE C CB    1 
ATOM   8867  C  CG    . PHE I  5  386  ? 37.883  111.689 -4.860  1.00 46.86  ? 386  PHE C CG    1 
ATOM   8868  C  CD1   . PHE I  5  386  ? 36.631  111.966 -4.265  1.00 46.32  ? 386  PHE C CD1   1 
ATOM   8869  C  CD2   . PHE I  5  386  ? 37.945  111.522 -6.254  1.00 46.98  ? 386  PHE C CD2   1 
ATOM   8870  C  CE1   . PHE I  5  386  ? 35.460  112.072 -5.045  1.00 45.62  ? 386  PHE C CE1   1 
ATOM   8871  C  CE2   . PHE I  5  386  ? 36.775  111.625 -7.059  1.00 46.70  ? 386  PHE C CE2   1 
ATOM   8872  C  CZ    . PHE I  5  386  ? 35.530  111.901 -6.448  1.00 46.64  ? 386  PHE C CZ    1 
ATOM   8873  N  N     . SER I  5  387  ? 40.642  110.275 -1.234  1.00 52.11  ? 387  SER C N     1 
ATOM   8874  C  CA    . SER I  5  387  ? 41.942  110.052 -0.616  1.00 55.75  ? 387  SER C CA    1 
ATOM   8875  C  C     . SER I  5  387  ? 41.911  108.906 0.395   1.00 58.64  ? 387  SER C C     1 
ATOM   8876  O  O     . SER I  5  387  ? 42.953  108.306 0.681   1.00 59.77  ? 387  SER C O     1 
ATOM   8877  C  CB    . SER I  5  387  ? 42.442  111.342 0.075   1.00 55.43  ? 387  SER C CB    1 
ATOM   8878  O  OG    . SER I  5  387  ? 41.577  111.807 1.089   1.00 55.12  ? 387  SER C OG    1 
ATOM   8879  N  N     . ARG I  5  388  ? 40.744  108.575 0.930   1.00 60.49  ? 388  ARG C N     1 
ATOM   8880  C  CA    . ARG I  5  388  ? 40.695  107.531 1.953   1.00 63.81  ? 388  ARG C CA    1 
ATOM   8881  C  C     . ARG I  5  388  ? 39.994  106.249 1.473   1.00 63.77  ? 388  ARG C C     1 
ATOM   8882  O  O     . ARG I  5  388  ? 40.377  105.155 1.905   1.00 63.87  ? 388  ARG C O     1 
ATOM   8883  C  CB    . ARG I  5  388  ? 39.973  108.051 3.214   1.00 65.48  ? 388  ARG C CB    1 
ATOM   8884  C  CG    . ARG I  5  388  ? 40.833  108.780 4.256   1.00 66.07  ? 388  ARG C CG    1 
ATOM   8885  C  CD    . ARG I  5  388  ? 41.193  110.226 3.882   1.00 68.78  ? 388  ARG C CD    1 
ATOM   8886  N  NE    . ARG I  5  388  ? 40.194  111.229 4.261   1.00 70.09  ? 388  ARG C NE    1 
ATOM   8887  C  CZ    . ARG I  5  388  ? 40.377  112.547 4.151   1.00 70.10  ? 388  ARG C CZ    1 
ATOM   8888  N  NH1   . ARG I  5  388  ? 41.523  113.033 3.679   1.00 70.26  ? 388  ARG C NH1   1 
ATOM   8889  N  NH2   . ARG I  5  388  ? 39.412  113.383 4.505   1.00 70.35  ? 388  ARG C NH2   1 
ATOM   8890  N  N     . SER I  5  389  ? 38.988  106.371 0.604   1.00 65.28  ? 389  SER C N     1 
ATOM   8891  C  CA    . SER I  5  389  ? 38.210  105.209 0.143   1.00 65.44  ? 389  SER C CA    1 
ATOM   8892  C  C     . SER I  5  389  ? 39.097  104.035 -0.217  1.00 66.68  ? 389  SER C C     1 
ATOM   8893  O  O     . SER I  5  389  ? 40.064  104.182 -0.983  1.00 66.75  ? 389  SER C O     1 
ATOM   8894  C  CB    . SER I  5  389  ? 37.355  105.551 -1.088  1.00 65.94  ? 389  SER C CB    1 
ATOM   8895  O  OG    . SER I  5  389  ? 36.525  104.461 -1.483  1.00 64.46  ? 389  SER C OG    1 
ATOM   8896  N  N     . GLN I  5  390  ? 38.752  102.872 0.351   1.00 67.23  ? 390  GLN C N     1 
ATOM   8897  C  CA    . GLN I  5  390  ? 39.463  101.611 0.089   1.00 66.66  ? 390  GLN C CA    1 
ATOM   8898  C  C     . GLN I  5  390  ? 39.551  101.367 -1.401  1.00 64.74  ? 390  GLN C C     1 
ATOM   8899  O  O     . GLN I  5  390  ? 40.507  100.798 -1.951  1.00 65.61  ? 390  GLN C O     1 
ATOM   8900  C  CB    . GLN I  5  390  ? 38.710  100.417 0.692   1.00 67.47  ? 390  GLN C CB    1 
ATOM   8901  C  CG    . GLN I  5  390  ? 39.007  100.082 2.134   1.00 66.91  ? 390  GLN C CG    1 
ATOM   8902  C  CD    . GLN I  5  390  ? 38.312  98.809  2.586   1.00 65.97  ? 390  GLN C CD    1 
ATOM   8903  O  OE1   . GLN I  5  390  ? 37.803  98.744  3.692   1.00 65.59  ? 390  GLN C OE1   1 
ATOM   8904  N  NE2   . GLN I  5  390  ? 38.294  97.795  1.729   1.00 66.03  ? 390  GLN C NE2   1 
ATOM   8905  N  N     . LEU I  5  391  ? 38.487  101.834 -2.021  1.00 61.98  ? 391  LEU C N     1 
ATOM   8906  C  CA    . LEU I  5  391  ? 38.252  101.719 -3.415  1.00 58.47  ? 391  LEU C CA    1 
ATOM   8907  C  C     . LEU I  5  391  ? 39.234  102.564 -4.239  1.00 56.99  ? 391  LEU C C     1 
ATOM   8908  O  O     . LEU I  5  391  ? 39.841  102.046 -5.169  1.00 58.71  ? 391  LEU C O     1 
ATOM   8909  C  CB    . LEU I  5  391  ? 36.815  102.117 -3.629  1.00 57.14  ? 391  LEU C CB    1 
ATOM   8910  C  CG    . LEU I  5  391  ? 36.263  101.604 -4.931  1.00 57.21  ? 391  LEU C CG    1 
ATOM   8911  C  CD1   . LEU I  5  391  ? 34.865  101.072 -4.776  1.00 56.58  ? 391  LEU C CD1   1 
ATOM   8912  C  CD2   . LEU I  5  391  ? 36.335  102.742 -5.890  1.00 57.95  ? 391  LEU C CD2   1 
ATOM   8913  N  N     . SER I  5  392  ? 39.406  103.844 -3.926  1.00 54.66  ? 392  SER C N     1 
ATOM   8914  C  CA    . SER I  5  392  ? 40.316  104.686 -4.716  1.00 52.03  ? 392  SER C CA    1 
ATOM   8915  C  C     . SER I  5  392  ? 41.749  104.448 -4.335  1.00 51.02  ? 392  SER C C     1 
ATOM   8916  O  O     . SER I  5  392  ? 42.081  104.613 -3.172  1.00 51.72  ? 392  SER C O     1 
ATOM   8917  C  CB    . SER I  5  392  ? 39.992  106.144 -4.494  1.00 51.80  ? 392  SER C CB    1 
ATOM   8918  O  OG    . SER I  5  392  ? 39.765  106.362 -3.121  1.00 52.03  ? 392  SER C OG    1 
ATOM   8919  N  N     . GLN I  5  393  ? 42.598  104.084 -5.299  1.00 49.92  ? 393  GLN C N     1 
ATOM   8920  C  CA    . GLN I  5  393  ? 44.011  103.782 -4.998  1.00 49.21  ? 393  GLN C CA    1 
ATOM   8921  C  C     . GLN I  5  393  ? 45.005  104.513 -5.952  1.00 48.43  ? 393  GLN C C     1 
ATOM   8922  O  O     . GLN I  5  393  ? 44.622  105.195 -6.916  1.00 48.54  ? 393  GLN C O     1 
ATOM   8923  C  CB    . GLN I  5  393  ? 44.271  102.261 -5.116  1.00 49.60  ? 393  GLN C CB    1 
ATOM   8924  C  CG    . GLN I  5  393  ? 43.100  101.290 -4.806  1.00 48.89  ? 393  GLN C CG    1 
ATOM   8925  C  CD    . GLN I  5  393  ? 42.237  100.928 -6.027  1.00 47.70  ? 393  GLN C CD    1 
ATOM   8926  O  OE1   . GLN I  5  393  ? 41.656  99.837  -6.092  1.00 46.88  ? 393  GLN C OE1   1 
ATOM   8927  N  NE2   . GLN I  5  393  ? 42.150  101.838 -6.985  1.00 46.42  ? 393  GLN C NE2   1 
ATOM   8928  N  N     . PHE I  5  394  ? 46.297  104.348 -5.641  1.00 46.05  ? 394  PHE C N     1 
ATOM   8929  C  CA    . PHE I  5  394  ? 47.403  104.880 -6.445  1.00 42.94  ? 394  PHE C CA    1 
ATOM   8930  C  C     . PHE I  5  394  ? 47.331  104.311 -7.825  1.00 41.93  ? 394  PHE C C     1 
ATOM   8931  O  O     . PHE I  5  394  ? 47.303  103.094 -7.965  1.00 42.34  ? 394  PHE C O     1 
ATOM   8932  C  CB    . PHE I  5  394  ? 48.749  104.448 -5.849  1.00 41.96  ? 394  PHE C CB    1 
ATOM   8933  C  CG    . PHE I  5  394  ? 49.911  105.347 -6.177  1.00 41.22  ? 394  PHE C CG    1 
ATOM   8934  C  CD1   . PHE I  5  394  ? 49.797  106.428 -7.069  1.00 41.28  ? 394  PHE C CD1   1 
ATOM   8935  C  CD2   . PHE I  5  394  ? 51.151  105.127 -5.545  1.00 40.57  ? 394  PHE C CD2   1 
ATOM   8936  C  CE1   . PHE I  5  394  ? 50.910  107.282 -7.317  1.00 40.15  ? 394  PHE C CE1   1 
ATOM   8937  C  CE2   . PHE I  5  394  ? 52.270  105.974 -5.787  1.00 39.05  ? 394  PHE C CE2   1 
ATOM   8938  C  CZ    . PHE I  5  394  ? 52.144  107.052 -6.673  1.00 39.25  ? 394  PHE C CZ    1 
ATOM   8939  N  N     . LYS I  5  395  ? 47.280  105.131 -8.855  1.00 39.70  ? 395  LYS C N     1 
ATOM   8940  C  CA    . LYS I  5  395  ? 47.249  104.494 -10.147 1.00 39.05  ? 395  LYS C CA    1 
ATOM   8941  C  C     . LYS I  5  395  ? 48.562  103.768 -10.396 1.00 38.36  ? 395  LYS C C     1 
ATOM   8942  O  O     . LYS I  5  395  ? 49.640  104.339 -10.238 1.00 38.70  ? 395  LYS C O     1 
ATOM   8943  C  CB    . LYS I  5  395  ? 47.023  105.525 -11.228 1.00 38.88  ? 395  LYS C CB    1 
ATOM   8944  C  CG    . LYS I  5  395  ? 46.695  104.958 -12.559 1.00 37.90  ? 395  LYS C CG    1 
ATOM   8945  C  CD    . LYS I  5  395  ? 46.605  106.094 -13.518 1.00 39.24  ? 395  LYS C CD    1 
ATOM   8946  C  CE    . LYS I  5  395  ? 46.289  105.613 -14.898 1.00 40.47  ? 395  LYS C CE    1 
ATOM   8947  N  NZ    . LYS I  5  395  ? 46.349  106.714 -15.896 1.00 41.43  ? 395  LYS C NZ    1 
ATOM   8948  N  N     . ASP I  5  396  ? 48.485  102.498 -10.755 1.00 36.16  ? 396  ASP C N     1 
ATOM   8949  C  CA    . ASP I  5  396  ? 49.698  101.777 -11.026 1.00 33.76  ? 396  ASP C CA    1 
ATOM   8950  C  C     . ASP I  5  396  ? 50.125  102.031 -12.442 1.00 31.55  ? 396  ASP C C     1 
ATOM   8951  O  O     . ASP I  5  396  ? 49.553  101.507 -13.389 1.00 28.28  ? 396  ASP C O     1 
ATOM   8952  C  CB    . ASP I  5  396  ? 49.477  100.270 -10.701 1.00 36.24  ? 396  ASP C CB    1 
ATOM   8953  C  CG    . ASP I  5  396  ? 49.540  99.350  -11.905 1.00 38.23  ? 396  ASP C CG    1 
ATOM   8954  O  OD1   . ASP I  5  396  ? 48.512  98.705  -12.230 1.00 40.36  ? 396  ASP C OD1   1 
ATOM   8955  O  OD2   . ASP I  5  396  ? 50.620  99.263  -12.525 1.00 41.65  ? 396  ASP C OD2   1 
ATOM   8956  N  N     . GLU I  5  397  ? 51.127  102.890 -12.576 1.00 30.70  ? 397  GLU C N     1 
ATOM   8957  C  CA    . GLU I  5  397  ? 51.623  103.226 -13.889 1.00 29.87  ? 397  GLU C CA    1 
ATOM   8958  C  C     . GLU I  5  397  ? 53.046  102.774 -14.083 1.00 28.94  ? 397  GLU C C     1 
ATOM   8959  O  O     . GLU I  5  397  ? 53.894  103.571 -14.481 1.00 28.04  ? 397  GLU C O     1 
ATOM   8960  C  CB    . GLU I  5  397  ? 51.528  104.727 -14.140 1.00 30.54  ? 397  GLU C CB    1 
ATOM   8961  C  CG    . GLU I  5  397  ? 50.101  105.227 -14.206 1.00 32.69  ? 397  GLU C CG    1 
ATOM   8962  C  CD    . GLU I  5  397  ? 49.934  106.327 -15.231 1.00 33.24  ? 397  GLU C CD    1 
ATOM   8963  O  OE1   . GLU I  5  397  ? 50.313  106.086 -16.398 1.00 33.65  ? 397  GLU C OE1   1 
ATOM   8964  O  OE2   . GLU I  5  397  ? 49.429  107.417 -14.874 1.00 32.55  ? 397  GLU C OE2   1 
ATOM   8965  N  N     . THR I  5  398  ? 53.308  101.499 -13.783 1.00 28.31  ? 398  THR C N     1 
ATOM   8966  C  CA    . THR I  5  398  ? 54.618  100.912 -14.045 1.00 26.53  ? 398  THR C CA    1 
ATOM   8967  C  C     . THR I  5  398  ? 54.999  101.224 -15.492 1.00 26.36  ? 398  THR C C     1 
ATOM   8968  O  O     . THR I  5  398  ? 56.048  101.774 -15.814 1.00 25.64  ? 398  THR C O     1 
ATOM   8969  C  CB    . THR I  5  398  ? 54.531  99.401  -13.839 1.00 25.35  ? 398  THR C CB    1 
ATOM   8970  O  OG1   . THR I  5  398  ? 53.973  99.139  -12.547 1.00 23.54  ? 398  THR C OG1   1 
ATOM   8971  C  CG2   . THR I  5  398  ? 55.896  98.766  -13.954 1.00 26.39  ? 398  THR C CG2   1 
ATOM   8972  N  N     . ASN I  5  399  ? 54.055  100.853 -16.342 1.00 23.13  ? 399  ASN C N     1 
ATOM   8973  C  CA    . ASN I  5  399  ? 54.058  101.141 -17.750 1.00 20.73  ? 399  ASN C CA    1 
ATOM   8974  C  C     . ASN I  5  399  ? 52.644  101.468 -18.175 1.00 21.48  ? 399  ASN C C     1 
ATOM   8975  O  O     . ASN I  5  399  ? 51.705  101.103 -17.477 1.00 18.90  ? 399  ASN C O     1 
ATOM   8976  C  CB    . ASN I  5  399  ? 54.595  99.956  -18.579 1.00 17.95  ? 399  ASN C CB    1 
ATOM   8977  C  CG    . ASN I  5  399  ? 53.650  98.794  -18.632 1.00 12.76  ? 399  ASN C CG    1 
ATOM   8978  O  OD1   . ASN I  5  399  ? 53.132  98.452  -19.689 1.00 7.50   ? 399  ASN C OD1   1 
ATOM   8979  N  ND2   . ASN I  5  399  ? 53.418  98.174  -17.485 1.00 12.72  ? 399  ASN C ND2   1 
ATOM   8980  N  N     . PRO I  5  400  ? 52.459  102.168 -19.297 1.00 22.27  ? 400  PRO C N     1 
ATOM   8981  C  CA    . PRO I  5  400  ? 51.108  102.510 -19.746 1.00 23.03  ? 400  PRO C CA    1 
ATOM   8982  C  C     . PRO I  5  400  ? 50.066  101.340 -19.579 1.00 23.56  ? 400  PRO C C     1 
ATOM   8983  O  O     . PRO I  5  400  ? 49.056  101.533 -18.896 1.00 23.29  ? 400  PRO C O     1 
ATOM   8984  C  CB    . PRO I  5  400  ? 51.361  102.950 -21.173 1.00 23.22  ? 400  PRO C CB    1 
ATOM   8985  C  CG    . PRO I  5  400  ? 52.643  103.743 -21.008 1.00 20.69  ? 400  PRO C CG    1 
ATOM   8986  C  CD    . PRO I  5  400  ? 53.468  102.841 -20.146 1.00 20.41  ? 400  PRO C CD    1 
ATOM   8987  N  N     . LEU I  5  401  ? 50.293  100.159 -20.169 1.00 24.24  ? 401  LEU C N     1 
ATOM   8988  C  CA    . LEU I  5  401  ? 49.327  99.021  -20.081 1.00 26.49  ? 401  LEU C CA    1 
ATOM   8989  C  C     . LEU I  5  401  ? 48.958  98.697  -18.654 1.00 27.83  ? 401  LEU C C     1 
ATOM   8990  O  O     . LEU I  5  401  ? 47.842  98.239  -18.370 1.00 25.06  ? 401  LEU C O     1 
ATOM   8991  C  CB    . LEU I  5  401  ? 49.876  97.720  -20.663 1.00 27.12  ? 401  LEU C CB    1 
ATOM   8992  C  CG    . LEU I  5  401  ? 49.053  96.469  -20.248 1.00 25.58  ? 401  LEU C CG    1 
ATOM   8993  C  CD1   . LEU I  5  401  ? 47.714  96.459  -20.933 1.00 23.11  ? 401  LEU C CD1   1 
ATOM   8994  C  CD2   . LEU I  5  401  ? 49.807  95.239  -20.588 1.00 27.45  ? 401  LEU C CD2   1 
ATOM   8995  N  N     . SER I  5  402  ? 49.911  98.890  -17.764 1.00 28.03  ? 402  SER C N     1 
ATOM   8996  C  CA    . SER I  5  402  ? 49.627  98.640  -16.380 1.00 29.68  ? 402  SER C CA    1 
ATOM   8997  C  C     . SER I  5  402  ? 48.539  99.594  -15.911 1.00 30.75  ? 402  SER C C     1 
ATOM   8998  O  O     . SER I  5  402  ? 47.484  99.175  -15.406 1.00 30.95  ? 402  SER C O     1 
ATOM   8999  C  CB    . SER I  5  402  ? 50.909  98.809  -15.552 1.00 30.68  ? 402  SER C CB    1 
ATOM   9000  O  OG    . SER I  5  402  ? 51.264  100.153 -15.310 1.00 30.17  ? 402  SER C OG    1 
ATOM   9001  N  N     . SER I  5  403  ? 48.813  100.885 -16.120 1.00 30.49  ? 403  SER C N     1 
ATOM   9002  C  CA    . SER I  5  403  ? 47.886  101.955 -15.775 1.00 28.52  ? 403  SER C CA    1 
ATOM   9003  C  C     . SER I