data_2PPH
# 
_entry.id   2PPH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2PPH         
RCSB  RCSB042639   
WWPDB D_1000042639 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2PPH 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hu, Q.'    1 
'Zhang, J.' 2 
'Wu, J.'    3 
'Shi, Y.'   4 
# 
_citation.id                        primary 
_citation.title                     'Insight into the Binding Properties of MEKK3 PB1 to MEK5 PB1 from Its Solution Structure.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                13478 
_citation.page_last                 13489 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17985933 
_citation.pdbx_database_id_DOI      10.1021/bi701341n 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hu, Q.'    1 
primary 'Shen, W.'  2 
primary 'Huang, H.' 3 
primary 'Liu, J.'   4 
primary 'Zhang, J.' 5 
primary 'Huang, X.' 6 
primary 'Wu, J.'    7 
primary 'Shi, Y.'   8 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Mitogen-activated protein kinase kinase kinase 3' 
_entity.formula_weight             11186.697 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    2.7.11.25 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PB1 domain (Residues 42-126)' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MAPK/ERK kinase kinase 3, MEK kinase 3, MEKK 3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILL
LSQDRNLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILL
LSQDRNLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  GLN n 
1 3  SER n 
1 4  ASP n 
1 5  VAL n 
1 6  ARG n 
1 7  ILE n 
1 8  LYS n 
1 9  PHE n 
1 10 GLU n 
1 11 HIS n 
1 12 ASN n 
1 13 GLY n 
1 14 GLU n 
1 15 ARG n 
1 16 ARG n 
1 17 ILE n 
1 18 ILE n 
1 19 ALA n 
1 20 PHE n 
1 21 SER n 
1 22 ARG n 
1 23 PRO n 
1 24 VAL n 
1 25 LYS n 
1 26 TYR n 
1 27 GLU n 
1 28 ASP n 
1 29 VAL n 
1 30 GLU n 
1 31 HIS n 
1 32 LYS n 
1 33 VAL n 
1 34 THR n 
1 35 THR n 
1 36 VAL n 
1 37 PHE n 
1 38 GLY n 
1 39 GLN n 
1 40 PRO n 
1 41 LEU n 
1 42 ASP n 
1 43 LEU n 
1 44 HIS n 
1 45 TYR n 
1 46 MET n 
1 47 ASN n 
1 48 ASN n 
1 49 GLU n 
1 50 LEU n 
1 51 SER n 
1 52 ILE n 
1 53 LEU n 
1 54 LEU n 
1 55 LYS n 
1 56 ASN n 
1 57 GLN n 
1 58 ASP n 
1 59 ASP n 
1 60 LEU n 
1 61 ASP n 
1 62 LYS n 
1 63 ALA n 
1 64 ILE n 
1 65 ASP n 
1 66 ILE n 
1 67 LEU n 
1 68 ASP n 
1 69 ARG n 
1 70 SER n 
1 71 SER n 
1 72 SER n 
1 73 MET n 
1 74 LYS n 
1 75 SER n 
1 76 LEU n 
1 77 ARG n 
1 78 ILE n 
1 79 LEU n 
1 80 LEU n 
1 81 LEU n 
1 82 SER n 
1 83 GLN n 
1 84 ASP n 
1 85 ARG n 
1 86 ASN n 
1 87 LEU n 
1 88 GLU n 
1 89 HIS n 
1 90 HIS n 
1 91 HIS n 
1 92 HIS n 
1 93 HIS n 
1 94 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 MEKK3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    M3K3_HUMAN 
_struct_ref.pdbx_db_accession          Q99759 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLL
SQDRN
;
_struct_ref.pdbx_align_begin           42 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2PPH 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 86 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q99759 
_struct_ref_seq.db_align_beg                  42 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  126 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       85 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2PPH MET A 1  ? UNP Q99759 ? ? 'CLONING ARTIFACT' 0  1 
1 2PPH LEU A 87 ? UNP Q99759 ? ? 'EXPRESSION TAG'   86 2 
1 2PPH GLU A 88 ? UNP Q99759 ? ? 'EXPRESSION TAG'   87 3 
1 2PPH HIS A 89 ? UNP Q99759 ? ? 'EXPRESSION TAG'   88 4 
1 2PPH HIS A 90 ? UNP Q99759 ? ? 'EXPRESSION TAG'   89 5 
1 2PPH HIS A 91 ? UNP Q99759 ? ? 'EXPRESSION TAG'   90 6 
1 2PPH HIS A 92 ? UNP Q99759 ? ? 'EXPRESSION TAG'   91 7 
1 2PPH HIS A 93 ? UNP Q99759 ? ? 'EXPRESSION TAG'   92 8 
1 2PPH HIS A 94 ? UNP Q99759 ? ? 'EXPRESSION TAG'   93 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY 1 
2 1 3D_15N-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;0.5mM 15N,13C-labeled MEKK3 PB1 
50mM phosphate buffer (pH 6.0), 1mM EDTA,10%(v/v) D2O
;
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DMX Bruker 600 ? 
2 DMX Bruker 500 ? 
# 
_pdbx_nmr_refine.entry_id           2PPH 
_pdbx_nmr_refine.method             'Distance geometry, simulated annealing, molecular dynamics, torsion angle dynamics' 
_pdbx_nmr_refine.details            
;the structures are based on a total of 1335 restraints, 1197 are NOE-derived 
distance constraints, 110 dihedral angle restraints,28 distance restraints  
from hydrogen bonds.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2PPH 
_pdbx_nmr_details.text       'The structure was determined using triple-resonance NMR spectroscopy' 
# 
_pdbx_nmr_ensemble.entry_id                                      2PPH 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2PPH 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
processing           NMRPipe 2.2  F.Delaglio         1 
'structure solution' CNS     1.1  A.T.Brunger        2 
'data analysis'      Csi     1.0  'David S. Wishart' 3 
'data analysis'      Molmol  2k.2 Koradi             4 
refinement           CNS     1.1  A.T.Brunger        5 
# 
_exptl.entry_id          2PPH 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2PPH 
_struct.title                     'solution structure of human MEKK3 PB1 domain' 
_struct.pdbx_descriptor           'Mitogen-activated protein kinase kinase kinase 3 (E.C.2.7.11.25)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2PPH 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'kinase signaling domain, TRANSFERASE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 25 ? GLY A 38 ? LYS A 24 GLY A 37 1 ? 14 
HELX_P HELX_P2 2 ASN A 56 ? SER A 70 ? ASN A 55 SER A 69 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 1  0.08  
2  ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 2  0.07  
3  ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 3  0.03  
4  ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 4  -0.03 
5  ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 5  -0.13 
6  ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 6  0.05  
7  ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 7  -0.02 
8  ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 8  0.03  
9  ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 9  0.24  
10 ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 10 0.18  
11 ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 11 0.15  
12 ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 12 0.22  
13 ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 13 -0.15 
14 ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 14 0.18  
15 ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 15 0.31  
16 ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 16 0.12  
17 ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 17 -0.09 
18 ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 18 -0.11 
19 ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 19 -0.09 
20 ARG 22 A . ? ARG 21 A PRO 23 A ? PRO 22 A 20 0.12  
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 14 ? PHE A 20 ? GLU A 13 PHE A 19 
A 2 VAL A 5  ? HIS A 11 ? VAL A 4  HIS A 10 
A 3 LEU A 76 ? SER A 82 ? LEU A 75 SER A 81 
A 4 LEU A 41 ? MET A 46 ? LEU A 40 MET A 45 
A 5 SER A 51 ? LEU A 53 ? SER A 50 LEU A 52 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 20 ? O PHE A 19 N VAL A 5  ? N VAL A 4  
A 2 3 N LYS A 8  ? N LYS A 7  O LEU A 76 ? O LEU A 75 
A 3 4 O LEU A 81 ? O LEU A 80 N ASP A 42 ? N ASP A 41 
A 4 5 N TYR A 45 ? N TYR A 44 O ILE A 52 ? O ILE A 51 
# 
_database_PDB_matrix.entry_id          2PPH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2PPH 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLN A 1 2  ? 139.708 -9.918  10.555  1.00 0.00 ? 1  GLN A N    1  
ATOM 2     C CA   . GLN A 1 2  ? 141.115 -9.544  10.875  1.00 0.00 ? 1  GLN A CA   1  
ATOM 3     C C    . GLN A 1 2  ? 142.003 -9.525  9.622   1.00 0.00 ? 1  GLN A C    1  
ATOM 4     O O    . GLN A 1 2  ? 143.150 -9.975  9.659   1.00 0.00 ? 1  GLN A O    1  
ATOM 5     C CB   . GLN A 1 2  ? 141.656 -10.554 11.898  1.00 0.00 ? 1  GLN A CB   1  
ATOM 6     C CG   . GLN A 1 2  ? 141.329 -10.197 13.343  1.00 0.00 ? 1  GLN A CG   1  
ATOM 7     C CD   . GLN A 1 2  ? 141.984 -11.128 14.352  1.00 0.00 ? 1  GLN A CD   1  
ATOM 8     O OE1  . GLN A 1 2  ? 142.022 -12.343 14.161  1.00 0.00 ? 1  GLN A OE1  1  
ATOM 9     N NE2  . GLN A 1 2  ? 142.497 -10.558 15.438  1.00 0.00 ? 1  GLN A NE2  1  
ATOM 10    H HA   . GLN A 1 2  ? 141.114 -8.560  11.316  1.00 0.00 ? 1  GLN A HA   1  
ATOM 11    H HB2  . GLN A 1 2  ? 141.230 -11.523 11.686  1.00 0.00 ? 1  GLN A HB2  1  
ATOM 12    H HB3  . GLN A 1 2  ? 142.729 -10.613 11.797  1.00 0.00 ? 1  GLN A HB3  1  
ATOM 13    H HG2  . GLN A 1 2  ? 141.667 -9.190  13.535  1.00 0.00 ? 1  GLN A HG2  1  
ATOM 14    H HG3  . GLN A 1 2  ? 140.259 -10.247 13.476  1.00 0.00 ? 1  GLN A HG3  1  
ATOM 15    H HE21 . GLN A 1 2  ? 142.428 -9.584  15.529  1.00 0.00 ? 1  GLN A HE21 1  
ATOM 16    H HE22 . GLN A 1 2  ? 142.922 -11.135 16.106  1.00 0.00 ? 1  GLN A HE22 1  
ATOM 17    N N    . SER A 1 3  ? 141.473 -8.999  8.516   1.00 0.00 ? 2  SER A N    1  
ATOM 18    C CA   . SER A 1 3  ? 142.232 -8.927  7.271   1.00 0.00 ? 2  SER A CA   1  
ATOM 19    C C    . SER A 1 3  ? 141.802 -7.722  6.435   1.00 0.00 ? 2  SER A C    1  
ATOM 20    O O    . SER A 1 3  ? 141.049 -7.859  5.468   1.00 0.00 ? 2  SER A O    1  
ATOM 21    C CB   . SER A 1 3  ? 142.068 -10.224 6.464   1.00 0.00 ? 2  SER A CB   1  
ATOM 22    O OG   . SER A 1 3  ? 140.709 -10.461 6.121   1.00 0.00 ? 2  SER A OG   1  
ATOM 23    H H    . SER A 1 3  ? 140.558 -8.650  8.538   1.00 0.00 ? 2  SER A H    1  
ATOM 24    H HA   . SER A 1 3  ? 143.273 -8.809  7.533   1.00 0.00 ? 2  SER A HA   1  
ATOM 25    H HB2  . SER A 1 3  ? 142.646 -10.153 5.555   1.00 0.00 ? 2  SER A HB2  1  
ATOM 26    H HB3  . SER A 1 3  ? 142.425 -11.057 7.053   1.00 0.00 ? 2  SER A HB3  1  
ATOM 27    H HG   . SER A 1 3  ? 140.143 -10.188 6.845   1.00 0.00 ? 2  SER A HG   1  
ATOM 28    N N    . ASP A 1 4  ? 142.284 -6.542  6.822   1.00 0.00 ? 3  ASP A N    1  
ATOM 29    C CA   . ASP A 1 4  ? 141.951 -5.303  6.121   1.00 0.00 ? 3  ASP A CA   1  
ATOM 30    C C    . ASP A 1 4  ? 142.823 -4.145  6.607   1.00 0.00 ? 3  ASP A C    1  
ATOM 31    O O    . ASP A 1 4  ? 142.396 -3.327  7.425   1.00 0.00 ? 3  ASP A O    1  
ATOM 32    C CB   . ASP A 1 4  ? 140.460 -4.967  6.292   1.00 0.00 ? 3  ASP A CB   1  
ATOM 33    C CG   . ASP A 1 4  ? 140.025 -4.824  7.746   1.00 0.00 ? 3  ASP A CG   1  
ATOM 34    O OD1  . ASP A 1 4  ? 140.527 -5.580  8.604   1.00 0.00 ? 3  ASP A OD1  1  
ATOM 35    O OD2  . ASP A 1 4  ? 139.172 -3.953  8.022   1.00 0.00 ? 3  ASP A OD2  1  
ATOM 36    H H    . ASP A 1 4  ? 142.874 -6.502  7.603   1.00 0.00 ? 3  ASP A H    1  
ATOM 37    H HA   . ASP A 1 4  ? 142.152 -5.459  5.072   1.00 0.00 ? 3  ASP A HA   1  
ATOM 38    H HB2  . ASP A 1 4  ? 140.254 -4.034  5.791   1.00 0.00 ? 3  ASP A HB2  1  
ATOM 39    H HB3  . ASP A 1 4  ? 139.871 -5.749  5.835   1.00 0.00 ? 3  ASP A HB3  1  
ATOM 40    N N    . VAL A 1 5  ? 144.049 -4.085  6.088   1.00 0.00 ? 4  VAL A N    1  
ATOM 41    C CA   . VAL A 1 5  ? 144.992 -3.029  6.451   1.00 0.00 ? 4  VAL A CA   1  
ATOM 42    C C    . VAL A 1 5  ? 144.720 -1.759  5.647   1.00 0.00 ? 4  VAL A C    1  
ATOM 43    O O    . VAL A 1 5  ? 144.522 -1.817  4.433   1.00 0.00 ? 4  VAL A O    1  
ATOM 44    C CB   . VAL A 1 5  ? 146.459 -3.460  6.219   1.00 0.00 ? 4  VAL A CB   1  
ATOM 45    C CG1  . VAL A 1 5  ? 147.406 -2.421  6.803   1.00 0.00 ? 4  VAL A CG1  1  
ATOM 46    C CG2  . VAL A 1 5  ? 146.724 -4.831  6.827   1.00 0.00 ? 4  VAL A CG2  1  
ATOM 47    H H    . VAL A 1 5  ? 144.324 -4.765  5.437   1.00 0.00 ? 4  VAL A H    1  
ATOM 48    H HA   . VAL A 1 5  ? 144.864 -2.815  7.504   1.00 0.00 ? 4  VAL A HA   1  
ATOM 49    H HB   . VAL A 1 5  ? 146.635 -3.519  5.154   1.00 0.00 ? 4  VAL A HB   1  
ATOM 50    H HG11 . VAL A 1 5  ? 148.348 -2.452  6.277   1.00 0.00 ? 4  VAL A HG11 1  
ATOM 51    H HG12 . VAL A 1 5  ? 147.571 -2.632  7.849   1.00 0.00 ? 4  VAL A HG12 1  
ATOM 52    H HG13 . VAL A 1 5  ? 146.969 -1.438  6.700   1.00 0.00 ? 4  VAL A HG13 1  
ATOM 53    H HG21 . VAL A 1 5  ? 147.759 -5.100  6.676   1.00 0.00 ? 4  VAL A HG21 1  
ATOM 54    H HG22 . VAL A 1 5  ? 146.088 -5.564  6.356   1.00 0.00 ? 4  VAL A HG22 1  
ATOM 55    H HG23 . VAL A 1 5  ? 146.512 -4.799  7.886   1.00 0.00 ? 4  VAL A HG23 1  
ATOM 56    N N    . ARG A 1 6  ? 144.720 -0.614  6.327   1.00 0.00 ? 5  ARG A N    1  
ATOM 57    C CA   . ARG A 1 6  ? 144.481 0.670   5.670   1.00 0.00 ? 5  ARG A CA   1  
ATOM 58    C C    . ARG A 1 6  ? 145.805 1.373   5.369   1.00 0.00 ? 5  ARG A C    1  
ATOM 59    O O    . ARG A 1 6  ? 146.522 1.780   6.286   1.00 0.00 ? 5  ARG A O    1  
ATOM 60    C CB   . ARG A 1 6  ? 143.601 1.568   6.547   1.00 0.00 ? 5  ARG A CB   1  
ATOM 61    C CG   . ARG A 1 6  ? 142.669 2.474   5.757   1.00 0.00 ? 5  ARG A CG   1  
ATOM 62    C CD   . ARG A 1 6  ? 141.750 3.264   6.677   1.00 0.00 ? 5  ARG A CD   1  
ATOM 63    N NE   . ARG A 1 6  ? 140.490 2.564   6.922   1.00 0.00 ? 5  ARG A NE   1  
ATOM 64    C CZ   . ARG A 1 6  ? 140.282 1.723   7.942   1.00 0.00 ? 5  ARG A CZ   1  
ATOM 65    N NH1  . ARG A 1 6  ? 141.247 1.472   8.826   1.00 0.00 ? 5  ARG A NH1  1  
ATOM 66    N NH2  . ARG A 1 6  ? 139.102 1.129   8.079   1.00 0.00 ? 5  ARG A NH2  1  
ATOM 67    H H    . ARG A 1 6  ? 144.888 -0.632  7.294   1.00 0.00 ? 5  ARG A H    1  
ATOM 68    H HA   . ARG A 1 6  ? 143.968 0.476   4.739   1.00 0.00 ? 5  ARG A HA   1  
ATOM 69    H HB2  . ARG A 1 6  ? 142.999 0.943   7.191   1.00 0.00 ? 5  ARG A HB2  1  
ATOM 70    H HB3  . ARG A 1 6  ? 144.239 2.190   7.158   1.00 0.00 ? 5  ARG A HB3  1  
ATOM 71    H HG2  . ARG A 1 6  ? 143.261 3.166   5.175   1.00 0.00 ? 5  ARG A HG2  1  
ATOM 72    H HG3  . ARG A 1 6  ? 142.068 1.867   5.095   1.00 0.00 ? 5  ARG A HG3  1  
ATOM 73    H HD2  . ARG A 1 6  ? 142.253 3.424   7.618   1.00 0.00 ? 5  ARG A HD2  1  
ATOM 74    H HD3  . ARG A 1 6  ? 141.537 4.219   6.219   1.00 0.00 ? 5  ARG A HD3  1  
ATOM 75    H HE   . ARG A 1 6  ? 139.756 2.727   6.292   1.00 0.00 ? 5  ARG A HE   1  
ATOM 76    H HH11 . ARG A 1 6  ? 142.140 1.913   8.735   1.00 0.00 ? 5  ARG A HH11 1  
ATOM 77    H HH12 . ARG A 1 6  ? 141.079 0.840   9.583   1.00 0.00 ? 5  ARG A HH12 1  
ATOM 78    H HH21 . ARG A 1 6  ? 138.371 1.311   7.421   1.00 0.00 ? 5  ARG A HH21 1  
ATOM 79    H HH22 . ARG A 1 6  ? 138.943 0.499   8.839   1.00 0.00 ? 5  ARG A HH22 1  
ATOM 80    N N    . ILE A 1 7  ? 146.128 1.510   4.082   1.00 0.00 ? 6  ILE A N    1  
ATOM 81    C CA   . ILE A 1 7  ? 147.370 2.161   3.664   1.00 0.00 ? 6  ILE A CA   1  
ATOM 82    C C    . ILE A 1 7  ? 147.086 3.458   2.906   1.00 0.00 ? 6  ILE A C    1  
ATOM 83    O O    . ILE A 1 7  ? 146.229 3.494   2.018   1.00 0.00 ? 6  ILE A O    1  
ATOM 84    C CB   . ILE A 1 7  ? 148.226 1.231   2.770   1.00 0.00 ? 6  ILE A CB   1  
ATOM 85    C CG1  . ILE A 1 7  ? 148.380 -0.149  3.417   1.00 0.00 ? 6  ILE A CG1  1  
ATOM 86    C CG2  . ILE A 1 7  ? 149.595 1.849   2.503   1.00 0.00 ? 6  ILE A CG2  1  
ATOM 87    C CD1  . ILE A 1 7  ? 147.266 -1.109  3.062   1.00 0.00 ? 6  ILE A CD1  1  
ATOM 88    H H    . ILE A 1 7  ? 145.518 1.163   3.396   1.00 0.00 ? 6  ILE A H    1  
ATOM 89    H HA   . ILE A 1 7  ? 147.938 2.394   4.553   1.00 0.00 ? 6  ILE A HA   1  
ATOM 90    H HB   . ILE A 1 7  ? 147.721 1.120   1.822   1.00 0.00 ? 6  ILE A HB   1  
ATOM 91    H HG12 . ILE A 1 7  ? 149.311 -0.590  3.092   1.00 0.00 ? 6  ILE A HG12 1  
ATOM 92    H HG13 . ILE A 1 7  ? 148.395 -0.038  4.492   1.00 0.00 ? 6  ILE A HG13 1  
ATOM 93    H HG21 . ILE A 1 7  ? 149.522 2.925   2.543   1.00 0.00 ? 6  ILE A HG21 1  
ATOM 94    H HG22 . ILE A 1 7  ? 149.938 1.548   1.525   1.00 0.00 ? 6  ILE A HG22 1  
ATOM 95    H HG23 . ILE A 1 7  ? 150.296 1.507   3.249   1.00 0.00 ? 6  ILE A HG23 1  
ATOM 96    H HD11 . ILE A 1 7  ? 146.390 -0.873  3.645   1.00 0.00 ? 6  ILE A HD11 1  
ATOM 97    H HD12 . ILE A 1 7  ? 147.579 -2.120  3.275   1.00 0.00 ? 6  ILE A HD12 1  
ATOM 98    H HD13 . ILE A 1 7  ? 147.034 -1.017  2.011   1.00 0.00 ? 6  ILE A HD13 1  
ATOM 99    N N    . LYS A 1 8  ? 147.814 4.519   3.258   1.00 0.00 ? 7  LYS A N    1  
ATOM 100   C CA   . LYS A 1 8  ? 147.647 5.818   2.612   1.00 0.00 ? 7  LYS A CA   1  
ATOM 101   C C    . LYS A 1 8  ? 148.794 6.094   1.638   1.00 0.00 ? 7  LYS A C    1  
ATOM 102   O O    . LYS A 1 8  ? 149.949 6.235   2.046   1.00 0.00 ? 7  LYS A O    1  
ATOM 103   C CB   . LYS A 1 8  ? 147.568 6.929   3.665   1.00 0.00 ? 7  LYS A CB   1  
ATOM 104   C CG   . LYS A 1 8  ? 146.147 7.250   4.105   1.00 0.00 ? 7  LYS A CG   1  
ATOM 105   C CD   . LYS A 1 8  ? 146.116 7.877   5.492   1.00 0.00 ? 7  LYS A CD   1  
ATOM 106   C CE   . LYS A 1 8  ? 145.114 9.020   5.564   1.00 0.00 ? 7  LYS A CE   1  
ATOM 107   N NZ   . LYS A 1 8  ? 145.267 9.820   6.812   1.00 0.00 ? 7  LYS A NZ   1  
ATOM 108   H H    . LYS A 1 8  ? 148.482 4.424   3.970   1.00 0.00 ? 7  LYS A H    1  
ATOM 109   H HA   . LYS A 1 8  ? 146.721 5.795   2.057   1.00 0.00 ? 7  LYS A HA   1  
ATOM 110   H HB2  . LYS A 1 8  ? 148.132 6.626   4.535   1.00 0.00 ? 7  LYS A HB2  1  
ATOM 111   H HB3  . LYS A 1 8  ? 148.008 7.828   3.258   1.00 0.00 ? 7  LYS A HB3  1  
ATOM 112   H HG2  . LYS A 1 8  ? 145.709 7.940   3.400   1.00 0.00 ? 7  LYS A HG2  1  
ATOM 113   H HG3  . LYS A 1 8  ? 145.570 6.336   4.121   1.00 0.00 ? 7  LYS A HG3  1  
ATOM 114   H HD2  . LYS A 1 8  ? 145.837 7.122   6.212   1.00 0.00 ? 7  LYS A HD2  1  
ATOM 115   H HD3  . LYS A 1 8  ? 147.100 8.256   5.727   1.00 0.00 ? 7  LYS A HD3  1  
ATOM 116   H HE2  . LYS A 1 8  ? 145.264 9.667   4.713   1.00 0.00 ? 7  LYS A HE2  1  
ATOM 117   H HE3  . LYS A 1 8  ? 144.116 8.608   5.532   1.00 0.00 ? 7  LYS A HE3  1  
ATOM 118   H HZ1  . LYS A 1 8  ? 145.035 10.817  6.629   1.00 0.00 ? 7  LYS A HZ1  1  
ATOM 119   H HZ2  . LYS A 1 8  ? 146.247 9.763   7.158   1.00 0.00 ? 7  LYS A HZ2  1  
ATOM 120   H HZ3  . LYS A 1 8  ? 144.631 9.457   7.550   1.00 0.00 ? 7  LYS A HZ3  1  
ATOM 121   N N    . PHE A 1 9  ? 148.463 6.170   0.348   1.00 0.00 ? 8  PHE A N    1  
ATOM 122   C CA   . PHE A 1 9  ? 149.456 6.427   -0.696  1.00 0.00 ? 8  PHE A CA   1  
ATOM 123   C C    . PHE A 1 9  ? 149.396 7.880   -1.169  1.00 0.00 ? 8  PHE A C    1  
ATOM 124   O O    . PHE A 1 9  ? 148.316 8.466   -1.259  1.00 0.00 ? 8  PHE A O    1  
ATOM 125   C CB   . PHE A 1 9  ? 149.226 5.486   -1.882  1.00 0.00 ? 8  PHE A CB   1  
ATOM 126   C CG   . PHE A 1 9  ? 149.577 4.052   -1.596  1.00 0.00 ? 8  PHE A CG   1  
ATOM 127   C CD1  . PHE A 1 9  ? 150.895 3.624   -1.644  1.00 0.00 ? 8  PHE A CD1  1  
ATOM 128   C CD2  . PHE A 1 9  ? 148.589 3.132   -1.279  1.00 0.00 ? 8  PHE A CD2  1  
ATOM 129   C CE1  . PHE A 1 9  ? 151.220 2.306   -1.386  1.00 0.00 ? 8  PHE A CE1  1  
ATOM 130   C CE2  . PHE A 1 9  ? 148.908 1.813   -1.020  1.00 0.00 ? 8  PHE A CE2  1  
ATOM 131   C CZ   . PHE A 1 9  ? 150.226 1.400   -1.072  1.00 0.00 ? 8  PHE A CZ   1  
ATOM 132   H H    . PHE A 1 9  ? 147.525 6.047   0.090   1.00 0.00 ? 8  PHE A H    1  
ATOM 133   H HA   . PHE A 1 9  ? 150.434 6.234   -0.280  1.00 0.00 ? 8  PHE A HA   1  
ATOM 134   H HB2  . PHE A 1 9  ? 148.183 5.522   -2.164  1.00 0.00 ? 8  PHE A HB2  1  
ATOM 135   H HB3  . PHE A 1 9  ? 149.828 5.817   -2.714  1.00 0.00 ? 8  PHE A HB3  1  
ATOM 136   H HD1  . PHE A 1 9  ? 151.673 4.332   -1.888  1.00 0.00 ? 8  PHE A HD1  1  
ATOM 137   H HD2  . PHE A 1 9  ? 147.559 3.455   -1.237  1.00 0.00 ? 8  PHE A HD2  1  
ATOM 138   H HE1  . PHE A 1 9  ? 152.249 1.986   -1.427  1.00 0.00 ? 8  PHE A HE1  1  
ATOM 139   H HE2  . PHE A 1 9  ? 148.129 1.106   -0.775  1.00 0.00 ? 8  PHE A HE2  1  
ATOM 140   H HZ   . PHE A 1 9  ? 150.477 0.369   -0.870  1.00 0.00 ? 8  PHE A HZ   1  
ATOM 141   N N    . GLU A 1 10 ? 150.564 8.453   -1.475  1.00 0.00 ? 9  GLU A N    1  
ATOM 142   C CA   . GLU A 1 10 ? 150.642 9.837   -1.942  1.00 0.00 ? 9  GLU A CA   1  
ATOM 143   C C    . GLU A 1 10 ? 151.540 9.959   -3.174  1.00 0.00 ? 9  GLU A C    1  
ATOM 144   O O    . GLU A 1 10 ? 152.675 9.479   -3.178  1.00 0.00 ? 9  GLU A O    1  
ATOM 145   C CB   . GLU A 1 10 ? 151.163 10.751  -0.828  1.00 0.00 ? 9  GLU A CB   1  
ATOM 146   C CG   . GLU A 1 10 ? 151.016 12.235  -1.141  1.00 0.00 ? 9  GLU A CG   1  
ATOM 147   C CD   . GLU A 1 10 ? 151.632 13.128  -0.080  1.00 0.00 ? 9  GLU A CD   1  
ATOM 148   O OE1  . GLU A 1 10 ? 151.304 12.950  1.113   1.00 0.00 ? 9  GLU A OE1  1  
ATOM 149   O OE2  . GLU A 1 10 ? 152.440 14.009  -0.442  1.00 0.00 ? 9  GLU A OE2  1  
ATOM 150   H H    . GLU A 1 10 ? 151.390 7.933   -1.385  1.00 0.00 ? 9  GLU A H    1  
ATOM 151   H HA   . GLU A 1 10 ? 149.643 10.149  -2.211  1.00 0.00 ? 9  GLU A HA   1  
ATOM 152   H HB2  . GLU A 1 10 ? 150.616 10.540  0.079   1.00 0.00 ? 9  GLU A HB2  1  
ATOM 153   H HB3  . GLU A 1 10 ? 152.210 10.541  -0.664  1.00 0.00 ? 9  GLU A HB3  1  
ATOM 154   H HG2  . GLU A 1 10 ? 151.502 12.439  -2.083  1.00 0.00 ? 9  GLU A HG2  1  
ATOM 155   H HG3  . GLU A 1 10 ? 149.965 12.470  -1.222  1.00 0.00 ? 9  GLU A HG3  1  
ATOM 156   N N    . HIS A 1 11 ? 151.020 10.613  -4.213  1.00 0.00 ? 10 HIS A N    1  
ATOM 157   C CA   . HIS A 1 11 ? 151.762 10.815  -5.453  1.00 0.00 ? 10 HIS A CA   1  
ATOM 158   C C    . HIS A 1 11 ? 151.530 12.225  -5.992  1.00 0.00 ? 10 HIS A C    1  
ATOM 159   O O    . HIS A 1 11 ? 150.408 12.578  -6.363  1.00 0.00 ? 10 HIS A O    1  
ATOM 160   C CB   . HIS A 1 11 ? 151.341 9.779   -6.499  1.00 0.00 ? 10 HIS A CB   1  
ATOM 161   C CG   . HIS A 1 11 ? 152.398 9.486   -7.519  1.00 0.00 ? 10 HIS A CG   1  
ATOM 162   N ND1  . HIS A 1 11 ? 152.107 9.130   -8.819  1.00 0.00 ? 10 HIS A ND1  1  
ATOM 163   C CD2  . HIS A 1 11 ? 153.750 9.495   -7.428  1.00 0.00 ? 10 HIS A CD2  1  
ATOM 164   C CE1  . HIS A 1 11 ? 153.231 8.933   -9.482  1.00 0.00 ? 10 HIS A CE1  1  
ATOM 165   N NE2  . HIS A 1 11 ? 154.243 9.150   -8.662  1.00 0.00 ? 10 HIS A NE2  1  
ATOM 166   H H    . HIS A 1 11 ? 150.111 10.975  -4.140  1.00 0.00 ? 10 HIS A H    1  
ATOM 167   H HA   . HIS A 1 11 ? 152.813 10.691  -5.236  1.00 0.00 ? 10 HIS A HA   1  
ATOM 168   H HB2  . HIS A 1 11 ? 151.096 8.853   -6.001  1.00 0.00 ? 10 HIS A HB2  1  
ATOM 169   H HB3  . HIS A 1 11 ? 150.468 10.142  -7.021  1.00 0.00 ? 10 HIS A HB3  1  
ATOM 170   H HD1  . HIS A 1 11 ? 151.209 9.039   -9.199  1.00 0.00 ? 10 HIS A HD1  1  
ATOM 171   H HD2  . HIS A 1 11 ? 154.332 9.732   -6.548  1.00 0.00 ? 10 HIS A HD2  1  
ATOM 172   H HE1  . HIS A 1 11 ? 153.309 8.640   -10.519 1.00 0.00 ? 10 HIS A HE1  1  
ATOM 173   H HE2  . HIS A 1 11 ? 155.183 9.210   -8.933  1.00 0.00 ? 10 HIS A HE2  1  
ATOM 174   N N    . ASN A 1 12 ? 152.595 13.028  -6.027  1.00 0.00 ? 11 ASN A N    1  
ATOM 175   C CA   . ASN A 1 12 ? 152.517 14.407  -6.516  1.00 0.00 ? 11 ASN A CA   1  
ATOM 176   C C    . ASN A 1 12 ? 151.514 15.230  -5.699  1.00 0.00 ? 11 ASN A C    1  
ATOM 177   O O    . ASN A 1 12 ? 150.838 16.114  -6.232  1.00 0.00 ? 11 ASN A O    1  
ATOM 178   C CB   . ASN A 1 12 ? 152.142 14.427  -8.003  1.00 0.00 ? 11 ASN A CB   1  
ATOM 179   C CG   . ASN A 1 12 ? 153.200 15.107  -8.854  1.00 0.00 ? 11 ASN A CG   1  
ATOM 180   O OD1  . ASN A 1 12 ? 152.924 16.097  -9.533  1.00 0.00 ? 11 ASN A OD1  1  
ATOM 181   N ND2  . ASN A 1 12 ? 154.420 14.580  -8.820  1.00 0.00 ? 11 ASN A ND2  1  
ATOM 182   H H    . ASN A 1 12 ? 153.459 12.685  -5.715  1.00 0.00 ? 11 ASN A H    1  
ATOM 183   H HA   . ASN A 1 12 ? 153.496 14.850  -6.401  1.00 0.00 ? 11 ASN A HA   1  
ATOM 184   H HB2  . ASN A 1 12 ? 152.025 13.412  -8.353  1.00 0.00 ? 11 ASN A HB2  1  
ATOM 185   H HB3  . ASN A 1 12 ? 151.209 14.956  -8.130  1.00 0.00 ? 11 ASN A HB3  1  
ATOM 186   H HD21 . ASN A 1 12 ? 154.569 13.791  -8.256  1.00 0.00 ? 11 ASN A HD21 1  
ATOM 187   H HD22 . ASN A 1 12 ? 155.121 15.002  -9.359  1.00 0.00 ? 11 ASN A HD22 1  
ATOM 188   N N    . GLY A 1 13 ? 151.424 14.934  -4.400  1.00 0.00 ? 12 GLY A N    1  
ATOM 189   C CA   . GLY A 1 13 ? 150.503 15.652  -3.529  1.00 0.00 ? 12 GLY A CA   1  
ATOM 190   C C    . GLY A 1 13 ? 149.118 15.017  -3.463  1.00 0.00 ? 12 GLY A C    1  
ATOM 191   O O    . GLY A 1 13 ? 148.324 15.349  -2.579  1.00 0.00 ? 12 GLY A O    1  
ATOM 192   H H    . GLY A 1 13 ? 151.987 14.223  -4.028  1.00 0.00 ? 12 GLY A H    1  
ATOM 193   H HA2  . GLY A 1 13 ? 150.921 15.680  -2.534  1.00 0.00 ? 12 GLY A HA2  1  
ATOM 194   H HA3  . GLY A 1 13 ? 150.403 16.664  -3.890  1.00 0.00 ? 12 GLY A HA3  1  
ATOM 195   N N    . GLU A 1 14 ? 148.825 14.104  -4.392  1.00 0.00 ? 13 GLU A N    1  
ATOM 196   C CA   . GLU A 1 14 ? 147.531 13.427  -4.429  1.00 0.00 ? 13 GLU A CA   1  
ATOM 197   C C    . GLU A 1 14 ? 147.530 12.215  -3.497  1.00 0.00 ? 13 GLU A C    1  
ATOM 198   O O    . GLU A 1 14 ? 148.327 11.291  -3.668  1.00 0.00 ? 13 GLU A O    1  
ATOM 199   C CB   . GLU A 1 14 ? 147.207 12.997  -5.864  1.00 0.00 ? 13 GLU A CB   1  
ATOM 200   C CG   . GLU A 1 14 ? 145.860 12.309  -6.016  1.00 0.00 ? 13 GLU A CG   1  
ATOM 201   C CD   . GLU A 1 14 ? 144.792 13.229  -6.578  1.00 0.00 ? 13 GLU A CD   1  
ATOM 202   O OE1  . GLU A 1 14 ? 144.907 13.623  -7.758  1.00 0.00 ? 13 GLU A OE1  1  
ATOM 203   O OE2  . GLU A 1 14 ? 143.841 13.553  -5.838  1.00 0.00 ? 13 GLU A OE2  1  
ATOM 204   H H    . GLU A 1 14 ? 149.495 13.877  -5.069  1.00 0.00 ? 13 GLU A H    1  
ATOM 205   H HA   . GLU A 1 14 ? 146.781 14.127  -4.093  1.00 0.00 ? 13 GLU A HA   1  
ATOM 206   H HB2  . GLU A 1 14 ? 147.211 13.873  -6.496  1.00 0.00 ? 13 GLU A HB2  1  
ATOM 207   H HB3  . GLU A 1 14 ? 147.974 12.317  -6.207  1.00 0.00 ? 13 GLU A HB3  1  
ATOM 208   H HG2  . GLU A 1 14 ? 145.974 11.468  -6.683  1.00 0.00 ? 13 GLU A HG2  1  
ATOM 209   H HG3  . GLU A 1 14 ? 145.538 11.957  -5.047  1.00 0.00 ? 13 GLU A HG3  1  
ATOM 210   N N    . ARG A 1 15 ? 146.637 12.230  -2.505  1.00 0.00 ? 14 ARG A N    1  
ATOM 211   C CA   . ARG A 1 15 ? 146.541 11.134  -1.540  1.00 0.00 ? 14 ARG A CA   1  
ATOM 212   C C    . ARG A 1 15 ? 145.390 10.192  -1.887  1.00 0.00 ? 14 ARG A C    1  
ATOM 213   O O    . ARG A 1 15 ? 144.375 10.615  -2.443  1.00 0.00 ? 14 ARG A O    1  
ATOM 214   C CB   . ARG A 1 15 ? 146.354 11.678  -0.120  1.00 0.00 ? 14 ARG A CB   1  
ATOM 215   C CG   . ARG A 1 15 ? 147.543 12.474  0.391   1.00 0.00 ? 14 ARG A CG   1  
ATOM 216   C CD   . ARG A 1 15 ? 147.339 13.970  0.204   1.00 0.00 ? 14 ARG A CD   1  
ATOM 217   N NE   . ARG A 1 15 ? 148.500 14.740  0.646   1.00 0.00 ? 14 ARG A NE   1  
ATOM 218   C CZ   . ARG A 1 15 ? 148.796 14.981  1.927   1.00 0.00 ? 14 ARG A CZ   1  
ATOM 219   N NH1  . ARG A 1 15 ? 148.016 14.513  2.899   1.00 0.00 ? 14 ARG A NH1  1  
ATOM 220   N NH2  . ARG A 1 15 ? 149.876 15.691  2.236   1.00 0.00 ? 14 ARG A NH2  1  
ATOM 221   H H    . ARG A 1 15 ? 146.033 12.997  -2.417  1.00 0.00 ? 14 ARG A H    1  
ATOM 222   H HA   . ARG A 1 15 ? 147.466 10.580  -1.582  1.00 0.00 ? 14 ARG A HA   1  
ATOM 223   H HB2  . ARG A 1 15 ? 145.483 12.318  -0.100  1.00 0.00 ? 14 ARG A HB2  1  
ATOM 224   H HB3  . ARG A 1 15 ? 146.192 10.847  0.550   1.00 0.00 ? 14 ARG A HB3  1  
ATOM 225   H HG2  . ARG A 1 15 ? 147.675 12.269  1.443   1.00 0.00 ? 14 ARG A HG2  1  
ATOM 226   H HG3  . ARG A 1 15 ? 148.427 12.170  -0.150  1.00 0.00 ? 14 ARG A HG3  1  
ATOM 227   H HD2  . ARG A 1 15 ? 147.165 14.169  -0.844  1.00 0.00 ? 14 ARG A HD2  1  
ATOM 228   H HD3  . ARG A 1 15 ? 146.476 14.276  0.775   1.00 0.00 ? 14 ARG A HD3  1  
ATOM 229   H HE   . ARG A 1 15 ? 149.094 15.098  -0.049  1.00 0.00 ? 14 ARG A HE   1  
ATOM 230   H HH11 . ARG A 1 15 ? 147.202 13.977  2.675   1.00 0.00 ? 14 ARG A HH11 1  
ATOM 231   H HH12 . ARG A 1 15 ? 148.243 14.698  3.856   1.00 0.00 ? 14 ARG A HH12 1  
ATOM 232   H HH21 . ARG A 1 15 ? 150.467 16.044  1.510   1.00 0.00 ? 14 ARG A HH21 1  
ATOM 233   H HH22 . ARG A 1 15 ? 150.099 15.874  3.194   1.00 0.00 ? 14 ARG A HH22 1  
ATOM 234   N N    . ARG A 1 16 ? 145.557 8.911   -1.550  1.00 0.00 ? 15 ARG A N    1  
ATOM 235   C CA   . ARG A 1 16 ? 144.535 7.902   -1.822  1.00 0.00 ? 15 ARG A CA   1  
ATOM 236   C C    . ARG A 1 16 ? 144.476 6.856   -0.708  1.00 0.00 ? 15 ARG A C    1  
ATOM 237   O O    . ARG A 1 16 ? 145.504 6.478   -0.141  1.00 0.00 ? 15 ARG A O    1  
ATOM 238   C CB   . ARG A 1 16 ? 144.812 7.215   -3.162  1.00 0.00 ? 15 ARG A CB   1  
ATOM 239   C CG   . ARG A 1 16 ? 144.664 8.134   -4.365  1.00 0.00 ? 15 ARG A CG   1  
ATOM 240   C CD   . ARG A 1 16 ? 144.621 7.347   -5.666  1.00 0.00 ? 15 ARG A CD   1  
ATOM 241   N NE   . ARG A 1 16 ? 143.287 6.809   -5.936  1.00 0.00 ? 15 ARG A NE   1  
ATOM 242   C CZ   . ARG A 1 16 ? 142.887 5.580   -5.589  1.00 0.00 ? 15 ARG A CZ   1  
ATOM 243   N NH1  . ARG A 1 16 ? 143.718 4.741   -4.974  1.00 0.00 ? 15 ARG A NH1  1  
ATOM 244   N NH2  . ARG A 1 16 ? 141.647 5.189   -5.862  1.00 0.00 ? 15 ARG A NH2  1  
ATOM 245   H H    . ARG A 1 16 ? 146.390 8.638   -1.108  1.00 0.00 ? 15 ARG A H    1  
ATOM 246   H HA   . ARG A 1 16 ? 143.581 8.405   -1.877  1.00 0.00 ? 15 ARG A HA   1  
ATOM 247   H HB2  . ARG A 1 16 ? 145.822 6.829   -3.152  1.00 0.00 ? 15 ARG A HB2  1  
ATOM 248   H HB3  . ARG A 1 16 ? 144.123 6.392   -3.276  1.00 0.00 ? 15 ARG A HB3  1  
ATOM 249   H HG2  . ARG A 1 16 ? 143.748 8.698   -4.265  1.00 0.00 ? 15 ARG A HG2  1  
ATOM 250   H HG3  . ARG A 1 16 ? 145.504 8.813   -4.392  1.00 0.00 ? 15 ARG A HG3  1  
ATOM 251   H HD2  . ARG A 1 16 ? 144.904 8.004   -6.477  1.00 0.00 ? 15 ARG A HD2  1  
ATOM 252   H HD3  . ARG A 1 16 ? 145.326 6.532   -5.604  1.00 0.00 ? 15 ARG A HD3  1  
ATOM 253   H HE   . ARG A 1 16 ? 142.650 7.398   -6.395  1.00 0.00 ? 15 ARG A HE   1  
ATOM 254   H HH11 . ARG A 1 16 ? 144.654 5.023   -4.764  1.00 0.00 ? 15 ARG A HH11 1  
ATOM 255   H HH12 . ARG A 1 16 ? 143.406 3.824   -4.719  1.00 0.00 ? 15 ARG A HH12 1  
ATOM 256   H HH21 . ARG A 1 16 ? 141.016 5.811   -6.326  1.00 0.00 ? 15 ARG A HH21 1  
ATOM 257   H HH22 . ARG A 1 16 ? 141.343 4.271   -5.603  1.00 0.00 ? 15 ARG A HH22 1  
ATOM 258   N N    . ILE A 1 17 ? 143.263 6.390   -0.405  1.00 0.00 ? 16 ILE A N    1  
ATOM 259   C CA   . ILE A 1 17 ? 143.055 5.383   0.634   1.00 0.00 ? 16 ILE A CA   1  
ATOM 260   C C    . ILE A 1 17 ? 142.812 4.006   0.016   1.00 0.00 ? 16 ILE A C    1  
ATOM 261   O O    . ILE A 1 17 ? 141.848 3.813   -0.728  1.00 0.00 ? 16 ILE A O    1  
ATOM 262   C CB   . ILE A 1 17 ? 141.856 5.744   1.542   1.00 0.00 ? 16 ILE A CB   1  
ATOM 263   C CG1  . ILE A 1 17 ? 141.978 7.182   2.056   1.00 0.00 ? 16 ILE A CG1  1  
ATOM 264   C CG2  . ILE A 1 17 ? 141.757 4.769   2.708   1.00 0.00 ? 16 ILE A CG2  1  
ATOM 265   C CD1  . ILE A 1 17 ? 140.678 7.958   1.998   1.00 0.00 ? 16 ILE A CD1  1  
ATOM 266   H H    . ILE A 1 17 ? 142.486 6.730   -0.898  1.00 0.00 ? 16 ILE A H    1  
ATOM 267   H HA   . ILE A 1 17 ? 143.946 5.343   1.245   1.00 0.00 ? 16 ILE A HA   1  
ATOM 268   H HB   . ILE A 1 17 ? 140.952 5.655   0.957   1.00 0.00 ? 16 ILE A HB   1  
ATOM 269   H HG12 . ILE A 1 17 ? 142.306 7.164   3.085   1.00 0.00 ? 16 ILE A HG12 1  
ATOM 270   H HG13 . ILE A 1 17 ? 142.707 7.712   1.461   1.00 0.00 ? 16 ILE A HG13 1  
ATOM 271   H HG21 . ILE A 1 17 ? 142.708 4.717   3.217   1.00 0.00 ? 16 ILE A HG21 1  
ATOM 272   H HG22 . ILE A 1 17 ? 141.494 3.789   2.337   1.00 0.00 ? 16 ILE A HG22 1  
ATOM 273   H HG23 . ILE A 1 17 ? 140.998 5.108   3.396   1.00 0.00 ? 16 ILE A HG23 1  
ATOM 274   H HD11 . ILE A 1 17 ? 139.865 7.282   1.781   1.00 0.00 ? 16 ILE A HD11 1  
ATOM 275   H HD12 . ILE A 1 17 ? 140.741 8.707   1.223   1.00 0.00 ? 16 ILE A HD12 1  
ATOM 276   H HD13 . ILE A 1 17 ? 140.503 8.438   2.950   1.00 0.00 ? 16 ILE A HD13 1  
ATOM 277   N N    . ILE A 1 18 ? 143.693 3.051   0.323   1.00 0.00 ? 17 ILE A N    1  
ATOM 278   C CA   . ILE A 1 18 ? 143.571 1.694   -0.208  1.00 0.00 ? 17 ILE A CA   1  
ATOM 279   C C    . ILE A 1 18 ? 143.650 0.652   0.910   1.00 0.00 ? 17 ILE A C    1  
ATOM 280   O O    . ILE A 1 18 ? 144.499 0.744   1.799   1.00 0.00 ? 17 ILE A O    1  
ATOM 281   C CB   . ILE A 1 18 ? 144.665 1.395   -1.257  1.00 0.00 ? 17 ILE A CB   1  
ATOM 282   C CG1  . ILE A 1 18 ? 144.723 2.510   -2.306  1.00 0.00 ? 17 ILE A CG1  1  
ATOM 283   C CG2  . ILE A 1 18 ? 144.410 0.049   -1.924  1.00 0.00 ? 17 ILE A CG2  1  
ATOM 284   C CD1  . ILE A 1 18 ? 145.966 2.466   -3.169  1.00 0.00 ? 17 ILE A CD1  1  
ATOM 285   H H    . ILE A 1 18 ? 144.443 3.266   0.918   1.00 0.00 ? 17 ILE A H    1  
ATOM 286   H HA   . ILE A 1 18 ? 142.608 1.613   -0.692  1.00 0.00 ? 17 ILE A HA   1  
ATOM 287   H HB   . ILE A 1 18 ? 145.616 1.341   -0.747  1.00 0.00 ? 17 ILE A HB   1  
ATOM 288   H HG12 . ILE A 1 18 ? 143.866 2.426   -2.956  1.00 0.00 ? 17 ILE A HG12 1  
ATOM 289   H HG13 . ILE A 1 18 ? 144.699 3.467   -1.808  1.00 0.00 ? 17 ILE A HG13 1  
ATOM 290   H HG21 . ILE A 1 18 ? 143.363 -0.036  -2.175  1.00 0.00 ? 17 ILE A HG21 1  
ATOM 291   H HG22 . ILE A 1 18 ? 144.683 -0.747  -1.247  1.00 0.00 ? 17 ILE A HG22 1  
ATOM 292   H HG23 . ILE A 1 18 ? 145.004 -0.025  -2.823  1.00 0.00 ? 17 ILE A HG23 1  
ATOM 293   H HD11 . ILE A 1 18 ? 146.707 1.834   -2.702  1.00 0.00 ? 17 ILE A HD11 1  
ATOM 294   H HD12 . ILE A 1 18 ? 146.362 3.465   -3.280  1.00 0.00 ? 17 ILE A HD12 1  
ATOM 295   H HD13 . ILE A 1 18 ? 145.715 2.069   -4.141  1.00 0.00 ? 17 ILE A HD13 1  
ATOM 296   N N    . ALA A 1 19 ? 142.759 -0.339  0.853   1.00 0.00 ? 18 ALA A N    1  
ATOM 297   C CA   . ALA A 1 19 ? 142.722 -1.404  1.854   1.00 0.00 ? 18 ALA A CA   1  
ATOM 298   C C    . ALA A 1 19 ? 143.295 -2.708  1.300   1.00 0.00 ? 18 ALA A C    1  
ATOM 299   O O    . ALA A 1 19 ? 143.063 -3.054  0.141   1.00 0.00 ? 18 ALA A O    1  
ATOM 300   C CB   . ALA A 1 19 ? 141.296 -1.619  2.339   1.00 0.00 ? 18 ALA A CB   1  
ATOM 301   H H    . ALA A 1 19 ? 142.110 -0.356  0.118   1.00 0.00 ? 18 ALA A H    1  
ATOM 302   H HA   . ALA A 1 19 ? 143.320 -1.088  2.697   1.00 0.00 ? 18 ALA A HA   1  
ATOM 303   H HB1  . ALA A 1 19 ? 140.625 -1.631  1.492   1.00 0.00 ? 18 ALA A HB1  1  
ATOM 304   H HB2  . ALA A 1 19 ? 141.018 -0.818  3.007   1.00 0.00 ? 18 ALA A HB2  1  
ATOM 305   H HB3  . ALA A 1 19 ? 141.233 -2.562  2.862   1.00 0.00 ? 18 ALA A HB3  1  
ATOM 306   N N    . PHE A 1 20 ? 144.043 -3.429  2.140   1.00 0.00 ? 19 PHE A N    1  
ATOM 307   C CA   . PHE A 1 20 ? 144.649 -4.698  1.739   1.00 0.00 ? 19 PHE A CA   1  
ATOM 308   C C    . PHE A 1 20 ? 144.317 -5.805  2.740   1.00 0.00 ? 19 PHE A C    1  
ATOM 309   O O    . PHE A 1 20 ? 144.663 -5.712  3.919   1.00 0.00 ? 19 PHE A O    1  
ATOM 310   C CB   . PHE A 1 20 ? 146.168 -4.547  1.611   1.00 0.00 ? 19 PHE A CB   1  
ATOM 311   C CG   . PHE A 1 20 ? 146.612 -4.005  0.280   1.00 0.00 ? 19 PHE A CG   1  
ATOM 312   C CD1  . PHE A 1 20 ? 146.142 -4.558  -0.901  1.00 0.00 ? 19 PHE A CD1  1  
ATOM 313   C CD2  . PHE A 1 20 ? 147.500 -2.943  0.210   1.00 0.00 ? 19 PHE A CD2  1  
ATOM 314   C CE1  . PHE A 1 20 ? 146.545 -4.060  -2.125  1.00 0.00 ? 19 PHE A CE1  1  
ATOM 315   C CE2  . PHE A 1 20 ? 147.907 -2.442  -1.011  1.00 0.00 ? 19 PHE A CE2  1  
ATOM 316   C CZ   . PHE A 1 20 ? 147.429 -3.001  -2.180  1.00 0.00 ? 19 PHE A CZ   1  
ATOM 317   H H    . PHE A 1 20 ? 144.189 -3.099  3.053   1.00 0.00 ? 19 PHE A H    1  
ATOM 318   H HA   . PHE A 1 20 ? 144.241 -4.969  0.776   1.00 0.00 ? 19 PHE A HA   1  
ATOM 319   H HB2  . PHE A 1 20 ? 146.521 -3.873  2.378   1.00 0.00 ? 19 PHE A HB2  1  
ATOM 320   H HB3  . PHE A 1 20 ? 146.631 -5.514  1.750   1.00 0.00 ? 19 PHE A HB3  1  
ATOM 321   H HD1  . PHE A 1 20 ? 145.449 -5.386  -0.859  1.00 0.00 ? 19 PHE A HD1  1  
ATOM 322   H HD2  . PHE A 1 20 ? 147.876 -2.506  1.122   1.00 0.00 ? 19 PHE A HD2  1  
ATOM 323   H HE1  . PHE A 1 20 ? 146.170 -4.501  -3.037  1.00 0.00 ? 19 PHE A HE1  1  
ATOM 324   H HE2  . PHE A 1 20 ? 148.599 -1.614  -1.051  1.00 0.00 ? 19 PHE A HE2  1  
ATOM 325   H HZ   . PHE A 1 20 ? 147.746 -2.610  -3.136  1.00 0.00 ? 19 PHE A HZ   1  
ATOM 326   N N    . SER A 1 21 ? 143.649 -6.855  2.259   1.00 0.00 ? 20 SER A N    1  
ATOM 327   C CA   . SER A 1 21 ? 143.272 -7.985  3.105   1.00 0.00 ? 20 SER A CA   1  
ATOM 328   C C    . SER A 1 21 ? 144.489 -8.848  3.442   1.00 0.00 ? 20 SER A C    1  
ATOM 329   O O    . SER A 1 21 ? 145.209 -9.297  2.549   1.00 0.00 ? 20 SER A O    1  
ATOM 330   C CB   . SER A 1 21 ? 142.202 -8.831  2.407   1.00 0.00 ? 20 SER A CB   1  
ATOM 331   O OG   . SER A 1 21 ? 141.820 -9.943  3.202   1.00 0.00 ? 20 SER A OG   1  
ATOM 332   H H    . SER A 1 21 ? 143.406 -6.870  1.309   1.00 0.00 ? 20 SER A H    1  
ATOM 333   H HA   . SER A 1 21 ? 142.862 -7.589  4.021   1.00 0.00 ? 20 SER A HA   1  
ATOM 334   H HB2  . SER A 1 21 ? 141.331 -8.222  2.222   1.00 0.00 ? 20 SER A HB2  1  
ATOM 335   H HB3  . SER A 1 21 ? 142.591 -9.193  1.466   1.00 0.00 ? 20 SER A HB3  1  
ATOM 336   H HG   . SER A 1 21 ? 141.048 -9.714  3.726   1.00 0.00 ? 20 SER A HG   1  
ATOM 337   N N    . ARG A 1 22 ? 144.713 -9.070  4.738   1.00 0.00 ? 21 ARG A N    1  
ATOM 338   C CA   . ARG A 1 22 ? 145.842 -9.875  5.203   1.00 0.00 ? 21 ARG A CA   1  
ATOM 339   C C    . ARG A 1 22 ? 145.730 -11.321 4.715   1.00 0.00 ? 21 ARG A C    1  
ATOM 340   O O    . ARG A 1 22 ? 144.626 -11.844 4.556   1.00 0.00 ? 21 ARG A O    1  
ATOM 341   C CB   . ARG A 1 22 ? 145.923 -9.849  6.734   1.00 0.00 ? 21 ARG A CB   1  
ATOM 342   C CG   . ARG A 1 22 ? 146.234 -8.472  7.302   1.00 0.00 ? 21 ARG A CG   1  
ATOM 343   C CD   . ARG A 1 22 ? 146.744 -8.553  8.735   1.00 0.00 ? 21 ARG A CD   1  
ATOM 344   N NE   . ARG A 1 22 ? 147.216 -7.254  9.214   1.00 0.00 ? 21 ARG A NE   1  
ATOM 345   C CZ   . ARG A 1 22 ? 147.493 -6.976  10.491  1.00 0.00 ? 21 ARG A CZ   1  
ATOM 346   N NH1  . ARG A 1 22 ? 147.366 -7.909  11.430  1.00 0.00 ? 21 ARG A NH1  1  
ATOM 347   N NH2  . ARG A 1 22 ? 147.901 -5.758  10.828  1.00 0.00 ? 21 ARG A NH2  1  
ATOM 348   H H    . ARG A 1 22 ? 144.104 -8.681  5.398   1.00 0.00 ? 21 ARG A H    1  
ATOM 349   H HA   . ARG A 1 22 ? 146.743 -9.439  4.798   1.00 0.00 ? 21 ARG A HA   1  
ATOM 350   H HB2  . ARG A 1 22 ? 144.977 -10.178 7.139   1.00 0.00 ? 21 ARG A HB2  1  
ATOM 351   H HB3  . ARG A 1 22 ? 146.698 -10.529 7.053   1.00 0.00 ? 21 ARG A HB3  1  
ATOM 352   H HG2  . ARG A 1 22 ? 146.989 -8.005  6.689   1.00 0.00 ? 21 ARG A HG2  1  
ATOM 353   H HG3  . ARG A 1 22 ? 145.333 -7.875  7.283   1.00 0.00 ? 21 ARG A HG3  1  
ATOM 354   H HD2  . ARG A 1 22 ? 145.940 -8.893  9.371   1.00 0.00 ? 21 ARG A HD2  1  
ATOM 355   H HD3  . ARG A 1 22 ? 147.559 -9.261  8.775   1.00 0.00 ? 21 ARG A HD3  1  
ATOM 356   H HE   . ARG A 1 22 ? 147.329 -6.545  8.550   1.00 0.00 ? 21 ARG A HE   1  
ATOM 357   H HH11 . ARG A 1 22 ? 147.063 -8.830  11.187  1.00 0.00 ? 21 ARG A HH11 1  
ATOM 358   H HH12 . ARG A 1 22 ? 147.578 -7.690  12.384  1.00 0.00 ? 21 ARG A HH12 1  
ATOM 359   H HH21 . ARG A 1 22 ? 148.001 -5.052  10.128  1.00 0.00 ? 21 ARG A HH21 1  
ATOM 360   H HH22 . ARG A 1 22 ? 148.109 -5.546  11.785  1.00 0.00 ? 21 ARG A HH22 1  
ATOM 361   N N    . PRO A 1 23 ? 146.877 -11.988 4.468   1.00 0.00 ? 22 PRO A N    1  
ATOM 362   C CA   . PRO A 1 23 ? 148.209 -11.396 4.646   1.00 0.00 ? 22 PRO A CA   1  
ATOM 363   C C    . PRO A 1 23 ? 148.588 -10.447 3.507   1.00 0.00 ? 22 PRO A C    1  
ATOM 364   O O    . PRO A 1 23 ? 148.410 -10.770 2.331   1.00 0.00 ? 22 PRO A O    1  
ATOM 365   C CB   . PRO A 1 23 ? 149.130 -12.617 4.656   1.00 0.00 ? 22 PRO A CB   1  
ATOM 366   C CG   . PRO A 1 23 ? 148.431 -13.624 3.809   1.00 0.00 ? 22 PRO A CG   1  
ATOM 367   C CD   . PRO A 1 23 ? 146.954 -13.385 3.993   1.00 0.00 ? 22 PRO A CD   1  
ATOM 368   H HA   . PRO A 1 23 ? 148.289 -10.875 5.589   1.00 0.00 ? 22 PRO A HA   1  
ATOM 369   H HB2  . PRO A 1 23 ? 150.092 -12.350 4.241   1.00 0.00 ? 22 PRO A HB2  1  
ATOM 370   H HB3  . PRO A 1 23 ? 149.253 -12.971 5.668   1.00 0.00 ? 22 PRO A HB3  1  
ATOM 371   H HG2  . PRO A 1 23 ? 148.704 -13.485 2.772   1.00 0.00 ? 22 PRO A HG2  1  
ATOM 372   H HG3  . PRO A 1 23 ? 148.691 -14.620 4.135   1.00 0.00 ? 22 PRO A HG3  1  
ATOM 373   H HD2  . PRO A 1 23 ? 146.434 -13.499 3.054   1.00 0.00 ? 22 PRO A HD2  1  
ATOM 374   H HD3  . PRO A 1 23 ? 146.553 -14.063 4.732   1.00 0.00 ? 22 PRO A HD3  1  
ATOM 375   N N    . VAL A 1 24 ? 149.116 -9.274  3.864   1.00 0.00 ? 23 VAL A N    1  
ATOM 376   C CA   . VAL A 1 24 ? 149.521 -8.280  2.871   1.00 0.00 ? 23 VAL A CA   1  
ATOM 377   C C    . VAL A 1 24 ? 150.884 -8.633  2.267   1.00 0.00 ? 23 VAL A C    1  
ATOM 378   O O    . VAL A 1 24 ? 151.904 -8.635  2.959   1.00 0.00 ? 23 VAL A O    1  
ATOM 379   C CB   . VAL A 1 24 ? 149.560 -6.853  3.472   1.00 0.00 ? 23 VAL A CB   1  
ATOM 380   C CG1  . VAL A 1 24 ? 150.577 -6.757  4.601   1.00 0.00 ? 23 VAL A CG1  1  
ATOM 381   C CG2  . VAL A 1 24 ? 149.856 -5.823  2.390   1.00 0.00 ? 23 VAL A CG2  1  
ATOM 382   H H    . VAL A 1 24 ? 149.236 -9.073  4.816   1.00 0.00 ? 23 VAL A H    1  
ATOM 383   H HA   . VAL A 1 24 ? 148.782 -8.290  2.081   1.00 0.00 ? 23 VAL A HA   1  
ATOM 384   H HB   . VAL A 1 24 ? 148.585 -6.634  3.883   1.00 0.00 ? 23 VAL A HB   1  
ATOM 385   H HG11 . VAL A 1 24 ? 150.230 -6.052  5.341   1.00 0.00 ? 23 VAL A HG11 1  
ATOM 386   H HG12 . VAL A 1 24 ? 151.525 -6.424  4.204   1.00 0.00 ? 23 VAL A HG12 1  
ATOM 387   H HG13 . VAL A 1 24 ? 150.700 -7.728  5.058   1.00 0.00 ? 23 VAL A HG13 1  
ATOM 388   H HG21 . VAL A 1 24 ? 150.913 -5.600  2.384   1.00 0.00 ? 23 VAL A HG21 1  
ATOM 389   H HG22 . VAL A 1 24 ? 149.300 -4.919  2.590   1.00 0.00 ? 23 VAL A HG22 1  
ATOM 390   H HG23 . VAL A 1 24 ? 149.567 -6.218  1.427   1.00 0.00 ? 23 VAL A HG23 1  
ATOM 391   N N    . LYS A 1 25 ? 150.885 -8.944  0.972   1.00 0.00 ? 24 LYS A N    1  
ATOM 392   C CA   . LYS A 1 25 ? 152.110 -9.313  0.266   1.00 0.00 ? 24 LYS A CA   1  
ATOM 393   C C    . LYS A 1 25 ? 152.629 -8.154  -0.582  1.00 0.00 ? 24 LYS A C    1  
ATOM 394   O O    . LYS A 1 25 ? 151.850 -7.438  -1.213  1.00 0.00 ? 24 LYS A O    1  
ATOM 395   C CB   . LYS A 1 25 ? 151.853 -10.530 -0.627  1.00 0.00 ? 24 LYS A CB   1  
ATOM 396   C CG   . LYS A 1 25 ? 152.408 -11.832 -0.072  1.00 0.00 ? 24 LYS A CG   1  
ATOM 397   C CD   . LYS A 1 25 ? 151.567 -13.025 -0.506  1.00 0.00 ? 24 LYS A CD   1  
ATOM 398   C CE   . LYS A 1 25 ? 152.417 -14.103 -1.164  1.00 0.00 ? 24 LYS A CE   1  
ATOM 399   N NZ   . LYS A 1 25 ? 152.485 -13.939 -2.645  1.00 0.00 ? 24 LYS A NZ   1  
ATOM 400   H H    . LYS A 1 25 ? 150.038 -8.933  0.478   1.00 0.00 ? 24 LYS A H    1  
ATOM 401   H HA   . LYS A 1 25 ? 152.856 -9.570  1.003   1.00 0.00 ? 24 LYS A HA   1  
ATOM 402   H HB2  . LYS A 1 25 ? 150.786 -10.646 -0.755  1.00 0.00 ? 24 LYS A HB2  1  
ATOM 403   H HB3  . LYS A 1 25 ? 152.303 -10.354 -1.593  1.00 0.00 ? 24 LYS A HB3  1  
ATOM 404   H HG2  . LYS A 1 25 ? 153.417 -11.965 -0.433  1.00 0.00 ? 24 LYS A HG2  1  
ATOM 405   H HG3  . LYS A 1 25 ? 152.413 -11.780 1.007   1.00 0.00 ? 24 LYS A HG3  1  
ATOM 406   H HD2  . LYS A 1 25 ? 151.082 -13.446 0.363   1.00 0.00 ? 24 LYS A HD2  1  
ATOM 407   H HD3  . LYS A 1 25 ? 150.820 -12.689 -1.209  1.00 0.00 ? 24 LYS A HD3  1  
ATOM 408   H HE2  . LYS A 1 25 ? 153.418 -14.052 -0.760  1.00 0.00 ? 24 LYS A HE2  1  
ATOM 409   H HE3  . LYS A 1 25 ? 151.988 -15.069 -0.937  1.00 0.00 ? 24 LYS A HE3  1  
ATOM 410   H HZ1  . LYS A 1 25 ? 151.561 -13.635 -3.015  1.00 0.00 ? 24 LYS A HZ1  1  
ATOM 411   H HZ2  . LYS A 1 25 ? 152.745 -14.840 -3.093  1.00 0.00 ? 24 LYS A HZ2  1  
ATOM 412   H HZ3  . LYS A 1 25 ? 153.199 -13.224 -2.894  1.00 0.00 ? 24 LYS A HZ3  1  
ATOM 413   N N    . TYR A 1 26 ? 153.954 -7.985  -0.601  1.00 0.00 ? 25 TYR A N    1  
ATOM 414   C CA   . TYR A 1 26 ? 154.586 -6.919  -1.382  1.00 0.00 ? 25 TYR A CA   1  
ATOM 415   C C    . TYR A 1 26 ? 154.245 -7.054  -2.867  1.00 0.00 ? 25 TYR A C    1  
ATOM 416   O O    . TYR A 1 26 ? 154.026 -6.054  -3.548  1.00 0.00 ? 25 TYR A O    1  
ATOM 417   C CB   . TYR A 1 26 ? 156.109 -6.942  -1.190  1.00 0.00 ? 25 TYR A CB   1  
ATOM 418   C CG   . TYR A 1 26 ? 156.842 -5.835  -1.924  1.00 0.00 ? 25 TYR A CG   1  
ATOM 419   C CD1  . TYR A 1 26 ? 157.033 -4.591  -1.334  1.00 0.00 ? 25 TYR A CD1  1  
ATOM 420   C CD2  . TYR A 1 26 ? 157.342 -6.035  -3.206  1.00 0.00 ? 25 TYR A CD2  1  
ATOM 421   C CE1  . TYR A 1 26 ? 157.703 -3.581  -1.999  1.00 0.00 ? 25 TYR A CE1  1  
ATOM 422   C CE2  . TYR A 1 26 ? 158.013 -5.030  -3.877  1.00 0.00 ? 25 TYR A CE2  1  
ATOM 423   C CZ   . TYR A 1 26 ? 158.190 -3.805  -3.271  1.00 0.00 ? 25 TYR A CZ   1  
ATOM 424   O OH   . TYR A 1 26 ? 158.856 -2.800  -3.935  1.00 0.00 ? 25 TYR A OH   1  
ATOM 425   H H    . TYR A 1 26 ? 154.519 -8.595  -0.083  1.00 0.00 ? 25 TYR A H    1  
ATOM 426   H HA   . TYR A 1 26 ? 154.202 -5.976  -1.023  1.00 0.00 ? 25 TYR A HA   1  
ATOM 427   H HB2  . TYR A 1 26 ? 156.331 -6.843  -0.138  1.00 0.00 ? 25 TYR A HB2  1  
ATOM 428   H HB3  . TYR A 1 26 ? 156.493 -7.887  -1.545  1.00 0.00 ? 25 TYR A HB3  1  
ATOM 429   H HD1  . TYR A 1 26 ? 156.651 -4.416  -0.338  1.00 0.00 ? 25 TYR A HD1  1  
ATOM 430   H HD2  . TYR A 1 26 ? 157.202 -6.995  -3.681  1.00 0.00 ? 25 TYR A HD2  1  
ATOM 431   H HE1  . TYR A 1 26 ? 157.842 -2.621  -1.523  1.00 0.00 ? 25 TYR A HE1  1  
ATOM 432   H HE2  . TYR A 1 26 ? 158.395 -5.206  -4.870  1.00 0.00 ? 25 TYR A HE2  1  
ATOM 433   H HH   . TYR A 1 26 ? 158.491 -2.701  -4.818  1.00 0.00 ? 25 TYR A HH   1  
ATOM 434   N N    . GLU A 1 27 ? 154.199 -8.293  -3.361  1.00 0.00 ? 26 GLU A N    1  
ATOM 435   C CA   . GLU A 1 27 ? 153.879 -8.547  -4.766  1.00 0.00 ? 26 GLU A CA   1  
ATOM 436   C C    . GLU A 1 27 ? 152.489 -8.021  -5.117  1.00 0.00 ? 26 GLU A C    1  
ATOM 437   O O    . GLU A 1 27 ? 152.303 -7.385  -6.152  1.00 0.00 ? 26 GLU A O    1  
ATOM 438   C CB   . GLU A 1 27 ? 153.947 -10.045 -5.073  1.00 0.00 ? 26 GLU A CB   1  
ATOM 439   C CG   . GLU A 1 27 ? 155.339 -10.536 -5.434  1.00 0.00 ? 26 GLU A CG   1  
ATOM 440   C CD   . GLU A 1 27 ? 155.699 -11.828 -4.726  1.00 0.00 ? 26 GLU A CD   1  
ATOM 441   O OE1  . GLU A 1 27 ? 155.160 -12.887 -5.111  1.00 0.00 ? 26 GLU A OE1  1  
ATOM 442   O OE2  . GLU A 1 27 ? 156.518 -11.778 -3.785  1.00 0.00 ? 26 GLU A OE2  1  
ATOM 443   H H    . GLU A 1 27 ? 154.383 -9.053  -2.768  1.00 0.00 ? 26 GLU A H    1  
ATOM 444   H HA   . GLU A 1 27 ? 154.610 -8.031  -5.371  1.00 0.00 ? 26 GLU A HA   1  
ATOM 445   H HB2  . GLU A 1 27 ? 153.609 -10.594 -4.206  1.00 0.00 ? 26 GLU A HB2  1  
ATOM 446   H HB3  . GLU A 1 27 ? 153.288 -10.260 -5.901  1.00 0.00 ? 26 GLU A HB3  1  
ATOM 447   H HG2  . GLU A 1 27 ? 155.382 -10.702 -6.500  1.00 0.00 ? 26 GLU A HG2  1  
ATOM 448   H HG3  . GLU A 1 27 ? 156.057 -9.779  -5.158  1.00 0.00 ? 26 GLU A HG3  1  
ATOM 449   N N    . ASP A 1 28 ? 151.516 -8.294  -4.249  1.00 0.00 ? 27 ASP A N    1  
ATOM 450   C CA   . ASP A 1 28 ? 150.142 -7.851  -4.475  1.00 0.00 ? 27 ASP A CA   1  
ATOM 451   C C    . ASP A 1 28 ? 150.037 -6.330  -4.419  1.00 0.00 ? 27 ASP A C    1  
ATOM 452   O O    . ASP A 1 28 ? 149.355 -5.717  -5.242  1.00 0.00 ? 27 ASP A O    1  
ATOM 453   C CB   . ASP A 1 28 ? 149.198 -8.484  -3.444  1.00 0.00 ? 27 ASP A CB   1  
ATOM 454   C CG   . ASP A 1 28 ? 148.547 -9.758  -3.952  1.00 0.00 ? 27 ASP A CG   1  
ATOM 455   O OD1  . ASP A 1 28 ? 149.187 -10.481 -4.748  1.00 0.00 ? 27 ASP A OD1  1  
ATOM 456   O OD2  . ASP A 1 28 ? 147.396 -10.034 -3.555  1.00 0.00 ? 27 ASP A OD2  1  
ATOM 457   H H    . ASP A 1 28 ? 151.727 -8.806  -3.439  1.00 0.00 ? 27 ASP A H    1  
ATOM 458   H HA   . ASP A 1 28 ? 149.851 -8.179  -5.462  1.00 0.00 ? 27 ASP A HA   1  
ATOM 459   H HB2  . ASP A 1 28 ? 149.755 -8.720  -2.552  1.00 0.00 ? 27 ASP A HB2  1  
ATOM 460   H HB3  . ASP A 1 28 ? 148.418 -7.778  -3.200  1.00 0.00 ? 27 ASP A HB3  1  
ATOM 461   N N    . VAL A 1 29 ? 150.719 -5.728  -3.450  1.00 0.00 ? 28 VAL A N    1  
ATOM 462   C CA   . VAL A 1 29 ? 150.703 -4.279  -3.291  1.00 0.00 ? 28 VAL A CA   1  
ATOM 463   C C    . VAL A 1 29 ? 151.470 -3.593  -4.423  1.00 0.00 ? 28 VAL A C    1  
ATOM 464   O O    . VAL A 1 29 ? 150.971 -2.652  -5.038  1.00 0.00 ? 28 VAL A O    1  
ATOM 465   C CB   . VAL A 1 29 ? 151.301 -3.846  -1.936  1.00 0.00 ? 28 VAL A CB   1  
ATOM 466   C CG1  . VAL A 1 29 ? 151.166 -2.341  -1.748  1.00 0.00 ? 28 VAL A CG1  1  
ATOM 467   C CG2  . VAL A 1 29 ? 150.634 -4.599  -0.790  1.00 0.00 ? 28 VAL A CG2  1  
ATOM 468   H H    . VAL A 1 29 ? 151.248 -6.272  -2.827  1.00 0.00 ? 28 VAL A H    1  
ATOM 469   H HA   . VAL A 1 29 ? 149.672 -3.956  -3.324  1.00 0.00 ? 28 VAL A HA   1  
ATOM 470   H HB   . VAL A 1 29 ? 152.354 -4.094  -1.934  1.00 0.00 ? 28 VAL A HB   1  
ATOM 471   H HG11 . VAL A 1 29 ? 152.062 -1.853  -2.105  1.00 0.00 ? 28 VAL A HG11 1  
ATOM 472   H HG12 . VAL A 1 29 ? 151.027 -2.118  -0.702  1.00 0.00 ? 28 VAL A HG12 1  
ATOM 473   H HG13 . VAL A 1 29 ? 150.315 -1.984  -2.310  1.00 0.00 ? 28 VAL A HG13 1  
ATOM 474   H HG21 . VAL A 1 29 ? 151.386 -4.924  -0.086  1.00 0.00 ? 28 VAL A HG21 1  
ATOM 475   H HG22 . VAL A 1 29 ? 150.112 -5.461  -1.179  1.00 0.00 ? 28 VAL A HG22 1  
ATOM 476   H HG23 . VAL A 1 29 ? 149.931 -3.949  -0.292  1.00 0.00 ? 28 VAL A HG23 1  
ATOM 477   N N    . GLU A 1 30 ? 152.685 -4.074  -4.688  1.00 0.00 ? 29 GLU A N    1  
ATOM 478   C CA   . GLU A 1 30 ? 153.530 -3.511  -5.741  1.00 0.00 ? 29 GLU A CA   1  
ATOM 479   C C    . GLU A 1 30 ? 152.876 -3.647  -7.114  1.00 0.00 ? 29 GLU A C    1  
ATOM 480   O O    . GLU A 1 30 ? 152.876 -2.701  -7.903  1.00 0.00 ? 29 GLU A O    1  
ATOM 481   C CB   . GLU A 1 30 ? 154.896 -4.196  -5.750  1.00 0.00 ? 29 GLU A CB   1  
ATOM 482   C CG   . GLU A 1 30 ? 155.969 -3.398  -6.472  1.00 0.00 ? 29 GLU A CG   1  
ATOM 483   C CD   . GLU A 1 30 ? 156.520 -4.123  -7.685  1.00 0.00 ? 29 GLU A CD   1  
ATOM 484   O OE1  . GLU A 1 30 ? 157.013 -5.259  -7.524  1.00 0.00 ? 29 GLU A OE1  1  
ATOM 485   O OE2  . GLU A 1 30 ? 156.460 -3.553  -8.795  1.00 0.00 ? 29 GLU A OE2  1  
ATOM 486   H H    . GLU A 1 30 ? 153.025 -4.828  -4.158  1.00 0.00 ? 29 GLU A H    1  
ATOM 487   H HA   . GLU A 1 30 ? 153.667 -2.463  -5.525  1.00 0.00 ? 29 GLU A HA   1  
ATOM 488   H HB2  . GLU A 1 30 ? 155.217 -4.349  -4.730  1.00 0.00 ? 29 GLU A HB2  1  
ATOM 489   H HB3  . GLU A 1 30 ? 154.802 -5.157  -6.236  1.00 0.00 ? 29 GLU A HB3  1  
ATOM 490   H HG2  . GLU A 1 30 ? 155.543 -2.460  -6.797  1.00 0.00 ? 29 GLU A HG2  1  
ATOM 491   H HG3  . GLU A 1 30 ? 156.779 -3.205  -5.786  1.00 0.00 ? 29 GLU A HG3  1  
ATOM 492   N N    . HIS A 1 31 ? 152.319 -4.825  -7.394  1.00 0.00 ? 30 HIS A N    1  
ATOM 493   C CA   . HIS A 1 31 ? 151.658 -5.075  -8.674  1.00 0.00 ? 30 HIS A CA   1  
ATOM 494   C C    . HIS A 1 31 ? 150.516 -4.081  -8.892  1.00 0.00 ? 30 HIS A C    1  
ATOM 495   O O    . HIS A 1 31 ? 150.308 -3.597  -10.007 1.00 0.00 ? 30 HIS A O    1  
ATOM 496   C CB   . HIS A 1 31 ? 151.118 -6.509  -8.730  1.00 0.00 ? 30 HIS A CB   1  
ATOM 497   C CG   . HIS A 1 31 ? 152.134 -7.529  -9.157  1.00 0.00 ? 30 HIS A CG   1  
ATOM 498   N ND1  . HIS A 1 31 ? 153.433 -7.552  -8.688  1.00 0.00 ? 30 HIS A ND1  1  
ATOM 499   C CD2  . HIS A 1 31 ? 152.027 -8.578  -10.007 1.00 0.00 ? 30 HIS A CD2  1  
ATOM 500   C CE1  . HIS A 1 31 ? 154.077 -8.571  -9.230  1.00 0.00 ? 30 HIS A CE1  1  
ATOM 501   N NE2  . HIS A 1 31 ? 153.247 -9.208  -10.034 1.00 0.00 ? 30 HIS A NE2  1  
ATOM 502   H H    . HIS A 1 31 ? 152.350 -5.540  -6.724  1.00 0.00 ? 30 HIS A H    1  
ATOM 503   H HA   . HIS A 1 31 ? 152.390 -4.942  -9.457  1.00 0.00 ? 30 HIS A HA   1  
ATOM 504   H HB2  . HIS A 1 31 ? 150.760 -6.789  -7.750  1.00 0.00 ? 30 HIS A HB2  1  
ATOM 505   H HB3  . HIS A 1 31 ? 150.297 -6.546  -9.430  1.00 0.00 ? 30 HIS A HB3  1  
ATOM 506   H HD1  . HIS A 1 31 ? 153.825 -6.915  -8.054  1.00 0.00 ? 30 HIS A HD1  1  
ATOM 507   H HD2  . HIS A 1 31 ? 151.144 -8.865  -10.562 1.00 0.00 ? 30 HIS A HD2  1  
ATOM 508   H HE1  . HIS A 1 31 ? 155.106 -8.840  -9.043  1.00 0.00 ? 30 HIS A HE1  1  
ATOM 509   H HE2  . HIS A 1 31 ? 153.438 -10.057 -10.485 1.00 0.00 ? 30 HIS A HE2  1  
ATOM 510   N N    . LYS A 1 32 ? 149.786 -3.774  -7.818  1.00 0.00 ? 31 LYS A N    1  
ATOM 511   C CA   . LYS A 1 32 ? 148.674 -2.830  -7.893  1.00 0.00 ? 31 LYS A CA   1  
ATOM 512   C C    . LYS A 1 32 ? 149.180 -1.420  -8.189  1.00 0.00 ? 31 LYS A C    1  
ATOM 513   O O    . LYS A 1 32 ? 148.652 -0.737  -9.067  1.00 0.00 ? 31 LYS A O    1  
ATOM 514   C CB   . LYS A 1 32 ? 147.868 -2.832  -6.587  1.00 0.00 ? 31 LYS A CB   1  
ATOM 515   C CG   . LYS A 1 32 ? 146.609 -1.976  -6.652  1.00 0.00 ? 31 LYS A CG   1  
ATOM 516   C CD   . LYS A 1 32 ? 145.386 -2.724  -6.138  1.00 0.00 ? 31 LYS A CD   1  
ATOM 517   C CE   . LYS A 1 32 ? 144.147 -2.403  -6.961  1.00 0.00 ? 31 LYS A CE   1  
ATOM 518   N NZ   . LYS A 1 32 ? 143.315 -3.613  -7.213  1.00 0.00 ? 31 LYS A NZ   1  
ATOM 519   H H    . LYS A 1 32 ? 150.005 -4.187  -6.956  1.00 0.00 ? 31 LYS A H    1  
ATOM 520   H HA   . LYS A 1 32 ? 148.032 -3.142  -8.701  1.00 0.00 ? 31 LYS A HA   1  
ATOM 521   H HB2  . LYS A 1 32 ? 147.579 -3.848  -6.357  1.00 0.00 ? 31 LYS A HB2  1  
ATOM 522   H HB3  . LYS A 1 32 ? 148.492 -2.456  -5.791  1.00 0.00 ? 31 LYS A HB3  1  
ATOM 523   H HG2  . LYS A 1 32 ? 146.755 -1.092  -6.049  1.00 0.00 ? 31 LYS A HG2  1  
ATOM 524   H HG3  . LYS A 1 32 ? 146.438 -1.688  -7.679  1.00 0.00 ? 31 LYS A HG3  1  
ATOM 525   H HD2  . LYS A 1 32 ? 145.576 -3.785  -6.191  1.00 0.00 ? 31 LYS A HD2  1  
ATOM 526   H HD3  . LYS A 1 32 ? 145.208 -2.439  -5.111  1.00 0.00 ? 31 LYS A HD3  1  
ATOM 527   H HE2  . LYS A 1 32 ? 143.553 -1.676  -6.426  1.00 0.00 ? 31 LYS A HE2  1  
ATOM 528   H HE3  . LYS A 1 32 ? 144.456 -1.985  -7.908  1.00 0.00 ? 31 LYS A HE3  1  
ATOM 529   H HZ1  . LYS A 1 32 ? 143.013 -4.034  -6.311  1.00 0.00 ? 31 LYS A HZ1  1  
ATOM 530   H HZ2  . LYS A 1 32 ? 143.861 -4.319  -7.746  1.00 0.00 ? 31 LYS A HZ2  1  
ATOM 531   H HZ3  . LYS A 1 32 ? 142.470 -3.357  -7.765  1.00 0.00 ? 31 LYS A HZ3  1  
ATOM 532   N N    . VAL A 1 33 ? 150.207 -0.989  -7.455  1.00 0.00 ? 32 VAL A N    1  
ATOM 533   C CA   . VAL A 1 33 ? 150.777 0.345   -7.648  1.00 0.00 ? 32 VAL A CA   1  
ATOM 534   C C    . VAL A 1 33 ? 151.361 0.497   -9.051  1.00 0.00 ? 32 VAL A C    1  
ATOM 535   O O    . VAL A 1 33 ? 151.152 1.517   -9.711  1.00 0.00 ? 32 VAL A O    1  
ATOM 536   C CB   . VAL A 1 33 ? 151.877 0.660   -6.612  1.00 0.00 ? 32 VAL A CB   1  
ATOM 537   C CG1  . VAL A 1 33 ? 152.331 2.106   -6.742  1.00 0.00 ? 32 VAL A CG1  1  
ATOM 538   C CG2  . VAL A 1 33 ? 151.386 0.375   -5.199  1.00 0.00 ? 32 VAL A CG2  1  
ATOM 539   H H    . VAL A 1 33 ? 150.589 -1.580  -6.772  1.00 0.00 ? 32 VAL A H    1  
ATOM 540   H HA   . VAL A 1 33 ? 149.981 1.064   -7.524  1.00 0.00 ? 32 VAL A HA   1  
ATOM 541   H HB   . VAL A 1 33 ? 152.725 0.021   -6.812  1.00 0.00 ? 32 VAL A HB   1  
ATOM 542   H HG11 . VAL A 1 33 ? 152.892 2.389   -5.864  1.00 0.00 ? 32 VAL A HG11 1  
ATOM 543   H HG12 . VAL A 1 33 ? 151.466 2.746   -6.839  1.00 0.00 ? 32 VAL A HG12 1  
ATOM 544   H HG13 . VAL A 1 33 ? 152.954 2.210   -7.618  1.00 0.00 ? 32 VAL A HG13 1  
ATOM 545   H HG21 . VAL A 1 33 ? 151.696 1.174   -4.541  1.00 0.00 ? 32 VAL A HG21 1  
ATOM 546   H HG22 . VAL A 1 33 ? 151.807 -0.558  -4.855  1.00 0.00 ? 32 VAL A HG22 1  
ATOM 547   H HG23 . VAL A 1 33 ? 150.308 0.305   -5.198  1.00 0.00 ? 32 VAL A HG23 1  
ATOM 548   N N    . THR A 1 34 ? 152.094 -0.521  -9.499  1.00 0.00 ? 33 THR A N    1  
ATOM 549   C CA   . THR A 1 34 ? 152.708 -0.501  -10.822 1.00 0.00 ? 33 THR A CA   1  
ATOM 550   C C    . THR A 1 34 ? 151.648 -0.426  -11.924 1.00 0.00 ? 33 THR A C    1  
ATOM 551   O O    . THR A 1 34 ? 151.839 0.270   -12.920 1.00 0.00 ? 33 THR A O    1  
ATOM 552   C CB   . THR A 1 34 ? 153.604 -1.728  -11.015 1.00 0.00 ? 33 THR A CB   1  
ATOM 553   O OG1  . THR A 1 34 ? 154.568 -1.800  -9.979  1.00 0.00 ? 33 THR A OG1  1  
ATOM 554   C CG2  . THR A 1 34 ? 154.354 -1.726  -12.331 1.00 0.00 ? 33 THR A CG2  1  
ATOM 555   H H    . THR A 1 34 ? 152.225 -1.306  -8.925  1.00 0.00 ? 33 THR A H    1  
ATOM 556   H HA   . THR A 1 34 ? 153.322 0.387   -10.880 1.00 0.00 ? 33 THR A HA   1  
ATOM 557   H HB   . THR A 1 34 ? 152.995 -2.620  -10.979 1.00 0.00 ? 33 THR A HB   1  
ATOM 558   H HG1  . THR A 1 34 ? 154.775 -2.719  -9.793  1.00 0.00 ? 33 THR A HG1  1  
ATOM 559   H HG21 . THR A 1 34 ? 155.234 -2.346  -12.245 1.00 0.00 ? 33 THR A HG21 1  
ATOM 560   H HG22 . THR A 1 34 ? 154.648 -0.716  -12.577 1.00 0.00 ? 33 THR A HG22 1  
ATOM 561   H HG23 . THR A 1 34 ? 153.717 -2.116  -13.111 1.00 0.00 ? 33 THR A HG23 1  
ATOM 562   N N    . THR A 1 35 ? 150.533 -1.142  -11.746 1.00 0.00 ? 34 THR A N    1  
ATOM 563   C CA   . THR A 1 35 ? 149.455 -1.131  -12.740 1.00 0.00 ? 34 THR A CA   1  
ATOM 564   C C    . THR A 1 35 ? 148.708 0.204   -12.741 1.00 0.00 ? 34 THR A C    1  
ATOM 565   O O    . THR A 1 35 ? 148.427 0.758   -13.804 1.00 0.00 ? 34 THR A O    1  
ATOM 566   C CB   . THR A 1 35 ? 148.467 -2.280  -12.505 1.00 0.00 ? 34 THR A CB   1  
ATOM 567   O OG1  . THR A 1 35 ? 149.132 -3.530  -12.532 1.00 0.00 ? 34 THR A OG1  1  
ATOM 568   C CG2  . THR A 1 35 ? 147.363 -2.332  -13.543 1.00 0.00 ? 34 THR A CG2  1  
ATOM 569   H H    . THR A 1 35 ? 150.432 -1.680  -10.932 1.00 0.00 ? 34 THR A H    1  
ATOM 570   H HA   . THR A 1 35 ? 149.911 -1.263  -13.710 1.00 0.00 ? 34 THR A HA   1  
ATOM 571   H HB   . THR A 1 35 ? 148.004 -2.159  -11.536 1.00 0.00 ? 34 THR A HB   1  
ATOM 572   H HG1  . THR A 1 35 ? 148.825 -4.072  -11.800 1.00 0.00 ? 34 THR A HG1  1  
ATOM 573   H HG21 . THR A 1 35 ? 147.768 -2.069  -14.510 1.00 0.00 ? 34 THR A HG21 1  
ATOM 574   H HG22 . THR A 1 35 ? 146.584 -1.633  -13.278 1.00 0.00 ? 34 THR A HG22 1  
ATOM 575   H HG23 . THR A 1 35 ? 146.952 -3.330  -13.583 1.00 0.00 ? 34 THR A HG23 1  
ATOM 576   N N    . VAL A 1 36 ? 148.379 0.715   -11.551 1.00 0.00 ? 35 VAL A N    1  
ATOM 577   C CA   . VAL A 1 36 ? 147.652 1.982   -11.438 1.00 0.00 ? 35 VAL A CA   1  
ATOM 578   C C    . VAL A 1 36 ? 148.437 3.133   -12.068 1.00 0.00 ? 35 VAL A C    1  
ATOM 579   O O    . VAL A 1 36 ? 147.896 3.891   -12.874 1.00 0.00 ? 35 VAL A O    1  
ATOM 580   C CB   . VAL A 1 36 ? 147.325 2.340   -9.968  1.00 0.00 ? 35 VAL A CB   1  
ATOM 581   C CG1  . VAL A 1 36 ? 146.520 3.631   -9.897  1.00 0.00 ? 35 VAL A CG1  1  
ATOM 582   C CG2  . VAL A 1 36 ? 146.572 1.204   -9.287  1.00 0.00 ? 35 VAL A CG2  1  
ATOM 583   H H    . VAL A 1 36 ? 148.622 0.226   -10.735 1.00 0.00 ? 35 VAL A H    1  
ATOM 584   H HA   . VAL A 1 36 ? 146.718 1.870   -11.971 1.00 0.00 ? 35 VAL A HA   1  
ATOM 585   H HB   . VAL A 1 36 ? 148.256 2.493   -9.440  1.00 0.00 ? 35 VAL A HB   1  
ATOM 586   H HG11 . VAL A 1 36 ? 146.958 4.366   -10.557 1.00 0.00 ? 35 VAL A HG11 1  
ATOM 587   H HG12 . VAL A 1 36 ? 146.528 4.006   -8.884  1.00 0.00 ? 35 VAL A HG12 1  
ATOM 588   H HG13 . VAL A 1 36 ? 145.502 3.438   -10.201 1.00 0.00 ? 35 VAL A HG13 1  
ATOM 589   H HG21 . VAL A 1 36 ? 145.543 1.495   -9.130  1.00 0.00 ? 35 VAL A HG21 1  
ATOM 590   H HG22 . VAL A 1 36 ? 147.032 0.988   -8.334  1.00 0.00 ? 35 VAL A HG22 1  
ATOM 591   H HG23 . VAL A 1 36 ? 146.606 0.323   -9.910  1.00 0.00 ? 35 VAL A HG23 1  
ATOM 592   N N    . PHE A 1 37 ? 149.712 3.262   -11.697 1.00 0.00 ? 36 PHE A N    1  
ATOM 593   C CA   . PHE A 1 37 ? 150.561 4.329   -12.229 1.00 0.00 ? 36 PHE A CA   1  
ATOM 594   C C    . PHE A 1 37 ? 151.139 3.966   -13.599 1.00 0.00 ? 36 PHE A C    1  
ATOM 595   O O    . PHE A 1 37 ? 151.479 4.851   -14.386 1.00 0.00 ? 36 PHE A O    1  
ATOM 596   C CB   . PHE A 1 37 ? 151.702 4.645   -11.258 1.00 0.00 ? 36 PHE A CB   1  
ATOM 597   C CG   . PHE A 1 37 ? 151.241 5.199   -9.937  1.00 0.00 ? 36 PHE A CG   1  
ATOM 598   C CD1  . PHE A 1 37 ? 150.281 6.200   -9.881  1.00 0.00 ? 36 PHE A CD1  1  
ATOM 599   C CD2  . PHE A 1 37 ? 151.769 4.717   -8.751  1.00 0.00 ? 36 PHE A CD2  1  
ATOM 600   C CE1  . PHE A 1 37 ? 149.862 6.709   -8.666  1.00 0.00 ? 36 PHE A CE1  1  
ATOM 601   C CE2  . PHE A 1 37 ? 151.354 5.223   -7.536  1.00 0.00 ? 36 PHE A CE2  1  
ATOM 602   C CZ   . PHE A 1 37 ? 150.399 6.218   -7.493  1.00 0.00 ? 36 PHE A CZ   1  
ATOM 603   H H    . PHE A 1 37 ? 150.088 2.629   -11.047 1.00 0.00 ? 36 PHE A H    1  
ATOM 604   H HA   . PHE A 1 37 ? 149.947 5.209   -12.340 1.00 0.00 ? 36 PHE A HA   1  
ATOM 605   H HB2  . PHE A 1 37 ? 152.259 3.740   -11.062 1.00 0.00 ? 36 PHE A HB2  1  
ATOM 606   H HB3  . PHE A 1 37 ? 152.358 5.372   -11.713 1.00 0.00 ? 36 PHE A HB3  1  
ATOM 607   H HD1  . PHE A 1 37 ? 149.860 6.584   -10.799 1.00 0.00 ? 36 PHE A HD1  1  
ATOM 608   H HD2  . PHE A 1 37 ? 152.516 3.938   -8.783  1.00 0.00 ? 36 PHE A HD2  1  
ATOM 609   H HE1  . PHE A 1 37 ? 149.114 7.489   -8.635  1.00 0.00 ? 36 PHE A HE1  1  
ATOM 610   H HE2  . PHE A 1 37 ? 151.775 4.838   -6.620  1.00 0.00 ? 36 PHE A HE2  1  
ATOM 611   H HZ   . PHE A 1 37 ? 150.073 6.614   -6.543  1.00 0.00 ? 36 PHE A HZ   1  
ATOM 612   N N    . GLY A 1 38 ? 151.260 2.667   -13.876 1.00 0.00 ? 37 GLY A N    1  
ATOM 613   C CA   . GLY A 1 38 ? 151.807 2.221   -15.148 1.00 0.00 ? 37 GLY A CA   1  
ATOM 614   C C    . GLY A 1 38 ? 153.327 2.317   -15.209 1.00 0.00 ? 37 GLY A C    1  
ATOM 615   O O    . GLY A 1 38 ? 153.903 2.371   -16.298 1.00 0.00 ? 37 GLY A O    1  
ATOM 616   H H    . GLY A 1 38 ? 150.981 2.004   -13.210 1.00 0.00 ? 37 GLY A H    1  
ATOM 617   H HA2  . GLY A 1 38 ? 151.516 1.194   -15.311 1.00 0.00 ? 37 GLY A HA2  1  
ATOM 618   H HA3  . GLY A 1 38 ? 151.389 2.827   -15.937 1.00 0.00 ? 37 GLY A HA3  1  
ATOM 619   N N    . GLN A 1 39 ? 153.980 2.336   -14.043 1.00 0.00 ? 38 GLN A N    1  
ATOM 620   C CA   . GLN A 1 39 ? 155.439 2.425   -13.974 1.00 0.00 ? 38 GLN A CA   1  
ATOM 621   C C    . GLN A 1 39 ? 155.968 1.776   -12.693 1.00 0.00 ? 38 GLN A C    1  
ATOM 622   O O    . GLN A 1 39 ? 155.273 1.743   -11.678 1.00 0.00 ? 38 GLN A O    1  
ATOM 623   C CB   . GLN A 1 39 ? 155.888 3.890   -14.025 1.00 0.00 ? 38 GLN A CB   1  
ATOM 624   C CG   . GLN A 1 39 ? 155.960 4.466   -15.430 1.00 0.00 ? 38 GLN A CG   1  
ATOM 625   C CD   . GLN A 1 39 ? 156.344 5.933   -15.435 1.00 0.00 ? 38 GLN A CD   1  
ATOM 626   O OE1  . GLN A 1 39 ? 155.492 6.808   -15.589 1.00 0.00 ? 38 GLN A OE1  1  
ATOM 627   N NE2  . GLN A 1 39 ? 157.632 6.211   -15.264 1.00 0.00 ? 38 GLN A NE2  1  
ATOM 628   H H    . GLN A 1 39 ? 153.469 2.287   -13.208 1.00 0.00 ? 38 GLN A H    1  
ATOM 629   H HA   . GLN A 1 39 ? 155.845 1.902   -14.827 1.00 0.00 ? 38 GLN A HA   1  
ATOM 630   H HB2  . GLN A 1 39 ? 155.194 4.487   -13.452 1.00 0.00 ? 38 GLN A HB2  1  
ATOM 631   H HB3  . GLN A 1 39 ? 156.868 3.969   -13.579 1.00 0.00 ? 38 GLN A HB3  1  
ATOM 632   H HG2  . GLN A 1 39 ? 156.696 3.914   -15.996 1.00 0.00 ? 38 GLN A HG2  1  
ATOM 633   H HG3  . GLN A 1 39 ? 154.993 4.361   -15.898 1.00 0.00 ? 38 GLN A HG3  1  
ATOM 634   H HE21 . GLN A 1 39 ? 158.257 5.465   -15.145 1.00 0.00 ? 38 GLN A HE21 1  
ATOM 635   H HE22 . GLN A 1 39 ? 157.905 7.152   -15.260 1.00 0.00 ? 38 GLN A HE22 1  
ATOM 636   N N    . PRO A 1 40 ? 157.214 1.260   -12.724 1.00 0.00 ? 39 PRO A N    1  
ATOM 637   C CA   . PRO A 1 40 ? 157.835 0.622   -11.557 1.00 0.00 ? 39 PRO A CA   1  
ATOM 638   C C    . PRO A 1 40 ? 158.234 1.641   -10.487 1.00 0.00 ? 39 PRO A C    1  
ATOM 639   O O    . PRO A 1 40 ? 159.377 2.102   -10.446 1.00 0.00 ? 39 PRO A O    1  
ATOM 640   C CB   . PRO A 1 40 ? 159.072 -0.062  -12.148 1.00 0.00 ? 39 PRO A CB   1  
ATOM 641   C CG   . PRO A 1 40 ? 159.418 0.752   -13.346 1.00 0.00 ? 39 PRO A CG   1  
ATOM 642   C CD   . PRO A 1 40 ? 158.114 1.266   -13.896 1.00 0.00 ? 39 PRO A CD   1  
ATOM 643   H HA   . PRO A 1 40 ? 157.183 -0.119  -11.121 1.00 0.00 ? 39 PRO A HA   1  
ATOM 644   H HB2  . PRO A 1 40 ? 159.872 -0.059  -11.422 1.00 0.00 ? 39 PRO A HB2  1  
ATOM 645   H HB3  . PRO A 1 40 ? 158.829 -1.080  -12.420 1.00 0.00 ? 39 PRO A HB3  1  
ATOM 646   H HG2  . PRO A 1 40 ? 160.052 1.577   -13.056 1.00 0.00 ? 39 PRO A HG2  1  
ATOM 647   H HG3  . PRO A 1 40 ? 159.915 0.135   -14.080 1.00 0.00 ? 39 PRO A HG3  1  
ATOM 648   H HD2  . PRO A 1 40 ? 158.237 2.267   -14.282 1.00 0.00 ? 39 PRO A HD2  1  
ATOM 649   H HD3  . PRO A 1 40 ? 157.745 0.606   -14.667 1.00 0.00 ? 39 PRO A HD3  1  
ATOM 650   N N    . LEU A 1 41 ? 157.277 1.994   -9.629  1.00 0.00 ? 40 LEU A N    1  
ATOM 651   C CA   . LEU A 1 41 ? 157.519 2.964   -8.563  1.00 0.00 ? 40 LEU A CA   1  
ATOM 652   C C    . LEU A 1 41 ? 158.100 2.288   -7.321  1.00 0.00 ? 40 LEU A C    1  
ATOM 653   O O    . LEU A 1 41 ? 157.750 1.150   -7.000  1.00 0.00 ? 40 LEU A O    1  
ATOM 654   C CB   . LEU A 1 41 ? 156.221 3.693   -8.203  1.00 0.00 ? 40 LEU A CB   1  
ATOM 655   C CG   . LEU A 1 41 ? 155.933 4.948   -9.030  1.00 0.00 ? 40 LEU A CG   1  
ATOM 656   C CD1  . LEU A 1 41 ? 155.109 4.605   -10.263 1.00 0.00 ? 40 LEU A CD1  1  
ATOM 657   C CD2  . LEU A 1 41 ? 155.220 5.988   -8.179  1.00 0.00 ? 40 LEU A CD2  1  
ATOM 658   H H    . LEU A 1 41 ? 156.384 1.597   -9.720  1.00 0.00 ? 40 LEU A H    1  
ATOM 659   H HA   . LEU A 1 41 ? 158.234 3.684   -8.933  1.00 0.00 ? 40 LEU A HA   1  
ATOM 660   H HB2  . LEU A 1 41 ? 155.397 3.004   -8.329  1.00 0.00 ? 40 LEU A HB2  1  
ATOM 661   H HB3  . LEU A 1 41 ? 156.272 3.978   -7.162  1.00 0.00 ? 40 LEU A HB3  1  
ATOM 662   H HG   . LEU A 1 41 ? 156.868 5.374   -9.363  1.00 0.00 ? 40 LEU A HG   1  
ATOM 663   H HD11 . LEU A 1 41 ? 154.268 3.991   -9.976  1.00 0.00 ? 40 LEU A HD11 1  
ATOM 664   H HD12 . LEU A 1 41 ? 155.724 4.066   -10.967 1.00 0.00 ? 40 LEU A HD12 1  
ATOM 665   H HD13 . LEU A 1 41 ? 154.750 5.515   -10.721 1.00 0.00 ? 40 LEU A HD13 1  
ATOM 666   H HD21 . LEU A 1 41 ? 155.815 6.206   -7.304  1.00 0.00 ? 40 LEU A HD21 1  
ATOM 667   H HD22 . LEU A 1 41 ? 154.257 5.606   -7.874  1.00 0.00 ? 40 LEU A HD22 1  
ATOM 668   H HD23 . LEU A 1 41 ? 155.082 6.891   -8.754  1.00 0.00 ? 40 LEU A HD23 1  
ATOM 669   N N    . ASP A 1 42 ? 158.987 3.003   -6.625  1.00 0.00 ? 41 ASP A N    1  
ATOM 670   C CA   . ASP A 1 42 ? 159.620 2.483   -5.413  1.00 0.00 ? 41 ASP A CA   1  
ATOM 671   C C    . ASP A 1 42 ? 158.907 2.995   -4.161  1.00 0.00 ? 41 ASP A C    1  
ATOM 672   O O    . ASP A 1 42 ? 158.511 4.161   -4.094  1.00 0.00 ? 41 ASP A O    1  
ATOM 673   C CB   . ASP A 1 42 ? 161.101 2.888   -5.371  1.00 0.00 ? 41 ASP A CB   1  
ATOM 674   C CG   . ASP A 1 42 ? 162.039 1.697   -5.260  1.00 0.00 ? 41 ASP A CG   1  
ATOM 675   O OD1  . ASP A 1 42 ? 161.818 0.690   -5.966  1.00 0.00 ? 41 ASP A OD1  1  
ATOM 676   O OD2  . ASP A 1 42 ? 163.004 1.775   -4.469  1.00 0.00 ? 41 ASP A OD2  1  
ATOM 677   H H    . ASP A 1 42 ? 159.220 3.905   -6.933  1.00 0.00 ? 41 ASP A H    1  
ATOM 678   H HA   . ASP A 1 42 ? 159.550 1.405   -5.438  1.00 0.00 ? 41 ASP A HA   1  
ATOM 679   H HB2  . ASP A 1 42 ? 161.345 3.426   -6.275  1.00 0.00 ? 41 ASP A HB2  1  
ATOM 680   H HB3  . ASP A 1 42 ? 161.267 3.532   -4.519  1.00 0.00 ? 41 ASP A HB3  1  
ATOM 681   N N    . LEU A 1 43 ? 158.747 2.114   -3.171  1.00 0.00 ? 42 LEU A N    1  
ATOM 682   C CA   . LEU A 1 43 ? 158.083 2.471   -1.916  1.00 0.00 ? 42 LEU A CA   1  
ATOM 683   C C    . LEU A 1 43 ? 159.107 2.796   -0.828  1.00 0.00 ? 42 LEU A C    1  
ATOM 684   O O    . LEU A 1 43 ? 160.019 2.009   -0.568  1.00 0.00 ? 42 LEU A O    1  
ATOM 685   C CB   . LEU A 1 43 ? 157.178 1.325   -1.444  1.00 0.00 ? 42 LEU A CB   1  
ATOM 686   C CG   . LEU A 1 43 ? 156.232 0.753   -2.503  1.00 0.00 ? 42 LEU A CG   1  
ATOM 687   C CD1  . LEU A 1 43 ? 155.713 -0.612  -2.074  1.00 0.00 ? 42 LEU A CD1  1  
ATOM 688   C CD2  . LEU A 1 43 ? 155.076 1.709   -2.758  1.00 0.00 ? 42 LEU A CD2  1  
ATOM 689   H H    . LEU A 1 43 ? 159.086 1.201   -3.287  1.00 0.00 ? 42 LEU A H    1  
ATOM 690   H HA   . LEU A 1 43 ? 157.476 3.345   -2.099  1.00 0.00 ? 42 LEU A HA   1  
ATOM 691   H HB2  . LEU A 1 43 ? 157.808 0.524   -1.086  1.00 0.00 ? 42 LEU A HB2  1  
ATOM 692   H HB3  . LEU A 1 43 ? 156.582 1.685   -0.619  1.00 0.00 ? 42 LEU A HB3  1  
ATOM 693   H HG   . LEU A 1 43 ? 156.773 0.628   -3.429  1.00 0.00 ? 42 LEU A HG   1  
ATOM 694   H HD11 . LEU A 1 43 ? 154.808 -0.489  -1.498  1.00 0.00 ? 42 LEU A HD11 1  
ATOM 695   H HD12 . LEU A 1 43 ? 156.459 -1.108  -1.472  1.00 0.00 ? 42 LEU A HD12 1  
ATOM 696   H HD13 . LEU A 1 43 ? 155.504 -1.208  -2.950  1.00 0.00 ? 42 LEU A HD13 1  
ATOM 697   H HD21 . LEU A 1 43 ? 155.460 2.706   -2.914  1.00 0.00 ? 42 LEU A HD21 1  
ATOM 698   H HD22 . LEU A 1 43 ? 154.413 1.708   -1.905  1.00 0.00 ? 42 LEU A HD22 1  
ATOM 699   H HD23 . LEU A 1 43 ? 154.533 1.391   -3.636  1.00 0.00 ? 42 LEU A HD23 1  
ATOM 700   N N    . HIS A 1 44 ? 158.952 3.960   -0.195  1.00 0.00 ? 43 HIS A N    1  
ATOM 701   C CA   . HIS A 1 44 ? 159.865 4.384   0.865   1.00 0.00 ? 43 HIS A CA   1  
ATOM 702   C C    . HIS A 1 44 ? 159.141 4.483   2.207   1.00 0.00 ? 43 HIS A C    1  
ATOM 703   O O    . HIS A 1 44 ? 158.232 5.298   2.374   1.00 0.00 ? 43 HIS A O    1  
ATOM 704   C CB   . HIS A 1 44 ? 160.500 5.733   0.512   1.00 0.00 ? 43 HIS A CB   1  
ATOM 705   C CG   . HIS A 1 44 ? 161.614 5.628   -0.485  1.00 0.00 ? 43 HIS A CG   1  
ATOM 706   N ND1  . HIS A 1 44 ? 162.691 6.489   -0.506  1.00 0.00 ? 43 HIS A ND1  1  
ATOM 707   C CD2  . HIS A 1 44 ? 161.814 4.756   -1.501  1.00 0.00 ? 43 HIS A CD2  1  
ATOM 708   C CE1  . HIS A 1 44 ? 163.504 6.151   -1.491  1.00 0.00 ? 43 HIS A CE1  1  
ATOM 709   N NE2  . HIS A 1 44 ? 162.994 5.102   -2.111  1.00 0.00 ? 43 HIS A NE2  1  
ATOM 710   H H    . HIS A 1 44 ? 158.208 4.546   -0.445  1.00 0.00 ? 43 HIS A H    1  
ATOM 711   H HA   . HIS A 1 44 ? 160.646 3.642   0.947   1.00 0.00 ? 43 HIS A HA   1  
ATOM 712   H HB2  . HIS A 1 44 ? 159.742 6.382   0.097   1.00 0.00 ? 43 HIS A HB2  1  
ATOM 713   H HB3  . HIS A 1 44 ? 160.897 6.181   1.411   1.00 0.00 ? 43 HIS A HB3  1  
ATOM 714   H HD1  . HIS A 1 44 ? 162.837 7.239   0.110   1.00 0.00 ? 43 HIS A HD1  1  
ATOM 715   H HD2  . HIS A 1 44 ? 161.164 3.939   -1.781  1.00 0.00 ? 43 HIS A HD2  1  
ATOM 716   H HE1  . HIS A 1 44 ? 164.429 6.646   -1.744  1.00 0.00 ? 43 HIS A HE1  1  
ATOM 717   H HE2  . HIS A 1 44 ? 163.319 4.739   -2.961  1.00 0.00 ? 43 HIS A HE2  1  
ATOM 718   N N    . TYR A 1 45 ? 159.554 3.647   3.158   1.00 0.00 ? 44 TYR A N    1  
ATOM 719   C CA   . TYR A 1 45 ? 158.954 3.631   4.488   1.00 0.00 ? 44 TYR A CA   1  
ATOM 720   C C    . TYR A 1 45 ? 159.709 4.561   5.438   1.00 0.00 ? 44 TYR A C    1  
ATOM 721   O O    . TYR A 1 45 ? 160.829 4.262   5.855   1.00 0.00 ? 44 TYR A O    1  
ATOM 722   C CB   . TYR A 1 45 ? 158.951 2.204   5.043   1.00 0.00 ? 44 TYR A CB   1  
ATOM 723   C CG   . TYR A 1 45 ? 157.693 1.846   5.799   1.00 0.00 ? 44 TYR A CG   1  
ATOM 724   C CD1  . TYR A 1 45 ? 156.574 1.366   5.131   1.00 0.00 ? 44 TYR A CD1  1  
ATOM 725   C CD2  . TYR A 1 45 ? 157.627 1.981   7.179   1.00 0.00 ? 44 TYR A CD2  1  
ATOM 726   C CE1  . TYR A 1 45 ? 155.422 1.032   5.819   1.00 0.00 ? 44 TYR A CE1  1  
ATOM 727   C CE2  . TYR A 1 45 ? 156.479 1.650   7.875   1.00 0.00 ? 44 TYR A CE2  1  
ATOM 728   C CZ   . TYR A 1 45 ? 155.380 1.175   7.190   1.00 0.00 ? 44 TYR A CZ   1  
ATOM 729   O OH   . TYR A 1 45 ? 154.235 0.842   7.880   1.00 0.00 ? 44 TYR A OH   1  
ATOM 730   H H    . TYR A 1 45 ? 160.284 3.022   2.961   1.00 0.00 ? 44 TYR A H    1  
ATOM 731   H HA   . TYR A 1 45 ? 157.934 3.976   4.397   1.00 0.00 ? 44 TYR A HA   1  
ATOM 732   H HB2  . TYR A 1 45 ? 159.054 1.508   4.224   1.00 0.00 ? 44 TYR A HB2  1  
ATOM 733   H HB3  . TYR A 1 45 ? 159.789 2.085   5.716   1.00 0.00 ? 44 TYR A HB3  1  
ATOM 734   H HD1  . TYR A 1 45 ? 156.612 1.256   4.058   1.00 0.00 ? 44 TYR A HD1  1  
ATOM 735   H HD2  . TYR A 1 45 ? 158.489 2.354   7.711   1.00 0.00 ? 44 TYR A HD2  1  
ATOM 736   H HE1  . TYR A 1 45 ? 154.561 0.660   5.282   1.00 0.00 ? 44 TYR A HE1  1  
ATOM 737   H HE2  . TYR A 1 45 ? 156.448 1.763   8.948   1.00 0.00 ? 44 TYR A HE2  1  
ATOM 738   H HH   . TYR A 1 45 ? 154.387 0.043   8.390   1.00 0.00 ? 44 TYR A HH   1  
ATOM 739   N N    . MET A 1 46 ? 159.084 5.685   5.781   1.00 0.00 ? 45 MET A N    1  
ATOM 740   C CA   . MET A 1 46 ? 159.688 6.658   6.687   1.00 0.00 ? 45 MET A CA   1  
ATOM 741   C C    . MET A 1 46 ? 159.036 6.581   8.065   1.00 0.00 ? 45 MET A C    1  
ATOM 742   O O    . MET A 1 46 ? 157.838 6.829   8.207   1.00 0.00 ? 45 MET A O    1  
ATOM 743   C CB   . MET A 1 46 ? 159.551 8.073   6.117   1.00 0.00 ? 45 MET A CB   1  
ATOM 744   C CG   . MET A 1 46 ? 160.329 8.291   4.827   1.00 0.00 ? 45 MET A CG   1  
ATOM 745   S SD   . MET A 1 46 ? 159.256 8.515   3.393   1.00 0.00 ? 45 MET A SD   1  
ATOM 746   C CE   . MET A 1 46 ? 159.297 10.297  3.212   1.00 0.00 ? 45 MET A CE   1  
ATOM 747   H H    . MET A 1 46 ? 158.190 5.864   5.420   1.00 0.00 ? 45 MET A H    1  
ATOM 748   H HA   . MET A 1 46 ? 160.737 6.417   6.783   1.00 0.00 ? 45 MET A HA   1  
ATOM 749   H HB2  . MET A 1 46 ? 158.507 8.271   5.922   1.00 0.00 ? 45 MET A HB2  1  
ATOM 750   H HB3  . MET A 1 46 ? 159.909 8.780   6.851   1.00 0.00 ? 45 MET A HB3  1  
ATOM 751   H HG2  . MET A 1 46 ? 160.943 9.173   4.938   1.00 0.00 ? 45 MET A HG2  1  
ATOM 752   H HG3  . MET A 1 46 ? 160.963 7.433   4.654   1.00 0.00 ? 45 MET A HG3  1  
ATOM 753   H HE1  . MET A 1 46 ? 160.305 10.613  2.989   1.00 0.00 ? 45 MET A HE1  1  
ATOM 754   H HE2  . MET A 1 46 ? 158.969 10.760  4.131   1.00 0.00 ? 45 MET A HE2  1  
ATOM 755   H HE3  . MET A 1 46 ? 158.641 10.591  2.406   1.00 0.00 ? 45 MET A HE3  1  
ATOM 756   N N    . ASN A 1 47 ? 159.830 6.232   9.076   1.00 0.00 ? 46 ASN A N    1  
ATOM 757   C CA   . ASN A 1 47 ? 159.328 6.117   10.444  1.00 0.00 ? 46 ASN A CA   1  
ATOM 758   C C    . ASN A 1 47 ? 159.136 7.498   11.069  1.00 0.00 ? 46 ASN A C    1  
ATOM 759   O O    . ASN A 1 47 ? 158.027 7.868   11.456  1.00 0.00 ? 46 ASN A O    1  
ATOM 760   C CB   . ASN A 1 47 ? 160.296 5.286   11.293  1.00 0.00 ? 46 ASN A CB   1  
ATOM 761   C CG   . ASN A 1 47 ? 159.602 4.569   12.437  1.00 0.00 ? 46 ASN A CG   1  
ATOM 762   O OD1  . ASN A 1 47 ? 159.283 5.175   13.459  1.00 0.00 ? 46 ASN A OD1  1  
ATOM 763   N ND2  . ASN A 1 47 ? 159.369 3.270   12.272  1.00 0.00 ? 46 ASN A ND2  1  
ATOM 764   H H    . ASN A 1 47 ? 160.779 6.046   8.898   1.00 0.00 ? 46 ASN A H    1  
ATOM 765   H HA   . ASN A 1 47 ? 158.372 5.615   10.405  1.00 0.00 ? 46 ASN A HA   1  
ATOM 766   H HB2  . ASN A 1 47 ? 160.770 4.547   10.665  1.00 0.00 ? 46 ASN A HB2  1  
ATOM 767   H HB3  . ASN A 1 47 ? 161.052 5.937   11.707  1.00 0.00 ? 46 ASN A HB3  1  
ATOM 768   H HD21 . ASN A 1 47 ? 159.652 2.849   11.433  1.00 0.00 ? 46 ASN A HD21 1  
ATOM 769   H HD22 . ASN A 1 47 ? 158.923 2.786   12.999  1.00 0.00 ? 46 ASN A HD22 1  
ATOM 770   N N    . ASN A 1 48 ? 160.230 8.255   11.155  1.00 0.00 ? 47 ASN A N    1  
ATOM 771   C CA   . ASN A 1 48 ? 160.211 9.603   11.722  1.00 0.00 ? 47 ASN A CA   1  
ATOM 772   C C    . ASN A 1 48 ? 161.601 10.228  11.646  1.00 0.00 ? 47 ASN A C    1  
ATOM 773   O O    . ASN A 1 48 ? 161.764 11.348  11.159  1.00 0.00 ? 47 ASN A O    1  
ATOM 774   C CB   . ASN A 1 48 ? 159.730 9.579   13.179  1.00 0.00 ? 47 ASN A CB   1  
ATOM 775   C CG   . ASN A 1 48 ? 158.558 10.515  13.419  1.00 0.00 ? 47 ASN A CG   1  
ATOM 776   O OD1  . ASN A 1 48 ? 157.448 10.074  13.718  1.00 0.00 ? 47 ASN A OD1  1  
ATOM 777   N ND2  . ASN A 1 48 ? 158.801 11.816  13.294  1.00 0.00 ? 47 ASN A ND2  1  
ATOM 778   H H    . ASN A 1 48 ? 161.079 7.895   10.820  1.00 0.00 ? 47 ASN A H    1  
ATOM 779   H HA   . ASN A 1 48 ? 159.528 10.199  11.134  1.00 0.00 ? 47 ASN A HA   1  
ATOM 780   H HB2  . ASN A 1 48 ? 159.424 8.577   13.437  1.00 0.00 ? 47 ASN A HB2  1  
ATOM 781   H HB3  . ASN A 1 48 ? 160.543 9.880   13.824  1.00 0.00 ? 47 ASN A HB3  1  
ATOM 782   H HD21 . ASN A 1 48 ? 159.709 12.098  13.057  1.00 0.00 ? 47 ASN A HD21 1  
ATOM 783   H HD22 . ASN A 1 48 ? 158.061 12.440  13.444  1.00 0.00 ? 47 ASN A HD22 1  
ATOM 784   N N    . GLU A 1 49 ? 162.599 9.490   12.131  1.00 0.00 ? 48 GLU A N    1  
ATOM 785   C CA   . GLU A 1 49 ? 163.982 9.957   12.122  1.00 0.00 ? 48 GLU A CA   1  
ATOM 786   C C    . GLU A 1 49 ? 164.797 9.280   11.014  1.00 0.00 ? 48 GLU A C    1  
ATOM 787   O O    . GLU A 1 49 ? 165.721 9.884   10.465  1.00 0.00 ? 48 GLU A O    1  
ATOM 788   C CB   . GLU A 1 49 ? 164.641 9.696   13.481  1.00 0.00 ? 48 GLU A CB   1  
ATOM 789   C CG   . GLU A 1 49 ? 163.820 10.177  14.670  1.00 0.00 ? 48 GLU A CG   1  
ATOM 790   C CD   . GLU A 1 49 ? 164.117 9.400   15.938  1.00 0.00 ? 48 GLU A CD   1  
ATOM 791   O OE1  . GLU A 1 49 ? 165.263 9.478   16.429  1.00 0.00 ? 48 GLU A OE1  1  
ATOM 792   O OE2  . GLU A 1 49 ? 163.203 8.713   16.441  1.00 0.00 ? 48 GLU A OE2  1  
ATOM 793   H H    . GLU A 1 49 ? 162.399 8.606   12.505  1.00 0.00 ? 48 GLU A H    1  
ATOM 794   H HA   . GLU A 1 49 ? 163.970 11.022  11.942  1.00 0.00 ? 48 GLU A HA   1  
ATOM 795   H HB2  . GLU A 1 49 ? 164.802 8.634   13.592  1.00 0.00 ? 48 GLU A HB2  1  
ATOM 796   H HB3  . GLU A 1 49 ? 165.597 10.199  13.506  1.00 0.00 ? 48 GLU A HB3  1  
ATOM 797   H HG2  . GLU A 1 49 ? 164.041 11.220  14.847  1.00 0.00 ? 48 GLU A HG2  1  
ATOM 798   H HG3  . GLU A 1 49 ? 162.771 10.068  14.436  1.00 0.00 ? 48 GLU A HG3  1  
ATOM 799   N N    . LEU A 1 50 ? 164.461 8.024   10.692  1.00 0.00 ? 49 LEU A N    1  
ATOM 800   C CA   . LEU A 1 50 ? 165.179 7.279   9.657   1.00 0.00 ? 49 LEU A CA   1  
ATOM 801   C C    . LEU A 1 50 ? 164.250 6.863   8.514   1.00 0.00 ? 49 LEU A C    1  
ATOM 802   O O    . LEU A 1 50 ? 163.035 6.752   8.696   1.00 0.00 ? 49 LEU A O    1  
ATOM 803   C CB   . LEU A 1 50 ? 165.845 6.042   10.267  1.00 0.00 ? 49 LEU A CB   1  
ATOM 804   C CG   . LEU A 1 50 ? 167.127 5.576   9.568   1.00 0.00 ? 49 LEU A CG   1  
ATOM 805   C CD1  . LEU A 1 50 ? 168.256 6.572   9.795   1.00 0.00 ? 49 LEU A CD1  1  
ATOM 806   C CD2  . LEU A 1 50 ? 167.526 4.192   10.058  1.00 0.00 ? 49 LEU A CD2  1  
ATOM 807   H H    . LEU A 1 50 ? 163.721 7.589   11.164  1.00 0.00 ? 49 LEU A H    1  
ATOM 808   H HA   . LEU A 1 50 ? 165.946 7.927   9.259   1.00 0.00 ? 49 LEU A HA   1  
ATOM 809   H HB2  . LEU A 1 50 ? 166.083 6.261   11.299  1.00 0.00 ? 49 LEU A HB2  1  
ATOM 810   H HB3  . LEU A 1 50 ? 165.136 5.228   10.245  1.00 0.00 ? 49 LEU A HB3  1  
ATOM 811   H HG   . LEU A 1 50 ? 166.946 5.516   8.504   1.00 0.00 ? 49 LEU A HG   1  
ATOM 812   H HD11 . LEU A 1 50 ? 168.475 6.634   10.850  1.00 0.00 ? 49 LEU A HD11 1  
ATOM 813   H HD12 . LEU A 1 50 ? 167.957 7.545   9.432   1.00 0.00 ? 49 LEU A HD12 1  
ATOM 814   H HD13 . LEU A 1 50 ? 169.137 6.245   9.262   1.00 0.00 ? 49 LEU A HD13 1  
ATOM 815   H HD21 . LEU A 1 50 ? 168.247 4.286   10.857  1.00 0.00 ? 49 LEU A HD21 1  
ATOM 816   H HD22 . LEU A 1 50 ? 167.961 3.632   9.244   1.00 0.00 ? 49 LEU A HD22 1  
ATOM 817   H HD23 . LEU A 1 50 ? 166.651 3.674   10.424  1.00 0.00 ? 49 LEU A HD23 1  
ATOM 818   N N    . SER A 1 51 ? 164.838 6.631   7.335   1.00 0.00 ? 50 SER A N    1  
ATOM 819   C CA   . SER A 1 51 ? 164.076 6.225   6.155   1.00 0.00 ? 50 SER A CA   1  
ATOM 820   C C    . SER A 1 51 ? 164.488 4.829   5.686   1.00 0.00 ? 50 SER A C    1  
ATOM 821   O O    . SER A 1 51 ? 165.676 4.538   5.540   1.00 0.00 ? 50 SER A O    1  
ATOM 822   C CB   . SER A 1 51 ? 164.271 7.236   5.019   1.00 0.00 ? 50 SER A CB   1  
ATOM 823   O OG   . SER A 1 51 ? 163.593 6.824   3.844   1.00 0.00 ? 50 SER A OG   1  
ATOM 824   H H    . SER A 1 51 ? 165.809 6.735   7.259   1.00 0.00 ? 50 SER A H    1  
ATOM 825   H HA   . SER A 1 51 ? 163.032 6.204   6.429   1.00 0.00 ? 50 SER A HA   1  
ATOM 826   H HB2  . SER A 1 51 ? 163.880 8.195   5.323   1.00 0.00 ? 50 SER A HB2  1  
ATOM 827   H HB3  . SER A 1 51 ? 165.325 7.329   4.799   1.00 0.00 ? 50 SER A HB3  1  
ATOM 828   H HG   . SER A 1 51 ? 164.224 6.736   3.123   1.00 0.00 ? 50 SER A HG   1  
ATOM 829   N N    . ILE A 1 52 ? 163.494 3.972   5.447   1.00 0.00 ? 51 ILE A N    1  
ATOM 830   C CA   . ILE A 1 52 ? 163.739 2.606   4.988   1.00 0.00 ? 51 ILE A CA   1  
ATOM 831   C C    . ILE A 1 52 ? 163.199 2.399   3.571   1.00 0.00 ? 51 ILE A C    1  
ATOM 832   O O    . ILE A 1 52 ? 162.071 2.788   3.266   1.00 0.00 ? 51 ILE A O    1  
ATOM 833   C CB   . ILE A 1 52 ? 163.087 1.568   5.931   1.00 0.00 ? 51 ILE A CB   1  
ATOM 834   C CG1  . ILE A 1 52 ? 163.429 1.871   7.396   1.00 0.00 ? 51 ILE A CG1  1  
ATOM 835   C CG2  . ILE A 1 52 ? 163.527 0.158   5.560   1.00 0.00 ? 51 ILE A CG2  1  
ATOM 836   C CD1  . ILE A 1 52 ? 164.910 1.792   7.711   1.00 0.00 ? 51 ILE A CD1  1  
ATOM 837   H H    . ILE A 1 52 ? 162.567 4.269   5.578   1.00 0.00 ? 51 ILE A H    1  
ATOM 838   H HA   . ILE A 1 52 ? 164.807 2.440   4.986   1.00 0.00 ? 51 ILE A HA   1  
ATOM 839   H HB   . ILE A 1 52 ? 162.016 1.627   5.802   1.00 0.00 ? 51 ILE A HB   1  
ATOM 840   H HG12 . ILE A 1 52 ? 163.092 2.867   7.639   1.00 0.00 ? 51 ILE A HG12 1  
ATOM 841   H HG13 . ILE A 1 52 ? 162.917 1.160   8.030   1.00 0.00 ? 51 ILE A HG13 1  
ATOM 842   H HG21 . ILE A 1 52 ? 162.980 -0.557  6.157   1.00 0.00 ? 51 ILE A HG21 1  
ATOM 843   H HG22 . ILE A 1 52 ? 164.584 0.050   5.749   1.00 0.00 ? 51 ILE A HG22 1  
ATOM 844   H HG23 . ILE A 1 52 ? 163.327 -0.019  4.514   1.00 0.00 ? 51 ILE A HG23 1  
ATOM 845   H HD11 . ILE A 1 52 ? 165.188 0.763   7.879   1.00 0.00 ? 51 ILE A HD11 1  
ATOM 846   H HD12 . ILE A 1 52 ? 165.120 2.371   8.599   1.00 0.00 ? 51 ILE A HD12 1  
ATOM 847   H HD13 . ILE A 1 52 ? 165.477 2.188   6.881   1.00 0.00 ? 51 ILE A HD13 1  
ATOM 848   N N    . LEU A 1 53 ? 164.007 1.779   2.709   1.00 0.00 ? 52 LEU A N    1  
ATOM 849   C CA   . LEU A 1 53 ? 163.605 1.519   1.325   1.00 0.00 ? 52 LEU A CA   1  
ATOM 850   C C    . LEU A 1 53 ? 163.058 0.100   1.175   1.00 0.00 ? 52 LEU A C    1  
ATOM 851   O O    . LEU A 1 53 ? 163.638 -0.857  1.691   1.00 0.00 ? 52 LEU A O    1  
ATOM 852   C CB   . LEU A 1 53 ? 164.792 1.727   0.377   1.00 0.00 ? 52 LEU A CB   1  
ATOM 853   C CG   . LEU A 1 53 ? 164.424 1.913   -1.100  1.00 0.00 ? 52 LEU A CG   1  
ATOM 854   C CD1  . LEU A 1 53 ? 165.430 2.817   -1.798  1.00 0.00 ? 52 LEU A CD1  1  
ATOM 855   C CD2  . LEU A 1 53 ? 164.340 0.567   -1.807  1.00 0.00 ? 52 LEU A CD2  1  
ATOM 856   H H    . LEU A 1 53 ? 164.893 1.487   3.010   1.00 0.00 ? 52 LEU A H    1  
ATOM 857   H HA   . LEU A 1 53 ? 162.826 2.220   1.070   1.00 0.00 ? 52 LEU A HA   1  
ATOM 858   H HB2  . LEU A 1 53 ? 165.334 2.603   0.704   1.00 0.00 ? 52 LEU A HB2  1  
ATOM 859   H HB3  . LEU A 1 53 ? 165.445 0.871   0.457   1.00 0.00 ? 52 LEU A HB3  1  
ATOM 860   H HG   . LEU A 1 53 ? 163.454 2.385   -1.164  1.00 0.00 ? 52 LEU A HG   1  
ATOM 861   H HD11 . LEU A 1 53 ? 164.938 3.354   -2.596  1.00 0.00 ? 52 LEU A HD11 1  
ATOM 862   H HD12 . LEU A 1 53 ? 166.229 2.217   -2.209  1.00 0.00 ? 52 LEU A HD12 1  
ATOM 863   H HD13 . LEU A 1 53 ? 165.838 3.521   -1.088  1.00 0.00 ? 52 LEU A HD13 1  
ATOM 864   H HD21 . LEU A 1 53 ? 165.275 0.363   -2.306  1.00 0.00 ? 52 LEU A HD21 1  
ATOM 865   H HD22 . LEU A 1 53 ? 163.544 0.594   -2.536  1.00 0.00 ? 52 LEU A HD22 1  
ATOM 866   H HD23 . LEU A 1 53 ? 164.139 -0.210  -1.085  1.00 0.00 ? 52 LEU A HD23 1  
ATOM 867   N N    . LEU A 1 54 ? 161.938 -0.031  0.464   1.00 0.00 ? 53 LEU A N    1  
ATOM 868   C CA   . LEU A 1 54 ? 161.313 -1.334  0.248   1.00 0.00 ? 53 LEU A CA   1  
ATOM 869   C C    . LEU A 1 54 ? 161.888 -2.024  -0.989  1.00 0.00 ? 53 LEU A C    1  
ATOM 870   O O    . LEU A 1 54 ? 161.531 -1.692  -2.120  1.00 0.00 ? 53 LEU A O    1  
ATOM 871   C CB   . LEU A 1 54 ? 159.794 -1.180  0.108   1.00 0.00 ? 53 LEU A CB   1  
ATOM 872   C CG   . LEU A 1 54 ? 158.997 -1.459  1.385   1.00 0.00 ? 53 LEU A CG   1  
ATOM 873   C CD1  . LEU A 1 54 ? 157.635 -0.780  1.333   1.00 0.00 ? 53 LEU A CD1  1  
ATOM 874   C CD2  . LEU A 1 54 ? 158.840 -2.957  1.597   1.00 0.00 ? 53 LEU A CD2  1  
ATOM 875   H H    . LEU A 1 54 ? 161.522 0.768   0.075   1.00 0.00 ? 53 LEU A H    1  
ATOM 876   H HA   . LEU A 1 54 ? 161.523 -1.946  1.112   1.00 0.00 ? 53 LEU A HA   1  
ATOM 877   H HB2  . LEU A 1 54 ? 159.583 -0.170  -0.212  1.00 0.00 ? 53 LEU A HB2  1  
ATOM 878   H HB3  . LEU A 1 54 ? 159.453 -1.860  -0.658  1.00 0.00 ? 53 LEU A HB3  1  
ATOM 879   H HG   . LEU A 1 54 ? 159.536 -1.058  2.231   1.00 0.00 ? 53 LEU A HG   1  
ATOM 880   H HD11 . LEU A 1 54 ? 157.119 -0.938  2.269   1.00 0.00 ? 53 LEU A HD11 1  
ATOM 881   H HD12 . LEU A 1 54 ? 157.052 -1.200  0.526   1.00 0.00 ? 53 LEU A HD12 1  
ATOM 882   H HD13 . LEU A 1 54 ? 157.766 0.279   1.169   1.00 0.00 ? 53 LEU A HD13 1  
ATOM 883   H HD21 . LEU A 1 54 ? 158.855 -3.461  0.641   1.00 0.00 ? 53 LEU A HD21 1  
ATOM 884   H HD22 . LEU A 1 54 ? 157.902 -3.154  2.092   1.00 0.00 ? 53 LEU A HD22 1  
ATOM 885   H HD23 . LEU A 1 54 ? 159.653 -3.320  2.207   1.00 0.00 ? 53 LEU A HD23 1  
ATOM 886   N N    . LYS A 1 55 ? 162.778 -2.988  -0.760  1.00 0.00 ? 54 LYS A N    1  
ATOM 887   C CA   . LYS A 1 55 ? 163.403 -3.734  -1.850  1.00 0.00 ? 54 LYS A CA   1  
ATOM 888   C C    . LYS A 1 55 ? 162.840 -5.154  -1.948  1.00 0.00 ? 54 LYS A C    1  
ATOM 889   O O    . LYS A 1 55 ? 162.706 -5.699  -3.045  1.00 0.00 ? 54 LYS A O    1  
ATOM 890   C CB   . LYS A 1 55 ? 164.922 -3.785  -1.658  1.00 0.00 ? 54 LYS A CB   1  
ATOM 891   C CG   . LYS A 1 55 ? 165.668 -2.655  -2.354  1.00 0.00 ? 54 LYS A CG   1  
ATOM 892   C CD   . LYS A 1 55 ? 165.700 -2.846  -3.863  1.00 0.00 ? 54 LYS A CD   1  
ATOM 893   C CE   . LYS A 1 55 ? 164.647 -1.993  -4.560  1.00 0.00 ? 54 LYS A CE   1  
ATOM 894   N NZ   . LYS A 1 55 ? 165.212 -0.719  -5.091  1.00 0.00 ? 54 LYS A NZ   1  
ATOM 895   H H    . LYS A 1 55 ? 163.019 -3.206  0.167   1.00 0.00 ? 54 LYS A H    1  
ATOM 896   H HA   . LYS A 1 55 ? 163.185 -3.214  -2.770  1.00 0.00 ? 54 LYS A HA   1  
ATOM 897   H HB2  . LYS A 1 55 ? 165.140 -3.733  -0.602  1.00 0.00 ? 54 LYS A HB2  1  
ATOM 898   H HB3  . LYS A 1 55 ? 165.291 -4.724  -2.045  1.00 0.00 ? 54 LYS A HB3  1  
ATOM 899   H HG2  . LYS A 1 55 ? 165.177 -1.721  -2.129  1.00 0.00 ? 54 LYS A HG2  1  
ATOM 900   H HG3  . LYS A 1 55 ? 166.682 -2.628  -1.983  1.00 0.00 ? 54 LYS A HG3  1  
ATOM 901   H HD2  . LYS A 1 55 ? 166.677 -2.567  -4.231  1.00 0.00 ? 54 LYS A HD2  1  
ATOM 902   H HD3  . LYS A 1 55 ? 165.513 -3.886  -4.088  1.00 0.00 ? 54 LYS A HD3  1  
ATOM 903   H HE2  . LYS A 1 55 ? 164.232 -2.559  -5.381  1.00 0.00 ? 54 LYS A HE2  1  
ATOM 904   H HE3  . LYS A 1 55 ? 163.864 -1.762  -3.854  1.00 0.00 ? 54 LYS A HE3  1  
ATOM 905   H HZ1  . LYS A 1 55 ? 165.790 -0.908  -5.936  1.00 0.00 ? 54 LYS A HZ1  1  
ATOM 906   H HZ2  . LYS A 1 55 ? 165.810 -0.263  -4.371  1.00 0.00 ? 54 LYS A HZ2  1  
ATOM 907   H HZ3  . LYS A 1 55 ? 164.443 -0.067  -5.349  1.00 0.00 ? 54 LYS A HZ3  1  
ATOM 908   N N    . ASN A 1 56 ? 162.519 -5.749  -0.797  1.00 0.00 ? 55 ASN A N    1  
ATOM 909   C CA   . ASN A 1 56 ? 161.977 -7.108  -0.756  1.00 0.00 ? 55 ASN A CA   1  
ATOM 910   C C    . ASN A 1 56 ? 160.912 -7.249  0.332   1.00 0.00 ? 55 ASN A C    1  
ATOM 911   O O    . ASN A 1 56 ? 160.610 -6.290  1.045   1.00 0.00 ? 55 ASN A O    1  
ATOM 912   C CB   . ASN A 1 56 ? 163.104 -8.123  -0.522  1.00 0.00 ? 55 ASN A CB   1  
ATOM 913   C CG   . ASN A 1 56 ? 163.982 -7.769  0.668   1.00 0.00 ? 55 ASN A CG   1  
ATOM 914   O OD1  . ASN A 1 56 ? 163.542 -7.101  1.605   1.00 0.00 ? 55 ASN A OD1  1  
ATOM 915   N ND2  . ASN A 1 56 ? 165.233 -8.215  0.636   1.00 0.00 ? 55 ASN A ND2  1  
ATOM 916   H H    . ASN A 1 56 ? 162.654 -5.265  0.044   1.00 0.00 ? 55 ASN A H    1  
ATOM 917   H HA   . ASN A 1 56 ? 161.521 -7.309  -1.714  1.00 0.00 ? 55 ASN A HA   1  
ATOM 918   H HB2  . ASN A 1 56 ? 162.672 -9.097  -0.344  1.00 0.00 ? 55 ASN A HB2  1  
ATOM 919   H HB3  . ASN A 1 56 ? 163.726 -8.168  -1.405  1.00 0.00 ? 55 ASN A HB3  1  
ATOM 920   H HD21 . ASN A 1 56 ? 165.520 -8.739  -0.140  1.00 0.00 ? 55 ASN A HD21 1  
ATOM 921   H HD22 . ASN A 1 56 ? 165.819 -8.001  1.392   1.00 0.00 ? 55 ASN A HD22 1  
ATOM 922   N N    . GLN A 1 57 ? 160.350 -8.456  0.457   1.00 0.00 ? 56 GLN A N    1  
ATOM 923   C CA   . GLN A 1 57 ? 159.323 -8.727  1.464   1.00 0.00 ? 56 GLN A CA   1  
ATOM 924   C C    . GLN A 1 57 ? 159.872 -8.505  2.873   1.00 0.00 ? 56 GLN A C    1  
ATOM 925   O O    . GLN A 1 57 ? 159.143 -8.076  3.765   1.00 0.00 ? 56 GLN A O    1  
ATOM 926   C CB   . GLN A 1 57 ? 158.794 -10.160 1.331   1.00 0.00 ? 56 GLN A CB   1  
ATOM 927   C CG   . GLN A 1 57 ? 157.690 -10.498 2.325   1.00 0.00 ? 56 GLN A CG   1  
ATOM 928   C CD   . GLN A 1 57 ? 156.545 -11.264 1.692   1.00 0.00 ? 56 GLN A CD   1  
ATOM 929   O OE1  . GLN A 1 57 ? 156.652 -12.463 1.433   1.00 0.00 ? 56 GLN A OE1  1  
ATOM 930   N NE2  . GLN A 1 57 ? 155.440 -10.573 1.437   1.00 0.00 ? 56 GLN A NE2  1  
ATOM 931   H H    . GLN A 1 57 ? 160.636 -9.181  -0.139  1.00 0.00 ? 56 GLN A H    1  
ATOM 932   H HA   . GLN A 1 57 ? 158.509 -8.036  1.297   1.00 0.00 ? 56 GLN A HA   1  
ATOM 933   H HB2  . GLN A 1 57 ? 158.404 -10.296 0.333   1.00 0.00 ? 56 GLN A HB2  1  
ATOM 934   H HB3  . GLN A 1 57 ? 159.610 -10.849 1.486   1.00 0.00 ? 56 GLN A HB3  1  
ATOM 935   H HG2  . GLN A 1 57 ? 158.108 -11.099 3.119   1.00 0.00 ? 56 GLN A HG2  1  
ATOM 936   H HG3  . GLN A 1 57 ? 157.301 -9.578  2.741   1.00 0.00 ? 56 GLN A HG3  1  
ATOM 937   H HE21 . GLN A 1 57 ? 155.425 -9.621  1.669   1.00 0.00 ? 56 GLN A HE21 1  
ATOM 938   H HE22 . GLN A 1 57 ? 154.683 -11.044 1.030   1.00 0.00 ? 56 GLN A HE22 1  
ATOM 939   N N    . ASP A 1 58 ? 161.162 -8.800  3.062   1.00 0.00 ? 57 ASP A N    1  
ATOM 940   C CA   . ASP A 1 58 ? 161.813 -8.631  4.364   1.00 0.00 ? 57 ASP A CA   1  
ATOM 941   C C    . ASP A 1 58 ? 161.603 -7.213  4.901   1.00 0.00 ? 57 ASP A C    1  
ATOM 942   O O    . ASP A 1 58 ? 161.314 -7.029  6.084   1.00 0.00 ? 57 ASP A O    1  
ATOM 943   C CB   . ASP A 1 58 ? 163.314 -8.930  4.255   1.00 0.00 ? 57 ASP A CB   1  
ATOM 944   C CG   . ASP A 1 58 ? 163.603 -10.409 4.078   1.00 0.00 ? 57 ASP A CG   1  
ATOM 945   O OD1  . ASP A 1 58 ? 163.341 -10.938 2.977   1.00 0.00 ? 57 ASP A OD1  1  
ATOM 946   O OD2  . ASP A 1 58 ? 164.096 -11.038 5.039   1.00 0.00 ? 57 ASP A OD2  1  
ATOM 947   H H    . ASP A 1 58 ? 161.689 -9.141  2.309   1.00 0.00 ? 57 ASP A H    1  
ATOM 948   H HA   . ASP A 1 58 ? 161.365 -9.333  5.052   1.00 0.00 ? 57 ASP A HA   1  
ATOM 949   H HB2  . ASP A 1 58 ? 163.720 -8.402  3.407   1.00 0.00 ? 57 ASP A HB2  1  
ATOM 950   H HB3  . ASP A 1 58 ? 163.807 -8.590  5.154   1.00 0.00 ? 57 ASP A HB3  1  
ATOM 951   N N    . ASP A 1 59 ? 161.739 -6.218  4.022   1.00 0.00 ? 58 ASP A N    1  
ATOM 952   C CA   . ASP A 1 59 ? 161.554 -4.819  4.409   1.00 0.00 ? 58 ASP A CA   1  
ATOM 953   C C    . ASP A 1 59 ? 160.106 -4.554  4.821   1.00 0.00 ? 58 ASP A C    1  
ATOM 954   O O    . ASP A 1 59 ? 159.848 -3.898  5.830   1.00 0.00 ? 58 ASP A O    1  
ATOM 955   C CB   . ASP A 1 59 ? 161.945 -3.884  3.258   1.00 0.00 ? 58 ASP A CB   1  
ATOM 956   C CG   . ASP A 1 59 ? 163.433 -3.901  2.963   1.00 0.00 ? 58 ASP A CG   1  
ATOM 957   O OD1  . ASP A 1 59 ? 164.229 -3.652  3.894   1.00 0.00 ? 58 ASP A OD1  1  
ATOM 958   O OD2  . ASP A 1 59 ? 163.802 -4.160  1.797   1.00 0.00 ? 58 ASP A OD2  1  
ATOM 959   H H    . ASP A 1 59 ? 161.964 -6.431  3.091   1.00 0.00 ? 58 ASP A H    1  
ATOM 960   H HA   . ASP A 1 59 ? 162.196 -4.623  5.254   1.00 0.00 ? 58 ASP A HA   1  
ATOM 961   H HB2  . ASP A 1 59 ? 161.419 -4.185  2.363   1.00 0.00 ? 58 ASP A HB2  1  
ATOM 962   H HB3  . ASP A 1 59 ? 161.660 -2.874  3.513   1.00 0.00 ? 58 ASP A HB3  1  
ATOM 963   N N    . LEU A 1 60 ? 159.164 -5.072  4.033   1.00 0.00 ? 59 LEU A N    1  
ATOM 964   C CA   . LEU A 1 60 ? 157.743 -4.892  4.319   1.00 0.00 ? 59 LEU A CA   1  
ATOM 965   C C    . LEU A 1 60 ? 157.338 -5.643  5.585   1.00 0.00 ? 59 LEU A C    1  
ATOM 966   O O    . LEU A 1 60 ? 156.557 -5.136  6.390   1.00 0.00 ? 59 LEU A O    1  
ATOM 967   C CB   . LEU A 1 60 ? 156.892 -5.365  3.138   1.00 0.00 ? 59 LEU A CB   1  
ATOM 968   C CG   . LEU A 1 60 ? 155.461 -4.824  3.116   1.00 0.00 ? 59 LEU A CG   1  
ATOM 969   C CD1  . LEU A 1 60 ? 155.455 -3.354  2.721   1.00 0.00 ? 59 LEU A CD1  1  
ATOM 970   C CD2  . LEU A 1 60 ? 154.598 -5.643  2.167   1.00 0.00 ? 59 LEU A CD2  1  
ATOM 971   H H    . LEU A 1 60 ? 159.431 -5.587  3.243   1.00 0.00 ? 59 LEU A H    1  
ATOM 972   H HA   . LEU A 1 60 ? 157.571 -3.837  4.474   1.00 0.00 ? 59 LEU A HA   1  
ATOM 973   H HB2  . LEU A 1 60 ? 157.384 -5.065  2.224   1.00 0.00 ? 59 LEU A HB2  1  
ATOM 974   H HB3  . LEU A 1 60 ? 156.845 -6.444  3.164   1.00 0.00 ? 59 LEU A HB3  1  
ATOM 975   H HG   . LEU A 1 60 ? 155.039 -4.903  4.108   1.00 0.00 ? 59 LEU A HG   1  
ATOM 976   H HD11 . LEU A 1 60 ? 154.469 -2.941  2.879   1.00 0.00 ? 59 LEU A HD11 1  
ATOM 977   H HD12 . LEU A 1 60 ? 155.722 -3.260  1.679   1.00 0.00 ? 59 LEU A HD12 1  
ATOM 978   H HD13 . LEU A 1 60 ? 156.171 -2.817  3.325   1.00 0.00 ? 59 LEU A HD13 1  
ATOM 979   H HD21 . LEU A 1 60 ? 153.568 -5.331  2.255   1.00 0.00 ? 59 LEU A HD21 1  
ATOM 980   H HD22 . LEU A 1 60 ? 154.679 -6.690  2.422   1.00 0.00 ? 59 LEU A HD22 1  
ATOM 981   H HD23 . LEU A 1 60 ? 154.935 -5.493  1.153   1.00 0.00 ? 59 LEU A HD23 1  
ATOM 982   N N    . ASP A 1 61 ? 157.874 -6.851  5.757   1.00 0.00 ? 60 ASP A N    1  
ATOM 983   C CA   . ASP A 1 61 ? 157.562 -7.668  6.928   1.00 0.00 ? 60 ASP A CA   1  
ATOM 984   C C    . ASP A 1 61 ? 157.992 -6.962  8.211   1.00 0.00 ? 60 ASP A C    1  
ATOM 985   O O    . ASP A 1 61 ? 157.250 -6.940  9.194   1.00 0.00 ? 60 ASP A O    1  
ATOM 986   C CB   . ASP A 1 61 ? 158.243 -9.035  6.826   1.00 0.00 ? 60 ASP A CB   1  
ATOM 987   C CG   . ASP A 1 61 ? 157.389 -10.149 7.402   1.00 0.00 ? 60 ASP A CG   1  
ATOM 988   O OD1  . ASP A 1 61 ? 156.253 -10.340 6.916   1.00 0.00 ? 60 ASP A OD1  1  
ATOM 989   O OD2  . ASP A 1 61 ? 157.856 -10.831 8.337   1.00 0.00 ? 60 ASP A OD2  1  
ATOM 990   H H    . ASP A 1 61 ? 158.493 -7.201  5.079   1.00 0.00 ? 60 ASP A H    1  
ATOM 991   H HA   . ASP A 1 61 ? 156.491 -7.810  6.953   1.00 0.00 ? 60 ASP A HA   1  
ATOM 992   H HB2  . ASP A 1 61 ? 158.437 -9.258  5.786   1.00 0.00 ? 60 ASP A HB2  1  
ATOM 993   H HB3  . ASP A 1 61 ? 159.179 -9.007  7.364   1.00 0.00 ? 60 ASP A HB3  1  
ATOM 994   N N    . LYS A 1 62 ? 159.185 -6.371  8.188   1.00 0.00 ? 61 LYS A N    1  
ATOM 995   C CA   . LYS A 1 62 ? 159.707 -5.645  9.343   1.00 0.00 ? 61 LYS A CA   1  
ATOM 996   C C    . LYS A 1 62 ? 158.836 -4.424  9.644   1.00 0.00 ? 61 LYS A C    1  
ATOM 997   O O    . LYS A 1 62 ? 158.515 -4.148  10.801  1.00 0.00 ? 61 LYS A O    1  
ATOM 998   C CB   . LYS A 1 62 ? 161.151 -5.206  9.082   1.00 0.00 ? 61 LYS A CB   1  
ATOM 999   C CG   . LYS A 1 62 ? 161.878 -4.715  10.325  1.00 0.00 ? 61 LYS A CG   1  
ATOM 1000  C CD   . LYS A 1 62 ? 163.354 -4.468  10.046  1.00 0.00 ? 61 LYS A CD   1  
ATOM 1001  C CE   . LYS A 1 62 ? 164.216 -5.624  10.532  1.00 0.00 ? 61 LYS A CE   1  
ATOM 1002  N NZ   . LYS A 1 62 ? 165.502 -5.717  9.781   1.00 0.00 ? 61 LYS A NZ   1  
ATOM 1003  H H    . LYS A 1 62 ? 159.724 -6.416  7.370   1.00 0.00 ? 61 LYS A H    1  
ATOM 1004  H HA   . LYS A 1 62 ? 159.686 -6.311  10.194  1.00 0.00 ? 61 LYS A HA   1  
ATOM 1005  H HB2  . LYS A 1 62 ? 161.703 -6.041  8.674   1.00 0.00 ? 61 LYS A HB2  1  
ATOM 1006  H HB3  . LYS A 1 62 ? 161.144 -4.405  8.357   1.00 0.00 ? 61 LYS A HB3  1  
ATOM 1007  H HG2  . LYS A 1 62 ? 161.426 -3.792  10.653  1.00 0.00 ? 61 LYS A HG2  1  
ATOM 1008  H HG3  . LYS A 1 62 ? 161.786 -5.460  11.101  1.00 0.00 ? 61 LYS A HG3  1  
ATOM 1009  H HD2  . LYS A 1 62 ? 163.495 -4.349  8.982   1.00 0.00 ? 61 LYS A HD2  1  
ATOM 1010  H HD3  . LYS A 1 62 ? 163.659 -3.565  10.555  1.00 0.00 ? 61 LYS A HD3  1  
ATOM 1011  H HE2  . LYS A 1 62 ? 164.433 -5.480  11.579  1.00 0.00 ? 61 LYS A HE2  1  
ATOM 1012  H HE3  . LYS A 1 62 ? 163.667 -6.546  10.403  1.00 0.00 ? 61 LYS A HE3  1  
ATOM 1013  H HZ1  . LYS A 1 62 ? 165.370 -6.280  8.916   1.00 0.00 ? 61 LYS A HZ1  1  
ATOM 1014  H HZ2  . LYS A 1 62 ? 166.227 -6.174  10.370  1.00 0.00 ? 61 LYS A HZ2  1  
ATOM 1015  H HZ3  . LYS A 1 62 ? 165.833 -4.767  9.518   1.00 0.00 ? 61 LYS A HZ3  1  
ATOM 1016  N N    . ALA A 1 63 ? 158.465 -3.695  8.588   1.00 0.00 ? 62 ALA A N    1  
ATOM 1017  C CA   . ALA A 1 63 ? 157.637 -2.496  8.724   1.00 0.00 ? 62 ALA A CA   1  
ATOM 1018  C C    . ALA A 1 63 ? 156.262 -2.817  9.312   1.00 0.00 ? 62 ALA A C    1  
ATOM 1019  O O    . ALA A 1 63 ? 155.793 -2.123  10.214  1.00 0.00 ? 62 ALA A O    1  
ATOM 1020  C CB   . ALA A 1 63 ? 157.487 -1.802  7.376   1.00 0.00 ? 62 ALA A CB   1  
ATOM 1021  H H    . ALA A 1 63 ? 158.759 -3.970  7.693   1.00 0.00 ? 62 ALA A H    1  
ATOM 1022  H HA   . ALA A 1 63 ? 158.149 -1.817  9.392   1.00 0.00 ? 62 ALA A HA   1  
ATOM 1023  H HB1  . ALA A 1 63 ? 157.538 -0.731  7.513   1.00 0.00 ? 62 ALA A HB1  1  
ATOM 1024  H HB2  . ALA A 1 63 ? 156.534 -2.063  6.940   1.00 0.00 ? 62 ALA A HB2  1  
ATOM 1025  H HB3  . ALA A 1 63 ? 158.282 -2.117  6.716   1.00 0.00 ? 62 ALA A HB3  1  
ATOM 1026  N N    . ILE A 1 64 ? 155.620 -3.870  8.805   1.00 0.00 ? 63 ILE A N    1  
ATOM 1027  C CA   . ILE A 1 64 ? 154.303 -4.267  9.300   1.00 0.00 ? 63 ILE A CA   1  
ATOM 1028  C C    . ILE A 1 64 ? 154.388 -4.757  10.745  1.00 0.00 ? 63 ILE A C    1  
ATOM 1029  O O    . ILE A 1 64 ? 153.536 -4.426  11.569  1.00 0.00 ? 63 ILE A O    1  
ATOM 1030  C CB   . ILE A 1 64 ? 153.657 -5.369  8.427   1.00 0.00 ? 63 ILE A CB   1  
ATOM 1031  C CG1  . ILE A 1 64 ? 153.613 -4.932  6.959   1.00 0.00 ? 63 ILE A CG1  1  
ATOM 1032  C CG2  . ILE A 1 64 ? 152.254 -5.687  8.932   1.00 0.00 ? 63 ILE A CG2  1  
ATOM 1033  C CD1  . ILE A 1 64 ? 153.659 -6.085  5.979   1.00 0.00 ? 63 ILE A CD1  1  
ATOM 1034  H H    . ILE A 1 64 ? 156.043 -4.393  8.089   1.00 0.00 ? 63 ILE A H    1  
ATOM 1035  H HA   . ILE A 1 64 ? 153.664 -3.395  9.269   1.00 0.00 ? 63 ILE A HA   1  
ATOM 1036  H HB   . ILE A 1 64 ? 154.256 -6.264  8.513   1.00 0.00 ? 63 ILE A HB   1  
ATOM 1037  H HG12 . ILE A 1 64 ? 152.701 -4.383  6.780   1.00 0.00 ? 63 ILE A HG12 1  
ATOM 1038  H HG13 . ILE A 1 64 ? 154.458 -4.291  6.756   1.00 0.00 ? 63 ILE A HG13 1  
ATOM 1039  H HG21 . ILE A 1 64 ? 152.316 -6.119  9.920   1.00 0.00 ? 63 ILE A HG21 1  
ATOM 1040  H HG22 . ILE A 1 64 ? 151.779 -6.389  8.263   1.00 0.00 ? 63 ILE A HG22 1  
ATOM 1041  H HG23 . ILE A 1 64 ? 151.671 -4.779  8.973   1.00 0.00 ? 63 ILE A HG23 1  
ATOM 1042  H HD11 . ILE A 1 64 ? 154.687 -6.366  5.802   1.00 0.00 ? 63 ILE A HD11 1  
ATOM 1043  H HD12 . ILE A 1 64 ? 153.203 -5.784  5.048   1.00 0.00 ? 63 ILE A HD12 1  
ATOM 1044  H HD13 . ILE A 1 64 ? 153.121 -6.927  6.387   1.00 0.00 ? 63 ILE A HD13 1  
ATOM 1045  N N    . ASP A 1 65 ? 155.423 -5.547  11.044  1.00 0.00 ? 64 ASP A N    1  
ATOM 1046  C CA   . ASP A 1 65 ? 155.617 -6.081  12.391  1.00 0.00 ? 64 ASP A CA   1  
ATOM 1047  C C    . ASP A 1 65 ? 155.692 -4.959  13.426  1.00 0.00 ? 64 ASP A C    1  
ATOM 1048  O O    . ASP A 1 65 ? 155.060 -5.036  14.481  1.00 0.00 ? 64 ASP A O    1  
ATOM 1049  C CB   . ASP A 1 65 ? 156.890 -6.934  12.454  1.00 0.00 ? 64 ASP A CB   1  
ATOM 1050  C CG   . ASP A 1 65 ? 156.895 -7.883  13.638  1.00 0.00 ? 64 ASP A CG   1  
ATOM 1051  O OD1  . ASP A 1 65 ? 156.832 -7.399  14.788  1.00 0.00 ? 64 ASP A OD1  1  
ATOM 1052  O OD2  . ASP A 1 65 ? 156.961 -9.110  13.416  1.00 0.00 ? 64 ASP A OD2  1  
ATOM 1053  H H    . ASP A 1 65 ? 156.070 -5.775  10.343  1.00 0.00 ? 64 ASP A H    1  
ATOM 1054  H HA   . ASP A 1 65 ? 154.766 -6.705  12.619  1.00 0.00 ? 64 ASP A HA   1  
ATOM 1055  H HB2  . ASP A 1 65 ? 156.970 -7.519  11.550  1.00 0.00 ? 64 ASP A HB2  1  
ATOM 1056  H HB3  . ASP A 1 65 ? 157.750 -6.284  12.533  1.00 0.00 ? 64 ASP A HB3  1  
ATOM 1057  N N    . ILE A 1 66 ? 156.464 -3.915  13.119  1.00 0.00 ? 65 ILE A N    1  
ATOM 1058  C CA   . ILE A 1 66 ? 156.615 -2.779  14.029  1.00 0.00 ? 65 ILE A CA   1  
ATOM 1059  C C    . ILE A 1 66 ? 155.328 -1.957  14.107  1.00 0.00 ? 65 ILE A C    1  
ATOM 1060  O O    . ILE A 1 66 ? 154.927 -1.521  15.188  1.00 0.00 ? 65 ILE A O    1  
ATOM 1061  C CB   . ILE A 1 66 ? 157.779 -1.854  13.608  1.00 0.00 ? 65 ILE A CB   1  
ATOM 1062  C CG1  . ILE A 1 66 ? 159.070 -2.659  13.436  1.00 0.00 ? 65 ILE A CG1  1  
ATOM 1063  C CG2  . ILE A 1 66 ? 157.976 -0.746  14.635  1.00 0.00 ? 65 ILE A CG2  1  
ATOM 1064  C CD1  . ILE A 1 66 ? 160.042 -2.034  12.459  1.00 0.00 ? 65 ILE A CD1  1  
ATOM 1065  H H    . ILE A 1 66 ? 156.941 -3.909  12.262  1.00 0.00 ? 65 ILE A H    1  
ATOM 1066  H HA   . ILE A 1 66 ? 156.835 -3.171  15.012  1.00 0.00 ? 65 ILE A HA   1  
ATOM 1067  H HB   . ILE A 1 66 ? 157.522 -1.395  12.665  1.00 0.00 ? 65 ILE A HB   1  
ATOM 1068  H HG12 . ILE A 1 66 ? 159.567 -2.742  14.391  1.00 0.00 ? 65 ILE A HG12 1  
ATOM 1069  H HG13 . ILE A 1 66 ? 158.827 -3.648  13.075  1.00 0.00 ? 65 ILE A HG13 1  
ATOM 1070  H HG21 . ILE A 1 66 ? 159.023 -0.485  14.689  1.00 0.00 ? 65 ILE A HG21 1  
ATOM 1071  H HG22 . ILE A 1 66 ? 157.640 -1.088  15.603  1.00 0.00 ? 65 ILE A HG22 1  
ATOM 1072  H HG23 . ILE A 1 66 ? 157.404 0.121   14.342  1.00 0.00 ? 65 ILE A HG23 1  
ATOM 1073  H HD11 . ILE A 1 66 ? 160.387 -1.090  12.852  1.00 0.00 ? 65 ILE A HD11 1  
ATOM 1074  H HD12 . ILE A 1 66 ? 159.547 -1.872  11.513  1.00 0.00 ? 65 ILE A HD12 1  
ATOM 1075  H HD13 . ILE A 1 66 ? 160.884 -2.694  12.316  1.00 0.00 ? 65 ILE A HD13 1  
ATOM 1076  N N    . LEU A 1 67 ? 154.685 -1.752  12.958  1.00 0.00 ? 66 LEU A N    1  
ATOM 1077  C CA   . LEU A 1 67 ? 153.442 -0.985  12.899  1.00 0.00 ? 66 LEU A CA   1  
ATOM 1078  C C    . LEU A 1 67 ? 152.349 -1.650  13.736  1.00 0.00 ? 66 LEU A C    1  
ATOM 1079  O O    . LEU A 1 67 ? 151.668 -0.984  14.516  1.00 0.00 ? 66 LEU A O    1  
ATOM 1080  C CB   . LEU A 1 67 ? 152.976 -0.833  11.448  1.00 0.00 ? 66 LEU A CB   1  
ATOM 1081  C CG   . LEU A 1 67 ? 151.777 0.099   11.245  1.00 0.00 ? 66 LEU A CG   1  
ATOM 1082  C CD1  . LEU A 1 67 ? 152.245 1.514   10.937  1.00 0.00 ? 66 LEU A CD1  1  
ATOM 1083  C CD2  . LEU A 1 67 ? 150.877 -0.422  10.133  1.00 0.00 ? 66 LEU A CD2  1  
ATOM 1084  H H    . LEU A 1 67 ? 155.054 -2.126  12.130  1.00 0.00 ? 66 LEU A H    1  
ATOM 1085  H HA   . LEU A 1 67 ? 153.642 -0.005  13.307  1.00 0.00 ? 66 LEU A HA   1  
ATOM 1086  H HB2  . LEU A 1 67 ? 153.805 -0.454  10.866  1.00 0.00 ? 66 LEU A HB2  1  
ATOM 1087  H HB3  . LEU A 1 67 ? 152.713 -1.811  11.074  1.00 0.00 ? 66 LEU A HB3  1  
ATOM 1088  H HG   . LEU A 1 67 ? 151.198 0.132   12.156  1.00 0.00 ? 66 LEU A HG   1  
ATOM 1089  H HD11 . LEU A 1 67 ? 152.530 2.005   11.856  1.00 0.00 ? 66 LEU A HD11 1  
ATOM 1090  H HD12 . LEU A 1 67 ? 151.442 2.065   10.469  1.00 0.00 ? 66 LEU A HD12 1  
ATOM 1091  H HD13 . LEU A 1 67 ? 153.093 1.477   10.271  1.00 0.00 ? 66 LEU A HD13 1  
ATOM 1092  H HD21 . LEU A 1 67 ? 150.340 0.403   9.688   1.00 0.00 ? 66 LEU A HD21 1  
ATOM 1093  H HD22 . LEU A 1 67 ? 150.172 -1.131  10.543  1.00 0.00 ? 66 LEU A HD22 1  
ATOM 1094  H HD23 . LEU A 1 67 ? 151.479 -0.909  9.379   1.00 0.00 ? 66 LEU A HD23 1  
ATOM 1095  N N    . ASP A 1 68 ? 152.191 -2.966  13.574  1.00 0.00 ? 67 ASP A N    1  
ATOM 1096  C CA   . ASP A 1 68 ? 151.184 -3.718  14.324  1.00 0.00 ? 67 ASP A CA   1  
ATOM 1097  C C    . ASP A 1 68 ? 151.464 -3.653  15.827  1.00 0.00 ? 67 ASP A C    1  
ATOM 1098  O O    . ASP A 1 68 ? 150.541 -3.551  16.635  1.00 0.00 ? 67 ASP A O    1  
ATOM 1099  C CB   . ASP A 1 68 ? 151.151 -5.180  13.866  1.00 0.00 ? 67 ASP A CB   1  
ATOM 1100  C CG   . ASP A 1 68 ? 149.879 -5.894  14.289  1.00 0.00 ? 67 ASP A CG   1  
ATOM 1101  O OD1  . ASP A 1 68 ? 149.846 -6.433  15.414  1.00 0.00 ? 67 ASP A OD1  1  
ATOM 1102  O OD2  . ASP A 1 68 ? 148.916 -5.913  13.492  1.00 0.00 ? 67 ASP A OD2  1  
ATOM 1103  H H    . ASP A 1 68 ? 152.769 -3.442  12.939  1.00 0.00 ? 67 ASP A H    1  
ATOM 1104  H HA   . ASP A 1 68 ? 150.221 -3.267  14.130  1.00 0.00 ? 67 ASP A HA   1  
ATOM 1105  H HB2  . ASP A 1 68 ? 151.220 -5.215  12.789  1.00 0.00 ? 67 ASP A HB2  1  
ATOM 1106  H HB3  . ASP A 1 68 ? 151.993 -5.703  14.294  1.00 0.00 ? 67 ASP A HB3  1  
ATOM 1107  N N    . ARG A 1 69 ? 152.748 -3.710  16.189  1.00 0.00 ? 68 ARG A N    1  
ATOM 1108  C CA   . ARG A 1 69 ? 153.165 -3.653  17.591  1.00 0.00 ? 68 ARG A CA   1  
ATOM 1109  C C    . ARG A 1 69 ? 152.769 -2.324  18.234  1.00 0.00 ? 68 ARG A C    1  
ATOM 1110  O O    . ARG A 1 69 ? 152.453 -2.271  19.423  1.00 0.00 ? 68 ARG A O    1  
ATOM 1111  C CB   . ARG A 1 69 ? 154.681 -3.847  17.703  1.00 0.00 ? 68 ARG A CB   1  
ATOM 1112  C CG   . ARG A 1 69 ? 155.101 -5.294  17.906  1.00 0.00 ? 68 ARG A CG   1  
ATOM 1113  C CD   . ARG A 1 69 ? 155.186 -5.650  19.383  1.00 0.00 ? 68 ARG A CD   1  
ATOM 1114  N NE   . ARG A 1 69 ? 156.386 -5.101  20.020  1.00 0.00 ? 68 ARG A NE   1  
ATOM 1115  C CZ   . ARG A 1 69 ? 156.786 -5.416  21.255  1.00 0.00 ? 68 ARG A CZ   1  
ATOM 1116  N NH1  . ARG A 1 69 ? 156.089 -6.277  21.992  1.00 0.00 ? 68 ARG A NH1  1  
ATOM 1117  N NH2  . ARG A 1 69 ? 157.887 -4.868  21.758  1.00 0.00 ? 68 ARG A NH2  1  
ATOM 1118  H H    . ARG A 1 69 ? 153.436 -3.790  15.493  1.00 0.00 ? 68 ARG A H    1  
ATOM 1119  H HA   . ARG A 1 69 ? 152.669 -4.455  18.116  1.00 0.00 ? 68 ARG A HA   1  
ATOM 1120  H HB2  . ARG A 1 69 ? 155.146 -3.486  16.797  1.00 0.00 ? 68 ARG A HB2  1  
ATOM 1121  H HB3  . ARG A 1 69 ? 155.046 -3.268  18.539  1.00 0.00 ? 68 ARG A HB3  1  
ATOM 1122  H HG2  . ARG A 1 69 ? 154.376 -5.940  17.433  1.00 0.00 ? 68 ARG A HG2  1  
ATOM 1123  H HG3  . ARG A 1 69 ? 156.069 -5.444  17.452  1.00 0.00 ? 68 ARG A HG3  1  
ATOM 1124  H HD2  . ARG A 1 69 ? 154.315 -5.258  19.885  1.00 0.00 ? 68 ARG A HD2  1  
ATOM 1125  H HD3  . ARG A 1 69 ? 155.201 -6.726  19.477  1.00 0.00 ? 68 ARG A HD3  1  
ATOM 1126  H HE   . ARG A 1 69 ? 156.921 -4.463  19.501  1.00 0.00 ? 68 ARG A HE   1  
ATOM 1127  H HH11 . ARG A 1 69 ? 155.259 -6.695  21.624  1.00 0.00 ? 68 ARG A HH11 1  
ATOM 1128  H HH12 . ARG A 1 69 ? 156.397 -6.509  22.915  1.00 0.00 ? 68 ARG A HH12 1  
ATOM 1129  H HH21 . ARG A 1 69 ? 158.418 -4.218  21.214  1.00 0.00 ? 68 ARG A HH21 1  
ATOM 1130  H HH22 . ARG A 1 69 ? 158.187 -5.106  22.683  1.00 0.00 ? 68 ARG A HH22 1  
ATOM 1131  N N    . SER A 1 70 ? 152.793 -1.252  17.442  1.00 0.00 ? 69 SER A N    1  
ATOM 1132  C CA   . SER A 1 70 ? 152.439 0.074   17.936  1.00 0.00 ? 69 SER A CA   1  
ATOM 1133  C C    . SER A 1 70 ? 150.934 0.318   17.819  1.00 0.00 ? 69 SER A C    1  
ATOM 1134  O O    . SER A 1 70 ? 150.424 0.594   16.732  1.00 0.00 ? 69 SER A O    1  
ATOM 1135  C CB   . SER A 1 70 ? 153.208 1.150   17.163  1.00 0.00 ? 69 SER A CB   1  
ATOM 1136  O OG   . SER A 1 70 ? 152.967 2.441   17.699  1.00 0.00 ? 69 SER A OG   1  
ATOM 1137  H H    . SER A 1 70 ? 153.056 -1.357  16.503  1.00 0.00 ? 69 SER A H    1  
ATOM 1138  H HA   . SER A 1 70 ? 152.720 0.123   18.978  1.00 0.00 ? 69 SER A HA   1  
ATOM 1139  H HB2  . SER A 1 70 ? 154.266 0.942   17.221  1.00 0.00 ? 69 SER A HB2  1  
ATOM 1140  H HB3  . SER A 1 70 ? 152.895 1.141   16.129  1.00 0.00 ? 69 SER A HB3  1  
ATOM 1141  H HG   . SER A 1 70 ? 153.801 2.908   17.799  1.00 0.00 ? 69 SER A HG   1  
ATOM 1142  N N    . SER A 1 71 ? 150.231 0.221   18.948  1.00 0.00 ? 70 SER A N    1  
ATOM 1143  C CA   . SER A 1 71 ? 148.783 0.438   18.978  1.00 0.00 ? 70 SER A CA   1  
ATOM 1144  C C    . SER A 1 71 ? 148.425 1.865   18.547  1.00 0.00 ? 70 SER A C    1  
ATOM 1145  O O    . SER A 1 71 ? 147.368 2.093   17.957  1.00 0.00 ? 70 SER A O    1  
ATOM 1146  C CB   . SER A 1 71 ? 148.232 0.163   20.380  1.00 0.00 ? 70 SER A CB   1  
ATOM 1147  O OG   . SER A 1 71 ? 148.683 1.135   21.310  1.00 0.00 ? 70 SER A OG   1  
ATOM 1148  H H    . SER A 1 71 ? 150.696 0.001   19.783  1.00 0.00 ? 70 SER A H    1  
ATOM 1149  H HA   . SER A 1 71 ? 148.331 -0.255  18.283  1.00 0.00 ? 70 SER A HA   1  
ATOM 1150  H HB2  . SER A 1 71 ? 147.152 0.184   20.352  1.00 0.00 ? 70 SER A HB2  1  
ATOM 1151  H HB3  . SER A 1 71 ? 148.563 -0.812  20.709  1.00 0.00 ? 70 SER A HB3  1  
ATOM 1152  H HG   . SER A 1 71 ? 149.594 0.950   21.552  1.00 0.00 ? 70 SER A HG   1  
ATOM 1153  N N    . SER A 1 72 ? 149.311 2.820   18.847  1.00 0.00 ? 71 SER A N    1  
ATOM 1154  C CA   . SER A 1 72 ? 149.085 4.222   18.488  1.00 0.00 ? 71 SER A CA   1  
ATOM 1155  C C    . SER A 1 72 ? 148.951 4.383   16.974  1.00 0.00 ? 71 SER A C    1  
ATOM 1156  O O    . SER A 1 72 ? 148.085 5.115   16.494  1.00 0.00 ? 71 SER A O    1  
ATOM 1157  C CB   . SER A 1 72 ? 150.229 5.101   19.004  1.00 0.00 ? 71 SER A CB   1  
ATOM 1158  O OG   . SER A 1 72 ? 150.428 4.915   20.393  1.00 0.00 ? 71 SER A OG   1  
ATOM 1159  H H    . SER A 1 72 ? 150.135 2.576   19.321  1.00 0.00 ? 71 SER A H    1  
ATOM 1160  H HA   . SER A 1 72 ? 148.164 4.538   18.954  1.00 0.00 ? 71 SER A HA   1  
ATOM 1161  H HB2  . SER A 1 72 ? 151.141 4.843   18.486  1.00 0.00 ? 71 SER A HB2  1  
ATOM 1162  H HB3  . SER A 1 72 ? 149.993 6.139   18.821  1.00 0.00 ? 71 SER A HB3  1  
ATOM 1163  H HG   . SER A 1 72 ? 151.044 4.191   20.531  1.00 0.00 ? 71 SER A HG   1  
ATOM 1164  N N    . MET A 1 73 ? 149.817 3.694   16.232  1.00 0.00 ? 72 MET A N    1  
ATOM 1165  C CA   . MET A 1 73 ? 149.800 3.752   14.770  1.00 0.00 ? 72 MET A CA   1  
ATOM 1166  C C    . MET A 1 73 ? 148.548 3.077   14.206  1.00 0.00 ? 72 MET A C    1  
ATOM 1167  O O    . MET A 1 73 ? 148.000 2.158   14.818  1.00 0.00 ? 72 MET A O    1  
ATOM 1168  C CB   . MET A 1 73 ? 151.054 3.084   14.198  1.00 0.00 ? 72 MET A CB   1  
ATOM 1169  C CG   . MET A 1 73 ? 152.219 4.041   13.994  1.00 0.00 ? 72 MET A CG   1  
ATOM 1170  S SD   . MET A 1 73 ? 153.822 3.244   14.212  1.00 0.00 ? 72 MET A SD   1  
ATOM 1171  C CE   . MET A 1 73 ? 154.562 3.520   12.604  1.00 0.00 ? 72 MET A CE   1  
ATOM 1172  H H    . MET A 1 73 ? 150.484 3.130   16.679  1.00 0.00 ? 72 MET A H    1  
ATOM 1173  H HA   . MET A 1 73 ? 149.794 4.793   14.481  1.00 0.00 ? 72 MET A HA   1  
ATOM 1174  H HB2  . MET A 1 73 ? 151.371 2.302   14.874  1.00 0.00 ? 72 MET A HB2  1  
ATOM 1175  H HB3  . MET A 1 73 ? 150.808 2.642   13.244  1.00 0.00 ? 72 MET A HB3  1  
ATOM 1176  H HG2  . MET A 1 73 ? 152.166 4.441   12.993  1.00 0.00 ? 72 MET A HG2  1  
ATOM 1177  H HG3  . MET A 1 73 ? 152.134 4.847   14.707  1.00 0.00 ? 72 MET A HG3  1  
ATOM 1178  H HE1  . MET A 1 73 ? 155.374 4.225   12.697  1.00 0.00 ? 72 MET A HE1  1  
ATOM 1179  H HE2  . MET A 1 73 ? 153.818 3.913   11.928  1.00 0.00 ? 72 MET A HE2  1  
ATOM 1180  H HE3  . MET A 1 73 ? 154.941 2.585   12.217  1.00 0.00 ? 72 MET A HE3  1  
ATOM 1181  N N    . LYS A 1 74 ? 148.103 3.538   13.036  1.00 0.00 ? 73 LYS A N    1  
ATOM 1182  C CA   . LYS A 1 74 ? 146.916 2.978   12.389  1.00 0.00 ? 73 LYS A CA   1  
ATOM 1183  C C    . LYS A 1 74 ? 147.150 2.765   10.892  1.00 0.00 ? 73 LYS A C    1  
ATOM 1184  O O    . LYS A 1 74 ? 147.145 1.631   10.411  1.00 0.00 ? 73 LYS A O    1  
ATOM 1185  C CB   . LYS A 1 74 ? 145.706 3.893   12.604  1.00 0.00 ? 73 LYS A CB   1  
ATOM 1186  C CG   . LYS A 1 74 ? 145.211 3.927   14.043  1.00 0.00 ? 73 LYS A CG   1  
ATOM 1187  C CD   . LYS A 1 74 ? 144.549 5.256   14.377  1.00 0.00 ? 73 LYS A CD   1  
ATOM 1188  C CE   . LYS A 1 74 ? 143.199 5.401   13.688  1.00 0.00 ? 73 LYS A CE   1  
ATOM 1189  N NZ   . LYS A 1 74 ? 142.182 6.037   14.573  1.00 0.00 ? 73 LYS A NZ   1  
ATOM 1190  H H    . LYS A 1 74 ? 148.583 4.272   12.597  1.00 0.00 ? 73 LYS A H    1  
ATOM 1191  H HA   . LYS A 1 74 ? 146.715 2.020   12.845  1.00 0.00 ? 73 LYS A HA   1  
ATOM 1192  H HB2  . LYS A 1 74 ? 145.972 4.898   12.313  1.00 0.00 ? 73 LYS A HB2  1  
ATOM 1193  H HB3  . LYS A 1 74 ? 144.896 3.550   11.976  1.00 0.00 ? 73 LYS A HB3  1  
ATOM 1194  H HG2  . LYS A 1 74 ? 144.493 3.133   14.184  1.00 0.00 ? 73 LYS A HG2  1  
ATOM 1195  H HG3  . LYS A 1 74 ? 146.050 3.777   14.705  1.00 0.00 ? 73 LYS A HG3  1  
ATOM 1196  H HD2  . LYS A 1 74 ? 144.404 5.314   15.445  1.00 0.00 ? 73 LYS A HD2  1  
ATOM 1197  H HD3  . LYS A 1 74 ? 145.195 6.060   14.055  1.00 0.00 ? 73 LYS A HD3  1  
ATOM 1198  H HE2  . LYS A 1 74 ? 143.324 6.010   12.804  1.00 0.00 ? 73 LYS A HE2  1  
ATOM 1199  H HE3  . LYS A 1 74 ? 142.849 4.420   13.399  1.00 0.00 ? 73 LYS A HE3  1  
ATOM 1200  H HZ1  . LYS A 1 74 ? 141.647 5.307   15.086  1.00 0.00 ? 73 LYS A HZ1  1  
ATOM 1201  H HZ2  . LYS A 1 74 ? 141.518 6.602   14.006  1.00 0.00 ? 73 LYS A HZ2  1  
ATOM 1202  H HZ3  . LYS A 1 74 ? 142.646 6.661   15.264  1.00 0.00 ? 73 LYS A HZ3  1  
ATOM 1203  N N    . SER A 1 75 ? 147.352 3.863   10.161  1.00 0.00 ? 74 SER A N    1  
ATOM 1204  C CA   . SER A 1 75 ? 147.586 3.794   8.718   1.00 0.00 ? 74 SER A CA   1  
ATOM 1205  C C    . SER A 1 75 ? 149.075 3.624   8.411   1.00 0.00 ? 74 SER A C    1  
ATOM 1206  O O    . SER A 1 75 ? 149.914 3.687   9.311   1.00 0.00 ? 74 SER A O    1  
ATOM 1207  C CB   . SER A 1 75 ? 147.052 5.055   8.031   1.00 0.00 ? 74 SER A CB   1  
ATOM 1208  O OG   . SER A 1 75 ? 146.376 4.733   6.827   1.00 0.00 ? 74 SER A OG   1  
ATOM 1209  H H    . SER A 1 75 ? 147.343 4.738   10.600  1.00 0.00 ? 74 SER A H    1  
ATOM 1210  H HA   . SER A 1 75 ? 147.054 2.936   8.338   1.00 0.00 ? 74 SER A HA   1  
ATOM 1211  H HB2  . SER A 1 75 ? 146.360 5.558   8.692   1.00 0.00 ? 74 SER A HB2  1  
ATOM 1212  H HB3  . SER A 1 75 ? 147.875 5.716   7.802   1.00 0.00 ? 74 SER A HB3  1  
ATOM 1213  H HG   . SER A 1 75 ? 146.886 5.047   6.078   1.00 0.00 ? 74 SER A HG   1  
ATOM 1214  N N    . LEU A 1 76 ? 149.395 3.404   7.134   1.00 0.00 ? 75 LEU A N    1  
ATOM 1215  C CA   . LEU A 1 76 ? 150.781 3.222   6.711   1.00 0.00 ? 75 LEU A CA   1  
ATOM 1216  C C    . LEU A 1 76 ? 151.244 4.381   5.831   1.00 0.00 ? 75 LEU A C    1  
ATOM 1217  O O    . LEU A 1 76 ? 150.610 4.699   4.823   1.00 0.00 ? 75 LEU A O    1  
ATOM 1218  C CB   . LEU A 1 76 ? 150.940 1.899   5.956   1.00 0.00 ? 75 LEU A CB   1  
ATOM 1219  C CG   . LEU A 1 76 ? 150.954 0.647   6.837   1.00 0.00 ? 75 LEU A CG   1  
ATOM 1220  C CD1  . LEU A 1 76 ? 149.538 0.253   7.229   1.00 0.00 ? 75 LEU A CD1  1  
ATOM 1221  C CD2  . LEU A 1 76 ? 151.653 -0.502  6.123   1.00 0.00 ? 75 LEU A CD2  1  
ATOM 1222  H H    . LEU A 1 76 ? 148.682 3.362   6.462   1.00 0.00 ? 75 LEU A H    1  
ATOM 1223  H HA   . LEU A 1 76 ? 151.396 3.194   7.599   1.00 0.00 ? 75 LEU A HA   1  
ATOM 1224  H HB2  . LEU A 1 76 ? 150.125 1.810   5.251   1.00 0.00 ? 75 LEU A HB2  1  
ATOM 1225  H HB3  . LEU A 1 76 ? 151.867 1.934   5.403   1.00 0.00 ? 75 LEU A HB3  1  
ATOM 1226  H HG   . LEU A 1 76 ? 151.503 0.860   7.743   1.00 0.00 ? 75 LEU A HG   1  
ATOM 1227  H HD11 . LEU A 1 76 ? 149.090 1.048   7.807   1.00 0.00 ? 75 LEU A HD11 1  
ATOM 1228  H HD12 . LEU A 1 76 ? 149.565 -0.650  7.821   1.00 0.00 ? 75 LEU A HD12 1  
ATOM 1229  H HD13 . LEU A 1 76 ? 148.951 0.082   6.338   1.00 0.00 ? 75 LEU A HD13 1  
ATOM 1230  H HD21 . LEU A 1 76 ? 150.921 -1.105  5.606   1.00 0.00 ? 75 LEU A HD21 1  
ATOM 1231  H HD22 . LEU A 1 76 ? 152.174 -1.111  6.846   1.00 0.00 ? 75 LEU A HD22 1  
ATOM 1232  H HD23 . LEU A 1 76 ? 152.362 -0.107  5.409   1.00 0.00 ? 75 LEU A HD23 1  
ATOM 1233  N N    . ARG A 1 77 ? 152.357 5.006   6.220   1.00 0.00 ? 76 ARG A N    1  
ATOM 1234  C CA   . ARG A 1 77 ? 152.914 6.128   5.468   1.00 0.00 ? 76 ARG A CA   1  
ATOM 1235  C C    . ARG A 1 77 ? 153.950 5.639   4.455   1.00 0.00 ? 76 ARG A C    1  
ATOM 1236  O O    . ARG A 1 77 ? 155.054 5.238   4.827   1.00 0.00 ? 76 ARG A O    1  
ATOM 1237  C CB   . ARG A 1 77 ? 153.555 7.147   6.418   1.00 0.00 ? 76 ARG A CB   1  
ATOM 1238  C CG   . ARG A 1 77 ? 152.553 7.902   7.281   1.00 0.00 ? 76 ARG A CG   1  
ATOM 1239  C CD   . ARG A 1 77 ? 153.212 9.073   7.997   1.00 0.00 ? 76 ARG A CD   1  
ATOM 1240  N NE   . ARG A 1 77 ? 152.334 10.240  8.073   1.00 0.00 ? 76 ARG A NE   1  
ATOM 1241  C CZ   . ARG A 1 77 ? 152.036 11.020  7.030   1.00 0.00 ? 76 ARG A CZ   1  
ATOM 1242  N NH1  . ARG A 1 77 ? 152.523 10.744  5.822   1.00 0.00 ? 76 ARG A NH1  1  
ATOM 1243  N NH2  . ARG A 1 77 ? 151.246 12.076  7.195   1.00 0.00 ? 76 ARG A NH2  1  
ATOM 1244  H H    . ARG A 1 77 ? 152.817 4.702   7.031   1.00 0.00 ? 76 ARG A H    1  
ATOM 1245  H HA   . ARG A 1 77 ? 152.103 6.606   4.935   1.00 0.00 ? 76 ARG A HA   1  
ATOM 1246  H HB2  . ARG A 1 77 ? 154.241 6.629   7.073   1.00 0.00 ? 76 ARG A HB2  1  
ATOM 1247  H HB3  . ARG A 1 77 ? 154.106 7.868   5.833   1.00 0.00 ? 76 ARG A HB3  1  
ATOM 1248  H HG2  . ARG A 1 77 ? 151.760 8.277   6.651   1.00 0.00 ? 76 ARG A HG2  1  
ATOM 1249  H HG3  . ARG A 1 77 ? 152.143 7.225   8.016   1.00 0.00 ? 76 ARG A HG3  1  
ATOM 1250  H HD2  . ARG A 1 77 ? 153.473 8.765   9.000   1.00 0.00 ? 76 ARG A HD2  1  
ATOM 1251  H HD3  . ARG A 1 77 ? 154.110 9.345   7.462   1.00 0.00 ? 76 ARG A HD3  1  
ATOM 1252  H HE   . ARG A 1 77 ? 151.953 10.461  8.950   1.00 0.00 ? 76 ARG A HE   1  
ATOM 1253  H HH11 . ARG A 1 77 ? 153.114 9.948   5.689   1.00 0.00 ? 76 ARG A HH11 1  
ATOM 1254  H HH12 . ARG A 1 77 ? 152.298 11.332  5.044   1.00 0.00 ? 76 ARG A HH12 1  
ATOM 1255  H HH21 . ARG A 1 77 ? 150.874 12.286  8.099   1.00 0.00 ? 76 ARG A HH21 1  
ATOM 1256  H HH22 . ARG A 1 77 ? 151.024 12.663  6.415   1.00 0.00 ? 76 ARG A HH22 1  
ATOM 1257  N N    . ILE A 1 78 ? 153.582 5.672   3.173   1.00 0.00 ? 77 ILE A N    1  
ATOM 1258  C CA   . ILE A 1 78 ? 154.473 5.230   2.102   1.00 0.00 ? 77 ILE A CA   1  
ATOM 1259  C C    . ILE A 1 78 ? 154.564 6.285   0.999   1.00 0.00 ? 77 ILE A C    1  
ATOM 1260  O O    . ILE A 1 78 ? 153.544 6.801   0.539   1.00 0.00 ? 77 ILE A O    1  
ATOM 1261  C CB   . ILE A 1 78 ? 153.997 3.894   1.484   1.00 0.00 ? 77 ILE A CB   1  
ATOM 1262  C CG1  . ILE A 1 78 ? 153.694 2.868   2.581   1.00 0.00 ? 77 ILE A CG1  1  
ATOM 1263  C CG2  . ILE A 1 78 ? 155.042 3.348   0.518   1.00 0.00 ? 77 ILE A CG2  1  
ATOM 1264  C CD1  . ILE A 1 78 ? 153.014 1.616   2.068   1.00 0.00 ? 77 ILE A CD1  1  
ATOM 1265  H H    . ILE A 1 78 ? 152.687 5.998   2.941   1.00 0.00 ? 77 ILE A H    1  
ATOM 1266  H HA   . ILE A 1 78 ? 155.456 5.078   2.526   1.00 0.00 ? 77 ILE A HA   1  
ATOM 1267  H HB   . ILE A 1 78 ? 153.094 4.087   0.923   1.00 0.00 ? 77 ILE A HB   1  
ATOM 1268  H HG12 . ILE A 1 78 ? 154.618 2.572   3.055   1.00 0.00 ? 77 ILE A HG12 1  
ATOM 1269  H HG13 . ILE A 1 78 ? 153.045 3.319   3.318   1.00 0.00 ? 77 ILE A HG13 1  
ATOM 1270  H HG21 . ILE A 1 78 ? 155.426 4.151   -0.093  1.00 0.00 ? 77 ILE A HG21 1  
ATOM 1271  H HG22 . ILE A 1 78 ? 154.588 2.600   -0.114  1.00 0.00 ? 77 ILE A HG22 1  
ATOM 1272  H HG23 . ILE A 1 78 ? 155.852 2.902   1.077   1.00 0.00 ? 77 ILE A HG23 1  
ATOM 1273  H HD11 . ILE A 1 78 ? 152.056 1.875   1.643   1.00 0.00 ? 77 ILE A HD11 1  
ATOM 1274  H HD12 . ILE A 1 78 ? 152.871 0.924   2.884   1.00 0.00 ? 77 ILE A HD12 1  
ATOM 1275  H HD13 . ILE A 1 78 ? 153.631 1.156   1.310   1.00 0.00 ? 77 ILE A HD13 1  
ATOM 1276  N N    . LEU A 1 79 ? 155.790 6.598   0.577   1.00 0.00 ? 78 LEU A N    1  
ATOM 1277  C CA   . LEU A 1 79 ? 156.010 7.588   -0.475  1.00 0.00 ? 78 LEU A CA   1  
ATOM 1278  C C    . LEU A 1 79 ? 156.312 6.903   -1.807  1.00 0.00 ? 78 LEU A C    1  
ATOM 1279  O O    . LEU A 1 79 ? 157.200 6.052   -1.890  1.00 0.00 ? 78 LEU A O    1  
ATOM 1280  C CB   . LEU A 1 79 ? 157.159 8.528   -0.094  1.00 0.00 ? 78 LEU A CB   1  
ATOM 1281  C CG   . LEU A 1 79 ? 156.988 9.983   -0.547  1.00 0.00 ? 78 LEU A CG   1  
ATOM 1282  C CD1  . LEU A 1 79 ? 155.884 10.669  0.247   1.00 0.00 ? 78 LEU A CD1  1  
ATOM 1283  C CD2  . LEU A 1 79 ? 158.301 10.742  -0.404  1.00 0.00 ? 78 LEU A CD2  1  
ATOM 1284  H H    . LEU A 1 79 ? 156.565 6.151   0.981   1.00 0.00 ? 78 LEU A H    1  
ATOM 1285  H HA   . LEU A 1 79 ? 155.104 8.166   -0.579  1.00 0.00 ? 78 LEU A HA   1  
ATOM 1286  H HB2  . LEU A 1 79 ? 157.264 8.517   0.981   1.00 0.00 ? 78 LEU A HB2  1  
ATOM 1287  H HB3  . LEU A 1 79 ? 158.070 8.145   -0.530  1.00 0.00 ? 78 LEU A HB3  1  
ATOM 1288  H HG   . LEU A 1 79 ? 156.706 9.997   -1.589  1.00 0.00 ? 78 LEU A HG   1  
ATOM 1289  H HD11 . LEU A 1 79 ? 156.109 10.610  1.302   1.00 0.00 ? 78 LEU A HD11 1  
ATOM 1290  H HD12 . LEU A 1 79 ? 154.942 10.178  0.053   1.00 0.00 ? 78 LEU A HD12 1  
ATOM 1291  H HD13 . LEU A 1 79 ? 155.818 11.705  -0.050  1.00 0.00 ? 78 LEU A HD13 1  
ATOM 1292  H HD21 . LEU A 1 79 ? 158.845 10.697  -1.336  1.00 0.00 ? 78 LEU A HD21 1  
ATOM 1293  H HD22 . LEU A 1 79 ? 158.893 10.295  0.380   1.00 0.00 ? 78 LEU A HD22 1  
ATOM 1294  H HD23 . LEU A 1 79 ? 158.096 11.773  -0.156  1.00 0.00 ? 78 LEU A HD23 1  
ATOM 1295  N N    . LEU A 1 80 ? 155.562 7.278   -2.843  1.00 0.00 ? 79 LEU A N    1  
ATOM 1296  C CA   . LEU A 1 80 ? 155.736 6.699   -4.174  1.00 0.00 ? 79 LEU A CA   1  
ATOM 1297  C C    . LEU A 1 80 ? 156.681 7.549   -5.025  1.00 0.00 ? 79 LEU A C    1  
ATOM 1298  O O    . LEU A 1 80 ? 156.486 8.759   -5.161  1.00 0.00 ? 79 LEU A O    1  
ATOM 1299  C CB   . LEU A 1 80 ? 154.380 6.568   -4.878  1.00 0.00 ? 79 LEU A CB   1  
ATOM 1300  C CG   . LEU A 1 80 ? 153.252 5.989   -4.017  1.00 0.00 ? 79 LEU A CG   1  
ATOM 1301  C CD1  . LEU A 1 80 ? 151.920 6.640   -4.367  1.00 0.00 ? 79 LEU A CD1  1  
ATOM 1302  C CD2  . LEU A 1 80 ? 153.174 4.479   -4.188  1.00 0.00 ? 79 LEU A CD2  1  
ATOM 1303  H H    . LEU A 1 80 ? 154.868 7.958   -2.707  1.00 0.00 ? 79 LEU A H    1  
ATOM 1304  H HA   . LEU A 1 80 ? 156.166 5.715   -4.054  1.00 0.00 ? 79 LEU A HA   1  
ATOM 1305  H HB2  . LEU A 1 80 ? 154.080 7.549   -5.218  1.00 0.00 ? 79 LEU A HB2  1  
ATOM 1306  H HB3  . LEU A 1 80 ? 154.507 5.931   -5.739  1.00 0.00 ? 79 LEU A HB3  1  
ATOM 1307  H HG   . LEU A 1 80 ? 153.460 6.198   -2.978  1.00 0.00 ? 79 LEU A HG   1  
ATOM 1308  H HD11 . LEU A 1 80 ? 152.098 7.574   -4.878  1.00 0.00 ? 79 LEU A HD11 1  
ATOM 1309  H HD12 . LEU A 1 80 ? 151.362 6.826   -3.462  1.00 0.00 ? 79 LEU A HD12 1  
ATOM 1310  H HD13 . LEU A 1 80 ? 151.354 5.981   -5.009  1.00 0.00 ? 79 LEU A HD13 1  
ATOM 1311  H HD21 . LEU A 1 80 ? 153.429 4.217   -5.204  1.00 0.00 ? 79 LEU A HD21 1  
ATOM 1312  H HD22 . LEU A 1 80 ? 152.170 4.143   -3.971  1.00 0.00 ? 79 LEU A HD22 1  
ATOM 1313  H HD23 . LEU A 1 80 ? 153.866 4.005   -3.509  1.00 0.00 ? 79 LEU A HD23 1  
ATOM 1314  N N    . LEU A 1 81 ? 157.703 6.909   -5.597  1.00 0.00 ? 80 LEU A N    1  
ATOM 1315  C CA   . LEU A 1 81 ? 158.677 7.609   -6.435  1.00 0.00 ? 80 LEU A CA   1  
ATOM 1316  C C    . LEU A 1 81 ? 158.926 6.860   -7.744  1.00 0.00 ? 80 LEU A C    1  
ATOM 1317  O O    . LEU A 1 81 ? 158.955 5.629   -7.772  1.00 0.00 ? 80 LEU A O    1  
ATOM 1318  C CB   . LEU A 1 81 ? 160.001 7.788   -5.683  1.00 0.00 ? 80 LEU A CB   1  
ATOM 1319  C CG   . LEU A 1 81 ? 159.873 8.275   -4.235  1.00 0.00 ? 80 LEU A CG   1  
ATOM 1320  C CD1  . LEU A 1 81 ? 160.072 7.119   -3.265  1.00 0.00 ? 80 LEU A CD1  1  
ATOM 1321  C CD2  . LEU A 1 81 ? 160.872 9.389   -3.956  1.00 0.00 ? 80 LEU A CD2  1  
ATOM 1322  H H    . LEU A 1 81 ? 157.804 5.945   -5.451  1.00 0.00 ? 80 LEU A H    1  
ATOM 1323  H HA   . LEU A 1 81 ? 158.274 8.584   -6.666  1.00 0.00 ? 80 LEU A HA   1  
ATOM 1324  H HB2  . LEU A 1 81 ? 160.518 6.839   -5.677  1.00 0.00 ? 80 LEU A HB2  1  
ATOM 1325  H HB3  . LEU A 1 81 ? 160.604 8.501   -6.226  1.00 0.00 ? 80 LEU A HB3  1  
ATOM 1326  H HG   . LEU A 1 81 ? 158.879 8.669   -4.082  1.00 0.00 ? 80 LEU A HG   1  
ATOM 1327  H HD11 . LEU A 1 81 ? 161.099 7.102   -2.930  1.00 0.00 ? 80 LEU A HD11 1  
ATOM 1328  H HD12 . LEU A 1 81 ? 159.841 6.188   -3.763  1.00 0.00 ? 80 LEU A HD12 1  
ATOM 1329  H HD13 . LEU A 1 81 ? 159.417 7.245   -2.416  1.00 0.00 ? 80 LEU A HD13 1  
ATOM 1330  H HD21 . LEU A 1 81 ? 161.814 9.156   -4.430  1.00 0.00 ? 80 LEU A HD21 1  
ATOM 1331  H HD22 . LEU A 1 81 ? 161.018 9.485   -2.891  1.00 0.00 ? 80 LEU A HD22 1  
ATOM 1332  H HD23 . LEU A 1 81 ? 160.491 10.320  -4.352  1.00 0.00 ? 80 LEU A HD23 1  
ATOM 1333  N N    . SER A 1 82 ? 159.109 7.618   -8.825  1.00 0.00 ? 81 SER A N    1  
ATOM 1334  C CA   . SER A 1 82 ? 159.360 7.041   -10.146 1.00 0.00 ? 81 SER A CA   1  
ATOM 1335  C C    . SER A 1 82 ? 160.848 6.747   -10.341 1.00 0.00 ? 81 SER A C    1  
ATOM 1336  O O    . SER A 1 82 ? 161.593 7.581   -10.860 1.00 0.00 ? 81 SER A O    1  
ATOM 1337  C CB   . SER A 1 82 ? 158.867 7.991   -11.244 1.00 0.00 ? 81 SER A CB   1  
ATOM 1338  O OG   . SER A 1 82 ? 159.114 9.345   -10.900 1.00 0.00 ? 81 SER A OG   1  
ATOM 1339  H H    . SER A 1 82 ? 159.077 8.594   -8.732  1.00 0.00 ? 81 SER A H    1  
ATOM 1340  H HA   . SER A 1 82 ? 158.809 6.113   -10.212 1.00 0.00 ? 81 SER A HA   1  
ATOM 1341  H HB2  . SER A 1 82 ? 159.383 7.770   -12.166 1.00 0.00 ? 81 SER A HB2  1  
ATOM 1342  H HB3  . SER A 1 82 ? 157.804 7.856   -11.385 1.00 0.00 ? 81 SER A HB3  1  
ATOM 1343  H HG   . SER A 1 82 ? 160.047 9.540   -11.018 1.00 0.00 ? 81 SER A HG   1  
ATOM 1344  N N    . GLN A 1 83 ? 161.270 5.554   -9.926  1.00 0.00 ? 82 GLN A N    1  
ATOM 1345  C CA   . GLN A 1 83 ? 162.664 5.142   -10.058 1.00 0.00 ? 82 GLN A CA   1  
ATOM 1346  C C    . GLN A 1 83 ? 162.770 3.901   -10.943 1.00 0.00 ? 82 GLN A C    1  
ATOM 1347  O O    . GLN A 1 83 ? 162.957 2.786   -10.451 1.00 0.00 ? 82 GLN A O    1  
ATOM 1348  C CB   . GLN A 1 83 ? 163.269 4.862   -8.677  1.00 0.00 ? 82 GLN A CB   1  
ATOM 1349  C CG   . GLN A 1 83 ? 164.427 5.781   -8.323  1.00 0.00 ? 82 GLN A CG   1  
ATOM 1350  C CD   . GLN A 1 83 ? 165.759 5.249   -8.818  1.00 0.00 ? 82 GLN A CD   1  
ATOM 1351  O OE1  . GLN A 1 83 ? 166.282 4.268   -8.290  1.00 0.00 ? 82 GLN A OE1  1  
ATOM 1352  N NE2  . GLN A 1 83 ? 166.317 5.895   -9.837  1.00 0.00 ? 82 GLN A NE2  1  
ATOM 1353  H H    . GLN A 1 83 ? 160.627 4.933   -9.524  1.00 0.00 ? 82 GLN A H    1  
ATOM 1354  H HA   . GLN A 1 83 ? 163.207 5.949   -10.526 1.00 0.00 ? 82 GLN A HA   1  
ATOM 1355  H HB2  . GLN A 1 83 ? 162.500 4.982   -7.928  1.00 0.00 ? 82 GLN A HB2  1  
ATOM 1356  H HB3  . GLN A 1 83 ? 163.628 3.844   -8.652  1.00 0.00 ? 82 GLN A HB3  1  
ATOM 1357  H HG2  . GLN A 1 83 ? 164.253 6.749   -8.770  1.00 0.00 ? 82 GLN A HG2  1  
ATOM 1358  H HG3  . GLN A 1 83 ? 164.473 5.885   -7.249  1.00 0.00 ? 82 GLN A HG3  1  
ATOM 1359  H HE21 . GLN A 1 83 ? 165.846 6.669   -10.211 1.00 0.00 ? 82 GLN A HE21 1  
ATOM 1360  H HE22 . GLN A 1 83 ? 167.177 5.568   -10.176 1.00 0.00 ? 82 GLN A HE22 1  
ATOM 1361  N N    . ASP A 1 84 ? 162.635 4.100   -12.253 1.00 0.00 ? 83 ASP A N    1  
ATOM 1362  C CA   . ASP A 1 84 ? 162.703 2.994   -13.204 1.00 0.00 ? 83 ASP A CA   1  
ATOM 1363  C C    . ASP A 1 84 ? 164.129 2.792   -13.726 1.00 0.00 ? 83 ASP A C    1  
ATOM 1364  O O    . ASP A 1 84 ? 164.559 3.460   -14.668 1.00 0.00 ? 83 ASP A O    1  
ATOM 1365  C CB   . ASP A 1 84 ? 161.720 3.225   -14.363 1.00 0.00 ? 83 ASP A CB   1  
ATOM 1366  C CG   . ASP A 1 84 ? 161.877 4.583   -15.025 1.00 0.00 ? 83 ASP A CG   1  
ATOM 1367  O OD1  . ASP A 1 84 ? 161.506 5.600   -14.398 1.00 0.00 ? 83 ASP A OD1  1  
ATOM 1368  O OD2  . ASP A 1 84 ? 162.360 4.630   -16.175 1.00 0.00 ? 83 ASP A OD2  1  
ATOM 1369  H H    . ASP A 1 84 ? 162.477 5.009   -12.587 1.00 0.00 ? 83 ASP A H    1  
ATOM 1370  H HA   . ASP A 1 84 ? 162.406 2.101   -12.677 1.00 0.00 ? 83 ASP A HA   1  
ATOM 1371  H HB2  . ASP A 1 84 ? 161.875 2.464   -15.111 1.00 0.00 ? 83 ASP A HB2  1  
ATOM 1372  H HB3  . ASP A 1 84 ? 160.711 3.146   -13.984 1.00 0.00 ? 83 ASP A HB3  1  
ATOM 1373  N N    . ARG A 1 85 ? 164.852 1.856   -13.099 1.00 0.00 ? 84 ARG A N    1  
ATOM 1374  C CA   . ARG A 1 85 ? 166.234 1.537   -13.478 1.00 0.00 ? 84 ARG A CA   1  
ATOM 1375  C C    . ARG A 1 85 ? 167.184 2.694   -13.162 1.00 0.00 ? 84 ARG A C    1  
ATOM 1376  O O    . ARG A 1 85 ? 167.175 3.722   -13.843 1.00 0.00 ? 84 ARG A O    1  
ATOM 1377  C CB   . ARG A 1 85 ? 166.318 1.170   -14.966 1.00 0.00 ? 84 ARG A CB   1  
ATOM 1378  C CG   . ARG A 1 85 ? 167.254 0.003   -15.257 1.00 0.00 ? 84 ARG A CG   1  
ATOM 1379  C CD   . ARG A 1 85 ? 166.965 -0.630  -16.610 1.00 0.00 ? 84 ARG A CD   1  
ATOM 1380  N NE   . ARG A 1 85 ? 168.189 -1.041  -17.298 1.00 0.00 ? 84 ARG A NE   1  
ATOM 1381  C CZ   . ARG A 1 85 ? 168.855 -2.171  -17.038 1.00 0.00 ? 84 ARG A CZ   1  
ATOM 1382  N NH1  . ARG A 1 85 ? 168.429 -3.003  -16.089 1.00 0.00 ? 84 ARG A NH1  1  
ATOM 1383  N NH2  . ARG A 1 85 ? 169.953 -2.467  -17.726 1.00 0.00 ? 84 ARG A NH2  1  
ATOM 1384  H H    . ARG A 1 85 ? 164.444 1.363   -12.356 1.00 0.00 ? 84 ARG A H    1  
ATOM 1385  H HA   . ARG A 1 85 ? 166.538 0.680   -12.894 1.00 0.00 ? 84 ARG A HA   1  
ATOM 1386  H HB2  . ARG A 1 85 ? 165.332 0.908   -15.318 1.00 0.00 ? 84 ARG A HB2  1  
ATOM 1387  H HB3  . ARG A 1 85 ? 166.670 2.031   -15.517 1.00 0.00 ? 84 ARG A HB3  1  
ATOM 1388  H HG2  . ARG A 1 85 ? 168.273 0.362   -15.251 1.00 0.00 ? 84 ARG A HG2  1  
ATOM 1389  H HG3  . ARG A 1 85 ? 167.130 -0.744  -14.487 1.00 0.00 ? 84 ARG A HG3  1  
ATOM 1390  H HD2  . ARG A 1 85 ? 166.340 -1.497  -16.460 1.00 0.00 ? 84 ARG A HD2  1  
ATOM 1391  H HD3  . ARG A 1 85 ? 166.441 0.087   -17.226 1.00 0.00 ? 84 ARG A HD3  1  
ATOM 1392  H HE   . ARG A 1 85 ? 168.535 -0.443  -17.997 1.00 0.00 ? 84 ARG A HE   1  
ATOM 1393  H HH11 . ARG A 1 85 ? 167.606 -2.786  -15.563 1.00 0.00 ? 84 ARG A HH11 1  
ATOM 1394  H HH12 . ARG A 1 85 ? 168.932 -3.848  -15.901 1.00 0.00 ? 84 ARG A HH12 1  
ATOM 1395  H HH21 . ARG A 1 85 ? 170.282 -1.844  -18.437 1.00 0.00 ? 84 ARG A HH21 1  
ATOM 1396  H HH22 . ARG A 1 85 ? 170.453 -3.313  -17.535 1.00 0.00 ? 84 ARG A HH22 1  
ATOM 1397  N N    . ASN A 1 86 ? 168.005 2.513   -12.123 1.00 0.00 ? 85 ASN A N    1  
ATOM 1398  C CA   . ASN A 1 86 ? 168.967 3.532   -11.707 1.00 0.00 ? 85 ASN A CA   1  
ATOM 1399  C C    . ASN A 1 86 ? 170.346 3.266   -12.318 1.00 0.00 ? 85 ASN A C    1  
ATOM 1400  O O    . ASN A 1 86 ? 171.206 2.650   -11.685 1.00 0.00 ? 85 ASN A O    1  
ATOM 1401  C CB   . ASN A 1 86 ? 169.066 3.567   -10.178 1.00 0.00 ? 85 ASN A CB   1  
ATOM 1402  C CG   . ASN A 1 86 ? 169.858 4.760   -9.671  1.00 0.00 ? 85 ASN A CG   1  
ATOM 1403  O OD1  . ASN A 1 86 ? 169.583 5.902   -10.038 1.00 0.00 ? 85 ASN A OD1  1  
ATOM 1404  N ND2  . ASN A 1 86 ? 170.846 4.502   -8.818  1.00 0.00 ? 85 ASN A ND2  1  
ATOM 1405  H H    . ASN A 1 86 ? 167.961 1.671   -11.623 1.00 0.00 ? 85 ASN A H    1  
ATOM 1406  H HA   . ASN A 1 86 ? 168.610 4.490   -12.058 1.00 0.00 ? 85 ASN A HA   1  
ATOM 1407  H HB2  . ASN A 1 86 ? 168.072 3.616   -9.761  1.00 0.00 ? 85 ASN A HB2  1  
ATOM 1408  H HB3  . ASN A 1 86 ? 169.551 2.664   -9.836  1.00 0.00 ? 85 ASN A HB3  1  
ATOM 1409  H HD21 . ASN A 1 86 ? 171.010 3.571   -8.563  1.00 0.00 ? 85 ASN A HD21 1  
ATOM 1410  H HD22 . ASN A 1 86 ? 171.371 5.258   -8.479  1.00 0.00 ? 85 ASN A HD22 1  
ATOM 1411  N N    . LEU A 1 87 ? 170.544 3.739   -13.551 1.00 0.00 ? 86 LEU A N    1  
ATOM 1412  C CA   . LEU A 1 87 ? 171.815 3.567   -14.265 1.00 0.00 ? 86 LEU A CA   1  
ATOM 1413  C C    . LEU A 1 87 ? 172.110 2.090   -14.547 1.00 0.00 ? 86 LEU A C    1  
ATOM 1414  O O    . LEU A 1 87 ? 171.426 1.198   -14.041 1.00 0.00 ? 86 LEU A O    1  
ATOM 1415  C CB   . LEU A 1 87 ? 172.972 4.182   -13.464 1.00 0.00 ? 86 LEU A CB   1  
ATOM 1416  C CG   . LEU A 1 87 ? 173.352 5.620   -13.839 1.00 0.00 ? 86 LEU A CG   1  
ATOM 1417  C CD1  . LEU A 1 87 ? 173.837 5.693   -15.280 1.00 0.00 ? 86 LEU A CD1  1  
ATOM 1418  C CD2  . LEU A 1 87 ? 172.177 6.565   -13.617 1.00 0.00 ? 86 LEU A CD2  1  
ATOM 1419  H H    . LEU A 1 87 ? 169.815 4.223   -13.995 1.00 0.00 ? 86 LEU A H    1  
ATOM 1420  H HA   . LEU A 1 87 ? 171.731 4.085   -15.208 1.00 0.00 ? 86 LEU A HA   1  
ATOM 1421  H HB2  . LEU A 1 87 ? 172.704 4.168   -12.418 1.00 0.00 ? 86 LEU A HB2  1  
ATOM 1422  H HB3  . LEU A 1 87 ? 173.843 3.560   -13.601 1.00 0.00 ? 86 LEU A HB3  1  
ATOM 1423  H HG   . LEU A 1 87 ? 174.163 5.944   -13.203 1.00 0.00 ? 86 LEU A HG   1  
ATOM 1424  H HD11 . LEU A 1 87 ? 174.349 6.632   -15.439 1.00 0.00 ? 86 LEU A HD11 1  
ATOM 1425  H HD12 . LEU A 1 87 ? 172.992 5.627   -15.949 1.00 0.00 ? 86 LEU A HD12 1  
ATOM 1426  H HD13 . LEU A 1 87 ? 174.515 4.876   -15.473 1.00 0.00 ? 86 LEU A HD13 1  
ATOM 1427  H HD21 . LEU A 1 87 ? 171.251 6.021   -13.728 1.00 0.00 ? 86 LEU A HD21 1  
ATOM 1428  H HD22 . LEU A 1 87 ? 172.215 7.364   -14.342 1.00 0.00 ? 86 LEU A HD22 1  
ATOM 1429  H HD23 . LEU A 1 87 ? 172.234 6.980   -12.622 1.00 0.00 ? 86 LEU A HD23 1  
ATOM 1430  N N    . GLU A 1 88 ? 173.140 1.844   -15.361 1.00 0.00 ? 87 GLU A N    1  
ATOM 1431  C CA   . GLU A 1 88 ? 173.535 0.482   -15.713 1.00 0.00 ? 87 GLU A CA   1  
ATOM 1432  C C    . GLU A 1 88 ? 174.694 0.005   -14.835 1.00 0.00 ? 87 GLU A C    1  
ATOM 1433  O O    . GLU A 1 88 ? 175.865 0.142   -15.202 1.00 0.00 ? 87 GLU A O    1  
ATOM 1434  C CB   . GLU A 1 88 ? 173.926 0.408   -17.193 1.00 0.00 ? 87 GLU A CB   1  
ATOM 1435  C CG   . GLU A 1 88 ? 172.834 -0.160  -18.090 1.00 0.00 ? 87 GLU A CG   1  
ATOM 1436  C CD   . GLU A 1 88 ? 171.769 0.862   -18.451 1.00 0.00 ? 87 GLU A CD   1  
ATOM 1437  O OE1  . GLU A 1 88 ? 172.126 2.032   -18.710 1.00 0.00 ? 87 GLU A OE1  1  
ATOM 1438  O OE2  . GLU A 1 88 ? 170.577 0.488   -18.483 1.00 0.00 ? 87 GLU A OE2  1  
ATOM 1439  H H    . GLU A 1 88 ? 173.646 2.598   -15.731 1.00 0.00 ? 87 GLU A H    1  
ATOM 1440  H HA   . GLU A 1 88 ? 172.685 -0.161  -15.543 1.00 0.00 ? 87 GLU A HA   1  
ATOM 1441  H HB2  . GLU A 1 88 ? 174.167 1.403   -17.540 1.00 0.00 ? 87 GLU A HB2  1  
ATOM 1442  H HB3  . GLU A 1 88 ? 174.802 -0.217  -17.291 1.00 0.00 ? 87 GLU A HB3  1  
ATOM 1443  H HG2  . GLU A 1 88 ? 173.287 -0.518  -19.003 1.00 0.00 ? 87 GLU A HG2  1  
ATOM 1444  H HG3  . GLU A 1 88 ? 172.359 -0.985  -17.579 1.00 0.00 ? 87 GLU A HG3  1  
ATOM 1445  N N    . HIS A 1 89 ? 174.357 -0.553  -13.673 1.00 0.00 ? 88 HIS A N    1  
ATOM 1446  C CA   . HIS A 1 89 ? 175.361 -1.054  -12.734 1.00 0.00 ? 88 HIS A CA   1  
ATOM 1447  C C    . HIS A 1 89 ? 174.710 -1.910  -11.642 1.00 0.00 ? 88 HIS A C    1  
ATOM 1448  O O    . HIS A 1 89 ? 173.496 -2.125  -11.654 1.00 0.00 ? 88 HIS A O    1  
ATOM 1449  C CB   . HIS A 1 89 ? 176.123 0.120   -12.101 1.00 0.00 ? 88 HIS A CB   1  
ATOM 1450  C CG   . HIS A 1 89 ? 177.599 -0.115  -11.959 1.00 0.00 ? 88 HIS A CG   1  
ATOM 1451  N ND1  . HIS A 1 89 ? 178.352 0.437   -10.944 1.00 0.00 ? 88 HIS A ND1  1  
ATOM 1452  C CD2  . HIS A 1 89 ? 178.463 -0.842  -12.710 1.00 0.00 ? 88 HIS A CD2  1  
ATOM 1453  C CE1  . HIS A 1 89 ? 179.612 0.061   -11.077 1.00 0.00 ? 88 HIS A CE1  1  
ATOM 1454  N NE2  . HIS A 1 89 ? 179.706 -0.715  -12.140 1.00 0.00 ? 88 HIS A NE2  1  
ATOM 1455  H H    . HIS A 1 89 ? 173.408 -0.631  -13.440 1.00 0.00 ? 88 HIS A H    1  
ATOM 1456  H HA   . HIS A 1 89 ? 176.055 -1.667  -13.288 1.00 0.00 ? 88 HIS A HA   1  
ATOM 1457  H HB2  . HIS A 1 89 ? 175.988 0.997   -12.716 1.00 0.00 ? 88 HIS A HB2  1  
ATOM 1458  H HB3  . HIS A 1 89 ? 175.720 0.311   -11.118 1.00 0.00 ? 88 HIS A HB3  1  
ATOM 1459  H HD1  . HIS A 1 89 ? 178.014 1.023   -10.234 1.00 0.00 ? 88 HIS A HD1  1  
ATOM 1460  H HD2  . HIS A 1 89 ? 178.219 -1.412  -13.596 1.00 0.00 ? 88 HIS A HD2  1  
ATOM 1461  H HE1  . HIS A 1 89 ? 180.427 0.342   -10.426 1.00 0.00 ? 88 HIS A HE1  1  
ATOM 1462  H HE2  . HIS A 1 89 ? 180.503 -1.225  -12.396 1.00 0.00 ? 88 HIS A HE2  1  
ATOM 1463  N N    . HIS A 1 90 ? 175.522 -2.396  -10.702 1.00 0.00 ? 89 HIS A N    1  
ATOM 1464  C CA   . HIS A 1 90 ? 175.020 -3.225  -9.608  1.00 0.00 ? 89 HIS A CA   1  
ATOM 1465  C C    . HIS A 1 90 ? 175.356 -2.603  -8.254  1.00 0.00 ? 89 HIS A C    1  
ATOM 1466  O O    . HIS A 1 90 ? 176.523 -2.342  -7.955  1.00 0.00 ? 89 HIS A O    1  
ATOM 1467  C CB   . HIS A 1 90 ? 175.611 -4.637  -9.697  1.00 0.00 ? 89 HIS A CB   1  
ATOM 1468  C CG   . HIS A 1 90 ? 174.740 -5.702  -9.096  1.00 0.00 ? 89 HIS A CG   1  
ATOM 1469  N ND1  . HIS A 1 90 ? 173.362 -5.695  -9.186  1.00 0.00 ? 89 HIS A ND1  1  
ATOM 1470  C CD2  . HIS A 1 90 ? 175.061 -6.820  -8.398  1.00 0.00 ? 89 HIS A CD2  1  
ATOM 1471  C CE1  . HIS A 1 90 ? 172.876 -6.759  -8.571  1.00 0.00 ? 89 HIS A CE1  1  
ATOM 1472  N NE2  . HIS A 1 90 ? 173.885 -7.459  -8.085  1.00 0.00 ? 89 HIS A NE2  1  
ATOM 1473  H H    . HIS A 1 90 ? 176.480 -2.192  -10.744 1.00 0.00 ? 89 HIS A H    1  
ATOM 1474  H HA   . HIS A 1 90 ? 173.948 -3.287  -9.706  1.00 0.00 ? 89 HIS A HA   1  
ATOM 1475  H HB2  . HIS A 1 90 ? 175.770 -4.886  -10.735 1.00 0.00 ? 89 HIS A HB2  1  
ATOM 1476  H HB3  . HIS A 1 90 ? 176.561 -4.653  -9.180  1.00 0.00 ? 89 HIS A HB3  1  
ATOM 1477  H HD1  . HIS A 1 90 ? 172.821 -5.012  -9.634  1.00 0.00 ? 89 HIS A HD1  1  
ATOM 1478  H HD2  . HIS A 1 90 ? 176.057 -7.148  -8.137  1.00 0.00 ? 89 HIS A HD2  1  
ATOM 1479  H HE1  . HIS A 1 90 ? 171.830 -7.016  -8.485  1.00 0.00 ? 89 HIS A HE1  1  
ATOM 1480  H HE2  . HIS A 1 90 ? 173.812 -8.357  -7.701  1.00 0.00 ? 89 HIS A HE2  1  
ATOM 1481  N N    . HIS A 1 91 ? 174.326 -2.372  -7.438  1.00 0.00 ? 90 HIS A N    1  
ATOM 1482  C CA   . HIS A 1 91 ? 174.513 -1.783  -6.113  1.00 0.00 ? 90 HIS A CA   1  
ATOM 1483  C C    . HIS A 1 91 ? 174.179 -2.792  -5.016  1.00 0.00 ? 90 HIS A C    1  
ATOM 1484  O O    . HIS A 1 91 ? 173.008 -3.019  -4.705  1.00 0.00 ? 90 HIS A O    1  
ATOM 1485  C CB   . HIS A 1 91 ? 173.644 -0.530  -5.954  1.00 0.00 ? 90 HIS A CB   1  
ATOM 1486  C CG   . HIS A 1 91 ? 174.281 0.714   -6.495  1.00 0.00 ? 90 HIS A CG   1  
ATOM 1487  N ND1  . HIS A 1 91 ? 174.378 0.987   -7.843  1.00 0.00 ? 90 HIS A ND1  1  
ATOM 1488  C CD2  . HIS A 1 91 ? 174.854 1.765   -5.859  1.00 0.00 ? 90 HIS A CD2  1  
ATOM 1489  C CE1  . HIS A 1 91 ? 174.982 2.150   -8.013  1.00 0.00 ? 90 HIS A CE1  1  
ATOM 1490  N NE2  . HIS A 1 91 ? 175.280 2.642   -6.825  1.00 0.00 ? 90 HIS A NE2  1  
ATOM 1491  H H    . HIS A 1 91 ? 173.420 -2.603  -7.734  1.00 0.00 ? 90 HIS A H    1  
ATOM 1492  H HA   . HIS A 1 91 ? 175.551 -1.503  -6.022  1.00 0.00 ? 90 HIS A HA   1  
ATOM 1493  H HB2  . HIS A 1 91 ? 172.710 -0.678  -6.476  1.00 0.00 ? 90 HIS A HB2  1  
ATOM 1494  H HB3  . HIS A 1 91 ? 173.443 -0.373  -4.905  1.00 0.00 ? 90 HIS A HB3  1  
ATOM 1495  H HD1  . HIS A 1 91 ? 174.054 0.412   -8.569  1.00 0.00 ? 90 HIS A HD1  1  
ATOM 1496  H HD2  . HIS A 1 91 ? 174.957 1.889   -4.790  1.00 0.00 ? 90 HIS A HD2  1  
ATOM 1497  H HE1  . HIS A 1 91 ? 175.192 2.620   -8.963  1.00 0.00 ? 90 HIS A HE1  1  
ATOM 1498  H HE2  . HIS A 1 91 ? 175.802 3.456   -6.665  1.00 0.00 ? 90 HIS A HE2  1  
ATOM 1499  N N    . HIS A 1 92 ? 175.217 -3.398  -4.437  1.00 0.00 ? 91 HIS A N    1  
ATOM 1500  C CA   . HIS A 1 92 ? 175.040 -4.386  -3.374  1.00 0.00 ? 91 HIS A CA   1  
ATOM 1501  C C    . HIS A 1 92 ? 175.924 -4.060  -2.170  1.00 0.00 ? 91 HIS A C    1  
ATOM 1502  O O    . HIS A 1 92 ? 177.118 -3.792  -2.322  1.00 0.00 ? 91 HIS A O    1  
ATOM 1503  C CB   . HIS A 1 92 ? 175.371 -5.788  -3.896  1.00 0.00 ? 91 HIS A CB   1  
ATOM 1504  C CG   . HIS A 1 92 ? 174.165 -6.638  -4.168  1.00 0.00 ? 91 HIS A CG   1  
ATOM 1505  N ND1  . HIS A 1 92 ? 174.191 -8.017  -4.112  1.00 0.00 ? 91 HIS A ND1  1  
ATOM 1506  C CD2  . HIS A 1 92 ? 172.896 -6.302  -4.506  1.00 0.00 ? 91 HIS A CD2  1  
ATOM 1507  C CE1  . HIS A 1 92 ? 172.992 -8.491  -4.404  1.00 0.00 ? 91 HIS A CE1  1  
ATOM 1508  N NE2  . HIS A 1 92 ? 172.190 -7.472  -4.646  1.00 0.00 ? 91 HIS A NE2  1  
ATOM 1509  H H    . HIS A 1 92 ? 176.125 -3.175  -4.731  1.00 0.00 ? 91 HIS A H    1  
ATOM 1510  H HA   . HIS A 1 92 ? 174.006 -4.360  -3.064  1.00 0.00 ? 91 HIS A HA   1  
ATOM 1511  H HB2  . HIS A 1 92 ? 175.926 -5.699  -4.817  1.00 0.00 ? 91 HIS A HB2  1  
ATOM 1512  H HB3  . HIS A 1 92 ? 175.979 -6.300  -3.164  1.00 0.00 ? 91 HIS A HB3  1  
ATOM 1513  H HD1  . HIS A 1 92 ? 174.971 -8.566  -3.889  1.00 0.00 ? 91 HIS A HD1  1  
ATOM 1514  H HD2  . HIS A 1 92 ? 172.511 -5.301  -4.640  1.00 0.00 ? 91 HIS A HD2  1  
ATOM 1515  H HE1  . HIS A 1 92 ? 172.716 -9.535  -4.439  1.00 0.00 ? 91 HIS A HE1  1  
ATOM 1516  H HE2  . HIS A 1 92 ? 171.231 -7.539  -4.841  1.00 0.00 ? 91 HIS A HE2  1  
ATOM 1517  N N    . HIS A 1 93 ? 175.333 -4.087  -0.974  1.00 0.00 ? 92 HIS A N    1  
ATOM 1518  C CA   . HIS A 1 93 ? 176.067 -3.795  0.257   1.00 0.00 ? 92 HIS A CA   1  
ATOM 1519  C C    . HIS A 1 93 ? 175.716 -4.803  1.352   1.00 0.00 ? 92 HIS A C    1  
ATOM 1520  O O    . HIS A 1 93 ? 174.588 -4.820  1.851   1.00 0.00 ? 92 HIS A O    1  
ATOM 1521  C CB   . HIS A 1 93 ? 175.756 -2.375  0.741   1.00 0.00 ? 92 HIS A CB   1  
ATOM 1522  C CG   . HIS A 1 93 ? 176.804 -1.365  0.379   1.00 0.00 ? 92 HIS A CG   1  
ATOM 1523  N ND1  . HIS A 1 93 ? 177.551 -1.429  -0.781  1.00 0.00 ? 92 HIS A ND1  1  
ATOM 1524  C CD2  . HIS A 1 93 ? 177.226 -0.255  1.032   1.00 0.00 ? 92 HIS A CD2  1  
ATOM 1525  C CE1  . HIS A 1 93 ? 178.383 -0.405  -0.824  1.00 0.00 ? 92 HIS A CE1  1  
ATOM 1526  N NE2  . HIS A 1 93 ? 178.206 0.322   0.264   1.00 0.00 ? 92 HIS A NE2  1  
ATOM 1527  H H    . HIS A 1 93 ? 174.379 -4.308  -0.918  1.00 0.00 ? 92 HIS A H    1  
ATOM 1528  H HA   . HIS A 1 93 ? 177.122 -3.871  0.040   1.00 0.00 ? 92 HIS A HA   1  
ATOM 1529  H HB2  . HIS A 1 93 ? 174.822 -2.052  0.306   1.00 0.00 ? 92 HIS A HB2  1  
ATOM 1530  H HB3  . HIS A 1 93 ? 175.660 -2.384  1.817   1.00 0.00 ? 92 HIS A HB3  1  
ATOM 1531  H HD1  . HIS A 1 93 ? 177.482 -2.124  -1.469  1.00 0.00 ? 92 HIS A HD1  1  
ATOM 1532  H HD2  . HIS A 1 93 ? 176.857 0.108   1.982   1.00 0.00 ? 92 HIS A HD2  1  
ATOM 1533  H HE1  . HIS A 1 93 ? 179.087 -0.195  -1.616  1.00 0.00 ? 92 HIS A HE1  1  
ATOM 1534  H HE2  . HIS A 1 93 ? 178.650 1.175   0.453   1.00 0.00 ? 92 HIS A HE2  1  
ATOM 1535  N N    . HIS A 1 94 ? 176.686 -5.640  1.720   1.00 0.00 ? 93 HIS A N    1  
ATOM 1536  C CA   . HIS A 1 94 ? 176.479 -6.651  2.757   1.00 0.00 ? 93 HIS A CA   1  
ATOM 1537  C C    . HIS A 1 94 ? 177.809 -7.103  3.358   1.00 0.00 ? 93 HIS A C    1  
ATOM 1538  O O    . HIS A 1 94 ? 178.788 -7.248  2.593   1.00 0.00 ? 93 HIS A O    1  
ATOM 1539  C CB   . HIS A 1 94 ? 175.730 -7.857  2.183   1.00 0.00 ? 93 HIS A CB   1  
ATOM 1540  C CG   . HIS A 1 94 ? 175.137 -8.751  3.229   1.00 0.00 ? 93 HIS A CG   1  
ATOM 1541  N ND1  . HIS A 1 94 ? 173.916 -8.509  3.823   1.00 0.00 ? 93 HIS A ND1  1  
ATOM 1542  C CD2  . HIS A 1 94 ? 175.603 -9.896  3.783   1.00 0.00 ? 93 HIS A CD2  1  
ATOM 1543  C CE1  . HIS A 1 94 ? 173.657 -9.464  4.698   1.00 0.00 ? 93 HIS A CE1  1  
ATOM 1544  N NE2  . HIS A 1 94 ? 174.664 -10.318 4.691   1.00 0.00 ? 93 HIS A NE2  1  
ATOM 1545  O OXT  . HIS A 1 94 ? 177.861 -7.307  4.589   1.00 0.00 ? 93 HIS A OXT  1  
ATOM 1546  H H    . HIS A 1 94 ? 177.563 -5.576  1.286   1.00 0.00 ? 93 HIS A H    1  
ATOM 1547  H HA   . HIS A 1 94 ? 175.880 -6.204  3.537   1.00 0.00 ? 93 HIS A HA   1  
ATOM 1548  H HB2  . HIS A 1 94 ? 174.926 -7.506  1.554   1.00 0.00 ? 93 HIS A HB2  1  
ATOM 1549  H HB3  . HIS A 1 94 ? 176.413 -8.446  1.589   1.00 0.00 ? 93 HIS A HB3  1  
ATOM 1550  H HD1  . HIS A 1 94 ? 173.329 -7.747  3.634   1.00 0.00 ? 93 HIS A HD1  1  
ATOM 1551  H HD2  . HIS A 1 94 ? 176.538 -10.386 3.552   1.00 0.00 ? 93 HIS A HD2  1  
ATOM 1552  H HE1  . HIS A 1 94 ? 172.771 -9.537  5.311   1.00 0.00 ? 93 HIS A HE1  1  
ATOM 1553  H HE2  . HIS A 1 94 ? 174.712 -11.140 5.222   1.00 0.00 ? 93 HIS A HE2  1  
ATOM 1554  N N    . GLN A 1 2  ? 135.535 -10.634 2.970   1.00 0.00 ? 1  GLN A N    2  
ATOM 1555  C CA   . GLN A 1 2  ? 136.548 -10.090 2.024   1.00 0.00 ? 1  GLN A CA   2  
ATOM 1556  C C    . GLN A 1 2  ? 137.150 -8.786  2.547   1.00 0.00 ? 1  GLN A C    2  
ATOM 1557  O O    . GLN A 1 2  ? 136.423 -7.865  2.925   1.00 0.00 ? 1  GLN A O    2  
ATOM 1558  C CB   . GLN A 1 2  ? 135.878 -9.859  0.665   1.00 0.00 ? 1  GLN A CB   2  
ATOM 1559  C CG   . GLN A 1 2  ? 136.863 -9.570  -0.458  1.00 0.00 ? 1  GLN A CG   2  
ATOM 1560  C CD   . GLN A 1 2  ? 136.629 -10.441 -1.679  1.00 0.00 ? 1  GLN A CD   2  
ATOM 1561  O OE1  . GLN A 1 2  ? 136.371 -11.639 -1.561  1.00 0.00 ? 1  GLN A OE1  2  
ATOM 1562  N NE2  . GLN A 1 2  ? 136.723 -9.844  -2.863  1.00 0.00 ? 1  GLN A NE2  2  
ATOM 1563  H HA   . GLN A 1 2  ? 137.337 -10.820 1.911   1.00 0.00 ? 1  GLN A HA   2  
ATOM 1564  H HB2  . GLN A 1 2  ? 135.313 -10.741 0.402   1.00 0.00 ? 1  GLN A HB2  2  
ATOM 1565  H HB3  . GLN A 1 2  ? 135.202 -9.021  0.747   1.00 0.00 ? 1  GLN A HB3  2  
ATOM 1566  H HG2  . GLN A 1 2  ? 136.763 -8.535  -0.749  1.00 0.00 ? 1  GLN A HG2  2  
ATOM 1567  H HG3  . GLN A 1 2  ? 137.865 -9.745  -0.095  1.00 0.00 ? 1  GLN A HG3  2  
ATOM 1568  H HE21 . GLN A 1 2  ? 136.935 -8.887  -2.886  1.00 0.00 ? 1  GLN A HE21 2  
ATOM 1569  H HE22 . GLN A 1 2  ? 136.577 -10.386 -3.666  1.00 0.00 ? 1  GLN A HE22 2  
ATOM 1570  N N    . SER A 1 3  ? 138.481 -8.717  2.567   1.00 0.00 ? 2  SER A N    2  
ATOM 1571  C CA   . SER A 1 3  ? 139.183 -7.528  3.045   1.00 0.00 ? 2  SER A CA   2  
ATOM 1572  C C    . SER A 1 3  ? 140.043 -6.913  1.944   1.00 0.00 ? 2  SER A C    2  
ATOM 1573  O O    . SER A 1 3  ? 140.468 -7.605  1.018   1.00 0.00 ? 2  SER A O    2  
ATOM 1574  C CB   . SER A 1 3  ? 140.059 -7.882  4.250   1.00 0.00 ? 2  SER A CB   2  
ATOM 1575  O OG   . SER A 1 3  ? 139.346 -7.717  5.464   1.00 0.00 ? 2  SER A OG   2  
ATOM 1576  H H    . SER A 1 3  ? 139.004 -9.484  2.254   1.00 0.00 ? 2  SER A H    2  
ATOM 1577  H HA   . SER A 1 3  ? 138.442 -6.805  3.352   1.00 0.00 ? 2  SER A HA   2  
ATOM 1578  H HB2  . SER A 1 3  ? 140.377 -8.911  4.171   1.00 0.00 ? 2  SER A HB2  2  
ATOM 1579  H HB3  . SER A 1 3  ? 140.925 -7.237  4.263   1.00 0.00 ? 2  SER A HB3  2  
ATOM 1580  H HG   . SER A 1 3  ? 139.706 -8.307  6.129   1.00 0.00 ? 2  SER A HG   2  
ATOM 1581  N N    . ASP A 1 4  ? 140.296 -5.608  2.059   1.00 0.00 ? 3  ASP A N    2  
ATOM 1582  C CA   . ASP A 1 4  ? 141.110 -4.886  1.082   1.00 0.00 ? 3  ASP A CA   2  
ATOM 1583  C C    . ASP A 1 4  ? 141.542 -3.527  1.633   1.00 0.00 ? 3  ASP A C    2  
ATOM 1584  O O    . ASP A 1 4  ? 140.804 -2.544  1.537   1.00 0.00 ? 3  ASP A O    2  
ATOM 1585  C CB   . ASP A 1 4  ? 140.336 -4.700  -0.228  1.00 0.00 ? 3  ASP A CB   2  
ATOM 1586  C CG   . ASP A 1 4  ? 140.946 -5.487  -1.372  1.00 0.00 ? 3  ASP A CG   2  
ATOM 1587  O OD1  . ASP A 1 4  ? 142.104 -5.199  -1.741  1.00 0.00 ? 3  ASP A OD1  2  
ATOM 1588  O OD2  . ASP A 1 4  ? 140.265 -6.392  -1.898  1.00 0.00 ? 3  ASP A OD2  2  
ATOM 1589  H H    . ASP A 1 4  ? 139.928 -5.117  2.823   1.00 0.00 ? 3  ASP A H    2  
ATOM 1590  H HA   . ASP A 1 4  ? 141.992 -5.477  0.888   1.00 0.00 ? 3  ASP A HA   2  
ATOM 1591  H HB2  . ASP A 1 4  ? 139.319 -5.032  -0.089  1.00 0.00 ? 3  ASP A HB2  2  
ATOM 1592  H HB3  . ASP A 1 4  ? 140.336 -3.653  -0.494  1.00 0.00 ? 3  ASP A HB3  2  
ATOM 1593  N N    . VAL A 1 5  ? 142.739 -3.480  2.216   1.00 0.00 ? 4  VAL A N    2  
ATOM 1594  C CA   . VAL A 1 5  ? 143.264 -2.241  2.784   1.00 0.00 ? 4  VAL A CA   2  
ATOM 1595  C C    . VAL A 1 5  ? 143.659 -1.256  1.685   1.00 0.00 ? 4  VAL A C    2  
ATOM 1596  O O    . VAL A 1 5  ? 144.361 -1.617  0.739   1.00 0.00 ? 4  VAL A O    2  
ATOM 1597  C CB   . VAL A 1 5  ? 144.486 -2.499  3.694   1.00 0.00 ? 4  VAL A CB   2  
ATOM 1598  C CG1  . VAL A 1 5  ? 144.930 -1.208  4.367   1.00 0.00 ? 4  VAL A CG1  2  
ATOM 1599  C CG2  . VAL A 1 5  ? 144.173 -3.566  4.734   1.00 0.00 ? 4  VAL A CG2  2  
ATOM 1600  H H    . VAL A 1 5  ? 143.280 -4.297  2.264   1.00 0.00 ? 4  VAL A H    2  
ATOM 1601  H HA   . VAL A 1 5  ? 142.483 -1.798  3.386   1.00 0.00 ? 4  VAL A HA   2  
ATOM 1602  H HB   . VAL A 1 5  ? 145.299 -2.854  3.077   1.00 0.00 ? 4  VAL A HB   2  
ATOM 1603  H HG11 . VAL A 1 5  ? 145.344 -1.433  5.339   1.00 0.00 ? 4  VAL A HG11 2  
ATOM 1604  H HG12 . VAL A 1 5  ? 144.081 -0.550  4.481   1.00 0.00 ? 4  VAL A HG12 2  
ATOM 1605  H HG13 . VAL A 1 5  ? 145.680 -0.725  3.759   1.00 0.00 ? 4  VAL A HG13 2  
ATOM 1606  H HG21 . VAL A 1 5  ? 143.307 -4.131  4.424   1.00 0.00 ? 4  VAL A HG21 2  
ATOM 1607  H HG22 . VAL A 1 5  ? 143.973 -3.094  5.686   1.00 0.00 ? 4  VAL A HG22 2  
ATOM 1608  H HG23 . VAL A 1 5  ? 145.020 -4.229  4.834   1.00 0.00 ? 4  VAL A HG23 2  
ATOM 1609  N N    . ARG A 1 6  ? 143.203 -0.010  1.819   1.00 0.00 ? 5  ARG A N    2  
ATOM 1610  C CA   . ARG A 1 6  ? 143.503 1.031   0.840   1.00 0.00 ? 5  ARG A CA   2  
ATOM 1611  C C    . ARG A 1 6  ? 144.831 1.716   1.160   1.00 0.00 ? 5  ARG A C    2  
ATOM 1612  O O    . ARG A 1 6  ? 144.943 2.444   2.148   1.00 0.00 ? 5  ARG A O    2  
ATOM 1613  C CB   . ARG A 1 6  ? 142.378 2.070   0.805   1.00 0.00 ? 5  ARG A CB   2  
ATOM 1614  C CG   . ARG A 1 6  ? 142.059 2.576   -0.592  1.00 0.00 ? 5  ARG A CG   2  
ATOM 1615  C CD   . ARG A 1 6  ? 141.497 3.990   -0.564  1.00 0.00 ? 5  ARG A CD   2  
ATOM 1616  N NE   . ARG A 1 6  ? 140.931 4.381   -1.857  1.00 0.00 ? 5  ARG A NE   2  
ATOM 1617  C CZ   . ARG A 1 6  ? 140.684 5.644   -2.217  1.00 0.00 ? 5  ARG A CZ   2  
ATOM 1618  N NH1  . ARG A 1 6  ? 140.947 6.648   -1.384  1.00 0.00 ? 5  ARG A NH1  2  
ATOM 1619  N NH2  . ARG A 1 6  ? 140.171 5.904   -3.415  1.00 0.00 ? 5  ARG A NH2  2  
ATOM 1620  H H    . ARG A 1 6  ? 142.648 0.213   2.596   1.00 0.00 ? 5  ARG A H    2  
ATOM 1621  H HA   . ARG A 1 6  ? 143.578 0.561   -0.131  1.00 0.00 ? 5  ARG A HA   2  
ATOM 1622  H HB2  . ARG A 1 6  ? 141.482 1.628   1.217   1.00 0.00 ? 5  ARG A HB2  2  
ATOM 1623  H HB3  . ARG A 1 6  ? 142.664 2.915   1.414   1.00 0.00 ? 5  ARG A HB3  2  
ATOM 1624  H HG2  . ARG A 1 6  ? 142.963 2.571   -1.182  1.00 0.00 ? 5  ARG A HG2  2  
ATOM 1625  H HG3  . ARG A 1 6  ? 141.330 1.918   -1.044  1.00 0.00 ? 5  ARG A HG3  2  
ATOM 1626  H HD2  . ARG A 1 6  ? 140.723 4.043   0.188   1.00 0.00 ? 5  ARG A HD2  2  
ATOM 1627  H HD3  . ARG A 1 6  ? 142.294 4.674   -0.309  1.00 0.00 ? 5  ARG A HD3  2  
ATOM 1628  H HE   . ARG A 1 6  ? 140.724 3.664   -2.492  1.00 0.00 ? 5  ARG A HE   2  
ATOM 1629  H HH11 . ARG A 1 6  ? 141.331 6.463   -0.480  1.00 0.00 ? 5  ARG A HH11 2  
ATOM 1630  H HH12 . ARG A 1 6  ? 140.760 7.590   -1.662  1.00 0.00 ? 5  ARG A HH12 2  
ATOM 1631  H HH21 . ARG A 1 6  ? 139.969 5.156   -4.047  1.00 0.00 ? 5  ARG A HH21 2  
ATOM 1632  H HH22 . ARG A 1 6  ? 139.987 6.850   -3.686  1.00 0.00 ? 5  ARG A HH22 2  
ATOM 1633  N N    . ILE A 1 7  ? 145.832 1.474   0.315   1.00 0.00 ? 6  ILE A N    2  
ATOM 1634  C CA   . ILE A 1 7  ? 147.157 2.063   0.497   1.00 0.00 ? 6  ILE A CA   2  
ATOM 1635  C C    . ILE A 1 7  ? 147.476 3.049   -0.627  1.00 0.00 ? 6  ILE A C    2  
ATOM 1636  O O    . ILE A 1 7  ? 147.341 2.721   -1.807  1.00 0.00 ? 6  ILE A O    2  
ATOM 1637  C CB   . ILE A 1 7  ? 148.259 0.978   0.539   1.00 0.00 ? 6  ILE A CB   2  
ATOM 1638  C CG1  . ILE A 1 7  ? 147.865 -0.166  1.481   1.00 0.00 ? 6  ILE A CG1  2  
ATOM 1639  C CG2  . ILE A 1 7  ? 149.587 1.586   0.970   1.00 0.00 ? 6  ILE A CG2  2  
ATOM 1640  C CD1  . ILE A 1 7  ? 148.736 -1.397  1.335   1.00 0.00 ? 6  ILE A CD1  2  
ATOM 1641  H H    . ILE A 1 7  ? 145.677 0.884   -0.454  1.00 0.00 ? 6  ILE A H    2  
ATOM 1642  H HA   . ILE A 1 7  ? 147.162 2.590   1.440   1.00 0.00 ? 6  ILE A HA   2  
ATOM 1643  H HB   . ILE A 1 7  ? 148.381 0.585   -0.459  1.00 0.00 ? 6  ILE A HB   2  
ATOM 1644  H HG12 . ILE A 1 7  ? 147.943 0.174   2.503   1.00 0.00 ? 6  ILE A HG12 2  
ATOM 1645  H HG13 . ILE A 1 7  ? 146.844 -0.457  1.279   1.00 0.00 ? 6  ILE A HG13 2  
ATOM 1646  H HG21 . ILE A 1 7  ? 149.429 2.242   1.813   1.00 0.00 ? 6  ILE A HG21 2  
ATOM 1647  H HG22 . ILE A 1 7  ? 150.009 2.148   0.151   1.00 0.00 ? 6  ILE A HG22 2  
ATOM 1648  H HG23 . ILE A 1 7  ? 150.269 0.797   1.252   1.00 0.00 ? 6  ILE A HG23 2  
ATOM 1649  H HD11 . ILE A 1 7  ? 148.120 -2.246  1.077   1.00 0.00 ? 6  ILE A HD11 2  
ATOM 1650  H HD12 . ILE A 1 7  ? 149.244 -1.592  2.269   1.00 0.00 ? 6  ILE A HD12 2  
ATOM 1651  H HD13 . ILE A 1 7  ? 149.467 -1.233  0.557   1.00 0.00 ? 6  ILE A HD13 2  
ATOM 1652  N N    . LYS A 1 8  ? 147.904 4.255   -0.255  1.00 0.00 ? 7  LYS A N    2  
ATOM 1653  C CA   . LYS A 1 8  ? 148.246 5.284   -1.233  1.00 0.00 ? 7  LYS A CA   2  
ATOM 1654  C C    . LYS A 1 8  ? 149.762 5.373   -1.421  1.00 0.00 ? 7  LYS A C    2  
ATOM 1655  O O    . LYS A 1 8  ? 150.504 5.586   -0.461  1.00 0.00 ? 7  LYS A O    2  
ATOM 1656  C CB   . LYS A 1 8  ? 147.685 6.640   -0.794  1.00 0.00 ? 7  LYS A CB   2  
ATOM 1657  C CG   . LYS A 1 8  ? 147.711 7.696   -1.888  1.00 0.00 ? 7  LYS A CG   2  
ATOM 1658  C CD   . LYS A 1 8  ? 147.507 9.092   -1.318  1.00 0.00 ? 7  LYS A CD   2  
ATOM 1659  C CE   . LYS A 1 8  ? 146.655 9.954   -2.238  1.00 0.00 ? 7  LYS A CE   2  
ATOM 1660  N NZ   . LYS A 1 8  ? 145.195 9.735   -2.019  1.00 0.00 ? 7  LYS A NZ   2  
ATOM 1661  H H    . LYS A 1 8  ? 147.995 4.457   0.700   1.00 0.00 ? 7  LYS A H    2  
ATOM 1662  H HA   . LYS A 1 8  ? 147.796 5.007   -2.176  1.00 0.00 ? 7  LYS A HA   2  
ATOM 1663  H HB2  . LYS A 1 8  ? 146.660 6.506   -0.480  1.00 0.00 ? 7  LYS A HB2  2  
ATOM 1664  H HB3  . LYS A 1 8  ? 148.263 7.003   0.041   1.00 0.00 ? 7  LYS A HB3  2  
ATOM 1665  H HG2  . LYS A 1 8  ? 148.668 7.659   -2.388  1.00 0.00 ? 7  LYS A HG2  2  
ATOM 1666  H HG3  . LYS A 1 8  ? 146.924 7.486   -2.597  1.00 0.00 ? 7  LYS A HG3  2  
ATOM 1667  H HD2  . LYS A 1 8  ? 147.017 9.010   -0.360  1.00 0.00 ? 7  LYS A HD2  2  
ATOM 1668  H HD3  . LYS A 1 8  ? 148.472 9.562   -1.191  1.00 0.00 ? 7  LYS A HD3  2  
ATOM 1669  H HE2  . LYS A 1 8  ? 146.884 10.992  -2.050  1.00 0.00 ? 7  LYS A HE2  2  
ATOM 1670  H HE3  . LYS A 1 8  ? 146.897 9.712   -3.262  1.00 0.00 ? 7  LYS A HE3  2  
ATOM 1671  H HZ1  . LYS A 1 8  ? 145.021 9.423   -1.042  1.00 0.00 ? 7  LYS A HZ1  2  
ATOM 1672  H HZ2  . LYS A 1 8  ? 144.841 9.007   -2.671  1.00 0.00 ? 7  LYS A HZ2  2  
ATOM 1673  H HZ3  . LYS A 1 8  ? 144.673 10.618  -2.188  1.00 0.00 ? 7  LYS A HZ3  2  
ATOM 1674  N N    . PHE A 1 9  ? 150.211 5.208   -2.665  1.00 0.00 ? 8  PHE A N    2  
ATOM 1675  C CA   . PHE A 1 9  ? 151.637 5.267   -2.989  1.00 0.00 ? 8  PHE A CA   2  
ATOM 1676  C C    . PHE A 1 9  ? 151.942 6.451   -3.906  1.00 0.00 ? 8  PHE A C    2  
ATOM 1677  O O    . PHE A 1 9  ? 151.243 6.673   -4.896  1.00 0.00 ? 8  PHE A O    2  
ATOM 1678  C CB   . PHE A 1 9  ? 152.085 3.966   -3.663  1.00 0.00 ? 8  PHE A CB   2  
ATOM 1679  C CG   . PHE A 1 9  ? 151.963 2.749   -2.788  1.00 0.00 ? 8  PHE A CG   2  
ATOM 1680  C CD1  . PHE A 1 9  ? 152.962 2.426   -1.881  1.00 0.00 ? 8  PHE A CD1  2  
ATOM 1681  C CD2  . PHE A 1 9  ? 150.854 1.922   -2.877  1.00 0.00 ? 8  PHE A CD2  2  
ATOM 1682  C CE1  . PHE A 1 9  ? 152.855 1.305   -1.081  1.00 0.00 ? 8  PHE A CE1  2  
ATOM 1683  C CE2  . PHE A 1 9  ? 150.743 0.799   -2.081  1.00 0.00 ? 8  PHE A CE2  2  
ATOM 1684  C CZ   . PHE A 1 9  ? 151.745 0.489   -1.182  1.00 0.00 ? 8  PHE A CZ   2  
ATOM 1685  H H    . PHE A 1 9  ? 149.567 5.043   -3.386  1.00 0.00 ? 8  PHE A H    2  
ATOM 1686  H HA   . PHE A 1 9  ? 152.183 5.391   -2.066  1.00 0.00 ? 8  PHE A HA   2  
ATOM 1687  H HB2  . PHE A 1 9  ? 151.483 3.801   -4.544  1.00 0.00 ? 8  PHE A HB2  2  
ATOM 1688  H HB3  . PHE A 1 9  ? 153.119 4.063   -3.956  1.00 0.00 ? 8  PHE A HB3  2  
ATOM 1689  H HD1  . PHE A 1 9  ? 153.830 3.063   -1.801  1.00 0.00 ? 8  PHE A HD1  2  
ATOM 1690  H HD2  . PHE A 1 9  ? 150.069 2.163   -3.579  1.00 0.00 ? 8  PHE A HD2  2  
ATOM 1691  H HE1  . PHE A 1 9  ? 153.640 1.065   -0.379  1.00 0.00 ? 8  PHE A HE1  2  
ATOM 1692  H HE2  . PHE A 1 9  ? 149.873 0.164   -2.161  1.00 0.00 ? 8  PHE A HE2  2  
ATOM 1693  H HZ   . PHE A 1 9  ? 151.660 -0.389  -0.559  1.00 0.00 ? 8  PHE A HZ   2  
ATOM 1694  N N    . GLU A 1 10 ? 152.992 7.205   -3.575  1.00 0.00 ? 9  GLU A N    2  
ATOM 1695  C CA   . GLU A 1 10 ? 153.387 8.364   -4.374  1.00 0.00 ? 9  GLU A CA   2  
ATOM 1696  C C    . GLU A 1 10 ? 154.896 8.381   -4.621  1.00 0.00 ? 9  GLU A C    2  
ATOM 1697  O O    . GLU A 1 10 ? 155.692 8.293   -3.684  1.00 0.00 ? 9  GLU A O    2  
ATOM 1698  C CB   . GLU A 1 10 ? 152.956 9.660   -3.680  1.00 0.00 ? 9  GLU A CB   2  
ATOM 1699  C CG   . GLU A 1 10 ? 153.188 10.911  -4.517  1.00 0.00 ? 9  GLU A CG   2  
ATOM 1700  C CD   . GLU A 1 10 ? 152.551 12.147  -3.911  1.00 0.00 ? 9  GLU A CD   2  
ATOM 1701  O OE1  . GLU A 1 10 ? 151.313 12.156  -3.739  1.00 0.00 ? 9  GLU A OE1  2  
ATOM 1702  O OE2  . GLU A 1 10 ? 153.290 13.108  -3.608  1.00 0.00 ? 9  GLU A OE2  2  
ATOM 1703  H H    . GLU A 1 10 ? 153.513 6.977   -2.776  1.00 0.00 ? 9  GLU A H    2  
ATOM 1704  H HA   . GLU A 1 10 ? 152.882 8.294   -5.326  1.00 0.00 ? 9  GLU A HA   2  
ATOM 1705  H HB2  . GLU A 1 10 ? 151.902 9.598   -3.452  1.00 0.00 ? 9  GLU A HB2  2  
ATOM 1706  H HB3  . GLU A 1 10 ? 153.507 9.763   -2.757  1.00 0.00 ? 9  GLU A HB3  2  
ATOM 1707  H HG2  . GLU A 1 10 ? 154.252 11.079  -4.600  1.00 0.00 ? 9  GLU A HG2  2  
ATOM 1708  H HG3  . GLU A 1 10 ? 152.772 10.754  -5.501  1.00 0.00 ? 9  GLU A HG3  2  
ATOM 1709  N N    . HIS A 1 11 ? 155.280 8.502   -5.892  1.00 0.00 ? 10 HIS A N    2  
ATOM 1710  C CA   . HIS A 1 11 ? 156.688 8.541   -6.278  1.00 0.00 ? 10 HIS A CA   2  
ATOM 1711  C C    . HIS A 1 11 ? 156.881 9.411   -7.519  1.00 0.00 ? 10 HIS A C    2  
ATOM 1712  O O    . HIS A 1 11 ? 156.159 9.261   -8.507  1.00 0.00 ? 10 HIS A O    2  
ATOM 1713  C CB   . HIS A 1 11 ? 157.212 7.125   -6.542  1.00 0.00 ? 10 HIS A CB   2  
ATOM 1714  C CG   . HIS A 1 11 ? 158.704 7.047   -6.685  1.00 0.00 ? 10 HIS A CG   2  
ATOM 1715  N ND1  . HIS A 1 11 ? 159.348 5.982   -7.279  1.00 0.00 ? 10 HIS A ND1  2  
ATOM 1716  C CD2  . HIS A 1 11 ? 159.680 7.909   -6.310  1.00 0.00 ? 10 HIS A CD2  2  
ATOM 1717  C CE1  . HIS A 1 11 ? 160.652 6.192   -7.263  1.00 0.00 ? 10 HIS A CE1  2  
ATOM 1718  N NE2  . HIS A 1 11 ? 160.880 7.354   -6.681  1.00 0.00 ? 10 HIS A NE2  2  
ATOM 1719  H H    . HIS A 1 11 ? 154.595 8.572   -6.592  1.00 0.00 ? 10 HIS A H    2  
ATOM 1720  H HA   . HIS A 1 11 ? 157.243 8.975   -5.458  1.00 0.00 ? 10 HIS A HA   2  
ATOM 1721  H HB2  . HIS A 1 11 ? 156.925 6.485   -5.721  1.00 0.00 ? 10 HIS A HB2  2  
ATOM 1722  H HB3  . HIS A 1 11 ? 156.770 6.751   -7.454  1.00 0.00 ? 10 HIS A HB3  2  
ATOM 1723  H HD1  . HIS A 1 11 ? 158.914 5.190   -7.657  1.00 0.00 ? 10 HIS A HD1  2  
ATOM 1724  H HD2  . HIS A 1 11 ? 159.540 8.856   -5.808  1.00 0.00 ? 10 HIS A HD2  2  
ATOM 1725  H HE1  . HIS A 1 11 ? 161.403 5.524   -7.657  1.00 0.00 ? 10 HIS A HE1  2  
ATOM 1726  H HE2  . HIS A 1 11 ? 161.747 7.812   -6.660  1.00 0.00 ? 10 HIS A HE2  2  
ATOM 1727  N N    . ASN A 1 12 ? 157.855 10.323  -7.455  1.00 0.00 ? 11 ASN A N    2  
ATOM 1728  C CA   . ASN A 1 12 ? 158.150 11.231  -8.567  1.00 0.00 ? 11 ASN A CA   2  
ATOM 1729  C C    . ASN A 1 12 ? 156.940 12.110  -8.903  1.00 0.00 ? 11 ASN A C    2  
ATOM 1730  O O    . ASN A 1 12 ? 156.755 12.516  -10.053 1.00 0.00 ? 11 ASN A O    2  
ATOM 1731  C CB   . ASN A 1 12 ? 158.588 10.440  -9.808  1.00 0.00 ? 11 ASN A CB   2  
ATOM 1732  C CG   . ASN A 1 12 ? 160.085 10.186  -9.841  1.00 0.00 ? 11 ASN A CG   2  
ATOM 1733  O OD1  . ASN A 1 12 ? 160.879 11.025  -9.415  1.00 0.00 ? 11 ASN A OD1  2  
ATOM 1734  N ND2  . ASN A 1 12 ? 160.479 9.024   -10.351 1.00 0.00 ? 11 ASN A ND2  2  
ATOM 1735  H H    . ASN A 1 12 ? 158.388 10.391  -6.637  1.00 0.00 ? 11 ASN A H    2  
ATOM 1736  H HA   . ASN A 1 12 ? 158.964 11.871  -8.259  1.00 0.00 ? 11 ASN A HA   2  
ATOM 1737  H HB2  . ASN A 1 12 ? 158.082 9.487   -9.817  1.00 0.00 ? 11 ASN A HB2  2  
ATOM 1738  H HB3  . ASN A 1 12 ? 158.316 10.993  -10.695 1.00 0.00 ? 11 ASN A HB3  2  
ATOM 1739  H HD21 . ASN A 1 12 ? 159.793 8.402   -10.673 1.00 0.00 ? 11 ASN A HD21 2  
ATOM 1740  H HD22 . ASN A 1 12 ? 161.440 8.837   -10.386 1.00 0.00 ? 11 ASN A HD22 2  
ATOM 1741  N N    . GLY A 1 13 ? 156.116 12.398  -7.892  1.00 0.00 ? 12 GLY A N    2  
ATOM 1742  C CA   . GLY A 1 13 ? 154.936 13.220  -8.103  1.00 0.00 ? 12 GLY A CA   2  
ATOM 1743  C C    . GLY A 1 13 ? 153.713 12.419  -8.538  1.00 0.00 ? 12 GLY A C    2  
ATOM 1744  O O    . GLY A 1 13 ? 152.593 12.931  -8.507  1.00 0.00 ? 12 GLY A O    2  
ATOM 1745  H H    . GLY A 1 13 ? 156.310 12.049  -6.998  1.00 0.00 ? 12 GLY A H    2  
ATOM 1746  H HA2  . GLY A 1 13 ? 154.703 13.735  -7.181  1.00 0.00 ? 12 GLY A HA2  2  
ATOM 1747  H HA3  . GLY A 1 13 ? 155.155 13.955  -8.862  1.00 0.00 ? 12 GLY A HA3  2  
ATOM 1748  N N    . GLU A 1 14 ? 153.922 11.162  -8.944  1.00 0.00 ? 13 GLU A N    2  
ATOM 1749  C CA   . GLU A 1 14 ? 152.823 10.305  -9.385  1.00 0.00 ? 13 GLU A CA   2  
ATOM 1750  C C    . GLU A 1 14 ? 152.127 9.651   -8.191  1.00 0.00 ? 13 GLU A C    2  
ATOM 1751  O O    . GLU A 1 14 ? 152.679 8.750   -7.555  1.00 0.00 ? 13 GLU A O    2  
ATOM 1752  C CB   . GLU A 1 14 ? 153.342 9.229   -10.344 1.00 0.00 ? 13 GLU A CB   2  
ATOM 1753  C CG   . GLU A 1 14 ? 152.430 8.978   -11.537 1.00 0.00 ? 13 GLU A CG   2  
ATOM 1754  C CD   . GLU A 1 14 ? 153.091 8.134   -12.612 1.00 0.00 ? 13 GLU A CD   2  
ATOM 1755  O OE1  . GLU A 1 14 ? 154.194 8.505   -13.068 1.00 0.00 ? 13 GLU A OE1  2  
ATOM 1756  O OE2  . GLU A 1 14 ? 152.506 7.100   -12.997 1.00 0.00 ? 13 GLU A OE2  2  
ATOM 1757  H H    . GLU A 1 14 ? 154.833 10.803  -8.948  1.00 0.00 ? 13 GLU A H    2  
ATOM 1758  H HA   . GLU A 1 14 ? 152.110 10.926  -9.905  1.00 0.00 ? 13 GLU A HA   2  
ATOM 1759  H HB2  . GLU A 1 14 ? 154.309 9.533   -10.716 1.00 0.00 ? 13 GLU A HB2  2  
ATOM 1760  H HB3  . GLU A 1 14 ? 153.451 8.302   -9.801  1.00 0.00 ? 13 GLU A HB3  2  
ATOM 1761  H HG2  . GLU A 1 14 ? 151.545 8.464   -11.194 1.00 0.00 ? 13 GLU A HG2  2  
ATOM 1762  H HG3  . GLU A 1 14 ? 152.149 9.928   -11.966 1.00 0.00 ? 13 GLU A HG3  2  
ATOM 1763  N N    . ARG A 1 15 ? 150.912 10.117  -7.894  1.00 0.00 ? 14 ARG A N    2  
ATOM 1764  C CA   . ARG A 1 15 ? 150.133 9.584   -6.777  1.00 0.00 ? 14 ARG A CA   2  
ATOM 1765  C C    . ARG A 1 15 ? 149.127 8.538   -7.257  1.00 0.00 ? 14 ARG A C    2  
ATOM 1766  O O    . ARG A 1 15 ? 148.451 8.730   -8.270  1.00 0.00 ? 14 ARG A O    2  
ATOM 1767  C CB   . ARG A 1 15 ? 149.403 10.716  -6.040  1.00 0.00 ? 14 ARG A CB   2  
ATOM 1768  C CG   . ARG A 1 15 ? 148.503 11.560  -6.932  1.00 0.00 ? 14 ARG A CG   2  
ATOM 1769  C CD   . ARG A 1 15 ? 147.289 12.076  -6.174  1.00 0.00 ? 14 ARG A CD   2  
ATOM 1770  N NE   . ARG A 1 15 ? 146.588 13.127  -6.911  1.00 0.00 ? 14 ARG A NE   2  
ATOM 1771  C CZ   . ARG A 1 15 ? 145.336 13.515  -6.656  1.00 0.00 ? 14 ARG A CZ   2  
ATOM 1772  N NH1  . ARG A 1 15 ? 144.638 12.948  -5.674  1.00 0.00 ? 14 ARG A NH1  2  
ATOM 1773  N NH2  . ARG A 1 15 ? 144.779 14.476  -7.384  1.00 0.00 ? 14 ARG A NH2  2  
ATOM 1774  H H    . ARG A 1 15 ? 150.532 10.836  -8.439  1.00 0.00 ? 14 ARG A H    2  
ATOM 1775  H HA   . ARG A 1 15 ? 150.822 9.111   -6.093  1.00 0.00 ? 14 ARG A HA   2  
ATOM 1776  H HB2  . ARG A 1 15 ? 148.795 10.286  -5.259  1.00 0.00 ? 14 ARG A HB2  2  
ATOM 1777  H HB3  . ARG A 1 15 ? 150.139 11.367  -5.592  1.00 0.00 ? 14 ARG A HB3  2  
ATOM 1778  H HG2  . ARG A 1 15 ? 149.068 12.402  -7.302  1.00 0.00 ? 14 ARG A HG2  2  
ATOM 1779  H HG3  . ARG A 1 15 ? 148.168 10.957  -7.763  1.00 0.00 ? 14 ARG A HG3  2  
ATOM 1780  H HD2  . ARG A 1 15 ? 146.611 11.253  -6.006  1.00 0.00 ? 14 ARG A HD2  2  
ATOM 1781  H HD3  . ARG A 1 15 ? 147.616 12.472  -5.223  1.00 0.00 ? 14 ARG A HD3  2  
ATOM 1782  H HE   . ARG A 1 15 ? 147.076 13.568  -7.638  1.00 0.00 ? 14 ARG A HE   2  
ATOM 1783  H HH11 . ARG A 1 15 ? 145.048 12.226  -5.118  1.00 0.00 ? 14 ARG A HH11 2  
ATOM 1784  H HH12 . ARG A 1 15 ? 143.700 13.245  -5.491  1.00 0.00 ? 14 ARG A HH12 2  
ATOM 1785  H HH21 . ARG A 1 15 ? 145.297 14.909  -8.123  1.00 0.00 ? 14 ARG A HH21 2  
ATOM 1786  H HH22 . ARG A 1 15 ? 143.840 14.768  -7.197  1.00 0.00 ? 14 ARG A HH22 2  
ATOM 1787  N N    . ARG A 1 16 ? 149.035 7.429   -6.521  1.00 0.00 ? 15 ARG A N    2  
ATOM 1788  C CA   . ARG A 1 16 ? 148.113 6.348   -6.868  1.00 0.00 ? 15 ARG A CA   2  
ATOM 1789  C C    . ARG A 1 16 ? 147.633 5.605   -5.620  1.00 0.00 ? 15 ARG A C    2  
ATOM 1790  O O    . ARG A 1 16 ? 148.310 5.599   -4.590  1.00 0.00 ? 15 ARG A O    2  
ATOM 1791  C CB   . ARG A 1 16 ? 148.785 5.368   -7.837  1.00 0.00 ? 15 ARG A CB   2  
ATOM 1792  C CG   . ARG A 1 16 ? 149.985 4.642   -7.246  1.00 0.00 ? 15 ARG A CG   2  
ATOM 1793  C CD   . ARG A 1 16 ? 151.160 4.627   -8.211  1.00 0.00 ? 15 ARG A CD   2  
ATOM 1794  N NE   . ARG A 1 16 ? 151.995 3.437   -8.045  1.00 0.00 ? 15 ARG A NE   2  
ATOM 1795  C CZ   . ARG A 1 16 ? 153.227 3.314   -8.547  1.00 0.00 ? 15 ARG A CZ   2  
ATOM 1796  N NH1  . ARG A 1 16 ? 153.771 4.302   -9.251  1.00 0.00 ? 15 ARG A NH1  2  
ATOM 1797  N NH2  . ARG A 1 16 ? 153.916 2.196   -8.343  1.00 0.00 ? 15 ARG A NH2  2  
ATOM 1798  H H    . ARG A 1 16 ? 149.601 7.335   -5.726  1.00 0.00 ? 15 ARG A H    2  
ATOM 1799  H HA   . ARG A 1 16 ? 147.257 6.790   -7.357  1.00 0.00 ? 15 ARG A HA   2  
ATOM 1800  H HB2  . ARG A 1 16 ? 148.059 4.628   -8.141  1.00 0.00 ? 15 ARG A HB2  2  
ATOM 1801  H HB3  . ARG A 1 16 ? 149.115 5.915   -8.708  1.00 0.00 ? 15 ARG A HB3  2  
ATOM 1802  H HG2  . ARG A 1 16 ? 150.286 5.143   -6.338  1.00 0.00 ? 15 ARG A HG2  2  
ATOM 1803  H HG3  . ARG A 1 16 ? 149.701 3.624   -7.021  1.00 0.00 ? 15 ARG A HG3  2  
ATOM 1804  H HD2  . ARG A 1 16 ? 150.779 4.649   -9.222  1.00 0.00 ? 15 ARG A HD2  2  
ATOM 1805  H HD3  . ARG A 1 16 ? 151.763 5.507   -8.036  1.00 0.00 ? 15 ARG A HD3  2  
ATOM 1806  H HE   . ARG A 1 16 ? 151.620 2.690   -7.533  1.00 0.00 ? 15 ARG A HE   2  
ATOM 1807  H HH11 . ARG A 1 16 ? 153.261 5.148   -9.410  1.00 0.00 ? 15 ARG A HH11 2  
ATOM 1808  H HH12 . ARG A 1 16 ? 154.694 4.201   -9.624  1.00 0.00 ? 15 ARG A HH12 2  
ATOM 1809  H HH21 . ARG A 1 16 ? 153.513 1.448   -7.816  1.00 0.00 ? 15 ARG A HH21 2  
ATOM 1810  H HH22 . ARG A 1 16 ? 154.840 2.102   -8.716  1.00 0.00 ? 15 ARG A HH22 2  
ATOM 1811  N N    . ILE A 1 17 ? 146.461 4.974   -5.721  1.00 0.00 ? 16 ILE A N    2  
ATOM 1812  C CA   . ILE A 1 17 ? 145.890 4.224   -4.604  1.00 0.00 ? 16 ILE A CA   2  
ATOM 1813  C C    . ILE A 1 17 ? 145.745 2.743   -4.960  1.00 0.00 ? 16 ILE A C    2  
ATOM 1814  O O    . ILE A 1 17 ? 145.047 2.391   -5.914  1.00 0.00 ? 16 ILE A O    2  
ATOM 1815  C CB   . ILE A 1 17 ? 144.512 4.784   -4.185  1.00 0.00 ? 16 ILE A CB   2  
ATOM 1816  C CG1  . ILE A 1 17 ? 144.585 6.300   -3.974  1.00 0.00 ? 16 ILE A CG1  2  
ATOM 1817  C CG2  . ILE A 1 17 ? 144.019 4.094   -2.919  1.00 0.00 ? 16 ILE A CG2  2  
ATOM 1818  C CD1  . ILE A 1 17 ? 143.393 7.047   -4.534  1.00 0.00 ? 16 ILE A CD1  2  
ATOM 1819  H H    . ILE A 1 17 ? 145.969 5.013   -6.569  1.00 0.00 ? 16 ILE A H    2  
ATOM 1820  H HA   . ILE A 1 17 ? 146.563 4.316   -3.763  1.00 0.00 ? 16 ILE A HA   2  
ATOM 1821  H HB   . ILE A 1 17 ? 143.808 4.571   -4.976  1.00 0.00 ? 16 ILE A HB   2  
ATOM 1822  H HG12 . ILE A 1 17 ? 144.637 6.508   -2.916  1.00 0.00 ? 16 ILE A HG12 2  
ATOM 1823  H HG13 . ILE A 1 17 ? 145.472 6.684   -4.455  1.00 0.00 ? 16 ILE A HG13 2  
ATOM 1824  H HG21 . ILE A 1 17 ? 144.866 3.741   -2.348  1.00 0.00 ? 16 ILE A HG21 2  
ATOM 1825  H HG22 . ILE A 1 17 ? 143.392 3.256   -3.187  1.00 0.00 ? 16 ILE A HG22 2  
ATOM 1826  H HG23 . ILE A 1 17 ? 143.450 4.793   -2.326  1.00 0.00 ? 16 ILE A HG23 2  
ATOM 1827  H HD11 . ILE A 1 17 ? 143.165 7.890   -3.900  1.00 0.00 ? 16 ILE A HD11 2  
ATOM 1828  H HD12 . ILE A 1 17 ? 142.540 6.386   -4.575  1.00 0.00 ? 16 ILE A HD12 2  
ATOM 1829  H HD13 . ILE A 1 17 ? 143.623 7.397   -5.530  1.00 0.00 ? 16 ILE A HD13 2  
ATOM 1830  N N    . ILE A 1 18 ? 146.412 1.884   -4.188  1.00 0.00 ? 17 ILE A N    2  
ATOM 1831  C CA   . ILE A 1 18 ? 146.368 0.440   -4.416  1.00 0.00 ? 17 ILE A CA   2  
ATOM 1832  C C    . ILE A 1 18 ? 145.747 -0.291  -3.224  1.00 0.00 ? 17 ILE A C    2  
ATOM 1833  O O    . ILE A 1 18 ? 146.118 -0.047  -2.074  1.00 0.00 ? 17 ILE A O    2  
ATOM 1834  C CB   . ILE A 1 18 ? 147.782 -0.132  -4.672  1.00 0.00 ? 17 ILE A CB   2  
ATOM 1835  C CG1  . ILE A 1 18 ? 148.524 0.708   -5.717  1.00 0.00 ? 17 ILE A CG1  2  
ATOM 1836  C CG2  . ILE A 1 18 ? 147.700 -1.586  -5.121  1.00 0.00 ? 17 ILE A CG2  2  
ATOM 1837  C CD1  . ILE A 1 18 ? 150.014 0.448   -5.755  1.00 0.00 ? 17 ILE A CD1  2  
ATOM 1838  H H    . ILE A 1 18 ? 146.952 2.230   -3.446  1.00 0.00 ? 17 ILE A H    2  
ATOM 1839  H HA   . ILE A 1 18 ? 145.764 0.257   -5.293  1.00 0.00 ? 17 ILE A HA   2  
ATOM 1840  H HB   . ILE A 1 18 ? 148.329 -0.100  -3.742  1.00 0.00 ? 17 ILE A HB   2  
ATOM 1841  H HG12 . ILE A 1 18 ? 148.125 0.488   -6.695  1.00 0.00 ? 17 ILE A HG12 2  
ATOM 1842  H HG13 . ILE A 1 18 ? 148.375 1.756   -5.500  1.00 0.00 ? 17 ILE A HG13 2  
ATOM 1843  H HG21 . ILE A 1 18 ? 148.698 -1.982  -5.237  1.00 0.00 ? 17 ILE A HG21 2  
ATOM 1844  H HG22 . ILE A 1 18 ? 147.178 -1.643  -6.065  1.00 0.00 ? 17 ILE A HG22 2  
ATOM 1845  H HG23 . ILE A 1 18 ? 147.167 -2.163  -4.379  1.00 0.00 ? 17 ILE A HG23 2  
ATOM 1846  H HD11 . ILE A 1 18 ? 150.538 1.379   -5.920  1.00 0.00 ? 17 ILE A HD11 2  
ATOM 1847  H HD12 . ILE A 1 18 ? 150.239 -0.239  -6.557  1.00 0.00 ? 17 ILE A HD12 2  
ATOM 1848  H HD13 . ILE A 1 18 ? 150.329 0.020   -4.815  1.00 0.00 ? 17 ILE A HD13 2  
ATOM 1849  N N    . ALA A 1 19 ? 144.805 -1.192  -3.507  1.00 0.00 ? 18 ALA A N    2  
ATOM 1850  C CA   . ALA A 1 19 ? 144.139 -1.963  -2.460  1.00 0.00 ? 18 ALA A CA   2  
ATOM 1851  C C    . ALA A 1 19 ? 144.742 -3.361  -2.339  1.00 0.00 ? 18 ALA A C    2  
ATOM 1852  O O    . ALA A 1 19 ? 145.011 -4.019  -3.347  1.00 0.00 ? 18 ALA A O    2  
ATOM 1853  C CB   . ALA A 1 19 ? 142.644 -2.053  -2.735  1.00 0.00 ? 18 ALA A CB   2  
ATOM 1854  H H    . ALA A 1 19 ? 144.556 -1.345  -4.443  1.00 0.00 ? 18 ALA A H    2  
ATOM 1855  H HA   . ALA A 1 19 ? 144.277 -1.441  -1.524  1.00 0.00 ? 18 ALA A HA   2  
ATOM 1856  H HB1  . ALA A 1 19 ? 142.338 -1.217  -3.347  1.00 0.00 ? 18 ALA A HB1  2  
ATOM 1857  H HB2  . ALA A 1 19 ? 142.105 -2.032  -1.800  1.00 0.00 ? 18 ALA A HB2  2  
ATOM 1858  H HB3  . ALA A 1 19 ? 142.428 -2.977  -3.253  1.00 0.00 ? 18 ALA A HB3  2  
ATOM 1859  N N    . PHE A 1 20 ? 144.950 -3.809  -1.101  1.00 0.00 ? 19 PHE A N    2  
ATOM 1860  C CA   . PHE A 1 20 ? 145.522 -5.130  -0.845  1.00 0.00 ? 19 PHE A CA   2  
ATOM 1861  C C    . PHE A 1 20 ? 144.664 -5.917  0.144   1.00 0.00 ? 19 PHE A C    2  
ATOM 1862  O O    . PHE A 1 20 ? 144.375 -5.441  1.244   1.00 0.00 ? 19 PHE A O    2  
ATOM 1863  C CB   . PHE A 1 20 ? 146.949 -4.994  -0.305  1.00 0.00 ? 19 PHE A CB   2  
ATOM 1864  C CG   . PHE A 1 20 ? 147.971 -4.691  -1.367  1.00 0.00 ? 19 PHE A CG   2  
ATOM 1865  C CD1  . PHE A 1 20 ? 148.548 -5.715  -2.103  1.00 0.00 ? 19 PHE A CD1  2  
ATOM 1866  C CD2  . PHE A 1 20 ? 148.356 -3.385  -1.626  1.00 0.00 ? 19 PHE A CD2  2  
ATOM 1867  C CE1  . PHE A 1 20 ? 149.487 -5.441  -3.078  1.00 0.00 ? 19 PHE A CE1  2  
ATOM 1868  C CE2  . PHE A 1 20 ? 149.295 -3.106  -2.601  1.00 0.00 ? 19 PHE A CE2  2  
ATOM 1869  C CZ   . PHE A 1 20 ? 149.862 -4.135  -3.327  1.00 0.00 ? 19 PHE A CZ   2  
ATOM 1870  H H    . PHE A 1 20 ? 144.714 -3.237  -0.340  1.00 0.00 ? 19 PHE A H    2  
ATOM 1871  H HA   . PHE A 1 20 ? 145.551 -5.665  -1.782  1.00 0.00 ? 19 PHE A HA   2  
ATOM 1872  H HB2  . PHE A 1 20 ? 146.977 -4.196  0.421   1.00 0.00 ? 19 PHE A HB2  2  
ATOM 1873  H HB3  . PHE A 1 20 ? 147.231 -5.920  0.176   1.00 0.00 ? 19 PHE A HB3  2  
ATOM 1874  H HD1  . PHE A 1 20 ? 148.255 -6.736  -1.910  1.00 0.00 ? 19 PHE A HD1  2  
ATOM 1875  H HD2  . PHE A 1 20 ? 147.913 -2.580  -1.059  1.00 0.00 ? 19 PHE A HD2  2  
ATOM 1876  H HE1  . PHE A 1 20 ? 149.929 -6.248  -3.645  1.00 0.00 ? 19 PHE A HE1  2  
ATOM 1877  H HE2  . PHE A 1 20 ? 149.586 -2.084  -2.793  1.00 0.00 ? 19 PHE A HE2  2  
ATOM 1878  H HZ   . PHE A 1 20 ? 150.596 -3.919  -4.088  1.00 0.00 ? 19 PHE A HZ   2  
ATOM 1879  N N    . SER A 1 21 ? 144.264 -7.126  -0.253  1.00 0.00 ? 20 SER A N    2  
ATOM 1880  C CA   . SER A 1 21 ? 143.439 -7.984  0.598   1.00 0.00 ? 20 SER A CA   2  
ATOM 1881  C C    . SER A 1 21 ? 144.219 -8.460  1.824   1.00 0.00 ? 20 SER A C    2  
ATOM 1882  O O    . SER A 1 21 ? 145.399 -8.801  1.728   1.00 0.00 ? 20 SER A O    2  
ATOM 1883  C CB   . SER A 1 21 ? 142.925 -9.188  -0.197  1.00 0.00 ? 20 SER A CB   2  
ATOM 1884  O OG   . SER A 1 21 ? 143.998 -9.955  -0.717  1.00 0.00 ? 20 SER A OG   2  
ATOM 1885  H H    . SER A 1 21 ? 144.530 -7.449  -1.139  1.00 0.00 ? 20 SER A H    2  
ATOM 1886  H HA   . SER A 1 21 ? 142.596 -7.399  0.932   1.00 0.00 ? 20 SER A HA   2  
ATOM 1887  H HB2  . SER A 1 21 ? 142.330 -9.816  0.449   1.00 0.00 ? 20 SER A HB2  2  
ATOM 1888  H HB3  . SER A 1 21 ? 142.317 -8.839  -1.019  1.00 0.00 ? 20 SER A HB3  2  
ATOM 1889  H HG   . SER A 1 21 ? 143.744 -10.333 -1.562  1.00 0.00 ? 20 SER A HG   2  
ATOM 1890  N N    . ARG A 1 22 ? 143.551 -8.480  2.978   1.00 0.00 ? 21 ARG A N    2  
ATOM 1891  C CA   . ARG A 1 22 ? 144.183 -8.914  4.222   1.00 0.00 ? 21 ARG A CA   2  
ATOM 1892  C C    . ARG A 1 22 ? 144.036 -10.423 4.418   1.00 0.00 ? 21 ARG A C    2  
ATOM 1893  O O    . ARG A 1 22 ? 143.056 -11.022 3.968   1.00 0.00 ? 21 ARG A O    2  
ATOM 1894  C CB   . ARG A 1 22 ? 143.579 -8.171  5.416   1.00 0.00 ? 21 ARG A CB   2  
ATOM 1895  C CG   . ARG A 1 22 ? 144.054 -6.733  5.540   1.00 0.00 ? 21 ARG A CG   2  
ATOM 1896  C CD   . ARG A 1 22 ? 144.100 -6.283  6.992   1.00 0.00 ? 21 ARG A CD   2  
ATOM 1897  N NE   . ARG A 1 22 ? 142.924 -5.495  7.362   1.00 0.00 ? 21 ARG A NE   2  
ATOM 1898  C CZ   . ARG A 1 22 ? 142.620 -5.153  8.617   1.00 0.00 ? 21 ARG A CZ   2  
ATOM 1899  N NH1  . ARG A 1 22 ? 143.407 -5.517  9.627   1.00 0.00 ? 21 ARG A NH1  2  
ATOM 1900  N NH2  . ARG A 1 22 ? 141.526 -4.441  8.864   1.00 0.00 ? 21 ARG A NH2  2  
ATOM 1901  H H    . ARG A 1 22 ? 142.613 -8.197  2.991   1.00 0.00 ? 21 ARG A H    2  
ATOM 1902  H HA   . ARG A 1 22 ? 145.232 -8.674  4.155   1.00 0.00 ? 21 ARG A HA   2  
ATOM 1903  H HB2  . ARG A 1 22 ? 142.503 -8.166  5.316   1.00 0.00 ? 21 ARG A HB2  2  
ATOM 1904  H HB3  . ARG A 1 22 ? 143.844 -8.695  6.322   1.00 0.00 ? 21 ARG A HB3  2  
ATOM 1905  H HG2  . ARG A 1 22 ? 145.045 -6.653  5.118   1.00 0.00 ? 21 ARG A HG2  2  
ATOM 1906  H HG3  . ARG A 1 22 ? 143.377 -6.093  4.995   1.00 0.00 ? 21 ARG A HG3  2  
ATOM 1907  H HD2  . ARG A 1 22 ? 144.148 -7.157  7.625   1.00 0.00 ? 21 ARG A HD2  2  
ATOM 1908  H HD3  . ARG A 1 22 ? 144.986 -5.683  7.142   1.00 0.00 ? 21 ARG A HD3  2  
ATOM 1909  H HE   . ARG A 1 22 ? 142.327 -5.208  6.640   1.00 0.00 ? 21 ARG A HE   2  
ATOM 1910  H HH11 . ARG A 1 22 ? 144.234 -6.051  9.452   1.00 0.00 ? 21 ARG A HH11 2  
ATOM 1911  H HH12 . ARG A 1 22 ? 143.172 -5.254  10.563  1.00 0.00 ? 21 ARG A HH12 2  
ATOM 1912  H HH21 . ARG A 1 22 ? 140.930 -4.162  8.111   1.00 0.00 ? 21 ARG A HH21 2  
ATOM 1913  H HH22 . ARG A 1 22 ? 141.298 -4.184  9.803   1.00 0.00 ? 21 ARG A HH22 2  
ATOM 1914  N N    . PRO A 1 23 ? 145.014 -11.063 5.095   1.00 0.00 ? 22 PRO A N    2  
ATOM 1915  C CA   . PRO A 1 23 ? 146.197 -10.389 5.647   1.00 0.00 ? 22 PRO A CA   2  
ATOM 1916  C C    . PRO A 1 23 ? 147.209 -10.009 4.569   1.00 0.00 ? 22 PRO A C    2  
ATOM 1917  O O    . PRO A 1 23 ? 147.698 -10.868 3.833   1.00 0.00 ? 22 PRO A O    2  
ATOM 1918  C CB   . PRO A 1 23 ? 146.808 -11.432 6.600   1.00 0.00 ? 22 PRO A CB   2  
ATOM 1919  C CG   . PRO A 1 23 ? 145.831 -12.564 6.653   1.00 0.00 ? 22 PRO A CG   2  
ATOM 1920  C CD   . PRO A 1 23 ? 145.041 -12.500 5.379   1.00 0.00 ? 22 PRO A CD   2  
ATOM 1921  H HA   . PRO A 1 23 ? 145.922 -9.507  6.207   1.00 0.00 ? 22 PRO A HA   2  
ATOM 1922  H HB2  . PRO A 1 23 ? 147.763 -11.757 6.214   1.00 0.00 ? 22 PRO A HB2  2  
ATOM 1923  H HB3  . PRO A 1 23 ? 146.946 -10.988 7.576   1.00 0.00 ? 22 PRO A HB3  2  
ATOM 1924  H HG2  . PRO A 1 23 ? 146.362 -13.502 6.717   1.00 0.00 ? 22 PRO A HG2  2  
ATOM 1925  H HG3  . PRO A 1 23 ? 145.178 -12.444 7.504   1.00 0.00 ? 22 PRO A HG3  2  
ATOM 1926  H HD2  . PRO A 1 23 ? 145.543 -13.043 4.591   1.00 0.00 ? 22 PRO A HD2  2  
ATOM 1927  H HD3  . PRO A 1 23 ? 144.043 -12.883 5.530   1.00 0.00 ? 22 PRO A HD3  2  
ATOM 1928  N N    . VAL A 1 24 ? 147.523 -8.716  4.489   1.00 0.00 ? 23 VAL A N    2  
ATOM 1929  C CA   . VAL A 1 24 ? 148.481 -8.217  3.507   1.00 0.00 ? 23 VAL A CA   2  
ATOM 1930  C C    . VAL A 1 24 ? 149.900 -8.662  3.860   1.00 0.00 ? 23 VAL A C    2  
ATOM 1931  O O    . VAL A 1 24 ? 150.377 -8.426  4.970   1.00 0.00 ? 23 VAL A O    2  
ATOM 1932  C CB   . VAL A 1 24 ? 148.432 -6.674  3.401   1.00 0.00 ? 23 VAL A CB   2  
ATOM 1933  C CG1  . VAL A 1 24 ? 148.815 -6.023  4.724   1.00 0.00 ? 23 VAL A CG1  2  
ATOM 1934  C CG2  . VAL A 1 24 ? 149.332 -6.180  2.276   1.00 0.00 ? 23 VAL A CG2  2  
ATOM 1935  H H    . VAL A 1 24 ? 147.103 -8.084  5.109   1.00 0.00 ? 23 VAL A H    2  
ATOM 1936  H HA   . VAL A 1 24 ? 148.215 -8.631  2.545   1.00 0.00 ? 23 VAL A HA   2  
ATOM 1937  H HB   . VAL A 1 24 ? 147.417 -6.385  3.169   1.00 0.00 ? 23 VAL A HB   2  
ATOM 1938  H HG11 . VAL A 1 24 ? 148.616 -6.709  5.534   1.00 0.00 ? 23 VAL A HG11 2  
ATOM 1939  H HG12 . VAL A 1 24 ? 148.236 -5.122  4.864   1.00 0.00 ? 23 VAL A HG12 2  
ATOM 1940  H HG13 . VAL A 1 24 ? 149.867 -5.776  4.712   1.00 0.00 ? 23 VAL A HG13 2  
ATOM 1941  H HG21 . VAL A 1 24 ? 149.813 -5.261  2.577   1.00 0.00 ? 23 VAL A HG21 2  
ATOM 1942  H HG22 . VAL A 1 24 ? 148.740 -6.003  1.392   1.00 0.00 ? 23 VAL A HG22 2  
ATOM 1943  H HG23 . VAL A 1 24 ? 150.084 -6.925  2.062   1.00 0.00 ? 23 VAL A HG23 2  
ATOM 1944  N N    . LYS A 1 25 ? 150.566 -9.312  2.910   1.00 0.00 ? 24 LYS A N    2  
ATOM 1945  C CA   . LYS A 1 25 ? 151.927 -9.792  3.122   1.00 0.00 ? 24 LYS A CA   2  
ATOM 1946  C C    . LYS A 1 25 ? 152.945 -8.795  2.581   1.00 0.00 ? 24 LYS A C    2  
ATOM 1947  O O    . LYS A 1 25 ? 152.838 -8.347  1.438   1.00 0.00 ? 24 LYS A O    2  
ATOM 1948  C CB   . LYS A 1 25 ? 152.123 -11.152 2.445   1.00 0.00 ? 24 LYS A CB   2  
ATOM 1949  C CG   . LYS A 1 25 ? 152.062 -12.329 3.405   1.00 0.00 ? 24 LYS A CG   2  
ATOM 1950  C CD   . LYS A 1 25 ? 151.126 -13.416 2.895   1.00 0.00 ? 24 LYS A CD   2  
ATOM 1951  C CE   . LYS A 1 25 ? 150.701 -14.358 4.011   1.00 0.00 ? 24 LYS A CE   2  
ATOM 1952  N NZ   . LYS A 1 25 ? 149.801 -13.690 4.995   1.00 0.00 ? 24 LYS A NZ   2  
ATOM 1953  H H    . LYS A 1 25 ? 150.133 -9.473  2.045   1.00 0.00 ? 24 LYS A H    2  
ATOM 1954  H HA   . LYS A 1 25 ? 152.077 -9.902  4.188   1.00 0.00 ? 24 LYS A HA   2  
ATOM 1955  H HB2  . LYS A 1 25 ? 151.354 -11.283 1.698   1.00 0.00 ? 24 LYS A HB2  2  
ATOM 1956  H HB3  . LYS A 1 25 ? 153.088 -11.162 1.960   1.00 0.00 ? 24 LYS A HB3  2  
ATOM 1957  H HG2  . LYS A 1 25 ? 153.053 -12.744 3.514   1.00 0.00 ? 24 LYS A HG2  2  
ATOM 1958  H HG3  . LYS A 1 25 ? 151.707 -11.982 4.364   1.00 0.00 ? 24 LYS A HG3  2  
ATOM 1959  H HD2  . LYS A 1 25 ? 150.247 -12.952 2.474   1.00 0.00 ? 24 LYS A HD2  2  
ATOM 1960  H HD3  . LYS A 1 25 ? 151.635 -13.986 2.129   1.00 0.00 ? 24 LYS A HD3  2  
ATOM 1961  H HE2  . LYS A 1 25 ? 150.181 -15.200 3.576   1.00 0.00 ? 24 LYS A HE2  2  
ATOM 1962  H HE3  . LYS A 1 25 ? 151.584 -14.709 4.524   1.00 0.00 ? 24 LYS A HE3  2  
ATOM 1963  H HZ1  . LYS A 1 25 ? 149.050 -13.168 4.497   1.00 0.00 ? 24 LYS A HZ1  2  
ATOM 1964  H HZ2  . LYS A 1 25 ? 150.342 -13.022 5.580   1.00 0.00 ? 24 LYS A HZ2  2  
ATOM 1965  H HZ3  . LYS A 1 25 ? 149.361 -14.399 5.616   1.00 0.00 ? 24 LYS A HZ3  2  
ATOM 1966  N N    . TYR A 1 26 ? 153.937 -8.457  3.406   1.00 0.00 ? 25 TYR A N    2  
ATOM 1967  C CA   . TYR A 1 26 ? 154.987 -7.517  3.007   1.00 0.00 ? 25 TYR A CA   2  
ATOM 1968  C C    . TYR A 1 26 ? 155.684 -7.993  1.732   1.00 0.00 ? 25 TYR A C    2  
ATOM 1969  O O    . TYR A 1 26 ? 156.022 -7.187  0.866   1.00 0.00 ? 25 TYR A O    2  
ATOM 1970  C CB   . TYR A 1 26 ? 156.013 -7.354  4.134   1.00 0.00 ? 25 TYR A CB   2  
ATOM 1971  C CG   . TYR A 1 26 ? 156.979 -6.203  3.932   1.00 0.00 ? 25 TYR A CG   2  
ATOM 1972  C CD1  . TYR A 1 26 ? 158.084 -6.333  3.096   1.00 0.00 ? 25 TYR A CD1  2  
ATOM 1973  C CD2  . TYR A 1 26 ? 156.790 -4.990  4.583   1.00 0.00 ? 25 TYR A CD2  2  
ATOM 1974  C CE1  . TYR A 1 26 ? 158.968 -5.288  2.915   1.00 0.00 ? 25 TYR A CE1  2  
ATOM 1975  C CE2  . TYR A 1 26 ? 157.671 -3.940  4.405   1.00 0.00 ? 25 TYR A CE2  2  
ATOM 1976  C CZ   . TYR A 1 26 ? 158.758 -4.095  3.571   1.00 0.00 ? 25 TYR A CZ   2  
ATOM 1977  O OH   . TYR A 1 26 ? 159.638 -3.053  3.394   1.00 0.00 ? 25 TYR A OH   2  
ATOM 1978  H H    . TYR A 1 26 ? 153.968 -8.855  4.301   1.00 0.00 ? 25 TYR A H    2  
ATOM 1979  H HA   . TYR A 1 26 ? 154.521 -6.563  2.814   1.00 0.00 ? 25 TYR A HA   2  
ATOM 1980  H HB2  . TYR A 1 26 ? 155.490 -7.186  5.064   1.00 0.00 ? 25 TYR A HB2  2  
ATOM 1981  H HB3  . TYR A 1 26 ? 156.592 -8.263  4.215   1.00 0.00 ? 25 TYR A HB3  2  
ATOM 1982  H HD1  . TYR A 1 26 ? 158.246 -7.269  2.582   1.00 0.00 ? 25 TYR A HD1  2  
ATOM 1983  H HD2  . TYR A 1 26 ? 155.937 -4.871  5.236   1.00 0.00 ? 25 TYR A HD2  2  
ATOM 1984  H HE1  . TYR A 1 26 ? 159.820 -5.409  2.262   1.00 0.00 ? 25 TYR A HE1  2  
ATOM 1985  H HE2  . TYR A 1 26 ? 157.507 -3.005  4.919   1.00 0.00 ? 25 TYR A HE2  2  
ATOM 1986  H HH   . TYR A 1 26 ? 159.282 -2.436  2.751   1.00 0.00 ? 25 TYR A HH   2  
ATOM 1987  N N    . GLU A 1 27 ? 155.890 -9.307  1.625   1.00 0.00 ? 26 GLU A N    2  
ATOM 1988  C CA   . GLU A 1 27 ? 156.541 -9.890  0.453   1.00 0.00 ? 26 GLU A CA   2  
ATOM 1989  C C    . GLU A 1 27 ? 155.750 -9.581  -0.818  1.00 0.00 ? 26 GLU A C    2  
ATOM 1990  O O    . GLU A 1 27 ? 156.327 -9.211  -1.840  1.00 0.00 ? 26 GLU A O    2  
ATOM 1991  C CB   . GLU A 1 27 ? 156.689 -11.407 0.620   1.00 0.00 ? 26 GLU A CB   2  
ATOM 1992  C CG   . GLU A 1 27 ? 157.440 -11.819 1.878   1.00 0.00 ? 26 GLU A CG   2  
ATOM 1993  C CD   . GLU A 1 27 ? 156.636 -12.762 2.754   1.00 0.00 ? 26 GLU A CD   2  
ATOM 1994  O OE1  . GLU A 1 27 ? 155.659 -12.301 3.383   1.00 0.00 ? 26 GLU A OE1  2  
ATOM 1995  O OE2  . GLU A 1 27 ? 156.981 -13.961 2.808   1.00 0.00 ? 26 GLU A OE2  2  
ATOM 1996  H H    . GLU A 1 27 ? 155.594 -9.899  2.349   1.00 0.00 ? 26 GLU A H    2  
ATOM 1997  H HA   . GLU A 1 27 ? 157.523 -9.449  0.367   1.00 0.00 ? 26 GLU A HA   2  
ATOM 1998  H HB2  . GLU A 1 27 ? 155.705 -11.851 0.654   1.00 0.00 ? 26 GLU A HB2  2  
ATOM 1999  H HB3  . GLU A 1 27 ? 157.220 -11.800 -0.234  1.00 0.00 ? 26 GLU A HB3  2  
ATOM 2000  H HG2  . GLU A 1 27 ? 158.356 -12.313 1.591   1.00 0.00 ? 26 GLU A HG2  2  
ATOM 2001  H HG3  . GLU A 1 27 ? 157.674 -10.934 2.450   1.00 0.00 ? 26 GLU A HG3  2  
ATOM 2002  N N    . ASP A 1 28 ? 154.426 -9.733  -0.744  1.00 0.00 ? 27 ASP A N    2  
ATOM 2003  C CA   . ASP A 1 28 ? 153.558 -9.467  -1.889  1.00 0.00 ? 27 ASP A CA   2  
ATOM 2004  C C    . ASP A 1 28 ? 153.562 -7.984  -2.254  1.00 0.00 ? 27 ASP A C    2  
ATOM 2005  O O    . ASP A 1 28 ? 153.597 -7.629  -3.434  1.00 0.00 ? 27 ASP A O    2  
ATOM 2006  C CB   . ASP A 1 28 ? 152.125 -9.925  -1.598  1.00 0.00 ? 27 ASP A CB   2  
ATOM 2007  C CG   . ASP A 1 28 ? 151.867 -11.346 -2.057  1.00 0.00 ? 27 ASP A CG   2  
ATOM 2008  O OD1  . ASP A 1 28 ? 151.910 -11.593 -3.281  1.00 0.00 ? 27 ASP A OD1  2  
ATOM 2009  O OD2  . ASP A 1 28 ? 151.621 -12.213 -1.192  1.00 0.00 ? 27 ASP A OD2  2  
ATOM 2010  H H    . ASP A 1 28 ? 154.025 -10.029 0.102   1.00 0.00 ? 27 ASP A H    2  
ATOM 2011  H HA   . ASP A 1 28 ? 153.940 -10.030 -2.727  1.00 0.00 ? 27 ASP A HA   2  
ATOM 2012  H HB2  . ASP A 1 28 ? 151.943 -9.870  -0.536  1.00 0.00 ? 27 ASP A HB2  2  
ATOM 2013  H HB3  . ASP A 1 28 ? 151.434 -9.271  -2.111  1.00 0.00 ? 27 ASP A HB3  2  
ATOM 2014  N N    . VAL A 1 29 ? 153.523 -7.121  -1.240  1.00 0.00 ? 28 VAL A N    2  
ATOM 2015  C CA   . VAL A 1 29 ? 153.521 -5.679  -1.469  1.00 0.00 ? 28 VAL A CA   2  
ATOM 2016  C C    . VAL A 1 29 ? 154.860 -5.214  -2.038  1.00 0.00 ? 28 VAL A C    2  
ATOM 2017  O O    . VAL A 1 29 ? 154.899 -4.493  -3.036  1.00 0.00 ? 28 VAL A O    2  
ATOM 2018  C CB   . VAL A 1 29 ? 153.212 -4.891  -0.178  1.00 0.00 ? 28 VAL A CB   2  
ATOM 2019  C CG1  . VAL A 1 29 ? 153.092 -3.402  -0.474  1.00 0.00 ? 28 VAL A CG1  2  
ATOM 2020  C CG2  . VAL A 1 29 ? 151.941 -5.411  0.480   1.00 0.00 ? 28 VAL A CG2  2  
ATOM 2021  H H    . VAL A 1 29 ? 153.495 -7.461  -0.320  1.00 0.00 ? 28 VAL A H    2  
ATOM 2022  H HA   . VAL A 1 29 ? 152.745 -5.463  -2.190  1.00 0.00 ? 28 VAL A HA   2  
ATOM 2023  H HB   . VAL A 1 29 ? 154.032 -5.032  0.511   1.00 0.00 ? 28 VAL A HB   2  
ATOM 2024  H HG11 . VAL A 1 29 ? 153.160 -2.844  0.448   1.00 0.00 ? 28 VAL A HG11 2  
ATOM 2025  H HG12 . VAL A 1 29 ? 152.141 -3.204  -0.946  1.00 0.00 ? 28 VAL A HG12 2  
ATOM 2026  H HG13 . VAL A 1 29 ? 153.891 -3.101  -1.137  1.00 0.00 ? 28 VAL A HG13 2  
ATOM 2027  H HG21 . VAL A 1 29 ? 151.793 -6.447  0.213   1.00 0.00 ? 28 VAL A HG21 2  
ATOM 2028  H HG22 . VAL A 1 29 ? 151.095 -4.830  0.143   1.00 0.00 ? 28 VAL A HG22 2  
ATOM 2029  H HG23 . VAL A 1 29 ? 152.031 -5.326  1.553   1.00 0.00 ? 28 VAL A HG23 2  
ATOM 2030  N N    . GLU A 1 30 ? 155.954 -5.637  -1.404  1.00 0.00 ? 29 GLU A N    2  
ATOM 2031  C CA   . GLU A 1 30 ? 157.295 -5.267  -1.854  1.00 0.00 ? 29 GLU A CA   2  
ATOM 2032  C C    . GLU A 1 30 ? 157.536 -5.736  -3.286  1.00 0.00 ? 29 GLU A C    2  
ATOM 2033  O O    . GLU A 1 30 ? 158.089 -5.000  -4.104  1.00 0.00 ? 29 GLU A O    2  
ATOM 2034  C CB   . GLU A 1 30 ? 158.356 -5.867  -0.930  1.00 0.00 ? 29 GLU A CB   2  
ATOM 2035  C CG   . GLU A 1 30 ? 159.617 -5.024  -0.825  1.00 0.00 ? 29 GLU A CG   2  
ATOM 2036  C CD   . GLU A 1 30 ? 160.866 -5.862  -0.634  1.00 0.00 ? 29 GLU A CD   2  
ATOM 2037  O OE1  . GLU A 1 30 ? 160.971 -6.540  0.410   1.00 0.00 ? 29 GLU A OE1  2  
ATOM 2038  O OE2  . GLU A 1 30 ? 161.740 -5.837  -1.526  1.00 0.00 ? 29 GLU A OE2  2  
ATOM 2039  H H    . GLU A 1 30 ? 155.856 -6.215  -0.617  1.00 0.00 ? 29 GLU A H    2  
ATOM 2040  H HA   . GLU A 1 30 ? 157.368 -4.190  -1.822  1.00 0.00 ? 29 GLU A HA   2  
ATOM 2041  H HB2  . GLU A 1 30 ? 157.937 -5.975  0.060   1.00 0.00 ? 29 GLU A HB2  2  
ATOM 2042  H HB3  . GLU A 1 30 ? 158.630 -6.843  -1.303  1.00 0.00 ? 29 GLU A HB3  2  
ATOM 2043  H HG2  . GLU A 1 30 ? 159.725 -4.446  -1.732  1.00 0.00 ? 29 GLU A HG2  2  
ATOM 2044  H HG3  . GLU A 1 30 ? 159.517 -4.355  0.016   1.00 0.00 ? 29 GLU A HG3  2  
ATOM 2045  N N    . HIS A 1 31 ? 157.114 -6.965  -3.579  1.00 0.00 ? 30 HIS A N    2  
ATOM 2046  C CA   . HIS A 1 31 ? 157.278 -7.538  -4.912  1.00 0.00 ? 30 HIS A CA   2  
ATOM 2047  C C    . HIS A 1 31 ? 156.614 -6.657  -5.970  1.00 0.00 ? 30 HIS A C    2  
ATOM 2048  O O    . HIS A 1 31 ? 157.179 -6.431  -7.040  1.00 0.00 ? 30 HIS A O    2  
ATOM 2049  C CB   . HIS A 1 31 ? 156.683 -8.950  -4.957  1.00 0.00 ? 30 HIS A CB   2  
ATOM 2050  C CG   . HIS A 1 31 ? 157.704 -10.047 -4.902  1.00 0.00 ? 30 HIS A CG   2  
ATOM 2051  N ND1  . HIS A 1 31 ? 158.939 -9.906  -4.301  1.00 0.00 ? 30 HIS A ND1  2  
ATOM 2052  C CD2  . HIS A 1 31 ? 157.663 -11.315 -5.377  1.00 0.00 ? 30 HIS A CD2  2  
ATOM 2053  C CE1  . HIS A 1 31 ? 159.613 -11.038 -4.413  1.00 0.00 ? 30 HIS A CE1  2  
ATOM 2054  N NE2  . HIS A 1 31 ? 158.860 -11.909 -5.060  1.00 0.00 ? 30 HIS A NE2  2  
ATOM 2055  H H    . HIS A 1 31 ? 156.678 -7.501  -2.881  1.00 0.00 ? 30 HIS A H    2  
ATOM 2056  H HA   . HIS A 1 31 ? 158.337 -7.595  -5.120  1.00 0.00 ? 30 HIS A HA   2  
ATOM 2057  H HB2  . HIS A 1 31 ? 156.018 -9.079  -4.116  1.00 0.00 ? 30 HIS A HB2  2  
ATOM 2058  H HB3  . HIS A 1 31 ? 156.121 -9.065  -5.872  1.00 0.00 ? 30 HIS A HB3  2  
ATOM 2059  H HD1  . HIS A 1 31 ? 159.272 -9.099  -3.857  1.00 0.00 ? 30 HIS A HD1  2  
ATOM 2060  H HD2  . HIS A 1 31 ? 156.840 -11.775 -5.906  1.00 0.00 ? 30 HIS A HD2  2  
ATOM 2061  H HE1  . HIS A 1 31 ? 160.608 -11.220 -4.038  1.00 0.00 ? 30 HIS A HE1  2  
ATOM 2062  H HE2  . HIS A 1 31 ? 159.157 -12.789 -5.370  1.00 0.00 ? 30 HIS A HE2  2  
ATOM 2063  N N    . LYS A 1 32 ? 155.418 -6.154  -5.662  1.00 0.00 ? 31 LYS A N    2  
ATOM 2064  C CA   . LYS A 1 32 ? 154.692 -5.291  -6.592  1.00 0.00 ? 31 LYS A CA   2  
ATOM 2065  C C    . LYS A 1 32 ? 155.455 -3.994  -6.853  1.00 0.00 ? 31 LYS A C    2  
ATOM 2066  O O    . LYS A 1 32 ? 155.623 -3.589  -8.002  1.00 0.00 ? 31 LYS A O    2  
ATOM 2067  C CB   . LYS A 1 32 ? 153.293 -4.968  -6.058  1.00 0.00 ? 31 LYS A CB   2  
ATOM 2068  C CG   . LYS A 1 32 ? 152.225 -4.943  -7.142  1.00 0.00 ? 31 LYS A CG   2  
ATOM 2069  C CD   . LYS A 1 32 ? 151.540 -6.295  -7.285  1.00 0.00 ? 31 LYS A CD   2  
ATOM 2070  C CE   . LYS A 1 32 ? 150.725 -6.643  -6.048  1.00 0.00 ? 31 LYS A CE   2  
ATOM 2071  N NZ   . LYS A 1 32 ? 151.353 -7.735  -5.247  1.00 0.00 ? 31 LYS A NZ   2  
ATOM 2072  H H    . LYS A 1 32 ? 155.018 -6.364  -4.790  1.00 0.00 ? 31 LYS A H    2  
ATOM 2073  H HA   . LYS A 1 32 ? 154.594 -5.826  -7.525  1.00 0.00 ? 31 LYS A HA   2  
ATOM 2074  H HB2  . LYS A 1 32 ? 153.017 -5.710  -5.324  1.00 0.00 ? 31 LYS A HB2  2  
ATOM 2075  H HB3  . LYS A 1 32 ? 153.316 -3.998  -5.585  1.00 0.00 ? 31 LYS A HB3  2  
ATOM 2076  H HG2  . LYS A 1 32 ? 151.485 -4.199  -6.890  1.00 0.00 ? 31 LYS A HG2  2  
ATOM 2077  H HG3  . LYS A 1 32 ? 152.690 -4.685  -8.083  1.00 0.00 ? 31 LYS A HG3  2  
ATOM 2078  H HD2  . LYS A 1 32 ? 150.880 -6.263  -8.139  1.00 0.00 ? 31 LYS A HD2  2  
ATOM 2079  H HD3  . LYS A 1 32 ? 152.292 -7.055  -7.437  1.00 0.00 ? 31 LYS A HD3  2  
ATOM 2080  H HE2  . LYS A 1 32 ? 150.639 -5.761  -5.430  1.00 0.00 ? 31 LYS A HE2  2  
ATOM 2081  H HE3  . LYS A 1 32 ? 149.740 -6.958  -6.360  1.00 0.00 ? 31 LYS A HE3  2  
ATOM 2082  H HZ1  . LYS A 1 32 ? 152.035 -7.337  -4.568  1.00 0.00 ? 31 LYS A HZ1  2  
ATOM 2083  H HZ2  . LYS A 1 32 ? 151.853 -8.400  -5.872  1.00 0.00 ? 31 LYS A HZ2  2  
ATOM 2084  H HZ3  . LYS A 1 32 ? 150.623 -8.257  -4.721  1.00 0.00 ? 31 LYS A HZ3  2  
ATOM 2085  N N    . VAL A 1 33 ? 155.914 -3.345  -5.781  1.00 0.00 ? 32 VAL A N    2  
ATOM 2086  C CA   . VAL A 1 33 ? 156.654 -2.088  -5.908  1.00 0.00 ? 32 VAL A CA   2  
ATOM 2087  C C    . VAL A 1 33 ? 157.957 -2.287  -6.681  1.00 0.00 ? 32 VAL A C    2  
ATOM 2088  O O    . VAL A 1 33 ? 158.311 -1.469  -7.533  1.00 0.00 ? 32 VAL A O    2  
ATOM 2089  C CB   . VAL A 1 33 ? 156.972 -1.464  -4.531  1.00 0.00 ? 32 VAL A CB   2  
ATOM 2090  C CG1  . VAL A 1 33 ? 157.639 -0.106  -4.699  1.00 0.00 ? 32 VAL A CG1  2  
ATOM 2091  C CG2  . VAL A 1 33 ? 155.706 -1.339  -3.693  1.00 0.00 ? 32 VAL A CG2  2  
ATOM 2092  H H    . VAL A 1 33 ? 155.749 -3.717  -4.888  1.00 0.00 ? 32 VAL A H    2  
ATOM 2093  H HA   . VAL A 1 33 ? 156.031 -1.396  -6.455  1.00 0.00 ? 32 VAL A HA   2  
ATOM 2094  H HB   . VAL A 1 33 ? 157.659 -2.116  -4.012  1.00 0.00 ? 32 VAL A HB   2  
ATOM 2095  H HG11 . VAL A 1 33 ? 158.581 -0.230  -5.213  1.00 0.00 ? 32 VAL A HG11 2  
ATOM 2096  H HG12 . VAL A 1 33 ? 157.814 0.333   -3.729  1.00 0.00 ? 32 VAL A HG12 2  
ATOM 2097  H HG13 . VAL A 1 33 ? 156.996 0.541   -5.277  1.00 0.00 ? 32 VAL A HG13 2  
ATOM 2098  H HG21 . VAL A 1 33 ? 155.375 -2.322  -3.395  1.00 0.00 ? 32 VAL A HG21 2  
ATOM 2099  H HG22 . VAL A 1 33 ? 154.933 -0.860  -4.276  1.00 0.00 ? 32 VAL A HG22 2  
ATOM 2100  H HG23 . VAL A 1 33 ? 155.913 -0.747  -2.814  1.00 0.00 ? 32 VAL A HG23 2  
ATOM 2101  N N    . THR A 1 34 ? 158.662 -3.377  -6.382  1.00 0.00 ? 33 THR A N    2  
ATOM 2102  C CA   . THR A 1 34 ? 159.922 -3.684  -7.052  1.00 0.00 ? 33 THR A CA   2  
ATOM 2103  C C    . THR A 1 34 ? 159.703 -3.936  -8.546  1.00 0.00 ? 33 THR A C    2  
ATOM 2104  O O    . THR A 1 34 ? 160.519 -3.529  -9.370  1.00 0.00 ? 33 THR A O    2  
ATOM 2105  C CB   . THR A 1 34 ? 160.596 -4.899  -6.404  1.00 0.00 ? 33 THR A CB   2  
ATOM 2106  O OG1  . THR A 1 34 ? 160.707 -4.728  -5.000  1.00 0.00 ? 33 THR A OG1  2  
ATOM 2107  C CG2  . THR A 1 34 ? 161.985 -5.172  -6.939  1.00 0.00 ? 33 THR A CG2  2  
ATOM 2108  H H    . THR A 1 34 ? 158.325 -3.991  -5.695  1.00 0.00 ? 33 THR A H    2  
ATOM 2109  H HA   . THR A 1 34 ? 160.568 -2.825  -6.940  1.00 0.00 ? 33 THR A HA   2  
ATOM 2110  H HB   . THR A 1 34 ? 159.991 -5.775  -6.591  1.00 0.00 ? 33 THR A HB   2  
ATOM 2111  H HG1  . THR A 1 34 ? 161.046 -3.851  -4.805  1.00 0.00 ? 33 THR A HG1  2  
ATOM 2112  H HG21 . THR A 1 34 ? 161.925 -5.414  -7.989  1.00 0.00 ? 33 THR A HG21 2  
ATOM 2113  H HG22 . THR A 1 34 ? 162.420 -6.002  -6.400  1.00 0.00 ? 33 THR A HG22 2  
ATOM 2114  H HG23 . THR A 1 34 ? 162.600 -4.295  -6.810  1.00 0.00 ? 33 THR A HG23 2  
ATOM 2115  N N    . THR A 1 35 ? 158.606 -4.616  -8.890  1.00 0.00 ? 34 THR A N    2  
ATOM 2116  C CA   . THR A 1 35 ? 158.301 -4.913  -10.291 1.00 0.00 ? 34 THR A CA   2  
ATOM 2117  C C    . THR A 1 35 ? 157.873 -3.654  -11.051 1.00 0.00 ? 34 THR A C    2  
ATOM 2118  O O    . THR A 1 35 ? 158.352 -3.402  -12.157 1.00 0.00 ? 34 THR A O    2  
ATOM 2119  C CB   . THR A 1 35 ? 157.212 -5.989  -10.402 1.00 0.00 ? 34 THR A CB   2  
ATOM 2120  O OG1  . THR A 1 35 ? 157.563 -7.144  -9.659  1.00 0.00 ? 34 THR A OG1  2  
ATOM 2121  C CG2  . THR A 1 35 ? 156.950 -6.429  -11.828 1.00 0.00 ? 34 THR A CG2  2  
ATOM 2122  H H    . THR A 1 35 ? 157.990 -4.922  -8.191  1.00 0.00 ? 34 THR A H    2  
ATOM 2123  H HA   . THR A 1 35 ? 159.206 -5.290  -10.745 1.00 0.00 ? 34 THR A HA   2  
ATOM 2124  H HB   . THR A 1 35 ? 156.288 -5.597  -10.003 1.00 0.00 ? 34 THR A HB   2  
ATOM 2125  H HG1  . THR A 1 35 ? 158.467 -7.399  -9.862  1.00 0.00 ? 34 THR A HG1  2  
ATOM 2126  H HG21 . THR A 1 35 ? 157.232 -5.639  -12.507 1.00 0.00 ? 34 THR A HG21 2  
ATOM 2127  H HG22 . THR A 1 35 ? 155.899 -6.651  -11.949 1.00 0.00 ? 34 THR A HG22 2  
ATOM 2128  H HG23 . THR A 1 35 ? 157.532 -7.312  -12.046 1.00 0.00 ? 34 THR A HG23 2  
ATOM 2129  N N    . VAL A 1 36 ? 156.964 -2.874  -10.461 1.00 0.00 ? 35 VAL A N    2  
ATOM 2130  C CA   . VAL A 1 36 ? 156.473 -1.652  -11.103 1.00 0.00 ? 35 VAL A CA   2  
ATOM 2131  C C    . VAL A 1 36 ? 157.614 -0.679  -11.403 1.00 0.00 ? 35 VAL A C    2  
ATOM 2132  O O    . VAL A 1 36 ? 157.727 -0.173  -12.520 1.00 0.00 ? 35 VAL A O    2  
ATOM 2133  C CB   . VAL A 1 36 ? 155.412 -0.928  -10.242 1.00 0.00 ? 35 VAL A CB   2  
ATOM 2134  C CG1  . VAL A 1 36 ? 154.870 0.294   -10.974 1.00 0.00 ? 35 VAL A CG1  2  
ATOM 2135  C CG2  . VAL A 1 36 ? 154.278 -1.875  -9.868  1.00 0.00 ? 35 VAL A CG2  2  
ATOM 2136  H H    . VAL A 1 36 ? 156.611 -3.129  -9.581  1.00 0.00 ? 35 VAL A H    2  
ATOM 2137  H HA   . VAL A 1 36 ? 156.009 -1.937  -12.037 1.00 0.00 ? 35 VAL A HA   2  
ATOM 2138  H HB   . VAL A 1 36 ? 155.886 -0.591  -9.331  1.00 0.00 ? 35 VAL A HB   2  
ATOM 2139  H HG11 . VAL A 1 36 ? 155.060 0.193   -12.033 1.00 0.00 ? 35 VAL A HG11 2  
ATOM 2140  H HG12 . VAL A 1 36 ? 155.360 1.182   -10.603 1.00 0.00 ? 35 VAL A HG12 2  
ATOM 2141  H HG13 . VAL A 1 36 ? 153.806 0.373   -10.806 1.00 0.00 ? 35 VAL A HG13 2  
ATOM 2142  H HG21 . VAL A 1 36 ? 154.551 -2.886  -10.130 1.00 0.00 ? 35 VAL A HG21 2  
ATOM 2143  H HG22 . VAL A 1 36 ? 153.382 -1.594  -10.402 1.00 0.00 ? 35 VAL A HG22 2  
ATOM 2144  H HG23 . VAL A 1 36 ? 154.096 -1.815  -8.806  1.00 0.00 ? 35 VAL A HG23 2  
ATOM 2145  N N    . PHE A 1 37 ? 158.454 -0.417  -10.402 1.00 0.00 ? 36 PHE A N    2  
ATOM 2146  C CA   . PHE A 1 37 ? 159.581 0.504   -10.567 1.00 0.00 ? 36 PHE A CA   2  
ATOM 2147  C C    . PHE A 1 37 ? 160.798 -0.187  -11.188 1.00 0.00 ? 36 PHE A C    2  
ATOM 2148  O O    . PHE A 1 37 ? 161.643 0.471   -11.797 1.00 0.00 ? 36 PHE A O    2  
ATOM 2149  C CB   . PHE A 1 37 ? 159.966 1.123   -9.220  1.00 0.00 ? 36 PHE A CB   2  
ATOM 2150  C CG   . PHE A 1 37 ? 158.884 1.976   -8.615  1.00 0.00 ? 36 PHE A CG   2  
ATOM 2151  C CD1  . PHE A 1 37 ? 158.193 2.900   -9.385  1.00 0.00 ? 36 PHE A CD1  2  
ATOM 2152  C CD2  . PHE A 1 37 ? 158.561 1.855   -7.273  1.00 0.00 ? 36 PHE A CD2  2  
ATOM 2153  C CE1  . PHE A 1 37 ? 157.201 3.683   -8.828  1.00 0.00 ? 36 PHE A CE1  2  
ATOM 2154  C CE2  . PHE A 1 37 ? 157.570 2.635   -6.712  1.00 0.00 ? 36 PHE A CE2  2  
ATOM 2155  C CZ   . PHE A 1 37 ? 156.889 3.551   -7.489  1.00 0.00 ? 36 PHE A CZ   2  
ATOM 2156  H H    . PHE A 1 37 ? 158.312 -0.847  -9.531  1.00 0.00 ? 36 PHE A H    2  
ATOM 2157  H HA   . PHE A 1 37 ? 159.261 1.292   -11.230 1.00 0.00 ? 36 PHE A HA   2  
ATOM 2158  H HB2  . PHE A 1 37 ? 160.197 0.332   -8.522  1.00 0.00 ? 36 PHE A HB2  2  
ATOM 2159  H HB3  . PHE A 1 37 ? 160.842 1.741   -9.356  1.00 0.00 ? 36 PHE A HB3  2  
ATOM 2160  H HD1  . PHE A 1 37 ? 158.436 3.004   -10.433 1.00 0.00 ? 36 PHE A HD1  2  
ATOM 2161  H HD2  . PHE A 1 37 ? 159.092 1.139   -6.663  1.00 0.00 ? 36 PHE A HD2  2  
ATOM 2162  H HE1  . PHE A 1 37 ? 156.671 4.399   -9.439  1.00 0.00 ? 36 PHE A HE1  2  
ATOM 2163  H HE2  . PHE A 1 37 ? 157.328 2.530   -5.665  1.00 0.00 ? 36 PHE A HE2  2  
ATOM 2164  H HZ   . PHE A 1 37 ? 156.114 4.162   -7.051  1.00 0.00 ? 36 PHE A HZ   2  
ATOM 2165  N N    . GLY A 1 38 ? 160.889 -1.506  -11.024 1.00 0.00 ? 37 GLY A N    2  
ATOM 2166  C CA   . GLY A 1 38 ? 162.013 -2.252  -11.570 1.00 0.00 ? 37 GLY A CA   2  
ATOM 2167  C C    . GLY A 1 38 ? 163.298 -2.056  -10.777 1.00 0.00 ? 37 GLY A C    2  
ATOM 2168  O O    . GLY A 1 38 ? 164.392 -2.191  -11.325 1.00 0.00 ? 37 GLY A O    2  
ATOM 2169  H H    . GLY A 1 38 ? 160.191 -1.979  -10.524 1.00 0.00 ? 37 GLY A H    2  
ATOM 2170  H HA2  . GLY A 1 38 ? 161.763 -3.303  -11.574 1.00 0.00 ? 37 GLY A HA2  2  
ATOM 2171  H HA3  . GLY A 1 38 ? 162.180 -1.933  -12.587 1.00 0.00 ? 37 GLY A HA3  2  
ATOM 2172  N N    . GLN A 1 39 ? 163.168 -1.737  -9.485  1.00 0.00 ? 38 GLN A N    2  
ATOM 2173  C CA   . GLN A 1 39 ? 164.331 -1.523  -8.624  1.00 0.00 ? 38 GLN A CA   2  
ATOM 2174  C C    . GLN A 1 39 ? 163.970 -1.715  -7.150  1.00 0.00 ? 38 GLN A C    2  
ATOM 2175  O O    . GLN A 1 39 ? 162.809 -1.568  -6.763  1.00 0.00 ? 38 GLN A O    2  
ATOM 2176  C CB   . GLN A 1 39 ? 164.893 -0.113  -8.829  1.00 0.00 ? 38 GLN A CB   2  
ATOM 2177  C CG   . GLN A 1 39 ? 165.900 -0.009  -9.963  1.00 0.00 ? 38 GLN A CG   2  
ATOM 2178  C CD   . GLN A 1 39 ? 166.927 1.083   -9.727  1.00 0.00 ? 38 GLN A CD   2  
ATOM 2179  O OE1  . GLN A 1 39 ? 168.131 0.848   -9.823  1.00 0.00 ? 38 GLN A OE1  2  
ATOM 2180  N NE2  . GLN A 1 39 ? 166.456 2.287   -9.415  1.00 0.00 ? 38 GLN A NE2  2  
ATOM 2181  H H    . GLN A 1 39 ? 162.270 -1.644  -9.103  1.00 0.00 ? 38 GLN A H    2  
ATOM 2182  H HA   . GLN A 1 39 ? 165.085 -2.245  -8.897  1.00 0.00 ? 38 GLN A HA   2  
ATOM 2183  H HB2  . GLN A 1 39 ? 164.075 0.559   -9.042  1.00 0.00 ? 38 GLN A HB2  2  
ATOM 2184  H HB3  . GLN A 1 39 ? 165.377 0.203   -7.917  1.00 0.00 ? 38 GLN A HB3  2  
ATOM 2185  H HG2  . GLN A 1 39 ? 166.415 -0.953  -10.060 1.00 0.00 ? 38 GLN A HG2  2  
ATOM 2186  H HG3  . GLN A 1 39 ? 165.370 0.208   -10.878 1.00 0.00 ? 38 GLN A HG3  2  
ATOM 2187  H HE21 . GLN A 1 39 ? 165.485 2.405   -9.355  1.00 0.00 ? 38 GLN A HE21 2  
ATOM 2188  H HE22 . GLN A 1 39 ? 167.101 3.008   -9.258  1.00 0.00 ? 38 GLN A HE22 2  
ATOM 2189  N N    . PRO A 1 40 ? 164.968 -2.042  -6.304  1.00 0.00 ? 39 PRO A N    2  
ATOM 2190  C CA   . PRO A 1 40 ? 164.753 -2.246  -4.868  1.00 0.00 ? 39 PRO A CA   2  
ATOM 2191  C C    . PRO A 1 40 ? 164.530 -0.928  -4.125  1.00 0.00 ? 39 PRO A C    2  
ATOM 2192  O O    . PRO A 1 40 ? 165.486 -0.246  -3.744  1.00 0.00 ? 39 PRO A O    2  
ATOM 2193  C CB   . PRO A 1 40 ? 166.050 -2.917  -4.412  1.00 0.00 ? 39 PRO A CB   2  
ATOM 2194  C CG   . PRO A 1 40 ? 167.084 -2.430  -5.367  1.00 0.00 ? 39 PRO A CG   2  
ATOM 2195  C CD   . PRO A 1 40 ? 166.382 -2.234  -6.685  1.00 0.00 ? 39 PRO A CD   2  
ATOM 2196  H HA   . PRO A 1 40 ? 163.918 -2.906  -4.685  1.00 0.00 ? 39 PRO A HA   2  
ATOM 2197  H HB2  . PRO A 1 40 ? 166.276 -2.619  -3.397  1.00 0.00 ? 39 PRO A HB2  2  
ATOM 2198  H HB3  . PRO A 1 40 ? 165.941 -3.991  -4.462  1.00 0.00 ? 39 PRO A HB3  2  
ATOM 2199  H HG2  . PRO A 1 40 ? 167.492 -1.493  -5.018  1.00 0.00 ? 39 PRO A HG2  2  
ATOM 2200  H HG3  . PRO A 1 40 ? 167.868 -3.167  -5.467  1.00 0.00 ? 39 PRO A HG3  2  
ATOM 2201  H HD2  . PRO A 1 40 ? 166.767 -1.360  -7.189  1.00 0.00 ? 39 PRO A HD2  2  
ATOM 2202  H HD3  . PRO A 1 40 ? 166.497 -3.110  -7.306  1.00 0.00 ? 39 PRO A HD3  2  
ATOM 2203  N N    . LEU A 1 41 ? 163.261 -0.573  -3.927  1.00 0.00 ? 40 LEU A N    2  
ATOM 2204  C CA   . LEU A 1 41 ? 162.907 0.664   -3.234  1.00 0.00 ? 40 LEU A CA   2  
ATOM 2205  C C    . LEU A 1 41 ? 162.525 0.389   -1.779  1.00 0.00 ? 40 LEU A C    2  
ATOM 2206  O O    . LEU A 1 41 ? 161.984 -0.673  -1.461  1.00 0.00 ? 40 LEU A O    2  
ATOM 2207  C CB   . LEU A 1 41 ? 161.747 1.364   -3.950  1.00 0.00 ? 40 LEU A CB   2  
ATOM 2208  C CG   . LEU A 1 41 ? 162.158 2.308   -5.085  1.00 0.00 ? 40 LEU A CG   2  
ATOM 2209  C CD1  . LEU A 1 41 ? 162.042 1.613   -6.435  1.00 0.00 ? 40 LEU A CD1  2  
ATOM 2210  C CD2  . LEU A 1 41 ? 161.308 3.570   -5.058  1.00 0.00 ? 40 LEU A CD2  2  
ATOM 2211  H H    . LEU A 1 41 ? 162.545 -1.155  -4.258  1.00 0.00 ? 40 LEU A H    2  
ATOM 2212  H HA   . LEU A 1 41 ? 163.771 1.311   -3.250  1.00 0.00 ? 40 LEU A HA   2  
ATOM 2213  H HB2  . LEU A 1 41 ? 161.092 0.606   -4.357  1.00 0.00 ? 40 LEU A HB2  2  
ATOM 2214  H HB3  . LEU A 1 41 ? 161.195 1.936   -3.220  1.00 0.00 ? 40 LEU A HB3  2  
ATOM 2215  H HG   . LEU A 1 41 ? 163.189 2.596   -4.948  1.00 0.00 ? 40 LEU A HG   2  
ATOM 2216  H HD11 . LEU A 1 41 ? 162.891 1.875   -7.048  1.00 0.00 ? 40 LEU A HD11 2  
ATOM 2217  H HD12 . LEU A 1 41 ? 161.134 1.928   -6.926  1.00 0.00 ? 40 LEU A HD12 2  
ATOM 2218  H HD13 . LEU A 1 41 ? 162.020 0.543   -6.291  1.00 0.00 ? 40 LEU A HD13 2  
ATOM 2219  H HD21 . LEU A 1 41 ? 161.164 3.885   -4.035  1.00 0.00 ? 40 LEU A HD21 2  
ATOM 2220  H HD22 . LEU A 1 41 ? 160.348 3.368   -5.510  1.00 0.00 ? 40 LEU A HD22 2  
ATOM 2221  H HD23 . LEU A 1 41 ? 161.807 4.353   -5.608  1.00 0.00 ? 40 LEU A HD23 2  
ATOM 2222  N N    . ASP A 1 42 ? 162.806 1.355   -0.904  1.00 0.00 ? 41 ASP A N    2  
ATOM 2223  C CA   . ASP A 1 42 ? 162.489 1.221   0.518   1.00 0.00 ? 41 ASP A CA   2  
ATOM 2224  C C    . ASP A 1 42 ? 161.210 1.978   0.867   1.00 0.00 ? 41 ASP A C    2  
ATOM 2225  O O    . ASP A 1 42 ? 160.982 3.088   0.383   1.00 0.00 ? 41 ASP A O    2  
ATOM 2226  C CB   . ASP A 1 42 ? 163.647 1.740   1.376   1.00 0.00 ? 41 ASP A CB   2  
ATOM 2227  C CG   . ASP A 1 42 ? 163.695 1.081   2.743   1.00 0.00 ? 41 ASP A CG   2  
ATOM 2228  O OD1  . ASP A 1 42 ? 162.864 1.439   3.604   1.00 0.00 ? 41 ASP A OD1  2  
ATOM 2229  O OD2  . ASP A 1 42 ? 164.565 0.210   2.951   1.00 0.00 ? 41 ASP A OD2  2  
ATOM 2230  H H    . ASP A 1 42 ? 163.234 2.178   -1.221  1.00 0.00 ? 41 ASP A H    2  
ATOM 2231  H HA   . ASP A 1 42 ? 162.341 0.173   0.727   1.00 0.00 ? 41 ASP A HA   2  
ATOM 2232  H HB2  . ASP A 1 42 ? 164.580 1.545   0.870   1.00 0.00 ? 41 ASP A HB2  2  
ATOM 2233  H HB3  . ASP A 1 42 ? 163.535 2.806   1.515   1.00 0.00 ? 41 ASP A HB3  2  
ATOM 2234  N N    . LEU A 1 43 ? 160.384 1.372   1.720   1.00 0.00 ? 42 LEU A N    2  
ATOM 2235  C CA   . LEU A 1 43 ? 159.130 1.989   2.144   1.00 0.00 ? 42 LEU A CA   2  
ATOM 2236  C C    . LEU A 1 43 ? 159.354 2.883   3.362   1.00 0.00 ? 42 LEU A C    2  
ATOM 2237  O O    . LEU A 1 43 ? 159.558 2.392   4.474   1.00 0.00 ? 42 LEU A O    2  
ATOM 2238  C CB   . LEU A 1 43 ? 158.086 0.916   2.470   1.00 0.00 ? 42 LEU A CB   2  
ATOM 2239  C CG   . LEU A 1 43 ? 157.610 0.082   1.278   1.00 0.00 ? 42 LEU A CG   2  
ATOM 2240  C CD1  . LEU A 1 43 ? 156.978 -1.219  1.754   1.00 0.00 ? 42 LEU A CD1  2  
ATOM 2241  C CD2  . LEU A 1 43 ? 156.626 0.877   0.428   1.00 0.00 ? 42 LEU A CD2  2  
ATOM 2242  H H    . LEU A 1 43 ? 160.626 0.491   2.075   1.00 0.00 ? 42 LEU A H    2  
ATOM 2243  H HA   . LEU A 1 43 ? 158.766 2.596   1.327   1.00 0.00 ? 42 LEU A HA   2  
ATOM 2244  H HB2  . LEU A 1 43 ? 158.508 0.245   3.206   1.00 0.00 ? 42 LEU A HB2  2  
ATOM 2245  H HB3  . LEU A 1 43 ? 157.226 1.402   2.906   1.00 0.00 ? 42 LEU A HB3  2  
ATOM 2246  H HG   . LEU A 1 43 ? 158.461 -0.168  0.660   1.00 0.00 ? 42 LEU A HG   2  
ATOM 2247  H HD11 . LEU A 1 43 ? 157.329 -1.446  2.750   1.00 0.00 ? 42 LEU A HD11 2  
ATOM 2248  H HD12 . LEU A 1 43 ? 157.255 -2.019  1.084   1.00 0.00 ? 42 LEU A HD12 2  
ATOM 2249  H HD13 . LEU A 1 43 ? 155.903 -1.115  1.765   1.00 0.00 ? 42 LEU A HD13 2  
ATOM 2250  H HD21 . LEU A 1 43 ? 156.749 0.608   -0.611  1.00 0.00 ? 42 LEU A HD21 2  
ATOM 2251  H HD22 . LEU A 1 43 ? 156.815 1.933   0.551   1.00 0.00 ? 42 LEU A HD22 2  
ATOM 2252  H HD23 . LEU A 1 43 ? 155.617 0.654   0.741   1.00 0.00 ? 42 LEU A HD23 2  
ATOM 2253  N N    . HIS A 1 44 ? 159.319 4.197   3.145   1.00 0.00 ? 43 HIS A N    2  
ATOM 2254  C CA   . HIS A 1 44 ? 159.521 5.156   4.226   1.00 0.00 ? 43 HIS A CA   2  
ATOM 2255  C C    . HIS A 1 44 ? 158.189 5.717   4.716   1.00 0.00 ? 43 HIS A C    2  
ATOM 2256  O O    . HIS A 1 44 ? 157.484 6.408   3.977   1.00 0.00 ? 43 HIS A O    2  
ATOM 2257  C CB   . HIS A 1 44 ? 160.435 6.292   3.762   1.00 0.00 ? 43 HIS A CB   2  
ATOM 2258  C CG   . HIS A 1 44 ? 161.869 6.096   4.148   1.00 0.00 ? 43 HIS A CG   2  
ATOM 2259  N ND1  . HIS A 1 44 ? 162.468 6.774   5.190   1.00 0.00 ? 43 HIS A ND1  2  
ATOM 2260  C CD2  . HIS A 1 44 ? 162.824 5.288   3.628   1.00 0.00 ? 43 HIS A CD2  2  
ATOM 2261  C CE1  . HIS A 1 44 ? 163.729 6.392   5.292   1.00 0.00 ? 43 HIS A CE1  2  
ATOM 2262  N NE2  . HIS A 1 44 ? 163.970 5.492   4.357   1.00 0.00 ? 43 HIS A NE2  2  
ATOM 2263  H H    . HIS A 1 44 ? 159.155 4.528   2.237   1.00 0.00 ? 43 HIS A H    2  
ATOM 2264  H HA   . HIS A 1 44 ? 159.999 4.636   5.043   1.00 0.00 ? 43 HIS A HA   2  
ATOM 2265  H HB2  . HIS A 1 44 ? 160.388 6.368   2.685   1.00 0.00 ? 43 HIS A HB2  2  
ATOM 2266  H HB3  . HIS A 1 44 ? 160.096 7.221   4.198   1.00 0.00 ? 43 HIS A HB3  2  
ATOM 2267  H HD1  . HIS A 1 44 ? 162.034 7.435   5.768   1.00 0.00 ? 43 HIS A HD1  2  
ATOM 2268  H HD2  . HIS A 1 44 ? 162.706 4.608   2.795   1.00 0.00 ? 43 HIS A HD2  2  
ATOM 2269  H HE1  . HIS A 1 44 ? 164.441 6.755   6.018   1.00 0.00 ? 43 HIS A HE1  2  
ATOM 2270  H HE2  . HIS A 1 44 ? 164.847 5.103   4.160   1.00 0.00 ? 43 HIS A HE2  2  
ATOM 2271  N N    . TYR A 1 45 ? 157.852 5.412   5.968   1.00 0.00 ? 44 TYR A N    2  
ATOM 2272  C CA   . TYR A 1 45 ? 156.606 5.879   6.564   1.00 0.00 ? 44 TYR A CA   2  
ATOM 2273  C C    . TYR A 1 45 ? 156.815 7.187   7.326   1.00 0.00 ? 44 TYR A C    2  
ATOM 2274  O O    . TYR A 1 45 ? 157.688 7.281   8.190   1.00 0.00 ? 44 TYR A O    2  
ATOM 2275  C CB   . TYR A 1 45 ? 156.035 4.813   7.503   1.00 0.00 ? 44 TYR A CB   2  
ATOM 2276  C CG   . TYR A 1 45 ? 154.531 4.682   7.421   1.00 0.00 ? 44 TYR A CG   2  
ATOM 2277  C CD1  . TYR A 1 45 ? 153.925 4.118   6.306   1.00 0.00 ? 44 TYR A CD1  2  
ATOM 2278  C CD2  . TYR A 1 45 ? 153.718 5.124   8.457   1.00 0.00 ? 44 TYR A CD2  2  
ATOM 2279  C CE1  . TYR A 1 45 ? 152.550 3.997   6.225   1.00 0.00 ? 44 TYR A CE1  2  
ATOM 2280  C CE2  . TYR A 1 45 ? 152.343 5.006   8.385   1.00 0.00 ? 44 TYR A CE2  2  
ATOM 2281  C CZ   . TYR A 1 45 ? 151.764 4.443   7.267   1.00 0.00 ? 44 TYR A CZ   2  
ATOM 2282  O OH   . TYR A 1 45 ? 150.394 4.325   7.190   1.00 0.00 ? 44 TYR A OH   2  
ATOM 2283  H H    . TYR A 1 45 ? 158.457 4.856   6.504   1.00 0.00 ? 44 TYR A H    2  
ATOM 2284  H HA   . TYR A 1 45 ? 155.902 6.053   5.764   1.00 0.00 ? 44 TYR A HA   2  
ATOM 2285  H HB2  . TYR A 1 45 ? 156.466 3.855   7.253   1.00 0.00 ? 44 TYR A HB2  2  
ATOM 2286  H HB3  . TYR A 1 45 ? 156.293 5.063   8.522   1.00 0.00 ? 44 TYR A HB3  2  
ATOM 2287  H HD1  . TYR A 1 45 ? 154.544 3.770   5.492   1.00 0.00 ? 44 TYR A HD1  2  
ATOM 2288  H HD2  . TYR A 1 45 ? 154.174 5.564   9.331   1.00 0.00 ? 44 TYR A HD2  2  
ATOM 2289  H HE1  . TYR A 1 45 ? 152.098 3.556   5.349   1.00 0.00 ? 44 TYR A HE1  2  
ATOM 2290  H HE2  . TYR A 1 45 ? 151.728 5.356   9.200   1.00 0.00 ? 44 TYR A HE2  2  
ATOM 2291  H HH   . TYR A 1 45 ? 150.102 3.600   7.747   1.00 0.00 ? 44 TYR A HH   2  
ATOM 2292  N N    . MET A 1 46 ? 156.004 8.191   6.999   1.00 0.00 ? 45 MET A N    2  
ATOM 2293  C CA   . MET A 1 46 ? 156.092 9.495   7.651   1.00 0.00 ? 45 MET A CA   2  
ATOM 2294  C C    . MET A 1 46 ? 154.726 9.935   8.170   1.00 0.00 ? 45 MET A C    2  
ATOM 2295  O O    . MET A 1 46 ? 153.794 10.140  7.390   1.00 0.00 ? 45 MET A O    2  
ATOM 2296  C CB   . MET A 1 46 ? 156.643 10.540  6.676   1.00 0.00 ? 45 MET A CB   2  
ATOM 2297  C CG   . MET A 1 46 ? 158.145 10.747  6.791   1.00 0.00 ? 45 MET A CG   2  
ATOM 2298  S SD   . MET A 1 46 ? 158.612 12.489  6.770   1.00 0.00 ? 45 MET A SD   2  
ATOM 2299  C CE   . MET A 1 46 ? 159.411 12.611  5.171   1.00 0.00 ? 45 MET A CE   2  
ATOM 2300  H H    . MET A 1 46 ? 155.326 8.052   6.304   1.00 0.00 ? 45 MET A H    2  
ATOM 2301  H HA   . MET A 1 46 ? 156.769 9.404   8.487   1.00 0.00 ? 45 MET A HA   2  
ATOM 2302  H HB2  . MET A 1 46 ? 156.421 10.228  5.666   1.00 0.00 ? 45 MET A HB2  2  
ATOM 2303  H HB3  . MET A 1 46 ? 156.155 11.486  6.866   1.00 0.00 ? 45 MET A HB3  2  
ATOM 2304  H HG2  . MET A 1 46 ? 158.485 10.311  7.719   1.00 0.00 ? 45 MET A HG2  2  
ATOM 2305  H HG3  . MET A 1 46 ? 158.627 10.248  5.963   1.00 0.00 ? 45 MET A HG3  2  
ATOM 2306  H HE1  . MET A 1 46 ? 160.478 12.699  5.307   1.00 0.00 ? 45 MET A HE1  2  
ATOM 2307  H HE2  . MET A 1 46 ? 159.042 13.483  4.650   1.00 0.00 ? 45 MET A HE2  2  
ATOM 2308  H HE3  . MET A 1 46 ? 159.194 11.727  4.591   1.00 0.00 ? 45 MET A HE3  2  
ATOM 2309  N N    . ASN A 1 47 ? 154.615 10.082  9.489   1.00 0.00 ? 46 ASN A N    2  
ATOM 2310  C CA   . ASN A 1 47 ? 153.361 10.504  10.112  1.00 0.00 ? 46 ASN A CA   2  
ATOM 2311  C C    . ASN A 1 47 ? 153.162 12.010  9.944   1.00 0.00 ? 46 ASN A C    2  
ATOM 2312  O O    . ASN A 1 47 ? 152.099 12.463  9.517   1.00 0.00 ? 46 ASN A O    2  
ATOM 2313  C CB   . ASN A 1 47 ? 153.353 10.134  11.598  1.00 0.00 ? 46 ASN A CB   2  
ATOM 2314  C CG   . ASN A 1 47 ? 152.115 9.354   11.995  1.00 0.00 ? 46 ASN A CG   2  
ATOM 2315  O OD1  . ASN A 1 47 ? 151.094 9.935   12.360  1.00 0.00 ? 46 ASN A OD1  2  
ATOM 2316  N ND2  . ASN A 1 47 ? 152.197 8.028   11.927  1.00 0.00 ? 46 ASN A ND2  2  
ATOM 2317  H H    . ASN A 1 47 ? 155.396 9.908   10.057  1.00 0.00 ? 46 ASN A H    2  
ATOM 2318  H HA   . ASN A 1 47 ? 152.553 9.987   9.615   1.00 0.00 ? 46 ASN A HA   2  
ATOM 2319  H HB2  . ASN A 1 47 ? 154.221 9.530   11.816  1.00 0.00 ? 46 ASN A HB2  2  
ATOM 2320  H HB3  . ASN A 1 47 ? 153.392 11.038  12.189  1.00 0.00 ? 46 ASN A HB3  2  
ATOM 2321  H HD21 . ASN A 1 47 ? 153.041 7.630   11.629  1.00 0.00 ? 46 ASN A HD21 2  
ATOM 2322  H HD22 . ASN A 1 47 ? 151.409 7.503   12.178  1.00 0.00 ? 46 ASN A HD22 2  
ATOM 2323  N N    . ASN A 1 48 ? 154.204 12.774  10.274  1.00 0.00 ? 47 ASN A N    2  
ATOM 2324  C CA   . ASN A 1 48 ? 154.174 14.231  10.156  1.00 0.00 ? 47 ASN A CA   2  
ATOM 2325  C C    . ASN A 1 48 ? 155.556 14.818  10.434  1.00 0.00 ? 47 ASN A C    2  
ATOM 2326  O O    . ASN A 1 48 ? 156.167 15.431  9.558   1.00 0.00 ? 47 ASN A O    2  
ATOM 2327  C CB   . ASN A 1 48 ? 153.142 14.838  11.115  1.00 0.00 ? 47 ASN A CB   2  
ATOM 2328  C CG   . ASN A 1 48 ? 152.647 16.193  10.643  1.00 0.00 ? 47 ASN A CG   2  
ATOM 2329  O OD1  . ASN A 1 48 ? 151.671 16.284  9.900   1.00 0.00 ? 47 ASN A OD1  2  
ATOM 2330  N ND2  . ASN A 1 48 ? 153.322 17.255  11.072  1.00 0.00 ? 47 ASN A ND2  2  
ATOM 2331  H H    . ASN A 1 48 ? 155.022 12.344  10.599  1.00 0.00 ? 47 ASN A H    2  
ATOM 2332  H HA   . ASN A 1 48 ? 153.894 14.472  9.141   1.00 0.00 ? 47 ASN A HA   2  
ATOM 2333  H HB2  . ASN A 1 48 ? 152.294 14.174  11.193  1.00 0.00 ? 47 ASN A HB2  2  
ATOM 2334  H HB3  . ASN A 1 48 ? 153.591 14.959  12.090  1.00 0.00 ? 47 ASN A HB3  2  
ATOM 2335  H HD21 . ASN A 1 48 ? 154.092 17.109  11.662  1.00 0.00 ? 47 ASN A HD21 2  
ATOM 2336  H HD22 . ASN A 1 48 ? 153.025 18.140  10.777  1.00 0.00 ? 47 ASN A HD22 2  
ATOM 2337  N N    . GLU A 1 49 ? 156.041 14.621  11.660  1.00 0.00 ? 48 GLU A N    2  
ATOM 2338  C CA   . GLU A 1 49 ? 157.353 15.125  12.064  1.00 0.00 ? 48 GLU A CA   2  
ATOM 2339  C C    . GLU A 1 49 ? 158.367 13.988  12.250  1.00 0.00 ? 48 GLU A C    2  
ATOM 2340  O O    . GLU A 1 49 ? 159.576 14.214  12.166  1.00 0.00 ? 48 GLU A O    2  
ATOM 2341  C CB   . GLU A 1 49 ? 157.229 15.928  13.362  1.00 0.00 ? 48 GLU A CB   2  
ATOM 2342  C CG   . GLU A 1 49 ? 157.359 17.430  13.163  1.00 0.00 ? 48 GLU A CG   2  
ATOM 2343  C CD   . GLU A 1 49 ? 156.267 18.209  13.871  1.00 0.00 ? 48 GLU A CD   2  
ATOM 2344  O OE1  . GLU A 1 49 ? 156.422 18.485  15.080  1.00 0.00 ? 48 GLU A OE1  2  
ATOM 2345  O OE2  . GLU A 1 49 ? 155.257 18.543  13.217  1.00 0.00 ? 48 GLU A OE2  2  
ATOM 2346  H H    . GLU A 1 49 ? 155.502 14.124  12.310  1.00 0.00 ? 48 GLU A H    2  
ATOM 2347  H HA   . GLU A 1 49 ? 157.708 15.780  11.283  1.00 0.00 ? 48 GLU A HA   2  
ATOM 2348  H HB2  . GLU A 1 49 ? 156.265 15.727  13.806  1.00 0.00 ? 48 GLU A HB2  2  
ATOM 2349  H HB3  . GLU A 1 49 ? 158.003 15.609  14.044  1.00 0.00 ? 48 GLU A HB3  2  
ATOM 2350  H HG2  . GLU A 1 49 ? 158.315 17.749  13.549  1.00 0.00 ? 48 GLU A HG2  2  
ATOM 2351  H HG3  . GLU A 1 49 ? 157.307 17.647  12.106  1.00 0.00 ? 48 GLU A HG3  2  
ATOM 2352  N N    . LEU A 1 50 ? 157.875 12.771  12.511  1.00 0.00 ? 49 LEU A N    2  
ATOM 2353  C CA   . LEU A 1 50 ? 158.747 11.616  12.717  1.00 0.00 ? 49 LEU A CA   2  
ATOM 2354  C C    . LEU A 1 50 ? 158.777 10.708  11.488  1.00 0.00 ? 49 LEU A C    2  
ATOM 2355  O O    . LEU A 1 50 ? 157.751 10.489  10.838  1.00 0.00 ? 49 LEU A O    2  
ATOM 2356  C CB   . LEU A 1 50 ? 158.286 10.816  13.943  1.00 0.00 ? 49 LEU A CB   2  
ATOM 2357  C CG   . LEU A 1 50 ? 159.311 10.701  15.076  1.00 0.00 ? 49 LEU A CG   2  
ATOM 2358  C CD1  . LEU A 1 50 ? 160.604 10.072  14.574  1.00 0.00 ? 49 LEU A CD1  2  
ATOM 2359  C CD2  . LEU A 1 50 ? 159.581 12.066  15.696  1.00 0.00 ? 49 LEU A CD2  2  
ATOM 2360  H H    . LEU A 1 50 ? 156.907 12.648  12.574  1.00 0.00 ? 49 LEU A H    2  
ATOM 2361  H HA   . LEU A 1 50 ? 159.745 11.986  12.898  1.00 0.00 ? 49 LEU A HA   2  
ATOM 2362  H HB2  . LEU A 1 50 ? 157.396 11.286  14.338  1.00 0.00 ? 49 LEU A HB2  2  
ATOM 2363  H HB3  . LEU A 1 50 ? 158.028 9.819   13.619  1.00 0.00 ? 49 LEU A HB3  2  
ATOM 2364  H HG   . LEU A 1 50 ? 158.910 10.059  15.847  1.00 0.00 ? 49 LEU A HG   2  
ATOM 2365  H HD11 . LEU A 1 50 ? 160.390 9.432   13.730  1.00 0.00 ? 49 LEU A HD11 2  
ATOM 2366  H HD12 . LEU A 1 50 ? 161.051 9.488   15.364  1.00 0.00 ? 49 LEU A HD12 2  
ATOM 2367  H HD13 . LEU A 1 50 ? 161.289 10.850  14.270  1.00 0.00 ? 49 LEU A HD13 2  
ATOM 2368  H HD21 . LEU A 1 50 ? 158.720 12.703  15.554  1.00 0.00 ? 49 LEU A HD21 2  
ATOM 2369  H HD22 . LEU A 1 50 ? 160.441 12.514  15.222  1.00 0.00 ? 49 LEU A HD22 2  
ATOM 2370  H HD23 . LEU A 1 50 ? 159.772 11.950  16.753  1.00 0.00 ? 49 LEU A HD23 2  
ATOM 2371  N N    . SER A 1 51 ? 159.964 10.179  11.183  1.00 0.00 ? 50 SER A N    2  
ATOM 2372  C CA   . SER A 1 51 ? 160.149 9.286   10.040  1.00 0.00 ? 50 SER A CA   2  
ATOM 2373  C C    . SER A 1 51 ? 160.437 7.857   10.503  1.00 0.00 ? 50 SER A C    2  
ATOM 2374  O O    . SER A 1 51 ? 161.335 7.629   11.316  1.00 0.00 ? 50 SER A O    2  
ATOM 2375  C CB   . SER A 1 51 ? 161.296 9.785   9.154   1.00 0.00 ? 50 SER A CB   2  
ATOM 2376  O OG   . SER A 1 51 ? 160.884 9.899   7.802   1.00 0.00 ? 50 SER A OG   2  
ATOM 2377  H H    . SER A 1 51 ? 160.736 10.393  11.747  1.00 0.00 ? 50 SER A H    2  
ATOM 2378  H HA   . SER A 1 51 ? 159.235 9.289   9.466   1.00 0.00 ? 50 SER A HA   2  
ATOM 2379  H HB2  . SER A 1 51 ? 161.622 10.754  9.502   1.00 0.00 ? 50 SER A HB2  2  
ATOM 2380  H HB3  . SER A 1 51 ? 162.120 9.088   9.209   1.00 0.00 ? 50 SER A HB3  2  
ATOM 2381  H HG   . SER A 1 51 ? 160.913 10.821  7.536   1.00 0.00 ? 50 SER A HG   2  
ATOM 2382  N N    . ILE A 1 52 ? 159.673 6.899   9.974   1.00 0.00 ? 51 ILE A N    2  
ATOM 2383  C CA   . ILE A 1 52 ? 159.844 5.488   10.323  1.00 0.00 ? 51 ILE A CA   2  
ATOM 2384  C C    . ILE A 1 52 ? 160.128 4.651   9.074   1.00 0.00 ? 51 ILE A C    2  
ATOM 2385  O O    . ILE A 1 52 ? 159.445 4.786   8.058   1.00 0.00 ? 51 ILE A O    2  
ATOM 2386  C CB   . ILE A 1 52 ? 158.593 4.920   11.035  1.00 0.00 ? 51 ILE A CB   2  
ATOM 2387  C CG1  . ILE A 1 52 ? 158.159 5.837   12.186  1.00 0.00 ? 51 ILE A CG1  2  
ATOM 2388  C CG2  . ILE A 1 52 ? 158.866 3.514   11.553  1.00 0.00 ? 51 ILE A CG2  2  
ATOM 2389  C CD1  . ILE A 1 52 ? 156.659 6.019   12.284  1.00 0.00 ? 51 ILE A CD1  2  
ATOM 2390  H H    . ILE A 1 52 ? 158.978 7.146   9.327   1.00 0.00 ? 51 ILE A H    2  
ATOM 2391  H HA   . ILE A 1 52 ? 160.685 5.410   10.997  1.00 0.00 ? 51 ILE A HA   2  
ATOM 2392  H HB   . ILE A 1 52 ? 157.796 4.859   10.312  1.00 0.00 ? 51 ILE A HB   2  
ATOM 2393  H HG12 . ILE A 1 52 ? 158.502 5.419   13.120  1.00 0.00 ? 51 ILE A HG12 2  
ATOM 2394  H HG13 . ILE A 1 52 ? 158.603 6.812   12.051  1.00 0.00 ? 51 ILE A HG13 2  
ATOM 2395  H HG21 . ILE A 1 52 ? 159.443 2.965   10.823  1.00 0.00 ? 51 ILE A HG21 2  
ATOM 2396  H HG22 . ILE A 1 52 ? 157.929 3.006   11.726  1.00 0.00 ? 51 ILE A HG22 2  
ATOM 2397  H HG23 . ILE A 1 52 ? 159.419 3.571   12.479  1.00 0.00 ? 51 ILE A HG23 2  
ATOM 2398  H HD11 . ILE A 1 52 ? 156.438 6.830   12.962  1.00 0.00 ? 51 ILE A HD11 2  
ATOM 2399  H HD12 . ILE A 1 52 ? 156.210 5.108   12.653  1.00 0.00 ? 51 ILE A HD12 2  
ATOM 2400  H HD13 . ILE A 1 52 ? 156.259 6.248   11.307  1.00 0.00 ? 51 ILE A HD13 2  
ATOM 2401  N N    . LEU A 1 53 ? 161.138 3.786   9.159   1.00 0.00 ? 52 LEU A N    2  
ATOM 2402  C CA   . LEU A 1 53 ? 161.512 2.927   8.036   1.00 0.00 ? 52 LEU A CA   2  
ATOM 2403  C C    . LEU A 1 53 ? 160.847 1.555   8.154   1.00 0.00 ? 52 LEU A C    2  
ATOM 2404  O O    . LEU A 1 53 ? 160.829 0.957   9.231   1.00 0.00 ? 52 LEU A O    2  
ATOM 2405  C CB   . LEU A 1 53 ? 163.035 2.768   7.974   1.00 0.00 ? 52 LEU A CB   2  
ATOM 2406  C CG   . LEU A 1 53 ? 163.582 2.234   6.647   1.00 0.00 ? 52 LEU A CG   2  
ATOM 2407  C CD1  . LEU A 1 53 ? 164.978 2.778   6.382   1.00 0.00 ? 52 LEU A CD1  2  
ATOM 2408  C CD2  . LEU A 1 53 ? 163.594 0.712   6.648   1.00 0.00 ? 52 LEU A CD2  2  
ATOM 2409  H H    . LEU A 1 53 ? 161.642 3.723   9.995   1.00 0.00 ? 52 LEU A H    2  
ATOM 2410  H HA   . LEU A 1 53 ? 161.172 3.401   7.127   1.00 0.00 ? 52 LEU A HA   2  
ATOM 2411  H HB2  . LEU A 1 53 ? 163.483 3.734   8.161   1.00 0.00 ? 52 LEU A HB2  2  
ATOM 2412  H HB3  . LEU A 1 53 ? 163.338 2.093   8.761   1.00 0.00 ? 52 LEU A HB3  2  
ATOM 2413  H HG   . LEU A 1 53 ? 162.939 2.562   5.844   1.00 0.00 ? 52 LEU A HG   2  
ATOM 2414  H HD11 . LEU A 1 53 ? 165.332 2.409   5.430   1.00 0.00 ? 52 LEU A HD11 2  
ATOM 2415  H HD12 . LEU A 1 53 ? 165.647 2.454   7.165   1.00 0.00 ? 52 LEU A HD12 2  
ATOM 2416  H HD13 . LEU A 1 53 ? 164.946 3.857   6.359   1.00 0.00 ? 52 LEU A HD13 2  
ATOM 2417  H HD21 . LEU A 1 53 ? 162.584 0.343   6.549   1.00 0.00 ? 52 LEU A HD21 2  
ATOM 2418  H HD22 . LEU A 1 53 ? 164.019 0.354   7.574   1.00 0.00 ? 52 LEU A HD22 2  
ATOM 2419  H HD23 . LEU A 1 53 ? 164.188 0.356   5.819   1.00 0.00 ? 52 LEU A HD23 2  
ATOM 2420  N N    . LEU A 1 54 ? 160.303 1.063   7.041   1.00 0.00 ? 53 LEU A N    2  
ATOM 2421  C CA   . LEU A 1 54 ? 159.639 -0.239  7.020   1.00 0.00 ? 53 LEU A CA   2  
ATOM 2422  C C    . LEU A 1 54 ? 160.584 -1.325  6.514   1.00 0.00 ? 53 LEU A C    2  
ATOM 2423  O O    . LEU A 1 54 ? 160.914 -1.367  5.328   1.00 0.00 ? 53 LEU A O    2  
ATOM 2424  C CB   . LEU A 1 54 ? 158.386 -0.181  6.140   1.00 0.00 ? 53 LEU A CB   2  
ATOM 2425  C CG   . LEU A 1 54 ? 157.234 0.649   6.713   1.00 0.00 ? 53 LEU A CG   2  
ATOM 2426  C CD1  . LEU A 1 54 ? 156.699 1.624   5.674   1.00 0.00 ? 53 LEU A CD1  2  
ATOM 2427  C CD2  . LEU A 1 54 ? 156.122 -0.257  7.217   1.00 0.00 ? 53 LEU A CD2  2  
ATOM 2428  H H    . LEU A 1 54 ? 160.351 1.586   6.213   1.00 0.00 ? 53 LEU A H    2  
ATOM 2429  H HA   . LEU A 1 54 ? 159.345 -0.478  8.032   1.00 0.00 ? 53 LEU A HA   2  
ATOM 2430  H HB2  . LEU A 1 54 ? 158.665 0.234   5.183   1.00 0.00 ? 53 LEU A HB2  2  
ATOM 2431  H HB3  . LEU A 1 54 ? 158.034 -1.190  5.987   1.00 0.00 ? 53 LEU A HB3  2  
ATOM 2432  H HG   . LEU A 1 54 ? 157.599 1.225   7.550   1.00 0.00 ? 53 LEU A HG   2  
ATOM 2433  H HD11 . LEU A 1 54 ? 155.789 2.074   6.039   1.00 0.00 ? 53 LEU A HD11 2  
ATOM 2434  H HD12 . LEU A 1 54 ? 156.496 1.096   4.754   1.00 0.00 ? 53 LEU A HD12 2  
ATOM 2435  H HD13 . LEU A 1 54 ? 157.434 2.394   5.491   1.00 0.00 ? 53 LEU A HD13 2  
ATOM 2436  H HD21 . LEU A 1 54 ? 155.634 0.208   8.061   1.00 0.00 ? 53 LEU A HD21 2  
ATOM 2437  H HD22 . LEU A 1 54 ? 156.540 -1.206  7.522   1.00 0.00 ? 53 LEU A HD22 2  
ATOM 2438  H HD23 . LEU A 1 54 ? 155.402 -0.418  6.429   1.00 0.00 ? 53 LEU A HD23 2  
ATOM 2439  N N    . LYS A 1 55 ? 161.015 -2.199  7.422   1.00 0.00 ? 54 LYS A N    2  
ATOM 2440  C CA   . LYS A 1 55 ? 161.925 -3.287  7.073   1.00 0.00 ? 54 LYS A CA   2  
ATOM 2441  C C    . LYS A 1 55 ? 161.205 -4.638  7.088   1.00 0.00 ? 54 LYS A C    2  
ATOM 2442  O O    . LYS A 1 55 ? 161.438 -5.482  6.220   1.00 0.00 ? 54 LYS A O    2  
ATOM 2443  C CB   . LYS A 1 55 ? 163.108 -3.311  8.045   1.00 0.00 ? 54 LYS A CB   2  
ATOM 2444  C CG   . LYS A 1 55 ? 164.117 -4.415  7.763   1.00 0.00 ? 54 LYS A CG   2  
ATOM 2445  C CD   . LYS A 1 55 ? 165.205 -3.951  6.806   1.00 0.00 ? 54 LYS A CD   2  
ATOM 2446  C CE   . LYS A 1 55 ? 166.032 -5.119  6.288   1.00 0.00 ? 54 LYS A CE   2  
ATOM 2447  N NZ   . LYS A 1 55 ? 165.281 -5.942  5.297   1.00 0.00 ? 54 LYS A NZ   2  
ATOM 2448  H H    . LYS A 1 55 ? 160.717 -2.109  8.352   1.00 0.00 ? 54 LYS A H    2  
ATOM 2449  H HA   . LYS A 1 55 ? 162.294 -3.103  6.077   1.00 0.00 ? 54 LYS A HA   2  
ATOM 2450  H HB2  . LYS A 1 55 ? 163.621 -2.362  7.990   1.00 0.00 ? 54 LYS A HB2  2  
ATOM 2451  H HB3  . LYS A 1 55 ? 162.730 -3.447  9.047   1.00 0.00 ? 54 LYS A HB3  2  
ATOM 2452  H HG2  . LYS A 1 55 ? 164.574 -4.714  8.693   1.00 0.00 ? 54 LYS A HG2  2  
ATOM 2453  H HG3  . LYS A 1 55 ? 163.601 -5.258  7.326   1.00 0.00 ? 54 LYS A HG3  2  
ATOM 2454  H HD2  . LYS A 1 55 ? 164.745 -3.450  5.968   1.00 0.00 ? 54 LYS A HD2  2  
ATOM 2455  H HD3  . LYS A 1 55 ? 165.857 -3.263  7.325   1.00 0.00 ? 54 LYS A HD3  2  
ATOM 2456  H HE2  . LYS A 1 55 ? 166.924 -4.731  5.818   1.00 0.00 ? 54 LYS A HE2  2  
ATOM 2457  H HE3  . LYS A 1 55 ? 166.312 -5.744  7.124   1.00 0.00 ? 54 LYS A HE3  2  
ATOM 2458  H HZ1  . LYS A 1 55 ? 165.935 -6.333  4.589   1.00 0.00 ? 54 LYS A HZ1  2  
ATOM 2459  H HZ2  . LYS A 1 55 ? 164.571 -5.359  4.811   1.00 0.00 ? 54 LYS A HZ2  2  
ATOM 2460  H HZ3  . LYS A 1 55 ? 164.798 -6.727  5.778   1.00 0.00 ? 54 LYS A HZ3  2  
ATOM 2461  N N    . ASN A 1 56 ? 160.343 -4.836  8.084   1.00 0.00 ? 55 ASN A N    2  
ATOM 2462  C CA   . ASN A 1 56 ? 159.595 -6.086  8.229   1.00 0.00 ? 55 ASN A CA   2  
ATOM 2463  C C    . ASN A 1 56 ? 158.100 -5.825  8.420   1.00 0.00 ? 55 ASN A C    2  
ATOM 2464  O O    . ASN A 1 56 ? 157.658 -4.675  8.451   1.00 0.00 ? 55 ASN A O    2  
ATOM 2465  C CB   . ASN A 1 56 ? 160.143 -6.893  9.414   1.00 0.00 ? 55 ASN A CB   2  
ATOM 2466  C CG   . ASN A 1 56 ? 160.054 -6.145  10.736  1.00 0.00 ? 55 ASN A CG   2  
ATOM 2467  O OD1  . ASN A 1 56 ? 159.849 -4.931  10.766  1.00 0.00 ? 55 ASN A OD1  2  
ATOM 2468  N ND2  . ASN A 1 56 ? 160.207 -6.870  11.840  1.00 0.00 ? 55 ASN A ND2  2  
ATOM 2469  H H    . ASN A 1 56 ? 160.213 -4.126  8.747   1.00 0.00 ? 55 ASN A H    2  
ATOM 2470  H HA   . ASN A 1 56 ? 159.732 -6.659  7.325   1.00 0.00 ? 55 ASN A HA   2  
ATOM 2471  H HB2  . ASN A 1 56 ? 159.582 -7.811  9.505   1.00 0.00 ? 55 ASN A HB2  2  
ATOM 2472  H HB3  . ASN A 1 56 ? 161.181 -7.130  9.228   1.00 0.00 ? 55 ASN A HB3  2  
ATOM 2473  H HD21 . ASN A 1 56 ? 160.367 -7.832  11.746  1.00 0.00 ? 55 ASN A HD21 2  
ATOM 2474  H HD22 . ASN A 1 56 ? 160.155 -6.411  12.703  1.00 0.00 ? 55 ASN A HD22 2  
ATOM 2475  N N    . GLN A 1 57 ? 157.327 -6.907  8.555   1.00 0.00 ? 56 GLN A N    2  
ATOM 2476  C CA   . GLN A 1 57 ? 155.881 -6.805  8.752   1.00 0.00 ? 56 GLN A CA   2  
ATOM 2477  C C    . GLN A 1 57 ? 155.551 -6.059  10.044  1.00 0.00 ? 56 GLN A C    2  
ATOM 2478  O O    . GLN A 1 57 ? 154.524 -5.387  10.130  1.00 0.00 ? 56 GLN A O    2  
ATOM 2479  C CB   . GLN A 1 57 ? 155.241 -8.196  8.782   1.00 0.00 ? 56 GLN A CB   2  
ATOM 2480  C CG   . GLN A 1 57 ? 154.223 -8.422  7.676   1.00 0.00 ? 56 GLN A CG   2  
ATOM 2481  C CD   . GLN A 1 57 ? 152.838 -7.914  8.033   1.00 0.00 ? 56 GLN A CD   2  
ATOM 2482  O OE1  . GLN A 1 57 ? 152.527 -7.678  9.200   1.00 0.00 ? 56 GLN A OE1  2  
ATOM 2483  N NE2  . GLN A 1 57 ? 151.996 -7.748  7.020   1.00 0.00 ? 56 GLN A NE2  2  
ATOM 2484  H H    . GLN A 1 57 ? 157.741 -7.795  8.526   1.00 0.00 ? 56 GLN A H    2  
ATOM 2485  H HA   . GLN A 1 57 ? 155.474 -6.251  7.920   1.00 0.00 ? 56 GLN A HA   2  
ATOM 2486  H HB2  . GLN A 1 57 ? 156.016 -8.940  8.684   1.00 0.00 ? 56 GLN A HB2  2  
ATOM 2487  H HB3  . GLN A 1 57 ? 154.744 -8.330  9.731   1.00 0.00 ? 56 GLN A HB3  2  
ATOM 2488  H HG2  . GLN A 1 57 ? 154.557 -7.908  6.787   1.00 0.00 ? 56 GLN A HG2  2  
ATOM 2489  H HG3  . GLN A 1 57 ? 154.161 -9.481  7.476   1.00 0.00 ? 56 GLN A HG3  2  
ATOM 2490  H HE21 . GLN A 1 57 ? 152.310 -7.958  6.116   1.00 0.00 ? 56 GLN A HE21 2  
ATOM 2491  H HE22 . GLN A 1 57 ? 151.093 -7.426  7.217   1.00 0.00 ? 56 GLN A HE22 2  
ATOM 2492  N N    . ASP A 1 58 ? 156.427 -6.181  11.045  1.00 0.00 ? 57 ASP A N    2  
ATOM 2493  C CA   . ASP A 1 58 ? 156.226 -5.514  12.331  1.00 0.00 ? 57 ASP A CA   2  
ATOM 2494  C C    . ASP A 1 58 ? 156.011 -4.011  12.143  1.00 0.00 ? 57 ASP A C    2  
ATOM 2495  O O    . ASP A 1 58 ? 155.089 -3.434  12.720  1.00 0.00 ? 57 ASP A O    2  
ATOM 2496  C CB   . ASP A 1 58 ? 157.423 -5.757  13.256  1.00 0.00 ? 57 ASP A CB   2  
ATOM 2497  C CG   . ASP A 1 58 ? 156.997 -6.117  14.666  1.00 0.00 ? 57 ASP A CG   2  
ATOM 2498  O OD1  . ASP A 1 58 ? 156.596 -7.280  14.886  1.00 0.00 ? 57 ASP A OD1  2  
ATOM 2499  O OD2  . ASP A 1 58 ? 157.065 -5.237  15.551  1.00 0.00 ? 57 ASP A OD2  2  
ATOM 2500  H H    . ASP A 1 58 ? 157.226 -6.735  10.914  1.00 0.00 ? 57 ASP A H    2  
ATOM 2501  H HA   . ASP A 1 58 ? 155.341 -5.937  12.787  1.00 0.00 ? 57 ASP A HA   2  
ATOM 2502  H HB2  . ASP A 1 58 ? 158.020 -6.567  12.863  1.00 0.00 ? 57 ASP A HB2  2  
ATOM 2503  H HB3  . ASP A 1 58 ? 158.025 -4.860  13.299  1.00 0.00 ? 57 ASP A HB3  2  
ATOM 2504  N N    . ASP A 1 59 ? 156.862 -3.387  11.325  1.00 0.00 ? 58 ASP A N    2  
ATOM 2505  C CA   . ASP A 1 59 ? 156.758 -1.952  11.055  1.00 0.00 ? 58 ASP A CA   2  
ATOM 2506  C C    . ASP A 1 59 ? 155.501 -1.641  10.241  1.00 0.00 ? 58 ASP A C    2  
ATOM 2507  O O    . ASP A 1 59 ? 154.844 -0.621  10.458  1.00 0.00 ? 58 ASP A O    2  
ATOM 2508  C CB   . ASP A 1 59 ? 158.001 -1.458  10.306  1.00 0.00 ? 58 ASP A CB   2  
ATOM 2509  C CG   . ASP A 1 59 ? 159.253 -1.469  11.166  1.00 0.00 ? 58 ASP A CG   2  
ATOM 2510  O OD1  . ASP A 1 59 ? 159.176 -1.045  12.341  1.00 0.00 ? 58 ASP A OD1  2  
ATOM 2511  O OD2  . ASP A 1 59 ? 160.311 -1.902  10.663  1.00 0.00 ? 58 ASP A OD2  2  
ATOM 2512  H H    . ASP A 1 59 ? 157.572 -3.905  10.890  1.00 0.00 ? 58 ASP A H    2  
ATOM 2513  H HA   . ASP A 1 59 ? 156.691 -1.441  12.003  1.00 0.00 ? 58 ASP A HA   2  
ATOM 2514  H HB2  . ASP A 1 59 ? 158.174 -2.096  9.451   1.00 0.00 ? 58 ASP A HB2  2  
ATOM 2515  H HB3  . ASP A 1 59 ? 157.830 -0.448  9.966   1.00 0.00 ? 58 ASP A HB3  2  
ATOM 2516  N N    . LEU A 1 60 ? 155.171 -2.533  9.306   1.00 0.00 ? 59 LEU A N    2  
ATOM 2517  C CA   . LEU A 1 60 ? 153.991 -2.366  8.462   1.00 0.00 ? 59 LEU A CA   2  
ATOM 2518  C C    . LEU A 1 60 ? 152.711 -2.478  9.290   1.00 0.00 ? 59 LEU A C    2  
ATOM 2519  O O    . LEU A 1 60 ? 151.784 -1.687  9.121   1.00 0.00 ? 59 LEU A O    2  
ATOM 2520  C CB   . LEU A 1 60 ? 153.988 -3.413  7.345   1.00 0.00 ? 59 LEU A CB   2  
ATOM 2521  C CG   . LEU A 1 60 ? 152.939 -3.194  6.252   1.00 0.00 ? 59 LEU A CG   2  
ATOM 2522  C CD1  . LEU A 1 60 ? 153.544 -2.442  5.075   1.00 0.00 ? 59 LEU A CD1  2  
ATOM 2523  C CD2  . LEU A 1 60 ? 152.360 -4.528  5.800   1.00 0.00 ? 59 LEU A CD2  2  
ATOM 2524  H H    . LEU A 1 60 ? 155.733 -3.327  9.185   1.00 0.00 ? 59 LEU A H    2  
ATOM 2525  H HA   . LEU A 1 60 ? 154.036 -1.381  8.022   1.00 0.00 ? 59 LEU A HA   2  
ATOM 2526  H HB2  . LEU A 1 60 ? 154.965 -3.418  6.883   1.00 0.00 ? 59 LEU A HB2  2  
ATOM 2527  H HB3  . LEU A 1 60 ? 153.815 -4.381  7.790   1.00 0.00 ? 59 LEU A HB3  2  
ATOM 2528  H HG   . LEU A 1 60 ? 152.132 -2.597  6.649   1.00 0.00 ? 59 LEU A HG   2  
ATOM 2529  H HD11 . LEU A 1 60 ? 154.115 -1.602  5.441   1.00 0.00 ? 59 LEU A HD11 2  
ATOM 2530  H HD12 . LEU A 1 60 ? 152.754 -2.086  4.430   1.00 0.00 ? 59 LEU A HD12 2  
ATOM 2531  H HD13 . LEU A 1 60 ? 154.193 -3.103  4.519   1.00 0.00 ? 59 LEU A HD13 2  
ATOM 2532  H HD21 . LEU A 1 60 ? 151.796 -4.968  6.610   1.00 0.00 ? 59 LEU A HD21 2  
ATOM 2533  H HD22 . LEU A 1 60 ? 153.163 -5.194  5.520   1.00 0.00 ? 59 LEU A HD22 2  
ATOM 2534  H HD23 . LEU A 1 60 ? 151.710 -4.371  4.952   1.00 0.00 ? 59 LEU A HD23 2  
ATOM 2535  N N    . ASP A 1 61 ? 152.671 -3.466  10.186  1.00 0.00 ? 60 ASP A N    2  
ATOM 2536  C CA   . ASP A 1 61 ? 151.507 -3.686  11.045  1.00 0.00 ? 60 ASP A CA   2  
ATOM 2537  C C    . ASP A 1 61 ? 151.321 -2.532  12.027  1.00 0.00 ? 60 ASP A C    2  
ATOM 2538  O O    . ASP A 1 61 ? 150.194 -2.134  12.322  1.00 0.00 ? 60 ASP A O    2  
ATOM 2539  C CB   . ASP A 1 61 ? 151.648 -5.001  11.816  1.00 0.00 ? 60 ASP A CB   2  
ATOM 2540  C CG   . ASP A 1 61 ? 150.306 -5.561  12.246  1.00 0.00 ? 60 ASP A CG   2  
ATOM 2541  O OD1  . ASP A 1 61 ? 149.763 -5.087  13.266  1.00 0.00 ? 60 ASP A OD1  2  
ATOM 2542  O OD2  . ASP A 1 61 ? 149.796 -6.472  11.563  1.00 0.00 ? 60 ASP A OD2  2  
ATOM 2543  H H    . ASP A 1 61 ? 153.448 -4.062  10.273  1.00 0.00 ? 60 ASP A H    2  
ATOM 2544  H HA   . ASP A 1 61 ? 150.635 -3.744  10.411  1.00 0.00 ? 60 ASP A HA   2  
ATOM 2545  H HB2  . ASP A 1 61 ? 152.136 -5.730  11.188  1.00 0.00 ? 60 ASP A HB2  2  
ATOM 2546  H HB3  . ASP A 1 61 ? 152.247 -4.832  12.699  1.00 0.00 ? 60 ASP A HB3  2  
ATOM 2547  N N    . LYS A 1 62 ? 152.434 -1.999  12.527  1.00 0.00 ? 61 LYS A N    2  
ATOM 2548  C CA   . LYS A 1 62 ? 152.394 -0.889  13.473  1.00 0.00 ? 61 LYS A CA   2  
ATOM 2549  C C    . LYS A 1 62 ? 151.759 0.346   12.833  1.00 0.00 ? 61 LYS A C    2  
ATOM 2550  O O    . LYS A 1 62 ? 151.023 1.085   13.488  1.00 0.00 ? 61 LYS A O    2  
ATOM 2551  C CB   . LYS A 1 62 ? 153.809 -0.564  13.955  1.00 0.00 ? 61 LYS A CB   2  
ATOM 2552  C CG   . LYS A 1 62 ? 153.875 -0.104  15.400  1.00 0.00 ? 61 LYS A CG   2  
ATOM 2553  C CD   . LYS A 1 62 ? 155.225 0.520   15.717  1.00 0.00 ? 61 LYS A CD   2  
ATOM 2554  C CE   . LYS A 1 62 ? 156.145 -0.464  16.427  1.00 0.00 ? 61 LYS A CE   2  
ATOM 2555  N NZ   . LYS A 1 62 ? 157.137 -1.080  15.498  1.00 0.00 ? 61 LYS A NZ   2  
ATOM 2556  H H    . LYS A 1 62 ? 153.303 -2.360  12.251  1.00 0.00 ? 61 LYS A H    2  
ATOM 2557  H HA   . LYS A 1 62 ? 151.794 -1.193  14.319  1.00 0.00 ? 61 LYS A HA   2  
ATOM 2558  H HB2  . LYS A 1 62 ? 154.421 -1.448  13.855  1.00 0.00 ? 61 LYS A HB2  2  
ATOM 2559  H HB3  . LYS A 1 62 ? 154.218 0.218   13.331  1.00 0.00 ? 61 LYS A HB3  2  
ATOM 2560  H HG2  . LYS A 1 62 ? 153.100 0.629   15.571  1.00 0.00 ? 61 LYS A HG2  2  
ATOM 2561  H HG3  . LYS A 1 62 ? 153.719 -0.956  16.046  1.00 0.00 ? 61 LYS A HG3  2  
ATOM 2562  H HD2  . LYS A 1 62 ? 155.692 0.830   14.793  1.00 0.00 ? 61 LYS A HD2  2  
ATOM 2563  H HD3  . LYS A 1 62 ? 155.072 1.380   16.351  1.00 0.00 ? 61 LYS A HD3  2  
ATOM 2564  H HE2  . LYS A 1 62 ? 156.676 0.061   17.207  1.00 0.00 ? 61 LYS A HE2  2  
ATOM 2565  H HE3  . LYS A 1 62 ? 155.544 -1.246  16.868  1.00 0.00 ? 61 LYS A HE3  2  
ATOM 2566  H HZ1  . LYS A 1 62 ? 157.798 -1.683  16.030  1.00 0.00 ? 61 LYS A HZ1  2  
ATOM 2567  H HZ2  . LYS A 1 62 ? 157.680 -0.341  15.008  1.00 0.00 ? 61 LYS A HZ2  2  
ATOM 2568  H HZ3  . LYS A 1 62 ? 156.649 -1.663  14.787  1.00 0.00 ? 61 LYS A HZ3  2  
ATOM 2569  N N    . ALA A 1 63 ? 152.041 0.553   11.545  1.00 0.00 ? 62 ALA A N    2  
ATOM 2570  C CA   . ALA A 1 63 ? 151.493 1.687   10.803  1.00 0.00 ? 62 ALA A CA   2  
ATOM 2571  C C    . ALA A 1 63 ? 149.973 1.576   10.672  1.00 0.00 ? 62 ALA A C    2  
ATOM 2572  O O    . ALA A 1 63 ? 149.254 2.560   10.855  1.00 0.00 ? 62 ALA A O    2  
ATOM 2573  C CB   . ALA A 1 63 ? 152.139 1.779   9.426   1.00 0.00 ? 62 ALA A CB   2  
ATOM 2574  H H    . ALA A 1 63 ? 152.628 -0.080  11.079  1.00 0.00 ? 62 ALA A H    2  
ATOM 2575  H HA   . ALA A 1 63 ? 151.732 2.589   11.348  1.00 0.00 ? 62 ALA A HA   2  
ATOM 2576  H HB1  . ALA A 1 63 ? 153.008 2.417   9.478   1.00 0.00 ? 62 ALA A HB1  2  
ATOM 2577  H HB2  . ALA A 1 63 ? 151.431 2.192   8.723   1.00 0.00 ? 62 ALA A HB2  2  
ATOM 2578  H HB3  . ALA A 1 63 ? 152.435 0.793   9.100   1.00 0.00 ? 62 ALA A HB3  2  
ATOM 2579  N N    . ILE A 1 64 ? 149.491 0.373   10.358  1.00 0.00 ? 63 ILE A N    2  
ATOM 2580  C CA   . ILE A 1 64 ? 148.055 0.136   10.207  1.00 0.00 ? 63 ILE A CA   2  
ATOM 2581  C C    . ILE A 1 64 ? 147.319 0.352   11.528  1.00 0.00 ? 63 ILE A C    2  
ATOM 2582  O O    . ILE A 1 64 ? 146.252 0.966   11.554  1.00 0.00 ? 63 ILE A O    2  
ATOM 2583  C CB   . ILE A 1 64 ? 147.751 -1.289  9.690   1.00 0.00 ? 63 ILE A CB   2  
ATOM 2584  C CG1  . ILE A 1 64 ? 148.555 -1.588  8.421   1.00 0.00 ? 63 ILE A CG1  2  
ATOM 2585  C CG2  . ILE A 1 64 ? 146.260 -1.443  9.423   1.00 0.00 ? 63 ILE A CG2  2  
ATOM 2586  C CD1  . ILE A 1 64 ? 148.333 -0.587  7.307   1.00 0.00 ? 63 ILE A CD1  2  
ATOM 2587  H H    . ILE A 1 64 ? 150.114 -0.373  10.227  1.00 0.00 ? 63 ILE A H    2  
ATOM 2588  H HA   . ILE A 1 64 ? 147.679 0.844   9.481   1.00 0.00 ? 63 ILE A HA   2  
ATOM 2589  H HB   . ILE A 1 64 ? 148.028 -1.995  10.459  1.00 0.00 ? 63 ILE A HB   2  
ATOM 2590  H HG12 . ILE A 1 64 ? 149.607 -1.584  8.662   1.00 0.00 ? 63 ILE A HG12 2  
ATOM 2591  H HG13 . ILE A 1 64 ? 148.280 -2.565  8.051   1.00 0.00 ? 63 ILE A HG13 2  
ATOM 2592  H HG21 . ILE A 1 64 ? 145.826 -0.472  9.237   1.00 0.00 ? 63 ILE A HG21 2  
ATOM 2593  H HG22 . ILE A 1 64 ? 145.784 -1.889  10.284  1.00 0.00 ? 63 ILE A HG22 2  
ATOM 2594  H HG23 . ILE A 1 64 ? 146.109 -2.076  8.561   1.00 0.00 ? 63 ILE A HG23 2  
ATOM 2595  H HD11 . ILE A 1 64 ? 149.198 0.054   7.223   1.00 0.00 ? 63 ILE A HD11 2  
ATOM 2596  H HD12 . ILE A 1 64 ? 147.461 0.012   7.529   1.00 0.00 ? 63 ILE A HD12 2  
ATOM 2597  H HD13 . ILE A 1 64 ? 148.182 -1.111  6.376   1.00 0.00 ? 63 ILE A HD13 2  
ATOM 2598  N N    . ASP A 1 65 ? 147.896 -0.154  12.622  1.00 0.00 ? 64 ASP A N    2  
ATOM 2599  C CA   . ASP A 1 65 ? 147.289 -0.012  13.946  1.00 0.00 ? 64 ASP A CA   2  
ATOM 2600  C C    . ASP A 1 65 ? 146.992 1.453   14.253  1.00 0.00 ? 64 ASP A C    2  
ATOM 2601  O O    . ASP A 1 65 ? 145.903 1.793   14.718  1.00 0.00 ? 64 ASP A O    2  
ATOM 2602  C CB   . ASP A 1 65 ? 148.215 -0.581  15.028  1.00 0.00 ? 64 ASP A CB   2  
ATOM 2603  C CG   . ASP A 1 65 ? 148.128 -2.091  15.150  1.00 0.00 ? 64 ASP A CG   2  
ATOM 2604  O OD1  . ASP A 1 65 ? 147.000 -2.629  15.113  1.00 0.00 ? 64 ASP A OD1  2  
ATOM 2605  O OD2  . ASP A 1 65 ? 149.189 -2.735  15.287  1.00 0.00 ? 64 ASP A OD2  2  
ATOM 2606  H H    . ASP A 1 65 ? 148.749 -0.633  12.535  1.00 0.00 ? 64 ASP A H    2  
ATOM 2607  H HA   . ASP A 1 65 ? 146.362 -0.564  13.948  1.00 0.00 ? 64 ASP A HA   2  
ATOM 2608  H HB2  . ASP A 1 65 ? 149.237 -0.318  14.793  1.00 0.00 ? 64 ASP A HB2  2  
ATOM 2609  H HB3  . ASP A 1 65 ? 147.949 -0.146  15.980  1.00 0.00 ? 64 ASP A HB3  2  
ATOM 2610  N N    . ILE A 1 66 ? 147.968 2.316   13.979  1.00 0.00 ? 65 ILE A N    2  
ATOM 2611  C CA   . ILE A 1 66 ? 147.817 3.747   14.218  1.00 0.00 ? 65 ILE A CA   2  
ATOM 2612  C C    . ILE A 1 66 ? 146.725 4.338   13.327  1.00 0.00 ? 65 ILE A C    2  
ATOM 2613  O O    . ILE A 1 66 ? 145.952 5.190   13.767  1.00 0.00 ? 65 ILE A O    2  
ATOM 2614  C CB   . ILE A 1 66 ? 149.140 4.510   13.977  1.00 0.00 ? 65 ILE A CB   2  
ATOM 2615  C CG1  . ILE A 1 66 ? 150.291 3.861   14.755  1.00 0.00 ? 65 ILE A CG1  2  
ATOM 2616  C CG2  . ILE A 1 66 ? 148.988 5.972   14.376  1.00 0.00 ? 65 ILE A CG2  2  
ATOM 2617  C CD1  . ILE A 1 66 ? 151.657 4.145   14.166  1.00 0.00 ? 65 ILE A CD1  2  
ATOM 2618  H H    . ILE A 1 66 ? 148.810 1.981   13.604  1.00 0.00 ? 65 ILE A H    2  
ATOM 2619  H HA   . ILE A 1 66 ? 147.533 3.882   15.252  1.00 0.00 ? 65 ILE A HA   2  
ATOM 2620  H HB   . ILE A 1 66 ? 149.363 4.473   12.921  1.00 0.00 ? 65 ILE A HB   2  
ATOM 2621  H HG12 . ILE A 1 66 ? 150.286 4.229   15.770  1.00 0.00 ? 65 ILE A HG12 2  
ATOM 2622  H HG13 . ILE A 1 66 ? 150.153 2.790   14.767  1.00 0.00 ? 65 ILE A HG13 2  
ATOM 2623  H HG21 . ILE A 1 66 ? 148.071 6.365   13.963  1.00 0.00 ? 65 ILE A HG21 2  
ATOM 2624  H HG22 . ILE A 1 66 ? 149.825 6.538   13.995  1.00 0.00 ? 65 ILE A HG22 2  
ATOM 2625  H HG23 . ILE A 1 66 ? 148.961 6.051   15.453  1.00 0.00 ? 65 ILE A HG23 2  
ATOM 2626  H HD11 . ILE A 1 66 ? 152.380 4.238   14.963  1.00 0.00 ? 65 ILE A HD11 2  
ATOM 2627  H HD12 . ILE A 1 66 ? 151.622 5.066   13.603  1.00 0.00 ? 65 ILE A HD12 2  
ATOM 2628  H HD13 . ILE A 1 66 ? 151.944 3.334   13.513  1.00 0.00 ? 65 ILE A HD13 2  
ATOM 2629  N N    . LEU A 1 67 ? 146.664 3.881   12.075  1.00 0.00 ? 66 LEU A N    2  
ATOM 2630  C CA   . LEU A 1 67 ? 145.661 4.370   11.132  1.00 0.00 ? 66 LEU A CA   2  
ATOM 2631  C C    . LEU A 1 67 ? 144.249 3.984   11.577  1.00 0.00 ? 66 LEU A C    2  
ATOM 2632  O O    . LEU A 1 67 ? 143.344 4.819   11.574  1.00 0.00 ? 66 LEU A O    2  
ATOM 2633  C CB   . LEU A 1 67 ? 145.933 3.831   9.724   1.00 0.00 ? 66 LEU A CB   2  
ATOM 2634  C CG   . LEU A 1 67 ? 145.606 4.807   8.589   1.00 0.00 ? 66 LEU A CG   2  
ATOM 2635  C CD1  . LEU A 1 67 ? 146.746 5.797   8.389   1.00 0.00 ? 66 LEU A CD1  2  
ATOM 2636  C CD2  . LEU A 1 67 ? 145.314 4.053   7.298   1.00 0.00 ? 66 LEU A CD2  2  
ATOM 2637  H H    . LEU A 1 67 ? 147.306 3.201   11.781  1.00 0.00 ? 66 LEU A H    2  
ATOM 2638  H HA   . LEU A 1 67 ? 145.732 5.448   11.111  1.00 0.00 ? 66 LEU A HA   2  
ATOM 2639  H HB2  . LEU A 1 67 ? 146.979 3.568   9.657   1.00 0.00 ? 66 LEU A HB2  2  
ATOM 2640  H HB3  . LEU A 1 67 ? 145.343 2.938   9.582   1.00 0.00 ? 66 LEU A HB3  2  
ATOM 2641  H HG   . LEU A 1 67 ? 144.722 5.371   8.854   1.00 0.00 ? 66 LEU A HG   2  
ATOM 2642  H HD11 . LEU A 1 67 ? 146.348 6.740   8.045   1.00 0.00 ? 66 LEU A HD11 2  
ATOM 2643  H HD12 . LEU A 1 67 ? 147.437 5.408   7.654   1.00 0.00 ? 66 LEU A HD12 2  
ATOM 2644  H HD13 . LEU A 1 67 ? 147.264 5.945   9.325   1.00 0.00 ? 66 LEU A HD13 2  
ATOM 2645  H HD21 . LEU A 1 67 ? 144.596 4.607   6.712   1.00 0.00 ? 66 LEU A HD21 2  
ATOM 2646  H HD22 . LEU A 1 67 ? 144.911 3.078   7.532   1.00 0.00 ? 66 LEU A HD22 2  
ATOM 2647  H HD23 . LEU A 1 67 ? 146.226 3.938   6.734   1.00 0.00 ? 66 LEU A HD23 2  
ATOM 2648  N N    . ASP A 1 68 ? 144.067 2.719   11.960  1.00 0.00 ? 67 ASP A N    2  
ATOM 2649  C CA   . ASP A 1 68 ? 142.761 2.231   12.412  1.00 0.00 ? 67 ASP A CA   2  
ATOM 2650  C C    . ASP A 1 68 ? 142.293 2.986   13.657  1.00 0.00 ? 67 ASP A C    2  
ATOM 2651  O O    . ASP A 1 68 ? 141.103 3.257   13.817  1.00 0.00 ? 67 ASP A O    2  
ATOM 2652  C CB   . ASP A 1 68 ? 142.820 0.730   12.713  1.00 0.00 ? 67 ASP A CB   2  
ATOM 2653  C CG   . ASP A 1 68 ? 142.755 -0.123  11.460  1.00 0.00 ? 67 ASP A CG   2  
ATOM 2654  O OD1  . ASP A 1 68 ? 141.673 -0.187  10.838  1.00 0.00 ? 67 ASP A OD1  2  
ATOM 2655  O OD2  . ASP A 1 68 ? 143.784 -0.732  11.104  1.00 0.00 ? 67 ASP A OD2  2  
ATOM 2656  H H    . ASP A 1 68 ? 144.828 2.100   11.942  1.00 0.00 ? 67 ASP A H    2  
ATOM 2657  H HA   . ASP A 1 68 ? 142.050 2.402   11.616  1.00 0.00 ? 67 ASP A HA   2  
ATOM 2658  H HB2  . ASP A 1 68 ? 143.742 0.509   13.226  1.00 0.00 ? 67 ASP A HB2  2  
ATOM 2659  H HB3  . ASP A 1 68 ? 141.987 0.466   13.348  1.00 0.00 ? 67 ASP A HB3  2  
ATOM 2660  N N    . ARG A 1 69 ? 143.240 3.320   14.535  1.00 0.00 ? 68 ARG A N    2  
ATOM 2661  C CA   . ARG A 1 69 ? 142.933 4.045   15.767  1.00 0.00 ? 68 ARG A CA   2  
ATOM 2662  C C    . ARG A 1 69 ? 142.302 5.409   15.471  1.00 0.00 ? 68 ARG A C    2  
ATOM 2663  O O    . ARG A 1 69 ? 141.457 5.884   16.231  1.00 0.00 ? 68 ARG A O    2  
ATOM 2664  C CB   . ARG A 1 69 ? 144.202 4.230   16.603  1.00 0.00 ? 68 ARG A CB   2  
ATOM 2665  C CG   . ARG A 1 69 ? 144.555 3.024   17.458  1.00 0.00 ? 68 ARG A CG   2  
ATOM 2666  C CD   . ARG A 1 69 ? 146.056 2.921   17.683  1.00 0.00 ? 68 ARG A CD   2  
ATOM 2667  N NE   . ARG A 1 69 ? 146.424 1.678   18.358  1.00 0.00 ? 68 ARG A NE   2  
ATOM 2668  C CZ   . ARG A 1 69 ? 146.322 1.481   19.676  1.00 0.00 ? 68 ARG A CZ   2  
ATOM 2669  N NH1  . ARG A 1 69 ? 145.859 2.444   20.472  1.00 0.00 ? 68 ARG A NH1  2  
ATOM 2670  N NH2  . ARG A 1 69 ? 146.683 0.314   20.200  1.00 0.00 ? 68 ARG A NH2  2  
ATOM 2671  H H    . ARG A 1 69 ? 144.171 3.072   14.348  1.00 0.00 ? 68 ARG A H    2  
ATOM 2672  H HA   . ARG A 1 69 ? 142.227 3.453   16.329  1.00 0.00 ? 68 ARG A HA   2  
ATOM 2673  H HB2  . ARG A 1 69 ? 145.030 4.427   15.937  1.00 0.00 ? 68 ARG A HB2  2  
ATOM 2674  H HB3  . ARG A 1 69 ? 144.067 5.080   17.256  1.00 0.00 ? 68 ARG A HB3  2  
ATOM 2675  H HG2  . ARG A 1 69 ? 144.064 3.117   18.415  1.00 0.00 ? 68 ARG A HG2  2  
ATOM 2676  H HG3  . ARG A 1 69 ? 144.211 2.127   16.961  1.00 0.00 ? 68 ARG A HG3  2  
ATOM 2677  H HD2  . ARG A 1 69 ? 146.554 2.961   16.725  1.00 0.00 ? 68 ARG A HD2  2  
ATOM 2678  H HD3  . ARG A 1 69 ? 146.374 3.757   18.288  1.00 0.00 ? 68 ARG A HD3  2  
ATOM 2679  H HE   . ARG A 1 69 ? 146.768 0.948   17.799  1.00 0.00 ? 68 ARG A HE   2  
ATOM 2680  H HH11 . ARG A 1 69 ? 145.583 3.325   20.087  1.00 0.00 ? 68 ARG A HH11 2  
ATOM 2681  H HH12 . ARG A 1 69 ? 145.786 2.288   21.458  1.00 0.00 ? 68 ARG A HH12 2  
ATOM 2682  H HH21 . ARG A 1 69 ? 147.029 -0.414  19.608  1.00 0.00 ? 68 ARG A HH21 2  
ATOM 2683  H HH22 . ARG A 1 69 ? 146.608 0.163   21.186  1.00 0.00 ? 68 ARG A HH22 2  
ATOM 2684  N N    . SER A 1 70 ? 142.716 6.037   14.368  1.00 0.00 ? 69 SER A N    2  
ATOM 2685  C CA   . SER A 1 70 ? 142.184 7.344   13.988  1.00 0.00 ? 69 SER A CA   2  
ATOM 2686  C C    . SER A 1 70 ? 140.824 7.208   13.298  1.00 0.00 ? 69 SER A C    2  
ATOM 2687  O O    . SER A 1 70 ? 140.652 6.378   12.403  1.00 0.00 ? 69 SER A O    2  
ATOM 2688  C CB   . SER A 1 70 ? 143.172 8.083   13.077  1.00 0.00 ? 69 SER A CB   2  
ATOM 2689  O OG   . SER A 1 70 ? 143.131 7.585   11.750  1.00 0.00 ? 69 SER A OG   2  
ATOM 2690  H H    . SER A 1 70 ? 143.392 5.612   13.799  1.00 0.00 ? 69 SER A H    2  
ATOM 2691  H HA   . SER A 1 70 ? 142.052 7.918   14.893  1.00 0.00 ? 69 SER A HA   2  
ATOM 2692  H HB2  . SER A 1 70 ? 142.924 9.135   13.059  1.00 0.00 ? 69 SER A HB2  2  
ATOM 2693  H HB3  . SER A 1 70 ? 144.173 7.958   13.463  1.00 0.00 ? 69 SER A HB3  2  
ATOM 2694  H HG   . SER A 1 70 ? 142.306 7.849   11.334  1.00 0.00 ? 69 SER A HG   2  
ATOM 2695  N N    . SER A 1 71 ? 139.863 8.030   13.725  1.00 0.00 ? 70 SER A N    2  
ATOM 2696  C CA   . SER A 1 71 ? 138.514 8.009   13.156  1.00 0.00 ? 70 SER A CA   2  
ATOM 2697  C C    . SER A 1 71 ? 138.468 8.688   11.784  1.00 0.00 ? 70 SER A C    2  
ATOM 2698  O O    . SER A 1 71 ? 137.697 8.283   10.913  1.00 0.00 ? 70 SER A O    2  
ATOM 2699  C CB   . SER A 1 71 ? 137.525 8.692   14.106  1.00 0.00 ? 70 SER A CB   2  
ATOM 2700  O OG   . SER A 1 71 ? 138.094 9.850   14.695  1.00 0.00 ? 70 SER A OG   2  
ATOM 2701  H H    . SER A 1 71 ? 140.066 8.667   14.441  1.00 0.00 ? 70 SER A H    2  
ATOM 2702  H HA   . SER A 1 71 ? 138.223 6.976   13.038  1.00 0.00 ? 70 SER A HA   2  
ATOM 2703  H HB2  . SER A 1 71 ? 136.642 8.981   13.557  1.00 0.00 ? 70 SER A HB2  2  
ATOM 2704  H HB3  . SER A 1 71 ? 137.249 8.003   14.892  1.00 0.00 ? 70 SER A HB3  2  
ATOM 2705  H HG   . SER A 1 71 ? 137.393 10.442  14.978  1.00 0.00 ? 70 SER A HG   2  
ATOM 2706  N N    . SER A 1 72 ? 139.288 9.727   11.599  1.00 0.00 ? 71 SER A N    2  
ATOM 2707  C CA   . SER A 1 72 ? 139.330 10.464  10.334  1.00 0.00 ? 71 SER A CA   2  
ATOM 2708  C C    . SER A 1 72 ? 140.477 9.982   9.435   1.00 0.00 ? 71 SER A C    2  
ATOM 2709  O O    . SER A 1 72 ? 141.123 10.784  8.757   1.00 0.00 ? 71 SER A O    2  
ATOM 2710  C CB   . SER A 1 72 ? 139.475 11.965  10.607  1.00 0.00 ? 71 SER A CB   2  
ATOM 2711  O OG   . SER A 1 72 ? 140.594 12.231  11.440  1.00 0.00 ? 71 SER A OG   2  
ATOM 2712  H H    . SER A 1 72 ? 139.874 10.009  12.332  1.00 0.00 ? 71 SER A H    2  
ATOM 2713  H HA   . SER A 1 72 ? 138.394 10.293  9.822   1.00 0.00 ? 71 SER A HA   2  
ATOM 2714  H HB2  . SER A 1 72 ? 139.607 12.487  9.671   1.00 0.00 ? 71 SER A HB2  2  
ATOM 2715  H HB3  . SER A 1 72 ? 138.583 12.326  11.097  1.00 0.00 ? 71 SER A HB3  2  
ATOM 2716  H HG   . SER A 1 72 ? 141.365 11.763  11.108  1.00 0.00 ? 71 SER A HG   2  
ATOM 2717  N N    . MET A 1 73 ? 140.724 8.671   9.434   1.00 0.00 ? 72 MET A N    2  
ATOM 2718  C CA   . MET A 1 73 ? 141.793 8.084   8.622   1.00 0.00 ? 72 MET A CA   2  
ATOM 2719  C C    . MET A 1 73 ? 141.609 8.403   7.137   1.00 0.00 ? 72 MET A C    2  
ATOM 2720  O O    . MET A 1 73 ? 140.483 8.439   6.633   1.00 0.00 ? 72 MET A O    2  
ATOM 2721  C CB   . MET A 1 73 ? 141.855 6.565   8.832   1.00 0.00 ? 72 MET A CB   2  
ATOM 2722  C CG   . MET A 1 73 ? 140.524 5.854   8.624   1.00 0.00 ? 72 MET A CG   2  
ATOM 2723  S SD   . MET A 1 73 ? 140.536 4.759   7.191   1.00 0.00 ? 72 MET A SD   2  
ATOM 2724  C CE   . MET A 1 73 ? 141.177 3.254   7.920   1.00 0.00 ? 72 MET A CE   2  
ATOM 2725  H H    . MET A 1 73 ? 140.177 8.084   9.995   1.00 0.00 ? 72 MET A H    2  
ATOM 2726  H HA   . MET A 1 73 ? 142.725 8.517   8.952   1.00 0.00 ? 72 MET A HA   2  
ATOM 2727  H HB2  . MET A 1 73 ? 142.572 6.148   8.141   1.00 0.00 ? 72 MET A HB2  2  
ATOM 2728  H HB3  . MET A 1 73 ? 142.186 6.370   9.840   1.00 0.00 ? 72 MET A HB3  2  
ATOM 2729  H HG2  . MET A 1 73 ? 140.305 5.266   9.503   1.00 0.00 ? 72 MET A HG2  2  
ATOM 2730  H HG3  . MET A 1 73 ? 139.751 6.595   8.486   1.00 0.00 ? 72 MET A HG3  2  
ATOM 2731  H HE1  . MET A 1 73 ? 140.771 2.399   7.399   1.00 0.00 ? 72 MET A HE1  2  
ATOM 2732  H HE2  . MET A 1 73 ? 140.892 3.209   8.961   1.00 0.00 ? 72 MET A HE2  2  
ATOM 2733  H HE3  . MET A 1 73 ? 142.254 3.246   7.841   1.00 0.00 ? 72 MET A HE3  2  
ATOM 2734  N N    . LYS A 1 74 ? 142.726 8.640   6.444   1.00 0.00 ? 73 LYS A N    2  
ATOM 2735  C CA   . LYS A 1 74 ? 142.701 8.961   5.018   1.00 0.00 ? 73 LYS A CA   2  
ATOM 2736  C C    . LYS A 1 74 ? 143.771 8.168   4.262   1.00 0.00 ? 73 LYS A C    2  
ATOM 2737  O O    . LYS A 1 74 ? 144.791 8.724   3.848   1.00 0.00 ? 73 LYS A O    2  
ATOM 2738  C CB   . LYS A 1 74 ? 142.915 10.466  4.810   1.00 0.00 ? 73 LYS A CB   2  
ATOM 2739  C CG   . LYS A 1 74 ? 141.788 11.331  5.354   1.00 0.00 ? 73 LYS A CG   2  
ATOM 2740  C CD   . LYS A 1 74 ? 140.802 11.715  4.261   1.00 0.00 ? 73 LYS A CD   2  
ATOM 2741  C CE   . LYS A 1 74 ? 139.734 10.648  4.070   1.00 0.00 ? 73 LYS A CE   2  
ATOM 2742  N NZ   . LYS A 1 74 ? 139.020 10.336  5.341   1.00 0.00 ? 73 LYS A NZ   2  
ATOM 2743  H H    . LYS A 1 74 ? 143.590 8.599   6.905   1.00 0.00 ? 73 LYS A H    2  
ATOM 2744  H HA   . LYS A 1 74 ? 141.729 8.688   4.633   1.00 0.00 ? 73 LYS A HA   2  
ATOM 2745  H HB2  . LYS A 1 74 ? 143.831 10.759  5.302   1.00 0.00 ? 73 LYS A HB2  2  
ATOM 2746  H HB3  . LYS A 1 74 ? 143.010 10.661  3.752   1.00 0.00 ? 73 LYS A HB3  2  
ATOM 2747  H HG2  . LYS A 1 74 ? 141.264 10.784  6.123   1.00 0.00 ? 73 LYS A HG2  2  
ATOM 2748  H HG3  . LYS A 1 74 ? 142.211 12.231  5.777   1.00 0.00 ? 73 LYS A HG3  2  
ATOM 2749  H HD2  . LYS A 1 74 ? 140.323 12.645  4.531   1.00 0.00 ? 73 LYS A HD2  2  
ATOM 2750  H HD3  . LYS A 1 74 ? 141.341 11.843  3.333   1.00 0.00 ? 73 LYS A HD3  2  
ATOM 2751  H HE2  . LYS A 1 74 ? 139.018 10.999  3.343   1.00 0.00 ? 73 LYS A HE2  2  
ATOM 2752  H HE3  . LYS A 1 74 ? 140.205 9.748   3.703   1.00 0.00 ? 73 LYS A HE3  2  
ATOM 2753  H HZ1  . LYS A 1 74 ? 138.033 10.074  5.142   1.00 0.00 ? 73 LYS A HZ1  2  
ATOM 2754  H HZ2  . LYS A 1 74 ? 139.026 11.165  5.970   1.00 0.00 ? 73 LYS A HZ2  2  
ATOM 2755  H HZ3  . LYS A 1 74 ? 139.486 9.541   5.828   1.00 0.00 ? 73 LYS A HZ3  2  
ATOM 2756  N N    . SER A 1 75 ? 143.528 6.866   4.086   1.00 0.00 ? 74 SER A N    2  
ATOM 2757  C CA   . SER A 1 75 ? 144.463 5.983   3.380   1.00 0.00 ? 74 SER A CA   2  
ATOM 2758  C C    . SER A 1 75 ? 145.827 5.933   4.081   1.00 0.00 ? 74 SER A C    2  
ATOM 2759  O O    . SER A 1 75 ? 145.975 6.413   5.207   1.00 0.00 ? 74 SER A O    2  
ATOM 2760  C CB   . SER A 1 75 ? 144.630 6.442   1.926   1.00 0.00 ? 74 SER A CB   2  
ATOM 2761  O OG   . SER A 1 75 ? 145.166 5.405   1.117   1.00 0.00 ? 74 SER A OG   2  
ATOM 2762  H H    . SER A 1 75 ? 142.695 6.487   4.440   1.00 0.00 ? 74 SER A H    2  
ATOM 2763  H HA   . SER A 1 75 ? 144.040 4.989   3.384   1.00 0.00 ? 74 SER A HA   2  
ATOM 2764  H HB2  . SER A 1 75 ? 143.668 6.730   1.529   1.00 0.00 ? 74 SER A HB2  2  
ATOM 2765  H HB3  . SER A 1 75 ? 145.299 7.289   1.893   1.00 0.00 ? 74 SER A HB3  2  
ATOM 2766  H HG   . SER A 1 75 ? 144.462 5.003   0.604   1.00 0.00 ? 74 SER A HG   2  
ATOM 2767  N N    . LEU A 1 76 ? 146.819 5.345   3.409   1.00 0.00 ? 75 LEU A N    2  
ATOM 2768  C CA   . LEU A 1 76 ? 148.167 5.229   3.963   1.00 0.00 ? 75 LEU A CA   2  
ATOM 2769  C C    . LEU A 1 76 ? 149.150 6.115   3.202   1.00 0.00 ? 75 LEU A C    2  
ATOM 2770  O O    . LEU A 1 76 ? 149.167 6.121   1.971   1.00 0.00 ? 75 LEU A O    2  
ATOM 2771  C CB   . LEU A 1 76 ? 148.639 3.772   3.916   1.00 0.00 ? 75 LEU A CB   2  
ATOM 2772  C CG   . LEU A 1 76 ? 148.291 2.935   5.150   1.00 0.00 ? 75 LEU A CG   2  
ATOM 2773  C CD1  . LEU A 1 76 ? 146.954 2.232   4.961   1.00 0.00 ? 75 LEU A CD1  2  
ATOM 2774  C CD2  . LEU A 1 76 ? 149.395 1.925   5.436   1.00 0.00 ? 75 LEU A CD2  2  
ATOM 2775  H H    . LEU A 1 76 ? 146.640 4.978   2.517   1.00 0.00 ? 75 LEU A H    2  
ATOM 2776  H HA   . LEU A 1 76 ? 148.130 5.553   4.992   1.00 0.00 ? 75 LEU A HA   2  
ATOM 2777  H HB2  . LEU A 1 76 ? 148.199 3.301   3.050   1.00 0.00 ? 75 LEU A HB2  2  
ATOM 2778  H HB3  . LEU A 1 76 ? 149.713 3.770   3.798   1.00 0.00 ? 75 LEU A HB3  2  
ATOM 2779  H HG   . LEU A 1 76 ? 148.206 3.587   6.008   1.00 0.00 ? 75 LEU A HG   2  
ATOM 2780  H HD11 . LEU A 1 76 ? 146.537 1.985   5.926   1.00 0.00 ? 75 LEU A HD11 2  
ATOM 2781  H HD12 . LEU A 1 76 ? 147.099 1.327   4.389   1.00 0.00 ? 75 LEU A HD12 2  
ATOM 2782  H HD13 . LEU A 1 76 ? 146.275 2.886   4.433   1.00 0.00 ? 75 LEU A HD13 2  
ATOM 2783  H HD21 . LEU A 1 76 ? 150.318 2.261   4.986   1.00 0.00 ? 75 LEU A HD21 2  
ATOM 2784  H HD22 . LEU A 1 76 ? 149.122 0.965   5.022   1.00 0.00 ? 75 LEU A HD22 2  
ATOM 2785  H HD23 . LEU A 1 76 ? 149.529 1.831   6.503   1.00 0.00 ? 75 LEU A HD23 2  
ATOM 2786  N N    . ARG A 1 77 ? 149.970 6.859   3.945   1.00 0.00 ? 76 ARG A N    2  
ATOM 2787  C CA   . ARG A 1 77 ? 150.959 7.747   3.340   1.00 0.00 ? 76 ARG A CA   2  
ATOM 2788  C C    . ARG A 1 77 ? 152.352 7.119   3.383   1.00 0.00 ? 76 ARG A C    2  
ATOM 2789  O O    . ARG A 1 77 ? 152.971 7.030   4.445   1.00 0.00 ? 76 ARG A O    2  
ATOM 2790  C CB   . ARG A 1 77 ? 150.969 9.102   4.057   1.00 0.00 ? 76 ARG A CB   2  
ATOM 2791  C CG   . ARG A 1 77 ? 149.681 9.894   3.886   1.00 0.00 ? 76 ARG A CG   2  
ATOM 2792  C CD   . ARG A 1 77 ? 149.921 11.389  4.034   1.00 0.00 ? 76 ARG A CD   2  
ATOM 2793  N NE   . ARG A 1 77 ? 148.754 12.081  4.579   1.00 0.00 ? 76 ARG A NE   2  
ATOM 2794  C CZ   . ARG A 1 77 ? 148.428 12.091  5.875   1.00 0.00 ? 76 ARG A CZ   2  
ATOM 2795  N NH1  . ARG A 1 77 ? 149.175 11.439  6.766   1.00 0.00 ? 76 ARG A NH1  2  
ATOM 2796  N NH2  . ARG A 1 77 ? 147.350 12.754  6.282   1.00 0.00 ? 76 ARG A NH2  2  
ATOM 2797  H H    . ARG A 1 77 ? 149.909 6.807   4.922   1.00 0.00 ? 76 ARG A H    2  
ATOM 2798  H HA   . ARG A 1 77 ? 150.678 7.899   2.308   1.00 0.00 ? 76 ARG A HA   2  
ATOM 2799  H HB2  . ARG A 1 77 ? 151.127 8.937   5.113   1.00 0.00 ? 76 ARG A HB2  2  
ATOM 2800  H HB3  . ARG A 1 77 ? 151.785 9.694   3.668   1.00 0.00 ? 76 ARG A HB3  2  
ATOM 2801  H HG2  . ARG A 1 77 ? 149.276 9.699   2.904   1.00 0.00 ? 76 ARG A HG2  2  
ATOM 2802  H HG3  . ARG A 1 77 ? 148.974 9.576   4.638   1.00 0.00 ? 76 ARG A HG3  2  
ATOM 2803  H HD2  . ARG A 1 77 ? 150.760 11.543  4.697   1.00 0.00 ? 76 ARG A HD2  2  
ATOM 2804  H HD3  . ARG A 1 77 ? 150.152 11.802  3.062   1.00 0.00 ? 76 ARG A HD3  2  
ATOM 2805  H HE   . ARG A 1 77 ? 148.182 12.566  3.946   1.00 0.00 ? 76 ARG A HE   2  
ATOM 2806  H HH11 . ARG A 1 77 ? 149.986 10.934  6.469   1.00 0.00 ? 76 ARG A HH11 2  
ATOM 2807  H HH12 . ARG A 1 77 ? 148.925 11.453  7.735   1.00 0.00 ? 76 ARG A HH12 2  
ATOM 2808  H HH21 . ARG A 1 77 ? 146.783 13.243  5.619   1.00 0.00 ? 76 ARG A HH21 2  
ATOM 2809  H HH22 . ARG A 1 77 ? 147.104 12.764  7.252   1.00 0.00 ? 76 ARG A HH22 2  
ATOM 2810  N N    . ILE A 1 78 ? 152.837 6.683   2.219   1.00 0.00 ? 77 ILE A N    2  
ATOM 2811  C CA   . ILE A 1 78 ? 154.155 6.059   2.116   1.00 0.00 ? 77 ILE A CA   2  
ATOM 2812  C C    . ILE A 1 78 ? 154.979 6.707   1.003   1.00 0.00 ? 77 ILE A C    2  
ATOM 2813  O O    . ILE A 1 78 ? 154.491 6.891   -0.114  1.00 0.00 ? 77 ILE A O    2  
ATOM 2814  C CB   . ILE A 1 78 ? 154.045 4.542   1.839   1.00 0.00 ? 77 ILE A CB   2  
ATOM 2815  C CG1  . ILE A 1 78 ? 153.047 3.886   2.802   1.00 0.00 ? 77 ILE A CG1  2  
ATOM 2816  C CG2  . ILE A 1 78 ? 155.411 3.876   1.953   1.00 0.00 ? 77 ILE A CG2  2  
ATOM 2817  C CD1  . ILE A 1 78 ? 152.760 2.434   2.481   1.00 0.00 ? 77 ILE A CD1  2  
ATOM 2818  H H    . ILE A 1 78 ? 152.293 6.780   1.409   1.00 0.00 ? 77 ILE A H    2  
ATOM 2819  H HA   . ILE A 1 78 ? 154.666 6.198   3.059   1.00 0.00 ? 77 ILE A HA   2  
ATOM 2820  H HB   . ILE A 1 78 ? 153.694 4.411   0.826   1.00 0.00 ? 77 ILE A HB   2  
ATOM 2821  H HG12 . ILE A 1 78 ? 153.443 3.931   3.804   1.00 0.00 ? 77 ILE A HG12 2  
ATOM 2822  H HG13 . ILE A 1 78 ? 152.112 4.425   2.764   1.00 0.00 ? 77 ILE A HG13 2  
ATOM 2823  H HG21 . ILE A 1 78 ? 156.053 4.234   1.161   1.00 0.00 ? 77 ILE A HG21 2  
ATOM 2824  H HG22 . ILE A 1 78 ? 155.297 2.806   1.866   1.00 0.00 ? 77 ILE A HG22 2  
ATOM 2825  H HG23 . ILE A 1 78 ? 155.851 4.115   2.910   1.00 0.00 ? 77 ILE A HG23 2  
ATOM 2826  H HD11 . ILE A 1 78 ? 152.112 2.020   3.240   1.00 0.00 ? 77 ILE A HD11 2  
ATOM 2827  H HD12 . ILE A 1 78 ? 153.687 1.880   2.458   1.00 0.00 ? 77 ILE A HD12 2  
ATOM 2828  H HD13 . ILE A 1 78 ? 152.275 2.366   1.519   1.00 0.00 ? 77 ILE A HD13 2  
ATOM 2829  N N    . LEU A 1 79 ? 156.230 7.049   1.314   1.00 0.00 ? 78 LEU A N    2  
ATOM 2830  C CA   . LEU A 1 79 ? 157.121 7.671   0.338   1.00 0.00 ? 78 LEU A CA   2  
ATOM 2831  C C    . LEU A 1 79 ? 158.110 6.648   -0.218  1.00 0.00 ? 78 LEU A C    2  
ATOM 2832  O O    . LEU A 1 79 ? 158.881 6.046   0.532   1.00 0.00 ? 78 LEU A O    2  
ATOM 2833  C CB   . LEU A 1 79 ? 157.877 8.842   0.974   1.00 0.00 ? 78 LEU A CB   2  
ATOM 2834  C CG   . LEU A 1 79 ? 158.174 10.011  0.030   1.00 0.00 ? 78 LEU A CG   2  
ATOM 2835  C CD1  . LEU A 1 79 ? 157.039 11.026  0.056   1.00 0.00 ? 78 LEU A CD1  2  
ATOM 2836  C CD2  . LEU A 1 79 ? 159.494 10.672  0.400   1.00 0.00 ? 78 LEU A CD2  2  
ATOM 2837  H H    . LEU A 1 79 ? 156.563 6.874   2.220   1.00 0.00 ? 78 LEU A H    2  
ATOM 2838  H HA   . LEU A 1 79 ? 156.513 8.045   -0.474  1.00 0.00 ? 78 LEU A HA   2  
ATOM 2839  H HB2  . LEU A 1 79 ? 157.290 9.214   1.802   1.00 0.00 ? 78 LEU A HB2  2  
ATOM 2840  H HB3  . LEU A 1 79 ? 158.815 8.471   1.358   1.00 0.00 ? 78 LEU A HB3  2  
ATOM 2841  H HG   . LEU A 1 79 ? 158.259 9.636   -0.980  1.00 0.00 ? 78 LEU A HG   2  
ATOM 2842  H HD11 . LEU A 1 79 ? 157.281 11.820  0.747   1.00 0.00 ? 78 LEU A HD11 2  
ATOM 2843  H HD12 . LEU A 1 79 ? 156.127 10.541  0.372   1.00 0.00 ? 78 LEU A HD12 2  
ATOM 2844  H HD13 . LEU A 1 79 ? 156.902 11.438  -0.932  1.00 0.00 ? 78 LEU A HD13 2  
ATOM 2845  H HD21 . LEU A 1 79 ? 159.888 11.194  -0.460  1.00 0.00 ? 78 LEU A HD21 2  
ATOM 2846  H HD22 . LEU A 1 79 ? 160.199 9.918   0.717   1.00 0.00 ? 78 LEU A HD22 2  
ATOM 2847  H HD23 . LEU A 1 79 ? 159.333 11.374  1.204   1.00 0.00 ? 78 LEU A HD23 2  
ATOM 2848  N N    . LEU A 1 80 ? 158.075 6.454   -1.535  1.00 0.00 ? 79 LEU A N    2  
ATOM 2849  C CA   . LEU A 1 80 ? 158.961 5.499   -2.197  1.00 0.00 ? 79 LEU A CA   2  
ATOM 2850  C C    . LEU A 1 80 ? 160.203 6.197   -2.747  1.00 0.00 ? 79 LEU A C    2  
ATOM 2851  O O    . LEU A 1 80 ? 160.098 7.155   -3.514  1.00 0.00 ? 79 LEU A O    2  
ATOM 2852  C CB   . LEU A 1 80 ? 158.219 4.783   -3.331  1.00 0.00 ? 79 LEU A CB   2  
ATOM 2853  C CG   . LEU A 1 80 ? 156.813 4.289   -2.976  1.00 0.00 ? 79 LEU A CG   2  
ATOM 2854  C CD1  . LEU A 1 80 ? 155.888 4.385   -4.181  1.00 0.00 ? 79 LEU A CD1  2  
ATOM 2855  C CD2  . LEU A 1 80 ? 156.866 2.861   -2.451  1.00 0.00 ? 79 LEU A CD2  2  
ATOM 2856  H H    . LEU A 1 80 ? 157.434 6.962   -2.076  1.00 0.00 ? 79 LEU A H    2  
ATOM 2857  H HA   . LEU A 1 80 ? 159.268 4.769   -1.463  1.00 0.00 ? 79 LEU A HA   2  
ATOM 2858  H HB2  . LEU A 1 80 ? 158.140 5.463   -4.167  1.00 0.00 ? 79 LEU A HB2  2  
ATOM 2859  H HB3  . LEU A 1 80 ? 158.809 3.932   -3.636  1.00 0.00 ? 79 LEU A HB3  2  
ATOM 2860  H HG   . LEU A 1 80 ? 156.407 4.916   -2.196  1.00 0.00 ? 79 LEU A HG   2  
ATOM 2861  H HD11 . LEU A 1 80 ? 155.196 3.555   -4.173  1.00 0.00 ? 79 LEU A HD11 2  
ATOM 2862  H HD12 . LEU A 1 80 ? 156.473 4.356   -5.087  1.00 0.00 ? 79 LEU A HD12 2  
ATOM 2863  H HD13 . LEU A 1 80 ? 155.337 5.313   -4.138  1.00 0.00 ? 79 LEU A HD13 2  
ATOM 2864  H HD21 . LEU A 1 80 ? 157.242 2.207   -3.223  1.00 0.00 ? 79 LEU A HD21 2  
ATOM 2865  H HD22 . LEU A 1 80 ? 155.874 2.546   -2.163  1.00 0.00 ? 79 LEU A HD22 2  
ATOM 2866  H HD23 . LEU A 1 80 ? 157.520 2.818   -1.592  1.00 0.00 ? 79 LEU A HD23 2  
ATOM 2867  N N    . LEU A 1 81 ? 161.378 5.711   -2.347  1.00 0.00 ? 80 LEU A N    2  
ATOM 2868  C CA   . LEU A 1 81 ? 162.644 6.288   -2.798  1.00 0.00 ? 80 LEU A CA   2  
ATOM 2869  C C    . LEU A 1 81 ? 163.651 5.193   -3.149  1.00 0.00 ? 80 LEU A C    2  
ATOM 2870  O O    . LEU A 1 81 ? 163.652 4.118   -2.545  1.00 0.00 ? 80 LEU A O    2  
ATOM 2871  C CB   . LEU A 1 81 ? 163.230 7.207   -1.720  1.00 0.00 ? 80 LEU A CB   2  
ATOM 2872  C CG   . LEU A 1 81 ? 162.249 8.223   -1.123  1.00 0.00 ? 80 LEU A CG   2  
ATOM 2873  C CD1  . LEU A 1 81 ? 162.751 8.729   0.222   1.00 0.00 ? 80 LEU A CD1  2  
ATOM 2874  C CD2  . LEU A 1 81 ? 162.032 9.382   -2.086  1.00 0.00 ? 80 LEU A CD2  2  
ATOM 2875  H H    . LEU A 1 81 ? 161.395 4.946   -1.734  1.00 0.00 ? 80 LEU A H    2  
ATOM 2876  H HA   . LEU A 1 81 ? 162.444 6.871   -3.684  1.00 0.00 ? 80 LEU A HA   2  
ATOM 2877  H HB2  . LEU A 1 81 ? 163.608 6.590   -0.918  1.00 0.00 ? 80 LEU A HB2  2  
ATOM 2878  H HB3  . LEU A 1 81 ? 164.056 7.752   -2.152  1.00 0.00 ? 80 LEU A HB3  2  
ATOM 2879  H HG   . LEU A 1 81 ? 161.296 7.740   -0.961  1.00 0.00 ? 80 LEU A HG   2  
ATOM 2880  H HD11 . LEU A 1 81 ? 163.439 8.011   0.644   1.00 0.00 ? 80 LEU A HD11 2  
ATOM 2881  H HD12 . LEU A 1 81 ? 161.915 8.862   0.892   1.00 0.00 ? 80 LEU A HD12 2  
ATOM 2882  H HD13 . LEU A 1 81 ? 163.256 9.674   0.086   1.00 0.00 ? 80 LEU A HD13 2  
ATOM 2883  H HD21 . LEU A 1 81 ? 161.257 9.123   -2.792  1.00 0.00 ? 80 LEU A HD21 2  
ATOM 2884  H HD22 . LEU A 1 81 ? 162.949 9.587   -2.617  1.00 0.00 ? 80 LEU A HD22 2  
ATOM 2885  H HD23 . LEU A 1 81 ? 161.733 10.260  -1.532  1.00 0.00 ? 80 LEU A HD23 2  
ATOM 2886  N N    . SER A 1 82 ? 164.507 5.474   -4.131  1.00 0.00 ? 81 SER A N    2  
ATOM 2887  C CA   . SER A 1 82 ? 165.522 4.516   -4.568  1.00 0.00 ? 81 SER A CA   2  
ATOM 2888  C C    . SER A 1 82 ? 166.690 4.465   -3.583  1.00 0.00 ? 81 SER A C    2  
ATOM 2889  O O    . SER A 1 82 ? 167.322 5.486   -3.306  1.00 0.00 ? 81 SER A O    2  
ATOM 2890  C CB   . SER A 1 82 ? 166.034 4.885   -5.963  1.00 0.00 ? 81 SER A CB   2  
ATOM 2891  O OG   . SER A 1 82 ? 164.965 5.235   -6.827  1.00 0.00 ? 81 SER A OG   2  
ATOM 2892  H H    . SER A 1 82 ? 164.455 6.348   -4.573  1.00 0.00 ? 81 SER A H    2  
ATOM 2893  H HA   . SER A 1 82 ? 165.059 3.542   -4.610  1.00 0.00 ? 81 SER A HA   2  
ATOM 2894  H HB2  . SER A 1 82 ? 166.707 5.727   -5.886  1.00 0.00 ? 81 SER A HB2  2  
ATOM 2895  H HB3  . SER A 1 82 ? 166.561 4.042   -6.384  1.00 0.00 ? 81 SER A HB3  2  
ATOM 2896  H HG   . SER A 1 82 ? 164.378 4.482   -6.933  1.00 0.00 ? 81 SER A HG   2  
ATOM 2897  N N    . GLN A 1 83 ? 166.972 3.271   -3.057  1.00 0.00 ? 82 GLN A N    2  
ATOM 2898  C CA   . GLN A 1 83 ? 168.064 3.089   -2.103  1.00 0.00 ? 82 GLN A CA   2  
ATOM 2899  C C    . GLN A 1 83 ? 169.092 2.074   -2.617  1.00 0.00 ? 82 GLN A C    2  
ATOM 2900  O O    . GLN A 1 83 ? 169.657 1.300   -1.840  1.00 0.00 ? 82 GLN A O    2  
ATOM 2901  C CB   . GLN A 1 83 ? 167.508 2.639   -0.747  1.00 0.00 ? 82 GLN A CB   2  
ATOM 2902  C CG   . GLN A 1 83 ? 166.799 3.746   0.021   1.00 0.00 ? 82 GLN A CG   2  
ATOM 2903  C CD   . GLN A 1 83 ? 167.683 4.957   0.263   1.00 0.00 ? 82 GLN A CD   2  
ATOM 2904  O OE1  . GLN A 1 83 ? 167.301 6.087   -0.040  1.00 0.00 ? 82 GLN A OE1  2  
ATOM 2905  N NE2  . GLN A 1 83 ? 168.876 4.728   0.806   1.00 0.00 ? 82 GLN A NE2  2  
ATOM 2906  H H    . GLN A 1 83 ? 166.431 2.496   -3.317  1.00 0.00 ? 82 GLN A H    2  
ATOM 2907  H HA   . GLN A 1 83 ? 168.557 4.043   -1.979  1.00 0.00 ? 82 GLN A HA   2  
ATOM 2908  H HB2  . GLN A 1 83 ? 166.806 1.835   -0.908  1.00 0.00 ? 82 GLN A HB2  2  
ATOM 2909  H HB3  . GLN A 1 83 ? 168.324 2.276   -0.139  1.00 0.00 ? 82 GLN A HB3  2  
ATOM 2910  H HG2  . GLN A 1 83 ? 165.934 4.059   -0.545  1.00 0.00 ? 82 GLN A HG2  2  
ATOM 2911  H HG3  . GLN A 1 83 ? 166.480 3.355   0.976   1.00 0.00 ? 82 GLN A HG3  2  
ATOM 2912  H HE21 . GLN A 1 83 ? 169.121 3.804   1.021   1.00 0.00 ? 82 GLN A HE21 2  
ATOM 2913  H HE22 . GLN A 1 83 ? 169.465 5.495   0.968   1.00 0.00 ? 82 GLN A HE22 2  
ATOM 2914  N N    . ASP A 1 84 ? 169.334 2.085   -3.931  1.00 0.00 ? 83 ASP A N    2  
ATOM 2915  C CA   . ASP A 1 84 ? 170.294 1.170   -4.547  1.00 0.00 ? 83 ASP A CA   2  
ATOM 2916  C C    . ASP A 1 84 ? 170.760 1.702   -5.902  1.00 0.00 ? 83 ASP A C    2  
ATOM 2917  O O    . ASP A 1 84 ? 170.277 1.272   -6.952  1.00 0.00 ? 83 ASP A O    2  
ATOM 2918  C CB   . ASP A 1 84 ? 169.673 -0.224  -4.706  1.00 0.00 ? 83 ASP A CB   2  
ATOM 2919  C CG   . ASP A 1 84 ? 170.681 -1.343  -4.517  1.00 0.00 ? 83 ASP A CG   2  
ATOM 2920  O OD1  . ASP A 1 84 ? 171.412 -1.322  -3.503  1.00 0.00 ? 83 ASP A OD1  2  
ATOM 2921  O OD2  . ASP A 1 84 ? 170.738 -2.244  -5.380  1.00 0.00 ? 83 ASP A OD2  2  
ATOM 2922  H H    . ASP A 1 84 ? 168.858 2.726   -4.499  1.00 0.00 ? 83 ASP A H    2  
ATOM 2923  H HA   . ASP A 1 84 ? 171.149 1.100   -3.891  1.00 0.00 ? 83 ASP A HA   2  
ATOM 2924  H HB2  . ASP A 1 84 ? 168.889 -0.347  -3.975  1.00 0.00 ? 83 ASP A HB2  2  
ATOM 2925  H HB3  . ASP A 1 84 ? 169.249 -0.311  -5.697  1.00 0.00 ? 83 ASP A HB3  2  
ATOM 2926  N N    . ARG A 1 85 ? 171.696 2.649   -5.868  1.00 0.00 ? 84 ARG A N    2  
ATOM 2927  C CA   . ARG A 1 85 ? 172.225 3.250   -7.090  1.00 0.00 ? 84 ARG A CA   2  
ATOM 2928  C C    . ARG A 1 85 ? 173.502 2.540   -7.556  1.00 0.00 ? 84 ARG A C    2  
ATOM 2929  O O    . ARG A 1 85 ? 174.608 3.065   -7.408  1.00 0.00 ? 84 ARG A O    2  
ATOM 2930  C CB   . ARG A 1 85 ? 172.488 4.746   -6.865  1.00 0.00 ? 84 ARG A CB   2  
ATOM 2931  C CG   . ARG A 1 85 ? 172.287 5.597   -8.110  1.00 0.00 ? 84 ARG A CG   2  
ATOM 2932  C CD   . ARG A 1 85 ? 173.586 6.248   -8.561  1.00 0.00 ? 84 ARG A CD   2  
ATOM 2933  N NE   . ARG A 1 85 ? 173.774 7.580   -7.979  1.00 0.00 ? 84 ARG A NE   2  
ATOM 2934  C CZ   . ARG A 1 85 ? 174.618 8.495   -8.466  1.00 0.00 ? 84 ARG A CZ   2  
ATOM 2935  N NH1  . ARG A 1 85 ? 175.363 8.228   -9.536  1.00 0.00 ? 84 ARG A NH1  2  
ATOM 2936  N NH2  . ARG A 1 85 ? 174.724 9.682   -7.879  1.00 0.00 ? 84 ARG A NH2  2  
ATOM 2937  H H    . ARG A 1 85 ? 172.035 2.954   -5.000  1.00 0.00 ? 84 ARG A H    2  
ATOM 2938  H HA   . ARG A 1 85 ? 171.474 3.142   -7.858  1.00 0.00 ? 84 ARG A HA   2  
ATOM 2939  H HB2  . ARG A 1 85 ? 171.815 5.104   -6.100  1.00 0.00 ? 84 ARG A HB2  2  
ATOM 2940  H HB3  . ARG A 1 85 ? 173.505 4.875   -6.525  1.00 0.00 ? 84 ARG A HB3  2  
ATOM 2941  H HG2  . ARG A 1 85 ? 171.917 4.969   -8.906  1.00 0.00 ? 84 ARG A HG2  2  
ATOM 2942  H HG3  . ARG A 1 85 ? 171.563 6.369   -7.892  1.00 0.00 ? 84 ARG A HG3  2  
ATOM 2943  H HD2  . ARG A 1 85 ? 174.412 5.618   -8.264  1.00 0.00 ? 84 ARG A HD2  2  
ATOM 2944  H HD3  . ARG A 1 85 ? 173.571 6.335   -9.637  1.00 0.00 ? 84 ARG A HD3  2  
ATOM 2945  H HE   . ARG A 1 85 ? 173.242 7.805   -7.186  1.00 0.00 ? 84 ARG A HE   2  
ATOM 2946  H HH11 . ARG A 1 85 ? 175.296 7.337   -9.985  1.00 0.00 ? 84 ARG A HH11 2  
ATOM 2947  H HH12 . ARG A 1 85 ? 175.990 8.921   -9.895  1.00 0.00 ? 84 ARG A HH12 2  
ATOM 2948  H HH21 . ARG A 1 85 ? 174.173 9.893   -7.071  1.00 0.00 ? 84 ARG A HH21 2  
ATOM 2949  H HH22 . ARG A 1 85 ? 175.354 10.368  -8.245  1.00 0.00 ? 84 ARG A HH22 2  
ATOM 2950  N N    . ASN A 1 86 ? 173.335 1.343   -8.125  1.00 0.00 ? 85 ASN A N    2  
ATOM 2951  C CA   . ASN A 1 86 ? 174.467 0.556   -8.624  1.00 0.00 ? 85 ASN A CA   2  
ATOM 2952  C C    . ASN A 1 86 ? 174.106 -0.165  -9.927  1.00 0.00 ? 85 ASN A C    2  
ATOM 2953  O O    . ASN A 1 86 ? 173.002 -0.004  -10.450 1.00 0.00 ? 85 ASN A O    2  
ATOM 2954  C CB   . ASN A 1 86 ? 174.915 -0.466  -7.572  1.00 0.00 ? 85 ASN A CB   2  
ATOM 2955  C CG   . ASN A 1 86 ? 175.611 0.181   -6.390  1.00 0.00 ? 85 ASN A CG   2  
ATOM 2956  O OD1  . ASN A 1 86 ? 176.572 0.933   -6.555  1.00 0.00 ? 85 ASN A OD1  2  
ATOM 2957  N ND2  . ASN A 1 86 ? 175.125 -0.107  -5.188  1.00 0.00 ? 85 ASN A ND2  2  
ATOM 2958  H H    . ASN A 1 86 ? 172.427 0.982   -8.217  1.00 0.00 ? 85 ASN A H    2  
ATOM 2959  H HA   . ASN A 1 86 ? 175.280 1.238   -8.819  1.00 0.00 ? 85 ASN A HA   2  
ATOM 2960  H HB2  . ASN A 1 86 ? 174.053 -1.005  -7.208  1.00 0.00 ? 85 ASN A HB2  2  
ATOM 2961  H HB3  . ASN A 1 86 ? 175.603 -1.163  -8.028  1.00 0.00 ? 85 ASN A HB3  2  
ATOM 2962  H HD21 . ASN A 1 86 ? 174.355 -0.710  -5.133  1.00 0.00 ? 85 ASN A HD21 2  
ATOM 2963  H HD22 . ASN A 1 86 ? 175.560 0.292   -4.406  1.00 0.00 ? 85 ASN A HD22 2  
ATOM 2964  N N    . LEU A 1 87 ? 175.046 -0.962  -10.444 1.00 0.00 ? 86 LEU A N    2  
ATOM 2965  C CA   . LEU A 1 87 ? 174.829 -1.715  -11.681 1.00 0.00 ? 86 LEU A CA   2  
ATOM 2966  C C    . LEU A 1 87 ? 173.811 -2.833  -11.465 1.00 0.00 ? 86 LEU A C    2  
ATOM 2967  O O    . LEU A 1 87 ? 173.608 -3.288  -10.337 1.00 0.00 ? 86 LEU A O    2  
ATOM 2968  C CB   . LEU A 1 87 ? 176.150 -2.314  -12.180 1.00 0.00 ? 86 LEU A CB   2  
ATOM 2969  C CG   . LEU A 1 87 ? 176.858 -1.526  -13.287 1.00 0.00 ? 86 LEU A CG   2  
ATOM 2970  C CD1  . LEU A 1 87 ? 176.059 -1.578  -14.582 1.00 0.00 ? 86 LEU A CD1  2  
ATOM 2971  C CD2  . LEU A 1 87 ? 177.090 -0.085  -12.856 1.00 0.00 ? 86 LEU A CD2  2  
ATOM 2972  H H    . LEU A 1 87 ? 175.904 -1.051  -9.978  1.00 0.00 ? 86 LEU A H    2  
ATOM 2973  H HA   . LEU A 1 87 ? 174.447 -1.032  -12.426 1.00 0.00 ? 86 LEU A HA   2  
ATOM 2974  H HB2  . LEU A 1 87 ? 176.821 -2.394  -11.337 1.00 0.00 ? 86 LEU A HB2  2  
ATOM 2975  H HB3  . LEU A 1 87 ? 175.949 -3.309  -12.551 1.00 0.00 ? 86 LEU A HB3  2  
ATOM 2976  H HG   . LEU A 1 87 ? 177.822 -1.977  -13.476 1.00 0.00 ? 86 LEU A HG   2  
ATOM 2977  H HD11 . LEU A 1 87 ? 176.559 -0.990  -15.337 1.00 0.00 ? 86 LEU A HD11 2  
ATOM 2978  H HD12 . LEU A 1 87 ? 175.071 -1.178  -14.411 1.00 0.00 ? 86 LEU A HD12 2  
ATOM 2979  H HD13 . LEU A 1 87 ? 175.981 -2.602  -14.916 1.00 0.00 ? 86 LEU A HD13 2  
ATOM 2980  H HD21 . LEU A 1 87 ? 177.733 0.406   -13.572 1.00 0.00 ? 86 LEU A HD21 2  
ATOM 2981  H HD22 . LEU A 1 87 ? 177.558 -0.071  -11.883 1.00 0.00 ? 86 LEU A HD22 2  
ATOM 2982  H HD23 . LEU A 1 87 ? 176.143 0.433   -12.808 1.00 0.00 ? 86 LEU A HD23 2  
ATOM 2983  N N    . GLU A 1 88 ? 173.178 -3.277  -12.550 1.00 0.00 ? 87 GLU A N    2  
ATOM 2984  C CA   . GLU A 1 88 ? 172.185 -4.347  -12.474 1.00 0.00 ? 87 GLU A CA   2  
ATOM 2985  C C    . GLU A 1 88 ? 172.836 -5.722  -12.666 1.00 0.00 ? 87 GLU A C    2  
ATOM 2986  O O    . GLU A 1 88 ? 172.478 -6.684  -11.984 1.00 0.00 ? 87 GLU A O    2  
ATOM 2987  C CB   . GLU A 1 88 ? 171.083 -4.130  -13.519 1.00 0.00 ? 87 GLU A CB   2  
ATOM 2988  C CG   . GLU A 1 88 ? 170.496 -2.721  -13.510 1.00 0.00 ? 87 GLU A CG   2  
ATOM 2989  C CD   . GLU A 1 88 ? 169.031 -2.681  -13.107 1.00 0.00 ? 87 GLU A CD   2  
ATOM 2990  O OE1  . GLU A 1 88 ? 168.627 -3.475  -12.230 1.00 0.00 ? 87 GLU A OE1  2  
ATOM 2991  O OE2  . GLU A 1 88 ? 168.285 -1.849  -13.668 1.00 0.00 ? 87 GLU A OE2  2  
ATOM 2992  H H    . GLU A 1 88 ? 173.386 -2.879  -13.421 1.00 0.00 ? 87 GLU A H    2  
ATOM 2993  H HA   . GLU A 1 88 ? 171.742 -4.312  -11.490 1.00 0.00 ? 87 GLU A HA   2  
ATOM 2994  H HB2  . GLU A 1 88 ? 171.491 -4.319  -14.500 1.00 0.00 ? 87 GLU A HB2  2  
ATOM 2995  H HB3  . GLU A 1 88 ? 170.283 -4.831  -13.330 1.00 0.00 ? 87 GLU A HB3  2  
ATOM 2996  H HG2  . GLU A 1 88 ? 171.056 -2.116  -12.812 1.00 0.00 ? 87 GLU A HG2  2  
ATOM 2997  H HG3  . GLU A 1 88 ? 170.591 -2.300  -14.500 1.00 0.00 ? 87 GLU A HG3  2  
ATOM 2998  N N    . HIS A 1 89 ? 173.794 -5.811  -13.595 1.00 0.00 ? 88 HIS A N    2  
ATOM 2999  C CA   . HIS A 1 89 ? 174.488 -7.070  -13.868 1.00 0.00 ? 88 HIS A CA   2  
ATOM 3000  C C    . HIS A 1 89 ? 175.991 -6.844  -14.052 1.00 0.00 ? 88 HIS A C    2  
ATOM 3001  O O    . HIS A 1 89 ? 176.412 -5.829  -14.611 1.00 0.00 ? 88 HIS A O    2  
ATOM 3002  C CB   . HIS A 1 89 ? 173.904 -7.739  -15.117 1.00 0.00 ? 88 HIS A CB   2  
ATOM 3003  C CG   . HIS A 1 89 ? 172.865 -8.779  -14.818 1.00 0.00 ? 88 HIS A CG   2  
ATOM 3004  N ND1  . HIS A 1 89 ? 171.655 -8.846  -15.480 1.00 0.00 ? 88 HIS A ND1  2  
ATOM 3005  C CD2  . HIS A 1 89 ? 172.860 -9.802  -13.928 1.00 0.00 ? 88 HIS A CD2  2  
ATOM 3006  C CE1  . HIS A 1 89 ? 170.953 -9.863  -15.011 1.00 0.00 ? 88 HIS A CE1  2  
ATOM 3007  N NE2  . HIS A 1 89 ? 171.661 -10.458 -14.070 1.00 0.00 ? 88 HIS A NE2  2  
ATOM 3008  H H    . HIS A 1 89 ? 174.039 -5.013  -14.109 1.00 0.00 ? 88 HIS A H    2  
ATOM 3009  H HA   . HIS A 1 89 ? 174.338 -7.720  -13.019 1.00 0.00 ? 88 HIS A HA   2  
ATOM 3010  H HB2  . HIS A 1 89 ? 173.448 -6.985  -15.740 1.00 0.00 ? 88 HIS A HB2  2  
ATOM 3011  H HB3  . HIS A 1 89 ? 174.702 -8.216  -15.667 1.00 0.00 ? 88 HIS A HB3  2  
ATOM 3012  H HD1  . HIS A 1 89 ? 171.356 -8.238  -16.188 1.00 0.00 ? 88 HIS A HD1  2  
ATOM 3013  H HD2  . HIS A 1 89 ? 173.652 -10.055 -13.238 1.00 0.00 ? 88 HIS A HD2  2  
ATOM 3014  H HE1  . HIS A 1 89 ? 169.970 -10.159 -15.344 1.00 0.00 ? 88 HIS A HE1  2  
ATOM 3015  H HE2  . HIS A 1 89 ? 171.401 -11.278 -13.599 1.00 0.00 ? 88 HIS A HE2  2  
ATOM 3016  N N    . HIS A 1 90 ? 176.796 -7.800  -13.577 1.00 0.00 ? 89 HIS A N    2  
ATOM 3017  C CA   . HIS A 1 90 ? 178.252 -7.710  -13.686 1.00 0.00 ? 89 HIS A CA   2  
ATOM 3018  C C    . HIS A 1 90 ? 178.876 -9.097  -13.854 1.00 0.00 ? 89 HIS A C    2  
ATOM 3019  O O    . HIS A 1 90 ? 178.441 -10.060 -13.218 1.00 0.00 ? 89 HIS A O    2  
ATOM 3020  C CB   . HIS A 1 90 ? 178.832 -7.022  -12.445 1.00 0.00 ? 89 HIS A CB   2  
ATOM 3021  C CG   . HIS A 1 90 ? 180.011 -6.137  -12.731 1.00 0.00 ? 89 HIS A CG   2  
ATOM 3022  N ND1  . HIS A 1 90 ? 180.680 -5.437  -11.749 1.00 0.00 ? 89 HIS A ND1  2  
ATOM 3023  C CD2  . HIS A 1 90 ? 180.640 -5.840  -13.895 1.00 0.00 ? 89 HIS A CD2  2  
ATOM 3024  C CE1  . HIS A 1 90 ? 181.667 -4.748  -12.295 1.00 0.00 ? 89 HIS A CE1  2  
ATOM 3025  N NE2  . HIS A 1 90 ? 181.664 -4.976  -13.595 1.00 0.00 ? 89 HIS A NE2  2  
ATOM 3026  H H    . HIS A 1 90 ? 176.400 -8.584  -13.142 1.00 0.00 ? 89 HIS A H    2  
ATOM 3027  H HA   . HIS A 1 90 ? 178.482 -7.117  -14.558 1.00 0.00 ? 89 HIS A HA   2  
ATOM 3028  H HB2  . HIS A 1 90 ? 178.065 -6.411  -11.992 1.00 0.00 ? 89 HIS A HB2  2  
ATOM 3029  H HB3  . HIS A 1 90 ? 179.146 -7.776  -11.738 1.00 0.00 ? 89 HIS A HB3  2  
ATOM 3030  H HD1  . HIS A 1 90 ? 180.463 -5.443  -10.793 1.00 0.00 ? 89 HIS A HD1  2  
ATOM 3031  H HD2  . HIS A 1 90 ? 180.383 -6.213  -14.876 1.00 0.00 ? 89 HIS A HD2  2  
ATOM 3032  H HE1  . HIS A 1 90 ? 182.360 -4.108  -11.767 1.00 0.00 ? 89 HIS A HE1  2  
ATOM 3033  H HE2  . HIS A 1 90 ? 182.231 -4.516  -14.250 1.00 0.00 ? 89 HIS A HE2  2  
ATOM 3034  N N    . HIS A 1 91 ? 179.896 -9.186  -14.715 1.00 0.00 ? 90 HIS A N    2  
ATOM 3035  C CA   . HIS A 1 91 ? 180.595 -10.448 -14.982 1.00 0.00 ? 90 HIS A CA   2  
ATOM 3036  C C    . HIS A 1 91 ? 179.657 -11.473 -15.621 1.00 0.00 ? 90 HIS A C    2  
ATOM 3037  O O    . HIS A 1 91 ? 178.986 -12.236 -14.925 1.00 0.00 ? 90 HIS A O    2  
ATOM 3038  C CB   . HIS A 1 91 ? 181.208 -11.017 -13.696 1.00 0.00 ? 90 HIS A CB   2  
ATOM 3039  C CG   . HIS A 1 91 ? 182.641 -10.630 -13.489 1.00 0.00 ? 90 HIS A CG   2  
ATOM 3040  N ND1  . HIS A 1 91 ? 183.676 -11.124 -14.256 1.00 0.00 ? 90 HIS A ND1  2  
ATOM 3041  C CD2  . HIS A 1 91 ? 183.211 -9.792  -12.590 1.00 0.00 ? 90 HIS A CD2  2  
ATOM 3042  C CE1  . HIS A 1 91 ? 184.818 -10.607 -13.838 1.00 0.00 ? 90 HIS A CE1  2  
ATOM 3043  N NE2  . HIS A 1 91 ? 184.563 -9.796  -12.828 1.00 0.00 ? 90 HIS A NE2  2  
ATOM 3044  H H    . HIS A 1 91 ? 180.189 -8.378  -15.185 1.00 0.00 ? 90 HIS A H    2  
ATOM 3045  H HA   . HIS A 1 91 ? 181.392 -10.234 -15.681 1.00 0.00 ? 90 HIS A HA   2  
ATOM 3046  H HB2  . HIS A 1 91 ? 180.645 -10.661 -12.848 1.00 0.00 ? 90 HIS A HB2  2  
ATOM 3047  H HB3  . HIS A 1 91 ? 181.156 -12.095 -13.729 1.00 0.00 ? 90 HIS A HB3  2  
ATOM 3048  H HD1  . HIS A 1 91 ? 183.587 -11.759 -14.998 1.00 0.00 ? 90 HIS A HD1  2  
ATOM 3049  H HD2  . HIS A 1 91 ? 182.695 -9.223  -11.828 1.00 0.00 ? 90 HIS A HD2  2  
ATOM 3050  H HE1  . HIS A 1 91 ? 185.794 -10.811 -14.254 1.00 0.00 ? 90 HIS A HE1  2  
ATOM 3051  H HE2  . HIS A 1 91 ? 185.241 -9.371  -12.261 1.00 0.00 ? 90 HIS A HE2  2  
ATOM 3052  N N    . HIS A 1 92 ? 179.616 -11.480 -16.955 1.00 0.00 ? 91 HIS A N    2  
ATOM 3053  C CA   . HIS A 1 92 ? 178.762 -12.407 -17.695 1.00 0.00 ? 91 HIS A CA   2  
ATOM 3054  C C    . HIS A 1 92 ? 179.520 -13.682 -18.060 1.00 0.00 ? 91 HIS A C    2  
ATOM 3055  O O    . HIS A 1 92 ? 180.636 -13.624 -18.579 1.00 0.00 ? 91 HIS A O    2  
ATOM 3056  C CB   . HIS A 1 92 ? 178.223 -11.736 -18.964 1.00 0.00 ? 91 HIS A CB   2  
ATOM 3057  C CG   . HIS A 1 92 ? 177.055 -12.451 -19.581 1.00 0.00 ? 91 HIS A CG   2  
ATOM 3058  N ND1  . HIS A 1 92 ? 176.228 -13.304 -18.877 1.00 0.00 ? 91 HIS A ND1  2  
ATOM 3059  C CD2  . HIS A 1 92 ? 176.579 -12.433 -20.849 1.00 0.00 ? 91 HIS A CD2  2  
ATOM 3060  C CE1  . HIS A 1 92 ? 175.297 -13.779 -19.685 1.00 0.00 ? 91 HIS A CE1  2  
ATOM 3061  N NE2  . HIS A 1 92 ? 175.487 -13.266 -20.886 1.00 0.00 ? 91 HIS A NE2  2  
ATOM 3062  H H    . HIS A 1 92 ? 180.174 -10.847 -17.453 1.00 0.00 ? 91 HIS A H    2  
ATOM 3063  H HA   . HIS A 1 92 ? 177.930 -12.667 -17.057 1.00 0.00 ? 91 HIS A HA   2  
ATOM 3064  H HB2  . HIS A 1 92 ? 177.906 -10.732 -18.726 1.00 0.00 ? 91 HIS A HB2  2  
ATOM 3065  H HB3  . HIS A 1 92 ? 179.012 -11.692 -19.701 1.00 0.00 ? 91 HIS A HB3  2  
ATOM 3066  H HD1  . HIS A 1 92 ? 176.311 -13.528 -17.927 1.00 0.00 ? 91 HIS A HD1  2  
ATOM 3067  H HD2  . HIS A 1 92 ? 176.982 -11.868 -21.678 1.00 0.00 ? 91 HIS A HD2  2  
ATOM 3068  H HE1  . HIS A 1 92 ? 174.513 -14.468 -19.408 1.00 0.00 ? 91 HIS A HE1  2  
ATOM 3069  H HE2  . HIS A 1 92 ? 174.989 -13.516 -21.692 1.00 0.00 ? 91 HIS A HE2  2  
ATOM 3070  N N    . HIS A 1 93 ? 178.900 -14.832 -17.788 1.00 0.00 ? 92 HIS A N    2  
ATOM 3071  C CA   . HIS A 1 93 ? 179.507 -16.129 -18.088 1.00 0.00 ? 92 HIS A CA   2  
ATOM 3072  C C    . HIS A 1 93 ? 179.409 -16.450 -19.579 1.00 0.00 ? 92 HIS A C    2  
ATOM 3073  O O    . HIS A 1 93 ? 178.519 -15.953 -20.272 1.00 0.00 ? 92 HIS A O    2  
ATOM 3074  C CB   . HIS A 1 93 ? 178.831 -17.235 -17.270 1.00 0.00 ? 92 HIS A CB   2  
ATOM 3075  C CG   . HIS A 1 93 ? 179.770 -18.314 -16.827 1.00 0.00 ? 92 HIS A CG   2  
ATOM 3076  N ND1  . HIS A 1 93 ? 180.759 -18.115 -15.886 1.00 0.00 ? 92 HIS A ND1  2  
ATOM 3077  C CD2  . HIS A 1 93 ? 179.864 -19.613 -17.199 1.00 0.00 ? 92 HIS A CD2  2  
ATOM 3078  C CE1  . HIS A 1 93 ? 181.419 -19.245 -15.698 1.00 0.00 ? 92 HIS A CE1  2  
ATOM 3079  N NE2  . HIS A 1 93 ? 180.895 -20.168 -16.482 1.00 0.00 ? 92 HIS A NE2  2  
ATOM 3080  H H    . HIS A 1 93 ? 178.011 -14.807 -17.377 1.00 0.00 ? 92 HIS A H    2  
ATOM 3081  H HA   . HIS A 1 93 ? 180.549 -16.078 -17.812 1.00 0.00 ? 92 HIS A HA   2  
ATOM 3082  H HB2  . HIS A 1 93 ? 178.385 -16.801 -16.387 1.00 0.00 ? 92 HIS A HB2  2  
ATOM 3083  H HB3  . HIS A 1 93 ? 178.056 -17.694 -17.868 1.00 0.00 ? 92 HIS A HB3  2  
ATOM 3084  H HD1  . HIS A 1 93 ? 180.952 -17.270 -15.427 1.00 0.00 ? 92 HIS A HD1  2  
ATOM 3085  H HD2  . HIS A 1 93 ? 179.244 -20.117 -17.927 1.00 0.00 ? 92 HIS A HD2  2  
ATOM 3086  H HE1  . HIS A 1 93 ? 182.244 -19.388 -15.016 1.00 0.00 ? 92 HIS A HE1  2  
ATOM 3087  H HE2  . HIS A 1 93 ? 181.254 -21.070 -16.610 1.00 0.00 ? 92 HIS A HE2  2  
ATOM 3088  N N    . HIS A 1 94 ? 180.329 -17.286 -20.062 1.00 0.00 ? 93 HIS A N    2  
ATOM 3089  C CA   . HIS A 1 94 ? 180.350 -17.678 -21.472 1.00 0.00 ? 93 HIS A CA   2  
ATOM 3090  C C    . HIS A 1 94 ? 179.289 -18.738 -21.772 1.00 0.00 ? 93 HIS A C    2  
ATOM 3091  O O    . HIS A 1 94 ? 178.877 -18.841 -22.947 1.00 0.00 ? 93 HIS A O    2  
ATOM 3092  C CB   . HIS A 1 94 ? 181.734 -18.209 -21.858 1.00 0.00 ? 93 HIS A CB   2  
ATOM 3093  C CG   . HIS A 1 94 ? 182.210 -17.733 -23.197 1.00 0.00 ? 93 HIS A CG   2  
ATOM 3094  N ND1  . HIS A 1 94 ? 181.511 -17.949 -24.365 1.00 0.00 ? 93 HIS A ND1  2  
ATOM 3095  C CD2  . HIS A 1 94 ? 183.323 -17.046 -23.550 1.00 0.00 ? 93 HIS A CD2  2  
ATOM 3096  C CE1  . HIS A 1 94 ? 182.172 -17.417 -25.378 1.00 0.00 ? 93 HIS A CE1  2  
ATOM 3097  N NE2  . HIS A 1 94 ? 183.274 -16.862 -24.910 1.00 0.00 ? 93 HIS A NE2  2  
ATOM 3098  O OXT  . HIS A 1 94 ? 178.879 -19.455 -20.833 1.00 0.00 ? 93 HIS A OXT  2  
ATOM 3099  H H    . HIS A 1 94 ? 181.008 -17.649 -19.457 1.00 0.00 ? 93 HIS A H    2  
ATOM 3100  H HA   . HIS A 1 94 ? 180.136 -16.798 -22.060 1.00 0.00 ? 93 HIS A HA   2  
ATOM 3101  H HB2  . HIS A 1 94 ? 182.454 -17.893 -21.118 1.00 0.00 ? 93 HIS A HB2  2  
ATOM 3102  H HB3  . HIS A 1 94 ? 181.703 -19.289 -21.882 1.00 0.00 ? 93 HIS A HB3  2  
ATOM 3103  H HD1  . HIS A 1 94 ? 180.656 -18.425 -24.440 1.00 0.00 ? 93 HIS A HD1  2  
ATOM 3104  H HD2  . HIS A 1 94 ? 184.106 -16.707 -22.885 1.00 0.00 ? 93 HIS A HD2  2  
ATOM 3105  H HE1  . HIS A 1 94 ? 181.862 -17.432 -26.411 1.00 0.00 ? 93 HIS A HE1  2  
ATOM 3106  H HE2  . HIS A 1 94 ? 183.888 -16.302 -25.430 1.00 0.00 ? 93 HIS A HE2  2  
ATOM 3107  N N    . GLN A 1 2  ? 137.327 1.614   12.106  1.00 0.00 ? 1  GLN A N    3  
ATOM 3108  C CA   . GLN A 1 2  ? 136.942 0.177   12.087  1.00 0.00 ? 1  GLN A CA   3  
ATOM 3109  C C    . GLN A 1 2  ? 138.137 -0.710  11.745  1.00 0.00 ? 1  GLN A C    3  
ATOM 3110  O O    . GLN A 1 2  ? 138.744 -1.310  12.633  1.00 0.00 ? 1  GLN A O    3  
ATOM 3111  C CB   . GLN A 1 2  ? 135.803 -0.015  11.077  1.00 0.00 ? 1  GLN A CB   3  
ATOM 3112  C CG   . GLN A 1 2  ? 134.481 0.572   11.547  1.00 0.00 ? 1  GLN A CG   3  
ATOM 3113  C CD   . GLN A 1 2  ? 133.287 -0.272  11.145  1.00 0.00 ? 1  GLN A CD   3  
ATOM 3114  O OE1  . GLN A 1 2  ? 132.764 -1.048  11.945  1.00 0.00 ? 1  GLN A OE1  3  
ATOM 3115  N NE2  . GLN A 1 2  ? 132.849 -0.125  9.901   1.00 0.00 ? 1  GLN A NE2  3  
ATOM 3116  H HA   . GLN A 1 2  ? 136.588 -0.090  13.068  1.00 0.00 ? 1  GLN A HA   3  
ATOM 3117  H HB2  . GLN A 1 2  ? 136.074 0.462   10.146  1.00 0.00 ? 1  GLN A HB2  3  
ATOM 3118  H HB3  . GLN A 1 2  ? 135.662 -1.072  10.904  1.00 0.00 ? 1  GLN A HB3  3  
ATOM 3119  H HG2  . GLN A 1 2  ? 134.499 0.649   12.625  1.00 0.00 ? 1  GLN A HG2  3  
ATOM 3120  H HG3  . GLN A 1 2  ? 134.367 1.558   11.121  1.00 0.00 ? 1  GLN A HG3  3  
ATOM 3121  H HE21 . GLN A 1 2  ? 133.313 0.512   9.318   1.00 0.00 ? 1  GLN A HE21 3  
ATOM 3122  H HE22 . GLN A 1 2  ? 132.080 -0.660  9.615   1.00 0.00 ? 1  GLN A HE22 3  
ATOM 3123  N N    . SER A 1 3  ? 138.480 -0.785  10.462  1.00 0.00 ? 2  SER A N    3  
ATOM 3124  C CA   . SER A 1 3  ? 139.612 -1.596  10.025  1.00 0.00 ? 2  SER A CA   3  
ATOM 3125  C C    . SER A 1 3  ? 140.069 -1.193  8.623   1.00 0.00 ? 2  SER A C    3  
ATOM 3126  O O    . SER A 1 3  ? 139.574 -1.711  7.621   1.00 0.00 ? 2  SER A O    3  
ATOM 3127  C CB   . SER A 1 3  ? 139.252 -3.086  10.065  1.00 0.00 ? 2  SER A CB   3  
ATOM 3128  O OG   . SER A 1 3  ? 138.019 -3.336  9.414   1.00 0.00 ? 2  SER A OG   3  
ATOM 3129  H H    . SER A 1 3  ? 137.966 -0.282  9.800   1.00 0.00 ? 2  SER A H    3  
ATOM 3130  H HA   . SER A 1 3  ? 140.424 -1.415  10.713  1.00 0.00 ? 2  SER A HA   3  
ATOM 3131  H HB2  . SER A 1 3  ? 140.027 -3.656  9.573   1.00 0.00 ? 2  SER A HB2  3  
ATOM 3132  H HB3  . SER A 1 3  ? 139.171 -3.405  11.095  1.00 0.00 ? 2  SER A HB3  3  
ATOM 3133  H HG   . SER A 1 3  ? 138.162 -3.933  8.676   1.00 0.00 ? 2  SER A HG   3  
ATOM 3134  N N    . ASP A 1 4  ? 141.021 -0.263  8.571   1.00 0.00 ? 3  ASP A N    3  
ATOM 3135  C CA   . ASP A 1 4  ? 141.566 0.231   7.309   1.00 0.00 ? 3  ASP A CA   3  
ATOM 3136  C C    . ASP A 1 4  ? 142.880 0.970   7.548   1.00 0.00 ? 3  ASP A C    3  
ATOM 3137  O O    . ASP A 1 4  ? 142.879 2.156   7.884   1.00 0.00 ? 3  ASP A O    3  
ATOM 3138  C CB   . ASP A 1 4  ? 140.566 1.169   6.624   1.00 0.00 ? 3  ASP A CB   3  
ATOM 3139  C CG   . ASP A 1 4  ? 139.778 0.479   5.528   1.00 0.00 ? 3  ASP A CG   3  
ATOM 3140  O OD1  . ASP A 1 4  ? 140.380 0.138   4.488   1.00 0.00 ? 3  ASP A OD1  3  
ATOM 3141  O OD2  . ASP A 1 4  ? 138.558 0.280   5.710   1.00 0.00 ? 3  ASP A OD2  3  
ATOM 3142  H H    . ASP A 1 4  ? 141.368 0.103   9.407   1.00 0.00 ? 3  ASP A H    3  
ATOM 3143  H HA   . ASP A 1 4  ? 141.752 -0.618  6.669   1.00 0.00 ? 3  ASP A HA   3  
ATOM 3144  H HB2  . ASP A 1 4  ? 139.871 1.545   7.359   1.00 0.00 ? 3  ASP A HB2  3  
ATOM 3145  H HB3  . ASP A 1 4  ? 141.103 2.000   6.186   1.00 0.00 ? 3  ASP A HB3  3  
ATOM 3146  N N    . VAL A 1 5  ? 144.000 0.271   7.374   1.00 0.00 ? 4  VAL A N    3  
ATOM 3147  C CA   . VAL A 1 5  ? 145.311 0.883   7.573   1.00 0.00 ? 4  VAL A CA   3  
ATOM 3148  C C    . VAL A 1 5  ? 145.607 1.892   6.465   1.00 0.00 ? 4  VAL A C    3  
ATOM 3149  O O    . VAL A 1 5  ? 145.521 1.566   5.281   1.00 0.00 ? 4  VAL A O    3  
ATOM 3150  C CB   . VAL A 1 5  ? 146.445 -0.166  7.619   1.00 0.00 ? 4  VAL A CB   3  
ATOM 3151  C CG1  . VAL A 1 5  ? 147.762 0.494   7.998   1.00 0.00 ? 4  VAL A CG1  3  
ATOM 3152  C CG2  . VAL A 1 5  ? 146.109 -1.287  8.593   1.00 0.00 ? 4  VAL A CG2  3  
ATOM 3153  H H    . VAL A 1 5  ? 143.945 -0.671  7.104   1.00 0.00 ? 4  VAL A H    3  
ATOM 3154  H HA   . VAL A 1 5  ? 145.292 1.403   8.521   1.00 0.00 ? 4  VAL A HA   3  
ATOM 3155  H HB   . VAL A 1 5  ? 146.553 -0.594  6.633   1.00 0.00 ? 4  VAL A HB   3  
ATOM 3156  H HG11 . VAL A 1 5  ? 147.976 1.295   7.306   1.00 0.00 ? 4  VAL A HG11 3  
ATOM 3157  H HG12 . VAL A 1 5  ? 148.556 -0.236  7.961   1.00 0.00 ? 4  VAL A HG12 3  
ATOM 3158  H HG13 . VAL A 1 5  ? 147.689 0.894   8.999   1.00 0.00 ? 4  VAL A HG13 3  
ATOM 3159  H HG21 . VAL A 1 5  ? 145.512 -2.034  8.091   1.00 0.00 ? 4  VAL A HG21 3  
ATOM 3160  H HG22 . VAL A 1 5  ? 145.555 -0.885  9.428   1.00 0.00 ? 4  VAL A HG22 3  
ATOM 3161  H HG23 . VAL A 1 5  ? 147.023 -1.738  8.952   1.00 0.00 ? 4  VAL A HG23 3  
ATOM 3162  N N    . ARG A 1 6  ? 145.948 3.119   6.859   1.00 0.00 ? 5  ARG A N    3  
ATOM 3163  C CA   . ARG A 1 6  ? 146.247 4.180   5.900   1.00 0.00 ? 5  ARG A CA   3  
ATOM 3164  C C    . ARG A 1 6  ? 147.717 4.147   5.486   1.00 0.00 ? 5  ARG A C    3  
ATOM 3165  O O    . ARG A 1 6  ? 148.608 4.414   6.295   1.00 0.00 ? 5  ARG A O    3  
ATOM 3166  C CB   . ARG A 1 6  ? 145.903 5.550   6.496   1.00 0.00 ? 5  ARG A CB   3  
ATOM 3167  C CG   . ARG A 1 6  ? 144.459 5.973   6.272   1.00 0.00 ? 5  ARG A CG   3  
ATOM 3168  C CD   . ARG A 1 6  ? 144.182 7.346   6.867   1.00 0.00 ? 5  ARG A CD   3  
ATOM 3169  N NE   . ARG A 1 6  ? 142.940 7.930   6.353   1.00 0.00 ? 5  ARG A NE   3  
ATOM 3170  C CZ   . ARG A 1 6  ? 142.608 9.218   6.481   1.00 0.00 ? 5  ARG A CZ   3  
ATOM 3171  N NH1  . ARG A 1 6  ? 143.417 10.067  7.109   1.00 0.00 ? 5  ARG A NH1  3  
ATOM 3172  N NH2  . ARG A 1 6  ? 141.459 9.659   5.978   1.00 0.00 ? 5  ARG A NH2  3  
ATOM 3173  H H    . ARG A 1 6  ? 145.993 3.316   7.818   1.00 0.00 ? 5  ARG A H    3  
ATOM 3174  H HA   . ARG A 1 6  ? 145.636 4.016   5.024   1.00 0.00 ? 5  ARG A HA   3  
ATOM 3175  H HB2  . ARG A 1 6  ? 146.086 5.523   7.561   1.00 0.00 ? 5  ARG A HB2  3  
ATOM 3176  H HB3  . ARG A 1 6  ? 146.546 6.294   6.050   1.00 0.00 ? 5  ARG A HB3  3  
ATOM 3177  H HG2  . ARG A 1 6  ? 144.264 6.005   5.210   1.00 0.00 ? 5  ARG A HG2  3  
ATOM 3178  H HG3  . ARG A 1 6  ? 143.806 5.250   6.738   1.00 0.00 ? 5  ARG A HG3  3  
ATOM 3179  H HD2  . ARG A 1 6  ? 144.105 7.252   7.940   1.00 0.00 ? 5  ARG A HD2  3  
ATOM 3180  H HD3  . ARG A 1 6  ? 145.005 8.001   6.623   1.00 0.00 ? 5  ARG A HD3  3  
ATOM 3181  H HE   . ARG A 1 6  ? 142.321 7.330   5.886   1.00 0.00 ? 5  ARG A HE   3  
ATOM 3182  H HH11 . ARG A 1 6  ? 144.282 9.745   7.492   1.00 0.00 ? 5  ARG A HH11 3  
ATOM 3183  H HH12 . ARG A 1 6  ? 143.159 11.030  7.199   1.00 0.00 ? 5  ARG A HH12 3  
ATOM 3184  H HH21 . ARG A 1 6  ? 140.844 9.028   5.505   1.00 0.00 ? 5  ARG A HH21 3  
ATOM 3185  H HH22 . ARG A 1 6  ? 141.209 10.623  6.072   1.00 0.00 ? 5  ARG A HH22 3  
ATOM 3186  N N    . ILE A 1 7  ? 147.960 3.817   4.219   1.00 0.00 ? 6  ILE A N    3  
ATOM 3187  C CA   . ILE A 1 7  ? 149.316 3.746   3.686   1.00 0.00 ? 6  ILE A CA   3  
ATOM 3188  C C    . ILE A 1 7  ? 149.549 4.837   2.641   1.00 0.00 ? 6  ILE A C    3  
ATOM 3189  O O    . ILE A 1 7  ? 148.698 5.078   1.782   1.00 0.00 ? 6  ILE A O    3  
ATOM 3190  C CB   . ILE A 1 7  ? 149.597 2.366   3.050   1.00 0.00 ? 6  ILE A CB   3  
ATOM 3191  C CG1  . ILE A 1 7  ? 149.235 1.238   4.023   1.00 0.00 ? 6  ILE A CG1  3  
ATOM 3192  C CG2  . ILE A 1 7  ? 151.056 2.256   2.629   1.00 0.00 ? 6  ILE A CG2  3  
ATOM 3193  C CD1  . ILE A 1 7  ? 148.561 0.058   3.358   1.00 0.00 ? 6  ILE A CD1  3  
ATOM 3194  H H    . ILE A 1 7  ? 147.206 3.615   3.625   1.00 0.00 ? 6  ILE A H    3  
ATOM 3195  H HA   . ILE A 1 7  ? 150.006 3.891   4.505   1.00 0.00 ? 6  ILE A HA   3  
ATOM 3196  H HB   . ILE A 1 7  ? 148.986 2.275   2.163   1.00 0.00 ? 6  ILE A HB   3  
ATOM 3197  H HG12 . ILE A 1 7  ? 150.135 0.880   4.499   1.00 0.00 ? 6  ILE A HG12 3  
ATOM 3198  H HG13 . ILE A 1 7  ? 148.563 1.622   4.777   1.00 0.00 ? 6  ILE A HG13 3  
ATOM 3199  H HG21 . ILE A 1 7  ? 151.188 1.371   2.024   1.00 0.00 ? 6  ILE A HG21 3  
ATOM 3200  H HG22 . ILE A 1 7  ? 151.680 2.188   3.507   1.00 0.00 ? 6  ILE A HG22 3  
ATOM 3201  H HG23 . ILE A 1 7  ? 151.333 3.128   2.055   1.00 0.00 ? 6  ILE A HG23 3  
ATOM 3202  H HD11 . ILE A 1 7  ? 148.939 -0.860  3.784   1.00 0.00 ? 6  ILE A HD11 3  
ATOM 3203  H HD12 . ILE A 1 7  ? 148.769 0.075   2.298   1.00 0.00 ? 6  ILE A HD12 3  
ATOM 3204  H HD13 . ILE A 1 7  ? 147.494 0.115   3.517   1.00 0.00 ? 6  ILE A HD13 3  
ATOM 3205  N N    . LYS A 1 8  ? 150.706 5.494   2.722   1.00 0.00 ? 7  LYS A N    3  
ATOM 3206  C CA   . LYS A 1 8  ? 151.054 6.558   1.785   1.00 0.00 ? 7  LYS A CA   3  
ATOM 3207  C C    . LYS A 1 8  ? 151.950 6.026   0.667   1.00 0.00 ? 7  LYS A C    3  
ATOM 3208  O O    . LYS A 1 8  ? 152.974 5.390   0.928   1.00 0.00 ? 7  LYS A O    3  
ATOM 3209  C CB   . LYS A 1 8  ? 151.752 7.706   2.521   1.00 0.00 ? 7  LYS A CB   3  
ATOM 3210  C CG   . LYS A 1 8  ? 151.324 9.084   2.043   1.00 0.00 ? 7  LYS A CG   3  
ATOM 3211  C CD   . LYS A 1 8  ? 152.384 10.130  2.346   1.00 0.00 ? 7  LYS A CD   3  
ATOM 3212  C CE   . LYS A 1 8  ? 151.850 11.541  2.153   1.00 0.00 ? 7  LYS A CE   3  
ATOM 3213  N NZ   . LYS A 1 8  ? 152.949 12.540  2.047   1.00 0.00 ? 7  LYS A NZ   3  
ATOM 3214  H H    . LYS A 1 8  ? 151.342 5.255   3.429   1.00 0.00 ? 7  LYS A H    3  
ATOM 3215  H HA   . LYS A 1 8  ? 150.137 6.927   1.349   1.00 0.00 ? 7  LYS A HA   3  
ATOM 3216  H HB2  . LYS A 1 8  ? 151.529 7.630   3.575   1.00 0.00 ? 7  LYS A HB2  3  
ATOM 3217  H HB3  . LYS A 1 8  ? 152.820 7.614   2.381   1.00 0.00 ? 7  LYS A HB3  3  
ATOM 3218  H HG2  . LYS A 1 8  ? 151.160 9.052   0.976   1.00 0.00 ? 7  LYS A HG2  3  
ATOM 3219  H HG3  . LYS A 1 8  ? 150.407 9.359   2.543   1.00 0.00 ? 7  LYS A HG3  3  
ATOM 3220  H HD2  . LYS A 1 8  ? 152.706 10.017  3.370   1.00 0.00 ? 7  LYS A HD2  3  
ATOM 3221  H HD3  . LYS A 1 8  ? 153.224 9.979   1.683   1.00 0.00 ? 7  LYS A HD3  3  
ATOM 3222  H HE2  . LYS A 1 8  ? 151.261 11.569  1.248   1.00 0.00 ? 7  LYS A HE2  3  
ATOM 3223  H HE3  . LYS A 1 8  ? 151.224 11.793  2.997   1.00 0.00 ? 7  LYS A HE3  3  
ATOM 3224  H HZ1  . LYS A 1 8  ? 152.625 13.465  2.395   1.00 0.00 ? 7  LYS A HZ1  3  
ATOM 3225  H HZ2  . LYS A 1 8  ? 153.248 12.640  1.057   1.00 0.00 ? 7  LYS A HZ2  3  
ATOM 3226  H HZ3  . LYS A 1 8  ? 153.767 12.235  2.614   1.00 0.00 ? 7  LYS A HZ3  3  
ATOM 3227  N N    . PHE A 1 9  ? 151.551 6.287   -0.578  1.00 0.00 ? 8  PHE A N    3  
ATOM 3228  C CA   . PHE A 1 9  ? 152.305 5.833   -1.747  1.00 0.00 ? 8  PHE A CA   3  
ATOM 3229  C C    . PHE A 1 9  ? 152.986 7.008   -2.450  1.00 0.00 ? 8  PHE A C    3  
ATOM 3230  O O    . PHE A 1 9  ? 152.372 8.054   -2.663  1.00 0.00 ? 8  PHE A O    3  
ATOM 3231  C CB   . PHE A 1 9  ? 151.372 5.109   -2.725  1.00 0.00 ? 8  PHE A CB   3  
ATOM 3232  C CG   . PHE A 1 9  ? 150.949 3.740   -2.262  1.00 0.00 ? 8  PHE A CG   3  
ATOM 3233  C CD1  . PHE A 1 9  ? 150.173 3.583   -1.122  1.00 0.00 ? 8  PHE A CD1  3  
ATOM 3234  C CD2  . PHE A 1 9  ? 151.326 2.609   -2.969  1.00 0.00 ? 8  PHE A CD2  3  
ATOM 3235  C CE1  . PHE A 1 9  ? 149.787 2.326   -0.697  1.00 0.00 ? 8  PHE A CE1  3  
ATOM 3236  C CE2  . PHE A 1 9  ? 150.942 1.351   -2.549  1.00 0.00 ? 8  PHE A CE2  3  
ATOM 3237  C CZ   . PHE A 1 9  ? 150.171 1.208   -1.412  1.00 0.00 ? 8  PHE A CZ   3  
ATOM 3238  H H    . PHE A 1 9  ? 150.724 6.794   -0.715  1.00 0.00 ? 8  PHE A H    3  
ATOM 3239  H HA   . PHE A 1 9  ? 153.062 5.142   -1.406  1.00 0.00 ? 8  PHE A HA   3  
ATOM 3240  H HB2  . PHE A 1 9  ? 150.479 5.702   -2.865  1.00 0.00 ? 8  PHE A HB2  3  
ATOM 3241  H HB3  . PHE A 1 9  ? 151.875 5.000   -3.674  1.00 0.00 ? 8  PHE A HB3  3  
ATOM 3242  H HD1  . PHE A 1 9  ? 149.871 4.456   -0.562  1.00 0.00 ? 8  PHE A HD1  3  
ATOM 3243  H HD2  . PHE A 1 9  ? 151.929 2.717   -3.859  1.00 0.00 ? 8  PHE A HD2  3  
ATOM 3244  H HE1  . PHE A 1 9  ? 149.184 2.219   0.192   1.00 0.00 ? 8  PHE A HE1  3  
ATOM 3245  H HE2  . PHE A 1 9  ? 151.244 0.478   -3.109  1.00 0.00 ? 8  PHE A HE2  3  
ATOM 3246  H HZ   . PHE A 1 9  ? 149.870 0.224   -1.081  1.00 0.00 ? 8  PHE A HZ   3  
ATOM 3247  N N    . GLU A 1 10 ? 154.260 6.828   -2.809  1.00 0.00 ? 9  GLU A N    3  
ATOM 3248  C CA   . GLU A 1 10 ? 155.025 7.874   -3.487  1.00 0.00 ? 9  GLU A CA   3  
ATOM 3249  C C    . GLU A 1 10 ? 155.498 7.410   -4.866  1.00 0.00 ? 9  GLU A C    3  
ATOM 3250  O O    . GLU A 1 10 ? 156.145 6.369   -4.994  1.00 0.00 ? 9  GLU A O    3  
ATOM 3251  C CB   . GLU A 1 10 ? 156.225 8.291   -2.631  1.00 0.00 ? 9  GLU A CB   3  
ATOM 3252  C CG   . GLU A 1 10 ? 156.028 9.618   -1.911  1.00 0.00 ? 9  GLU A CG   3  
ATOM 3253  C CD   . GLU A 1 10 ? 156.399 9.550   -0.441  1.00 0.00 ? 9  GLU A CD   3  
ATOM 3254  O OE1  . GLU A 1 10 ? 157.589 9.321   -0.136  1.00 0.00 ? 9  GLU A OE1  3  
ATOM 3255  O OE2  . GLU A 1 10 ? 155.498 9.728   0.407   1.00 0.00 ? 9  GLU A OE2  3  
ATOM 3256  H H    . GLU A 1 10 ? 154.697 5.972   -2.611  1.00 0.00 ? 9  GLU A H    3  
ATOM 3257  H HA   . GLU A 1 10 ? 154.374 8.727   -3.614  1.00 0.00 ? 9  GLU A HA   3  
ATOM 3258  H HB2  . GLU A 1 10 ? 156.409 7.527   -1.888  1.00 0.00 ? 9  GLU A HB2  3  
ATOM 3259  H HB3  . GLU A 1 10 ? 157.095 8.378   -3.266  1.00 0.00 ? 9  GLU A HB3  3  
ATOM 3260  H HG2  . GLU A 1 10 ? 156.645 10.366  -2.386  1.00 0.00 ? 9  GLU A HG2  3  
ATOM 3261  H HG3  . GLU A 1 10 ? 154.990 9.905   -1.992  1.00 0.00 ? 9  GLU A HG3  3  
ATOM 3262  N N    . HIS A 1 11 ? 155.170 8.197   -5.894  1.00 0.00 ? 10 HIS A N    3  
ATOM 3263  C CA   . HIS A 1 11 ? 155.556 7.882   -7.269  1.00 0.00 ? 10 HIS A CA   3  
ATOM 3264  C C    . HIS A 1 11 ? 155.760 9.162   -8.075  1.00 0.00 ? 10 HIS A C    3  
ATOM 3265  O O    . HIS A 1 11 ? 154.854 9.992   -8.166  1.00 0.00 ? 10 HIS A O    3  
ATOM 3266  C CB   . HIS A 1 11 ? 154.488 7.010   -7.932  1.00 0.00 ? 10 HIS A CB   3  
ATOM 3267  C CG   . HIS A 1 11 ? 154.822 6.599   -9.335  1.00 0.00 ? 10 HIS A CG   3  
ATOM 3268  N ND1  . HIS A 1 11 ? 154.021 6.903   -10.416 1.00 0.00 ? 10 HIS A ND1  3  
ATOM 3269  C CD2  . HIS A 1 11 ? 155.866 5.892   -9.830  1.00 0.00 ? 10 HIS A CD2  3  
ATOM 3270  C CE1  . HIS A 1 11 ? 154.554 6.398   -11.513 1.00 0.00 ? 10 HIS A CE1  3  
ATOM 3271  N NE2  . HIS A 1 11 ? 155.674 5.780   -11.186 1.00 0.00 ? 10 HIS A NE2  3  
ATOM 3272  H H    . HIS A 1 11 ? 154.654 9.014   -5.723  1.00 0.00 ? 10 HIS A H    3  
ATOM 3273  H HA   . HIS A 1 11 ? 156.488 7.337   -7.236  1.00 0.00 ? 10 HIS A HA   3  
ATOM 3274  H HB2  . HIS A 1 11 ? 154.355 6.112   -7.348  1.00 0.00 ? 10 HIS A HB2  3  
ATOM 3275  H HB3  . HIS A 1 11 ? 153.556 7.556   -7.958  1.00 0.00 ? 10 HIS A HB3  3  
ATOM 3276  H HD1  . HIS A 1 11 ? 153.189 7.421   -10.384 1.00 0.00 ? 10 HIS A HD1  3  
ATOM 3277  H HD2  . HIS A 1 11 ? 156.697 5.491   -9.265  1.00 0.00 ? 10 HIS A HD2  3  
ATOM 3278  H HE1  . HIS A 1 11 ? 154.140 6.470   -12.509 1.00 0.00 ? 10 HIS A HE1  3  
ATOM 3279  H HE2  . HIS A 1 11 ? 156.280 5.336   -11.814 1.00 0.00 ? 10 HIS A HE2  3  
ATOM 3280  N N    . ASN A 1 12 ? 156.951 9.319   -8.653  1.00 0.00 ? 11 ASN A N    3  
ATOM 3281  C CA   . ASN A 1 12 ? 157.276 10.503  -9.448  1.00 0.00 ? 11 ASN A CA   3  
ATOM 3282  C C    . ASN A 1 12 ? 157.114 11.780  -8.617  1.00 0.00 ? 11 ASN A C    3  
ATOM 3283  O O    . ASN A 1 12 ? 156.697 12.820  -9.129  1.00 0.00 ? 11 ASN A O    3  
ATOM 3284  C CB   . ASN A 1 12 ? 156.391 10.568  -10.698 1.00 0.00 ? 11 ASN A CB   3  
ATOM 3285  C CG   . ASN A 1 12 ? 157.013 11.406  -11.801 1.00 0.00 ? 11 ASN A CG   3  
ATOM 3286  O OD1  . ASN A 1 12 ? 156.812 12.619  -11.862 1.00 0.00 ? 11 ASN A OD1  3  
ATOM 3287  N ND2  . ASN A 1 12 ? 157.775 10.764  -12.680 1.00 0.00 ? 11 ASN A ND2  3  
ATOM 3288  H H    . ASN A 1 12 ? 157.632 8.622   -8.539  1.00 0.00 ? 11 ASN A H    3  
ATOM 3289  H HA   . ASN A 1 12 ? 158.308 10.420  -9.755  1.00 0.00 ? 11 ASN A HA   3  
ATOM 3290  H HB2  . ASN A 1 12 ? 156.235 9.569   -11.075 1.00 0.00 ? 11 ASN A HB2  3  
ATOM 3291  H HB3  . ASN A 1 12 ? 155.438 11.001  -10.435 1.00 0.00 ? 11 ASN A HB3  3  
ATOM 3292  H HD21 . ASN A 1 12 ? 157.894 9.797   -12.572 1.00 0.00 ? 11 ASN A HD21 3  
ATOM 3293  H HD22 . ASN A 1 12 ? 158.187 11.284  -13.401 1.00 0.00 ? 11 ASN A HD22 3  
ATOM 3294  N N    . GLY A 1 13 ? 157.445 11.689  -7.327  1.00 0.00 ? 12 GLY A N    3  
ATOM 3295  C CA   . GLY A 1 13 ? 157.329 12.838  -6.444  1.00 0.00 ? 12 GLY A CA   3  
ATOM 3296  C C    . GLY A 1 13 ? 155.884 13.194  -6.111  1.00 0.00 ? 12 GLY A C    3  
ATOM 3297  O O    . GLY A 1 13 ? 155.617 14.271  -5.576  1.00 0.00 ? 12 GLY A O    3  
ATOM 3298  H H    . GLY A 1 13 ? 157.770 10.836  -6.973  1.00 0.00 ? 12 GLY A H    3  
ATOM 3299  H HA2  . GLY A 1 13 ? 157.853 12.623  -5.525  1.00 0.00 ? 12 GLY A HA2  3  
ATOM 3300  H HA3  . GLY A 1 13 ? 157.796 13.689  -6.918  1.00 0.00 ? 12 GLY A HA3  3  
ATOM 3301  N N    . GLU A 1 14 ? 154.950 12.293  -6.429  1.00 0.00 ? 13 GLU A N    3  
ATOM 3302  C CA   . GLU A 1 14 ? 153.533 12.527  -6.163  1.00 0.00 ? 13 GLU A CA   3  
ATOM 3303  C C    . GLU A 1 14 ? 153.083 11.783  -4.910  1.00 0.00 ? 13 GLU A C    3  
ATOM 3304  O O    . GLU A 1 14 ? 153.569 10.688  -4.619  1.00 0.00 ? 13 GLU A O    3  
ATOM 3305  C CB   . GLU A 1 14 ? 152.688 12.087  -7.362  1.00 0.00 ? 13 GLU A CB   3  
ATOM 3306  C CG   . GLU A 1 14 ? 152.931 12.913  -8.618  1.00 0.00 ? 13 GLU A CG   3  
ATOM 3307  C CD   . GLU A 1 14 ? 152.396 12.248  -9.873  1.00 0.00 ? 13 GLU A CD   3  
ATOM 3308  O OE1  . GLU A 1 14 ? 151.162 12.262  -10.072 1.00 0.00 ? 13 GLU A OE1  3  
ATOM 3309  O OE2  . GLU A 1 14 ? 153.209 11.715  -10.657 1.00 0.00 ? 13 GLU A OE2  3  
ATOM 3310  H H    . GLU A 1 14 ? 155.217 11.453  -6.854  1.00 0.00 ? 13 GLU A H    3  
ATOM 3311  H HA   . GLU A 1 14 ? 153.396 13.587  -6.007  1.00 0.00 ? 13 GLU A HA   3  
ATOM 3312  H HB2  . GLU A 1 14 ? 152.913 11.054  -7.586  1.00 0.00 ? 13 GLU A HB2  3  
ATOM 3313  H HB3  . GLU A 1 14 ? 151.643 12.169  -7.099  1.00 0.00 ? 13 GLU A HB3  3  
ATOM 3314  H HG2  . GLU A 1 14 ? 152.446 13.870  -8.503  1.00 0.00 ? 13 GLU A HG2  3  
ATOM 3315  H HG3  . GLU A 1 14 ? 153.995 13.061  -8.735  1.00 0.00 ? 13 GLU A HG3  3  
ATOM 3316  N N    . ARG A 1 15 ? 152.153 12.388  -4.172  1.00 0.00 ? 14 ARG A N    3  
ATOM 3317  C CA   . ARG A 1 15 ? 151.633 11.787  -2.945  1.00 0.00 ? 14 ARG A CA   3  
ATOM 3318  C C    . ARG A 1 15 ? 150.309 11.066  -3.200  1.00 0.00 ? 14 ARG A C    3  
ATOM 3319  O O    . ARG A 1 15 ? 149.481 11.529  -3.987  1.00 0.00 ? 14 ARG A O    3  
ATOM 3320  C CB   . ARG A 1 15 ? 151.440 12.855  -1.863  1.00 0.00 ? 14 ARG A CB   3  
ATOM 3321  C CG   . ARG A 1 15 ? 152.636 13.779  -1.684  1.00 0.00 ? 14 ARG A CG   3  
ATOM 3322  C CD   . ARG A 1 15 ? 152.196 15.203  -1.380  1.00 0.00 ? 14 ARG A CD   3  
ATOM 3323  N NE   . ARG A 1 15 ? 151.791 15.372  0.016   1.00 0.00 ? 14 ARG A NE   3  
ATOM 3324  C CZ   . ARG A 1 15 ? 151.047 16.390  0.459   1.00 0.00 ? 14 ARG A CZ   3  
ATOM 3325  N NH1  . ARG A 1 15 ? 150.631 17.334  -0.381  1.00 0.00 ? 14 ARG A NH1  3  
ATOM 3326  N NH2  . ARG A 1 15 ? 150.721 16.465  1.744   1.00 0.00 ? 14 ARG A NH2  3  
ATOM 3327  H H    . ARG A 1 15 ? 151.807 13.259  -4.459  1.00 0.00 ? 14 ARG A H    3  
ATOM 3328  H HA   . ARG A 1 15 ? 152.360 11.067  -2.599  1.00 0.00 ? 14 ARG A HA   3  
ATOM 3329  H HB2  . ARG A 1 15 ? 150.582 13.461  -2.119  1.00 0.00 ? 14 ARG A HB2  3  
ATOM 3330  H HB3  . ARG A 1 15 ? 151.251 12.363  -0.921  1.00 0.00 ? 14 ARG A HB3  3  
ATOM 3331  H HG2  . ARG A 1 15 ? 153.239 13.417  -0.866  1.00 0.00 ? 14 ARG A HG2  3  
ATOM 3332  H HG3  . ARG A 1 15 ? 153.220 13.778  -2.592  1.00 0.00 ? 14 ARG A HG3  3  
ATOM 3333  H HD2  . ARG A 1 15 ? 153.017 15.872  -1.590  1.00 0.00 ? 14 ARG A HD2  3  
ATOM 3334  H HD3  . ARG A 1 15 ? 151.360 15.450  -2.019  1.00 0.00 ? 14 ARG A HD3  3  
ATOM 3335  H HE   . ARG A 1 15 ? 152.086 14.693  0.658   1.00 0.00 ? 14 ARG A HE   3  
ATOM 3336  H HH11 . ARG A 1 15 ? 150.872 17.288  -1.350  1.00 0.00 ? 14 ARG A HH11 3  
ATOM 3337  H HH12 . ARG A 1 15 ? 150.074 18.093  -0.042  1.00 0.00 ? 14 ARG A HH12 3  
ATOM 3338  H HH21 . ARG A 1 15 ? 151.030 15.760  2.382   1.00 0.00 ? 14 ARG A HH21 3  
ATOM 3339  H HH22 . ARG A 1 15 ? 150.164 17.229  2.075   1.00 0.00 ? 14 ARG A HH22 3  
ATOM 3340  N N    . ARG A 1 16 ? 150.113 9.931   -2.527  1.00 0.00 ? 15 ARG A N    3  
ATOM 3341  C CA   . ARG A 1 16 ? 148.888 9.147   -2.678  1.00 0.00 ? 15 ARG A CA   3  
ATOM 3342  C C    . ARG A 1 16 ? 148.476 8.506   -1.354  1.00 0.00 ? 15 ARG A C    3  
ATOM 3343  O O    . ARG A 1 16 ? 149.315 7.973   -0.625  1.00 0.00 ? 15 ARG A O    3  
ATOM 3344  C CB   . ARG A 1 16 ? 149.080 8.065   -3.745  1.00 0.00 ? 15 ARG A CB   3  
ATOM 3345  C CG   . ARG A 1 16 ? 148.217 8.268   -4.983  1.00 0.00 ? 15 ARG A CG   3  
ATOM 3346  C CD   . ARG A 1 16 ? 147.017 7.330   -4.993  1.00 0.00 ? 15 ARG A CD   3  
ATOM 3347  N NE   . ARG A 1 16 ? 146.867 6.646   -6.277  1.00 0.00 ? 15 ARG A NE   3  
ATOM 3348  C CZ   . ARG A 1 16 ? 147.703 5.703   -6.722  1.00 0.00 ? 15 ARG A CZ   3  
ATOM 3349  N NH1  . ARG A 1 16 ? 148.748 5.330   -5.987  1.00 0.00 ? 15 ARG A NH1  3  
ATOM 3350  N NH2  . ARG A 1 16 ? 147.493 5.135   -7.904  1.00 0.00 ? 15 ARG A NH2  3  
ATOM 3351  H H    . ARG A 1 16 ? 150.810 9.613   -1.913  1.00 0.00 ? 15 ARG A H    3  
ATOM 3352  H HA   . ARG A 1 16 ? 148.105 9.819   -2.997  1.00 0.00 ? 15 ARG A HA   3  
ATOM 3353  H HB2  . ARG A 1 16 ? 150.116 8.061   -4.054  1.00 0.00 ? 15 ARG A HB2  3  
ATOM 3354  H HB3  . ARG A 1 16 ? 148.837 7.104   -3.316  1.00 0.00 ? 15 ARG A HB3  3  
ATOM 3355  H HG2  . ARG A 1 16 ? 147.863 9.289   -5.000  1.00 0.00 ? 15 ARG A HG2  3  
ATOM 3356  H HG3  . ARG A 1 16 ? 148.817 8.079   -5.860  1.00 0.00 ? 15 ARG A HG3  3  
ATOM 3357  H HD2  . ARG A 1 16 ? 147.145 6.590   -4.217  1.00 0.00 ? 15 ARG A HD2  3  
ATOM 3358  H HD3  . ARG A 1 16 ? 146.123 7.905   -4.796  1.00 0.00 ? 15 ARG A HD3  3  
ATOM 3359  H HE   . ARG A 1 16 ? 146.104 6.902   -6.839  1.00 0.00 ? 15 ARG A HE   3  
ATOM 3360  H HH11 . ARG A 1 16 ? 148.913 5.755   -5.096  1.00 0.00 ? 15 ARG A HH11 3  
ATOM 3361  H HH12 . ARG A 1 16 ? 149.371 4.623   -6.324  1.00 0.00 ? 15 ARG A HH12 3  
ATOM 3362  H HH21 . ARG A 1 16 ? 146.710 5.412   -8.462  1.00 0.00 ? 15 ARG A HH21 3  
ATOM 3363  H HH22 . ARG A 1 16 ? 148.118 4.428   -8.238  1.00 0.00 ? 15 ARG A HH22 3  
ATOM 3364  N N    . ILE A 1 17 ? 147.179 8.558   -1.050  1.00 0.00 ? 16 ILE A N    3  
ATOM 3365  C CA   . ILE A 1 17 ? 146.655 7.979   0.185   1.00 0.00 ? 16 ILE A CA   3  
ATOM 3366  C C    . ILE A 1 17 ? 145.712 6.814   -0.117  1.00 0.00 ? 16 ILE A C    3  
ATOM 3367  O O    . ILE A 1 17 ? 144.626 7.011   -0.665  1.00 0.00 ? 16 ILE A O    3  
ATOM 3368  C CB   . ILE A 1 17 ? 145.898 9.032   1.027   1.00 0.00 ? 16 ILE A CB   3  
ATOM 3369  C CG1  . ILE A 1 17 ? 146.718 10.322  1.153   1.00 0.00 ? 16 ILE A CG1  3  
ATOM 3370  C CG2  . ILE A 1 17 ? 145.559 8.477   2.406   1.00 0.00 ? 16 ILE A CG2  3  
ATOM 3371  C CD1  . ILE A 1 17 ? 148.038 10.139  1.873   1.00 0.00 ? 16 ILE A CD1  3  
ATOM 3372  H H    . ILE A 1 17 ? 146.558 8.995   -1.671  1.00 0.00 ? 16 ILE A H    3  
ATOM 3373  H HA   . ILE A 1 17 ? 147.491 7.615   0.766   1.00 0.00 ? 16 ILE A HA   3  
ATOM 3374  H HB   . ILE A 1 17 ? 144.968 9.258   0.524   1.00 0.00 ? 16 ILE A HB   3  
ATOM 3375  H HG12 . ILE A 1 17 ? 146.930 10.704  0.167   1.00 0.00 ? 16 ILE A HG12 3  
ATOM 3376  H HG13 . ILE A 1 17 ? 146.141 11.054  1.701   1.00 0.00 ? 16 ILE A HG13 3  
ATOM 3377  H HG21 . ILE A 1 17 ? 144.571 8.043   2.385   1.00 0.00 ? 16 ILE A HG21 3  
ATOM 3378  H HG22 . ILE A 1 17 ? 145.585 9.276   3.131   1.00 0.00 ? 16 ILE A HG22 3  
ATOM 3379  H HG23 . ILE A 1 17 ? 146.280 7.720   2.678   1.00 0.00 ? 16 ILE A HG23 3  
ATOM 3380  H HD11 . ILE A 1 17 ? 148.327 9.100   1.838   1.00 0.00 ? 16 ILE A HD11 3  
ATOM 3381  H HD12 . ILE A 1 17 ? 147.934 10.450  2.902   1.00 0.00 ? 16 ILE A HD12 3  
ATOM 3382  H HD13 . ILE A 1 17 ? 148.796 10.738  1.391   1.00 0.00 ? 16 ILE A HD13 3  
ATOM 3383  N N    . ILE A 1 18 ? 146.133 5.601   0.246   1.00 0.00 ? 17 ILE A N    3  
ATOM 3384  C CA   . ILE A 1 18 ? 145.322 4.406   0.017   1.00 0.00 ? 17 ILE A CA   3  
ATOM 3385  C C    . ILE A 1 18 ? 145.196 3.579   1.295   1.00 0.00 ? 17 ILE A C    3  
ATOM 3386  O O    . ILE A 1 18 ? 146.200 3.217   1.912   1.00 0.00 ? 17 ILE A O    3  
ATOM 3387  C CB   . ILE A 1 18 ? 145.914 3.515   -1.100  1.00 0.00 ? 17 ILE A CB   3  
ATOM 3388  C CG1  . ILE A 1 18 ? 146.232 4.350   -2.347  1.00 0.00 ? 17 ILE A CG1  3  
ATOM 3389  C CG2  . ILE A 1 18 ? 144.952 2.383   -1.446  1.00 0.00 ? 17 ILE A CG2  3  
ATOM 3390  C CD1  . ILE A 1 18 ? 145.007 4.939   -3.017  1.00 0.00 ? 17 ILE A CD1  3  
ATOM 3391  H H    . ILE A 1 18 ? 147.008 5.508   0.681   1.00 0.00 ? 17 ILE A H    3  
ATOM 3392  H HA   . ILE A 1 18 ? 144.338 4.727   -0.290  1.00 0.00 ? 17 ILE A HA   3  
ATOM 3393  H HB   . ILE A 1 18 ? 146.828 3.074   -0.730  1.00 0.00 ? 17 ILE A HB   3  
ATOM 3394  H HG12 . ILE A 1 18 ? 146.882 5.166   -2.070  1.00 0.00 ? 17 ILE A HG12 3  
ATOM 3395  H HG13 . ILE A 1 18 ? 146.736 3.724   -3.070  1.00 0.00 ? 17 ILE A HG13 3  
ATOM 3396  H HG21 . ILE A 1 18 ? 145.472 1.634   -2.027  1.00 0.00 ? 17 ILE A HG21 3  
ATOM 3397  H HG22 . ILE A 1 18 ? 144.126 2.774   -2.020  1.00 0.00 ? 17 ILE A HG22 3  
ATOM 3398  H HG23 . ILE A 1 18 ? 144.578 1.937   -0.536  1.00 0.00 ? 17 ILE A HG23 3  
ATOM 3399  H HD11 . ILE A 1 18 ? 144.549 4.194   -3.651  1.00 0.00 ? 17 ILE A HD11 3  
ATOM 3400  H HD12 . ILE A 1 18 ? 145.297 5.790   -3.613  1.00 0.00 ? 17 ILE A HD12 3  
ATOM 3401  H HD13 . ILE A 1 18 ? 144.299 5.251   -2.263  1.00 0.00 ? 17 ILE A HD13 3  
ATOM 3402  N N    . ALA A 1 19 ? 143.957 3.284   1.688   1.00 0.00 ? 18 ALA A N    3  
ATOM 3403  C CA   . ALA A 1 19 ? 143.703 2.498   2.893   1.00 0.00 ? 18 ALA A CA   3  
ATOM 3404  C C    . ALA A 1 19 ? 143.409 1.039   2.552   1.00 0.00 ? 18 ALA A C    3  
ATOM 3405  O O    . ALA A 1 19 ? 142.814 0.742   1.515   1.00 0.00 ? 18 ALA A O    3  
ATOM 3406  C CB   . ALA A 1 19 ? 142.549 3.095   3.687   1.00 0.00 ? 18 ALA A CB   3  
ATOM 3407  H H    . ALA A 1 19 ? 143.197 3.600   1.155   1.00 0.00 ? 18 ALA A H    3  
ATOM 3408  H HA   . ALA A 1 19 ? 144.590 2.541   3.508   1.00 0.00 ? 18 ALA A HA   3  
ATOM 3409  H HB1  . ALA A 1 19 ? 141.733 3.327   3.020   1.00 0.00 ? 18 ALA A HB1  3  
ATOM 3410  H HB2  . ALA A 1 19 ? 142.880 3.997   4.180   1.00 0.00 ? 18 ALA A HB2  3  
ATOM 3411  H HB3  . ALA A 1 19 ? 142.217 2.381   4.427   1.00 0.00 ? 18 ALA A HB3  3  
ATOM 3412  N N    . PHE A 1 20 ? 143.829 0.135   3.435   1.00 0.00 ? 19 PHE A N    3  
ATOM 3413  C CA   . PHE A 1 20 ? 143.612 -1.294  3.236   1.00 0.00 ? 19 PHE A CA   3  
ATOM 3414  C C    . PHE A 1 20 ? 143.030 -1.936  4.495   1.00 0.00 ? 19 PHE A C    3  
ATOM 3415  O O    . PHE A 1 20 ? 143.637 -1.888  5.566   1.00 0.00 ? 19 PHE A O    3  
ATOM 3416  C CB   . PHE A 1 20 ? 144.925 -1.985  2.854   1.00 0.00 ? 19 PHE A CB   3  
ATOM 3417  C CG   . PHE A 1 20 ? 145.297 -1.815  1.407   1.00 0.00 ? 19 PHE A CG   3  
ATOM 3418  C CD1  . PHE A 1 20 ? 144.867 -2.725  0.455   1.00 0.00 ? 19 PHE A CD1  3  
ATOM 3419  C CD2  . PHE A 1 20 ? 146.075 -0.742  0.998   1.00 0.00 ? 19 PHE A CD2  3  
ATOM 3420  C CE1  . PHE A 1 20 ? 145.205 -2.570  -0.876  1.00 0.00 ? 19 PHE A CE1  3  
ATOM 3421  C CE2  . PHE A 1 20 ? 146.416 -0.582  -0.332  1.00 0.00 ? 19 PHE A CE2  3  
ATOM 3422  C CZ   . PHE A 1 20 ? 145.980 -1.497  -1.270  1.00 0.00 ? 19 PHE A CZ   3  
ATOM 3423  H H    . PHE A 1 20 ? 144.296 0.438   4.243   1.00 0.00 ? 19 PHE A H    3  
ATOM 3424  H HA   . PHE A 1 20 ? 142.905 -1.412  2.428   1.00 0.00 ? 19 PHE A HA   3  
ATOM 3425  H HB2  . PHE A 1 20 ? 145.726 -1.578  3.454   1.00 0.00 ? 19 PHE A HB2  3  
ATOM 3426  H HB3  . PHE A 1 20 ? 144.836 -3.043  3.054   1.00 0.00 ? 19 PHE A HB3  3  
ATOM 3427  H HD1  . PHE A 1 20 ? 144.260 -3.565  0.761   1.00 0.00 ? 19 PHE A HD1  3  
ATOM 3428  H HD2  . PHE A 1 20 ? 146.418 -0.026  1.730   1.00 0.00 ? 19 PHE A HD2  3  
ATOM 3429  H HE1  . PHE A 1 20 ? 144.862 -3.288  -1.607  1.00 0.00 ? 19 PHE A HE1  3  
ATOM 3430  H HE2  . PHE A 1 20 ? 147.022 0.258   -0.637  1.00 0.00 ? 19 PHE A HE2  3  
ATOM 3431  H HZ   . PHE A 1 20 ? 146.244 -1.374  -2.310  1.00 0.00 ? 19 PHE A HZ   3  
ATOM 3432  N N    . SER A 1 21 ? 141.850 -2.537  4.355   1.00 0.00 ? 20 SER A N    3  
ATOM 3433  C CA   . SER A 1 21 ? 141.179 -3.193  5.475   1.00 0.00 ? 20 SER A CA   3  
ATOM 3434  C C    . SER A 1 21 ? 141.946 -4.441  5.918   1.00 0.00 ? 20 SER A C    3  
ATOM 3435  O O    . SER A 1 21 ? 142.540 -5.140  5.097   1.00 0.00 ? 20 SER A O    3  
ATOM 3436  C CB   . SER A 1 21 ? 139.748 -3.573  5.084   1.00 0.00 ? 20 SER A CB   3  
ATOM 3437  O OG   . SER A 1 21 ? 139.737 -4.411  3.939   1.00 0.00 ? 20 SER A OG   3  
ATOM 3438  H H    . SER A 1 21 ? 141.418 -2.542  3.474   1.00 0.00 ? 20 SER A H    3  
ATOM 3439  H HA   . SER A 1 21 ? 141.145 -2.491  6.300   1.00 0.00 ? 20 SER A HA   3  
ATOM 3440  H HB2  . SER A 1 21 ? 139.279 -4.098  5.902   1.00 0.00 ? 20 SER A HB2  3  
ATOM 3441  H HB3  . SER A 1 21 ? 139.189 -2.676  4.863   1.00 0.00 ? 20 SER A HB3  3  
ATOM 3442  H HG   . SER A 1 21 ? 139.975 -5.307  4.194   1.00 0.00 ? 20 SER A HG   3  
ATOM 3443  N N    . ARG A 1 22 ? 141.927 -4.709  7.221   1.00 0.00 ? 21 ARG A N    3  
ATOM 3444  C CA   . ARG A 1 22 ? 142.620 -5.868  7.779   1.00 0.00 ? 21 ARG A CA   3  
ATOM 3445  C C    . ARG A 1 22 ? 141.726 -7.108  7.754   1.00 0.00 ? 21 ARG A C    3  
ATOM 3446  O O    . ARG A 1 22 ? 140.516 -7.010  7.969   1.00 0.00 ? 21 ARG A O    3  
ATOM 3447  C CB   . ARG A 1 22 ? 143.068 -5.575  9.215   1.00 0.00 ? 21 ARG A CB   3  
ATOM 3448  C CG   . ARG A 1 22 ? 143.787 -4.244  9.366   1.00 0.00 ? 21 ARG A CG   3  
ATOM 3449  C CD   . ARG A 1 22 ? 144.443 -4.113  10.730  1.00 0.00 ? 21 ARG A CD   3  
ATOM 3450  N NE   . ARG A 1 22 ? 144.536 -2.719  11.156  1.00 0.00 ? 21 ARG A NE   3  
ATOM 3451  C CZ   . ARG A 1 22 ? 143.521 -2.030  11.683  1.00 0.00 ? 21 ARG A CZ   3  
ATOM 3452  N NH1  . ARG A 1 22 ? 142.330 -2.602  11.848  1.00 0.00 ? 21 ARG A NH1  3  
ATOM 3453  N NH2  . ARG A 1 22 ? 143.697 -0.763  12.041  1.00 0.00 ? 21 ARG A NH2  3  
ATOM 3454  H H    . ARG A 1 22 ? 141.436 -4.112  7.824   1.00 0.00 ? 21 ARG A H    3  
ATOM 3455  H HA   . ARG A 1 22 ? 143.493 -6.054  7.172   1.00 0.00 ? 21 ARG A HA   3  
ATOM 3456  H HB2  . ARG A 1 22 ? 142.198 -5.564  9.855   1.00 0.00 ? 21 ARG A HB2  3  
ATOM 3457  H HB3  . ARG A 1 22 ? 143.734 -6.360  9.540   1.00 0.00 ? 21 ARG A HB3  3  
ATOM 3458  H HG2  . ARG A 1 22 ? 144.547 -4.167  8.602   1.00 0.00 ? 21 ARG A HG2  3  
ATOM 3459  H HG3  . ARG A 1 22 ? 143.070 -3.445  9.244   1.00 0.00 ? 21 ARG A HG3  3  
ATOM 3460  H HD2  . ARG A 1 22 ? 143.857 -4.662  11.452  1.00 0.00 ? 21 ARG A HD2  3  
ATOM 3461  H HD3  . ARG A 1 22 ? 145.438 -4.533  10.680  1.00 0.00 ? 21 ARG A HD3  3  
ATOM 3462  H HE   . ARG A 1 22 ? 145.401 -2.270  11.043  1.00 0.00 ? 21 ARG A HE   3  
ATOM 3463  H HH11 . ARG A 1 22 ? 142.188 -3.554  11.576  1.00 0.00 ? 21 ARG A HH11 3  
ATOM 3464  H HH12 . ARG A 1 22 ? 141.575 -2.081  12.249  1.00 0.00 ? 21 ARG A HH12 3  
ATOM 3465  H HH21 . ARG A 1 22 ? 144.589 -0.326  11.915  1.00 0.00 ? 21 ARG A HH21 3  
ATOM 3466  H HH22 . ARG A 1 22 ? 142.940 -0.244  12.437  1.00 0.00 ? 21 ARG A HH22 3  
ATOM 3467  N N    . PRO A 1 23 ? 142.307 -8.297  7.490   1.00 0.00 ? 22 PRO A N    3  
ATOM 3468  C CA   . PRO A 1 23 ? 143.744 -8.453  7.229   1.00 0.00 ? 22 PRO A CA   3  
ATOM 3469  C C    . PRO A 1 23 ? 144.139 -8.027  5.816   1.00 0.00 ? 22 PRO A C    3  
ATOM 3470  O O    . PRO A 1 23 ? 143.387 -8.232  4.861   1.00 0.00 ? 22 PRO A O    3  
ATOM 3471  C CB   . PRO A 1 23 ? 143.965 -9.954  7.409   1.00 0.00 ? 22 PRO A CB   3  
ATOM 3472  C CG   . PRO A 1 23 ? 142.665 -10.572 7.027   1.00 0.00 ? 22 PRO A CG   3  
ATOM 3473  C CD   . PRO A 1 23 ? 141.595 -9.588  7.428   1.00 0.00 ? 22 PRO A CD   3  
ATOM 3474  H HA   . PRO A 1 23 ? 144.340 -7.911  7.948   1.00 0.00 ? 22 PRO A HA   3  
ATOM 3475  H HB2  . PRO A 1 23 ? 144.765 -10.284 6.762   1.00 0.00 ? 22 PRO A HB2  3  
ATOM 3476  H HB3  . PRO A 1 23 ? 144.216 -10.166 8.438   1.00 0.00 ? 22 PRO A HB3  3  
ATOM 3477  H HG2  . PRO A 1 23 ? 142.637 -10.739 5.960   1.00 0.00 ? 22 PRO A HG2  3  
ATOM 3478  H HG3  . PRO A 1 23 ? 142.532 -11.504 7.556   1.00 0.00 ? 22 PRO A HG3  3  
ATOM 3479  H HD2  . PRO A 1 23 ? 140.812 -9.559  6.684   1.00 0.00 ? 22 PRO A HD2  3  
ATOM 3480  H HD3  . PRO A 1 23 ? 141.187 -9.848  8.394   1.00 0.00 ? 22 PRO A HD3  3  
ATOM 3481  N N    . VAL A 1 24 ? 145.328 -7.439  5.690   1.00 0.00 ? 23 VAL A N    3  
ATOM 3482  C CA   . VAL A 1 24 ? 145.831 -6.988  4.396   1.00 0.00 ? 23 VAL A CA   3  
ATOM 3483  C C    . VAL A 1 24 ? 146.812 -8.002  3.806   1.00 0.00 ? 23 VAL A C    3  
ATOM 3484  O O    . VAL A 1 24 ? 147.742 -8.448  4.482   1.00 0.00 ? 23 VAL A O    3  
ATOM 3485  C CB   . VAL A 1 24 ? 146.515 -5.606  4.504   1.00 0.00 ? 23 VAL A CB   3  
ATOM 3486  C CG1  . VAL A 1 24 ? 147.740 -5.672  5.406   1.00 0.00 ? 23 VAL A CG1  3  
ATOM 3487  C CG2  . VAL A 1 24 ? 146.889 -5.081  3.124   1.00 0.00 ? 23 VAL A CG2  3  
ATOM 3488  H H    . VAL A 1 24 ? 145.884 -7.310  6.487   1.00 0.00 ? 23 VAL A H    3  
ATOM 3489  H HA   . VAL A 1 24 ? 144.986 -6.895  3.727   1.00 0.00 ? 23 VAL A HA   3  
ATOM 3490  H HB   . VAL A 1 24 ? 145.812 -4.915  4.946   1.00 0.00 ? 23 VAL A HB   3  
ATOM 3491  H HG11 . VAL A 1 24 ? 147.756 -4.811  6.057   1.00 0.00 ? 23 VAL A HG11 3  
ATOM 3492  H HG12 . VAL A 1 24 ? 148.634 -5.681  4.800   1.00 0.00 ? 23 VAL A HG12 3  
ATOM 3493  H HG13 . VAL A 1 24 ? 147.701 -6.572  6.002   1.00 0.00 ? 23 VAL A HG13 3  
ATOM 3494  H HG21 . VAL A 1 24 ? 147.480 -4.183  3.228   1.00 0.00 ? 23 VAL A HG21 3  
ATOM 3495  H HG22 . VAL A 1 24 ? 145.990 -4.858  2.568   1.00 0.00 ? 23 VAL A HG22 3  
ATOM 3496  H HG23 . VAL A 1 24 ? 147.462 -5.830  2.597   1.00 0.00 ? 23 VAL A HG23 3  
ATOM 3497  N N    . LYS A 1 25 ? 146.596 -8.362  2.544   1.00 0.00 ? 24 LYS A N    3  
ATOM 3498  C CA   . LYS A 1 25 ? 147.456 -9.323  1.860   1.00 0.00 ? 24 LYS A CA   3  
ATOM 3499  C C    . LYS A 1 25 ? 148.423 -8.611  0.919   1.00 0.00 ? 24 LYS A C    3  
ATOM 3500  O O    . LYS A 1 25 ? 148.020 -7.737  0.150   1.00 0.00 ? 24 LYS A O    3  
ATOM 3501  C CB   . LYS A 1 25 ? 146.609 -10.327 1.071   1.00 0.00 ? 24 LYS A CB   3  
ATOM 3502  C CG   . LYS A 1 25 ? 145.688 -11.167 1.941   1.00 0.00 ? 24 LYS A CG   3  
ATOM 3503  C CD   . LYS A 1 25 ? 146.476 -12.100 2.846   1.00 0.00 ? 24 LYS A CD   3  
ATOM 3504  C CE   . LYS A 1 25 ? 145.823 -12.237 4.213   1.00 0.00 ? 24 LYS A CE   3  
ATOM 3505  N NZ   . LYS A 1 25 ? 145.683 -13.662 4.624   1.00 0.00 ? 24 LYS A NZ   3  
ATOM 3506  H H    . LYS A 1 25 ? 145.837 -7.972  2.059   1.00 0.00 ? 24 LYS A H    3  
ATOM 3507  H HA   . LYS A 1 25 ? 148.024 -9.854  2.609   1.00 0.00 ? 24 LYS A HA   3  
ATOM 3508  H HB2  . LYS A 1 25 ? 146.001 -9.787  0.360   1.00 0.00 ? 24 LYS A HB2  3  
ATOM 3509  H HB3  . LYS A 1 25 ? 147.269 -10.993 0.535   1.00 0.00 ? 24 LYS A HB3  3  
ATOM 3510  H HG2  . LYS A 1 25 ? 145.088 -10.510 2.553   1.00 0.00 ? 24 LYS A HG2  3  
ATOM 3511  H HG3  . LYS A 1 25 ? 145.046 -11.756 1.304   1.00 0.00 ? 24 LYS A HG3  3  
ATOM 3512  H HD2  . LYS A 1 25 ? 146.530 -13.073 2.384   1.00 0.00 ? 24 LYS A HD2  3  
ATOM 3513  H HD3  . LYS A 1 25 ? 147.473 -11.705 2.973   1.00 0.00 ? 24 LYS A HD3  3  
ATOM 3514  H HE2  . LYS A 1 25 ? 146.430 -11.720 4.941   1.00 0.00 ? 24 LYS A HE2  3  
ATOM 3515  H HE3  . LYS A 1 25 ? 144.844 -11.784 4.176   1.00 0.00 ? 24 LYS A HE3  3  
ATOM 3516  H HZ1  . LYS A 1 25 ? 145.595 -13.729 5.658   1.00 0.00 ? 24 LYS A HZ1  3  
ATOM 3517  H HZ2  . LYS A 1 25 ? 146.516 -14.207 4.322   1.00 0.00 ? 24 LYS A HZ2  3  
ATOM 3518  H HZ3  . LYS A 1 25 ? 144.835 -14.078 4.187   1.00 0.00 ? 24 LYS A HZ3  3  
ATOM 3519  N N    . TYR A 1 26 ? 149.699 -8.994  0.981   1.00 0.00 ? 25 TYR A N    3  
ATOM 3520  C CA   . TYR A 1 26 ? 150.722 -8.392  0.125   1.00 0.00 ? 25 TYR A CA   3  
ATOM 3521  C C    . TYR A 1 26 ? 150.366 -8.560  -1.352  1.00 0.00 ? 25 TYR A C    3  
ATOM 3522  O O    . TYR A 1 26 ? 150.586 -7.652  -2.156  1.00 0.00 ? 25 TYR A O    3  
ATOM 3523  C CB   . TYR A 1 26 ? 152.096 -9.013  0.404   1.00 0.00 ? 25 TYR A CB   3  
ATOM 3524  C CG   . TYR A 1 26 ? 153.207 -8.443  -0.457  1.00 0.00 ? 25 TYR A CG   3  
ATOM 3525  C CD1  . TYR A 1 26 ? 153.646 -7.136  -0.281  1.00 0.00 ? 25 TYR A CD1  3  
ATOM 3526  C CD2  . TYR A 1 26 ? 153.809 -9.209  -1.447  1.00 0.00 ? 25 TYR A CD2  3  
ATOM 3527  C CE1  . TYR A 1 26 ? 154.654 -6.611  -1.068  1.00 0.00 ? 25 TYR A CE1  3  
ATOM 3528  C CE2  . TYR A 1 26 ? 154.816 -8.691  -2.238  1.00 0.00 ? 25 TYR A CE2  3  
ATOM 3529  C CZ   . TYR A 1 26 ? 155.235 -7.392  -2.044  1.00 0.00 ? 25 TYR A CZ   3  
ATOM 3530  O OH   . TYR A 1 26 ? 156.237 -6.872  -2.832  1.00 0.00 ? 25 TYR A OH   3  
ATOM 3531  H H    . TYR A 1 26 ? 149.957 -9.700  1.611   1.00 0.00 ? 25 TYR A H    3  
ATOM 3532  H HA   . TYR A 1 26 ? 150.762 -7.338  0.354   1.00 0.00 ? 25 TYR A HA   3  
ATOM 3533  H HB2  . TYR A 1 26 ? 152.357 -8.841  1.438   1.00 0.00 ? 25 TYR A HB2  3  
ATOM 3534  H HB3  . TYR A 1 26 ? 152.046 -10.076 0.222   1.00 0.00 ? 25 TYR A HB3  3  
ATOM 3535  H HD1  . TYR A 1 26 ? 153.190 -6.525  0.484   1.00 0.00 ? 25 TYR A HD1  3  
ATOM 3536  H HD2  . TYR A 1 26 ? 153.478 -10.226 -1.597  1.00 0.00 ? 25 TYR A HD2  3  
ATOM 3537  H HE1  . TYR A 1 26 ? 154.983 -5.593  -0.915  1.00 0.00 ? 25 TYR A HE1  3  
ATOM 3538  H HE2  . TYR A 1 26 ? 155.273 -9.303  -3.002  1.00 0.00 ? 25 TYR A HE2  3  
ATOM 3539  H HH   . TYR A 1 26 ? 155.912 -6.755  -3.731  1.00 0.00 ? 25 TYR A HH   3  
ATOM 3540  N N    . GLU A 1 27 ? 149.812 -9.723  -1.703  1.00 0.00 ? 26 GLU A N    3  
ATOM 3541  C CA   . GLU A 1 27 ? 149.424 -10.001 -3.085  1.00 0.00 ? 26 GLU A CA   3  
ATOM 3542  C C    . GLU A 1 27 ? 148.375 -9.005  -3.569  1.00 0.00 ? 26 GLU A C    3  
ATOM 3543  O O    . GLU A 1 27 ? 148.463 -8.495  -4.685  1.00 0.00 ? 26 GLU A O    3  
ATOM 3544  C CB   . GLU A 1 27 ? 148.881 -11.427 -3.221  1.00 0.00 ? 26 GLU A CB   3  
ATOM 3545  C CG   . GLU A 1 27 ? 149.834 -12.374 -3.932  1.00 0.00 ? 26 GLU A CG   3  
ATOM 3546  C CD   . GLU A 1 27 ? 149.137 -13.605 -4.477  1.00 0.00 ? 26 GLU A CD   3  
ATOM 3547  O OE1  . GLU A 1 27 ? 148.288 -13.457 -5.384  1.00 0.00 ? 26 GLU A OE1  3  
ATOM 3548  O OE2  . GLU A 1 27 ? 149.441 -14.718 -4.000  1.00 0.00 ? 26 GLU A OE2  3  
ATOM 3549  H H    . GLU A 1 27 ? 149.661 -10.407 -1.017  1.00 0.00 ? 26 GLU A H    3  
ATOM 3550  H HA   . GLU A 1 27 ? 150.306 -9.901  -3.700  1.00 0.00 ? 26 GLU A HA   3  
ATOM 3551  H HB2  . GLU A 1 27 ? 148.681 -11.824 -2.236  1.00 0.00 ? 26 GLU A HB2  3  
ATOM 3552  H HB3  . GLU A 1 27 ? 147.958 -11.395 -3.782  1.00 0.00 ? 26 GLU A HB3  3  
ATOM 3553  H HG2  . GLU A 1 27 ? 150.296 -11.848 -4.754  1.00 0.00 ? 26 GLU A HG2  3  
ATOM 3554  H HG3  . GLU A 1 27 ? 150.595 -12.689 -3.233  1.00 0.00 ? 26 GLU A HG3  3  
ATOM 3555  N N    . ASP A 1 28 ? 147.382 -8.733  -2.722  1.00 0.00 ? 27 ASP A N    3  
ATOM 3556  C CA   . ASP A 1 28 ? 146.315 -7.797  -3.069  1.00 0.00 ? 27 ASP A CA   3  
ATOM 3557  C C    . ASP A 1 28 ? 146.867 -6.390  -3.289  1.00 0.00 ? 27 ASP A C    3  
ATOM 3558  O O    . ASP A 1 28 ? 146.496 -5.717  -4.252  1.00 0.00 ? 27 ASP A O    3  
ATOM 3559  C CB   . ASP A 1 28 ? 145.245 -7.774  -1.973  1.00 0.00 ? 27 ASP A CB   3  
ATOM 3560  C CG   . ASP A 1 28 ? 144.088 -6.853  -2.310  1.00 0.00 ? 27 ASP A CG   3  
ATOM 3561  O OD1  . ASP A 1 28 ? 143.239 -7.244  -3.138  1.00 0.00 ? 27 ASP A OD1  3  
ATOM 3562  O OD2  . ASP A 1 28 ? 144.033 -5.737  -1.750  1.00 0.00 ? 27 ASP A OD2  3  
ATOM 3563  H H    . ASP A 1 28 ? 147.367 -9.172  -1.846  1.00 0.00 ? 27 ASP A H    3  
ATOM 3564  H HA   . ASP A 1 28 ? 145.866 -8.140  -3.989  1.00 0.00 ? 27 ASP A HA   3  
ATOM 3565  H HB2  . ASP A 1 28 ? 144.857 -8.771  -1.839  1.00 0.00 ? 27 ASP A HB2  3  
ATOM 3566  H HB3  . ASP A 1 28 ? 145.693 -7.439  -1.048  1.00 0.00 ? 27 ASP A HB3  3  
ATOM 3567  N N    . VAL A 1 29 ? 147.757 -5.954  -2.397  1.00 0.00 ? 28 VAL A N    3  
ATOM 3568  C CA   . VAL A 1 29 ? 148.357 -4.627  -2.506  1.00 0.00 ? 28 VAL A CA   3  
ATOM 3569  C C    . VAL A 1 29 ? 149.143 -4.493  -3.808  1.00 0.00 ? 28 VAL A C    3  
ATOM 3570  O O    . VAL A 1 29 ? 148.986 -3.514  -4.538  1.00 0.00 ? 28 VAL A O    3  
ATOM 3571  C CB   . VAL A 1 29 ? 149.294 -4.314  -1.315  1.00 0.00 ? 28 VAL A CB   3  
ATOM 3572  C CG1  . VAL A 1 29 ? 149.764 -2.866  -1.368  1.00 0.00 ? 28 VAL A CG1  3  
ATOM 3573  C CG2  . VAL A 1 29 ? 148.601 -4.605  0.011   1.00 0.00 ? 28 VAL A CG2  3  
ATOM 3574  H H    . VAL A 1 29 ? 148.016 -6.539  -1.654  1.00 0.00 ? 28 VAL A H    3  
ATOM 3575  H HA   . VAL A 1 29 ? 147.555 -3.902  -2.507  1.00 0.00 ? 28 VAL A HA   3  
ATOM 3576  H HB   . VAL A 1 29 ? 150.163 -4.953  -1.389  1.00 0.00 ? 28 VAL A HB   3  
ATOM 3577  H HG11 . VAL A 1 29 ? 150.486 -2.691  -0.584  1.00 0.00 ? 28 VAL A HG11 3  
ATOM 3578  H HG12 . VAL A 1 29 ? 148.919 -2.208  -1.232  1.00 0.00 ? 28 VAL A HG12 3  
ATOM 3579  H HG13 . VAL A 1 29 ? 150.221 -2.670  -2.328  1.00 0.00 ? 28 VAL A HG13 3  
ATOM 3580  H HG21 . VAL A 1 29 ? 148.876 -3.851  0.735   1.00 0.00 ? 28 VAL A HG21 3  
ATOM 3581  H HG22 . VAL A 1 29 ? 148.906 -5.576  0.371   1.00 0.00 ? 28 VAL A HG22 3  
ATOM 3582  H HG23 . VAL A 1 29 ? 147.531 -4.594  -0.131  1.00 0.00 ? 28 VAL A HG23 3  
ATOM 3583  N N    . GLU A 1 30 ? 149.982 -5.485  -4.094  1.00 0.00 ? 29 GLU A N    3  
ATOM 3584  C CA   . GLU A 1 30 ? 150.790 -5.481  -5.310  1.00 0.00 ? 29 GLU A CA   3  
ATOM 3585  C C    . GLU A 1 30 ? 149.913 -5.572  -6.557  1.00 0.00 ? 29 GLU A C    3  
ATOM 3586  O O    . GLU A 1 30 ? 150.136 -4.854  -7.533  1.00 0.00 ? 29 GLU A O    3  
ATOM 3587  C CB   . GLU A 1 30 ? 151.790 -6.639  -5.290  1.00 0.00 ? 29 GLU A CB   3  
ATOM 3588  C CG   . GLU A 1 30 ? 152.871 -6.525  -6.352  1.00 0.00 ? 29 GLU A CG   3  
ATOM 3589  C CD   . GLU A 1 30 ? 153.865 -7.668  -6.295  1.00 0.00 ? 29 GLU A CD   3  
ATOM 3590  O OE1  . GLU A 1 30 ? 154.704 -7.678  -5.369  1.00 0.00 ? 29 GLU A OE1  3  
ATOM 3591  O OE2  . GLU A 1 30 ? 153.804 -8.552  -7.175  1.00 0.00 ? 29 GLU A OE2  3  
ATOM 3592  H H    . GLU A 1 30 ? 150.058 -6.241  -3.472  1.00 0.00 ? 29 GLU A H    3  
ATOM 3593  H HA   . GLU A 1 30 ? 151.334 -4.549  -5.338  1.00 0.00 ? 29 GLU A HA   3  
ATOM 3594  H HB2  . GLU A 1 30 ? 152.267 -6.672  -4.322  1.00 0.00 ? 29 GLU A HB2  3  
ATOM 3595  H HB3  . GLU A 1 30 ? 151.255 -7.564  -5.448  1.00 0.00 ? 29 GLU A HB3  3  
ATOM 3596  H HG2  . GLU A 1 30 ? 152.404 -6.522  -7.326  1.00 0.00 ? 29 GLU A HG2  3  
ATOM 3597  H HG3  . GLU A 1 30 ? 153.403 -5.597  -6.206  1.00 0.00 ? 29 GLU A HG3  3  
ATOM 3598  N N    . HIS A 1 31 ? 148.916 -6.457  -6.519  1.00 0.00 ? 30 HIS A N    3  
ATOM 3599  C CA   . HIS A 1 31 ? 148.010 -6.642  -7.650  1.00 0.00 ? 30 HIS A CA   3  
ATOM 3600  C C    . HIS A 1 31 ? 147.315 -5.332  -8.014  1.00 0.00 ? 30 HIS A C    3  
ATOM 3601  O O    . HIS A 1 31 ? 147.257 -4.960  -9.187  1.00 0.00 ? 30 HIS A O    3  
ATOM 3602  C CB   . HIS A 1 31 ? 146.961 -7.713  -7.331  1.00 0.00 ? 30 HIS A CB   3  
ATOM 3603  C CG   . HIS A 1 31 ? 147.263 -9.057  -7.924  1.00 0.00 ? 30 HIS A CG   3  
ATOM 3604  N ND1  . HIS A 1 31 ? 147.804 -9.226  -9.183  1.00 0.00 ? 30 HIS A ND1  3  
ATOM 3605  C CD2  . HIS A 1 31 ? 147.084 -10.304 -7.424  1.00 0.00 ? 30 HIS A CD2  3  
ATOM 3606  C CE1  . HIS A 1 31 ? 147.942 -10.517 -9.431  1.00 0.00 ? 30 HIS A CE1  3  
ATOM 3607  N NE2  . HIS A 1 31 ? 147.513 -11.191 -8.380  1.00 0.00 ? 30 HIS A NE2  3  
ATOM 3608  H H    . HIS A 1 31 ? 148.791 -7.001  -5.711  1.00 0.00 ? 30 HIS A H    3  
ATOM 3609  H HA   . HIS A 1 31 ? 148.600 -6.968  -8.493  1.00 0.00 ? 30 HIS A HA   3  
ATOM 3610  H HB2  . HIS A 1 31 ? 146.892 -7.833  -6.261  1.00 0.00 ? 30 HIS A HB2  3  
ATOM 3611  H HB3  . HIS A 1 31 ? 146.003 -7.390  -7.711  1.00 0.00 ? 30 HIS A HB3  3  
ATOM 3612  H HD1  . HIS A 1 31 ? 148.053 -8.508  -9.802  1.00 0.00 ? 30 HIS A HD1  3  
ATOM 3613  H HD2  . HIS A 1 31 ? 146.678 -10.553 -6.454  1.00 0.00 ? 30 HIS A HD2  3  
ATOM 3614  H HE1  . HIS A 1 31 ? 148.334 -10.948 -10.340 1.00 0.00 ? 30 HIS A HE1  3  
ATOM 3615  H HE2  . HIS A 1 31 ? 147.446 -12.167 -8.322  1.00 0.00 ? 30 HIS A HE2  3  
ATOM 3616  N N    . LYS A 1 32 ? 146.793 -4.635  -7.006  1.00 0.00 ? 31 LYS A N    3  
ATOM 3617  C CA   . LYS A 1 32 ? 146.108 -3.365  -7.230  1.00 0.00 ? 31 LYS A CA   3  
ATOM 3618  C C    . LYS A 1 32 ? 147.052 -2.341  -7.851  1.00 0.00 ? 31 LYS A C    3  
ATOM 3619  O O    . LYS A 1 32 ? 146.685 -1.645  -8.798  1.00 0.00 ? 31 LYS A O    3  
ATOM 3620  C CB   . LYS A 1 32 ? 145.532 -2.821  -5.918  1.00 0.00 ? 31 LYS A CB   3  
ATOM 3621  C CG   . LYS A 1 32 ? 144.135 -3.339  -5.606  1.00 0.00 ? 31 LYS A CG   3  
ATOM 3622  C CD   . LYS A 1 32 ? 143.946 -3.602  -4.118  1.00 0.00 ? 31 LYS A CD   3  
ATOM 3623  C CE   . LYS A 1 32 ? 142.893 -2.683  -3.514  1.00 0.00 ? 31 LYS A CE   3  
ATOM 3624  N NZ   . LYS A 1 32 ? 141.597 -3.384  -3.286  1.00 0.00 ? 31 LYS A NZ   3  
ATOM 3625  H H    . LYS A 1 32 ? 146.875 -4.981  -6.091  1.00 0.00 ? 31 LYS A H    3  
ATOM 3626  H HA   . LYS A 1 32 ? 145.297 -3.547  -7.919  1.00 0.00 ? 31 LYS A HA   3  
ATOM 3627  H HB2  . LYS A 1 32 ? 146.189 -3.100  -5.106  1.00 0.00 ? 31 LYS A HB2  3  
ATOM 3628  H HB3  . LYS A 1 32 ? 145.489 -1.744  -5.977  1.00 0.00 ? 31 LYS A HB3  3  
ATOM 3629  H HG2  . LYS A 1 32 ? 143.412 -2.603  -5.925  1.00 0.00 ? 31 LYS A HG2  3  
ATOM 3630  H HG3  . LYS A 1 32 ? 143.975 -4.259  -6.148  1.00 0.00 ? 31 LYS A HG3  3  
ATOM 3631  H HD2  . LYS A 1 32 ? 143.633 -4.627  -3.983  1.00 0.00 ? 31 LYS A HD2  3  
ATOM 3632  H HD3  . LYS A 1 32 ? 144.886 -3.442  -3.610  1.00 0.00 ? 31 LYS A HD3  3  
ATOM 3633  H HE2  . LYS A 1 32 ? 143.259 -2.310  -2.569  1.00 0.00 ? 31 LYS A HE2  3  
ATOM 3634  H HE3  . LYS A 1 32 ? 142.730 -1.853  -4.187  1.00 0.00 ? 31 LYS A HE3  3  
ATOM 3635  H HZ1  . LYS A 1 32 ? 141.076 -2.929  -2.509  1.00 0.00 ? 31 LYS A HZ1  3  
ATOM 3636  H HZ2  . LYS A 1 32 ? 141.765 -4.380  -3.038  1.00 0.00 ? 31 LYS A HZ2  3  
ATOM 3637  H HZ3  . LYS A 1 32 ? 141.014 -3.346  -4.147  1.00 0.00 ? 31 LYS A HZ3  3  
ATOM 3638  N N    . VAL A 1 33 ? 148.272 -2.256  -7.320  1.00 0.00 ? 32 VAL A N    3  
ATOM 3639  C CA   . VAL A 1 33 ? 149.262 -1.317  -7.837  1.00 0.00 ? 32 VAL A CA   3  
ATOM 3640  C C    . VAL A 1 33 ? 149.589 -1.619  -9.299  1.00 0.00 ? 32 VAL A C    3  
ATOM 3641  O O    . VAL A 1 33 ? 149.689 -0.705  -10.118 1.00 0.00 ? 32 VAL A O    3  
ATOM 3642  C CB   . VAL A 1 33 ? 150.565 -1.334  -7.010  1.00 0.00 ? 32 VAL A CB   3  
ATOM 3643  C CG1  . VAL A 1 33 ? 151.518 -0.253  -7.495  1.00 0.00 ? 32 VAL A CG1  3  
ATOM 3644  C CG2  . VAL A 1 33 ? 150.270 -1.158  -5.526  1.00 0.00 ? 32 VAL A CG2  3  
ATOM 3645  H H    . VAL A 1 33 ? 148.511 -2.841  -6.569  1.00 0.00 ? 32 VAL A H    3  
ATOM 3646  H HA   . VAL A 1 33 ? 148.835 -0.325  -7.776  1.00 0.00 ? 32 VAL A HA   3  
ATOM 3647  H HB   . VAL A 1 33 ? 151.043 -2.293  -7.149  1.00 0.00 ? 32 VAL A HB   3  
ATOM 3648  H HG11 . VAL A 1 33 ? 151.523 -0.235  -8.576  1.00 0.00 ? 32 VAL A HG11 3  
ATOM 3649  H HG12 . VAL A 1 33 ? 152.514 -0.463  -7.136  1.00 0.00 ? 32 VAL A HG12 3  
ATOM 3650  H HG13 . VAL A 1 33 ? 151.194 0.707   -7.121  1.00 0.00 ? 32 VAL A HG13 3  
ATOM 3651  H HG21 . VAL A 1 33 ? 150.589 -0.176  -5.209  1.00 0.00 ? 32 VAL A HG21 3  
ATOM 3652  H HG22 . VAL A 1 33 ? 150.805 -1.908  -4.963  1.00 0.00 ? 32 VAL A HG22 3  
ATOM 3653  H HG23 . VAL A 1 33 ? 149.210 -1.266  -5.352  1.00 0.00 ? 32 VAL A HG23 3  
ATOM 3654  N N    . THR A 1 34 ? 149.746 -2.904  -9.625  1.00 0.00 ? 33 THR A N    3  
ATOM 3655  C CA   . THR A 1 34 ? 150.053 -3.309  -10.995 1.00 0.00 ? 33 THR A CA   3  
ATOM 3656  C C    . THR A 1 34 ? 148.933 -2.898  -11.951 1.00 0.00 ? 33 THR A C    3  
ATOM 3657  O O    . THR A 1 34 ? 149.198 -2.468  -13.072 1.00 0.00 ? 33 THR A O    3  
ATOM 3658  C CB   . THR A 1 34 ? 150.278 -4.824  -11.086 1.00 0.00 ? 33 THR A CB   3  
ATOM 3659  O OG1  . THR A 1 34 ? 151.027 -5.298  -9.980  1.00 0.00 ? 33 THR A OG1  3  
ATOM 3660  C CG2  . THR A 1 34 ? 151.010 -5.243  -12.344 1.00 0.00 ? 33 THR A CG2  3  
ATOM 3661  H H    . THR A 1 34 ? 149.649 -3.591  -8.931  1.00 0.00 ? 33 THR A H    3  
ATOM 3662  H HA   . THR A 1 34 ? 150.961 -2.803  -11.290 1.00 0.00 ? 33 THR A HA   3  
ATOM 3663  H HB   . THR A 1 34 ? 149.318 -5.321  -11.084 1.00 0.00 ? 33 THR A HB   3  
ATOM 3664  H HG1  . THR A 1 34 ? 151.768 -4.712  -9.814  1.00 0.00 ? 33 THR A HG1  3  
ATOM 3665  H HG21 . THR A 1 34 ? 150.778 -4.554  -13.143 1.00 0.00 ? 33 THR A HG21 3  
ATOM 3666  H HG22 . THR A 1 34 ? 150.700 -6.239  -12.625 1.00 0.00 ? 33 THR A HG22 3  
ATOM 3667  H HG23 . THR A 1 34 ? 152.074 -5.233  -12.162 1.00 0.00 ? 33 THR A HG23 3  
ATOM 3668  N N    . THR A 1 35 ? 147.683 -3.033  -11.505 1.00 0.00 ? 34 THR A N    3  
ATOM 3669  C CA   . THR A 1 35 ? 146.535 -2.671  -12.336 1.00 0.00 ? 34 THR A CA   3  
ATOM 3670  C C    . THR A 1 35 ? 146.416 -1.154  -12.492 1.00 0.00 ? 34 THR A C    3  
ATOM 3671  O O    . THR A 1 35 ? 146.240 -0.653  -13.602 1.00 0.00 ? 34 THR A O    3  
ATOM 3672  C CB   . THR A 1 35 ? 145.234 -3.240  -11.757 1.00 0.00 ? 34 THR A CB   3  
ATOM 3673  O OG1  . THR A 1 35 ? 145.424 -4.562  -11.283 1.00 0.00 ? 34 THR A OG1  3  
ATOM 3674  C CG2  . THR A 1 35 ? 144.104 -3.272  -12.765 1.00 0.00 ? 34 THR A CG2  3  
ATOM 3675  H H    . THR A 1 35 ? 147.529 -3.384  -10.601 1.00 0.00 ? 34 THR A H    3  
ATOM 3676  H HA   . THR A 1 35 ? 146.695 -3.100  -13.313 1.00 0.00 ? 34 THR A HA   3  
ATOM 3677  H HB   . THR A 1 35 ? 144.919 -2.621  -10.928 1.00 0.00 ? 34 THR A HB   3  
ATOM 3678  H HG1  . THR A 1 35 ? 144.764 -4.759  -10.614 1.00 0.00 ? 34 THR A HG1  3  
ATOM 3679  H HG21 . THR A 1 35 ? 143.178 -3.004  -12.279 1.00 0.00 ? 34 THR A HG21 3  
ATOM 3680  H HG22 . THR A 1 35 ? 144.020 -4.266  -13.180 1.00 0.00 ? 34 THR A HG22 3  
ATOM 3681  H HG23 . THR A 1 35 ? 144.308 -2.567  -13.558 1.00 0.00 ? 34 THR A HG23 3  
ATOM 3682  N N    . VAL A 1 36 ? 146.506 -0.427  -11.377 1.00 0.00 ? 35 VAL A N    3  
ATOM 3683  C CA   . VAL A 1 36 ? 146.399 1.032   -11.405 1.00 0.00 ? 35 VAL A CA   3  
ATOM 3684  C C    . VAL A 1 36 ? 147.519 1.654   -12.241 1.00 0.00 ? 35 VAL A C    3  
ATOM 3685  O O    . VAL A 1 36 ? 147.263 2.483   -13.115 1.00 0.00 ? 35 VAL A O    3  
ATOM 3686  C CB   . VAL A 1 36 ? 146.429 1.643   -9.985  1.00 0.00 ? 35 VAL A CB   3  
ATOM 3687  C CG1  . VAL A 1 36 ? 146.211 3.148   -10.049 1.00 0.00 ? 35 VAL A CG1  3  
ATOM 3688  C CG2  . VAL A 1 36 ? 145.386 0.988   -9.088  1.00 0.00 ? 35 VAL A CG2  3  
ATOM 3689  H H    . VAL A 1 36 ? 146.641 -0.882  -10.518 1.00 0.00 ? 35 VAL A H    3  
ATOM 3690  H HA   . VAL A 1 36 ? 145.449 1.282   -11.859 1.00 0.00 ? 35 VAL A HA   3  
ATOM 3691  H HB   . VAL A 1 36 ? 147.404 1.462   -9.559  1.00 0.00 ? 35 VAL A HB   3  
ATOM 3692  H HG11 . VAL A 1 36 ? 147.133 3.633   -10.334 1.00 0.00 ? 35 VAL A HG11 3  
ATOM 3693  H HG12 . VAL A 1 36 ? 145.897 3.508   -9.081  1.00 0.00 ? 35 VAL A HG12 3  
ATOM 3694  H HG13 . VAL A 1 36 ? 145.447 3.370   -10.780 1.00 0.00 ? 35 VAL A HG13 3  
ATOM 3695  H HG21 . VAL A 1 36 ? 145.030 0.079   -9.550  1.00 0.00 ? 35 VAL A HG21 3  
ATOM 3696  H HG22 . VAL A 1 36 ? 144.558 1.665   -8.941  1.00 0.00 ? 35 VAL A HG22 3  
ATOM 3697  H HG23 . VAL A 1 36 ? 145.831 0.753   -8.132  1.00 0.00 ? 35 VAL A HG23 3  
ATOM 3698  N N    . PHE A 1 37 ? 148.760 1.251   -11.965 1.00 0.00 ? 36 PHE A N    3  
ATOM 3699  C CA   . PHE A 1 37 ? 149.919 1.772   -12.690 1.00 0.00 ? 36 PHE A CA   3  
ATOM 3700  C C    . PHE A 1 37 ? 150.067 1.115   -14.066 1.00 0.00 ? 36 PHE A C    3  
ATOM 3701  O O    . PHE A 1 37 ? 150.673 1.691   -14.970 1.00 0.00 ? 36 PHE A O    3  
ATOM 3702  C CB   . PHE A 1 37 ? 151.200 1.562   -11.876 1.00 0.00 ? 36 PHE A CB   3  
ATOM 3703  C CG   . PHE A 1 37 ? 151.266 2.388   -10.620 1.00 0.00 ? 36 PHE A CG   3  
ATOM 3704  C CD1  . PHE A 1 37 ? 150.337 2.215   -9.604  1.00 0.00 ? 36 PHE A CD1  3  
ATOM 3705  C CD2  . PHE A 1 37 ? 152.261 3.339   -10.455 1.00 0.00 ? 36 PHE A CD2  3  
ATOM 3706  C CE1  . PHE A 1 37 ? 150.400 2.972   -8.452  1.00 0.00 ? 36 PHE A CE1  3  
ATOM 3707  C CE2  . PHE A 1 37 ? 152.327 4.099   -9.304  1.00 0.00 ? 36 PHE A CE2  3  
ATOM 3708  C CZ   . PHE A 1 37 ? 151.396 3.915   -8.302  1.00 0.00 ? 36 PHE A CZ   3  
ATOM 3709  H H    . PHE A 1 37 ? 148.901 0.591   -11.252 1.00 0.00 ? 36 PHE A H    3  
ATOM 3710  H HA   . PHE A 1 37 ? 149.767 2.832   -12.830 1.00 0.00 ? 36 PHE A HA   3  
ATOM 3711  H HB2  . PHE A 1 37 ? 151.275 0.522   -11.594 1.00 0.00 ? 36 PHE A HB2  3  
ATOM 3712  H HB3  . PHE A 1 37 ? 152.052 1.823   -12.489 1.00 0.00 ? 36 PHE A HB3  3  
ATOM 3713  H HD1  . PHE A 1 37 ? 149.557 1.479   -9.718  1.00 0.00 ? 36 PHE A HD1  3  
ATOM 3714  H HD2  . PHE A 1 37 ? 152.990 3.484   -11.238 1.00 0.00 ? 36 PHE A HD2  3  
ATOM 3715  H HE1  . PHE A 1 37 ? 149.670 2.827   -7.670  1.00 0.00 ? 36 PHE A HE1  3  
ATOM 3716  H HE2  . PHE A 1 37 ? 153.107 4.835   -9.189  1.00 0.00 ? 36 PHE A HE2  3  
ATOM 3717  H HZ   . PHE A 1 37 ? 151.445 4.505   -7.404  1.00 0.00 ? 36 PHE A HZ   3  
ATOM 3718  N N    . GLY A 1 38 ? 149.518 -0.093  -14.216 1.00 0.00 ? 37 GLY A N    3  
ATOM 3719  C CA   . GLY A 1 38 ? 149.607 -0.807  -15.482 1.00 0.00 ? 37 GLY A CA   3  
ATOM 3720  C C    . GLY A 1 38 ? 150.960 -1.475  -15.700 1.00 0.00 ? 37 GLY A C    3  
ATOM 3721  O O    . GLY A 1 38 ? 151.315 -1.804  -16.833 1.00 0.00 ? 37 GLY A O    3  
ATOM 3722  H H    . GLY A 1 38 ? 149.052 -0.507  -13.460 1.00 0.00 ? 37 GLY A H    3  
ATOM 3723  H HA2  . GLY A 1 38 ? 148.839 -1.564  -15.507 1.00 0.00 ? 37 GLY A HA2  3  
ATOM 3724  H HA3  . GLY A 1 38 ? 149.430 -0.109  -16.287 1.00 0.00 ? 37 GLY A HA3  3  
ATOM 3725  N N    . GLN A 1 39 ? 151.716 -1.675  -14.617 1.00 0.00 ? 38 GLN A N    3  
ATOM 3726  C CA   . GLN A 1 39 ? 153.035 -2.305  -14.699 1.00 0.00 ? 38 GLN A CA   3  
ATOM 3727  C C    . GLN A 1 39 ? 153.550 -2.668  -13.304 1.00 0.00 ? 38 GLN A C    3  
ATOM 3728  O O    . GLN A 1 39 ? 153.164 -2.044  -12.315 1.00 0.00 ? 38 GLN A O    3  
ATOM 3729  C CB   . GLN A 1 39 ? 154.033 -1.362  -15.380 1.00 0.00 ? 38 GLN A CB   3  
ATOM 3730  C CG   . GLN A 1 39 ? 154.219 -1.626  -16.866 1.00 0.00 ? 38 GLN A CG   3  
ATOM 3731  C CD   . GLN A 1 39 ? 155.593 -1.214  -17.360 1.00 0.00 ? 38 GLN A CD   3  
ATOM 3732  O OE1  . GLN A 1 39 ? 155.725 -0.284  -18.154 1.00 0.00 ? 38 GLN A OE1  3  
ATOM 3733  N NE2  . GLN A 1 39 ? 156.626 -1.905  -16.888 1.00 0.00 ? 38 GLN A NE2  3  
ATOM 3734  H H    . GLN A 1 39 ? 151.380 -1.392  -13.742 1.00 0.00 ? 38 GLN A H    3  
ATOM 3735  H HA   . GLN A 1 39 ? 152.940 -3.206  -15.287 1.00 0.00 ? 38 GLN A HA   3  
ATOM 3736  H HB2  . GLN A 1 39 ? 153.689 -0.346  -15.260 1.00 0.00 ? 38 GLN A HB2  3  
ATOM 3737  H HB3  . GLN A 1 39 ? 154.994 -1.465  -14.897 1.00 0.00 ? 38 GLN A HB3  3  
ATOM 3738  H HG2  . GLN A 1 39 ? 154.085 -2.681  -17.052 1.00 0.00 ? 38 GLN A HG2  3  
ATOM 3739  H HG3  . GLN A 1 39 ? 153.473 -1.067  -17.414 1.00 0.00 ? 38 GLN A HG3  3  
ATOM 3740  H HE21 . GLN A 1 39 ? 156.449 -2.631  -16.255 1.00 0.00 ? 38 GLN A HE21 3  
ATOM 3741  H HE22 . GLN A 1 39 ? 157.525 -1.656  -17.190 1.00 0.00 ? 38 GLN A HE22 3  
ATOM 3742  N N    . PRO A 1 40 ? 154.436 -3.680  -13.206 1.00 0.00 ? 39 PRO A N    3  
ATOM 3743  C CA   . PRO A 1 40 ? 155.005 -4.112  -11.922 1.00 0.00 ? 39 PRO A CA   3  
ATOM 3744  C C    . PRO A 1 40 ? 155.989 -3.090  -11.347 1.00 0.00 ? 39 PRO A C    3  
ATOM 3745  O O    . PRO A 1 40 ? 156.734 -2.447  -12.090 1.00 0.00 ? 39 PRO A O    3  
ATOM 3746  C CB   . PRO A 1 40 ? 155.730 -5.413  -12.274 1.00 0.00 ? 39 PRO A CB   3  
ATOM 3747  C CG   . PRO A 1 40 ? 156.069 -5.281  -13.718 1.00 0.00 ? 39 PRO A CG   3  
ATOM 3748  C CD   . PRO A 1 40 ? 154.956 -4.478  -14.335 1.00 0.00 ? 39 PRO A CD   3  
ATOM 3749  H HA   . PRO A 1 40 ? 154.230 -4.312  -11.197 1.00 0.00 ? 39 PRO A HA   3  
ATOM 3750  H HB2  . PRO A 1 40 ? 156.619 -5.510  -11.666 1.00 0.00 ? 39 PRO A HB2  3  
ATOM 3751  H HB3  . PRO A 1 40 ? 155.074 -6.253  -12.099 1.00 0.00 ? 39 PRO A HB3  3  
ATOM 3752  H HG2  . PRO A 1 40 ? 157.011 -4.762  -13.828 1.00 0.00 ? 39 PRO A HG2  3  
ATOM 3753  H HG3  . PRO A 1 40 ? 156.124 -6.258  -14.174 1.00 0.00 ? 39 PRO A HG3  3  
ATOM 3754  H HD2  . PRO A 1 40 ? 155.340 -3.839  -15.115 1.00 0.00 ? 39 PRO A HD2  3  
ATOM 3755  H HD3  . PRO A 1 40 ? 154.191 -5.135  -14.726 1.00 0.00 ? 39 PRO A HD3  3  
ATOM 3756  N N    . LEU A 1 41 ? 155.984 -2.948  -10.021 1.00 0.00 ? 40 LEU A N    3  
ATOM 3757  C CA   . LEU A 1 41 ? 156.875 -2.006  -9.343  1.00 0.00 ? 40 LEU A CA   3  
ATOM 3758  C C    . LEU A 1 41 ? 157.467 -2.624  -8.076  1.00 0.00 ? 40 LEU A C    3  
ATOM 3759  O O    . LEU A 1 41 ? 156.962 -3.627  -7.568  1.00 0.00 ? 40 LEU A O    3  
ATOM 3760  C CB   . LEU A 1 41 ? 156.129 -0.713  -8.981  1.00 0.00 ? 40 LEU A CB   3  
ATOM 3761  C CG   . LEU A 1 41 ? 155.167 -0.179  -10.047 1.00 0.00 ? 40 LEU A CG   3  
ATOM 3762  C CD1  . LEU A 1 41 ? 153.769 -0.731  -9.820  1.00 0.00 ? 40 LEU A CD1  3  
ATOM 3763  C CD2  . LEU A 1 41 ? 155.143 1.343   -10.034 1.00 0.00 ? 40 LEU A CD2  3  
ATOM 3764  H H    . LEU A 1 41 ? 155.368 -3.490  -9.484  1.00 0.00 ? 40 LEU A H    3  
ATOM 3765  H HA   . LEU A 1 41 ? 157.681 -1.767  -10.021 1.00 0.00 ? 40 LEU A HA   3  
ATOM 3766  H HB2  . LEU A 1 41 ? 155.565 -0.892  -8.076  1.00 0.00 ? 40 LEU A HB2  3  
ATOM 3767  H HB3  . LEU A 1 41 ? 156.863 0.052   -8.778  1.00 0.00 ? 40 LEU A HB3  3  
ATOM 3768  H HG   . LEU A 1 41 ? 155.502 -0.501  -11.022 1.00 0.00 ? 40 LEU A HG   3  
ATOM 3769  H HD11 . LEU A 1 41 ? 153.758 -1.788  -10.036 1.00 0.00 ? 40 LEU A HD11 3  
ATOM 3770  H HD12 . LEU A 1 41 ? 153.071 -0.224  -10.471 1.00 0.00 ? 40 LEU A HD12 3  
ATOM 3771  H HD13 . LEU A 1 41 ? 153.483 -0.570  -8.792  1.00 0.00 ? 40 LEU A HD13 3  
ATOM 3772  H HD21 . LEU A 1 41 ? 154.814 1.706   -10.997 1.00 0.00 ? 40 LEU A HD21 3  
ATOM 3773  H HD22 . LEU A 1 41 ? 156.134 1.717   -9.829  1.00 0.00 ? 40 LEU A HD22 3  
ATOM 3774  H HD23 . LEU A 1 41 ? 154.463 1.686   -9.268  1.00 0.00 ? 40 LEU A HD23 3  
ATOM 3775  N N    . ASP A 1 42 ? 158.537 -2.011  -7.568  1.00 0.00 ? 41 ASP A N    3  
ATOM 3776  C CA   . ASP A 1 42 ? 159.199 -2.491  -6.356  1.00 0.00 ? 41 ASP A CA   3  
ATOM 3777  C C    . ASP A 1 42 ? 158.860 -1.599  -5.162  1.00 0.00 ? 41 ASP A C    3  
ATOM 3778  O O    . ASP A 1 42 ? 159.048 -0.383  -5.215  1.00 0.00 ? 41 ASP A O    3  
ATOM 3779  C CB   . ASP A 1 42 ? 160.716 -2.532  -6.562  1.00 0.00 ? 41 ASP A CB   3  
ATOM 3780  C CG   . ASP A 1 42 ? 161.364 -3.708  -5.858  1.00 0.00 ? 41 ASP A CG   3  
ATOM 3781  O OD1  . ASP A 1 42 ? 161.091 -4.862  -6.251  1.00 0.00 ? 41 ASP A OD1  3  
ATOM 3782  O OD2  . ASP A 1 42 ? 162.143 -3.474  -4.912  1.00 0.00 ? 41 ASP A OD2  3  
ATOM 3783  H H    . ASP A 1 42 ? 158.888 -1.214  -8.018  1.00 0.00 ? 41 ASP A H    3  
ATOM 3784  H HA   . ASP A 1 42 ? 158.843 -3.491  -6.157  1.00 0.00 ? 41 ASP A HA   3  
ATOM 3785  H HB2  . ASP A 1 42 ? 160.928 -2.608  -7.617  1.00 0.00 ? 41 ASP A HB2  3  
ATOM 3786  H HB3  . ASP A 1 42 ? 161.150 -1.620  -6.176  1.00 0.00 ? 41 ASP A HB3  3  
ATOM 3787  N N    . LEU A 1 43 ? 158.360 -2.211  -4.087  1.00 0.00 ? 42 LEU A N    3  
ATOM 3788  C CA   . LEU A 1 43 ? 157.993 -1.470  -2.879  1.00 0.00 ? 42 LEU A CA   3  
ATOM 3789  C C    . LEU A 1 43 ? 159.211 -1.250  -1.978  1.00 0.00 ? 42 LEU A C    3  
ATOM 3790  O O    . LEU A 1 43 ? 159.770 -2.202  -1.429  1.00 0.00 ? 42 LEU A O    3  
ATOM 3791  C CB   . LEU A 1 43 ? 156.894 -2.213  -2.109  1.00 0.00 ? 42 LEU A CB   3  
ATOM 3792  C CG   . LEU A 1 43 ? 155.558 -2.354  -2.849  1.00 0.00 ? 42 LEU A CG   3  
ATOM 3793  C CD1  . LEU A 1 43 ? 154.652 -3.347  -2.133  1.00 0.00 ? 42 LEU A CD1  3  
ATOM 3794  C CD2  . LEU A 1 43 ? 154.871 -1.002  -2.980  1.00 0.00 ? 42 LEU A CD2  3  
ATOM 3795  H H    . LEU A 1 43 ? 158.234 -3.184  -4.107  1.00 0.00 ? 42 LEU A H    3  
ATOM 3796  H HA   . LEU A 1 43 ? 157.614 -0.507  -3.189  1.00 0.00 ? 42 LEU A HA   3  
ATOM 3797  H HB2  . LEU A 1 43 ? 157.255 -3.204  -1.872  1.00 0.00 ? 42 LEU A HB2  3  
ATOM 3798  H HB3  . LEU A 1 43 ? 156.712 -1.686  -1.185  1.00 0.00 ? 42 LEU A HB3  3  
ATOM 3799  H HG   . LEU A 1 43 ? 155.744 -2.733  -3.844  1.00 0.00 ? 42 LEU A HG   3  
ATOM 3800  H HD11 . LEU A 1 43 ? 154.815 -4.336  -2.534  1.00 0.00 ? 42 LEU A HD11 3  
ATOM 3801  H HD12 . LEU A 1 43 ? 153.620 -3.065  -2.279  1.00 0.00 ? 42 LEU A HD12 3  
ATOM 3802  H HD13 . LEU A 1 43 ? 154.879 -3.345  -1.076  1.00 0.00 ? 42 LEU A HD13 3  
ATOM 3803  H HD21 . LEU A 1 43 ? 155.606 -0.243  -3.201  1.00 0.00 ? 42 LEU A HD21 3  
ATOM 3804  H HD22 . LEU A 1 43 ? 154.371 -0.759  -2.052  1.00 0.00 ? 42 LEU A HD22 3  
ATOM 3805  H HD23 . LEU A 1 43 ? 154.144 -1.042  -3.778  1.00 0.00 ? 42 LEU A HD23 3  
ATOM 3806  N N    . HIS A 1 44 ? 159.620 0.012   -1.835  1.00 0.00 ? 43 HIS A N    3  
ATOM 3807  C CA   . HIS A 1 44 ? 160.774 0.366   -1.008  1.00 0.00 ? 43 HIS A CA   3  
ATOM 3808  C C    . HIS A 1 44 ? 160.335 1.028   0.300   1.00 0.00 ? 43 HIS A C    3  
ATOM 3809  O O    . HIS A 1 44 ? 159.666 2.063   0.287   1.00 0.00 ? 43 HIS A O    3  
ATOM 3810  C CB   . HIS A 1 44 ? 161.703 1.312   -1.778  1.00 0.00 ? 43 HIS A CB   3  
ATOM 3811  C CG   . HIS A 1 44 ? 162.973 0.672   -2.247  1.00 0.00 ? 43 HIS A CG   3  
ATOM 3812  N ND1  . HIS A 1 44 ? 163.124 0.129   -3.506  1.00 0.00 ? 43 HIS A ND1  3  
ATOM 3813  C CD2  . HIS A 1 44 ? 164.165 0.508   -1.623  1.00 0.00 ? 43 HIS A CD2  3  
ATOM 3814  C CE1  . HIS A 1 44 ? 164.353 -0.341  -3.637  1.00 0.00 ? 43 HIS A CE1  3  
ATOM 3815  N NE2  . HIS A 1 44 ? 165.003 -0.123  -2.509  1.00 0.00 ? 43 HIS A NE2  3  
ATOM 3816  H H    . HIS A 1 44 ? 159.136 0.726   -2.303  1.00 0.00 ? 43 HIS A H    3  
ATOM 3817  H HA   . HIS A 1 44 ? 161.311 -0.543  -0.778  1.00 0.00 ? 43 HIS A HA   3  
ATOM 3818  H HB2  . HIS A 1 44 ? 161.182 1.685   -2.647  1.00 0.00 ? 43 HIS A HB2  3  
ATOM 3819  H HB3  . HIS A 1 44 ? 161.965 2.144   -1.140  1.00 0.00 ? 43 HIS A HB3  3  
ATOM 3820  H HD1  . HIS A 1 44 ? 162.432 0.090   -4.200  1.00 0.00 ? 43 HIS A HD1  3  
ATOM 3821  H HD2  . HIS A 1 44 ? 164.410 0.816   -0.617  1.00 0.00 ? 43 HIS A HD2  3  
ATOM 3822  H HE1  . HIS A 1 44 ? 164.757 -0.815  -4.519  1.00 0.00 ? 43 HIS A HE1  3  
ATOM 3823  H HE2  . HIS A 1 44 ? 165.933 -0.379  -2.332  1.00 0.00 ? 43 HIS A HE2  3  
ATOM 3824  N N    . TYR A 1 45 ? 160.723 0.431   1.428   1.00 0.00 ? 44 TYR A N    3  
ATOM 3825  C CA   . TYR A 1 45 ? 160.378 0.966   2.741   1.00 0.00 ? 44 TYR A CA   3  
ATOM 3826  C C    . TYR A 1 45 ? 161.615 1.561   3.415   1.00 0.00 ? 44 TYR A C    3  
ATOM 3827  O O    . TYR A 1 45 ? 162.578 0.850   3.702   1.00 0.00 ? 44 TYR A O    3  
ATOM 3828  C CB   . TYR A 1 45 ? 159.768 -0.140  3.613   1.00 0.00 ? 44 TYR A CB   3  
ATOM 3829  C CG   . TYR A 1 45 ? 159.629 0.225   5.076   1.00 0.00 ? 44 TYR A CG   3  
ATOM 3830  C CD1  . TYR A 1 45 ? 160.693 0.063   5.954   1.00 0.00 ? 44 TYR A CD1  3  
ATOM 3831  C CD2  . TYR A 1 45 ? 158.433 0.720   5.579   1.00 0.00 ? 44 TYR A CD2  3  
ATOM 3832  C CE1  . TYR A 1 45 ? 160.573 0.390   7.291   1.00 0.00 ? 44 TYR A CE1  3  
ATOM 3833  C CE2  . TYR A 1 45 ? 158.303 1.050   6.916   1.00 0.00 ? 44 TYR A CE2  3  
ATOM 3834  C CZ   . TYR A 1 45 ? 159.375 0.881   7.769   1.00 0.00 ? 44 TYR A CZ   3  
ATOM 3835  O OH   . TYR A 1 45 ? 159.247 1.207   9.101   1.00 0.00 ? 44 TYR A OH   3  
ATOM 3836  H H    . TYR A 1 45 ? 161.260 -0.388  1.377   1.00 0.00 ? 44 TYR A H    3  
ATOM 3837  H HA   . TYR A 1 45 ? 159.645 1.747   2.601   1.00 0.00 ? 44 TYR A HA   3  
ATOM 3838  H HB2  . TYR A 1 45 ? 158.785 -0.378  3.239   1.00 0.00 ? 44 TYR A HB2  3  
ATOM 3839  H HB3  . TYR A 1 45 ? 160.392 -1.020  3.549   1.00 0.00 ? 44 TYR A HB3  3  
ATOM 3840  H HD1  . TYR A 1 45 ? 161.629 -0.320  5.575   1.00 0.00 ? 44 TYR A HD1  3  
ATOM 3841  H HD2  . TYR A 1 45 ? 157.595 0.852   4.910   1.00 0.00 ? 44 TYR A HD2  3  
ATOM 3842  H HE1  . TYR A 1 45 ? 161.411 0.258   7.956   1.00 0.00 ? 44 TYR A HE1  3  
ATOM 3843  H HE2  . TYR A 1 45 ? 157.364 1.434   7.288   1.00 0.00 ? 44 TYR A HE2  3  
ATOM 3844  H HH   . TYR A 1 45 ? 160.022 1.697   9.391   1.00 0.00 ? 44 TYR A HH   3  
ATOM 3845  N N    . MET A 1 46 ? 161.585 2.870   3.661   1.00 0.00 ? 45 MET A N    3  
ATOM 3846  C CA   . MET A 1 46 ? 162.707 3.559   4.296   1.00 0.00 ? 45 MET A CA   3  
ATOM 3847  C C    . MET A 1 46 ? 162.398 3.875   5.759   1.00 0.00 ? 45 MET A C    3  
ATOM 3848  O O    . MET A 1 46 ? 161.320 4.378   6.079   1.00 0.00 ? 45 MET A O    3  
ATOM 3849  C CB   . MET A 1 46 ? 163.035 4.855   3.546   1.00 0.00 ? 45 MET A CB   3  
ATOM 3850  C CG   . MET A 1 46 ? 163.142 4.690   2.036   1.00 0.00 ? 45 MET A CG   3  
ATOM 3851  S SD   . MET A 1 46 ? 163.009 6.263   1.162   1.00 0.00 ? 45 MET A SD   3  
ATOM 3852  C CE   . MET A 1 46 ? 162.984 5.714   -0.542  1.00 0.00 ? 45 MET A CE   3  
ATOM 3853  H H    . MET A 1 46 ? 160.789 3.386   3.408   1.00 0.00 ? 45 MET A H    3  
ATOM 3854  H HA   . MET A 1 46 ? 163.565 2.904   4.255   1.00 0.00 ? 45 MET A HA   3  
ATOM 3855  H HB2  . MET A 1 46 ? 162.261 5.580   3.750   1.00 0.00 ? 45 MET A HB2  3  
ATOM 3856  H HB3  . MET A 1 46 ? 163.976 5.238   3.911   1.00 0.00 ? 45 MET A HB3  3  
ATOM 3857  H HG2  . MET A 1 46 ? 164.098 4.244   1.803   1.00 0.00 ? 45 MET A HG2  3  
ATOM 3858  H HG3  . MET A 1 46 ? 162.350 4.039   1.699   1.00 0.00 ? 45 MET A HG3  3  
ATOM 3859  H HE1  . MET A 1 46 ? 162.249 6.284   -1.093  1.00 0.00 ? 45 MET A HE1  3  
ATOM 3860  H HE2  . MET A 1 46 ? 162.729 4.667   -0.581  1.00 0.00 ? 45 MET A HE2  3  
ATOM 3861  H HE3  . MET A 1 46 ? 163.958 5.866   -0.983  1.00 0.00 ? 45 MET A HE3  3  
ATOM 3862  N N    . ASN A 1 47 ? 163.355 3.587   6.641   1.00 0.00 ? 46 ASN A N    3  
ATOM 3863  C CA   . ASN A 1 47 ? 163.186 3.850   8.070   1.00 0.00 ? 46 ASN A CA   3  
ATOM 3864  C C    . ASN A 1 47 ? 163.695 5.244   8.427   1.00 0.00 ? 46 ASN A C    3  
ATOM 3865  O O    . ASN A 1 47 ? 162.990 6.029   9.063   1.00 0.00 ? 46 ASN A O    3  
ATOM 3866  C CB   . ASN A 1 47 ? 163.924 2.796   8.900   1.00 0.00 ? 46 ASN A CB   3  
ATOM 3867  C CG   . ASN A 1 47 ? 162.989 1.737   9.454   1.00 0.00 ? 46 ASN A CG   3  
ATOM 3868  O OD1  . ASN A 1 47 ? 161.846 2.026   9.808   1.00 0.00 ? 46 ASN A OD1  3  
ATOM 3869  N ND2  . ASN A 1 47 ? 163.469 0.501   9.530   1.00 0.00 ? 46 ASN A ND2  3  
ATOM 3870  H H    . ASN A 1 47 ? 164.198 3.194   6.324   1.00 0.00 ? 46 ASN A H    3  
ATOM 3871  H HA   . ASN A 1 47 ? 162.130 3.797   8.294   1.00 0.00 ? 46 ASN A HA   3  
ATOM 3872  H HB2  . ASN A 1 47 ? 164.664 2.311   8.281   1.00 0.00 ? 46 ASN A HB2  3  
ATOM 3873  H HB3  . ASN A 1 47 ? 164.419 3.281   9.730   1.00 0.00 ? 46 ASN A HB3  3  
ATOM 3874  H HD21 . ASN A 1 47 ? 164.388 0.340   9.231   1.00 0.00 ? 46 ASN A HD21 3  
ATOM 3875  H HD22 . ASN A 1 47 ? 162.883 -0.199  9.886   1.00 0.00 ? 46 ASN A HD22 3  
ATOM 3876  N N    . ASN A 1 48 ? 164.924 5.540   8.010   1.00 0.00 ? 47 ASN A N    3  
ATOM 3877  C CA   . ASN A 1 48 ? 165.542 6.837   8.273   1.00 0.00 ? 47 ASN A CA   3  
ATOM 3878  C C    . ASN A 1 48 ? 166.855 6.971   7.503   1.00 0.00 ? 47 ASN A C    3  
ATOM 3879  O O    . ASN A 1 48 ? 166.994 7.840   6.641   1.00 0.00 ? 47 ASN A O    3  
ATOM 3880  C CB   . ASN A 1 48 ? 165.794 7.021   9.774   1.00 0.00 ? 47 ASN A CB   3  
ATOM 3881  C CG   . ASN A 1 48 ? 165.650 8.468   10.212  1.00 0.00 ? 47 ASN A CG   3  
ATOM 3882  O OD1  . ASN A 1 48 ? 165.976 9.390   9.465   1.00 0.00 ? 47 ASN A OD1  3  
ATOM 3883  N ND2  . ASN A 1 48 ? 165.162 8.676   11.431  1.00 0.00 ? 47 ASN A ND2  3  
ATOM 3884  H H    . ASN A 1 48 ? 165.429 4.867   7.508   1.00 0.00 ? 47 ASN A H    3  
ATOM 3885  H HA   . ASN A 1 48 ? 164.861 7.603   7.935   1.00 0.00 ? 47 ASN A HA   3  
ATOM 3886  H HB2  . ASN A 1 48 ? 165.085 6.425   10.328  1.00 0.00 ? 47 ASN A HB2  3  
ATOM 3887  H HB3  . ASN A 1 48 ? 166.795 6.692   10.008  1.00 0.00 ? 47 ASN A HB3  3  
ATOM 3888  H HD21 . ASN A 1 48 ? 164.923 7.898   11.977  1.00 0.00 ? 47 ASN A HD21 3  
ATOM 3889  H HD22 . ASN A 1 48 ? 165.061 9.603   11.735  1.00 0.00 ? 47 ASN A HD22 3  
ATOM 3890  N N    . GLU A 1 49 ? 167.811 6.100   7.819   1.00 0.00 ? 48 GLU A N    3  
ATOM 3891  C CA   . GLU A 1 49 ? 169.116 6.109   7.161   1.00 0.00 ? 48 GLU A CA   3  
ATOM 3892  C C    . GLU A 1 49 ? 169.274 4.914   6.214   1.00 0.00 ? 48 GLU A C    3  
ATOM 3893  O O    . GLU A 1 49 ? 169.996 4.997   5.220   1.00 0.00 ? 48 GLU A O    3  
ATOM 3894  C CB   . GLU A 1 49 ? 170.238 6.100   8.205   1.00 0.00 ? 48 GLU A CB   3  
ATOM 3895  C CG   . GLU A 1 49 ? 170.122 7.215   9.238   1.00 0.00 ? 48 GLU A CG   3  
ATOM 3896  C CD   . GLU A 1 49 ? 169.757 6.704   10.621  1.00 0.00 ? 48 GLU A CD   3  
ATOM 3897  O OE1  . GLU A 1 49 ? 168.793 5.916   10.732  1.00 0.00 ? 48 GLU A OE1  3  
ATOM 3898  O OE2  . GLU A 1 49 ? 170.435 7.094   11.595  1.00 0.00 ? 48 GLU A OE2  3  
ATOM 3899  H H    . GLU A 1 49 ? 167.635 5.432   8.516   1.00 0.00 ? 48 GLU A H    3  
ATOM 3900  H HA   . GLU A 1 49 ? 169.186 7.018   6.583   1.00 0.00 ? 48 GLU A HA   3  
ATOM 3901  H HB2  . GLU A 1 49 ? 170.223 5.153   8.724   1.00 0.00 ? 48 GLU A HB2  3  
ATOM 3902  H HB3  . GLU A 1 49 ? 171.185 6.207   7.698   1.00 0.00 ? 48 GLU A HB3  3  
ATOM 3903  H HG2  . GLU A 1 49 ? 171.070 7.726   9.303   1.00 0.00 ? 48 GLU A HG2  3  
ATOM 3904  H HG3  . GLU A 1 49 ? 169.361 7.910   8.914   1.00 0.00 ? 48 GLU A HG3  3  
ATOM 3905  N N    . LEU A 1 50 ? 168.600 3.801   6.527   1.00 0.00 ? 49 LEU A N    3  
ATOM 3906  C CA   . LEU A 1 50 ? 168.679 2.599   5.702   1.00 0.00 ? 49 LEU A CA   3  
ATOM 3907  C C    . LEU A 1 50 ? 167.378 2.365   4.935   1.00 0.00 ? 49 LEU A C    3  
ATOM 3908  O O    . LEU A 1 50 ? 166.323 2.892   5.300   1.00 0.00 ? 49 LEU A O    3  
ATOM 3909  C CB   . LEU A 1 50 ? 168.999 1.380   6.572   1.00 0.00 ? 49 LEU A CB   3  
ATOM 3910  C CG   . LEU A 1 50 ? 170.020 0.405   5.975   1.00 0.00 ? 49 LEU A CG   3  
ATOM 3911  C CD1  . LEU A 1 50 ? 171.428 0.749   6.439   1.00 0.00 ? 49 LEU A CD1  3  
ATOM 3912  C CD2  . LEU A 1 50 ? 169.666 -1.029  6.347   1.00 0.00 ? 49 LEU A CD2  3  
ATOM 3913  H H    . LEU A 1 50 ? 168.041 3.786   7.331   1.00 0.00 ? 49 LEU A H    3  
ATOM 3914  H HA   . LEU A 1 50 ? 169.479 2.741   4.991   1.00 0.00 ? 49 LEU A HA   3  
ATOM 3915  H HB2  . LEU A 1 50 ? 169.379 1.732   7.521   1.00 0.00 ? 49 LEU A HB2  3  
ATOM 3916  H HB3  . LEU A 1 50 ? 168.081 0.840   6.750   1.00 0.00 ? 49 LEU A HB3  3  
ATOM 3917  H HG   . LEU A 1 50 ? 169.996 0.486   4.898   1.00 0.00 ? 49 LEU A HG   3  
ATOM 3918  H HD11 . LEU A 1 50 ? 171.508 1.816   6.586   1.00 0.00 ? 49 LEU A HD11 3  
ATOM 3919  H HD12 . LEU A 1 50 ? 172.141 0.435   5.691   1.00 0.00 ? 49 LEU A HD12 3  
ATOM 3920  H HD13 . LEU A 1 50 ? 171.636 0.241   7.370   1.00 0.00 ? 49 LEU A HD13 3  
ATOM 3921  H HD21 . LEU A 1 50 ? 169.055 -1.462  5.569   1.00 0.00 ? 49 LEU A HD21 3  
ATOM 3922  H HD22 . LEU A 1 50 ? 169.120 -1.036  7.278   1.00 0.00 ? 49 LEU A HD22 3  
ATOM 3923  H HD23 . LEU A 1 50 ? 170.573 -1.607  6.457   1.00 0.00 ? 49 LEU A HD23 3  
ATOM 3924  N N    . SER A 1 51 ? 167.467 1.568   3.872   1.00 0.00 ? 50 SER A N    3  
ATOM 3925  C CA   . SER A 1 51 ? 166.308 1.249   3.042   1.00 0.00 ? 50 SER A CA   3  
ATOM 3926  C C    . SER A 1 51 ? 166.022 -0.251  3.059   1.00 0.00 ? 50 SER A C    3  
ATOM 3927  O O    . SER A 1 51 ? 166.930 -1.068  2.885   1.00 0.00 ? 50 SER A O    3  
ATOM 3928  C CB   . SER A 1 51 ? 166.533 1.723   1.601   1.00 0.00 ? 50 SER A CB   3  
ATOM 3929  O OG   . SER A 1 51 ? 167.909 1.703   1.258   1.00 0.00 ? 50 SER A OG   3  
ATOM 3930  H H    . SER A 1 51 ? 168.337 1.181   3.640   1.00 0.00 ? 50 SER A H    3  
ATOM 3931  H HA   . SER A 1 51 ? 165.456 1.769   3.453   1.00 0.00 ? 50 SER A HA   3  
ATOM 3932  H HB2  . SER A 1 51 ? 165.999 1.074   0.923   1.00 0.00 ? 50 SER A HB2  3  
ATOM 3933  H HB3  . SER A 1 51 ? 166.164 2.733   1.496   1.00 0.00 ? 50 SER A HB3  3  
ATOM 3934  H HG   . SER A 1 51 ? 168.033 2.121   0.402   1.00 0.00 ? 50 SER A HG   3  
ATOM 3935  N N    . ILE A 1 52 ? 164.756 -0.605  3.270   1.00 0.00 ? 51 ILE A N    3  
ATOM 3936  C CA   . ILE A 1 52 ? 164.337 -2.005  3.312   1.00 0.00 ? 51 ILE A CA   3  
ATOM 3937  C C    . ILE A 1 52 ? 163.418 -2.333  2.135   1.00 0.00 ? 51 ILE A C    3  
ATOM 3938  O O    . ILE A 1 52 ? 162.496 -1.577  1.827   1.00 0.00 ? 51 ILE A O    3  
ATOM 3939  C CB   . ILE A 1 52 ? 163.603 -2.337  4.631   1.00 0.00 ? 51 ILE A CB   3  
ATOM 3940  C CG1  . ILE A 1 52 ? 164.412 -1.853  5.839   1.00 0.00 ? 51 ILE A CG1  3  
ATOM 3941  C CG2  . ILE A 1 52 ? 163.339 -3.834  4.731   1.00 0.00 ? 51 ILE A CG2  3  
ATOM 3942  C CD1  . ILE A 1 52 ? 163.617 -1.824  7.127   1.00 0.00 ? 51 ILE A CD1  3  
ATOM 3943  H H    . ILE A 1 52 ? 164.081 0.095   3.401   1.00 0.00 ? 51 ILE A H    3  
ATOM 3944  H HA   . ILE A 1 52 ? 165.223 -2.621  3.250   1.00 0.00 ? 51 ILE A HA   3  
ATOM 3945  H HB   . ILE A 1 52 ? 162.650 -1.831  4.619   1.00 0.00 ? 51 ILE A HB   3  
ATOM 3946  H HG12 . ILE A 1 52 ? 165.255 -2.511  5.986   1.00 0.00 ? 51 ILE A HG12 3  
ATOM 3947  H HG13 . ILE A 1 52 ? 164.771 -0.853  5.648   1.00 0.00 ? 51 ILE A HG13 3  
ATOM 3948  H HG21 . ILE A 1 52 ? 164.275 -4.370  4.667   1.00 0.00 ? 51 ILE A HG21 3  
ATOM 3949  H HG22 . ILE A 1 52 ? 162.693 -4.141  3.922   1.00 0.00 ? 51 ILE A HG22 3  
ATOM 3950  H HG23 . ILE A 1 52 ? 162.863 -4.053  5.675   1.00 0.00 ? 51 ILE A HG23 3  
ATOM 3951  H HD11 . ILE A 1 52 ? 162.654 -1.369  6.947   1.00 0.00 ? 51 ILE A HD11 3  
ATOM 3952  H HD12 . ILE A 1 52 ? 164.153 -1.252  7.869   1.00 0.00 ? 51 ILE A HD12 3  
ATOM 3953  H HD13 . ILE A 1 52 ? 163.475 -2.833  7.485   1.00 0.00 ? 51 ILE A HD13 3  
ATOM 3954  N N    . LEU A 1 53 ? 163.675 -3.464  1.480   1.00 0.00 ? 52 LEU A N    3  
ATOM 3955  C CA   . LEU A 1 53 ? 162.870 -3.888  0.337   1.00 0.00 ? 52 LEU A CA   3  
ATOM 3956  C C    . LEU A 1 53 ? 161.666 -4.715  0.786   1.00 0.00 ? 52 LEU A C    3  
ATOM 3957  O O    . LEU A 1 53 ? 161.812 -5.704  1.506   1.00 0.00 ? 52 LEU A O    3  
ATOM 3958  C CB   . LEU A 1 53 ? 163.723 -4.696  -0.645  1.00 0.00 ? 52 LEU A CB   3  
ATOM 3959  C CG   . LEU A 1 53 ? 163.441 -4.422  -2.124  1.00 0.00 ? 52 LEU A CG   3  
ATOM 3960  C CD1  . LEU A 1 53 ? 164.371 -3.341  -2.652  1.00 0.00 ? 52 LEU A CD1  3  
ATOM 3961  C CD2  . LEU A 1 53 ? 163.582 -5.696  -2.945  1.00 0.00 ? 52 LEU A CD2  3  
ATOM 3962  H H    . LEU A 1 53 ? 164.424 -4.026  1.771   1.00 0.00 ? 52 LEU A H    3  
ATOM 3963  H HA   . LEU A 1 53 ? 162.512 -2.999  -0.162  1.00 0.00 ? 52 LEU A HA   3  
ATOM 3964  H HB2  . LEU A 1 53 ? 164.762 -4.475  -0.450  1.00 0.00 ? 52 LEU A HB2  3  
ATOM 3965  H HB3  . LEU A 1 53 ? 163.555 -5.747  -0.457  1.00 0.00 ? 52 LEU A HB3  3  
ATOM 3966  H HG   . LEU A 1 53 ? 162.426 -4.067  -2.230  1.00 0.00 ? 52 LEU A HG   3  
ATOM 3967  H HD11 . LEU A 1 53 ? 164.094 -3.092  -3.665  1.00 0.00 ? 52 LEU A HD11 3  
ATOM 3968  H HD12 . LEU A 1 53 ? 165.389 -3.702  -2.635  1.00 0.00 ? 52 LEU A HD12 3  
ATOM 3969  H HD13 . LEU A 1 53 ? 164.290 -2.463  -2.031  1.00 0.00 ? 52 LEU A HD13 3  
ATOM 3970  H HD21 . LEU A 1 53 ? 163.374 -5.480  -3.983  1.00 0.00 ? 52 LEU A HD21 3  
ATOM 3971  H HD22 . LEU A 1 53 ? 162.882 -6.437  -2.586  1.00 0.00 ? 52 LEU A HD22 3  
ATOM 3972  H HD23 . LEU A 1 53 ? 164.589 -6.077  -2.851  1.00 0.00 ? 52 LEU A HD23 3  
ATOM 3973  N N    . LEU A 1 54 ? 160.478 -4.303  0.347   1.00 0.00 ? 53 LEU A N    3  
ATOM 3974  C CA   . LEU A 1 54 ? 159.242 -5.001  0.693   1.00 0.00 ? 53 LEU A CA   3  
ATOM 3975  C C    . LEU A 1 54 ? 158.952 -6.114  -0.313  1.00 0.00 ? 53 LEU A C    3  
ATOM 3976  O O    . LEU A 1 54 ? 158.230 -5.909  -1.290  1.00 0.00 ? 53 LEU A O    3  
ATOM 3977  C CB   . LEU A 1 54 ? 158.069 -4.016  0.737   1.00 0.00 ? 53 LEU A CB   3  
ATOM 3978  C CG   . LEU A 1 54 ? 157.925 -3.235  2.045   1.00 0.00 ? 53 LEU A CG   3  
ATOM 3979  C CD1  . LEU A 1 54 ? 157.326 -1.860  1.787   1.00 0.00 ? 53 LEU A CD1  3  
ATOM 3980  C CD2  . LEU A 1 54 ? 157.073 -4.013  3.035   1.00 0.00 ? 53 LEU A CD2  3  
ATOM 3981  H H    . LEU A 1 54 ? 160.430 -3.511  -0.228  1.00 0.00 ? 53 LEU A H    3  
ATOM 3982  H HA   . LEU A 1 54 ? 159.369 -5.441  1.673   1.00 0.00 ? 53 LEU A HA   3  
ATOM 3983  H HB2  . LEU A 1 54 ? 158.193 -3.308  -0.069  1.00 0.00 ? 53 LEU A HB2  3  
ATOM 3984  H HB3  . LEU A 1 54 ? 157.156 -4.567  0.571   1.00 0.00 ? 53 LEU A HB3  3  
ATOM 3985  H HG   . LEU A 1 54 ? 158.903 -3.095  2.483   1.00 0.00 ? 53 LEU A HG   3  
ATOM 3986  H HD11 . LEU A 1 54 ? 156.409 -1.965  1.225   1.00 0.00 ? 53 LEU A HD11 3  
ATOM 3987  H HD12 . LEU A 1 54 ? 158.026 -1.262  1.224   1.00 0.00 ? 53 LEU A HD12 3  
ATOM 3988  H HD13 . LEU A 1 54 ? 157.117 -1.375  2.730   1.00 0.00 ? 53 LEU A HD13 3  
ATOM 3989  H HD21 . LEU A 1 54 ? 157.318 -5.063  2.975   1.00 0.00 ? 53 LEU A HD21 3  
ATOM 3990  H HD22 . LEU A 1 54 ? 156.028 -3.874  2.799   1.00 0.00 ? 53 LEU A HD22 3  
ATOM 3991  H HD23 . LEU A 1 54 ? 157.267 -3.656  4.035   1.00 0.00 ? 53 LEU A HD23 3  
ATOM 3992  N N    . LYS A 1 55 ? 159.523 -7.290  -0.065  1.00 0.00 ? 54 LYS A N    3  
ATOM 3993  C CA   . LYS A 1 55 ? 159.332 -8.441  -0.946  1.00 0.00 ? 54 LYS A CA   3  
ATOM 3994  C C    . LYS A 1 55 ? 158.395 -9.472  -0.317  1.00 0.00 ? 54 LYS A C    3  
ATOM 3995  O O    . LYS A 1 55 ? 157.646 -10.152 -1.022  1.00 0.00 ? 54 LYS A O    3  
ATOM 3996  C CB   . LYS A 1 55 ? 160.679 -9.089  -1.274  1.00 0.00 ? 54 LYS A CB   3  
ATOM 3997  C CG   . LYS A 1 55 ? 160.796 -9.551  -2.718  1.00 0.00 ? 54 LYS A CG   3  
ATOM 3998  C CD   . LYS A 1 55 ? 161.588 -10.845 -2.830  1.00 0.00 ? 54 LYS A CD   3  
ATOM 3999  C CE   . LYS A 1 55 ? 160.675 -12.047 -3.025  1.00 0.00 ? 54 LYS A CE   3  
ATOM 4000  N NZ   . LYS A 1 55 ? 160.183 -12.595 -1.729  1.00 0.00 ? 54 LYS A NZ   3  
ATOM 4001  H H    . LYS A 1 55 ? 160.090 -7.387  0.730   1.00 0.00 ? 54 LYS A H    3  
ATOM 4002  H HA   . LYS A 1 55 ? 158.886 -8.083  -1.862  1.00 0.00 ? 54 LYS A HA   3  
ATOM 4003  H HB2  . LYS A 1 55 ? 161.466 -8.373  -1.083  1.00 0.00 ? 54 LYS A HB2  3  
ATOM 4004  H HB3  . LYS A 1 55 ? 160.819 -9.945  -0.631  1.00 0.00 ? 54 LYS A HB3  3  
ATOM 4005  H HG2  . LYS A 1 55 ? 159.804 -9.713  -3.114  1.00 0.00 ? 54 LYS A HG2  3  
ATOM 4006  H HG3  . LYS A 1 55 ? 161.294 -8.783  -3.293  1.00 0.00 ? 54 LYS A HG3  3  
ATOM 4007  H HD2  . LYS A 1 55 ? 162.256 -10.773 -3.676  1.00 0.00 ? 54 LYS A HD2  3  
ATOM 4008  H HD3  . LYS A 1 55 ? 162.165 -10.984 -1.926  1.00 0.00 ? 54 LYS A HD3  3  
ATOM 4009  H HE2  . LYS A 1 55 ? 159.827 -11.746 -3.622  1.00 0.00 ? 54 LYS A HE2  3  
ATOM 4010  H HE3  . LYS A 1 55 ? 161.224 -12.817 -3.547  1.00 0.00 ? 54 LYS A HE3  3  
ATOM 4011  H HZ1  . LYS A 1 55 ? 160.867 -12.396 -0.972  1.00 0.00 ? 54 LYS A HZ1  3  
ATOM 4012  H HZ2  . LYS A 1 55 ? 160.055 -13.625 -1.802  1.00 0.00 ? 54 LYS A HZ2  3  
ATOM 4013  H HZ3  . LYS A 1 55 ? 159.270 -12.161 -1.481  1.00 0.00 ? 54 LYS A HZ3  3  
ATOM 4014  N N    . ASN A 1 56 ? 158.442 -9.585  1.011   1.00 0.00 ? 55 ASN A N    3  
ATOM 4015  C CA   . ASN A 1 56 ? 157.597 -10.531 1.735   1.00 0.00 ? 55 ASN A CA   3  
ATOM 4016  C C    . ASN A 1 56 ? 156.644 -9.796  2.672   1.00 0.00 ? 55 ASN A C    3  
ATOM 4017  O O    . ASN A 1 56 ? 156.895 -8.651  3.053   1.00 0.00 ? 55 ASN A O    3  
ATOM 4018  C CB   . ASN A 1 56 ? 158.462 -11.511 2.535   1.00 0.00 ? 55 ASN A CB   3  
ATOM 4019  C CG   . ASN A 1 56 ? 157.888 -12.917 2.549   1.00 0.00 ? 55 ASN A CG   3  
ATOM 4020  O OD1  . ASN A 1 56 ? 156.681 -13.106 2.706   1.00 0.00 ? 55 ASN A OD1  3  
ATOM 4021  N ND2  . ASN A 1 56 ? 158.751 -13.915 2.385   1.00 0.00 ? 55 ASN A ND2  3  
ATOM 4022  H H    . ASN A 1 56 ? 159.058 -9.016  1.518   1.00 0.00 ? 55 ASN A H    3  
ATOM 4023  H HA   . ASN A 1 56 ? 157.019 -11.084 1.009   1.00 0.00 ? 55 ASN A HA   3  
ATOM 4024  H HB2  . ASN A 1 56 ? 159.449 -11.549 2.099   1.00 0.00 ? 55 ASN A HB2  3  
ATOM 4025  H HB3  . ASN A 1 56 ? 158.537 -11.164 3.556   1.00 0.00 ? 55 ASN A HB3  3  
ATOM 4026  H HD21 . ASN A 1 56 ? 159.699 -13.694 2.266   1.00 0.00 ? 55 ASN A HD21 3  
ATOM 4027  H HD22 . ASN A 1 56 ? 158.404 -14.831 2.392   1.00 0.00 ? 55 ASN A HD22 3  
ATOM 4028  N N    . GLN A 1 57 ? 155.551 -10.463 3.049   1.00 0.00 ? 56 GLN A N    3  
ATOM 4029  C CA   . GLN A 1 57 ? 154.566 -9.871  3.951   1.00 0.00 ? 56 GLN A CA   3  
ATOM 4030  C C    . GLN A 1 57 ? 155.208 -9.510  5.291   1.00 0.00 ? 56 GLN A C    3  
ATOM 4031  O O    . GLN A 1 57 ? 154.846 -8.509  5.908   1.00 0.00 ? 56 GLN A O    3  
ATOM 4032  C CB   . GLN A 1 57 ? 153.395 -10.832 4.172   1.00 0.00 ? 56 GLN A CB   3  
ATOM 4033  C CG   . GLN A 1 57 ? 152.233 -10.213 4.936   1.00 0.00 ? 56 GLN A CG   3  
ATOM 4034  C CD   . GLN A 1 57 ? 151.059 -9.861  4.040   1.00 0.00 ? 56 GLN A CD   3  
ATOM 4035  O OE1  . GLN A 1 57 ? 150.543 -10.708 3.308   1.00 0.00 ? 56 GLN A OE1  3  
ATOM 4036  N NE2  . GLN A 1 57 ? 150.627 -8.605  4.094   1.00 0.00 ? 56 GLN A NE2  3  
ATOM 4037  H H    . GLN A 1 57 ? 155.408 -11.375 2.718   1.00 0.00 ? 56 GLN A H    3  
ATOM 4038  H HA   . GLN A 1 57 ? 154.197 -8.966  3.488   1.00 0.00 ? 56 GLN A HA   3  
ATOM 4039  H HB2  . GLN A 1 57 ? 153.031 -11.166 3.212   1.00 0.00 ? 56 GLN A HB2  3  
ATOM 4040  H HB3  . GLN A 1 57 ? 153.748 -11.687 4.729   1.00 0.00 ? 56 GLN A HB3  3  
ATOM 4041  H HG2  . GLN A 1 57 ? 151.895 -10.916 5.681   1.00 0.00 ? 56 GLN A HG2  3  
ATOM 4042  H HG3  . GLN A 1 57 ? 152.579 -9.313  5.423   1.00 0.00 ? 56 GLN A HG3  3  
ATOM 4043  H HE21 . GLN A 1 57 ? 151.082 -7.983  4.700   1.00 0.00 ? 56 GLN A HE21 3  
ATOM 4044  H HE22 . GLN A 1 57 ? 149.869 -8.352  3.526   1.00 0.00 ? 56 GLN A HE22 3  
ATOM 4045  N N    . ASP A 1 58 ? 156.166 -10.331 5.731   1.00 0.00 ? 57 ASP A N    3  
ATOM 4046  C CA   . ASP A 1 58 ? 156.865 -10.097 6.994   1.00 0.00 ? 57 ASP A CA   3  
ATOM 4047  C C    . ASP A 1 58 ? 157.487 -8.700  7.029   1.00 0.00 ? 57 ASP A C    3  
ATOM 4048  O O    . ASP A 1 58 ? 157.456 -8.026  8.057   1.00 0.00 ? 57 ASP A O    3  
ATOM 4049  C CB   . ASP A 1 58 ? 157.952 -11.156 7.207   1.00 0.00 ? 57 ASP A CB   3  
ATOM 4050  C CG   . ASP A 1 58 ? 157.451 -12.359 7.984   1.00 0.00 ? 57 ASP A CG   3  
ATOM 4051  O OD1  . ASP A 1 58 ? 156.523 -13.038 7.495   1.00 0.00 ? 57 ASP A OD1  3  
ATOM 4052  O OD2  . ASP A 1 58 ? 157.988 -12.624 9.081   1.00 0.00 ? 57 ASP A OD2  3  
ATOM 4053  H H    . ASP A 1 58 ? 156.410 -11.112 5.190   1.00 0.00 ? 57 ASP A H    3  
ATOM 4054  H HA   . ASP A 1 58 ? 156.139 -10.173 7.792   1.00 0.00 ? 57 ASP A HA   3  
ATOM 4055  H HB2  . ASP A 1 58 ? 158.306 -11.497 6.246   1.00 0.00 ? 57 ASP A HB2  3  
ATOM 4056  H HB3  . ASP A 1 58 ? 158.773 -10.715 7.752   1.00 0.00 ? 57 ASP A HB3  3  
ATOM 4057  N N    . ASP A 1 59 ? 158.049 -8.272  5.896   1.00 0.00 ? 58 ASP A N    3  
ATOM 4058  C CA   . ASP A 1 59 ? 158.673 -6.953  5.796   1.00 0.00 ? 58 ASP A CA   3  
ATOM 4059  C C    . ASP A 1 59 ? 157.654 -5.849  6.070   1.00 0.00 ? 58 ASP A C    3  
ATOM 4060  O O    . ASP A 1 59 ? 157.926 -4.908  6.817   1.00 0.00 ? 58 ASP A O    3  
ATOM 4061  C CB   . ASP A 1 59 ? 159.292 -6.756  4.407   1.00 0.00 ? 58 ASP A CB   3  
ATOM 4062  C CG   . ASP A 1 59 ? 160.373 -7.774  4.098   1.00 0.00 ? 58 ASP A CG   3  
ATOM 4063  O OD1  . ASP A 1 59 ? 160.025 -8.936  3.794   1.00 0.00 ? 58 ASP A OD1  3  
ATOM 4064  O OD2  . ASP A 1 59 ? 161.566 -7.408  4.155   1.00 0.00 ? 58 ASP A OD2  3  
ATOM 4065  H H    . ASP A 1 59 ? 158.039 -8.854  5.107   1.00 0.00 ? 58 ASP A H    3  
ATOM 4066  H HA   . ASP A 1 59 ? 159.453 -6.900  6.542   1.00 0.00 ? 58 ASP A HA   3  
ATOM 4067  H HB2  . ASP A 1 59 ? 158.518 -6.848  3.658   1.00 0.00 ? 58 ASP A HB2  3  
ATOM 4068  H HB3  . ASP A 1 59 ? 159.726 -5.768  4.350   1.00 0.00 ? 58 ASP A HB3  3  
ATOM 4069  N N    . LEU A 1 60 ? 156.476 -5.976  5.463   1.00 0.00 ? 59 LEU A N    3  
ATOM 4070  C CA   . LEU A 1 60 ? 155.409 -4.996  5.640   1.00 0.00 ? 59 LEU A CA   3  
ATOM 4071  C C    . LEU A 1 60 ? 154.812 -5.083  7.047   1.00 0.00 ? 59 LEU A C    3  
ATOM 4072  O O    . LEU A 1 60 ? 154.482 -4.062  7.652   1.00 0.00 ? 59 LEU A O    3  
ATOM 4073  C CB   . LEU A 1 60 ? 154.314 -5.212  4.591   1.00 0.00 ? 59 LEU A CB   3  
ATOM 4074  C CG   . LEU A 1 60 ? 153.270 -4.099  4.505   1.00 0.00 ? 59 LEU A CG   3  
ATOM 4075  C CD1  . LEU A 1 60 ? 153.617 -3.125  3.387   1.00 0.00 ? 59 LEU A CD1  3  
ATOM 4076  C CD2  . LEU A 1 60 ? 151.883 -4.691  4.297   1.00 0.00 ? 59 LEU A CD2  3  
ATOM 4077  H H    . LEU A 1 60 ? 156.319 -6.753  4.884   1.00 0.00 ? 59 LEU A H    3  
ATOM 4078  H HA   . LEU A 1 60 ? 155.837 -4.014  5.504   1.00 0.00 ? 59 LEU A HA   3  
ATOM 4079  H HB2  . LEU A 1 60 ? 154.787 -5.310  3.624   1.00 0.00 ? 59 LEU A HB2  3  
ATOM 4080  H HB3  . LEU A 1 60 ? 153.805 -6.137  4.817   1.00 0.00 ? 59 LEU A HB3  3  
ATOM 4081  H HG   . LEU A 1 60 ? 153.263 -3.548  5.435   1.00 0.00 ? 59 LEU A HG   3  
ATOM 4082  H HD11 . LEU A 1 60 ? 154.401 -2.460  3.719   1.00 0.00 ? 59 LEU A HD11 3  
ATOM 4083  H HD12 . LEU A 1 60 ? 152.742 -2.548  3.127   1.00 0.00 ? 59 LEU A HD12 3  
ATOM 4084  H HD13 . LEU A 1 60 ? 153.956 -3.675  2.522   1.00 0.00 ? 59 LEU A HD13 3  
ATOM 4085  H HD21 . LEU A 1 60 ? 151.791 -5.045  3.281   1.00 0.00 ? 59 LEU A HD21 3  
ATOM 4086  H HD22 . LEU A 1 60 ? 151.136 -3.935  4.485   1.00 0.00 ? 59 LEU A HD22 3  
ATOM 4087  H HD23 . LEU A 1 60 ? 151.740 -5.516  4.981   1.00 0.00 ? 59 LEU A HD23 3  
ATOM 4088  N N    . ASP A 1 61 ? 154.680 -6.307  7.559   1.00 0.00 ? 60 ASP A N    3  
ATOM 4089  C CA   . ASP A 1 61 ? 154.124 -6.533  8.894   1.00 0.00 ? 60 ASP A CA   3  
ATOM 4090  C C    . ASP A 1 61 ? 155.034 -5.953  9.974   1.00 0.00 ? 60 ASP A C    3  
ATOM 4091  O O    . ASP A 1 61 ? 154.562 -5.319  10.919  1.00 0.00 ? 60 ASP A O    3  
ATOM 4092  C CB   . ASP A 1 61 ? 153.911 -8.032  9.130   1.00 0.00 ? 60 ASP A CB   3  
ATOM 4093  C CG   . ASP A 1 61 ? 152.505 -8.487  8.781   1.00 0.00 ? 60 ASP A CG   3  
ATOM 4094  O OD1  . ASP A 1 61 ? 151.940 -7.974  7.791   1.00 0.00 ? 60 ASP A OD1  3  
ATOM 4095  O OD2  . ASP A 1 61 ? 151.969 -9.357  9.500   1.00 0.00 ? 60 ASP A OD2  3  
ATOM 4096  H H    . ASP A 1 61 ? 154.964 -7.081  7.025   1.00 0.00 ? 60 ASP A H    3  
ATOM 4097  H HA   . ASP A 1 61 ? 153.168 -6.031  8.942   1.00 0.00 ? 60 ASP A HA   3  
ATOM 4098  H HB2  . ASP A 1 61 ? 154.607 -8.588  8.519   1.00 0.00 ? 60 ASP A HB2  3  
ATOM 4099  H HB3  . ASP A 1 61 ? 154.095 -8.256  10.170  1.00 0.00 ? 60 ASP A HB3  3  
ATOM 4100  N N    . LYS A 1 62 ? 156.339 -6.167  9.825   1.00 0.00 ? 61 LYS A N    3  
ATOM 4101  C CA   . LYS A 1 62 ? 157.314 -5.656  10.784  1.00 0.00 ? 61 LYS A CA   3  
ATOM 4102  C C    . LYS A 1 62 ? 157.305 -4.128  10.811  1.00 0.00 ? 61 LYS A C    3  
ATOM 4103  O O    . LYS A 1 62 ? 157.512 -3.519  11.860  1.00 0.00 ? 61 LYS A O    3  
ATOM 4104  C CB   . LYS A 1 62 ? 158.716 -6.168  10.445  1.00 0.00 ? 61 LYS A CB   3  
ATOM 4105  C CG   . LYS A 1 62 ? 159.398 -6.874  11.604  1.00 0.00 ? 61 LYS A CG   3  
ATOM 4106  C CD   . LYS A 1 62 ? 159.229 -8.382  11.512  1.00 0.00 ? 61 LYS A CD   3  
ATOM 4107  C CE   . LYS A 1 62 ? 158.072 -8.870  12.371  1.00 0.00 ? 61 LYS A CE   3  
ATOM 4108  N NZ   . LYS A 1 62 ? 158.169 -10.329 12.660  1.00 0.00 ? 61 LYS A NZ   3  
ATOM 4109  H H    . LYS A 1 62 ? 156.654 -6.675  9.048   1.00 0.00 ? 61 LYS A H    3  
ATOM 4110  H HA   . LYS A 1 62 ? 157.035 -6.022  11.763  1.00 0.00 ? 61 LYS A HA   3  
ATOM 4111  H HB2  . LYS A 1 62 ? 158.645 -6.862  9.620   1.00 0.00 ? 61 LYS A HB2  3  
ATOM 4112  H HB3  . LYS A 1 62 ? 159.332 -5.331  10.147  1.00 0.00 ? 61 LYS A HB3  3  
ATOM 4113  H HG2  . LYS A 1 62 ? 160.451 -6.637  11.588  1.00 0.00 ? 61 LYS A HG2  3  
ATOM 4114  H HG3  . LYS A 1 62 ? 158.962 -6.526  12.530  1.00 0.00 ? 61 LYS A HG3  3  
ATOM 4115  H HD2  . LYS A 1 62 ? 159.037 -8.651  10.483  1.00 0.00 ? 61 LYS A HD2  3  
ATOM 4116  H HD3  . LYS A 1 62 ? 160.140 -8.856  11.846  1.00 0.00 ? 61 LYS A HD3  3  
ATOM 4117  H HE2  . LYS A 1 62 ? 158.080 -8.327  13.305  1.00 0.00 ? 61 LYS A HE2  3  
ATOM 4118  H HE3  . LYS A 1 62 ? 157.145 -8.675  11.851  1.00 0.00 ? 61 LYS A HE3  3  
ATOM 4119  H HZ1  . LYS A 1 62 ? 157.634 -10.869 11.950  1.00 0.00 ? 61 LYS A HZ1  3  
ATOM 4120  H HZ2  . LYS A 1 62 ? 157.779 -10.534 13.602  1.00 0.00 ? 61 LYS A HZ2  3  
ATOM 4121  H HZ3  . LYS A 1 62 ? 159.163 -10.634 12.635  1.00 0.00 ? 61 LYS A HZ3  3  
ATOM 4122  N N    . ALA A 1 63 ? 157.064 -3.514  9.651   1.00 0.00 ? 62 ALA A N    3  
ATOM 4123  C CA   . ALA A 1 63 ? 157.026 -2.057  9.546   1.00 0.00 ? 62 ALA A CA   3  
ATOM 4124  C C    . ALA A 1 63 ? 155.905 -1.468  10.401  1.00 0.00 ? 62 ALA A C    3  
ATOM 4125  O O    . ALA A 1 63 ? 156.085 -0.433  11.044  1.00 0.00 ? 62 ALA A O    3  
ATOM 4126  C CB   . ALA A 1 63 ? 156.864 -1.634  8.094   1.00 0.00 ? 62 ALA A CB   3  
ATOM 4127  H H    . ALA A 1 63 ? 156.904 -4.054  8.848   1.00 0.00 ? 62 ALA A H    3  
ATOM 4128  H HA   . ALA A 1 63 ? 157.973 -1.675  9.903   1.00 0.00 ? 62 ALA A HA   3  
ATOM 4129  H HB1  . ALA A 1 63 ? 157.839 -1.519  7.643   1.00 0.00 ? 62 ALA A HB1  3  
ATOM 4130  H HB2  . ALA A 1 63 ? 156.334 -0.694  8.050   1.00 0.00 ? 62 ALA A HB2  3  
ATOM 4131  H HB3  . ALA A 1 63 ? 156.306 -2.387  7.558   1.00 0.00 ? 62 ALA A HB3  3  
ATOM 4132  N N    . ILE A 1 64 ? 154.752 -2.137  10.414  1.00 0.00 ? 63 ILE A N    3  
ATOM 4133  C CA   . ILE A 1 64 ? 153.615 -1.675  11.206  1.00 0.00 ? 63 ILE A CA   3  
ATOM 4134  C C    . ILE A 1 64 ? 153.926 -1.768  12.696  1.00 0.00 ? 63 ILE A C    3  
ATOM 4135  O O    . ILE A 1 64 ? 153.620 -0.852  13.459  1.00 0.00 ? 63 ILE A O    3  
ATOM 4136  C CB   . ILE A 1 64 ? 152.332 -2.484  10.907  1.00 0.00 ? 63 ILE A CB   3  
ATOM 4137  C CG1  . ILE A 1 64 ? 152.073 -2.546  9.398   1.00 0.00 ? 63 ILE A CG1  3  
ATOM 4138  C CG2  . ILE A 1 64 ? 151.137 -1.872  11.628  1.00 0.00 ? 63 ILE A CG2  3  
ATOM 4139  C CD1  . ILE A 1 64 ? 151.994 -1.186  8.736   1.00 0.00 ? 63 ILE A CD1  3  
ATOM 4140  H H    . ILE A 1 64 ? 154.669 -2.961  9.889   1.00 0.00 ? 63 ILE A H    3  
ATOM 4141  H HA   . ILE A 1 64 ? 153.431 -0.641  10.951  1.00 0.00 ? 63 ILE A HA   3  
ATOM 4142  H HB   . ILE A 1 64 ? 152.470 -3.488  11.282  1.00 0.00 ? 63 ILE A HB   3  
ATOM 4143  H HG12 . ILE A 1 64 ? 152.872 -3.097  8.926   1.00 0.00 ? 63 ILE A HG12 3  
ATOM 4144  H HG13 . ILE A 1 64 ? 151.138 -3.057  9.221   1.00 0.00 ? 63 ILE A HG13 3  
ATOM 4145  H HG21 . ILE A 1 64 ? 151.166 -2.147  12.672  1.00 0.00 ? 63 ILE A HG21 3  
ATOM 4146  H HG22 . ILE A 1 64 ? 150.222 -2.236  11.185  1.00 0.00 ? 63 ILE A HG22 3  
ATOM 4147  H HG23 . ILE A 1 64 ? 151.176 -0.796  11.538  1.00 0.00 ? 63 ILE A HG23 3  
ATOM 4148  H HD11 . ILE A 1 64 ? 152.991 -0.793  8.599   1.00 0.00 ? 63 ILE A HD11 3  
ATOM 4149  H HD12 . ILE A 1 64 ? 151.425 -0.513  9.360   1.00 0.00 ? 63 ILE A HD12 3  
ATOM 4150  H HD13 . ILE A 1 64 ? 151.510 -1.281  7.775   1.00 0.00 ? 63 ILE A HD13 3  
ATOM 4151  N N    . ASP A 1 65 ? 154.545 -2.878  13.101  1.00 0.00 ? 64 ASP A N    3  
ATOM 4152  C CA   . ASP A 1 65 ? 154.907 -3.088  14.500  1.00 0.00 ? 64 ASP A CA   3  
ATOM 4153  C C    . ASP A 1 65 ? 155.838 -1.983  14.996  1.00 0.00 ? 64 ASP A C    3  
ATOM 4154  O O    . ASP A 1 65 ? 155.646 -1.443  16.087  1.00 0.00 ? 64 ASP A O    3  
ATOM 4155  C CB   . ASP A 1 65 ? 155.577 -4.453  14.683  1.00 0.00 ? 64 ASP A CB   3  
ATOM 4156  C CG   . ASP A 1 65 ? 155.250 -5.084  16.023  1.00 0.00 ? 64 ASP A CG   3  
ATOM 4157  O OD1  . ASP A 1 65 ? 155.736 -4.572  17.055  1.00 0.00 ? 64 ASP A OD1  3  
ATOM 4158  O OD2  . ASP A 1 65 ? 154.510 -6.089  16.040  1.00 0.00 ? 64 ASP A OD2  3  
ATOM 4159  H H    . ASP A 1 65 ? 154.767 -3.569  12.441  1.00 0.00 ? 64 ASP A H    3  
ATOM 4160  H HA   . ASP A 1 65 ? 153.998 -3.063  15.082  1.00 0.00 ? 64 ASP A HA   3  
ATOM 4161  H HB2  . ASP A 1 65 ? 155.242 -5.119  13.901  1.00 0.00 ? 64 ASP A HB2  3  
ATOM 4162  H HB3  . ASP A 1 65 ? 156.648 -4.334  14.613  1.00 0.00 ? 64 ASP A HB3  3  
ATOM 4163  N N    . ILE A 1 66 ? 156.846 -1.650  14.189  1.00 0.00 ? 65 ILE A N    3  
ATOM 4164  C CA   . ILE A 1 66 ? 157.803 -0.606  14.550  1.00 0.00 ? 65 ILE A CA   3  
ATOM 4165  C C    . ILE A 1 66 ? 157.123 0.763   14.616  1.00 0.00 ? 65 ILE A C    3  
ATOM 4166  O O    . ILE A 1 66 ? 157.349 1.531   15.552  1.00 0.00 ? 65 ILE A O    3  
ATOM 4167  C CB   . ILE A 1 66 ? 158.987 -0.536  13.556  1.00 0.00 ? 65 ILE A CB   3  
ATOM 4168  C CG1  . ILE A 1 66 ? 159.642 -1.914  13.393  1.00 0.00 ? 65 ILE A CG1  3  
ATOM 4169  C CG2  . ILE A 1 66 ? 160.013 0.487   14.025  1.00 0.00 ? 65 ILE A CG2  3  
ATOM 4170  C CD1  . ILE A 1 66 ? 160.272 -2.129  12.032  1.00 0.00 ? 65 ILE A CD1  3  
ATOM 4171  H H    . ILE A 1 66 ? 156.945 -2.114  13.330  1.00 0.00 ? 65 ILE A H    3  
ATOM 4172  H HA   . ILE A 1 66 ? 158.196 -0.844  15.528  1.00 0.00 ? 65 ILE A HA   3  
ATOM 4173  H HB   . ILE A 1 66 ? 158.605 -0.212  12.599  1.00 0.00 ? 65 ILE A HB   3  
ATOM 4174  H HG12 . ILE A 1 66 ? 160.416 -2.028  14.137  1.00 0.00 ? 65 ILE A HG12 3  
ATOM 4175  H HG13 . ILE A 1 66 ? 158.896 -2.681  13.537  1.00 0.00 ? 65 ILE A HG13 3  
ATOM 4176  H HG21 . ILE A 1 66 ? 160.971 0.271   13.573  1.00 0.00 ? 65 ILE A HG21 3  
ATOM 4177  H HG22 . ILE A 1 66 ? 160.104 0.439   15.101  1.00 0.00 ? 65 ILE A HG22 3  
ATOM 4178  H HG23 . ILE A 1 66 ? 159.693 1.476   13.736  1.00 0.00 ? 65 ILE A HG23 3  
ATOM 4179  H HD11 . ILE A 1 66 ? 159.497 -2.212  11.285  1.00 0.00 ? 65 ILE A HD11 3  
ATOM 4180  H HD12 . ILE A 1 66 ? 160.858 -3.036  12.046  1.00 0.00 ? 65 ILE A HD12 3  
ATOM 4181  H HD13 . ILE A 1 66 ? 160.912 -1.292  11.795  1.00 0.00 ? 65 ILE A HD13 3  
ATOM 4182  N N    . LEU A 1 67 ? 156.286 1.057   13.620  1.00 0.00 ? 66 LEU A N    3  
ATOM 4183  C CA   . LEU A 1 67 ? 155.571 2.331   13.569  1.00 0.00 ? 66 LEU A CA   3  
ATOM 4184  C C    . LEU A 1 67 ? 154.611 2.473   14.750  1.00 0.00 ? 66 LEU A C    3  
ATOM 4185  O O    . LEU A 1 67 ? 154.456 3.561   15.302  1.00 0.00 ? 66 LEU A O    3  
ATOM 4186  C CB   . LEU A 1 67 ? 154.792 2.460   12.257  1.00 0.00 ? 66 LEU A CB   3  
ATOM 4187  C CG   . LEU A 1 67 ? 154.364 3.887   11.897  1.00 0.00 ? 66 LEU A CG   3  
ATOM 4188  C CD1  . LEU A 1 67 ? 155.499 4.630   11.207  1.00 0.00 ? 66 LEU A CD1  3  
ATOM 4189  C CD2  . LEU A 1 67 ? 153.121 3.867   11.018  1.00 0.00 ? 66 LEU A CD2  3  
ATOM 4190  H H    . LEU A 1 67 ? 156.146 0.401   12.905  1.00 0.00 ? 66 LEU A H    3  
ATOM 4191  H HA   . LEU A 1 67 ? 156.304 3.123   13.620  1.00 0.00 ? 66 LEU A HA   3  
ATOM 4192  H HB2  . LEU A 1 67 ? 155.409 2.076   11.457  1.00 0.00 ? 66 LEU A HB2  3  
ATOM 4193  H HB3  . LEU A 1 67 ? 153.905 1.850   12.330  1.00 0.00 ? 66 LEU A HB3  3  
ATOM 4194  H HG   . LEU A 1 67 ? 154.123 4.421   12.805  1.00 0.00 ? 66 LEU A HG   3  
ATOM 4195  H HD11 . LEU A 1 67 ? 156.443 4.184   11.485  1.00 0.00 ? 66 LEU A HD11 3  
ATOM 4196  H HD12 . LEU A 1 67 ? 155.489 5.667   11.511  1.00 0.00 ? 66 LEU A HD12 3  
ATOM 4197  H HD13 . LEU A 1 67 ? 155.373 4.568   10.136  1.00 0.00 ? 66 LEU A HD13 3  
ATOM 4198  H HD21 . LEU A 1 67 ? 152.434 3.117   11.382  1.00 0.00 ? 66 LEU A HD21 3  
ATOM 4199  H HD22 . LEU A 1 67 ? 153.402 3.634   10.002  1.00 0.00 ? 66 LEU A HD22 3  
ATOM 4200  H HD23 . LEU A 1 67 ? 152.645 4.836   11.046  1.00 0.00 ? 66 LEU A HD23 3  
ATOM 4201  N N    . ASP A 1 68 ? 153.970 1.366   15.130  1.00 0.00 ? 67 ASP A N    3  
ATOM 4202  C CA   . ASP A 1 68 ? 153.024 1.368   16.246  1.00 0.00 ? 67 ASP A CA   3  
ATOM 4203  C C    . ASP A 1 68 ? 153.692 1.860   17.529  1.00 0.00 ? 67 ASP A C    3  
ATOM 4204  O O    . ASP A 1 68 ? 153.080 2.580   18.319  1.00 0.00 ? 67 ASP A O    3  
ATOM 4205  C CB   . ASP A 1 68 ? 152.449 -0.035  16.465  1.00 0.00 ? 67 ASP A CB   3  
ATOM 4206  C CG   . ASP A 1 68 ? 151.255 -0.032  17.402  1.00 0.00 ? 67 ASP A CG   3  
ATOM 4207  O OD1  . ASP A 1 68 ? 150.216 0.561   17.042  1.00 0.00 ? 67 ASP A OD1  3  
ATOM 4208  O OD2  . ASP A 1 68 ? 151.360 -0.625  18.496  1.00 0.00 ? 67 ASP A OD2  3  
ATOM 4209  H H    . ASP A 1 68 ? 154.135 0.529   14.647  1.00 0.00 ? 67 ASP A H    3  
ATOM 4210  H HA   . ASP A 1 68 ? 152.218 2.041   15.995  1.00 0.00 ? 67 ASP A HA   3  
ATOM 4211  H HB2  . ASP A 1 68 ? 152.136 -0.441  15.515  1.00 0.00 ? 67 ASP A HB2  3  
ATOM 4212  H HB3  . ASP A 1 68 ? 153.215 -0.669  16.888  1.00 0.00 ? 67 ASP A HB3  3  
ATOM 4213  N N    . ARG A 1 69 ? 154.952 1.472   17.725  1.00 0.00 ? 68 ARG A N    3  
ATOM 4214  C CA   . ARG A 1 69 ? 155.708 1.878   18.908  1.00 0.00 ? 68 ARG A CA   3  
ATOM 4215  C C    . ARG A 1 69 ? 156.042 3.372   18.861  1.00 0.00 ? 68 ARG A C    3  
ATOM 4216  O O    . ARG A 1 69 ? 156.131 4.027   19.900  1.00 0.00 ? 68 ARG A O    3  
ATOM 4217  C CB   . ARG A 1 69 ? 156.999 1.059   19.019  1.00 0.00 ? 68 ARG A CB   3  
ATOM 4218  C CG   . ARG A 1 69 ? 156.896 -0.134  19.959  1.00 0.00 ? 68 ARG A CG   3  
ATOM 4219  C CD   . ARG A 1 69 ? 156.371 -1.369  19.242  1.00 0.00 ? 68 ARG A CD   3  
ATOM 4220  N NE   . ARG A 1 69 ? 157.450 -2.192  18.692  1.00 0.00 ? 68 ARG A NE   3  
ATOM 4221  C CZ   . ARG A 1 69 ? 158.248 -2.973  19.427  1.00 0.00 ? 68 ARG A CZ   3  
ATOM 4222  N NH1  . ARG A 1 69 ? 158.095 -3.042  20.748  1.00 0.00 ? 68 ARG A NH1  3  
ATOM 4223  N NH2  . ARG A 1 69 ? 159.199 -3.691  18.838  1.00 0.00 ? 68 ARG A NH2  3  
ATOM 4224  H H    . ARG A 1 69 ? 155.384 0.900   17.055  1.00 0.00 ? 68 ARG A H    3  
ATOM 4225  H HA   . ARG A 1 69 ? 155.094 1.686   19.775  1.00 0.00 ? 68 ARG A HA   3  
ATOM 4226  H HB2  . ARG A 1 69 ? 157.264 0.694   18.038  1.00 0.00 ? 68 ARG A HB2  3  
ATOM 4227  H HB3  . ARG A 1 69 ? 157.788 1.704   19.378  1.00 0.00 ? 68 ARG A HB3  3  
ATOM 4228  H HG2  . ARG A 1 69 ? 157.877 -0.350  20.354  1.00 0.00 ? 68 ARG A HG2  3  
ATOM 4229  H HG3  . ARG A 1 69 ? 156.227 0.114   20.769  1.00 0.00 ? 68 ARG A HG3  3  
ATOM 4230  H HD2  . ARG A 1 69 ? 155.803 -1.961  19.944  1.00 0.00 ? 68 ARG A HD2  3  
ATOM 4231  H HD3  . ARG A 1 69 ? 155.726 -1.054  18.436  1.00 0.00 ? 68 ARG A HD3  3  
ATOM 4232  H HE   . ARG A 1 69 ? 157.585 -2.163  17.721  1.00 0.00 ? 68 ARG A HE   3  
ATOM 4233  H HH11 . ARG A 1 69 ? 157.380 -2.507  21.199  1.00 0.00 ? 68 ARG A HH11 3  
ATOM 4234  H HH12 . ARG A 1 69 ? 158.696 -3.629  21.291  1.00 0.00 ? 68 ARG A HH12 3  
ATOM 4235  H HH21 . ARG A 1 69 ? 159.318 -3.646  17.846  1.00 0.00 ? 68 ARG A HH21 3  
ATOM 4236  H HH22 . ARG A 1 69 ? 159.798 -4.276  19.387  1.00 0.00 ? 68 ARG A HH22 3  
ATOM 4237  N N    . SER A 1 70 ? 156.228 3.904   17.651  1.00 0.00 ? 69 SER A N    3  
ATOM 4238  C CA   . SER A 1 70 ? 156.554 5.319   17.472  1.00 0.00 ? 69 SER A CA   3  
ATOM 4239  C C    . SER A 1 70 ? 155.388 6.217   17.892  1.00 0.00 ? 69 SER A C    3  
ATOM 4240  O O    . SER A 1 70 ? 154.228 5.927   17.592  1.00 0.00 ? 69 SER A O    3  
ATOM 4241  C CB   . SER A 1 70 ? 156.922 5.597   16.011  1.00 0.00 ? 69 SER A CB   3  
ATOM 4242  O OG   . SER A 1 70 ? 157.369 6.932   15.839  1.00 0.00 ? 69 SER A OG   3  
ATOM 4243  H H    . SER A 1 70 ? 156.146 3.331   16.860  1.00 0.00 ? 69 SER A H    3  
ATOM 4244  H HA   . SER A 1 70 ? 157.406 5.541   18.096  1.00 0.00 ? 69 SER A HA   3  
ATOM 4245  H HB2  . SER A 1 70 ? 157.711 4.925   15.707  1.00 0.00 ? 69 SER A HB2  3  
ATOM 4246  H HB3  . SER A 1 70 ? 156.055 5.438   15.387  1.00 0.00 ? 69 SER A HB3  3  
ATOM 4247  H HG   . SER A 1 70 ? 156.671 7.456   15.436  1.00 0.00 ? 69 SER A HG   3  
ATOM 4248  N N    . SER A 1 71 ? 155.709 7.312   18.583  1.00 0.00 ? 70 SER A N    3  
ATOM 4249  C CA   . SER A 1 71 ? 154.694 8.263   19.043  1.00 0.00 ? 70 SER A CA   3  
ATOM 4250  C C    . SER A 1 71 ? 154.180 9.132   17.893  1.00 0.00 ? 70 SER A C    3  
ATOM 4251  O O    . SER A 1 71 ? 153.002 9.489   17.858  1.00 0.00 ? 70 SER A O    3  
ATOM 4252  C CB   . SER A 1 71 ? 155.263 9.155   20.151  1.00 0.00 ? 70 SER A CB   3  
ATOM 4253  O OG   . SER A 1 71 ? 155.382 8.441   21.371  1.00 0.00 ? 70 SER A OG   3  
ATOM 4254  H H    . SER A 1 71 ? 156.651 7.487   18.786  1.00 0.00 ? 70 SER A H    3  
ATOM 4255  H HA   . SER A 1 71 ? 153.868 7.694   19.444  1.00 0.00 ? 70 SER A HA   3  
ATOM 4256  H HB2  . SER A 1 71 ? 156.241 9.509   19.859  1.00 0.00 ? 70 SER A HB2  3  
ATOM 4257  H HB3  . SER A 1 71 ? 154.606 9.998   20.304  1.00 0.00 ? 70 SER A HB3  3  
ATOM 4258  H HG   . SER A 1 71 ? 156.166 7.890   21.344  1.00 0.00 ? 70 SER A HG   3  
ATOM 4259  N N    . SER A 1 72 ? 155.070 9.471   16.955  1.00 0.00 ? 71 SER A N    3  
ATOM 4260  C CA   . SER A 1 72 ? 154.704 10.302  15.806  1.00 0.00 ? 71 SER A CA   3  
ATOM 4261  C C    . SER A 1 72 ? 154.381 9.448   14.578  1.00 0.00 ? 71 SER A C    3  
ATOM 4262  O O    . SER A 1 72 ? 154.710 9.821   13.450  1.00 0.00 ? 71 SER A O    3  
ATOM 4263  C CB   . SER A 1 72 ? 155.839 11.280  15.477  1.00 0.00 ? 71 SER A CB   3  
ATOM 4264  O OG   . SER A 1 72 ? 156.929 10.620  14.846  1.00 0.00 ? 71 SER A OG   3  
ATOM 4265  H H    . SER A 1 72 ? 155.994 9.159   17.040  1.00 0.00 ? 71 SER A H    3  
ATOM 4266  H HA   . SER A 1 72 ? 153.823 10.867  16.074  1.00 0.00 ? 71 SER A HA   3  
ATOM 4267  H HB2  . SER A 1 72 ? 155.466 12.045  14.812  1.00 0.00 ? 71 SER A HB2  3  
ATOM 4268  H HB3  . SER A 1 72 ? 156.192 11.738  16.389  1.00 0.00 ? 71 SER A HB3  3  
ATOM 4269  H HG   . SER A 1 72 ? 157.094 9.780   15.281  1.00 0.00 ? 71 SER A HG   3  
ATOM 4270  N N    . MET A 1 73 ? 153.736 8.303   14.798  1.00 0.00 ? 72 MET A N    3  
ATOM 4271  C CA   . MET A 1 73 ? 153.376 7.410   13.700  1.00 0.00 ? 72 MET A CA   3  
ATOM 4272  C C    . MET A 1 73 ? 152.419 8.102   12.730  1.00 0.00 ? 72 MET A C    3  
ATOM 4273  O O    . MET A 1 73 ? 151.238 8.281   13.030  1.00 0.00 ? 72 MET A O    3  
ATOM 4274  C CB   . MET A 1 73 ? 152.751 6.113   14.233  1.00 0.00 ? 72 MET A CB   3  
ATOM 4275  C CG   . MET A 1 73 ? 151.577 6.322   15.179  1.00 0.00 ? 72 MET A CG   3  
ATOM 4276  S SD   . MET A 1 73 ? 150.019 5.745   14.478  1.00 0.00 ? 72 MET A SD   3  
ATOM 4277  C CE   . MET A 1 73 ? 148.843 6.465   15.618  1.00 0.00 ? 72 MET A CE   3  
ATOM 4278  H H    . MET A 1 73 ? 153.498 8.056   15.714  1.00 0.00 ? 72 MET A H    3  
ATOM 4279  H HA   . MET A 1 73 ? 154.284 7.165   13.169  1.00 0.00 ? 72 MET A HA   3  
ATOM 4280  H HB2  . MET A 1 73 ? 152.404 5.528   13.395  1.00 0.00 ? 72 MET A HB2  3  
ATOM 4281  H HB3  . MET A 1 73 ? 153.511 5.553   14.757  1.00 0.00 ? 72 MET A HB3  3  
ATOM 4282  H HG2  . MET A 1 73 ? 151.768 5.778   16.093  1.00 0.00 ? 72 MET A HG2  3  
ATOM 4283  H HG3  . MET A 1 73 ? 151.489 7.375   15.400  1.00 0.00 ? 72 MET A HG3  3  
ATOM 4284  H HE1  . MET A 1 73 ? 149.350 7.166   16.264  1.00 0.00 ? 72 MET A HE1  3  
ATOM 4285  H HE2  . MET A 1 73 ? 148.397 5.684   16.216  1.00 0.00 ? 72 MET A HE2  3  
ATOM 4286  H HE3  . MET A 1 73 ? 148.072 6.978   15.062  1.00 0.00 ? 72 MET A HE3  3  
ATOM 4287  N N    . LYS A 1 74 ? 152.944 8.493   11.565  1.00 0.00 ? 73 LYS A N    3  
ATOM 4288  C CA   . LYS A 1 74 ? 152.148 9.169   10.543  1.00 0.00 ? 73 LYS A CA   3  
ATOM 4289  C C    . LYS A 1 74 ? 152.150 8.367   9.243   1.00 0.00 ? 73 LYS A C    3  
ATOM 4290  O O    . LYS A 1 74 ? 152.985 8.589   8.364   1.00 0.00 ? 73 LYS A O    3  
ATOM 4291  C CB   . LYS A 1 74 ? 152.676 10.592  10.304  1.00 0.00 ? 73 LYS A CB   3  
ATOM 4292  C CG   . LYS A 1 74 ? 154.132 10.655  9.848   1.00 0.00 ? 73 LYS A CG   3  
ATOM 4293  C CD   . LYS A 1 74 ? 155.013 11.357  10.872  1.00 0.00 ? 73 LYS A CD   3  
ATOM 4294  C CE   . LYS A 1 74 ? 156.061 12.242  10.209  1.00 0.00 ? 73 LYS A CE   3  
ATOM 4295  N NZ   . LYS A 1 74 ? 155.467 13.474  9.615   1.00 0.00 ? 73 LYS A NZ   3  
ATOM 4296  H H    . LYS A 1 74 ? 153.894 8.324   11.391  1.00 0.00 ? 73 LYS A H    3  
ATOM 4297  H HA   . LYS A 1 74 ? 151.132 9.232   10.906  1.00 0.00 ? 73 LYS A HA   3  
ATOM 4298  H HB2  . LYS A 1 74 ? 152.067 11.064  9.548   1.00 0.00 ? 73 LYS A HB2  3  
ATOM 4299  H HB3  . LYS A 1 74 ? 152.586 11.151  11.223  1.00 0.00 ? 73 LYS A HB3  3  
ATOM 4300  H HG2  . LYS A 1 74 ? 154.499 9.650   9.703   1.00 0.00 ? 73 LYS A HG2  3  
ATOM 4301  H HG3  . LYS A 1 74 ? 154.182 11.195  8.913   1.00 0.00 ? 73 LYS A HG3  3  
ATOM 4302  H HD2  . LYS A 1 74 ? 154.391 11.967  11.508  1.00 0.00 ? 73 LYS A HD2  3  
ATOM 4303  H HD3  . LYS A 1 74 ? 155.515 10.609  11.470  1.00 0.00 ? 73 LYS A HD3  3  
ATOM 4304  H HE2  . LYS A 1 74 ? 156.789 12.531  10.953  1.00 0.00 ? 73 LYS A HE2  3  
ATOM 4305  H HE3  . LYS A 1 74 ? 156.551 11.676  9.430   1.00 0.00 ? 73 LYS A HE3  3  
ATOM 4306  H HZ1  . LYS A 1 74 ? 154.529 13.265  9.217   1.00 0.00 ? 73 LYS A HZ1  3  
ATOM 4307  H HZ2  . LYS A 1 74 ? 156.079 13.836  8.857   1.00 0.00 ? 73 LYS A HZ2  3  
ATOM 4308  H HZ3  . LYS A 1 74 ? 155.366 14.209  10.344  1.00 0.00 ? 73 LYS A HZ3  3  
ATOM 4309  N N    . SER A 1 75 ? 151.213 7.422   9.143   1.00 0.00 ? 74 SER A N    3  
ATOM 4310  C CA   . SER A 1 75 ? 151.086 6.554   7.966   1.00 0.00 ? 74 SER A CA   3  
ATOM 4311  C C    . SER A 1 75 ? 152.402 5.821   7.665   1.00 0.00 ? 74 SER A C    3  
ATOM 4312  O O    . SER A 1 75 ? 153.357 5.897   8.439   1.00 0.00 ? 74 SER A O    3  
ATOM 4313  C CB   . SER A 1 75 ? 150.627 7.362   6.741   1.00 0.00 ? 74 SER A CB   3  
ATOM 4314  O OG   . SER A 1 75 ? 151.706 8.061   6.136   1.00 0.00 ? 74 SER A OG   3  
ATOM 4315  H H    . SER A 1 75 ? 150.590 7.297   9.887   1.00 0.00 ? 74 SER A H    3  
ATOM 4316  H HA   . SER A 1 75 ? 150.331 5.816   8.193   1.00 0.00 ? 74 SER A HA   3  
ATOM 4317  H HB2  . SER A 1 75 ? 150.202 6.688   6.012   1.00 0.00 ? 74 SER A HB2  3  
ATOM 4318  H HB3  . SER A 1 75 ? 149.876 8.077   7.046   1.00 0.00 ? 74 SER A HB3  3  
ATOM 4319  H HG   . SER A 1 75 ? 152.160 7.479   5.521   1.00 0.00 ? 74 SER A HG   3  
ATOM 4320  N N    . LEU A 1 76 ? 152.442 5.101   6.540   1.00 0.00 ? 75 LEU A N    3  
ATOM 4321  C CA   . LEU A 1 76 ? 153.638 4.356   6.148   1.00 0.00 ? 75 LEU A CA   3  
ATOM 4322  C C    . LEU A 1 76 ? 154.267 4.951   4.891   1.00 0.00 ? 75 LEU A C    3  
ATOM 4323  O O    . LEU A 1 76 ? 153.580 5.182   3.892   1.00 0.00 ? 75 LEU A O    3  
ATOM 4324  C CB   . LEU A 1 76 ? 153.298 2.881   5.910   1.00 0.00 ? 75 LEU A CB   3  
ATOM 4325  C CG   . LEU A 1 76 ? 153.365 1.981   7.148   1.00 0.00 ? 75 LEU A CG   3  
ATOM 4326  C CD1  . LEU A 1 76 ? 154.719 2.103   7.832   1.00 0.00 ? 75 LEU A CD1  3  
ATOM 4327  C CD2  . LEU A 1 76 ? 152.239 2.317   8.117   1.00 0.00 ? 75 LEU A CD2  3  
ATOM 4328  H H    . LEU A 1 76 ? 151.650 5.068   5.963   1.00 0.00 ? 75 LEU A H    3  
ATOM 4329  H HA   . LEU A 1 76 ? 154.350 4.425   6.957   1.00 0.00 ? 75 LEU A HA   3  
ATOM 4330  H HB2  . LEU A 1 76 ? 152.298 2.826   5.503   1.00 0.00 ? 75 LEU A HB2  3  
ATOM 4331  H HB3  . LEU A 1 76 ? 153.987 2.492   5.174   1.00 0.00 ? 75 LEU A HB3  3  
ATOM 4332  H HG   . LEU A 1 76 ? 153.243 0.953   6.839   1.00 0.00 ? 75 LEU A HG   3  
ATOM 4333  H HD11 . LEU A 1 76 ? 155.483 2.279   7.089   1.00 0.00 ? 75 LEU A HD11 3  
ATOM 4334  H HD12 . LEU A 1 76 ? 154.938 1.188   8.362   1.00 0.00 ? 75 LEU A HD12 3  
ATOM 4335  H HD13 . LEU A 1 76 ? 154.699 2.927   8.530   1.00 0.00 ? 75 LEU A HD13 3  
ATOM 4336  H HD21 . LEU A 1 76 ? 152.345 1.720   9.011   1.00 0.00 ? 75 LEU A HD21 3  
ATOM 4337  H HD22 . LEU A 1 76 ? 151.288 2.102   7.653   1.00 0.00 ? 75 LEU A HD22 3  
ATOM 4338  H HD23 . LEU A 1 76 ? 152.285 3.364   8.377   1.00 0.00 ? 75 LEU A HD23 3  
ATOM 4339  N N    . ARG A 1 77 ? 155.576 5.194   4.946   1.00 0.00 ? 76 ARG A N    3  
ATOM 4340  C CA   . ARG A 1 77 ? 156.300 5.760   3.811   1.00 0.00 ? 76 ARG A CA   3  
ATOM 4341  C C    . ARG A 1 77 ? 156.898 4.656   2.940   1.00 0.00 ? 76 ARG A C    3  
ATOM 4342  O O    . ARG A 1 77 ? 157.869 4.001   3.330   1.00 0.00 ? 76 ARG A O    3  
ATOM 4343  C CB   . ARG A 1 77 ? 157.407 6.701   4.295   1.00 0.00 ? 76 ARG A CB   3  
ATOM 4344  C CG   . ARG A 1 77 ? 156.913 8.091   4.666   1.00 0.00 ? 76 ARG A CG   3  
ATOM 4345  C CD   . ARG A 1 77 ? 157.948 8.850   5.484   1.00 0.00 ? 76 ARG A CD   3  
ATOM 4346  N NE   . ARG A 1 77 ? 158.936 9.522   4.639   1.00 0.00 ? 76 ARG A NE   3  
ATOM 4347  C CZ   . ARG A 1 77 ? 160.119 9.958   5.078   1.00 0.00 ? 76 ARG A CZ   3  
ATOM 4348  N NH1  . ARG A 1 77 ? 160.468 9.795   6.351   1.00 0.00 ? 76 ARG A NH1  3  
ATOM 4349  N NH2  . ARG A 1 77 ? 160.958 10.560  4.241   1.00 0.00 ? 76 ARG A NH2  3  
ATOM 4350  H H    . ARG A 1 77 ? 156.067 4.987   5.769   1.00 0.00 ? 76 ARG A H    3  
ATOM 4351  H HA   . ARG A 1 77 ? 155.595 6.324   3.218   1.00 0.00 ? 76 ARG A HA   3  
ATOM 4352  H HB2  . ARG A 1 77 ? 157.878 6.266   5.165   1.00 0.00 ? 76 ARG A HB2  3  
ATOM 4353  H HB3  . ARG A 1 77 ? 158.144 6.802   3.512   1.00 0.00 ? 76 ARG A HB3  3  
ATOM 4354  H HG2  . ARG A 1 77 ? 156.709 8.644   3.760   1.00 0.00 ? 76 ARG A HG2  3  
ATOM 4355  H HG3  . ARG A 1 77 ? 156.006 7.999   5.245   1.00 0.00 ? 76 ARG A HG3  3  
ATOM 4356  H HD2  . ARG A 1 77 ? 157.441 9.589   6.086   1.00 0.00 ? 76 ARG A HD2  3  
ATOM 4357  H HD3  . ARG A 1 77 ? 158.458 8.149   6.130   1.00 0.00 ? 76 ARG A HD3  3  
ATOM 4358  H HE   . ARG A 1 77 ? 158.706 9.657   3.695   1.00 0.00 ? 76 ARG A HE   3  
ATOM 4359  H HH11 . ARG A 1 77 ? 159.844 9.344   6.989   1.00 0.00 ? 76 ARG A HH11 3  
ATOM 4360  H HH12 . ARG A 1 77 ? 161.357 10.123  6.672   1.00 0.00 ? 76 ARG A HH12 3  
ATOM 4361  H HH21 . ARG A 1 77 ? 160.703 10.687  3.282   1.00 0.00 ? 76 ARG A HH21 3  
ATOM 4362  H HH22 . ARG A 1 77 ? 161.845 10.886  4.570   1.00 0.00 ? 76 ARG A HH22 3  
ATOM 4363  N N    . ILE A 1 78 ? 156.313 4.457   1.759   1.00 0.00 ? 77 ILE A N    3  
ATOM 4364  C CA   . ILE A 1 78 ? 156.786 3.438   0.827   1.00 0.00 ? 77 ILE A CA   3  
ATOM 4365  C C    . ILE A 1 78 ? 156.987 4.030   -0.566  1.00 0.00 ? 77 ILE A C    3  
ATOM 4366  O O    . ILE A 1 78 ? 156.110 4.719   -1.091  1.00 0.00 ? 77 ILE A O    3  
ATOM 4367  C CB   . ILE A 1 78 ? 155.802 2.245   0.738   1.00 0.00 ? 77 ILE A CB   3  
ATOM 4368  C CG1  . ILE A 1 78 ? 155.415 1.760   2.141   1.00 0.00 ? 77 ILE A CG1  3  
ATOM 4369  C CG2  . ILE A 1 78 ? 156.413 1.106   -0.070  1.00 0.00 ? 77 ILE A CG2  3  
ATOM 4370  C CD1  . ILE A 1 78 ? 154.412 0.625   2.137   1.00 0.00 ? 77 ILE A CD1  3  
ATOM 4371  H H    . ILE A 1 78 ? 155.546 5.013   1.507   1.00 0.00 ? 77 ILE A H    3  
ATOM 4372  H HA   . ILE A 1 78 ? 157.735 3.069   1.190   1.00 0.00 ? 77 ILE A HA   3  
ATOM 4373  H HB   . ILE A 1 78 ? 154.913 2.580   0.224   1.00 0.00 ? 77 ILE A HB   3  
ATOM 4374  H HG12 . ILE A 1 78 ? 156.300 1.417   2.654   1.00 0.00 ? 77 ILE A HG12 3  
ATOM 4375  H HG13 . ILE A 1 78 ? 154.982 2.583   2.692   1.00 0.00 ? 77 ILE A HG13 3  
ATOM 4376  H HG21 . ILE A 1 78 ? 155.742 0.260   -0.062  1.00 0.00 ? 77 ILE A HG21 3  
ATOM 4377  H HG22 . ILE A 1 78 ? 157.358 0.820   0.367   1.00 0.00 ? 77 ILE A HG22 3  
ATOM 4378  H HG23 . ILE A 1 78 ? 156.571 1.430   -1.088  1.00 0.00 ? 77 ILE A HG23 3  
ATOM 4379  H HD11 . ILE A 1 78 ? 154.086 0.435   1.124   1.00 0.00 ? 77 ILE A HD11 3  
ATOM 4380  H HD12 . ILE A 1 78 ? 153.561 0.894   2.745   1.00 0.00 ? 77 ILE A HD12 3  
ATOM 4381  H HD13 . ILE A 1 78 ? 154.874 -0.265  2.538   1.00 0.00 ? 77 ILE A HD13 3  
ATOM 4382  N N    . LEU A 1 79 ? 158.149 3.757   -1.156  1.00 0.00 ? 78 LEU A N    3  
ATOM 4383  C CA   . LEU A 1 79 ? 158.476 4.255   -2.487  1.00 0.00 ? 78 LEU A CA   3  
ATOM 4384  C C    . LEU A 1 79 ? 158.296 3.155   -3.525  1.00 0.00 ? 78 LEU A C    3  
ATOM 4385  O O    . LEU A 1 79 ? 158.957 2.118   -3.461  1.00 0.00 ? 78 LEU A O    3  
ATOM 4386  C CB   . LEU A 1 79 ? 159.918 4.777   -2.522  1.00 0.00 ? 78 LEU A CB   3  
ATOM 4387  C CG   . LEU A 1 79 ? 160.103 6.164   -3.147  1.00 0.00 ? 78 LEU A CG   3  
ATOM 4388  C CD1  . LEU A 1 79 ? 159.571 6.191   -4.574  1.00 0.00 ? 78 LEU A CD1  3  
ATOM 4389  C CD2  . LEU A 1 79 ? 159.419 7.228   -2.299  1.00 0.00 ? 78 LEU A CD2  3  
ATOM 4390  H H    . LEU A 1 79 ? 158.804 3.200   -0.683  1.00 0.00 ? 78 LEU A H    3  
ATOM 4391  H HA   . LEU A 1 79 ? 157.800 5.068   -2.715  1.00 0.00 ? 78 LEU A HA   3  
ATOM 4392  H HB2  . LEU A 1 79 ? 160.289 4.812   -1.508  1.00 0.00 ? 78 LEU A HB2  3  
ATOM 4393  H HB3  . LEU A 1 79 ? 160.519 4.074   -3.080  1.00 0.00 ? 78 LEU A HB3  3  
ATOM 4394  H HG   . LEU A 1 79 ? 161.157 6.394   -3.183  1.00 0.00 ? 78 LEU A HG   3  
ATOM 4395  H HD11 . LEU A 1 79 ? 159.806 7.143   -5.026  1.00 0.00 ? 78 LEU A HD11 3  
ATOM 4396  H HD12 . LEU A 1 79 ? 158.501 6.051   -4.564  1.00 0.00 ? 78 LEU A HD12 3  
ATOM 4397  H HD13 . LEU A 1 79 ? 160.033 5.399   -5.145  1.00 0.00 ? 78 LEU A HD13 3  
ATOM 4398  H HD21 . LEU A 1 79 ? 159.846 7.227   -1.307  1.00 0.00 ? 78 LEU A HD21 3  
ATOM 4399  H HD22 . LEU A 1 79 ? 158.362 7.015   -2.237  1.00 0.00 ? 78 LEU A HD22 3  
ATOM 4400  H HD23 . LEU A 1 79 ? 159.564 8.198   -2.752  1.00 0.00 ? 78 LEU A HD23 3  
ATOM 4401  N N    . LEU A 1 80 ? 157.395 3.386   -4.474  1.00 0.00 ? 79 LEU A N    3  
ATOM 4402  C CA   . LEU A 1 80 ? 157.123 2.410   -5.524  1.00 0.00 ? 79 LEU A CA   3  
ATOM 4403  C C    . LEU A 1 80 ? 157.410 2.996   -6.903  1.00 0.00 ? 79 LEU A C    3  
ATOM 4404  O O    . LEU A 1 80 ? 156.940 4.085   -7.237  1.00 0.00 ? 79 LEU A O    3  
ATOM 4405  C CB   . LEU A 1 80 ? 155.670 1.929   -5.449  1.00 0.00 ? 79 LEU A CB   3  
ATOM 4406  C CG   . LEU A 1 80 ? 154.624 3.031   -5.256  1.00 0.00 ? 79 LEU A CG   3  
ATOM 4407  C CD1  . LEU A 1 80 ? 153.327 2.664   -5.961  1.00 0.00 ? 79 LEU A CD1  3  
ATOM 4408  C CD2  . LEU A 1 80 ? 154.377 3.277   -3.775  1.00 0.00 ? 79 LEU A CD2  3  
ATOM 4409  H H    . LEU A 1 80 ? 156.898 4.232   -4.469  1.00 0.00 ? 79 LEU A H    3  
ATOM 4410  H HA   . LEU A 1 80 ? 157.778 1.566   -5.364  1.00 0.00 ? 79 LEU A HA   3  
ATOM 4411  H HB2  . LEU A 1 80 ? 155.442 1.402   -6.364  1.00 0.00 ? 79 LEU A HB2  3  
ATOM 4412  H HB3  . LEU A 1 80 ? 155.586 1.236   -4.625  1.00 0.00 ? 79 LEU A HB3  3  
ATOM 4413  H HG   . LEU A 1 80 ? 154.993 3.948   -5.692  1.00 0.00 ? 79 LEU A HG   3  
ATOM 4414  H HD11 . LEU A 1 80 ? 152.976 1.710   -5.597  1.00 0.00 ? 79 LEU A HD11 3  
ATOM 4415  H HD12 . LEU A 1 80 ? 153.502 2.600   -7.025  1.00 0.00 ? 79 LEU A HD12 3  
ATOM 4416  H HD13 . LEU A 1 80 ? 152.584 3.422   -5.764  1.00 0.00 ? 79 LEU A HD13 3  
ATOM 4417  H HD21 . LEU A 1 80 ? 153.900 2.412   -3.340  1.00 0.00 ? 79 LEU A HD21 3  
ATOM 4418  H HD22 . LEU A 1 80 ? 153.737 4.139   -3.656  1.00 0.00 ? 79 LEU A HD22 3  
ATOM 4419  H HD23 . LEU A 1 80 ? 155.318 3.458   -3.277  1.00 0.00 ? 79 LEU A HD23 3  
ATOM 4420  N N    . LEU A 1 81 ? 158.183 2.261   -7.700  1.00 0.00 ? 80 LEU A N    3  
ATOM 4421  C CA   . LEU A 1 81 ? 158.539 2.696   -9.048  1.00 0.00 ? 80 LEU A CA   3  
ATOM 4422  C C    . LEU A 1 81 ? 158.622 1.501   -9.995  1.00 0.00 ? 80 LEU A C    3  
ATOM 4423  O O    . LEU A 1 81 ? 158.992 0.399   -9.585  1.00 0.00 ? 80 LEU A O    3  
ATOM 4424  C CB   . LEU A 1 81 ? 159.872 3.450   -9.033  1.00 0.00 ? 80 LEU A CB   3  
ATOM 4425  C CG   . LEU A 1 81 ? 161.056 2.682   -8.435  1.00 0.00 ? 80 LEU A CG   3  
ATOM 4426  C CD1  . LEU A 1 81 ? 162.308 2.901   -9.271  1.00 0.00 ? 80 LEU A CD1  3  
ATOM 4427  C CD2  . LEU A 1 81 ? 161.294 3.106   -6.992  1.00 0.00 ? 80 LEU A CD2  3  
ATOM 4428  H H    . LEU A 1 81 ? 158.523 1.402   -7.374  1.00 0.00 ? 80 LEU A H    3  
ATOM 4429  H HA   . LEU A 1 81 ? 157.764 3.361   -9.396  1.00 0.00 ? 80 LEU A HA   3  
ATOM 4430  H HB2  . LEU A 1 81 ? 160.120 3.716   -10.051 1.00 0.00 ? 80 LEU A HB2  3  
ATOM 4431  H HB3  . LEU A 1 81 ? 159.740 4.360   -8.466  1.00 0.00 ? 80 LEU A HB3  3  
ATOM 4432  H HG   . LEU A 1 81 ? 160.832 1.625   -8.442  1.00 0.00 ? 80 LEU A HG   3  
ATOM 4433  H HD11 . LEU A 1 81 ? 162.216 3.828   -9.818  1.00 0.00 ? 80 LEU A HD11 3  
ATOM 4434  H HD12 . LEU A 1 81 ? 162.424 2.084   -9.966  1.00 0.00 ? 80 LEU A HD12 3  
ATOM 4435  H HD13 . LEU A 1 81 ? 163.171 2.949   -8.624  1.00 0.00 ? 80 LEU A HD13 3  
ATOM 4436  H HD21 . LEU A 1 81 ? 161.807 2.316   -6.463  1.00 0.00 ? 80 LEU A HD21 3  
ATOM 4437  H HD22 . LEU A 1 81 ? 160.346 3.302   -6.512  1.00 0.00 ? 80 LEU A HD22 3  
ATOM 4438  H HD23 . LEU A 1 81 ? 161.898 4.002   -6.974  1.00 0.00 ? 80 LEU A HD23 3  
ATOM 4439  N N    . SER A 1 82 ? 158.271 1.726   -11.263 1.00 0.00 ? 81 SER A N    3  
ATOM 4440  C CA   . SER A 1 82 ? 158.302 0.669   -12.275 1.00 0.00 ? 81 SER A CA   3  
ATOM 4441  C C    . SER A 1 82 ? 159.739 0.237   -12.565 1.00 0.00 ? 81 SER A C    3  
ATOM 4442  O O    . SER A 1 82 ? 160.355 0.687   -13.533 1.00 0.00 ? 81 SER A O    3  
ATOM 4443  C CB   . SER A 1 82 ? 157.623 1.145   -13.564 1.00 0.00 ? 81 SER A CB   3  
ATOM 4444  O OG   . SER A 1 82 ? 157.662 2.559   -13.675 1.00 0.00 ? 81 SER A OG   3  
ATOM 4445  H H    . SER A 1 82 ? 157.982 2.625   -11.524 1.00 0.00 ? 81 SER A H    3  
ATOM 4446  H HA   . SER A 1 82 ? 157.758 -0.178  -11.884 1.00 0.00 ? 81 SER A HA   3  
ATOM 4447  H HB2  . SER A 1 82 ? 158.131 0.717   -14.415 1.00 0.00 ? 81 SER A HB2  3  
ATOM 4448  H HB3  . SER A 1 82 ? 156.592 0.825   -13.563 1.00 0.00 ? 81 SER A HB3  3  
ATOM 4449  H HG   . SER A 1 82 ? 156.768 2.901   -13.738 1.00 0.00 ? 81 SER A HG   3  
ATOM 4450  N N    . GLN A 1 83 ? 160.263 -0.636  -11.710 1.00 0.00 ? 82 GLN A N    3  
ATOM 4451  C CA   . GLN A 1 83 ? 161.625 -1.135  -11.851 1.00 0.00 ? 82 GLN A CA   3  
ATOM 4452  C C    . GLN A 1 83 ? 161.750 -2.531  -11.236 1.00 0.00 ? 82 GLN A C    3  
ATOM 4453  O O    . GLN A 1 83 ? 162.711 -2.825  -10.521 1.00 0.00 ? 82 GLN A O    3  
ATOM 4454  C CB   . GLN A 1 83 ? 162.601 -0.165  -11.183 1.00 0.00 ? 82 GLN A CB   3  
ATOM 4455  C CG   . GLN A 1 83 ? 164.062 -0.462  -11.473 1.00 0.00 ? 82 GLN A CG   3  
ATOM 4456  C CD   . GLN A 1 83 ? 164.934 -0.327  -10.240 1.00 0.00 ? 82 GLN A CD   3  
ATOM 4457  O OE1  . GLN A 1 83 ? 165.895 0.443   -10.225 1.00 0.00 ? 82 GLN A OE1  3  
ATOM 4458  N NE2  . GLN A 1 83 ? 164.599 -1.075  -9.193  1.00 0.00 ? 82 GLN A NE2  3  
ATOM 4459  H H    . GLN A 1 83 ? 159.720 -0.949  -10.957 1.00 0.00 ? 82 GLN A H    3  
ATOM 4460  H HA   . GLN A 1 83 ? 161.851 -1.196  -12.905 1.00 0.00 ? 82 GLN A HA   3  
ATOM 4461  H HB2  . GLN A 1 83 ? 162.387 0.836   -11.528 1.00 0.00 ? 82 GLN A HB2  3  
ATOM 4462  H HB3  . GLN A 1 83 ? 162.454 -0.208  -10.114 1.00 0.00 ? 82 GLN A HB3  3  
ATOM 4463  H HG2  . GLN A 1 83 ? 164.145 -1.473  -11.845 1.00 0.00 ? 82 GLN A HG2  3  
ATOM 4464  H HG3  . GLN A 1 83 ? 164.415 0.229   -12.225 1.00 0.00 ? 82 GLN A HG3  3  
ATOM 4465  H HE21 . GLN A 1 83 ? 163.820 -1.665  -9.276  1.00 0.00 ? 82 GLN A HE21 3  
ATOM 4466  H HE22 . GLN A 1 83 ? 165.144 -1.007  -8.382  1.00 0.00 ? 82 GLN A HE22 3  
ATOM 4467  N N    . ASP A 1 84 ? 160.768 -3.385  -11.520 1.00 0.00 ? 83 ASP A N    3  
ATOM 4468  C CA   . ASP A 1 84 ? 160.761 -4.747  -11.000 1.00 0.00 ? 83 ASP A CA   3  
ATOM 4469  C C    . ASP A 1 84 ? 161.803 -5.601  -11.722 1.00 0.00 ? 83 ASP A C    3  
ATOM 4470  O O    . ASP A 1 84 ? 161.513 -6.216  -12.752 1.00 0.00 ? 83 ASP A O    3  
ATOM 4471  C CB   . ASP A 1 84 ? 159.365 -5.363  -11.156 1.00 0.00 ? 83 ASP A CB   3  
ATOM 4472  C CG   . ASP A 1 84 ? 159.094 -6.482  -10.166 1.00 0.00 ? 83 ASP A CG   3  
ATOM 4473  O OD1  . ASP A 1 84 ? 160.044 -7.212  -9.811  1.00 0.00 ? 83 ASP A OD1  3  
ATOM 4474  O OD2  . ASP A 1 84 ? 157.927 -6.629  -9.747  1.00 0.00 ? 83 ASP A OD2  3  
ATOM 4475  H H    . ASP A 1 84 ? 160.030 -3.091  -12.095 1.00 0.00 ? 83 ASP A H    3  
ATOM 4476  H HA   . ASP A 1 84 ? 161.012 -4.702  -9.951  1.00 0.00 ? 83 ASP A HA   3  
ATOM 4477  H HB2  . ASP A 1 84 ? 158.624 -4.593  -11.004 1.00 0.00 ? 83 ASP A HB2  3  
ATOM 4478  H HB3  . ASP A 1 84 ? 159.264 -5.760  -12.156 1.00 0.00 ? 83 ASP A HB3  3  
ATOM 4479  N N    . ARG A 1 85 ? 163.020 -5.623  -11.178 1.00 0.00 ? 84 ARG A N    3  
ATOM 4480  C CA   . ARG A 1 85 ? 164.113 -6.391  -11.767 1.00 0.00 ? 84 ARG A CA   3  
ATOM 4481  C C    . ARG A 1 85 ? 165.079 -6.890  -10.690 1.00 0.00 ? 84 ARG A C    3  
ATOM 4482  O O    . ARG A 1 85 ? 165.003 -8.045  -10.265 1.00 0.00 ? 84 ARG A O    3  
ATOM 4483  C CB   . ARG A 1 85 ? 164.862 -5.540  -12.798 1.00 0.00 ? 84 ARG A CB   3  
ATOM 4484  C CG   . ARG A 1 85 ? 164.318 -5.661  -14.213 1.00 0.00 ? 84 ARG A CG   3  
ATOM 4485  C CD   . ARG A 1 85 ? 165.289 -5.073  -15.226 1.00 0.00 ? 84 ARG A CD   3  
ATOM 4486  N NE   . ARG A 1 85 ? 164.603 -4.482  -16.376 1.00 0.00 ? 84 ARG A NE   3  
ATOM 4487  C CZ   . ARG A 1 85 ? 165.177 -3.624  -17.225 1.00 0.00 ? 84 ARG A CZ   3  
ATOM 4488  N NH1  . ARG A 1 85 ? 166.446 -3.259  -17.061 1.00 0.00 ? 84 ARG A NH1  3  
ATOM 4489  N NH2  . ARG A 1 85 ? 164.480 -3.131  -18.243 1.00 0.00 ? 84 ARG A NH2  3  
ATOM 4490  H H    . ARG A 1 85 ? 163.187 -5.105  -10.363 1.00 0.00 ? 84 ARG A H    3  
ATOM 4491  H HA   . ARG A 1 85 ? 163.683 -7.245  -12.264 1.00 0.00 ? 84 ARG A HA   3  
ATOM 4492  H HB2  . ARG A 1 85 ? 164.802 -4.502  -12.502 1.00 0.00 ? 84 ARG A HB2  3  
ATOM 4493  H HB3  . ARG A 1 85 ? 165.900 -5.840  -12.808 1.00 0.00 ? 84 ARG A HB3  3  
ATOM 4494  H HG2  . ARG A 1 85 ? 164.161 -6.706  -14.441 1.00 0.00 ? 84 ARG A HG2  3  
ATOM 4495  H HG3  . ARG A 1 85 ? 163.379 -5.132  -14.274 1.00 0.00 ? 84 ARG A HG3  3  
ATOM 4496  H HD2  . ARG A 1 85 ? 165.874 -4.308  -14.739 1.00 0.00 ? 84 ARG A HD2  3  
ATOM 4497  H HD3  . ARG A 1 85 ? 165.945 -5.858  -15.574 1.00 0.00 ? 84 ARG A HD3  3  
ATOM 4498  H HE   . ARG A 1 85 ? 163.668 -4.735  -16.523 1.00 0.00 ? 84 ARG A HE   3  
ATOM 4499  H HH11 . ARG A 1 85 ? 166.979 -3.626  -16.300 1.00 0.00 ? 84 ARG A HH11 3  
ATOM 4500  H HH12 . ARG A 1 85 ? 166.867 -2.615  -17.700 1.00 0.00 ? 84 ARG A HH12 3  
ATOM 4501  H HH21 . ARG A 1 85 ? 163.527 -3.402  -18.376 1.00 0.00 ? 84 ARG A HH21 3  
ATOM 4502  H HH22 . ARG A 1 85 ? 164.909 -2.487  -18.878 1.00 0.00 ? 84 ARG A HH22 3  
ATOM 4503  N N    . ASN A 1 86 ? 165.984 -6.012  -10.254 1.00 0.00 ? 85 ASN A N    3  
ATOM 4504  C CA   . ASN A 1 86 ? 166.969 -6.350  -9.227  1.00 0.00 ? 85 ASN A CA   3  
ATOM 4505  C C    . ASN A 1 86 ? 167.863 -5.147  -8.915  1.00 0.00 ? 85 ASN A C    3  
ATOM 4506  O O    . ASN A 1 86 ? 167.875 -4.166  -9.662  1.00 0.00 ? 85 ASN A O    3  
ATOM 4507  C CB   . ASN A 1 86 ? 167.834 -7.539  -9.672  1.00 0.00 ? 85 ASN A CB   3  
ATOM 4508  C CG   . ASN A 1 86 ? 168.104 -8.521  -8.544  1.00 0.00 ? 85 ASN A CG   3  
ATOM 4509  O OD1  . ASN A 1 86 ? 167.906 -8.208  -7.369  1.00 0.00 ? 85 ASN A OD1  3  
ATOM 4510  N ND2  . ASN A 1 86 ? 168.562 -9.719  -8.894  1.00 0.00 ? 85 ASN A ND2  3  
ATOM 4511  H H    . ASN A 1 86 ? 165.987 -5.110  -10.634 1.00 0.00 ? 85 ASN A H    3  
ATOM 4512  H HA   . ASN A 1 86 ? 166.431 -6.622  -8.332  1.00 0.00 ? 85 ASN A HA   3  
ATOM 4513  H HB2  . ASN A 1 86 ? 167.328 -8.066  -10.467 1.00 0.00 ? 85 ASN A HB2  3  
ATOM 4514  H HB3  . ASN A 1 86 ? 168.781 -7.170  -10.038 1.00 0.00 ? 85 ASN A HB3  3  
ATOM 4515  H HD21 . ASN A 1 86 ? 168.700 -9.905  -9.847  1.00 0.00 ? 85 ASN A HD21 3  
ATOM 4516  H HD22 . ASN A 1 86 ? 168.745 -10.369 -8.184  1.00 0.00 ? 85 ASN A HD22 3  
ATOM 4517  N N    . LEU A 1 87 ? 168.609 -5.234  -7.810  1.00 0.00 ? 86 LEU A N    3  
ATOM 4518  C CA   . LEU A 1 87 ? 169.512 -4.156  -7.390  1.00 0.00 ? 86 LEU A CA   3  
ATOM 4519  C C    . LEU A 1 87 ? 168.740 -2.863  -7.100  1.00 0.00 ? 86 LEU A C    3  
ATOM 4520  O O    . LEU A 1 87 ? 167.510 -2.832  -7.171  1.00 0.00 ? 86 LEU A O    3  
ATOM 4521  C CB   . LEU A 1 87 ? 170.576 -3.894  -8.465  1.00 0.00 ? 86 LEU A CB   3  
ATOM 4522  C CG   . LEU A 1 87 ? 171.946 -4.522  -8.199  1.00 0.00 ? 86 LEU A CG   3  
ATOM 4523  C CD1  . LEU A 1 87 ? 172.853 -4.346  -9.407  1.00 0.00 ? 86 LEU A CD1  3  
ATOM 4524  C CD2  . LEU A 1 87 ? 172.585 -3.916  -6.955  1.00 0.00 ? 86 LEU A CD2  3  
ATOM 4525  H H    . LEU A 1 87 ? 168.552 -6.044  -7.261  1.00 0.00 ? 86 LEU A H    3  
ATOM 4526  H HA   . LEU A 1 87 ? 170.004 -4.476  -6.483  1.00 0.00 ? 86 LEU A HA   3  
ATOM 4527  H HB2  . LEU A 1 87 ? 170.208 -4.273  -9.407  1.00 0.00 ? 86 LEU A HB2  3  
ATOM 4528  H HB3  . LEU A 1 87 ? 170.709 -2.826  -8.556  1.00 0.00 ? 86 LEU A HB3  3  
ATOM 4529  H HG   . LEU A 1 87 ? 171.821 -5.582  -8.029  1.00 0.00 ? 86 LEU A HG   3  
ATOM 4530  H HD11 . LEU A 1 87 ? 173.877 -4.245  -9.079  1.00 0.00 ? 86 LEU A HD11 3  
ATOM 4531  H HD12 . LEU A 1 87 ? 172.560 -3.460  -9.951  1.00 0.00 ? 86 LEU A HD12 3  
ATOM 4532  H HD13 . LEU A 1 87 ? 172.766 -5.208  -10.051 1.00 0.00 ? 86 LEU A HD13 3  
ATOM 4533  H HD21 . LEU A 1 87 ? 173.141 -4.678  -6.430  1.00 0.00 ? 86 LEU A HD21 3  
ATOM 4534  H HD22 . LEU A 1 87 ? 171.815 -3.523  -6.308  1.00 0.00 ? 86 LEU A HD22 3  
ATOM 4535  H HD23 . LEU A 1 87 ? 173.253 -3.119  -7.245  1.00 0.00 ? 86 LEU A HD23 3  
ATOM 4536  N N    . GLU A 1 88 ? 169.477 -1.797  -6.779  1.00 0.00 ? 87 GLU A N    3  
ATOM 4537  C CA   . GLU A 1 88 ? 168.877 -0.495  -6.487  1.00 0.00 ? 87 GLU A CA   3  
ATOM 4538  C C    . GLU A 1 88 ? 169.125 0.478   -7.640  1.00 0.00 ? 87 GLU A C    3  
ATOM 4539  O O    . GLU A 1 88 ? 169.781 0.129   -8.624  1.00 0.00 ? 87 GLU A O    3  
ATOM 4540  C CB   . GLU A 1 88 ? 169.448 0.076   -5.183  1.00 0.00 ? 87 GLU A CB   3  
ATOM 4541  C CG   . GLU A 1 88 ? 168.777 -0.471  -3.931  1.00 0.00 ? 87 GLU A CG   3  
ATOM 4542  C CD   . GLU A 1 88 ? 169.372 0.088   -2.651  1.00 0.00 ? 87 GLU A CD   3  
ATOM 4543  O OE1  . GLU A 1 88 ? 170.616 0.176   -2.562  1.00 0.00 ? 87 GLU A OE1  3  
ATOM 4544  O OE2  . GLU A 1 88 ? 168.594 0.439   -1.739  1.00 0.00 ? 87 GLU A OE2  3  
ATOM 4545  H H    . GLU A 1 88 ? 170.453 -1.885  -6.743  1.00 0.00 ? 87 GLU A H    3  
ATOM 4546  H HA   . GLU A 1 88 ? 167.812 -0.637  -6.374  1.00 0.00 ? 87 GLU A HA   3  
ATOM 4547  H HB2  . GLU A 1 88 ? 170.501 -0.158  -5.132  1.00 0.00 ? 87 GLU A HB2  3  
ATOM 4548  H HB3  . GLU A 1 88 ? 169.329 1.150   -5.189  1.00 0.00 ? 87 GLU A HB3  3  
ATOM 4549  H HG2  . GLU A 1 88 ? 167.728 -0.217  -3.960  1.00 0.00 ? 87 GLU A HG2  3  
ATOM 4550  H HG3  . GLU A 1 88 ? 168.886 -1.545  -3.921  1.00 0.00 ? 87 GLU A HG3  3  
ATOM 4551  N N    . HIS A 1 89 ? 168.597 1.698   -7.516  1.00 0.00 ? 88 HIS A N    3  
ATOM 4552  C CA   . HIS A 1 89 ? 168.763 2.722   -8.553  1.00 0.00 ? 88 HIS A CA   3  
ATOM 4553  C C    . HIS A 1 89 ? 170.242 2.952   -8.878  1.00 0.00 ? 88 HIS A C    3  
ATOM 4554  O O    . HIS A 1 89 ? 170.594 3.215   -10.028 1.00 0.00 ? 88 HIS A O    3  
ATOM 4555  C CB   . HIS A 1 89 ? 168.125 4.046   -8.116  1.00 0.00 ? 88 HIS A CB   3  
ATOM 4556  C CG   . HIS A 1 89 ? 166.956 4.460   -8.959  1.00 0.00 ? 88 HIS A CG   3  
ATOM 4557  N ND1  . HIS A 1 89 ? 165.809 5.013   -8.431  1.00 0.00 ? 88 HIS A ND1  3  
ATOM 4558  C CD2  . HIS A 1 89 ? 166.764 4.410   -10.300 1.00 0.00 ? 88 HIS A CD2  3  
ATOM 4559  C CE1  . HIS A 1 89 ? 164.962 5.284   -9.408  1.00 0.00 ? 88 HIS A CE1  3  
ATOM 4560  N NE2  . HIS A 1 89 ? 165.518 4.928   -10.552 1.00 0.00 ? 88 HIS A NE2  3  
ATOM 4561  H H    . HIS A 1 89 ? 168.084 1.914   -6.709  1.00 0.00 ? 88 HIS A H    3  
ATOM 4562  H HA   . HIS A 1 89 ? 168.263 2.372   -9.444  1.00 0.00 ? 88 HIS A HA   3  
ATOM 4563  H HB2  . HIS A 1 89 ? 167.783 3.957   -7.097  1.00 0.00 ? 88 HIS A HB2  3  
ATOM 4564  H HB3  . HIS A 1 89 ? 168.867 4.830   -8.172  1.00 0.00 ? 88 HIS A HB3  3  
ATOM 4565  H HD1  . HIS A 1 89 ? 165.641 5.181   -7.482  1.00 0.00 ? 88 HIS A HD1  3  
ATOM 4566  H HD2  . HIS A 1 89 ? 167.464 4.036   -11.037 1.00 0.00 ? 88 HIS A HD2  3  
ATOM 4567  H HE1  . HIS A 1 89 ? 163.984 5.725   -9.291  1.00 0.00 ? 88 HIS A HE1  3  
ATOM 4568  H HE2  . HIS A 1 89 ? 165.065 4.927   -11.423 1.00 0.00 ? 88 HIS A HE2  3  
ATOM 4569  N N    . HIS A 1 90 ? 171.098 2.858   -7.854  1.00 0.00 ? 89 HIS A N    3  
ATOM 4570  C CA   . HIS A 1 90 ? 172.540 3.056   -8.020  1.00 0.00 ? 89 HIS A CA   3  
ATOM 4571  C C    . HIS A 1 90 ? 172.868 4.515   -8.336  1.00 0.00 ? 89 HIS A C    3  
ATOM 4572  O O    . HIS A 1 90 ? 172.010 5.268   -8.802  1.00 0.00 ? 89 HIS A O    3  
ATOM 4573  C CB   . HIS A 1 90 ? 173.087 2.136   -9.116  1.00 0.00 ? 89 HIS A CB   3  
ATOM 4574  C CG   . HIS A 1 90 ? 173.731 0.893   -8.587  1.00 0.00 ? 89 HIS A CG   3  
ATOM 4575  N ND1  . HIS A 1 90 ? 173.467 0.376   -7.334  1.00 0.00 ? 89 HIS A ND1  3  
ATOM 4576  C CD2  . HIS A 1 90 ? 174.635 0.059   -9.152  1.00 0.00 ? 89 HIS A CD2  3  
ATOM 4577  C CE1  . HIS A 1 90 ? 174.180 -0.719  -7.152  1.00 0.00 ? 89 HIS A CE1  3  
ATOM 4578  N NE2  . HIS A 1 90 ? 174.896 -0.934  -8.241  1.00 0.00 ? 89 HIS A NE2  3  
ATOM 4579  H H    . HIS A 1 90 ? 170.751 2.652   -6.962  1.00 0.00 ? 89 HIS A H    3  
ATOM 4580  H HA   . HIS A 1 90 ? 173.013 2.799   -7.085  1.00 0.00 ? 89 HIS A HA   3  
ATOM 4581  H HB2  . HIS A 1 90 ? 172.277 1.837   -9.763  1.00 0.00 ? 89 HIS A HB2  3  
ATOM 4582  H HB3  . HIS A 1 90 ? 173.824 2.673   -9.696  1.00 0.00 ? 89 HIS A HB3  3  
ATOM 4583  H HD1  . HIS A 1 90 ? 172.848 0.757   -6.675  1.00 0.00 ? 89 HIS A HD1  3  
ATOM 4584  H HD2  . HIS A 1 90 ? 175.069 0.157   -10.137 1.00 0.00 ? 89 HIS A HD2  3  
ATOM 4585  H HE1  . HIS A 1 90 ? 174.178 -1.336  -6.265  1.00 0.00 ? 89 HIS A HE1  3  
ATOM 4586  H HE2  . HIS A 1 90 ? 175.542 -1.660  -8.359  1.00 0.00 ? 89 HIS A HE2  3  
ATOM 4587  N N    . HIS A 1 91 ? 174.119 4.907   -8.068  1.00 0.00 ? 90 HIS A N    3  
ATOM 4588  C CA   . HIS A 1 91 ? 174.576 6.276   -8.308  1.00 0.00 ? 90 HIS A CA   3  
ATOM 4589  C C    . HIS A 1 91 ? 173.704 7.269   -7.548  1.00 0.00 ? 90 HIS A C    3  
ATOM 4590  O O    . HIS A 1 91 ? 172.861 7.950   -8.134  1.00 0.00 ? 90 HIS A O    3  
ATOM 4591  C CB   . HIS A 1 91 ? 174.563 6.601   -9.806  1.00 0.00 ? 90 HIS A CB   3  
ATOM 4592  C CG   . HIS A 1 91 ? 175.423 5.693   -10.630 1.00 0.00 ? 90 HIS A CG   3  
ATOM 4593  N ND1  . HIS A 1 91 ? 176.639 5.209   -10.197 1.00 0.00 ? 90 HIS A ND1  3  
ATOM 4594  C CD2  . HIS A 1 91 ? 175.236 5.182   -11.870 1.00 0.00 ? 90 HIS A CD2  3  
ATOM 4595  C CE1  . HIS A 1 91 ? 177.162 4.440   -11.134 1.00 0.00 ? 90 HIS A CE1  3  
ATOM 4596  N NE2  . HIS A 1 91 ? 176.331 4.407   -12.159 1.00 0.00 ? 90 HIS A NE2  3  
ATOM 4597  H H    . HIS A 1 91 ? 174.750 4.258   -7.692  1.00 0.00 ? 90 HIS A H    3  
ATOM 4598  H HA   . HIS A 1 91 ? 175.590 6.355   -7.942  1.00 0.00 ? 90 HIS A HA   3  
ATOM 4599  H HB2  . HIS A 1 91 ? 173.552 6.524   -10.175 1.00 0.00 ? 90 HIS A HB2  3  
ATOM 4600  H HB3  . HIS A 1 91 ? 174.915 7.612   -9.949  1.00 0.00 ? 90 HIS A HB3  3  
ATOM 4601  H HD1  . HIS A 1 91 ? 177.057 5.401   -9.332  1.00 0.00 ? 90 HIS A HD1  3  
ATOM 4602  H HD2  . HIS A 1 91 ? 174.381 5.352   -12.512 1.00 0.00 ? 90 HIS A HD2  3  
ATOM 4603  H HE1  . HIS A 1 91 ? 178.108 3.923   -11.071 1.00 0.00 ? 90 HIS A HE1  3  
ATOM 4604  H HE2  . HIS A 1 91 ? 176.521 3.993   -13.027 1.00 0.00 ? 90 HIS A HE2  3  
ATOM 4605  N N    . HIS A 1 92 ? 173.908 7.337   -6.235  1.00 0.00 ? 91 HIS A N    3  
ATOM 4606  C CA   . HIS A 1 92 ? 173.135 8.235   -5.384  1.00 0.00 ? 91 HIS A CA   3  
ATOM 4607  C C    . HIS A 1 92 ? 173.916 8.620   -4.122  1.00 0.00 ? 91 HIS A C    3  
ATOM 4608  O O    . HIS A 1 92 ? 173.968 9.795   -3.757  1.00 0.00 ? 91 HIS A O    3  
ATOM 4609  C CB   . HIS A 1 92 ? 171.788 7.597   -5.008  1.00 0.00 ? 91 HIS A CB   3  
ATOM 4610  C CG   . HIS A 1 92 ? 171.894 6.222   -4.413  1.00 0.00 ? 91 HIS A CG   3  
ATOM 4611  N ND1  . HIS A 1 92 ? 171.249 5.856   -3.252  1.00 0.00 ? 91 HIS A ND1  3  
ATOM 4612  C CD2  . HIS A 1 92 ? 172.570 5.122   -4.828  1.00 0.00 ? 91 HIS A CD2  3  
ATOM 4613  C CE1  . HIS A 1 92 ? 171.524 4.593   -2.975  1.00 0.00 ? 91 HIS A CE1  3  
ATOM 4614  N NE2  . HIS A 1 92 ? 172.323 4.125   -3.916  1.00 0.00 ? 91 HIS A NE2  3  
ATOM 4615  H H    . HIS A 1 92 ? 174.591 6.762   -5.830  1.00 0.00 ? 91 HIS A H    3  
ATOM 4616  H HA   . HIS A 1 92 ? 172.942 9.133   -5.955  1.00 0.00 ? 91 HIS A HA   3  
ATOM 4617  H HB2  . HIS A 1 92 ? 171.290 8.228   -4.289  1.00 0.00 ? 91 HIS A HB2  3  
ATOM 4618  H HB3  . HIS A 1 92 ? 171.175 7.525   -5.896  1.00 0.00 ? 91 HIS A HB3  3  
ATOM 4619  H HD1  . HIS A 1 92 ? 170.671 6.433   -2.713  1.00 0.00 ? 91 HIS A HD1  3  
ATOM 4620  H HD2  . HIS A 1 92 ? 173.184 5.042   -5.713  1.00 0.00 ? 91 HIS A HD2  3  
ATOM 4621  H HE1  . HIS A 1 92 ? 171.155 4.037   -2.126  1.00 0.00 ? 91 HIS A HE1  3  
ATOM 4622  H HE2  . HIS A 1 92 ? 172.771 3.253   -3.892  1.00 0.00 ? 91 HIS A HE2  3  
ATOM 4623  N N    . HIS A 1 93 ? 174.520 7.628   -3.459  1.00 0.00 ? 92 HIS A N    3  
ATOM 4624  C CA   . HIS A 1 93 ? 175.293 7.874   -2.239  1.00 0.00 ? 92 HIS A CA   3  
ATOM 4625  C C    . HIS A 1 93 ? 176.698 7.278   -2.348  1.00 0.00 ? 92 HIS A C    3  
ATOM 4626  O O    . HIS A 1 93 ? 177.247 6.775   -1.366  1.00 0.00 ? 92 HIS A O    3  
ATOM 4627  C CB   . HIS A 1 93 ? 174.568 7.295   -1.021  1.00 0.00 ? 92 HIS A CB   3  
ATOM 4628  C CG   . HIS A 1 93 ? 173.505 8.196   -0.464  1.00 0.00 ? 92 HIS A CG   3  
ATOM 4629  N ND1  . HIS A 1 93 ? 173.751 9.135   0.517   1.00 0.00 ? 92 HIS A ND1  3  
ATOM 4630  C CD2  . HIS A 1 93 ? 172.184 8.293   -0.750  1.00 0.00 ? 92 HIS A CD2  3  
ATOM 4631  C CE1  . HIS A 1 93 ? 172.628 9.766   0.812   1.00 0.00 ? 92 HIS A CE1  3  
ATOM 4632  N NE2  . HIS A 1 93 ? 171.663 9.276   0.057   1.00 0.00 ? 92 HIS A NE2  3  
ATOM 4633  H H    . HIS A 1 93 ? 174.444 6.710   -3.795  1.00 0.00 ? 92 HIS A H    3  
ATOM 4634  H HA   . HIS A 1 93 ? 175.384 8.942   -2.116  1.00 0.00 ? 92 HIS A HA   3  
ATOM 4635  H HB2  . HIS A 1 93 ? 174.103 6.360   -1.297  1.00 0.00 ? 92 HIS A HB2  3  
ATOM 4636  H HB3  . HIS A 1 93 ? 175.290 7.110   -0.238  1.00 0.00 ? 92 HIS A HB3  3  
ATOM 4637  H HD1  . HIS A 1 93 ? 174.619 9.311   0.938   1.00 0.00 ? 92 HIS A HD1  3  
ATOM 4638  H HD2  . HIS A 1 93 ? 171.640 7.705   -1.475  1.00 0.00 ? 92 HIS A HD2  3  
ATOM 4639  H HE1  . HIS A 1 93 ? 172.515 10.546  1.553   1.00 0.00 ? 92 HIS A HE1  3  
ATOM 4640  H HE2  . HIS A 1 93 ? 170.752 9.634   0.003   1.00 0.00 ? 92 HIS A HE2  3  
ATOM 4641  N N    . HIS A 1 94 ? 177.275 7.347   -3.551  1.00 0.00 ? 93 HIS A N    3  
ATOM 4642  C CA   . HIS A 1 94 ? 178.619 6.825   -3.809  1.00 0.00 ? 93 HIS A CA   3  
ATOM 4643  C C    . HIS A 1 94 ? 178.622 5.299   -3.914  1.00 0.00 ? 93 HIS A C    3  
ATOM 4644  O O    . HIS A 1 94 ? 177.724 4.654   -3.327  1.00 0.00 ? 93 HIS A O    3  
ATOM 4645  C CB   . HIS A 1 94 ? 179.597 7.281   -2.719  1.00 0.00 ? 93 HIS A CB   3  
ATOM 4646  C CG   . HIS A 1 94 ? 181.039 7.077   -3.074  1.00 0.00 ? 93 HIS A CG   3  
ATOM 4647  N ND1  . HIS A 1 94 ? 181.797 8.025   -3.731  1.00 0.00 ? 93 HIS A ND1  3  
ATOM 4648  C CD2  . HIS A 1 94 ? 181.864 6.024   -2.857  1.00 0.00 ? 93 HIS A CD2  3  
ATOM 4649  C CE1  . HIS A 1 94 ? 183.023 7.564   -3.904  1.00 0.00 ? 93 HIS A CE1  3  
ATOM 4650  N NE2  . HIS A 1 94 ? 183.089 6.353   -3.381  1.00 0.00 ? 93 HIS A NE2  3  
ATOM 4651  O OXT  . HIS A 1 94 ? 179.523 4.763   -4.591  1.00 0.00 ? 93 HIS A OXT  3  
ATOM 4652  H H    . HIS A 1 94 ? 176.783 7.764   -4.289  1.00 0.00 ? 93 HIS A H    3  
ATOM 4653  H HA   . HIS A 1 94 ? 178.942 7.230   -4.756  1.00 0.00 ? 93 HIS A HA   3  
ATOM 4654  H HB2  . HIS A 1 94 ? 179.448 8.332   -2.528  1.00 0.00 ? 93 HIS A HB2  3  
ATOM 4655  H HB3  . HIS A 1 94 ? 179.398 6.727   -1.816  1.00 0.00 ? 93 HIS A HB3  3  
ATOM 4656  H HD1  . HIS A 1 94 ? 181.483 8.907   -4.021  1.00 0.00 ? 93 HIS A HD1  3  
ATOM 4657  H HD2  . HIS A 1 94 ? 181.608 5.102   -2.353  1.00 0.00 ? 93 HIS A HD2  3  
ATOM 4658  H HE1  . HIS A 1 94 ? 183.836 8.088   -4.388  1.00 0.00 ? 93 HIS A HE1  3  
ATOM 4659  H HE2  . HIS A 1 94 ? 183.861 5.752   -3.447  1.00 0.00 ? 93 HIS A HE2  3  
ATOM 4660  N N    . GLN A 1 2  ? 137.214 4.861   11.272  1.00 0.00 ? 1  GLN A N    4  
ATOM 4661  C CA   . GLN A 1 2  ? 137.699 5.273   9.928   1.00 0.00 ? 1  GLN A CA   4  
ATOM 4662  C C    . GLN A 1 2  ? 138.236 4.077   9.143   1.00 0.00 ? 1  GLN A C    4  
ATOM 4663  O O    . GLN A 1 2  ? 138.814 3.155   9.720   1.00 0.00 ? 1  GLN A O    4  
ATOM 4664  C CB   . GLN A 1 2  ? 138.799 6.326   10.105  1.00 0.00 ? 1  GLN A CB   4  
ATOM 4665  C CG   . GLN A 1 2  ? 138.273 7.752   10.164  1.00 0.00 ? 1  GLN A CG   4  
ATOM 4666  C CD   . GLN A 1 2  ? 139.374 8.767   10.403  1.00 0.00 ? 1  GLN A CD   4  
ATOM 4667  O OE1  . GLN A 1 2  ? 139.833 9.431   9.475   1.00 0.00 ? 1  GLN A OE1  4  
ATOM 4668  N NE2  . GLN A 1 2  ? 139.805 8.891   11.654  1.00 0.00 ? 1  GLN A NE2  4  
ATOM 4669  H HA   . GLN A 1 2  ? 136.875 5.710   9.383   1.00 0.00 ? 1  GLN A HA   4  
ATOM 4670  H HB2  . GLN A 1 2  ? 139.330 6.125   11.024  1.00 0.00 ? 1  GLN A HB2  4  
ATOM 4671  H HB3  . GLN A 1 2  ? 139.490 6.254   9.278   1.00 0.00 ? 1  GLN A HB3  4  
ATOM 4672  H HG2  . GLN A 1 2  ? 137.789 7.983   9.226   1.00 0.00 ? 1  GLN A HG2  4  
ATOM 4673  H HG3  . GLN A 1 2  ? 137.555 7.824   10.966  1.00 0.00 ? 1  GLN A HG3  4  
ATOM 4674  H HE21 . GLN A 1 2  ? 139.395 8.328   12.343  1.00 0.00 ? 1  GLN A HE21 4  
ATOM 4675  H HE22 . GLN A 1 2  ? 140.516 9.539   11.835  1.00 0.00 ? 1  GLN A HE22 4  
ATOM 4676  N N    . SER A 1 3  ? 138.040 4.102   7.826   1.00 0.00 ? 2  SER A N    4  
ATOM 4677  C CA   . SER A 1 3  ? 138.502 3.023   6.957   1.00 0.00 ? 2  SER A CA   4  
ATOM 4678  C C    . SER A 1 3  ? 139.213 3.583   5.725   1.00 0.00 ? 2  SER A C    4  
ATOM 4679  O O    . SER A 1 3  ? 139.423 4.793   5.621   1.00 0.00 ? 2  SER A O    4  
ATOM 4680  C CB   . SER A 1 3  ? 137.323 2.144   6.530   1.00 0.00 ? 2  SER A CB   4  
ATOM 4681  O OG   . SER A 1 3  ? 136.468 1.866   7.626   1.00 0.00 ? 2  SER A OG   4  
ATOM 4682  H H    . SER A 1 3  ? 137.572 4.866   7.427   1.00 0.00 ? 2  SER A H    4  
ATOM 4683  H HA   . SER A 1 3  ? 139.201 2.423   7.518   1.00 0.00 ? 2  SER A HA   4  
ATOM 4684  H HB2  . SER A 1 3  ? 136.754 2.654   5.767   1.00 0.00 ? 2  SER A HB2  4  
ATOM 4685  H HB3  . SER A 1 3  ? 137.697 1.211   6.136   1.00 0.00 ? 2  SER A HB3  4  
ATOM 4686  H HG   . SER A 1 3  ? 135.563 1.794   7.316   1.00 0.00 ? 2  SER A HG   4  
ATOM 4687  N N    . ASP A 1 4  ? 139.580 2.693   4.796   1.00 0.00 ? 3  ASP A N    4  
ATOM 4688  C CA   . ASP A 1 4  ? 140.270 3.081   3.563   1.00 0.00 ? 3  ASP A CA   4  
ATOM 4689  C C    . ASP A 1 4  ? 141.674 3.606   3.857   1.00 0.00 ? 3  ASP A C    4  
ATOM 4690  O O    . ASP A 1 4  ? 141.839 4.691   4.417   1.00 0.00 ? 3  ASP A O    4  
ATOM 4691  C CB   . ASP A 1 4  ? 139.464 4.135   2.797   1.00 0.00 ? 3  ASP A CB   4  
ATOM 4692  C CG   . ASP A 1 4  ? 138.352 3.519   1.968   1.00 0.00 ? 3  ASP A CG   4  
ATOM 4693  O OD1  . ASP A 1 4  ? 138.663 2.852   0.958   1.00 0.00 ? 3  ASP A OD1  4  
ATOM 4694  O OD2  . ASP A 1 4  ? 137.172 3.699   2.333   1.00 0.00 ? 3  ASP A OD2  4  
ATOM 4695  H H    . ASP A 1 4  ? 139.382 1.745   4.946   1.00 0.00 ? 3  ASP A H    4  
ATOM 4696  H HA   . ASP A 1 4  ? 140.356 2.198   2.947   1.00 0.00 ? 3  ASP A HA   4  
ATOM 4697  H HB2  . ASP A 1 4  ? 139.023 4.825   3.499   1.00 0.00 ? 3  ASP A HB2  4  
ATOM 4698  H HB3  . ASP A 1 4  ? 140.125 4.675   2.134   1.00 0.00 ? 3  ASP A HB3  4  
ATOM 4699  N N    . VAL A 1 5  ? 142.682 2.823   3.474   1.00 0.00 ? 4  VAL A N    4  
ATOM 4700  C CA   . VAL A 1 5  ? 144.078 3.196   3.692   1.00 0.00 ? 4  VAL A CA   4  
ATOM 4701  C C    . VAL A 1 5  ? 144.750 3.595   2.378   1.00 0.00 ? 4  VAL A C    4  
ATOM 4702  O O    . VAL A 1 5  ? 144.869 2.781   1.461   1.00 0.00 ? 4  VAL A O    4  
ATOM 4703  C CB   . VAL A 1 5  ? 144.879 2.042   4.335   1.00 0.00 ? 4  VAL A CB   4  
ATOM 4704  C CG1  . VAL A 1 5  ? 146.265 2.516   4.756   1.00 0.00 ? 4  VAL A CG1  4  
ATOM 4705  C CG2  . VAL A 1 5  ? 144.124 1.459   5.523   1.00 0.00 ? 4  VAL A CG2  4  
ATOM 4706  H H    . VAL A 1 5  ? 142.483 1.970   3.034   1.00 0.00 ? 4  VAL A H    4  
ATOM 4707  H HA   . VAL A 1 5  ? 144.097 4.040   4.368   1.00 0.00 ? 4  VAL A HA   4  
ATOM 4708  H HB   . VAL A 1 5  ? 145.001 1.262   3.596   1.00 0.00 ? 4  VAL A HB   4  
ATOM 4709  H HG11 . VAL A 1 5  ? 146.243 2.819   5.792   1.00 0.00 ? 4  VAL A HG11 4  
ATOM 4710  H HG12 . VAL A 1 5  ? 146.561 3.354   4.142   1.00 0.00 ? 4  VAL A HG12 4  
ATOM 4711  H HG13 . VAL A 1 5  ? 146.975 1.711   4.631   1.00 0.00 ? 4  VAL A HG13 4  
ATOM 4712  H HG21 . VAL A 1 5  ? 144.186 2.142   6.357   1.00 0.00 ? 4  VAL A HG21 4  
ATOM 4713  H HG22 . VAL A 1 5  ? 144.564 0.512   5.799   1.00 0.00 ? 4  VAL A HG22 4  
ATOM 4714  H HG23 . VAL A 1 5  ? 143.090 1.311   5.254   1.00 0.00 ? 4  VAL A HG23 4  
ATOM 4715  N N    . ARG A 1 6  ? 145.193 4.851   2.297   1.00 0.00 ? 5  ARG A N    4  
ATOM 4716  C CA   . ARG A 1 6  ? 145.861 5.357   1.098   1.00 0.00 ? 5  ARG A CA   4  
ATOM 4717  C C    . ARG A 1 6  ? 147.361 5.069   1.159   1.00 0.00 ? 5  ARG A C    4  
ATOM 4718  O O    . ARG A 1 6  ? 148.096 5.725   1.900   1.00 0.00 ? 5  ARG A O    4  
ATOM 4719  C CB   . ARG A 1 6  ? 145.624 6.864   0.946   1.00 0.00 ? 5  ARG A CB   4  
ATOM 4720  C CG   . ARG A 1 6  ? 144.444 7.212   0.050   1.00 0.00 ? 5  ARG A CG   4  
ATOM 4721  C CD   . ARG A 1 6  ? 143.116 7.027   0.771   1.00 0.00 ? 5  ARG A CD   4  
ATOM 4722  N NE   . ARG A 1 6  ? 142.850 8.106   1.724   1.00 0.00 ? 5  ARG A NE   4  
ATOM 4723  C CZ   . ARG A 1 6  ? 142.431 9.326   1.375   1.00 0.00 ? 5  ARG A CZ   4  
ATOM 4724  N NH1  . ARG A 1 6  ? 142.242 9.636   0.094   1.00 0.00 ? 5  ARG A NH1  4  
ATOM 4725  N NH2  . ARG A 1 6  ? 142.201 10.242  2.311   1.00 0.00 ? 5  ARG A NH2  4  
ATOM 4726  H H    . ARG A 1 6  ? 145.072 5.450   3.064   1.00 0.00 ? 5  ARG A H    4  
ATOM 4727  H HA   . ARG A 1 6  ? 145.442 4.845   0.243   1.00 0.00 ? 5  ARG A HA   4  
ATOM 4728  H HB2  . ARG A 1 6  ? 145.444 7.289   1.923   1.00 0.00 ? 5  ARG A HB2  4  
ATOM 4729  H HB3  . ARG A 1 6  ? 146.511 7.314   0.526   1.00 0.00 ? 5  ARG A HB3  4  
ATOM 4730  H HG2  . ARG A 1 6  ? 144.534 8.242   -0.259  1.00 0.00 ? 5  ARG A HG2  4  
ATOM 4731  H HG3  . ARG A 1 6  ? 144.464 6.570   -0.819  1.00 0.00 ? 5  ARG A HG3  4  
ATOM 4732  H HD2  . ARG A 1 6  ? 142.324 7.007   0.037   1.00 0.00 ? 5  ARG A HD2  4  
ATOM 4733  H HD3  . ARG A 1 6  ? 143.137 6.087   1.302   1.00 0.00 ? 5  ARG A HD3  4  
ATOM 4734  H HE   . ARG A 1 6  ? 142.986 7.909   2.675   1.00 0.00 ? 5  ARG A HE   4  
ATOM 4735  H HH11 . ARG A 1 6  ? 142.414 8.956   -0.618  1.00 0.00 ? 5  ARG A HH11 4  
ATOM 4736  H HH12 . ARG A 1 6  ? 141.927 10.552  -0.158  1.00 0.00 ? 5  ARG A HH12 4  
ATOM 4737  H HH21 . ARG A 1 6  ? 142.342 10.018  3.276   1.00 0.00 ? 5  ARG A HH21 4  
ATOM 4738  H HH22 . ARG A 1 6  ? 141.886 11.155  2.052   1.00 0.00 ? 5  ARG A HH22 4  
ATOM 4739  N N    . ILE A 1 7  ? 147.808 4.083   0.382   1.00 0.00 ? 6  ILE A N    4  
ATOM 4740  C CA   . ILE A 1 7  ? 149.220 3.705   0.356   1.00 0.00 ? 6  ILE A CA   4  
ATOM 4741  C C    . ILE A 1 7  ? 149.929 4.295   -0.863  1.00 0.00 ? 6  ILE A C    4  
ATOM 4742  O O    . ILE A 1 7  ? 149.598 3.968   -2.005  1.00 0.00 ? 6  ILE A O    4  
ATOM 4743  C CB   . ILE A 1 7  ? 149.393 2.169   0.357   1.00 0.00 ? 6  ILE A CB   4  
ATOM 4744  C CG1  . ILE A 1 7  ? 148.536 1.537   1.459   1.00 0.00 ? 6  ILE A CG1  4  
ATOM 4745  C CG2  . ILE A 1 7  ? 150.859 1.795   0.541   1.00 0.00 ? 6  ILE A CG2  4  
ATOM 4746  C CD1  . ILE A 1 7  ? 148.602 0.025   1.492   1.00 0.00 ? 6  ILE A CD1  4  
ATOM 4747  H H    . ILE A 1 7  ? 147.173 3.593   -0.184  1.00 0.00 ? 6  ILE A H    4  
ATOM 4748  H HA   . ILE A 1 7  ? 149.683 4.097   1.250   1.00 0.00 ? 6  ILE A HA   4  
ATOM 4749  H HB   . ILE A 1 7  ? 149.069 1.793   -0.601  1.00 0.00 ? 6  ILE A HB   4  
ATOM 4750  H HG12 . ILE A 1 7  ? 148.869 1.903   2.419   1.00 0.00 ? 6  ILE A HG12 4  
ATOM 4751  H HG13 . ILE A 1 7  ? 147.504 1.821   1.310   1.00 0.00 ? 6  ILE A HG13 4  
ATOM 4752  H HG21 . ILE A 1 7  ? 150.956 0.719   0.558   1.00 0.00 ? 6  ILE A HG21 4  
ATOM 4753  H HG22 . ILE A 1 7  ? 151.221 2.203   1.473   1.00 0.00 ? 6  ILE A HG22 4  
ATOM 4754  H HG23 . ILE A 1 7  ? 151.440 2.195   -0.277  1.00 0.00 ? 6  ILE A HG23 4  
ATOM 4755  H HD11 . ILE A 1 7  ? 148.868 -0.346  0.513   1.00 0.00 ? 6  ILE A HD11 4  
ATOM 4756  H HD12 . ILE A 1 7  ? 147.639 -0.371  1.778   1.00 0.00 ? 6  ILE A HD12 4  
ATOM 4757  H HD13 . ILE A 1 7  ? 149.347 -0.286  2.209   1.00 0.00 ? 6  ILE A HD13 4  
ATOM 4758  N N    . LYS A 1 8  ? 150.910 5.164   -0.610  1.00 0.00 ? 7  LYS A N    4  
ATOM 4759  C CA   . LYS A 1 8  ? 151.674 5.802   -1.680  1.00 0.00 ? 7  LYS A CA   4  
ATOM 4760  C C    . LYS A 1 8  ? 153.100 5.252   -1.726  1.00 0.00 ? 7  LYS A C    4  
ATOM 4761  O O    . LYS A 1 8  ? 153.884 5.456   -0.798  1.00 0.00 ? 7  LYS A O    4  
ATOM 4762  C CB   . LYS A 1 8  ? 151.700 7.320   -1.481  1.00 0.00 ? 7  LYS A CB   4  
ATOM 4763  C CG   . LYS A 1 8  ? 152.379 8.075   -2.613  1.00 0.00 ? 7  LYS A CG   4  
ATOM 4764  C CD   . LYS A 1 8  ? 153.219 9.228   -2.087  1.00 0.00 ? 7  LYS A CD   4  
ATOM 4765  C CE   . LYS A 1 8  ? 153.098 10.461  -2.970  1.00 0.00 ? 7  LYS A CE   4  
ATOM 4766  N NZ   . LYS A 1 8  ? 151.771 11.125  -2.826  1.00 0.00 ? 7  LYS A NZ   4  
ATOM 4767  H H    . LYS A 1 8  ? 151.127 5.381   0.322   1.00 0.00 ? 7  LYS A H    4  
ATOM 4768  H HA   . LYS A 1 8  ? 151.184 5.579   -2.616  1.00 0.00 ? 7  LYS A HA   4  
ATOM 4769  H HB2  . LYS A 1 8  ? 150.684 7.676   -1.399  1.00 0.00 ? 7  LYS A HB2  4  
ATOM 4770  H HB3  . LYS A 1 8  ? 152.225 7.541   -0.563  1.00 0.00 ? 7  LYS A HB3  4  
ATOM 4771  H HG2  . LYS A 1 8  ? 153.019 7.394   -3.154  1.00 0.00 ? 7  LYS A HG2  4  
ATOM 4772  H HG3  . LYS A 1 8  ? 151.622 8.465   -3.278  1.00 0.00 ? 7  LYS A HG3  4  
ATOM 4773  H HD2  . LYS A 1 8  ? 152.886 9.478   -1.090  1.00 0.00 ? 7  LYS A HD2  4  
ATOM 4774  H HD3  . LYS A 1 8  ? 154.254 8.919   -2.054  1.00 0.00 ? 7  LYS A HD3  4  
ATOM 4775  H HE2  . LYS A 1 8  ? 153.872 11.162  -2.695  1.00 0.00 ? 7  LYS A HE2  4  
ATOM 4776  H HE3  . LYS A 1 8  ? 153.233 10.164  -4.001  1.00 0.00 ? 7  LYS A HE3  4  
ATOM 4777  H HZ1  . LYS A 1 8  ? 151.756 12.015  -3.365  1.00 0.00 ? 7  LYS A HZ1  4  
ATOM 4778  H HZ2  . LYS A 1 8  ? 151.583 11.337  -1.826  1.00 0.00 ? 7  LYS A HZ2  4  
ATOM 4779  H HZ3  . LYS A 1 8  ? 151.018 10.501  -3.183  1.00 0.00 ? 7  LYS A HZ3  4  
ATOM 4780  N N    . PHE A 1 9  ? 153.427 4.550   -2.809  1.00 0.00 ? 8  PHE A N    4  
ATOM 4781  C CA   . PHE A 1 9  ? 154.758 3.967   -2.974  1.00 0.00 ? 8  PHE A CA   4  
ATOM 4782  C C    . PHE A 1 9  ? 155.476 4.561   -4.183  1.00 0.00 ? 8  PHE A C    4  
ATOM 4783  O O    . PHE A 1 9  ? 154.846 4.892   -5.189  1.00 0.00 ? 8  PHE A O    4  
ATOM 4784  C CB   . PHE A 1 9  ? 154.660 2.443   -3.114  1.00 0.00 ? 8  PHE A CB   4  
ATOM 4785  C CG   . PHE A 1 9  ? 153.637 1.984   -4.120  1.00 0.00 ? 8  PHE A CG   4  
ATOM 4786  C CD1  . PHE A 1 9  ? 152.320 1.774   -3.742  1.00 0.00 ? 8  PHE A CD1  4  
ATOM 4787  C CD2  . PHE A 1 9  ? 153.996 1.757   -5.439  1.00 0.00 ? 8  PHE A CD2  4  
ATOM 4788  C CE1  . PHE A 1 9  ? 151.381 1.350   -4.662  1.00 0.00 ? 8  PHE A CE1  4  
ATOM 4789  C CE2  . PHE A 1 9  ? 153.061 1.332   -6.363  1.00 0.00 ? 8  PHE A CE2  4  
ATOM 4790  C CZ   . PHE A 1 9  ? 151.752 1.128   -5.974  1.00 0.00 ? 8  PHE A CZ   4  
ATOM 4791  H H    . PHE A 1 9  ? 152.759 4.422   -3.516  1.00 0.00 ? 8  PHE A H    4  
ATOM 4792  H HA   . PHE A 1 9  ? 155.330 4.198   -2.087  1.00 0.00 ? 8  PHE A HA   4  
ATOM 4793  H HB2  . PHE A 1 9  ? 155.620 2.056   -3.419  1.00 0.00 ? 8  PHE A HB2  4  
ATOM 4794  H HB3  . PHE A 1 9  ? 154.398 2.019   -2.156  1.00 0.00 ? 8  PHE A HB3  4  
ATOM 4795  H HD1  . PHE A 1 9  ? 152.029 1.948   -2.717  1.00 0.00 ? 8  PHE A HD1  4  
ATOM 4796  H HD2  . PHE A 1 9  ? 155.019 1.918   -5.746  1.00 0.00 ? 8  PHE A HD2  4  
ATOM 4797  H HE1  . PHE A 1 9  ? 150.359 1.192   -4.355  1.00 0.00 ? 8  PHE A HE1  4  
ATOM 4798  H HE2  . PHE A 1 9  ? 153.354 1.160   -7.388  1.00 0.00 ? 8  PHE A HE2  4  
ATOM 4799  H HZ   . PHE A 1 9  ? 151.020 0.795   -6.694  1.00 0.00 ? 8  PHE A HZ   4  
ATOM 4800  N N    . GLU A 1 10 ? 156.799 4.693   -4.077  1.00 0.00 ? 9  GLU A N    4  
ATOM 4801  C CA   . GLU A 1 10 ? 157.604 5.247   -5.163  1.00 0.00 ? 9  GLU A CA   4  
ATOM 4802  C C    . GLU A 1 10 ? 158.775 4.330   -5.511  1.00 0.00 ? 9  GLU A C    4  
ATOM 4803  O O    . GLU A 1 10 ? 159.364 3.692   -4.635  1.00 0.00 ? 9  GLU A O    4  
ATOM 4804  C CB   . GLU A 1 10 ? 158.125 6.638   -4.790  1.00 0.00 ? 9  GLU A CB   4  
ATOM 4805  C CG   . GLU A 1 10 ? 158.842 7.342   -5.934  1.00 0.00 ? 9  GLU A CG   4  
ATOM 4806  C CD   . GLU A 1 10 ? 159.114 8.807   -5.652  1.00 0.00 ? 9  GLU A CD   4  
ATOM 4807  O OE1  . GLU A 1 10 ? 158.151 9.547   -5.360  1.00 0.00 ? 9  GLU A OE1  4  
ATOM 4808  O OE2  . GLU A 1 10 ? 160.292 9.216   -5.730  1.00 0.00 ? 9  GLU A OE2  4  
ATOM 4809  H H    . GLU A 1 10 ? 157.244 4.410   -3.251  1.00 0.00 ? 9  GLU A H    4  
ATOM 4810  H HA   . GLU A 1 10 ? 156.967 5.336   -6.032  1.00 0.00 ? 9  GLU A HA   4  
ATOM 4811  H HB2  . GLU A 1 10 ? 157.291 7.251   -4.482  1.00 0.00 ? 9  GLU A HB2  4  
ATOM 4812  H HB3  . GLU A 1 10 ? 158.816 6.543   -3.965  1.00 0.00 ? 9  GLU A HB3  4  
ATOM 4813  H HG2  . GLU A 1 10 ? 159.785 6.846   -6.109  1.00 0.00 ? 9  GLU A HG2  4  
ATOM 4814  H HG3  . GLU A 1 10 ? 158.230 7.269   -6.822  1.00 0.00 ? 9  GLU A HG3  4  
ATOM 4815  N N    . HIS A 1 11 ? 159.105 4.276   -6.799  1.00 0.00 ? 10 HIS A N    4  
ATOM 4816  C CA   . HIS A 1 11 ? 160.201 3.449   -7.283  1.00 0.00 ? 10 HIS A CA   4  
ATOM 4817  C C    . HIS A 1 11 ? 160.939 4.152   -8.424  1.00 0.00 ? 10 HIS A C    4  
ATOM 4818  O O    . HIS A 1 11 ? 160.379 4.350   -9.504  1.00 0.00 ? 10 HIS A O    4  
ATOM 4819  C CB   . HIS A 1 11 ? 159.666 2.092   -7.751  1.00 0.00 ? 10 HIS A CB   4  
ATOM 4820  C CG   . HIS A 1 11 ? 160.734 1.129   -8.165  1.00 0.00 ? 10 HIS A CG   4  
ATOM 4821  N ND1  . HIS A 1 11 ? 160.562 0.210   -9.176  1.00 0.00 ? 10 HIS A ND1  4  
ATOM 4822  C CD2  . HIS A 1 11 ? 161.992 0.944   -7.701  1.00 0.00 ? 10 HIS A CD2  4  
ATOM 4823  C CE1  . HIS A 1 11 ? 161.667 -0.499  -9.316  1.00 0.00 ? 10 HIS A CE1  4  
ATOM 4824  N NE2  . HIS A 1 11 ? 162.552 -0.073  -8.433  1.00 0.00 ? 10 HIS A NE2  4  
ATOM 4825  H H    . HIS A 1 11 ? 158.595 4.812   -7.443  1.00 0.00 ? 10 HIS A H    4  
ATOM 4826  H HA   . HIS A 1 11 ? 160.889 3.294   -6.465  1.00 0.00 ? 10 HIS A HA   4  
ATOM 4827  H HB2  . HIS A 1 11 ? 159.107 1.639   -6.948  1.00 0.00 ? 10 HIS A HB2  4  
ATOM 4828  H HB3  . HIS A 1 11 ? 159.011 2.246   -8.597  1.00 0.00 ? 10 HIS A HB3  4  
ATOM 4829  H HD1  . HIS A 1 11 ? 159.749 0.093   -9.712  1.00 0.00 ? 10 HIS A HD1  4  
ATOM 4830  H HD2  . HIS A 1 11 ? 162.465 1.493   -6.899  1.00 0.00 ? 10 HIS A HD2  4  
ATOM 4831  H HE1  . HIS A 1 11 ? 161.820 -1.295  -10.030 1.00 0.00 ? 10 HIS A HE1  4  
ATOM 4832  H HE2  . HIS A 1 11 ? 163.503 -0.308  -8.435  1.00 0.00 ? 10 HIS A HE2  4  
ATOM 4833  N N    . ASN A 1 12 ? 162.194 4.530   -8.170  1.00 0.00 ? 11 ASN A N    4  
ATOM 4834  C CA   . ASN A 1 12 ? 163.021 5.219   -9.166  1.00 0.00 ? 11 ASN A CA   4  
ATOM 4835  C C    . ASN A 1 12 ? 162.354 6.514   -9.641  1.00 0.00 ? 11 ASN A C    4  
ATOM 4836  O O    . ASN A 1 12 ? 162.404 6.854   -10.825 1.00 0.00 ? 11 ASN A O    4  
ATOM 4837  C CB   . ASN A 1 12 ? 163.303 4.300   -10.362 1.00 0.00 ? 11 ASN A CB   4  
ATOM 4838  C CG   . ASN A 1 12 ? 164.334 3.232   -10.048 1.00 0.00 ? 11 ASN A CG   4  
ATOM 4839  O OD1  . ASN A 1 12 ? 164.177 2.461   -9.101  1.00 0.00 ? 11 ASN A OD1  4  
ATOM 4840  N ND2  . ASN A 1 12 ? 165.397 3.176   -10.845 1.00 0.00 ? 11 ASN A ND2  4  
ATOM 4841  H H    . ASN A 1 12 ? 162.576 4.344   -7.287  1.00 0.00 ? 11 ASN A H    4  
ATOM 4842  H HA   . ASN A 1 12 ? 163.959 5.470   -8.694  1.00 0.00 ? 11 ASN A HA   4  
ATOM 4843  H HB2  . ASN A 1 12 ? 162.387 3.812   -10.658 1.00 0.00 ? 11 ASN A HB2  4  
ATOM 4844  H HB3  . ASN A 1 12 ? 163.669 4.895   -11.186 1.00 0.00 ? 11 ASN A HB3  4  
ATOM 4845  H HD21 . ASN A 1 12 ? 165.458 3.818   -11.584 1.00 0.00 ? 11 ASN A HD21 4  
ATOM 4846  H HD22 . ASN A 1 12 ? 166.078 2.494   -10.663 1.00 0.00 ? 11 ASN A HD22 4  
ATOM 4847  N N    . GLY A 1 13 ? 161.728 7.233   -8.707  1.00 0.00 ? 12 GLY A N    4  
ATOM 4848  C CA   . GLY A 1 13 ? 161.058 8.480   -9.045  1.00 0.00 ? 12 GLY A CA   4  
ATOM 4849  C C    . GLY A 1 13 ? 159.607 8.290   -9.470  1.00 0.00 ? 12 GLY A C    4  
ATOM 4850  O O    . GLY A 1 13 ? 158.847 9.258   -9.530  1.00 0.00 ? 12 GLY A O    4  
ATOM 4851  H H    . GLY A 1 13 ? 161.720 6.915   -7.780  1.00 0.00 ? 12 GLY A H    4  
ATOM 4852  H HA2  . GLY A 1 13 ? 161.085 9.132   -8.185  1.00 0.00 ? 12 GLY A HA2  4  
ATOM 4853  H HA3  . GLY A 1 13 ? 161.596 8.953   -9.854  1.00 0.00 ? 12 GLY A HA3  4  
ATOM 4854  N N    . GLU A 1 14 ? 159.217 7.046   -9.762  1.00 0.00 ? 13 GLU A N    4  
ATOM 4855  C CA   . GLU A 1 14 ? 157.850 6.747   -10.179 1.00 0.00 ? 13 GLU A CA   4  
ATOM 4856  C C    . GLU A 1 14 ? 156.954 6.522   -8.964  1.00 0.00 ? 13 GLU A C    4  
ATOM 4857  O O    . GLU A 1 14 ? 157.011 5.468   -8.327  1.00 0.00 ? 13 GLU A O    4  
ATOM 4858  C CB   . GLU A 1 14 ? 157.833 5.511   -11.084 1.00 0.00 ? 13 GLU A CB   4  
ATOM 4859  C CG   . GLU A 1 14 ? 156.534 5.323   -11.852 1.00 0.00 ? 13 GLU A CG   4  
ATOM 4860  C CD   . GLU A 1 14 ? 156.646 4.252   -12.921 1.00 0.00 ? 13 GLU A CD   4  
ATOM 4861  O OE1  . GLU A 1 14 ? 156.656 3.055   -12.564 1.00 0.00 ? 13 GLU A OE1  4  
ATOM 4862  O OE2  . GLU A 1 14 ? 156.720 4.610   -14.115 1.00 0.00 ? 13 GLU A OE2  4  
ATOM 4863  H H    . GLU A 1 14 ? 159.862 6.312   -9.696  1.00 0.00 ? 13 GLU A H    4  
ATOM 4864  H HA   . GLU A 1 14 ? 157.479 7.595   -10.734 1.00 0.00 ? 13 GLU A HA   4  
ATOM 4865  H HB2  . GLU A 1 14 ? 158.638 5.594   -11.799 1.00 0.00 ? 13 GLU A HB2  4  
ATOM 4866  H HB3  . GLU A 1 14 ? 157.995 4.633   -10.475 1.00 0.00 ? 13 GLU A HB3  4  
ATOM 4867  H HG2  . GLU A 1 14 ? 155.757 5.037   -11.158 1.00 0.00 ? 13 GLU A HG2  4  
ATOM 4868  H HG3  . GLU A 1 14 ? 156.268 6.258   -12.323 1.00 0.00 ? 13 GLU A HG3  4  
ATOM 4869  N N    . ARG A 1 15 ? 156.133 7.522   -8.644  1.00 0.00 ? 14 ARG A N    4  
ATOM 4870  C CA   . ARG A 1 15 ? 155.229 7.436   -7.497  1.00 0.00 ? 14 ARG A CA   4  
ATOM 4871  C C    . ARG A 1 15 ? 153.862 6.889   -7.908  1.00 0.00 ? 14 ARG A C    4  
ATOM 4872  O O    . ARG A 1 15 ? 153.340 7.227   -8.971  1.00 0.00 ? 14 ARG A O    4  
ATOM 4873  C CB   . ARG A 1 15 ? 155.068 8.808   -6.829  1.00 0.00 ? 14 ARG A CB   4  
ATOM 4874  C CG   . ARG A 1 15 ? 154.616 9.912   -7.773  1.00 0.00 ? 14 ARG A CG   4  
ATOM 4875  C CD   . ARG A 1 15 ? 155.671 11.000  -7.901  1.00 0.00 ? 14 ARG A CD   4  
ATOM 4876  N NE   . ARG A 1 15 ? 155.262 12.059  -8.822  1.00 0.00 ? 14 ARG A NE   4  
ATOM 4877  C CZ   . ARG A 1 15 ? 156.041 13.086  -9.170  1.00 0.00 ? 14 ARG A CZ   4  
ATOM 4878  N NH1  . ARG A 1 15 ? 157.273 13.197  -8.679  1.00 0.00 ? 14 ARG A NH1  4  
ATOM 4879  N NH2  . ARG A 1 15 ? 155.585 14.006  -10.013 1.00 0.00 ? 14 ARG A NH2  4  
ATOM 4880  H H    . ARG A 1 15 ? 156.138 8.338   -9.188  1.00 0.00 ? 14 ARG A H    4  
ATOM 4881  H HA   . ARG A 1 15 ? 155.672 6.755   -6.787  1.00 0.00 ? 14 ARG A HA   4  
ATOM 4882  H HB2  . ARG A 1 15 ? 154.339 8.724   -6.037  1.00 0.00 ? 14 ARG A HB2  4  
ATOM 4883  H HB3  . ARG A 1 15 ? 156.017 9.097   -6.400  1.00 0.00 ? 14 ARG A HB3  4  
ATOM 4884  H HG2  . ARG A 1 15 ? 154.430 9.488   -8.748  1.00 0.00 ? 14 ARG A HG2  4  
ATOM 4885  H HG3  . ARG A 1 15 ? 153.706 10.351  -7.389  1.00 0.00 ? 14 ARG A HG3  4  
ATOM 4886  H HD2  . ARG A 1 15 ? 155.845 11.431  -6.927  1.00 0.00 ? 14 ARG A HD2  4  
ATOM 4887  H HD3  . ARG A 1 15 ? 156.586 10.553  -8.264  1.00 0.00 ? 14 ARG A HD3  4  
ATOM 4888  H HE   . ARG A 1 15 ? 154.360 12.003  -9.202  1.00 0.00 ? 14 ARG A HE   4  
ATOM 4889  H HH11 . ARG A 1 15 ? 157.625 12.508  -8.045  1.00 0.00 ? 14 ARG A HH11 4  
ATOM 4890  H HH12 . ARG A 1 15 ? 157.850 13.970  -8.945  1.00 0.00 ? 14 ARG A HH12 4  
ATOM 4891  H HH21 . ARG A 1 15 ? 154.661 13.929  -10.387 1.00 0.00 ? 14 ARG A HH21 4  
ATOM 4892  H HH22 . ARG A 1 15 ? 156.167 14.776  -10.275 1.00 0.00 ? 14 ARG A HH22 4  
ATOM 4893  N N    . ARG A 1 16 ? 153.292 6.040   -7.052  1.00 0.00 ? 15 ARG A N    4  
ATOM 4894  C CA   . ARG A 1 16 ? 151.986 5.437   -7.311  1.00 0.00 ? 15 ARG A CA   4  
ATOM 4895  C C    . ARG A 1 16 ? 151.101 5.493   -6.067  1.00 0.00 ? 15 ARG A C    4  
ATOM 4896  O O    . ARG A 1 16 ? 151.568 5.255   -4.951  1.00 0.00 ? 15 ARG A O    4  
ATOM 4897  C CB   . ARG A 1 16 ? 152.155 3.985   -7.766  1.00 0.00 ? 15 ARG A CB   4  
ATOM 4898  C CG   . ARG A 1 16 ? 151.994 3.789   -9.264  1.00 0.00 ? 15 ARG A CG   4  
ATOM 4899  C CD   . ARG A 1 16 ? 152.101 2.321   -9.647  1.00 0.00 ? 15 ARG A CD   4  
ATOM 4900  N NE   . ARG A 1 16 ? 151.789 2.096   -11.058 1.00 0.00 ? 15 ARG A NE   4  
ATOM 4901  C CZ   . ARG A 1 16 ? 152.648 2.313   -12.058 1.00 0.00 ? 15 ARG A CZ   4  
ATOM 4902  N NH1  . ARG A 1 16 ? 153.873 2.769   -11.808 1.00 0.00 ? 15 ARG A NH1  4  
ATOM 4903  N NH2  . ARG A 1 16 ? 152.280 2.074   -13.312 1.00 0.00 ? 15 ARG A NH2  4  
ATOM 4904  H H    . ARG A 1 16 ? 153.763 5.812   -6.221  1.00 0.00 ? 15 ARG A H    4  
ATOM 4905  H HA   . ARG A 1 16 ? 151.511 6.001   -8.101  1.00 0.00 ? 15 ARG A HA   4  
ATOM 4906  H HB2  . ARG A 1 16 ? 153.141 3.645   -7.484  1.00 0.00 ? 15 ARG A HB2  4  
ATOM 4907  H HB3  . ARG A 1 16 ? 151.418 3.375   -7.264  1.00 0.00 ? 15 ARG A HB3  4  
ATOM 4908  H HG2  . ARG A 1 16 ? 151.026 4.161   -9.565  1.00 0.00 ? 15 ARG A HG2  4  
ATOM 4909  H HG3  . ARG A 1 16 ? 152.769 4.343   -9.775  1.00 0.00 ? 15 ARG A HG3  4  
ATOM 4910  H HD2  . ARG A 1 16 ? 153.109 1.984   -9.455  1.00 0.00 ? 15 ARG A HD2  4  
ATOM 4911  H HD3  . ARG A 1 16 ? 151.411 1.752   -9.041  1.00 0.00 ? 15 ARG A HD3  4  
ATOM 4912  H HE   . ARG A 1 16 ? 150.892 1.763   -11.273 1.00 0.00 ? 15 ARG A HE   4  
ATOM 4913  H HH11 . ARG A 1 16 ? 154.159 2.954   -10.868 1.00 0.00 ? 15 ARG A HH11 4  
ATOM 4914  H HH12 . ARG A 1 16 ? 154.513 2.925   -12.562 1.00 0.00 ? 15 ARG A HH12 4  
ATOM 4915  H HH21 . ARG A 1 16 ? 151.361 1.733   -13.509 1.00 0.00 ? 15 ARG A HH21 4  
ATOM 4916  H HH22 . ARG A 1 16 ? 152.923 2.236   -14.063 1.00 0.00 ? 15 ARG A HH22 4  
ATOM 4917  N N    . ILE A 1 17 ? 149.822 5.809   -6.268  1.00 0.00 ? 16 ILE A N    4  
ATOM 4918  C CA   . ILE A 1 17 ? 148.865 5.900   -5.166  1.00 0.00 ? 16 ILE A CA   4  
ATOM 4919  C C    . ILE A 1 17 ? 147.749 4.868   -5.319  1.00 0.00 ? 16 ILE A C    4  
ATOM 4920  O O    . ILE A 1 17 ? 147.054 4.839   -6.336  1.00 0.00 ? 16 ILE A O    4  
ATOM 4921  C CB   . ILE A 1 17 ? 148.236 7.309   -5.079  1.00 0.00 ? 16 ILE A CB   4  
ATOM 4922  C CG1  . ILE A 1 17 ? 149.322 8.389   -5.093  1.00 0.00 ? 16 ILE A CG1  4  
ATOM 4923  C CG2  . ILE A 1 17 ? 147.375 7.433   -3.828  1.00 0.00 ? 16 ILE A CG2  4  
ATOM 4924  C CD1  . ILE A 1 17 ? 149.034 9.523   -6.053  1.00 0.00 ? 16 ILE A CD1  4  
ATOM 4925  H H    . ILE A 1 17 ? 149.512 5.988   -7.181  1.00 0.00 ? 16 ILE A H    4  
ATOM 4926  H HA   . ILE A 1 17 ? 149.397 5.709   -4.245  1.00 0.00 ? 16 ILE A HA   4  
ATOM 4927  H HB   . ILE A 1 17 ? 147.594 7.444   -5.938  1.00 0.00 ? 16 ILE A HB   4  
ATOM 4928  H HG12 . ILE A 1 17 ? 149.416 8.810   -4.103  1.00 0.00 ? 16 ILE A HG12 4  
ATOM 4929  H HG13 . ILE A 1 17 ? 150.263 7.942   -5.379  1.00 0.00 ? 16 ILE A HG13 4  
ATOM 4930  H HG21 . ILE A 1 17 ? 146.350 7.194   -4.072  1.00 0.00 ? 16 ILE A HG21 4  
ATOM 4931  H HG22 . ILE A 1 17 ? 147.428 8.444   -3.452  1.00 0.00 ? 16 ILE A HG22 4  
ATOM 4932  H HG23 . ILE A 1 17 ? 147.734 6.749   -3.073  1.00 0.00 ? 16 ILE A HG23 4  
ATOM 4933  H HD11 . ILE A 1 17 ? 149.964 9.966   -6.376  1.00 0.00 ? 16 ILE A HD11 4  
ATOM 4934  H HD12 . ILE A 1 17 ? 148.431 10.270  -5.557  1.00 0.00 ? 16 ILE A HD12 4  
ATOM 4935  H HD13 . ILE A 1 17 ? 148.500 9.141   -6.911  1.00 0.00 ? 16 ILE A HD13 4  
ATOM 4936  N N    . ILE A 1 18 ? 147.579 4.024   -4.299  1.00 0.00 ? 17 ILE A N    4  
ATOM 4937  C CA   . ILE A 1 18 ? 146.542 2.994   -4.318  1.00 0.00 ? 17 ILE A CA   4  
ATOM 4938  C C    . ILE A 1 18 ? 145.813 2.919   -2.977  1.00 0.00 ? 17 ILE A C    4  
ATOM 4939  O O    . ILE A 1 18 ? 146.444 2.890   -1.918  1.00 0.00 ? 17 ILE A O    4  
ATOM 4940  C CB   . ILE A 1 18 ? 147.122 1.602   -4.652  1.00 0.00 ? 17 ILE A CB   4  
ATOM 4941  C CG1  . ILE A 1 18 ? 147.982 1.667   -5.918  1.00 0.00 ? 17 ILE A CG1  4  
ATOM 4942  C CG2  . ILE A 1 18 ? 145.998 0.587   -4.823  1.00 0.00 ? 17 ILE A CG2  4  
ATOM 4943  C CD1  . ILE A 1 18 ? 148.552 0.327   -6.332  1.00 0.00 ? 17 ILE A CD1  4  
ATOM 4944  H H    . ILE A 1 18 ? 148.162 4.099   -3.514  1.00 0.00 ? 17 ILE A H    4  
ATOM 4945  H HA   . ILE A 1 18 ? 145.830 3.257   -5.087  1.00 0.00 ? 17 ILE A HA   4  
ATOM 4946  H HB   . ILE A 1 18 ? 147.737 1.285   -3.823  1.00 0.00 ? 17 ILE A HB   4  
ATOM 4947  H HG12 . ILE A 1 18 ? 147.382 2.037   -6.735  1.00 0.00 ? 17 ILE A HG12 4  
ATOM 4948  H HG13 . ILE A 1 18 ? 148.809 2.342   -5.749  1.00 0.00 ? 17 ILE A HG13 4  
ATOM 4949  H HG21 . ILE A 1 18 ? 145.406 0.549   -3.920  1.00 0.00 ? 17 ILE A HG21 4  
ATOM 4950  H HG22 . ILE A 1 18 ? 146.421 -0.388  -5.015  1.00 0.00 ? 17 ILE A HG22 4  
ATOM 4951  H HG23 . ILE A 1 18 ? 145.372 0.878   -5.653  1.00 0.00 ? 17 ILE A HG23 4  
ATOM 4952  H HD11 . ILE A 1 18 ? 149.231 -0.027  -5.570  1.00 0.00 ? 17 ILE A HD11 4  
ATOM 4953  H HD12 . ILE A 1 18 ? 149.083 0.434   -7.266  1.00 0.00 ? 17 ILE A HD12 4  
ATOM 4954  H HD13 . ILE A 1 18 ? 147.748 -0.384  -6.454  1.00 0.00 ? 17 ILE A HD13 4  
ATOM 4955  N N    . ALA A 1 19 ? 144.483 2.883   -3.034  1.00 0.00 ? 18 ALA A N    4  
ATOM 4956  C CA   . ALA A 1 19 ? 143.662 2.807   -1.830  1.00 0.00 ? 18 ALA A CA   4  
ATOM 4957  C C    . ALA A 1 19 ? 143.134 1.390   -1.615  1.00 0.00 ? 18 ALA A C    4  
ATOM 4958  O O    . ALA A 1 19 ? 142.680 0.737   -2.556  1.00 0.00 ? 18 ALA A O    4  
ATOM 4959  C CB   . ALA A 1 19 ? 142.506 3.794   -1.915  1.00 0.00 ? 18 ALA A CB   4  
ATOM 4960  H H    . ALA A 1 19 ? 144.042 2.906   -3.910  1.00 0.00 ? 18 ALA A H    4  
ATOM 4961  H HA   . ALA A 1 19 ? 144.279 3.082   -0.987  1.00 0.00 ? 18 ALA A HA   4  
ATOM 4962  H HB1  . ALA A 1 19 ? 142.895 4.793   -2.044  1.00 0.00 ? 18 ALA A HB1  4  
ATOM 4963  H HB2  . ALA A 1 19 ? 141.926 3.748   -1.005  1.00 0.00 ? 18 ALA A HB2  4  
ATOM 4964  H HB3  . ALA A 1 19 ? 141.877 3.541   -2.757  1.00 0.00 ? 18 ALA A HB3  4  
ATOM 4965  N N    . PHE A 1 20 ? 143.197 0.923   -0.369  1.00 0.00 ? 19 PHE A N    4  
ATOM 4966  C CA   . PHE A 1 20 ? 142.724 -0.416  -0.025  1.00 0.00 ? 19 PHE A CA   4  
ATOM 4967  C C    . PHE A 1 20 ? 141.690 -0.354  1.097   1.00 0.00 ? 19 PHE A C    4  
ATOM 4968  O O    . PHE A 1 20 ? 141.948 0.213   2.161   1.00 0.00 ? 19 PHE A O    4  
ATOM 4969  C CB   . PHE A 1 20 ? 143.896 -1.307  0.392   1.00 0.00 ? 19 PHE A CB   4  
ATOM 4970  C CG   . PHE A 1 20 ? 144.846 -1.619  -0.732  1.00 0.00 ? 19 PHE A CG   4  
ATOM 4971  C CD1  . PHE A 1 20 ? 144.506 -2.542  -1.709  1.00 0.00 ? 19 PHE A CD1  4  
ATOM 4972  C CD2  . PHE A 1 20 ? 146.078 -0.989  -0.810  1.00 0.00 ? 19 PHE A CD2  4  
ATOM 4973  C CE1  . PHE A 1 20 ? 145.377 -2.828  -2.743  1.00 0.00 ? 19 PHE A CE1  4  
ATOM 4974  C CE2  . PHE A 1 20 ? 146.952 -1.272  -1.841  1.00 0.00 ? 19 PHE A CE2  4  
ATOM 4975  C CZ   . PHE A 1 20 ? 146.602 -2.194  -2.808  1.00 0.00 ? 19 PHE A CZ   4  
ATOM 4976  H H    . PHE A 1 20 ? 143.568 1.492   0.337   1.00 0.00 ? 19 PHE A H    4  
ATOM 4977  H HA   . PHE A 1 20 ? 142.257 -0.837  -0.903  1.00 0.00 ? 19 PHE A HA   4  
ATOM 4978  H HB2  . PHE A 1 20 ? 144.456 -0.813  1.173   1.00 0.00 ? 19 PHE A HB2  4  
ATOM 4979  H HB3  . PHE A 1 20 ? 143.510 -2.241  0.771   1.00 0.00 ? 19 PHE A HB3  4  
ATOM 4980  H HD1  . PHE A 1 20 ? 143.548 -3.038  -1.659  1.00 0.00 ? 19 PHE A HD1  4  
ATOM 4981  H HD2  . PHE A 1 20 ? 146.354 -0.268  -0.053  1.00 0.00 ? 19 PHE A HD2  4  
ATOM 4982  H HE1  . PHE A 1 20 ? 145.100 -3.550  -3.497  1.00 0.00 ? 19 PHE A HE1  4  
ATOM 4983  H HE2  . PHE A 1 20 ? 147.910 -0.775  -1.890  1.00 0.00 ? 19 PHE A HE2  4  
ATOM 4984  H HZ   . PHE A 1 20 ? 147.284 -2.417  -3.615  1.00 0.00 ? 19 PHE A HZ   4  
ATOM 4985  N N    . SER A 1 21 ? 140.520 -0.941  0.850   1.00 0.00 ? 20 SER A N    4  
ATOM 4986  C CA   . SER A 1 21 ? 139.441 -0.956  1.835   1.00 0.00 ? 20 SER A CA   4  
ATOM 4987  C C    . SER A 1 21 ? 139.775 -1.891  2.995   1.00 0.00 ? 20 SER A C    4  
ATOM 4988  O O    . SER A 1 21 ? 140.066 -3.071  2.788   1.00 0.00 ? 20 SER A O    4  
ATOM 4989  C CB   . SER A 1 21 ? 138.127 -1.386  1.177   1.00 0.00 ? 20 SER A CB   4  
ATOM 4990  O OG   . SER A 1 21 ? 138.033 -0.893  -0.150  1.00 0.00 ? 20 SER A OG   4  
ATOM 4991  H H    . SER A 1 21 ? 140.378 -1.374  -0.018  1.00 0.00 ? 20 SER A H    4  
ATOM 4992  H HA   . SER A 1 21 ? 139.329 0.048   2.218   1.00 0.00 ? 20 SER A HA   4  
ATOM 4993  H HB2  . SER A 1 21 ? 138.076 -2.465  1.151   1.00 0.00 ? 20 SER A HB2  4  
ATOM 4994  H HB3  . SER A 1 21 ? 137.296 -1.002  1.751   1.00 0.00 ? 20 SER A HB3  4  
ATOM 4995  H HG   . SER A 1 21 ? 138.044 0.067   -0.137  1.00 0.00 ? 20 SER A HG   4  
ATOM 4996  N N    . ARG A 1 22 ? 139.731 -1.358  4.214   1.00 0.00 ? 21 ARG A N    4  
ATOM 4997  C CA   . ARG A 1 22 ? 140.031 -2.146  5.407   1.00 0.00 ? 21 ARG A CA   4  
ATOM 4998  C C    . ARG A 1 22 ? 138.897 -3.122  5.720   1.00 0.00 ? 21 ARG A C    4  
ATOM 4999  O O    . ARG A 1 22 ? 137.726 -2.821  5.479   1.00 0.00 ? 21 ARG A O    4  
ATOM 5000  C CB   . ARG A 1 22 ? 140.274 -1.227  6.608   1.00 0.00 ? 21 ARG A CB   4  
ATOM 5001  C CG   . ARG A 1 22 ? 141.745 -1.060  6.954   1.00 0.00 ? 21 ARG A CG   4  
ATOM 5002  C CD   . ARG A 1 22 ? 141.938 -0.721  8.423   1.00 0.00 ? 21 ARG A CD   4  
ATOM 5003  N NE   . ARG A 1 22 ? 142.016 0.722   8.649   1.00 0.00 ? 21 ARG A NE   4  
ATOM 5004  C CZ   . ARG A 1 22 ? 141.820 1.302   9.835   1.00 0.00 ? 21 ARG A CZ   4  
ATOM 5005  N NH1  . ARG A 1 22 ? 141.533 0.569   10.907  1.00 0.00 ? 21 ARG A NH1  4  
ATOM 5006  N NH2  . ARG A 1 22 ? 141.913 2.622   9.950   1.00 0.00 ? 21 ARG A NH2  4  
ATOM 5007  H H    . ARG A 1 22 ? 139.493 -0.413  4.314   1.00 0.00 ? 21 ARG A H    4  
ATOM 5008  H HA   . ARG A 1 22 ? 140.930 -2.709  5.210   1.00 0.00 ? 21 ARG A HA   4  
ATOM 5009  H HB2  . ARG A 1 22 ? 139.864 -0.252  6.390   1.00 0.00 ? 21 ARG A HB2  4  
ATOM 5010  H HB3  . ARG A 1 22 ? 139.767 -1.637  7.469   1.00 0.00 ? 21 ARG A HB3  4  
ATOM 5011  H HG2  . ARG A 1 22 ? 142.264 -1.981  6.737   1.00 0.00 ? 21 ARG A HG2  4  
ATOM 5012  H HG3  . ARG A 1 22 ? 142.157 -0.262  6.353   1.00 0.00 ? 21 ARG A HG3  4  
ATOM 5013  H HD2  . ARG A 1 22 ? 141.103 -1.118  8.983   1.00 0.00 ? 21 ARG A HD2  4  
ATOM 5014  H HD3  . ARG A 1 22 ? 142.852 -1.180  8.768   1.00 0.00 ? 21 ARG A HD3  4  
ATOM 5015  H HE   . ARG A 1 22 ? 142.228 1.288   7.877   1.00 0.00 ? 21 ARG A HE   4  
ATOM 5016  H HH11 . ARG A 1 22 ? 141.463 -0.426  10.832  1.00 0.00 ? 21 ARG A HH11 4  
ATOM 5017  H HH12 . ARG A 1 22 ? 141.388 1.012   11.792  1.00 0.00 ? 21 ARG A HH12 4  
ATOM 5018  H HH21 . ARG A 1 22 ? 142.130 3.181   9.149   1.00 0.00 ? 21 ARG A HH21 4  
ATOM 5019  H HH22 . ARG A 1 22 ? 141.766 3.058   10.838  1.00 0.00 ? 21 ARG A HH22 4  
ATOM 5020  N N    . PRO A 1 23 ? 139.228 -4.311  6.264   1.00 0.00 ? 22 PRO A N    4  
ATOM 5021  C CA   . PRO A 1 23 ? 140.610 -4.713  6.568   1.00 0.00 ? 22 PRO A CA   4  
ATOM 5022  C C    . PRO A 1 23 ? 141.402 -5.086  5.313   1.00 0.00 ? 22 PRO A C    4  
ATOM 5023  O O    . PRO A 1 23 ? 140.949 -5.894  4.501   1.00 0.00 ? 22 PRO A O    4  
ATOM 5024  C CB   . PRO A 1 23 ? 140.442 -5.946  7.475   1.00 0.00 ? 22 PRO A CB   4  
ATOM 5025  C CG   . PRO A 1 23 ? 138.978 -6.047  7.764   1.00 0.00 ? 22 PRO A CG   4  
ATOM 5026  C CD   . PRO A 1 23 ? 138.277 -5.363  6.629   1.00 0.00 ? 22 PRO A CD   4  
ATOM 5027  H HA   . PRO A 1 23 ? 141.136 -3.938  7.106   1.00 0.00 ? 22 PRO A HA   4  
ATOM 5028  H HB2  . PRO A 1 23 ? 140.799 -6.823  6.957   1.00 0.00 ? 22 PRO A HB2  4  
ATOM 5029  H HB3  . PRO A 1 23 ? 141.012 -5.805  8.382   1.00 0.00 ? 22 PRO A HB3  4  
ATOM 5030  H HG2  . PRO A 1 23 ? 138.685 -7.085  7.813   1.00 0.00 ? 22 PRO A HG2  4  
ATOM 5031  H HG3  . PRO A 1 23 ? 138.754 -5.550  8.697   1.00 0.00 ? 22 PRO A HG3  4  
ATOM 5032  H HD2  . PRO A 1 23 ? 138.120 -6.049  5.809   1.00 0.00 ? 22 PRO A HD2  4  
ATOM 5033  H HD3  . PRO A 1 23 ? 137.341 -4.940  6.959   1.00 0.00 ? 22 PRO A HD3  4  
ATOM 5034  N N    . VAL A 1 24 ? 142.591 -4.497  5.165   1.00 0.00 ? 23 VAL A N    4  
ATOM 5035  C CA   . VAL A 1 24 ? 143.448 -4.770  4.011   1.00 0.00 ? 23 VAL A CA   4  
ATOM 5036  C C    . VAL A 1 24 ? 144.500 -5.834  4.340   1.00 0.00 ? 23 VAL A C    4  
ATOM 5037  O O    . VAL A 1 24 ? 145.190 -5.745  5.356   1.00 0.00 ? 23 VAL A O    4  
ATOM 5038  C CB   . VAL A 1 24 ? 144.152 -3.488  3.508   1.00 0.00 ? 23 VAL A CB   4  
ATOM 5039  C CG1  . VAL A 1 24 ? 145.070 -2.910  4.579   1.00 0.00 ? 23 VAL A CG1  4  
ATOM 5040  C CG2  . VAL A 1 24 ? 144.927 -3.768  2.229   1.00 0.00 ? 23 VAL A CG2  4  
ATOM 5041  H H    . VAL A 1 24 ? 142.899 -3.866  5.848   1.00 0.00 ? 23 VAL A H    4  
ATOM 5042  H HA   . VAL A 1 24 ? 142.818 -5.141  3.215   1.00 0.00 ? 23 VAL A HA   4  
ATOM 5043  H HB   . VAL A 1 24 ? 143.392 -2.751  3.286   1.00 0.00 ? 23 VAL A HB   4  
ATOM 5044  H HG11 . VAL A 1 24 ? 144.816 -3.333  5.539   1.00 0.00 ? 23 VAL A HG11 4  
ATOM 5045  H HG12 . VAL A 1 24 ? 144.952 -1.837  4.616   1.00 0.00 ? 23 VAL A HG12 4  
ATOM 5046  H HG13 . VAL A 1 24 ? 146.095 -3.151  4.340   1.00 0.00 ? 23 VAL A HG13 4  
ATOM 5047  H HG21 . VAL A 1 24 ? 145.353 -2.848  1.857   1.00 0.00 ? 23 VAL A HG21 4  
ATOM 5048  H HG22 . VAL A 1 24 ? 144.261 -4.183  1.487   1.00 0.00 ? 23 VAL A HG22 4  
ATOM 5049  H HG23 . VAL A 1 24 ? 145.719 -4.473  2.436   1.00 0.00 ? 23 VAL A HG23 4  
ATOM 5050  N N    . LYS A 1 25 ? 144.613 -6.839  3.472   1.00 0.00 ? 24 LYS A N    4  
ATOM 5051  C CA   . LYS A 1 25 ? 145.578 -7.921  3.667   1.00 0.00 ? 24 LYS A CA   4  
ATOM 5052  C C    . LYS A 1 25 ? 146.920 -7.582  3.020   1.00 0.00 ? 24 LYS A C    4  
ATOM 5053  O O    . LYS A 1 25 ? 146.964 -7.028  1.920   1.00 0.00 ? 24 LYS A O    4  
ATOM 5054  C CB   . LYS A 1 25 ? 145.040 -9.231  3.080   1.00 0.00 ? 24 LYS A CB   4  
ATOM 5055  C CG   . LYS A 1 25 ? 143.678 -9.636  3.623   1.00 0.00 ? 24 LYS A CG   4  
ATOM 5056  C CD   . LYS A 1 25 ? 143.765 -10.098 5.070   1.00 0.00 ? 24 LYS A CD   4  
ATOM 5057  C CE   . LYS A 1 25 ? 142.665 -9.480  5.919   1.00 0.00 ? 24 LYS A CE   4  
ATOM 5058  N NZ   . LYS A 1 25 ? 142.937 -8.048  6.231   1.00 0.00 ? 24 LYS A NZ   4  
ATOM 5059  H H    . LYS A 1 25 ? 144.034 -6.854  2.681   1.00 0.00 ? 24 LYS A H    4  
ATOM 5060  H HA   . LYS A 1 25 ? 145.725 -8.047  4.729   1.00 0.00 ? 24 LYS A HA   4  
ATOM 5061  H HB2  . LYS A 1 25 ? 144.957 -9.122  2.008   1.00 0.00 ? 24 LYS A HB2  4  
ATOM 5062  H HB3  . LYS A 1 25 ? 145.741 -10.023 3.298   1.00 0.00 ? 24 LYS A HB3  4  
ATOM 5063  H HG2  . LYS A 1 25 ? 143.012 -8.788  3.567   1.00 0.00 ? 24 LYS A HG2  4  
ATOM 5064  H HG3  . LYS A 1 25 ? 143.288 -10.443 3.020   1.00 0.00 ? 24 LYS A HG3  4  
ATOM 5065  H HD2  . LYS A 1 25 ? 143.669 -11.174 5.101   1.00 0.00 ? 24 LYS A HD2  4  
ATOM 5066  H HD3  . LYS A 1 25 ? 144.725 -9.810  5.473   1.00 0.00 ? 24 LYS A HD3  4  
ATOM 5067  H HE2  . LYS A 1 25 ? 141.732 -9.550  5.381   1.00 0.00 ? 24 LYS A HE2  4  
ATOM 5068  H HE3  . LYS A 1 25 ? 142.589 -10.033 6.844   1.00 0.00 ? 24 LYS A HE3  4  
ATOM 5069  H HZ1  . LYS A 1 25 ? 142.475 -7.437  5.529   1.00 0.00 ? 24 LYS A HZ1  4  
ATOM 5070  H HZ2  . LYS A 1 25 ? 143.961 -7.863  6.213   1.00 0.00 ? 24 LYS A HZ2  4  
ATOM 5071  H HZ3  . LYS A 1 25 ? 142.572 -7.812  7.175   1.00 0.00 ? 24 LYS A HZ3  4  
ATOM 5072  N N    . TYR A 1 26 ? 148.012 -7.925  3.706   1.00 0.00 ? 25 TYR A N    4  
ATOM 5073  C CA   . TYR A 1 26 ? 149.359 -7.662  3.195   1.00 0.00 ? 25 TYR A CA   4  
ATOM 5074  C C    . TYR A 1 26 ? 149.581 -8.355  1.851   1.00 0.00 ? 25 TYR A C    4  
ATOM 5075  O O    . TYR A 1 26 ? 150.117 -7.755  0.918   1.00 0.00 ? 25 TYR A O    4  
ATOM 5076  C CB   . TYR A 1 26 ? 150.417 -8.130  4.200   1.00 0.00 ? 25 TYR A CB   4  
ATOM 5077  C CG   . TYR A 1 26 ? 151.837 -7.788  3.793   1.00 0.00 ? 25 TYR A CG   4  
ATOM 5078  C CD1  . TYR A 1 26 ? 152.402 -6.564  4.129   1.00 0.00 ? 25 TYR A CD1  4  
ATOM 5079  C CD2  . TYR A 1 26 ? 152.612 -8.691  3.073   1.00 0.00 ? 25 TYR A CD2  4  
ATOM 5080  C CE1  . TYR A 1 26 ? 153.694 -6.248  3.758   1.00 0.00 ? 25 TYR A CE1  4  
ATOM 5081  C CE2  . TYR A 1 26 ? 153.905 -8.382  2.700   1.00 0.00 ? 25 TYR A CE2  4  
ATOM 5082  C CZ   . TYR A 1 26 ? 154.442 -7.160  3.045   1.00 0.00 ? 25 TYR A CZ   4  
ATOM 5083  O OH   . TYR A 1 26 ? 155.730 -6.848  2.674   1.00 0.00 ? 25 TYR A OH   4  
ATOM 5084  H H    . TYR A 1 26 ? 147.910 -8.368  4.575   1.00 0.00 ? 25 TYR A H    4  
ATOM 5085  H HA   . TYR A 1 26 ? 149.457 -6.595  3.055   1.00 0.00 ? 25 TYR A HA   4  
ATOM 5086  H HB2  . TYR A 1 26 ? 150.226 -7.666  5.156   1.00 0.00 ? 25 TYR A HB2  4  
ATOM 5087  H HB3  . TYR A 1 26 ? 150.350 -9.203  4.306   1.00 0.00 ? 25 TYR A HB3  4  
ATOM 5088  H HD1  . TYR A 1 26 ? 151.813 -5.851  4.688   1.00 0.00 ? 25 TYR A HD1  4  
ATOM 5089  H HD2  . TYR A 1 26 ? 152.189 -9.648  2.802   1.00 0.00 ? 25 TYR A HD2  4  
ATOM 5090  H HE1  . TYR A 1 26 ? 154.115 -5.292  4.029   1.00 0.00 ? 25 TYR A HE1  4  
ATOM 5091  H HE2  . TYR A 1 26 ? 154.491 -9.097  2.140   1.00 0.00 ? 25 TYR A HE2  4  
ATOM 5092  H HH   . TYR A 1 26 ? 155.803 -6.867  1.716   1.00 0.00 ? 25 TYR A HH   4  
ATOM 5093  N N    . GLU A 1 27 ? 149.166 -9.620  1.760   1.00 0.00 ? 26 GLU A N    4  
ATOM 5094  C CA   . GLU A 1 27 ? 149.320 -10.391 0.529   1.00 0.00 ? 26 GLU A CA   4  
ATOM 5095  C C    . GLU A 1 27 ? 148.612 -9.706  -0.636  1.00 0.00 ? 26 GLU A C    4  
ATOM 5096  O O    . GLU A 1 27 ? 149.118 -9.695  -1.758  1.00 0.00 ? 26 GLU A O    4  
ATOM 5097  C CB   . GLU A 1 27 ? 148.767 -11.808 0.706   1.00 0.00 ? 26 GLU A CB   4  
ATOM 5098  C CG   . GLU A 1 27 ? 149.846 -12.865 0.881   1.00 0.00 ? 26 GLU A CG   4  
ATOM 5099  C CD   . GLU A 1 27 ? 149.527 -13.848 1.990   1.00 0.00 ? 26 GLU A CD   4  
ATOM 5100  O OE1  . GLU A 1 27 ? 148.714 -14.766 1.755   1.00 0.00 ? 26 GLU A OE1  4  
ATOM 5101  O OE2  . GLU A 1 27 ? 150.090 -13.697 3.095   1.00 0.00 ? 26 GLU A OE2  4  
ATOM 5102  H H    . GLU A 1 27 ? 148.747 -10.042 2.539   1.00 0.00 ? 26 GLU A H    4  
ATOM 5103  H HA   . GLU A 1 27 ? 150.376 -10.452 0.306   1.00 0.00 ? 26 GLU A HA   4  
ATOM 5104  H HB2  . GLU A 1 27 ? 148.127 -11.829 1.575   1.00 0.00 ? 26 GLU A HB2  4  
ATOM 5105  H HB3  . GLU A 1 27 ? 148.182 -12.065 -0.166  1.00 0.00 ? 26 GLU A HB3  4  
ATOM 5106  H HG2  . GLU A 1 27 ? 149.948 -13.412 -0.044  1.00 0.00 ? 26 GLU A HG2  4  
ATOM 5107  H HG3  . GLU A 1 27 ? 150.779 -12.373 1.112   1.00 0.00 ? 26 GLU A HG3  4  
ATOM 5108  N N    . ASP A 1 28 ? 147.440 -9.133  -0.362  1.00 0.00 ? 27 ASP A N    4  
ATOM 5109  C CA   . ASP A 1 28 ? 146.668 -8.444  -1.390  1.00 0.00 ? 27 ASP A CA   4  
ATOM 5110  C C    . ASP A 1 28 ? 147.408 -7.206  -1.894  1.00 0.00 ? 27 ASP A C    4  
ATOM 5111  O O    . ASP A 1 28 ? 147.473 -6.963  -3.099  1.00 0.00 ? 27 ASP A O    4  
ATOM 5112  C CB   . ASP A 1 28 ? 145.291 -8.046  -0.851  1.00 0.00 ? 27 ASP A CB   4  
ATOM 5113  C CG   . ASP A 1 28 ? 144.228 -8.016  -1.934  1.00 0.00 ? 27 ASP A CG   4  
ATOM 5114  O OD1  . ASP A 1 28 ? 144.142 -8.991  -2.712  1.00 0.00 ? 27 ASP A OD1  4  
ATOM 5115  O OD2  . ASP A 1 28 ? 143.481 -7.019  -2.003  1.00 0.00 ? 27 ASP A OD2  4  
ATOM 5116  H H    . ASP A 1 28 ? 147.090 -9.174  0.553   1.00 0.00 ? 27 ASP A H    4  
ATOM 5117  H HA   . ASP A 1 28 ? 146.537 -9.128  -2.214  1.00 0.00 ? 27 ASP A HA   4  
ATOM 5118  H HB2  . ASP A 1 28 ? 144.988 -8.755  -0.095  1.00 0.00 ? 27 ASP A HB2  4  
ATOM 5119  H HB3  . ASP A 1 28 ? 145.355 -7.063  -0.408  1.00 0.00 ? 27 ASP A HB3  4  
ATOM 5120  N N    . VAL A 1 29 ? 147.966 -6.428  -0.966  1.00 0.00 ? 28 VAL A N    4  
ATOM 5121  C CA   . VAL A 1 29 ? 148.700 -5.216  -1.327  1.00 0.00 ? 28 VAL A CA   4  
ATOM 5122  C C    . VAL A 1 29 ? 149.996 -5.562  -2.058  1.00 0.00 ? 28 VAL A C    4  
ATOM 5123  O O    . VAL A 1 29 ? 150.284 -5.011  -3.123  1.00 0.00 ? 28 VAL A O    4  
ATOM 5124  C CB   . VAL A 1 29 ? 149.031 -4.357  -0.086  1.00 0.00 ? 28 VAL A CB   4  
ATOM 5125  C CG1  . VAL A 1 29 ? 149.634 -3.022  -0.501  1.00 0.00 ? 28 VAL A CG1  4  
ATOM 5126  C CG2  . VAL A 1 29 ? 147.787 -4.147  0.766   1.00 0.00 ? 28 VAL A CG2  4  
ATOM 5127  H H    . VAL A 1 29 ? 147.883 -6.673  -0.019  1.00 0.00 ? 28 VAL A H    4  
ATOM 5128  H HA   . VAL A 1 29 ? 148.073 -4.633  -1.986  1.00 0.00 ? 28 VAL A HA   4  
ATOM 5129  H HB   . VAL A 1 29 ? 149.762 -4.886  0.508   1.00 0.00 ? 28 VAL A HB   4  
ATOM 5130  H HG11 . VAL A 1 29 ? 148.873 -2.257  -0.469  1.00 0.00 ? 28 VAL A HG11 4  
ATOM 5131  H HG12 . VAL A 1 29 ? 150.024 -3.098  -1.506  1.00 0.00 ? 28 VAL A HG12 4  
ATOM 5132  H HG13 . VAL A 1 29 ? 150.434 -2.762  0.175   1.00 0.00 ? 28 VAL A HG13 4  
ATOM 5133  H HG21 . VAL A 1 29 ? 147.781 -3.138  1.154   1.00 0.00 ? 28 VAL A HG21 4  
ATOM 5134  H HG22 . VAL A 1 29 ? 147.791 -4.848  1.587   1.00 0.00 ? 28 VAL A HG22 4  
ATOM 5135  H HG23 . VAL A 1 29 ? 146.905 -4.305  0.162   1.00 0.00 ? 28 VAL A HG23 4  
ATOM 5136  N N    . GLU A 1 30 ? 150.767 -6.485  -1.483  1.00 0.00 ? 29 GLU A N    4  
ATOM 5137  C CA   . GLU A 1 30 ? 152.031 -6.918  -2.077  1.00 0.00 ? 29 GLU A CA   4  
ATOM 5138  C C    . GLU A 1 30 ? 151.814 -7.500  -3.474  1.00 0.00 ? 29 GLU A C    4  
ATOM 5139  O O    . GLU A 1 30 ? 152.588 -7.233  -4.394  1.00 0.00 ? 29 GLU A O    4  
ATOM 5140  C CB   . GLU A 1 30 ? 152.706 -7.956  -1.178  1.00 0.00 ? 29 GLU A CB   4  
ATOM 5141  C CG   . GLU A 1 30 ? 154.151 -8.244  -1.558  1.00 0.00 ? 29 GLU A CG   4  
ATOM 5142  C CD   . GLU A 1 30 ? 154.613 -9.628  -1.136  1.00 0.00 ? 29 GLU A CD   4  
ATOM 5143  O OE1  . GLU A 1 30 ? 154.187 -10.098 -0.059  1.00 0.00 ? 29 GLU A OE1  4  
ATOM 5144  O OE2  . GLU A 1 30 ? 155.405 -10.241 -1.883  1.00 0.00 ? 29 GLU A OE2  4  
ATOM 5145  H H    . GLU A 1 30 ? 150.476 -6.889  -0.638  1.00 0.00 ? 29 GLU A H    4  
ATOM 5146  H HA   . GLU A 1 30 ? 152.674 -6.053  -2.155  1.00 0.00 ? 29 GLU A HA   4  
ATOM 5147  H HB2  . GLU A 1 30 ? 152.689 -7.598  -0.159  1.00 0.00 ? 29 GLU A HB2  4  
ATOM 5148  H HB3  . GLU A 1 30 ? 152.149 -8.881  -1.235  1.00 0.00 ? 29 GLU A HB3  4  
ATOM 5149  H HG2  . GLU A 1 30 ? 154.248 -8.165  -2.630  1.00 0.00 ? 29 GLU A HG2  4  
ATOM 5150  H HG3  . GLU A 1 30 ? 154.786 -7.509  -1.086  1.00 0.00 ? 29 GLU A HG3  4  
ATOM 5151  N N    . HIS A 1 31 ? 150.753 -8.296  -3.623  1.00 0.00 ? 30 HIS A N    4  
ATOM 5152  C CA   . HIS A 1 31 ? 150.428 -8.917  -4.906  1.00 0.00 ? 30 HIS A CA   4  
ATOM 5153  C C    . HIS A 1 31 ? 150.238 -7.860  -5.993  1.00 0.00 ? 30 HIS A C    4  
ATOM 5154  O O    . HIS A 1 31 ? 150.699 -8.031  -7.123  1.00 0.00 ? 30 HIS A O    4  
ATOM 5155  C CB   . HIS A 1 31 ? 149.155 -9.762  -4.776  1.00 0.00 ? 30 HIS A CB   4  
ATOM 5156  C CG   . HIS A 1 31 ? 148.836 -10.570 -5.998  1.00 0.00 ? 30 HIS A CG   4  
ATOM 5157  N ND1  . HIS A 1 31 ? 149.546 -11.695 -6.364  1.00 0.00 ? 30 HIS A ND1  4  
ATOM 5158  C CD2  . HIS A 1 31 ? 147.871 -10.416 -6.937  1.00 0.00 ? 30 HIS A CD2  4  
ATOM 5159  C CE1  . HIS A 1 31 ? 149.032 -12.196 -7.473  1.00 0.00 ? 30 HIS A CE1  4  
ATOM 5160  N NE2  . HIS A 1 31 ? 148.014 -11.440 -7.841  1.00 0.00 ? 30 HIS A NE2  4  
ATOM 5161  H H    . HIS A 1 31 ? 150.176 -8.471  -2.850  1.00 0.00 ? 30 HIS A H    4  
ATOM 5162  H HA   . HIS A 1 31 ? 151.251 -9.560  -5.183  1.00 0.00 ? 30 HIS A HA   4  
ATOM 5163  H HB2  . HIS A 1 31 ? 149.268 -10.446 -3.949  1.00 0.00 ? 30 HIS A HB2  4  
ATOM 5164  H HB3  . HIS A 1 31 ? 148.318 -9.107  -4.583  1.00 0.00 ? 30 HIS A HB3  4  
ATOM 5165  H HD1  . HIS A 1 31 ? 150.313 -12.068 -5.882  1.00 0.00 ? 30 HIS A HD1  4  
ATOM 5166  H HD2  . HIS A 1 31 ? 147.125 -9.633  -6.967  1.00 0.00 ? 30 HIS A HD2  4  
ATOM 5167  H HE1  . HIS A 1 31 ? 149.383 -13.077 -7.990  1.00 0.00 ? 30 HIS A HE1  4  
ATOM 5168  H HE2  . HIS A 1 31 ? 147.392 -11.646 -8.569  1.00 0.00 ? 30 HIS A HE2  4  
ATOM 5169  N N    . LYS A 1 32 ? 149.561 -6.767  -5.643  1.00 0.00 ? 31 LYS A N    4  
ATOM 5170  C CA   . LYS A 1 32 ? 149.314 -5.680  -6.588  1.00 0.00 ? 31 LYS A CA   4  
ATOM 5171  C C    . LYS A 1 32 ? 150.622 -5.033  -7.042  1.00 0.00 ? 31 LYS A C    4  
ATOM 5172  O O    . LYS A 1 32 ? 150.837 -4.832  -8.236  1.00 0.00 ? 31 LYS A O    4  
ATOM 5173  C CB   . LYS A 1 32 ? 148.400 -4.623  -5.960  1.00 0.00 ? 31 LYS A CB   4  
ATOM 5174  C CG   . LYS A 1 32 ? 147.375 -4.051  -6.928  1.00 0.00 ? 31 LYS A CG   4  
ATOM 5175  C CD   . LYS A 1 32 ? 146.246 -3.349  -6.191  1.00 0.00 ? 31 LYS A CD   4  
ATOM 5176  C CE   . LYS A 1 32 ? 145.038 -3.130  -7.088  1.00 0.00 ? 31 LYS A CE   4  
ATOM 5177  N NZ   . LYS A 1 32 ? 143.757 -3.215  -6.330  1.00 0.00 ? 31 LYS A NZ   4  
ATOM 5178  H H    . LYS A 1 32 ? 149.220 -6.688  -4.726  1.00 0.00 ? 31 LYS A H    4  
ATOM 5179  H HA   . LYS A 1 32 ? 148.820 -6.101  -7.452  1.00 0.00 ? 31 LYS A HA   4  
ATOM 5180  H HB2  . LYS A 1 32 ? 147.870 -5.068  -5.131  1.00 0.00 ? 31 LYS A HB2  4  
ATOM 5181  H HB3  . LYS A 1 32 ? 149.008 -3.810  -5.592  1.00 0.00 ? 31 LYS A HB3  4  
ATOM 5182  H HG2  . LYS A 1 32 ? 147.863 -3.341  -7.579  1.00 0.00 ? 31 LYS A HG2  4  
ATOM 5183  H HG3  . LYS A 1 32 ? 146.962 -4.857  -7.517  1.00 0.00 ? 31 LYS A HG3  4  
ATOM 5184  H HD2  . LYS A 1 32 ? 145.950 -3.955  -5.348  1.00 0.00 ? 31 LYS A HD2  4  
ATOM 5185  H HD3  . LYS A 1 32 ? 146.601 -2.391  -5.840  1.00 0.00 ? 31 LYS A HD3  4  
ATOM 5186  H HE2  . LYS A 1 32 ? 145.113 -2.151  -7.538  1.00 0.00 ? 31 LYS A HE2  4  
ATOM 5187  H HE3  . LYS A 1 32 ? 145.038 -3.882  -7.863  1.00 0.00 ? 31 LYS A HE3  4  
ATOM 5188  H HZ1  . LYS A 1 32 ? 143.909 -2.947  -5.336  1.00 0.00 ? 31 LYS A HZ1  4  
ATOM 5189  H HZ2  . LYS A 1 32 ? 143.386 -4.186  -6.361  1.00 0.00 ? 31 LYS A HZ2  4  
ATOM 5190  H HZ3  . LYS A 1 32 ? 143.051 -2.575  -6.746  1.00 0.00 ? 31 LYS A HZ3  4  
ATOM 5191  N N    . VAL A 1 33 ? 151.491 -4.711  -6.085  1.00 0.00 ? 32 VAL A N    4  
ATOM 5192  C CA   . VAL A 1 33 ? 152.776 -4.084  -6.400  1.00 0.00 ? 32 VAL A CA   4  
ATOM 5193  C C    . VAL A 1 33 ? 153.641 -5.003  -7.260  1.00 0.00 ? 32 VAL A C    4  
ATOM 5194  O O    . VAL A 1 33 ? 154.282 -4.554  -8.212  1.00 0.00 ? 32 VAL A O    4  
ATOM 5195  C CB   . VAL A 1 33 ? 153.559 -3.706  -5.124  1.00 0.00 ? 32 VAL A CB   4  
ATOM 5196  C CG1  . VAL A 1 33 ? 154.806 -2.911  -5.480  1.00 0.00 ? 32 VAL A CG1  4  
ATOM 5197  C CG2  . VAL A 1 33 ? 152.675 -2.923  -4.163  1.00 0.00 ? 32 VAL A CG2  4  
ATOM 5198  H H    . VAL A 1 33 ? 151.266 -4.898  -5.148  1.00 0.00 ? 32 VAL A H    4  
ATOM 5199  H HA   . VAL A 1 33 ? 152.574 -3.179  -6.953  1.00 0.00 ? 32 VAL A HA   4  
ATOM 5200  H HB   . VAL A 1 33 ? 153.869 -4.617  -4.633  1.00 0.00 ? 32 VAL A HB   4  
ATOM 5201  H HG11 . VAL A 1 33 ? 155.522 -3.562  -5.960  1.00 0.00 ? 32 VAL A HG11 4  
ATOM 5202  H HG12 . VAL A 1 33 ? 155.240 -2.497  -4.582  1.00 0.00 ? 32 VAL A HG12 4  
ATOM 5203  H HG13 . VAL A 1 33 ? 154.540 -2.110  -6.154  1.00 0.00 ? 32 VAL A HG13 4  
ATOM 5204  H HG21 . VAL A 1 33 ? 153.290 -2.290  -3.540  1.00 0.00 ? 32 VAL A HG21 4  
ATOM 5205  H HG22 . VAL A 1 33 ? 152.122 -3.611  -3.541  1.00 0.00 ? 32 VAL A HG22 4  
ATOM 5206  H HG23 . VAL A 1 33 ? 151.985 -2.312  -4.725  1.00 0.00 ? 32 VAL A HG23 4  
ATOM 5207  N N    . THR A 1 34 ? 153.651 -6.289  -6.915  1.00 0.00 ? 33 THR A N    4  
ATOM 5208  C CA   . THR A 1 34 ? 154.434 -7.276  -7.650  1.00 0.00 ? 33 THR A CA   4  
ATOM 5209  C C    . THR A 1 34 ? 153.913 -7.444  -9.079  1.00 0.00 ? 33 THR A C    4  
ATOM 5210  O O    . THR A 1 34 ? 154.699 -7.592  -10.014 1.00 0.00 ? 33 THR A O    4  
ATOM 5211  C CB   . THR A 1 34 ? 154.418 -8.620  -6.915  1.00 0.00 ? 33 THR A CB   4  
ATOM 5212  O OG1  . THR A 1 34 ? 154.940 -8.477  -5.606  1.00 0.00 ? 33 THR A OG1  4  
ATOM 5213  C CG2  . THR A 1 34 ? 155.222 -9.700  -7.613  1.00 0.00 ? 33 THR A CG2  4  
ATOM 5214  H H    . THR A 1 34 ? 153.118 -6.582  -6.146  1.00 0.00 ? 33 THR A H    4  
ATOM 5215  H HA   . THR A 1 34 ? 155.451 -6.917  -7.695  1.00 0.00 ? 33 THR A HA   4  
ATOM 5216  H HB   . THR A 1 34 ? 153.397 -8.965  -6.837  1.00 0.00 ? 33 THR A HB   4  
ATOM 5217  H HG1  . THR A 1 34 ? 154.249 -8.161  -5.018  1.00 0.00 ? 33 THR A HG1  4  
ATOM 5218  H HG21 . THR A 1 34 ? 155.593 -10.403 -6.880  1.00 0.00 ? 33 THR A HG21 4  
ATOM 5219  H HG22 . THR A 1 34 ? 156.054 -9.251  -8.134  1.00 0.00 ? 33 THR A HG22 4  
ATOM 5220  H HG23 . THR A 1 34 ? 154.591 -10.217 -8.320  1.00 0.00 ? 33 THR A HG23 4  
ATOM 5221  N N    . THR A 1 35 ? 152.586 -7.420  -9.246  1.00 0.00 ? 34 THR A N    4  
ATOM 5222  C CA   . THR A 1 35 ? 151.978 -7.569  -10.570 1.00 0.00 ? 34 THR A CA   4  
ATOM 5223  C C    . THR A 1 35 ? 152.207 -6.325  -11.431 1.00 0.00 ? 34 THR A C    4  
ATOM 5224  O O    . THR A 1 35 ? 152.550 -6.437  -12.608 1.00 0.00 ? 34 THR A O    4  
ATOM 5225  C CB   . THR A 1 35 ? 150.475 -7.860  -10.459 1.00 0.00 ? 34 THR A CB   4  
ATOM 5226  O OG1  . THR A 1 35 ? 150.244 -9.024  -9.686  1.00 0.00 ? 34 THR A OG1  4  
ATOM 5227  C CG2  . THR A 1 35 ? 149.805 -8.067  -11.804 1.00 0.00 ? 34 THR A CG2  4  
ATOM 5228  H H    . THR A 1 35 ? 152.006 -7.299  -8.464  1.00 0.00 ? 34 THR A H    4  
ATOM 5229  H HA   . THR A 1 35 ? 152.457 -8.408  -11.053 1.00 0.00 ? 34 THR A HA   4  
ATOM 5230  H HB   . THR A 1 35 ? 149.988 -7.026  -9.973  1.00 0.00 ? 34 THR A HB   4  
ATOM 5231  H HG1  . THR A 1 35 ? 149.449 -8.907  -9.161  1.00 0.00 ? 34 THR A HG1  4  
ATOM 5232  H HG21 . THR A 1 35 ? 150.487 -7.786  -12.593 1.00 0.00 ? 34 THR A HG21 4  
ATOM 5233  H HG22 . THR A 1 35 ? 148.915 -7.457  -11.863 1.00 0.00 ? 34 THR A HG22 4  
ATOM 5234  H HG23 . THR A 1 35 ? 149.537 -9.107  -11.915 1.00 0.00 ? 34 THR A HG23 4  
ATOM 5235  N N    . VAL A 1 36 ? 152.011 -5.141  -10.844 1.00 0.00 ? 35 VAL A N    4  
ATOM 5236  C CA   . VAL A 1 36 ? 152.195 -3.887  -11.578 1.00 0.00 ? 35 VAL A CA   4  
ATOM 5237  C C    . VAL A 1 36 ? 153.629 -3.751  -12.090 1.00 0.00 ? 35 VAL A C    4  
ATOM 5238  O O    . VAL A 1 36 ? 153.848 -3.464  -13.268 1.00 0.00 ? 35 VAL A O    4  
ATOM 5239  C CB   . VAL A 1 36 ? 151.846 -2.654  -10.713 1.00 0.00 ? 35 VAL A CB   4  
ATOM 5240  C CG1  . VAL A 1 36 ? 151.998 -1.371  -11.521 1.00 0.00 ? 35 VAL A CG1  4  
ATOM 5241  C CG2  . VAL A 1 36 ? 150.434 -2.768  -10.151 1.00 0.00 ? 35 VAL A CG2  4  
ATOM 5242  H H    . VAL A 1 36 ? 151.733 -5.110  -9.904  1.00 0.00 ? 35 VAL A H    4  
ATOM 5243  H HA   . VAL A 1 36 ? 151.525 -3.903  -12.427 1.00 0.00 ? 35 VAL A HA   4  
ATOM 5244  H HB   . VAL A 1 36 ? 152.538 -2.613  -9.884  1.00 0.00 ? 35 VAL A HB   4  
ATOM 5245  H HG11 . VAL A 1 36 ? 152.997 -1.317  -11.925 1.00 0.00 ? 35 VAL A HG11 4  
ATOM 5246  H HG12 . VAL A 1 36 ? 151.822 -0.520  -10.880 1.00 0.00 ? 35 VAL A HG12 4  
ATOM 5247  H HG13 . VAL A 1 36 ? 151.282 -1.368  -12.330 1.00 0.00 ? 35 VAL A HG13 4  
ATOM 5248  H HG21 . VAL A 1 36 ? 150.077 -3.780  -10.276 1.00 0.00 ? 35 VAL A HG21 4  
ATOM 5249  H HG22 . VAL A 1 36 ? 149.779 -2.088  -10.676 1.00 0.00 ? 35 VAL A HG22 4  
ATOM 5250  H HG23 . VAL A 1 36 ? 150.445 -2.518  -9.101  1.00 0.00 ? 35 VAL A HG23 4  
ATOM 5251  N N    . PHE A 1 37 ? 154.601 -3.956  -11.200 1.00 0.00 ? 36 PHE A N    4  
ATOM 5252  C CA   . PHE A 1 37 ? 156.014 -3.852  -11.569 1.00 0.00 ? 36 PHE A CA   4  
ATOM 5253  C C    . PHE A 1 37 ? 156.512 -5.119  -12.269 1.00 0.00 ? 36 PHE A C    4  
ATOM 5254  O O    . PHE A 1 37 ? 157.465 -5.067  -13.047 1.00 0.00 ? 36 PHE A O    4  
ATOM 5255  C CB   . PHE A 1 37 ? 156.874 -3.577  -10.333 1.00 0.00 ? 36 PHE A CB   4  
ATOM 5256  C CG   . PHE A 1 37 ? 156.607 -2.243  -9.690  1.00 0.00 ? 36 PHE A CG   4  
ATOM 5257  C CD1  . PHE A 1 37 ? 156.535 -1.086  -10.452 1.00 0.00 ? 36 PHE A CD1  4  
ATOM 5258  C CD2  . PHE A 1 37 ? 156.433 -2.149  -8.320  1.00 0.00 ? 36 PHE A CD2  4  
ATOM 5259  C CE1  . PHE A 1 37 ? 156.292 0.137   -9.857  1.00 0.00 ? 36 PHE A CE1  4  
ATOM 5260  C CE2  . PHE A 1 37 ? 156.190 -0.929  -7.721  1.00 0.00 ? 36 PHE A CE2  4  
ATOM 5261  C CZ   . PHE A 1 37 ? 156.121 0.215   -8.490  1.00 0.00 ? 36 PHE A CZ   4  
ATOM 5262  H H    . PHE A 1 37 ? 154.364 -4.179  -10.275 1.00 0.00 ? 36 PHE A H    4  
ATOM 5263  H HA   . PHE A 1 37 ? 156.113 -3.022  -12.251 1.00 0.00 ? 36 PHE A HA   4  
ATOM 5264  H HB2  . PHE A 1 37 ? 156.686 -4.345  -9.596  1.00 0.00 ? 36 PHE A HB2  4  
ATOM 5265  H HB3  . PHE A 1 37 ? 157.916 -3.607  -10.617 1.00 0.00 ? 36 PHE A HB3  4  
ATOM 5266  H HD1  . PHE A 1 37 ? 156.669 -1.147  -11.523 1.00 0.00 ? 36 PHE A HD1  4  
ATOM 5267  H HD2  . PHE A 1 37 ? 156.487 -3.044  -7.716  1.00 0.00 ? 36 PHE A HD2  4  
ATOM 5268  H HE1  . PHE A 1 37 ? 156.239 1.031   -10.461 1.00 0.00 ? 36 PHE A HE1  4  
ATOM 5269  H HE2  . PHE A 1 37 ? 156.056 -0.871  -6.652  1.00 0.00 ? 36 PHE A HE2  4  
ATOM 5270  H HZ   . PHE A 1 37 ? 155.932 1.169   -8.022  1.00 0.00 ? 36 PHE A HZ   4  
ATOM 5271  N N    . GLY A 1 38 ? 155.874 -6.254  -11.980 1.00 0.00 ? 37 GLY A N    4  
ATOM 5272  C CA   . GLY A 1 38 ? 156.276 -7.514  -12.585 1.00 0.00 ? 37 GLY A CA   4  
ATOM 5273  C C    . GLY A 1 38 ? 157.490 -8.133  -11.908 1.00 0.00 ? 37 GLY A C    4  
ATOM 5274  O O    . GLY A 1 38 ? 158.241 -8.879  -12.538 1.00 0.00 ? 37 GLY A O    4  
ATOM 5275  H H    . GLY A 1 38 ? 155.127 -6.238  -11.345 1.00 0.00 ? 37 GLY A H    4  
ATOM 5276  H HA2  . GLY A 1 38 ? 155.453 -8.209  -12.524 1.00 0.00 ? 37 GLY A HA2  4  
ATOM 5277  H HA3  . GLY A 1 38 ? 156.509 -7.341  -13.625 1.00 0.00 ? 37 GLY A HA3  4  
ATOM 5278  N N    . GLN A 1 39 ? 157.685 -7.824  -10.624 1.00 0.00 ? 38 GLN A N    4  
ATOM 5279  C CA   . GLN A 1 39 ? 158.817 -8.357  -9.867  1.00 0.00 ? 38 GLN A CA   4  
ATOM 5280  C C    . GLN A 1 39 ? 158.638 -8.112  -8.368  1.00 0.00 ? 38 GLN A C    4  
ATOM 5281  O O    . GLN A 1 39 ? 157.918 -7.198  -7.964  1.00 0.00 ? 38 GLN A O    4  
ATOM 5282  C CB   . GLN A 1 39 ? 160.129 -7.722  -10.345 1.00 0.00 ? 38 GLN A CB   4  
ATOM 5283  C CG   . GLN A 1 39 ? 160.021 -6.229  -10.625 1.00 0.00 ? 38 GLN A CG   4  
ATOM 5284  C CD   . GLN A 1 39 ? 161.375 -5.560  -10.777 1.00 0.00 ? 38 GLN A CD   4  
ATOM 5285  O OE1  . GLN A 1 39 ? 162.105 -5.822  -11.733 1.00 0.00 ? 38 GLN A OE1  4  
ATOM 5286  N NE2  . GLN A 1 39 ? 161.720 -4.686  -9.835  1.00 0.00 ? 38 GLN A NE2  4  
ATOM 5287  H H    . GLN A 1 39 ? 157.053 -7.223  -10.173 1.00 0.00 ? 38 GLN A H    4  
ATOM 5288  H HA   . GLN A 1 39 ? 158.859 -9.421  -10.042 1.00 0.00 ? 38 GLN A HA   4  
ATOM 5289  H HB2  . GLN A 1 39 ? 160.884 -7.870  -9.587  1.00 0.00 ? 38 GLN A HB2  4  
ATOM 5290  H HB3  . GLN A 1 39 ? 160.442 -8.214  -11.253 1.00 0.00 ? 38 GLN A HB3  4  
ATOM 5291  H HG2  . GLN A 1 39 ? 159.466 -6.089  -11.541 1.00 0.00 ? 38 GLN A HG2  4  
ATOM 5292  H HG3  . GLN A 1 39 ? 159.492 -5.761  -9.810  1.00 0.00 ? 38 GLN A HG3  4  
ATOM 5293  H HE21 . GLN A 1 39 ? 161.092 -4.521  -9.101  1.00 0.00 ? 38 GLN A HE21 4  
ATOM 5294  H HE22 . GLN A 1 39 ? 162.591 -4.242  -9.913  1.00 0.00 ? 38 GLN A HE22 4  
ATOM 5295  N N    . PRO A 1 40 ? 159.294 -8.930  -7.521  1.00 0.00 ? 39 PRO A N    4  
ATOM 5296  C CA   . PRO A 1 40 ? 159.203 -8.795  -6.064  1.00 0.00 ? 39 PRO A CA   4  
ATOM 5297  C C    . PRO A 1 40 ? 159.981 -7.585  -5.544  1.00 0.00 ? 39 PRO A C    4  
ATOM 5298  O O    . PRO A 1 40 ? 161.214 -7.574  -5.555  1.00 0.00 ? 39 PRO A O    4  
ATOM 5299  C CB   . PRO A 1 40 ? 159.820 -10.097 -5.549  1.00 0.00 ? 39 PRO A CB   4  
ATOM 5300  C CG   . PRO A 1 40 ? 160.771 -10.513 -6.618  1.00 0.00 ? 39 PRO A CG   4  
ATOM 5301  C CD   . PRO A 1 40 ? 160.171 -10.050 -7.919  1.00 0.00 ? 39 PRO A CD   4  
ATOM 5302  H HA   . PRO A 1 40 ? 158.175 -8.727  -5.738  1.00 0.00 ? 39 PRO A HA   4  
ATOM 5303  H HB2  . PRO A 1 40 ? 160.330 -9.913  -4.615  1.00 0.00 ? 39 PRO A HB2  4  
ATOM 5304  H HB3  . PRO A 1 40 ? 159.043 -10.833 -5.403  1.00 0.00 ? 39 PRO A HB3  4  
ATOM 5305  H HG2  . PRO A 1 40 ? 161.729 -10.041 -6.459  1.00 0.00 ? 39 PRO A HG2  4  
ATOM 5306  H HG3  . PRO A 1 40 ? 160.876 -11.588 -6.616  1.00 0.00 ? 39 PRO A HG3  4  
ATOM 5307  H HD2  . PRO A 1 40 ? 160.946 -9.712  -8.590  1.00 0.00 ? 39 PRO A HD2  4  
ATOM 5308  H HD3  . PRO A 1 40 ? 159.598 -10.845 -8.373  1.00 0.00 ? 39 PRO A HD3  4  
ATOM 5309  N N    . LEU A 1 41 ? 159.250 -6.567  -5.090  1.00 0.00 ? 40 LEU A N    4  
ATOM 5310  C CA   . LEU A 1 41 ? 159.865 -5.350  -4.565  1.00 0.00 ? 40 LEU A CA   4  
ATOM 5311  C C    . LEU A 1 41 ? 159.713 -5.273  -3.048  1.00 0.00 ? 40 LEU A C    4  
ATOM 5312  O O    . LEU A 1 41 ? 158.632 -5.521  -2.510  1.00 0.00 ? 40 LEU A O    4  
ATOM 5313  C CB   . LEU A 1 41 ? 159.234 -4.110  -5.207  1.00 0.00 ? 40 LEU A CB   4  
ATOM 5314  C CG   . LEU A 1 41 ? 159.743 -3.770  -6.610  1.00 0.00 ? 40 LEU A CG   4  
ATOM 5315  C CD1  . LEU A 1 41 ? 158.971 -4.551  -7.663  1.00 0.00 ? 40 LEU A CD1  4  
ATOM 5316  C CD2  . LEU A 1 41 ? 159.631 -2.274  -6.864  1.00 0.00 ? 40 LEU A CD2  4  
ATOM 5317  H H    . LEU A 1 41 ? 158.272 -6.636  -5.109  1.00 0.00 ? 40 LEU A H    4  
ATOM 5318  H HA   . LEU A 1 41 ? 160.916 -5.377  -4.809  1.00 0.00 ? 40 LEU A HA   4  
ATOM 5319  H HB2  . LEU A 1 41 ? 158.166 -4.264  -5.261  1.00 0.00 ? 40 LEU A HB2  4  
ATOM 5320  H HB3  . LEU A 1 41 ? 159.426 -3.264  -4.565  1.00 0.00 ? 40 LEU A HB3  4  
ATOM 5321  H HG   . LEU A 1 41 ? 160.786 -4.047  -6.686  1.00 0.00 ? 40 LEU A HG   4  
ATOM 5322  H HD11 . LEU A 1 41 ? 159.474 -5.486  -7.856  1.00 0.00 ? 40 LEU A HD11 4  
ATOM 5323  H HD12 . LEU A 1 41 ? 158.923 -3.974  -8.575  1.00 0.00 ? 40 LEU A HD12 4  
ATOM 5324  H HD13 . LEU A 1 41 ? 157.971 -4.746  -7.307  1.00 0.00 ? 40 LEU A HD13 4  
ATOM 5325  H HD21 . LEU A 1 41 ? 158.664 -1.924  -6.533  1.00 0.00 ? 40 LEU A HD21 4  
ATOM 5326  H HD22 . LEU A 1 41 ? 159.743 -2.077  -7.919  1.00 0.00 ? 40 LEU A HD22 4  
ATOM 5327  H HD23 . LEU A 1 41 ? 160.407 -1.757  -6.318  1.00 0.00 ? 40 LEU A HD23 4  
ATOM 5328  N N    . ASP A 1 42 ? 160.801 -4.920  -2.366  1.00 0.00 ? 41 ASP A N    4  
ATOM 5329  C CA   . ASP A 1 42 ? 160.790 -4.800  -0.912  1.00 0.00 ? 41 ASP A CA   4  
ATOM 5330  C C    . ASP A 1 42 ? 160.292 -3.420  -0.487  1.00 0.00 ? 41 ASP A C    4  
ATOM 5331  O O    . ASP A 1 42 ? 160.731 -2.401  -1.025  1.00 0.00 ? 41 ASP A O    4  
ATOM 5332  C CB   . ASP A 1 42 ? 162.193 -5.046  -0.347  1.00 0.00 ? 41 ASP A CB   4  
ATOM 5333  C CG   . ASP A 1 42 ? 162.175 -5.804  0.970   1.00 0.00 ? 41 ASP A CG   4  
ATOM 5334  O OD1  . ASP A 1 42 ? 161.168 -5.707  1.704   1.00 0.00 ? 41 ASP A OD1  4  
ATOM 5335  O OD2  . ASP A 1 42 ? 163.172 -6.494  1.267   1.00 0.00 ? 41 ASP A OD2  4  
ATOM 5336  H H    . ASP A 1 42 ? 161.630 -4.729  -2.854  1.00 0.00 ? 41 ASP A H    4  
ATOM 5337  H HA   . ASP A 1 42 ? 160.117 -5.549  -0.522  1.00 0.00 ? 41 ASP A HA   4  
ATOM 5338  H HB2  . ASP A 1 42 ? 162.764 -5.620  -1.061  1.00 0.00 ? 41 ASP A HB2  4  
ATOM 5339  H HB3  . ASP A 1 42 ? 162.679 -4.096  -0.186  1.00 0.00 ? 41 ASP A HB3  4  
ATOM 5340  N N    . LEU A 1 43 ? 159.375 -3.395  0.479   1.00 0.00 ? 42 LEU A N    4  
ATOM 5341  C CA   . LEU A 1 43 ? 158.816 -2.140  0.976   1.00 0.00 ? 42 LEU A CA   4  
ATOM 5342  C C    . LEU A 1 43 ? 159.609 -1.629  2.178   1.00 0.00 ? 42 LEU A C    4  
ATOM 5343  O O    . LEU A 1 43 ? 159.540 -2.202  3.267   1.00 0.00 ? 42 LEU A O    4  
ATOM 5344  C CB   . LEU A 1 43 ? 157.347 -2.323  1.367   1.00 0.00 ? 42 LEU A CB   4  
ATOM 5345  C CG   . LEU A 1 43 ? 156.454 -2.940  0.287   1.00 0.00 ? 42 LEU A CG   4  
ATOM 5346  C CD1  . LEU A 1 43 ? 156.167 -4.400  0.604   1.00 0.00 ? 42 LEU A CD1  4  
ATOM 5347  C CD2  . LEU A 1 43 ? 155.156 -2.154  0.154   1.00 0.00 ? 42 LEU A CD2  4  
ATOM 5348  H H    . LEU A 1 43 ? 159.066 -4.241  0.867   1.00 0.00 ? 42 LEU A H    4  
ATOM 5349  H HA   . LEU A 1 43 ? 158.880 -1.412  0.181   1.00 0.00 ? 42 LEU A HA   4  
ATOM 5350  H HB2  . LEU A 1 43 ? 157.306 -2.955  2.242   1.00 0.00 ? 42 LEU A HB2  4  
ATOM 5351  H HB3  . LEU A 1 43 ? 156.944 -1.356  1.626   1.00 0.00 ? 42 LEU A HB3  4  
ATOM 5352  H HG   . LEU A 1 43 ? 156.968 -2.901  -0.663  1.00 0.00 ? 42 LEU A HG   4  
ATOM 5353  H HD11 . LEU A 1 43 ? 156.934 -5.021  0.165   1.00 0.00 ? 42 LEU A HD11 4  
ATOM 5354  H HD12 . LEU A 1 43 ? 155.205 -4.676  0.198   1.00 0.00 ? 42 LEU A HD12 4  
ATOM 5355  H HD13 . LEU A 1 43 ? 156.160 -4.542  1.675   1.00 0.00 ? 42 LEU A HD13 4  
ATOM 5356  H HD21 . LEU A 1 43 ? 154.828 -2.172  -0.875  1.00 0.00 ? 42 LEU A HD21 4  
ATOM 5357  H HD22 . LEU A 1 43 ? 155.321 -1.131  0.461   1.00 0.00 ? 42 LEU A HD22 4  
ATOM 5358  H HD23 . LEU A 1 43 ? 154.399 -2.600  0.781   1.00 0.00 ? 42 LEU A HD23 4  
ATOM 5359  N N    . HIS A 1 44 ? 160.361 -0.549  1.972   1.00 0.00 ? 43 HIS A N    4  
ATOM 5360  C CA   . HIS A 1 44 ? 161.165 0.037   3.039   1.00 0.00 ? 43 HIS A CA   4  
ATOM 5361  C C    . HIS A 1 44 ? 160.531 1.320   3.567   1.00 0.00 ? 43 HIS A C    4  
ATOM 5362  O O    . HIS A 1 44 ? 160.357 2.290   2.826   1.00 0.00 ? 43 HIS A O    4  
ATOM 5363  C CB   . HIS A 1 44 ? 162.584 0.322   2.543   1.00 0.00 ? 43 HIS A CB   4  
ATOM 5364  C CG   . HIS A 1 44 ? 163.635 -0.454  3.274   1.00 0.00 ? 43 HIS A CG   4  
ATOM 5365  N ND1  . HIS A 1 44 ? 163.974 -0.206  4.587   1.00 0.00 ? 43 HIS A ND1  4  
ATOM 5366  C CD2  . HIS A 1 44 ? 164.418 -1.483  2.872   1.00 0.00 ? 43 HIS A CD2  4  
ATOM 5367  C CE1  . HIS A 1 44 ? 164.921 -1.048  4.961   1.00 0.00 ? 43 HIS A CE1  4  
ATOM 5368  N NE2  . HIS A 1 44 ? 165.208 -1.833  3.939   1.00 0.00 ? 43 HIS A NE2  4  
ATOM 5369  H H    . HIS A 1 44 ? 160.375 -0.137  1.082   1.00 0.00 ? 43 HIS A H    4  
ATOM 5370  H HA   . HIS A 1 44 ? 161.214 -0.681  3.845   1.00 0.00 ? 43 HIS A HA   4  
ATOM 5371  H HB2  . HIS A 1 44 ? 162.650 0.068   1.495   1.00 0.00 ? 43 HIS A HB2  4  
ATOM 5372  H HB3  . HIS A 1 44 ? 162.797 1.373   2.668   1.00 0.00 ? 43 HIS A HB3  4  
ATOM 5373  H HD1  . HIS A 1 44 ? 163.581 0.486   5.159   1.00 0.00 ? 43 HIS A HD1  4  
ATOM 5374  H HD2  . HIS A 1 44 ? 164.422 -1.943  1.893   1.00 0.00 ? 43 HIS A HD2  4  
ATOM 5375  H HE1  . HIS A 1 44 ? 165.380 -1.089  5.938   1.00 0.00 ? 43 HIS A HE1  4  
ATOM 5376  H HE2  . HIS A 1 44 ? 165.927 -2.499  3.922   1.00 0.00 ? 43 HIS A HE2  4  
ATOM 5377  N N    . TYR A 1 45 ? 160.190 1.314   4.853   1.00 0.00 ? 44 TYR A N    4  
ATOM 5378  C CA   . TYR A 1 45 ? 159.577 2.471   5.496   1.00 0.00 ? 44 TYR A CA   4  
ATOM 5379  C C    . TYR A 1 45 ? 160.642 3.382   6.103   1.00 0.00 ? 44 TYR A C    4  
ATOM 5380  O O    . TYR A 1 45 ? 161.507 2.925   6.851   1.00 0.00 ? 44 TYR A O    4  
ATOM 5381  C CB   . TYR A 1 45 ? 158.602 2.013   6.585   1.00 0.00 ? 44 TYR A CB   4  
ATOM 5382  C CG   . TYR A 1 45 ? 157.365 2.875   6.694   1.00 0.00 ? 44 TYR A CG   4  
ATOM 5383  C CD1  . TYR A 1 45 ? 156.567 3.116   5.583   1.00 0.00 ? 44 TYR A CD1  4  
ATOM 5384  C CD2  . TYR A 1 45 ? 156.996 3.447   7.905   1.00 0.00 ? 44 TYR A CD2  4  
ATOM 5385  C CE1  . TYR A 1 45 ? 155.437 3.904   5.675   1.00 0.00 ? 44 TYR A CE1  4  
ATOM 5386  C CE2  . TYR A 1 45 ? 155.866 4.236   8.006   1.00 0.00 ? 44 TYR A CE2  4  
ATOM 5387  C CZ   . TYR A 1 45 ? 155.091 4.461   6.888   1.00 0.00 ? 44 TYR A CZ   4  
ATOM 5388  O OH   . TYR A 1 45 ? 153.965 5.247   6.985   1.00 0.00 ? 44 TYR A OH   4  
ATOM 5389  H H    . TYR A 1 45 ? 160.357 0.509   5.387   1.00 0.00 ? 44 TYR A H    4  
ATOM 5390  H HA   . TYR A 1 45 ? 159.033 3.021   4.743   1.00 0.00 ? 44 TYR A HA   4  
ATOM 5391  H HB2  . TYR A 1 45 ? 158.285 1.004   6.371   1.00 0.00 ? 44 TYR A HB2  4  
ATOM 5392  H HB3  . TYR A 1 45 ? 159.106 2.032   7.540   1.00 0.00 ? 44 TYR A HB3  4  
ATOM 5393  H HD1  . TYR A 1 45 ? 156.842 2.679   4.635   1.00 0.00 ? 44 TYR A HD1  4  
ATOM 5394  H HD2  . TYR A 1 45 ? 157.606 3.268   8.777   1.00 0.00 ? 44 TYR A HD2  4  
ATOM 5395  H HE1  . TYR A 1 45 ? 154.829 4.080   4.800   1.00 0.00 ? 44 TYR A HE1  4  
ATOM 5396  H HE2  . TYR A 1 45 ? 155.595 4.671   8.955   1.00 0.00 ? 44 TYR A HE2  4  
ATOM 5397  H HH   . TYR A 1 45 ? 154.128 6.094   6.563   1.00 0.00 ? 44 TYR A HH   4  
ATOM 5398  N N    . MET A 1 46 ? 160.570 4.671   5.779   1.00 0.00 ? 45 MET A N    4  
ATOM 5399  C CA   . MET A 1 46 ? 161.526 5.647   6.295   1.00 0.00 ? 45 MET A CA   4  
ATOM 5400  C C    . MET A 1 46 ? 160.802 6.837   6.920   1.00 0.00 ? 45 MET A C    4  
ATOM 5401  O O    . MET A 1 46 ? 160.119 7.594   6.229   1.00 0.00 ? 45 MET A O    4  
ATOM 5402  C CB   . MET A 1 46 ? 162.461 6.124   5.178   1.00 0.00 ? 45 MET A CB   4  
ATOM 5403  C CG   . MET A 1 46 ? 161.744 6.482   3.885   1.00 0.00 ? 45 MET A CG   4  
ATOM 5404  S SD   . MET A 1 46 ? 162.584 7.784   2.964   1.00 0.00 ? 45 MET A SD   4  
ATOM 5405  C CE   . MET A 1 46 ? 161.910 9.246   3.750   1.00 0.00 ? 45 MET A CE   4  
ATOM 5406  H H    . MET A 1 46 ? 159.855 4.974   5.180   1.00 0.00 ? 45 MET A H    4  
ATOM 5407  H HA   . MET A 1 46 ? 162.115 5.161   7.059   1.00 0.00 ? 45 MET A HA   4  
ATOM 5408  H HB2  . MET A 1 46 ? 162.994 6.999   5.521   1.00 0.00 ? 45 MET A HB2  4  
ATOM 5409  H HB3  . MET A 1 46 ? 163.174 5.341   4.965   1.00 0.00 ? 45 MET A HB3  4  
ATOM 5410  H HG2  . MET A 1 46 ? 161.688 5.600   3.264   1.00 0.00 ? 45 MET A HG2  4  
ATOM 5411  H HG3  . MET A 1 46 ? 160.745 6.816   4.123   1.00 0.00 ? 45 MET A HG3  4  
ATOM 5412  H HE1  . MET A 1 46 ? 162.478 9.471   4.641   1.00 0.00 ? 45 MET A HE1  4  
ATOM 5413  H HE2  . MET A 1 46 ? 160.879 9.068   4.017   1.00 0.00 ? 45 MET A HE2  4  
ATOM 5414  H HE3  . MET A 1 46 ? 161.967 10.080  3.067   1.00 0.00 ? 45 MET A HE3  4  
ATOM 5415  N N    . ASN A 1 47 ? 160.956 6.998   8.233   1.00 0.00 ? 46 ASN A N    4  
ATOM 5416  C CA   . ASN A 1 47 ? 160.317 8.099   8.951   1.00 0.00 ? 46 ASN A CA   4  
ATOM 5417  C C    . ASN A 1 47 ? 161.180 9.357   8.881   1.00 0.00 ? 46 ASN A C    4  
ATOM 5418  O O    . ASN A 1 47 ? 160.715 10.417  8.459   1.00 0.00 ? 46 ASN A O    4  
ATOM 5419  C CB   . ASN A 1 47 ? 160.071 7.709   10.411  1.00 0.00 ? 46 ASN A CB   4  
ATOM 5420  C CG   . ASN A 1 47 ? 159.049 8.603   11.087  1.00 0.00 ? 46 ASN A CG   4  
ATOM 5421  O OD1  . ASN A 1 47 ? 159.375 9.696   11.551  1.00 0.00 ? 46 ASN A OD1  4  
ATOM 5422  N ND2  . ASN A 1 47 ? 157.804 8.144   11.148  1.00 0.00 ? 46 ASN A ND2  4  
ATOM 5423  H H    . ASN A 1 47 ? 161.515 6.364   8.732   1.00 0.00 ? 46 ASN A H    4  
ATOM 5424  H HA   . ASN A 1 47 ? 159.368 8.299   8.476   1.00 0.00 ? 46 ASN A HA   4  
ATOM 5425  H HB2  . ASN A 1 47 ? 159.713 6.691   10.448  1.00 0.00 ? 46 ASN A HB2  4  
ATOM 5426  H HB3  . ASN A 1 47 ? 161.001 7.778   10.957  1.00 0.00 ? 46 ASN A HB3  4  
ATOM 5427  H HD21 . ASN A 1 47 ? 157.614 7.263   10.761  1.00 0.00 ? 46 ASN A HD21 4  
ATOM 5428  H HD22 . ASN A 1 47 ? 157.125 8.705   11.577  1.00 0.00 ? 46 ASN A HD22 4  
ATOM 5429  N N    . ASN A 1 48 ? 162.440 9.221   9.289   1.00 0.00 ? 47 ASN A N    4  
ATOM 5430  C CA   . ASN A 1 48 ? 163.387 10.332  9.270   1.00 0.00 ? 47 ASN A CA   4  
ATOM 5431  C C    . ASN A 1 48 ? 164.810 9.822   9.483   1.00 0.00 ? 47 ASN A C    4  
ATOM 5432  O O    . ASN A 1 48 ? 165.659 9.932   8.597   1.00 0.00 ? 47 ASN A O    4  
ATOM 5433  C CB   . ASN A 1 48 ? 163.032 11.370  10.342  1.00 0.00 ? 47 ASN A CB   4  
ATOM 5434  C CG   . ASN A 1 48 ? 162.487 12.653  9.745   1.00 0.00 ? 47 ASN A CG   4  
ATOM 5435  O OD1  . ASN A 1 48 ? 161.301 12.956  9.873   1.00 0.00 ? 47 ASN A OD1  4  
ATOM 5436  N ND2  . ASN A 1 48 ? 163.353 13.417  9.086   1.00 0.00 ? 47 ASN A ND2  4  
ATOM 5437  H H    . ASN A 1 48 ? 162.745 8.345   9.606   1.00 0.00 ? 47 ASN A H    4  
ATOM 5438  H HA   . ASN A 1 48 ? 163.329 10.797  8.297   1.00 0.00 ? 47 ASN A HA   4  
ATOM 5439  H HB2  . ASN A 1 48 ? 162.285 10.956  11.003  1.00 0.00 ? 47 ASN A HB2  4  
ATOM 5440  H HB3  . ASN A 1 48 ? 163.918 11.608  10.912  1.00 0.00 ? 47 ASN A HB3  4  
ATOM 5441  H HD21 . ASN A 1 48 ? 164.284 13.115  9.024   1.00 0.00 ? 47 ASN A HD21 4  
ATOM 5442  H HD22 . ASN A 1 48 ? 163.025 14.250  8.688   1.00 0.00 ? 47 ASN A HD22 4  
ATOM 5443  N N    . GLU A 1 49 ? 165.059 9.260   10.664  1.00 0.00 ? 48 GLU A N    4  
ATOM 5444  C CA   . GLU A 1 49 ? 166.376 8.725   11.005  1.00 0.00 ? 48 GLU A CA   4  
ATOM 5445  C C    . GLU A 1 49 ? 166.367 7.192   11.072  1.00 0.00 ? 48 GLU A C    4  
ATOM 5446  O O    . GLU A 1 49 ? 167.411 6.556   10.916  1.00 0.00 ? 48 GLU A O    4  
ATOM 5447  C CB   . GLU A 1 49 ? 166.852 9.305   12.341  1.00 0.00 ? 48 GLU A CB   4  
ATOM 5448  C CG   . GLU A 1 49 ? 165.976 8.922   13.527  1.00 0.00 ? 48 GLU A CG   4  
ATOM 5449  C CD   . GLU A 1 49 ? 165.713 10.089  14.459  1.00 0.00 ? 48 GLU A CD   4  
ATOM 5450  O OE1  . GLU A 1 49 ? 166.685 10.614  15.044  1.00 0.00 ? 48 GLU A OE1  4  
ATOM 5451  O OE2  . GLU A 1 49 ? 164.535 10.478  14.604  1.00 0.00 ? 48 GLU A OE2  4  
ATOM 5452  H H    . GLU A 1 49 ? 164.338 9.203   11.325  1.00 0.00 ? 48 GLU A H    4  
ATOM 5453  H HA   . GLU A 1 49 ? 167.065 9.030   10.231  1.00 0.00 ? 48 GLU A HA   4  
ATOM 5454  H HB2  . GLU A 1 49 ? 167.855 8.955   12.535  1.00 0.00 ? 48 GLU A HB2  4  
ATOM 5455  H HB3  . GLU A 1 49 ? 166.866 10.383  12.266  1.00 0.00 ? 48 GLU A HB3  4  
ATOM 5456  H HG2  . GLU A 1 49 ? 165.030 8.557   13.158  1.00 0.00 ? 48 GLU A HG2  4  
ATOM 5457  H HG3  . GLU A 1 49 ? 166.470 8.139   14.085  1.00 0.00 ? 48 GLU A HG3  4  
ATOM 5458  N N    . LEU A 1 50 ? 165.190 6.603   11.309  1.00 0.00 ? 49 LEU A N    4  
ATOM 5459  C CA   . LEU A 1 50 ? 165.067 5.150   11.401  1.00 0.00 ? 49 LEU A CA   4  
ATOM 5460  C C    . LEU A 1 50 ? 164.269 4.585   10.227  1.00 0.00 ? 49 LEU A C    4  
ATOM 5461  O O    . LEU A 1 50 ? 163.345 5.228   9.722   1.00 0.00 ? 49 LEU A O    4  
ATOM 5462  C CB   . LEU A 1 50 ? 164.399 4.760   12.723  1.00 0.00 ? 49 LEU A CB   4  
ATOM 5463  C CG   . LEU A 1 50 ? 164.677 3.330   13.195  1.00 0.00 ? 49 LEU A CG   4  
ATOM 5464  C CD1  . LEU A 1 50 ? 164.823 3.287   14.710  1.00 0.00 ? 49 LEU A CD1  4  
ATOM 5465  C CD2  . LEU A 1 50 ? 163.569 2.392   12.736  1.00 0.00 ? 49 LEU A CD2  4  
ATOM 5466  H H    . LEU A 1 50 ? 164.390 7.155   11.428  1.00 0.00 ? 49 LEU A H    4  
ATOM 5467  H HA   . LEU A 1 50 ? 166.061 4.733   11.375  1.00 0.00 ? 49 LEU A HA   4  
ATOM 5468  H HB2  . LEU A 1 50 ? 164.742 5.442   13.487  1.00 0.00 ? 49 LEU A HB2  4  
ATOM 5469  H HB3  . LEU A 1 50 ? 163.331 4.878   12.612  1.00 0.00 ? 49 LEU A HB3  4  
ATOM 5470  H HG   . LEU A 1 50 ? 165.605 2.988   12.762  1.00 0.00 ? 49 LEU A HG   4  
ATOM 5471  H HD11 . LEU A 1 50 ? 165.495 4.070   15.029  1.00 0.00 ? 49 LEU A HD11 4  
ATOM 5472  H HD12 . LEU A 1 50 ? 165.221 2.328   15.007  1.00 0.00 ? 49 LEU A HD12 4  
ATOM 5473  H HD13 . LEU A 1 50 ? 163.856 3.433   15.170  1.00 0.00 ? 49 LEU A HD13 4  
ATOM 5474  H HD21 . LEU A 1 50 ? 163.129 2.772   11.826  1.00 0.00 ? 49 LEU A HD21 4  
ATOM 5475  H HD22 . LEU A 1 50 ? 162.810 2.327   13.502  1.00 0.00 ? 49 LEU A HD22 4  
ATOM 5476  H HD23 . LEU A 1 50 ? 163.981 1.411   12.554  1.00 0.00 ? 49 LEU A HD23 4  
ATOM 5477  N N    . SER A 1 51 ? 164.631 3.374   9.805   1.00 0.00 ? 50 SER A N    4  
ATOM 5478  C CA   . SER A 1 51 ? 163.952 2.708   8.698   1.00 0.00 ? 50 SER A CA   4  
ATOM 5479  C C    . SER A 1 51 ? 163.352 1.379   9.148   1.00 0.00 ? 50 SER A C    4  
ATOM 5480  O O    . SER A 1 51 ? 164.016 0.579   9.809   1.00 0.00 ? 50 SER A O    4  
ATOM 5481  C CB   . SER A 1 51 ? 164.919 2.477   7.534   1.00 0.00 ? 50 SER A CB   4  
ATOM 5482  O OG   . SER A 1 51 ? 164.895 3.568   6.630   1.00 0.00 ? 50 SER A OG   4  
ATOM 5483  H H    . SER A 1 51 ? 165.371 2.914   10.254  1.00 0.00 ? 50 SER A H    4  
ATOM 5484  H HA   . SER A 1 51 ? 163.154 3.355   8.366   1.00 0.00 ? 50 SER A HA   4  
ATOM 5485  H HB2  . SER A 1 51 ? 165.923 2.363   7.918   1.00 0.00 ? 50 SER A HB2  4  
ATOM 5486  H HB3  . SER A 1 51 ? 164.633 1.580   7.005   1.00 0.00 ? 50 SER A HB3  4  
ATOM 5487  H HG   . SER A 1 51 ? 165.788 3.764   6.339   1.00 0.00 ? 50 SER A HG   4  
ATOM 5488  N N    . ILE A 1 52 ? 162.093 1.152   8.782   1.00 0.00 ? 51 ILE A N    4  
ATOM 5489  C CA   . ILE A 1 52 ? 161.390 -0.076  9.142   1.00 0.00 ? 51 ILE A CA   4  
ATOM 5490  C C    . ILE A 1 52 ? 161.030 -0.878  7.891   1.00 0.00 ? 51 ILE A C    4  
ATOM 5491  O O    . ILE A 1 52 ? 160.529 -0.324  6.913   1.00 0.00 ? 51 ILE A O    4  
ATOM 5492  C CB   . ILE A 1 52 ? 160.105 0.232   9.944   1.00 0.00 ? 51 ILE A CB   4  
ATOM 5493  C CG1  . ILE A 1 52 ? 160.400 1.237   11.064  1.00 0.00 ? 51 ILE A CG1  4  
ATOM 5494  C CG2  . ILE A 1 52 ? 159.509 -1.045  10.518  1.00 0.00 ? 51 ILE A CG2  4  
ATOM 5495  C CD1  . ILE A 1 52 ? 160.073 2.669   10.696  1.00 0.00 ? 51 ILE A CD1  4  
ATOM 5496  H H    . ILE A 1 52 ? 161.621 1.831   8.253   1.00 0.00 ? 51 ILE A H    4  
ATOM 5497  H HA   . ILE A 1 52 ? 162.046 -0.669  9.763   1.00 0.00 ? 51 ILE A HA   4  
ATOM 5498  H HB   . ILE A 1 52 ? 159.383 0.662   9.267   1.00 0.00 ? 51 ILE A HB   4  
ATOM 5499  H HG12 . ILE A 1 52 ? 159.814 0.979   11.934  1.00 0.00 ? 51 ILE A HG12 4  
ATOM 5500  H HG13 . ILE A 1 52 ? 161.449 1.189   11.315  1.00 0.00 ? 51 ILE A HG13 4  
ATOM 5501  H HG21 . ILE A 1 52 ? 159.523 -1.820  9.766   1.00 0.00 ? 51 ILE A HG21 4  
ATOM 5502  H HG22 . ILE A 1 52 ? 158.489 -0.860  10.823  1.00 0.00 ? 51 ILE A HG22 4  
ATOM 5503  H HG23 . ILE A 1 52 ? 160.088 -1.361  11.372  1.00 0.00 ? 51 ILE A HG23 4  
ATOM 5504  H HD11 . ILE A 1 52 ? 159.646 2.698   9.705   1.00 0.00 ? 51 ILE A HD11 4  
ATOM 5505  H HD12 . ILE A 1 52 ? 160.977 3.261   10.715  1.00 0.00 ? 51 ILE A HD12 4  
ATOM 5506  H HD13 . ILE A 1 52 ? 159.366 3.071   11.406  1.00 0.00 ? 51 ILE A HD13 4  
ATOM 5507  N N    . LEU A 1 53 ? 161.290 -2.185  7.925   1.00 0.00 ? 52 LEU A N    4  
ATOM 5508  C CA   . LEU A 1 53 ? 160.993 -3.055  6.789   1.00 0.00 ? 52 LEU A CA   4  
ATOM 5509  C C    . LEU A 1 53 ? 159.664 -3.780  6.992   1.00 0.00 ? 52 LEU A C    4  
ATOM 5510  O O    . LEU A 1 53 ? 159.450 -4.432  8.016   1.00 0.00 ? 52 LEU A O    4  
ATOM 5511  C CB   . LEU A 1 53 ? 162.125 -4.068  6.579   1.00 0.00 ? 52 LEU A CB   4  
ATOM 5512  C CG   . LEU A 1 53 ? 162.234 -4.650  5.164   1.00 0.00 ? 52 LEU A CG   4  
ATOM 5513  C CD1  . LEU A 1 53 ? 163.647 -5.143  4.894   1.00 0.00 ? 52 LEU A CD1  4  
ATOM 5514  C CD2  . LEU A 1 53 ? 161.235 -5.782  4.969   1.00 0.00 ? 52 LEU A CD2  4  
ATOM 5515  H H    . LEU A 1 53 ? 161.689 -2.573  8.732   1.00 0.00 ? 52 LEU A H    4  
ATOM 5516  H HA   . LEU A 1 53 ? 160.916 -2.433  5.910   1.00 0.00 ? 52 LEU A HA   4  
ATOM 5517  H HB2  . LEU A 1 53 ? 163.060 -3.580  6.816   1.00 0.00 ? 52 LEU A HB2  4  
ATOM 5518  H HB3  . LEU A 1 53 ? 161.982 -4.885  7.270   1.00 0.00 ? 52 LEU A HB3  4  
ATOM 5519  H HG   . LEU A 1 53 ? 162.008 -3.876  4.444   1.00 0.00 ? 52 LEU A HG   4  
ATOM 5520  H HD11 . LEU A 1 53 ? 163.805 -6.080  5.409   1.00 0.00 ? 52 LEU A HD11 4  
ATOM 5521  H HD12 . LEU A 1 53 ? 164.359 -4.413  5.247   1.00 0.00 ? 52 LEU A HD12 4  
ATOM 5522  H HD13 . LEU A 1 53 ? 163.779 -5.291  3.832   1.00 0.00 ? 52 LEU A HD13 4  
ATOM 5523  H HD21 . LEU A 1 53 ? 161.292 -6.140  3.953   1.00 0.00 ? 52 LEU A HD21 4  
ATOM 5524  H HD22 . LEU A 1 53 ? 160.237 -5.422  5.167   1.00 0.00 ? 52 LEU A HD22 4  
ATOM 5525  H HD23 . LEU A 1 53 ? 161.467 -6.589  5.647   1.00 0.00 ? 52 LEU A HD23 4  
ATOM 5526  N N    . LEU A 1 54 ? 158.773 -3.660  6.006   1.00 0.00 ? 53 LEU A N    4  
ATOM 5527  C CA   . LEU A 1 54 ? 157.460 -4.301  6.069   1.00 0.00 ? 53 LEU A CA   4  
ATOM 5528  C C    . LEU A 1 54 ? 157.580 -5.818  5.919   1.00 0.00 ? 53 LEU A C    4  
ATOM 5529  O O    . LEU A 1 54 ? 157.677 -6.336  4.807   1.00 0.00 ? 53 LEU A O    4  
ATOM 5530  C CB   . LEU A 1 54 ? 156.537 -3.739  4.980   1.00 0.00 ? 53 LEU A CB   4  
ATOM 5531  C CG   . LEU A 1 54 ? 155.658 -2.558  5.406   1.00 0.00 ? 53 LEU A CG   4  
ATOM 5532  C CD1  . LEU A 1 54 ? 155.086 -1.852  4.185   1.00 0.00 ? 53 LEU A CD1  4  
ATOM 5533  C CD2  . LEU A 1 54 ? 154.534 -3.021  6.323   1.00 0.00 ? 53 LEU A CD2  4  
ATOM 5534  H H    . LEU A 1 54 ? 159.005 -3.126  5.217   1.00 0.00 ? 53 LEU A H    4  
ATOM 5535  H HA   . LEU A 1 54 ? 157.032 -4.082  7.036   1.00 0.00 ? 53 LEU A HA   4  
ATOM 5536  H HB2  . LEU A 1 54 ? 157.151 -3.420  4.151   1.00 0.00 ? 53 LEU A HB2  4  
ATOM 5537  H HB3  . LEU A 1 54 ? 155.891 -4.535  4.640   1.00 0.00 ? 53 LEU A HB3  4  
ATOM 5538  H HG   . LEU A 1 54 ? 156.261 -1.845  5.949   1.00 0.00 ? 53 LEU A HG   4  
ATOM 5539  H HD11 . LEU A 1 54 ? 154.372 -1.107  4.502   1.00 0.00 ? 53 LEU A HD11 4  
ATOM 5540  H HD12 . LEU A 1 54 ? 154.593 -2.574  3.549   1.00 0.00 ? 53 LEU A HD12 4  
ATOM 5541  H HD13 . LEU A 1 54 ? 155.885 -1.376  3.637   1.00 0.00 ? 53 LEU A HD13 4  
ATOM 5542  H HD21 . LEU A 1 54 ? 153.870 -3.677  5.779   1.00 0.00 ? 53 LEU A HD21 4  
ATOM 5543  H HD22 . LEU A 1 54 ? 153.981 -2.161  6.673   1.00 0.00 ? 53 LEU A HD22 4  
ATOM 5544  H HD23 . LEU A 1 54 ? 154.950 -3.549  7.168   1.00 0.00 ? 53 LEU A HD23 4  
ATOM 5545  N N    . LYS A 1 55 ? 157.572 -6.522  7.049   1.00 0.00 ? 54 LYS A N    4  
ATOM 5546  C CA   . LYS A 1 55 ? 157.676 -7.981  7.050   1.00 0.00 ? 54 LYS A CA   4  
ATOM 5547  C C    . LYS A 1 55 ? 156.292 -8.634  7.059   1.00 0.00 ? 54 LYS A C    4  
ATOM 5548  O O    . LYS A 1 55 ? 156.076 -9.657  6.407   1.00 0.00 ? 54 LYS A O    4  
ATOM 5549  C CB   . LYS A 1 55 ? 158.484 -8.457  8.260   1.00 0.00 ? 54 LYS A CB   4  
ATOM 5550  C CG   . LYS A 1 55 ? 159.988 -8.428  8.037   1.00 0.00 ? 54 LYS A CG   4  
ATOM 5551  C CD   . LYS A 1 55 ? 160.641 -9.735  8.460   1.00 0.00 ? 54 LYS A CD   4  
ATOM 5552  C CE   . LYS A 1 55 ? 160.889 -10.650 7.269   1.00 0.00 ? 54 LYS A CE   4  
ATOM 5553  N NZ   . LYS A 1 55 ? 159.958 -11.814 7.249   1.00 0.00 ? 54 LYS A NZ   4  
ATOM 5554  H H    . LYS A 1 55 ? 157.492 -6.049  7.905   1.00 0.00 ? 54 LYS A H    4  
ATOM 5555  H HA   . LYS A 1 55 ? 158.190 -8.276  6.149   1.00 0.00 ? 54 LYS A HA   4  
ATOM 5556  H HB2  . LYS A 1 55 ? 158.255 -7.822  9.103   1.00 0.00 ? 54 LYS A HB2  4  
ATOM 5557  H HB3  . LYS A 1 55 ? 158.196 -9.471  8.495   1.00 0.00 ? 54 LYS A HB3  4  
ATOM 5558  H HG2  . LYS A 1 55 ? 160.183 -8.262  6.988   1.00 0.00 ? 54 LYS A HG2  4  
ATOM 5559  H HG3  . LYS A 1 55 ? 160.411 -7.620  8.615   1.00 0.00 ? 54 LYS A HG3  4  
ATOM 5560  H HD2  . LYS A 1 55 ? 161.586 -9.515  8.933   1.00 0.00 ? 54 LYS A HD2  4  
ATOM 5561  H HD3  . LYS A 1 55 ? 159.994 -10.239 9.163   1.00 0.00 ? 54 LYS A HD3  4  
ATOM 5562  H HE2  . LYS A 1 55 ? 160.757 -10.080 6.360   1.00 0.00 ? 54 LYS A HE2  4  
ATOM 5563  H HE3  . LYS A 1 55 ? 161.905 -11.014 7.318   1.00 0.00 ? 54 LYS A HE3  4  
ATOM 5564  H HZ1  . LYS A 1 55 ? 159.065 -11.570 7.725   1.00 0.00 ? 54 LYS A HZ1  4  
ATOM 5565  H HZ2  . LYS A 1 55 ? 160.387 -12.625 7.737   1.00 0.00 ? 54 LYS A HZ2  4  
ATOM 5566  H HZ3  . LYS A 1 55 ? 159.750 -12.088 6.266   1.00 0.00 ? 54 LYS A HZ3  4  
ATOM 5567  N N    . ASN A 1 56 ? 155.363 -8.034  7.802   1.00 0.00 ? 55 ASN A N    4  
ATOM 5568  C CA   . ASN A 1 56 ? 154.000 -8.553  7.901   1.00 0.00 ? 55 ASN A CA   4  
ATOM 5569  C C    . ASN A 1 56 ? 153.008 -7.428  8.201   1.00 0.00 ? 55 ASN A C    4  
ATOM 5570  O O    . ASN A 1 56 ? 153.376 -6.251  8.211   1.00 0.00 ? 55 ASN A O    4  
ATOM 5571  C CB   . ASN A 1 56 ? 153.923 -9.631  8.989   1.00 0.00 ? 55 ASN A CB   4  
ATOM 5572  C CG   . ASN A 1 56 ? 153.796 -11.027 8.409   1.00 0.00 ? 55 ASN A CG   4  
ATOM 5573  O OD1  . ASN A 1 56 ? 154.792 -11.650 8.043   1.00 0.00 ? 55 ASN A OD1  4  
ATOM 5574  N ND2  . ASN A 1 56 ? 152.567 -11.527 8.320   1.00 0.00 ? 55 ASN A ND2  4  
ATOM 5575  H H    . ASN A 1 56 ? 155.601 -7.224  8.298   1.00 0.00 ? 55 ASN A H    4  
ATOM 5576  H HA   . ASN A 1 56 ? 153.745 -8.993  6.950   1.00 0.00 ? 55 ASN A HA   4  
ATOM 5577  H HB2  . ASN A 1 56 ? 154.819 -9.593  9.591   1.00 0.00 ? 55 ASN A HB2  4  
ATOM 5578  H HB3  . ASN A 1 56 ? 153.065 -9.443  9.617   1.00 0.00 ? 55 ASN A HB3  4  
ATOM 5579  H HD21 . ASN A 1 56 ? 151.819 -10.975 8.629   1.00 0.00 ? 55 ASN A HD21 4  
ATOM 5580  H HD22 . ASN A 1 56 ? 152.460 -12.427 7.950   1.00 0.00 ? 55 ASN A HD22 4  
ATOM 5581  N N    . GLN A 1 57 ? 151.749 -7.798  8.443   1.00 0.00 ? 56 GLN A N    4  
ATOM 5582  C CA   . GLN A 1 57 ? 150.704 -6.821  8.744   1.00 0.00 ? 56 GLN A CA   4  
ATOM 5583  C C    . GLN A 1 57 ? 151.038 -6.022  10.005  1.00 0.00 ? 56 GLN A C    4  
ATOM 5584  O O    . GLN A 1 57 ? 150.656 -4.859  10.124  1.00 0.00 ? 56 GLN A O    4  
ATOM 5585  C CB   . GLN A 1 57 ? 149.353 -7.520  8.914   1.00 0.00 ? 56 GLN A CB   4  
ATOM 5586  C CG   . GLN A 1 57 ? 148.172 -6.561  8.953   1.00 0.00 ? 56 GLN A CG   4  
ATOM 5587  C CD   . GLN A 1 57 ? 147.294 -6.662  7.719   1.00 0.00 ? 56 GLN A CD   4  
ATOM 5588  O OE1  . GLN A 1 57 ? 146.202 -7.231  7.763   1.00 0.00 ? 56 GLN A OE1  4  
ATOM 5589  N NE2  . GLN A 1 57 ? 147.767 -6.110  6.607   1.00 0.00 ? 56 GLN A NE2  4  
ATOM 5590  H H    . GLN A 1 57 ? 151.518 -8.749  8.420   1.00 0.00 ? 56 GLN A H    4  
ATOM 5591  H HA   . GLN A 1 57 ? 150.642 -6.140  7.909   1.00 0.00 ? 56 GLN A HA   4  
ATOM 5592  H HB2  . GLN A 1 57 ? 149.207 -8.205  8.091   1.00 0.00 ? 56 GLN A HB2  4  
ATOM 5593  H HB3  . GLN A 1 57 ? 149.364 -8.081  9.838   1.00 0.00 ? 56 GLN A HB3  4  
ATOM 5594  H HG2  . GLN A 1 57 ? 147.571 -6.784  9.822   1.00 0.00 ? 56 GLN A HG2  4  
ATOM 5595  H HG3  . GLN A 1 57 ? 148.548 -5.552  9.027   1.00 0.00 ? 56 GLN A HG3  4  
ATOM 5596  H HE21 . GLN A 1 57 ? 148.645 -5.675  6.642   1.00 0.00 ? 56 GLN A HE21 4  
ATOM 5597  H HE22 . GLN A 1 57 ? 147.217 -6.158  5.797   1.00 0.00 ? 56 GLN A HE22 4  
ATOM 5598  N N    . ASP A 1 58 ? 151.752 -6.655  10.940  1.00 0.00 ? 57 ASP A N    4  
ATOM 5599  C CA   . ASP A 1 58 ? 152.139 -6.005  12.193  1.00 0.00 ? 57 ASP A CA   4  
ATOM 5600  C C    . ASP A 1 58 ? 152.853 -4.678  11.927  1.00 0.00 ? 57 ASP A C    4  
ATOM 5601  O O    . ASP A 1 58 ? 152.498 -3.648  12.500  1.00 0.00 ? 57 ASP A O    4  
ATOM 5602  C CB   . ASP A 1 58 ? 153.048 -6.929  13.014  1.00 0.00 ? 57 ASP A CB   4  
ATOM 5603  C CG   . ASP A 1 58 ? 152.350 -8.205  13.446  1.00 0.00 ? 57 ASP A CG   4  
ATOM 5604  O OD1  . ASP A 1 58 ? 151.601 -8.164  14.445  1.00 0.00 ? 57 ASP A OD1  4  
ATOM 5605  O OD2  . ASP A 1 58 ? 152.553 -9.246  12.785  1.00 0.00 ? 57 ASP A OD2  4  
ATOM 5606  H H    . ASP A 1 58 ? 152.024 -7.584  10.785  1.00 0.00 ? 57 ASP A H    4  
ATOM 5607  H HA   . ASP A 1 58 ? 151.239 -5.809  12.757  1.00 0.00 ? 57 ASP A HA   4  
ATOM 5608  H HB2  . ASP A 1 58 ? 153.907 -7.199  12.417  1.00 0.00 ? 57 ASP A HB2  4  
ATOM 5609  H HB3  . ASP A 1 58 ? 153.381 -6.404  13.897  1.00 0.00 ? 57 ASP A HB3  4  
ATOM 5610  N N    . ASP A 1 59 ? 153.858 -4.713  11.053  1.00 0.00 ? 58 ASP A N    4  
ATOM 5611  C CA   . ASP A 1 59 ? 154.621 -3.515  10.707  1.00 0.00 ? 58 ASP A CA   4  
ATOM 5612  C C    . ASP A 1 59 ? 153.724 -2.465  10.051  1.00 0.00 ? 58 ASP A C    4  
ATOM 5613  O O    . ASP A 1 59 ? 153.806 -1.278  10.372  1.00 0.00 ? 58 ASP A O    4  
ATOM 5614  C CB   . ASP A 1 59 ? 155.777 -3.873  9.768   1.00 0.00 ? 58 ASP A CB   4  
ATOM 5615  C CG   . ASP A 1 59 ? 157.021 -4.317  10.516  1.00 0.00 ? 58 ASP A CG   4  
ATOM 5616  O OD1  . ASP A 1 59 ? 156.943 -5.314  11.262  1.00 0.00 ? 58 ASP A OD1  4  
ATOM 5617  O OD2  . ASP A 1 59 ? 158.074 -3.669  10.354  1.00 0.00 ? 58 ASP A OD2  4  
ATOM 5618  H H    . ASP A 1 59 ? 154.091 -5.566  10.628  1.00 0.00 ? 58 ASP A H    4  
ATOM 5619  H HA   . ASP A 1 59 ? 155.024 -3.104  11.621  1.00 0.00 ? 58 ASP A HA   4  
ATOM 5620  H HB2  . ASP A 1 59 ? 155.467 -4.678  9.120   1.00 0.00 ? 58 ASP A HB2  4  
ATOM 5621  H HB3  . ASP A 1 59 ? 156.027 -3.009  9.169   1.00 0.00 ? 58 ASP A HB3  4  
ATOM 5622  N N    . LEU A 1 60 ? 152.864 -2.911  9.135   1.00 0.00 ? 59 LEU A N    4  
ATOM 5623  C CA   . LEU A 1 60 ? 151.945 -2.014  8.438   1.00 0.00 ? 59 LEU A CA   4  
ATOM 5624  C C    . LEU A 1 60 ? 150.948 -1.393  9.413   1.00 0.00 ? 59 LEU A C    4  
ATOM 5625  O O    . LEU A 1 60 ? 150.593 -0.220  9.287   1.00 0.00 ? 59 LEU A O    4  
ATOM 5626  C CB   . LEU A 1 60 ? 151.195 -2.773  7.340   1.00 0.00 ? 59 LEU A CB   4  
ATOM 5627  C CG   . LEU A 1 60 ? 150.245 -1.923  6.488   1.00 0.00 ? 59 LEU A CG   4  
ATOM 5628  C CD1  . LEU A 1 60 ? 150.594 -2.044  5.012   1.00 0.00 ? 59 LEU A CD1  4  
ATOM 5629  C CD2  . LEU A 1 60 ? 148.797 -2.331  6.729   1.00 0.00 ? 59 LEU A CD2  4  
ATOM 5630  H H    . LEU A 1 60 ? 152.844 -3.870  8.927   1.00 0.00 ? 59 LEU A H    4  
ATOM 5631  H HA   . LEU A 1 60 ? 152.529 -1.226  7.984   1.00 0.00 ? 59 LEU A HA   4  
ATOM 5632  H HB2  . LEU A 1 60 ? 151.925 -3.227  6.685   1.00 0.00 ? 59 LEU A HB2  4  
ATOM 5633  H HB3  . LEU A 1 60 ? 150.620 -3.559  7.806   1.00 0.00 ? 59 LEU A HB3  4  
ATOM 5634  H HG   . LEU A 1 60 ? 150.351 -0.885  6.770   1.00 0.00 ? 59 LEU A HG   4  
ATOM 5635  H HD11 . LEU A 1 60 ? 149.695 -1.956  4.420   1.00 0.00 ? 59 LEU A HD11 4  
ATOM 5636  H HD12 . LEU A 1 60 ? 151.054 -3.004  4.828   1.00 0.00 ? 59 LEU A HD12 4  
ATOM 5637  H HD13 . LEU A 1 60 ? 151.283 -1.258  4.740   1.00 0.00 ? 59 LEU A HD13 4  
ATOM 5638  H HD21 . LEU A 1 60 ? 148.144 -1.697  6.148   1.00 0.00 ? 59 LEU A HD21 4  
ATOM 5639  H HD22 . LEU A 1 60 ? 148.562 -2.225  7.778   1.00 0.00 ? 59 LEU A HD22 4  
ATOM 5640  H HD23 . LEU A 1 60 ? 148.658 -3.360  6.432   1.00 0.00 ? 59 LEU A HD23 4  
ATOM 5641  N N    . ASP A 1 61 ? 150.502 -2.191  10.384  1.00 0.00 ? 60 ASP A N    4  
ATOM 5642  C CA   . ASP A 1 61 ? 149.546 -1.727  11.387  1.00 0.00 ? 60 ASP A CA   4  
ATOM 5643  C C    . ASP A 1 61 ? 150.130 -0.576  12.197  1.00 0.00 ? 60 ASP A C    4  
ATOM 5644  O O    . ASP A 1 61 ? 149.453 0.420   12.452  1.00 0.00 ? 60 ASP A O    4  
ATOM 5645  C CB   . ASP A 1 61 ? 149.162 -2.878  12.323  1.00 0.00 ? 60 ASP A CB   4  
ATOM 5646  C CG   . ASP A 1 61 ? 147.688 -2.875  12.682  1.00 0.00 ? 60 ASP A CG   4  
ATOM 5647  O OD1  . ASP A 1 61 ? 147.208 -1.857  13.224  1.00 0.00 ? 60 ASP A OD1  4  
ATOM 5648  O OD2  . ASP A 1 61 ? 147.014 -3.894  12.423  1.00 0.00 ? 60 ASP A OD2  4  
ATOM 5649  H H    . ASP A 1 61 ? 150.826 -3.116  10.426  1.00 0.00 ? 60 ASP A H    4  
ATOM 5650  H HA   . ASP A 1 61 ? 148.664 -1.381  10.871  1.00 0.00 ? 60 ASP A HA   4  
ATOM 5651  H HB2  . ASP A 1 61 ? 149.391 -3.816  11.841  1.00 0.00 ? 60 ASP A HB2  4  
ATOM 5652  H HB3  . ASP A 1 61 ? 149.736 -2.799  13.235  1.00 0.00 ? 60 ASP A HB3  4  
ATOM 5653  N N    . LYS A 1 62 ? 151.394 -0.715  12.589  1.00 0.00 ? 61 LYS A N    4  
ATOM 5654  C CA   . LYS A 1 62 ? 152.073 0.319   13.363  1.00 0.00 ? 61 LYS A CA   4  
ATOM 5655  C C    . LYS A 1 62 ? 152.221 1.602   12.547  1.00 0.00 ? 61 LYS A C    4  
ATOM 5656  O O    . LYS A 1 62 ? 152.133 2.703   13.091  1.00 0.00 ? 61 LYS A O    4  
ATOM 5657  C CB   . LYS A 1 62 ? 153.448 -0.171  13.825  1.00 0.00 ? 61 LYS A CB   4  
ATOM 5658  C CG   . LYS A 1 62 ? 153.470 -0.644  15.270  1.00 0.00 ? 61 LYS A CG   4  
ATOM 5659  C CD   . LYS A 1 62 ? 154.032 0.424   16.196  1.00 0.00 ? 61 LYS A CD   4  
ATOM 5660  C CE   . LYS A 1 62 ? 152.967 1.433   16.607  1.00 0.00 ? 61 LYS A CE   4  
ATOM 5661  N NZ   . LYS A 1 62 ? 152.309 1.062   17.891  1.00 0.00 ? 61 LYS A NZ   4  
ATOM 5662  H H    . LYS A 1 62 ? 151.884 -1.531  12.348  1.00 0.00 ? 61 LYS A H    4  
ATOM 5663  H HA   . LYS A 1 62 ? 151.466 0.529   14.230  1.00 0.00 ? 61 LYS A HA   4  
ATOM 5664  H HB2  . LYS A 1 62 ? 153.757 -0.992  13.195  1.00 0.00 ? 61 LYS A HB2  4  
ATOM 5665  H HB3  . LYS A 1 62 ? 154.157 0.637   13.723  1.00 0.00 ? 61 LYS A HB3  4  
ATOM 5666  H HG2  . LYS A 1 62 ? 152.463 -0.882  15.578  1.00 0.00 ? 61 LYS A HG2  4  
ATOM 5667  H HG3  . LYS A 1 62 ? 154.088 -1.528  15.338  1.00 0.00 ? 61 LYS A HG3  4  
ATOM 5668  H HD2  . LYS A 1 62 ? 154.423 -0.052  17.082  1.00 0.00 ? 61 LYS A HD2  4  
ATOM 5669  H HD3  . LYS A 1 62 ? 154.829 0.945   15.685  1.00 0.00 ? 61 LYS A HD3  4  
ATOM 5670  H HE2  . LYS A 1 62 ? 153.432 2.401   16.719  1.00 0.00 ? 61 LYS A HE2  4  
ATOM 5671  H HE3  . LYS A 1 62 ? 152.218 1.484   15.829  1.00 0.00 ? 61 LYS A HE3  4  
ATOM 5672  H HZ1  . LYS A 1 62 ? 151.505 1.697   18.077  1.00 0.00 ? 61 LYS A HZ1  4  
ATOM 5673  H HZ2  . LYS A 1 62 ? 152.986 1.140   18.677  1.00 0.00 ? 61 LYS A HZ2  4  
ATOM 5674  H HZ3  . LYS A 1 62 ? 151.959 0.083   17.845  1.00 0.00 ? 61 LYS A HZ3  4  
ATOM 5675  N N    . ALA A 1 63 ? 152.443 1.453   11.238  1.00 0.00 ? 62 ALA A N    4  
ATOM 5676  C CA   . ALA A 1 63 ? 152.599 2.605   10.352  1.00 0.00 ? 62 ALA A CA   4  
ATOM 5677  C C    . ALA A 1 63 ? 151.319 3.437   10.295  1.00 0.00 ? 62 ALA A C    4  
ATOM 5678  O O    . ALA A 1 63 ? 151.374 4.664   10.197  1.00 0.00 ? 62 ALA A O    4  
ATOM 5679  C CB   . ALA A 1 63 ? 152.999 2.155   8.953   1.00 0.00 ? 62 ALA A CB   4  
ATOM 5680  H H    . ALA A 1 63 ? 152.501 0.549   10.862  1.00 0.00 ? 62 ALA A H    4  
ATOM 5681  H HA   . ALA A 1 63 ? 153.395 3.219   10.746  1.00 0.00 ? 62 ALA A HA   4  
ATOM 5682  H HB1  . ALA A 1 63 ? 153.697 2.866   8.535   1.00 0.00 ? 62 ALA A HB1  4  
ATOM 5683  H HB2  . ALA A 1 63 ? 152.121 2.102   8.326   1.00 0.00 ? 62 ALA A HB2  4  
ATOM 5684  H HB3  . ALA A 1 63 ? 153.464 1.182   9.005   1.00 0.00 ? 62 ALA A HB3  4  
ATOM 5685  N N    . ILE A 1 64 ? 150.168 2.766   10.360  1.00 0.00 ? 63 ILE A N    4  
ATOM 5686  C CA   . ILE A 1 64 ? 148.878 3.452   10.321  1.00 0.00 ? 63 ILE A CA   4  
ATOM 5687  C C    . ILE A 1 64 ? 148.702 4.343   11.548  1.00 0.00 ? 63 ILE A C    4  
ATOM 5688  O O    . ILE A 1 64 ? 148.237 5.478   11.437  1.00 0.00 ? 63 ILE A O    4  
ATOM 5689  C CB   . ILE A 1 64 ? 147.701 2.454   10.243  1.00 0.00 ? 63 ILE A CB   4  
ATOM 5690  C CG1  . ILE A 1 64 ? 147.907 1.473   9.082   1.00 0.00 ? 63 ILE A CG1  4  
ATOM 5691  C CG2  . ILE A 1 64 ? 146.378 3.196   10.087  1.00 0.00 ? 63 ILE A CG2  4  
ATOM 5692  C CD1  . ILE A 1 64 ? 147.360 0.087   9.350   1.00 0.00 ? 63 ILE A CD1  4  
ATOM 5693  H H    . ILE A 1 64 ? 150.187 1.788   10.440  1.00 0.00 ? 63 ILE A H    4  
ATOM 5694  H HA   . ILE A 1 64 ? 148.858 4.071   9.434   1.00 0.00 ? 63 ILE A HA   4  
ATOM 5695  H HB   . ILE A 1 64 ? 147.666 1.901   11.169  1.00 0.00 ? 63 ILE A HB   4  
ATOM 5696  H HG12 . ILE A 1 64 ? 147.415 1.858   8.203   1.00 0.00 ? 63 ILE A HG12 4  
ATOM 5697  H HG13 . ILE A 1 64 ? 148.964 1.379   8.884   1.00 0.00 ? 63 ILE A HG13 4  
ATOM 5698  H HG21 . ILE A 1 64 ? 146.498 4.220   10.410  1.00 0.00 ? 63 ILE A HG21 4  
ATOM 5699  H HG22 . ILE A 1 64 ? 145.623 2.715   10.691  1.00 0.00 ? 63 ILE A HG22 4  
ATOM 5700  H HG23 . ILE A 1 64 ? 146.074 3.179   9.051   1.00 0.00 ? 63 ILE A HG23 4  
ATOM 5701  H HD11 . ILE A 1 64 ? 148.067 -0.651  9.001   1.00 0.00 ? 63 ILE A HD11 4  
ATOM 5702  H HD12 . ILE A 1 64 ? 146.423 -0.037  8.829   1.00 0.00 ? 63 ILE A HD12 4  
ATOM 5703  H HD13 . ILE A 1 64 ? 147.202 -0.040  10.411  1.00 0.00 ? 63 ILE A HD13 4  
ATOM 5704  N N    . ASP A 1 65 ? 149.083 3.823   12.715  1.00 0.00 ? 64 ASP A N    4  
ATOM 5705  C CA   . ASP A 1 65 ? 148.976 4.572   13.967  1.00 0.00 ? 64 ASP A CA   4  
ATOM 5706  C C    . ASP A 1 65 ? 149.660 5.932   13.852  1.00 0.00 ? 64 ASP A C    4  
ATOM 5707  O O    . ASP A 1 65 ? 149.157 6.935   14.359  1.00 0.00 ? 64 ASP A O    4  
ATOM 5708  C CB   . ASP A 1 65 ? 149.598 3.776   15.118  1.00 0.00 ? 64 ASP A CB   4  
ATOM 5709  C CG   . ASP A 1 65 ? 148.598 2.864   15.803  1.00 0.00 ? 64 ASP A CG   4  
ATOM 5710  O OD1  . ASP A 1 65 ? 148.038 1.979   15.123  1.00 0.00 ? 64 ASP A OD1  4  
ATOM 5711  O OD2  . ASP A 1 65 ? 148.381 3.032   17.022  1.00 0.00 ? 64 ASP A OD2  4  
ATOM 5712  H H    . ASP A 1 65 ? 149.451 2.914   12.735  1.00 0.00 ? 64 ASP A H    4  
ATOM 5713  H HA   . ASP A 1 65 ? 147.927 4.725   14.172  1.00 0.00 ? 64 ASP A HA   4  
ATOM 5714  H HB2  . ASP A 1 65 ? 150.404 3.169   14.733  1.00 0.00 ? 64 ASP A HB2  4  
ATOM 5715  H HB3  . ASP A 1 65 ? 149.991 4.464   15.852  1.00 0.00 ? 64 ASP A HB3  4  
ATOM 5716  N N    . ILE A 1 66 ? 150.808 5.957   13.176  1.00 0.00 ? 65 ILE A N    4  
ATOM 5717  C CA   . ILE A 1 66 ? 151.559 7.193   12.986  1.00 0.00 ? 65 ILE A CA   4  
ATOM 5718  C C    . ILE A 1 66 ? 150.783 8.171   12.103  1.00 0.00 ? 65 ILE A C    4  
ATOM 5719  O O    . ILE A 1 66 ? 150.775 9.377   12.357  1.00 0.00 ? 65 ILE A O    4  
ATOM 5720  C CB   . ILE A 1 66 ? 152.945 6.929   12.358  1.00 0.00 ? 65 ILE A CB   4  
ATOM 5721  C CG1  . ILE A 1 66 ? 153.689 5.837   13.136  1.00 0.00 ? 65 ILE A CG1  4  
ATOM 5722  C CG2  . ILE A 1 66 ? 153.765 8.211   12.323  1.00 0.00 ? 65 ILE A CG2  4  
ATOM 5723  C CD1  . ILE A 1 66 ? 154.706 5.086   12.304  1.00 0.00 ? 65 ILE A CD1  4  
ATOM 5724  H H    . ILE A 1 66 ? 151.154 5.124   12.790  1.00 0.00 ? 65 ILE A H    4  
ATOM 5725  H HA   . ILE A 1 66 ? 151.707 7.644   13.957  1.00 0.00 ? 65 ILE A HA   4  
ATOM 5726  H HB   . ILE A 1 66 ? 152.796 6.599   11.340  1.00 0.00 ? 65 ILE A HB   4  
ATOM 5727  H HG12 . ILE A 1 66 ? 154.210 6.287   13.967  1.00 0.00 ? 65 ILE A HG12 4  
ATOM 5728  H HG13 . ILE A 1 66 ? 152.974 5.119   13.512  1.00 0.00 ? 65 ILE A HG13 4  
ATOM 5729  H HG21 . ILE A 1 66 ? 153.150 9.023   11.963  1.00 0.00 ? 65 ILE A HG21 4  
ATOM 5730  H HG22 . ILE A 1 66 ? 154.610 8.081   11.664  1.00 0.00 ? 65 ILE A HG22 4  
ATOM 5731  H HG23 . ILE A 1 66 ? 154.116 8.441   13.318  1.00 0.00 ? 65 ILE A HG23 4  
ATOM 5732  H HD11 . ILE A 1 66 ? 154.540 4.023   12.405  1.00 0.00 ? 65 ILE A HD11 4  
ATOM 5733  H HD12 . ILE A 1 66 ? 155.701 5.329   12.648  1.00 0.00 ? 65 ILE A HD12 4  
ATOM 5734  H HD13 . ILE A 1 66 ? 154.604 5.369   11.267  1.00 0.00 ? 65 ILE A HD13 4  
ATOM 5735  N N    . LEU A 1 67 ? 150.126 7.643   11.070  1.00 0.00 ? 66 LEU A N    4  
ATOM 5736  C CA   . LEU A 1 67 ? 149.342 8.468   10.155  1.00 0.00 ? 66 LEU A CA   4  
ATOM 5737  C C    . LEU A 1 67 ? 148.185 9.152   10.888  1.00 0.00 ? 66 LEU A C    4  
ATOM 5738  O O    . LEU A 1 67 ? 147.919 10.333  10.669  1.00 0.00 ? 66 LEU A O    4  
ATOM 5739  C CB   . LEU A 1 67 ? 148.801 7.618   9.001   1.00 0.00 ? 66 LEU A CB   4  
ATOM 5740  C CG   . LEU A 1 67 ? 148.416 8.402   7.742   1.00 0.00 ? 66 LEU A CG   4  
ATOM 5741  C CD1  . LEU A 1 67 ? 149.657 8.782   6.948   1.00 0.00 ? 66 LEU A CD1  4  
ATOM 5742  C CD2  . LEU A 1 67 ? 147.454 7.593   6.883   1.00 0.00 ? 66 LEU A CD2  4  
ATOM 5743  H H    . LEU A 1 67 ? 150.168 6.674   10.922  1.00 0.00 ? 66 LEU A H    4  
ATOM 5744  H HA   . LEU A 1 67 ? 149.996 9.227   9.753   1.00 0.00 ? 66 LEU A HA   4  
ATOM 5745  H HB2  . LEU A 1 67 ? 149.555 6.893   8.732   1.00 0.00 ? 66 LEU A HB2  4  
ATOM 5746  H HB3  . LEU A 1 67 ? 147.927 7.090   9.350   1.00 0.00 ? 66 LEU A HB3  4  
ATOM 5747  H HG   . LEU A 1 67 ? 147.916 9.314   8.035   1.00 0.00 ? 66 LEU A HG   4  
ATOM 5748  H HD11 . LEU A 1 67 ? 149.967 9.779   7.222   1.00 0.00 ? 66 LEU A HD11 4  
ATOM 5749  H HD12 . LEU A 1 67 ? 149.432 8.754   5.892   1.00 0.00 ? 66 LEU A HD12 4  
ATOM 5750  H HD13 . LEU A 1 67 ? 150.452 8.086   7.166   1.00 0.00 ? 66 LEU A HD13 4  
ATOM 5751  H HD21 . LEU A 1 67 ? 147.637 7.804   5.840   1.00 0.00 ? 66 LEU A HD21 4  
ATOM 5752  H HD22 . LEU A 1 67 ? 146.438 7.861   7.132   1.00 0.00 ? 66 LEU A HD22 4  
ATOM 5753  H HD23 . LEU A 1 67 ? 147.603 6.539   7.068   1.00 0.00 ? 66 LEU A HD23 4  
ATOM 5754  N N    . ASP A 1 68 ? 147.505 8.401   11.760  1.00 0.00 ? 67 ASP A N    4  
ATOM 5755  C CA   . ASP A 1 68 ? 146.375 8.935   12.529  1.00 0.00 ? 67 ASP A CA   4  
ATOM 5756  C C    . ASP A 1 68 ? 146.824 10.049  13.478  1.00 0.00 ? 67 ASP A C    4  
ATOM 5757  O O    . ASP A 1 68 ? 146.087 11.006  13.717  1.00 0.00 ? 67 ASP A O    4  
ATOM 5758  C CB   . ASP A 1 68 ? 145.689 7.821   13.332  1.00 0.00 ? 67 ASP A CB   4  
ATOM 5759  C CG   . ASP A 1 68 ? 145.361 6.597   12.494  1.00 0.00 ? 67 ASP A CG   4  
ATOM 5760  O OD1  . ASP A 1 68 ? 144.817 6.763   11.382  1.00 0.00 ? 67 ASP A OD1  4  
ATOM 5761  O OD2  . ASP A 1 68 ? 145.648 5.472   12.954  1.00 0.00 ? 67 ASP A OD2  4  
ATOM 5762  H H    . ASP A 1 68 ? 147.769 7.465   11.888  1.00 0.00 ? 67 ASP A H    4  
ATOM 5763  H HA   . ASP A 1 68 ? 145.665 9.346   11.827  1.00 0.00 ? 67 ASP A HA   4  
ATOM 5764  H HB2  . ASP A 1 68 ? 146.339 7.516   14.138  1.00 0.00 ? 67 ASP A HB2  4  
ATOM 5765  H HB3  . ASP A 1 68 ? 144.768 8.205   13.747  1.00 0.00 ? 67 ASP A HB3  4  
ATOM 5766  N N    . ARG A 1 69 ? 148.039 9.918   14.013  1.00 0.00 ? 68 ARG A N    4  
ATOM 5767  C CA   . ARG A 1 69 ? 148.589 10.912  14.932  1.00 0.00 ? 68 ARG A CA   4  
ATOM 5768  C C    . ARG A 1 69 ? 149.039 12.165  14.182  1.00 0.00 ? 68 ARG A C    4  
ATOM 5769  O O    . ARG A 1 69 ? 148.945 13.278  14.702  1.00 0.00 ? 68 ARG A O    4  
ATOM 5770  C CB   . ARG A 1 69 ? 149.771 10.320  15.705  1.00 0.00 ? 68 ARG A CB   4  
ATOM 5771  C CG   . ARG A 1 69 ? 150.328 11.245  16.776  1.00 0.00 ? 68 ARG A CG   4  
ATOM 5772  C CD   . ARG A 1 69 ? 151.518 10.620  17.487  1.00 0.00 ? 68 ARG A CD   4  
ATOM 5773  N NE   . ARG A 1 69 ? 151.886 11.358  18.694  1.00 0.00 ? 68 ARG A NE   4  
ATOM 5774  C CZ   . ARG A 1 69 ? 151.202 11.307  19.840  1.00 0.00 ? 68 ARG A CZ   4  
ATOM 5775  N NH1  . ARG A 1 69 ? 150.106 10.557  19.941  1.00 0.00 ? 68 ARG A NH1  4  
ATOM 5776  N NH2  . ARG A 1 69 ? 151.616 12.009  20.890  1.00 0.00 ? 68 ARG A NH2  4  
ATOM 5777  H H    . ARG A 1 69 ? 148.580 9.134   13.781  1.00 0.00 ? 68 ARG A H    4  
ATOM 5778  H HA   . ARG A 1 69 ? 147.813 11.183  15.632  1.00 0.00 ? 68 ARG A HA   4  
ATOM 5779  H HB2  . ARG A 1 69 ? 149.453 9.405   16.182  1.00 0.00 ? 68 ARG A HB2  4  
ATOM 5780  H HB3  . ARG A 1 69 ? 150.564 10.096  15.007  1.00 0.00 ? 68 ARG A HB3  4  
ATOM 5781  H HG2  . ARG A 1 69 ? 150.643 12.169  16.312  1.00 0.00 ? 68 ARG A HG2  4  
ATOM 5782  H HG3  . ARG A 1 69 ? 149.553 11.450  17.500  1.00 0.00 ? 68 ARG A HG3  4  
ATOM 5783  H HD2  . ARG A 1 69 ? 151.265 9.607   17.761  1.00 0.00 ? 68 ARG A HD2  4  
ATOM 5784  H HD3  . ARG A 1 69 ? 152.361 10.608  16.811  1.00 0.00 ? 68 ARG A HD3  4  
ATOM 5785  H HE   . ARG A 1 69 ? 152.689 11.921  18.650  1.00 0.00 ? 68 ARG A HE   4  
ATOM 5786  H HH11 . ARG A 1 69 ? 149.786 10.026  19.157  1.00 0.00 ? 68 ARG A HH11 4  
ATOM 5787  H HH12 . ARG A 1 69 ? 149.599 10.525  20.804  1.00 0.00 ? 68 ARG A HH12 4  
ATOM 5788  H HH21 . ARG A 1 69 ? 152.438 12.575  20.821  1.00 0.00 ? 68 ARG A HH21 4  
ATOM 5789  H HH22 . ARG A 1 69 ? 151.106 11.974  21.749  1.00 0.00 ? 68 ARG A HH22 4  
ATOM 5790  N N    . SER A 1 70 ? 149.535 11.974  12.960  1.00 0.00 ? 69 SER A N    4  
ATOM 5791  C CA   . SER A 1 70 ? 150.010 13.083  12.138  1.00 0.00 ? 69 SER A CA   4  
ATOM 5792  C C    . SER A 1 70 ? 148.866 13.722  11.351  1.00 0.00 ? 69 SER A C    4  
ATOM 5793  O O    . SER A 1 70 ? 148.106 13.032  10.672  1.00 0.00 ? 69 SER A O    4  
ATOM 5794  C CB   . SER A 1 70 ? 151.093 12.594  11.173  1.00 0.00 ? 69 SER A CB   4  
ATOM 5795  O OG   . SER A 1 70 ? 151.918 13.663  10.736  1.00 0.00 ? 69 SER A OG   4  
ATOM 5796  H H    . SER A 1 70 ? 149.589 11.062  12.605  1.00 0.00 ? 69 SER A H    4  
ATOM 5797  H HA   . SER A 1 70 ? 150.436 13.824  12.796  1.00 0.00 ? 69 SER A HA   4  
ATOM 5798  H HB2  . SER A 1 70 ? 151.711 11.861  11.672  1.00 0.00 ? 69 SER A HB2  4  
ATOM 5799  H HB3  . SER A 1 70 ? 150.624 12.140  10.313  1.00 0.00 ? 69 SER A HB3  4  
ATOM 5800  H HG   . SER A 1 70 ? 151.377 14.432  10.542  1.00 0.00 ? 69 SER A HG   4  
ATOM 5801  N N    . SER A 1 71 ? 148.757 15.049  11.440  1.00 0.00 ? 70 SER A N    4  
ATOM 5802  C CA   . SER A 1 71 ? 147.713 15.787  10.729  1.00 0.00 ? 70 SER A CA   4  
ATOM 5803  C C    . SER A 1 71 ? 148.085 15.984  9.259   1.00 0.00 ? 70 SER A C    4  
ATOM 5804  O O    . SER A 1 71 ? 147.235 15.871  8.375   1.00 0.00 ? 70 SER A O    4  
ATOM 5805  C CB   . SER A 1 71 ? 147.473 17.150  11.389  1.00 0.00 ? 70 SER A CB   4  
ATOM 5806  O OG   . SER A 1 71 ? 146.112 17.532  11.292  1.00 0.00 ? 70 SER A OG   4  
ATOM 5807  H H    . SER A 1 71 ? 149.398 15.545  11.991  1.00 0.00 ? 70 SER A H    4  
ATOM 5808  H HA   . SER A 1 71 ? 146.803 15.208  10.783  1.00 0.00 ? 70 SER A HA   4  
ATOM 5809  H HB2  . SER A 1 71 ? 147.746 17.097  12.432  1.00 0.00 ? 70 SER A HB2  4  
ATOM 5810  H HB3  . SER A 1 71 ? 148.079 17.897  10.896  1.00 0.00 ? 70 SER A HB3  4  
ATOM 5811  H HG   . SER A 1 71 ? 145.677 17.391  12.137  1.00 0.00 ? 70 SER A HG   4  
ATOM 5812  N N    . SER A 1 72 ? 149.362 16.283  9.008   1.00 0.00 ? 71 SER A N    4  
ATOM 5813  C CA   . SER A 1 72 ? 149.849 16.501  7.646   1.00 0.00 ? 71 SER A CA   4  
ATOM 5814  C C    . SER A 1 72 ? 149.996 15.181  6.890   1.00 0.00 ? 71 SER A C    4  
ATOM 5815  O O    . SER A 1 72 ? 149.647 15.093  5.712   1.00 0.00 ? 71 SER A O    4  
ATOM 5816  C CB   . SER A 1 72 ? 151.191 17.241  7.663   1.00 0.00 ? 71 SER A CB   4  
ATOM 5817  O OG   . SER A 1 72 ? 151.966 16.879  8.793   1.00 0.00 ? 71 SER A OG   4  
ATOM 5818  H H    . SER A 1 72 ? 149.990 16.363  9.756   1.00 0.00 ? 71 SER A H    4  
ATOM 5819  H HA   . SER A 1 72 ? 149.122 17.111  7.131   1.00 0.00 ? 71 SER A HA   4  
ATOM 5820  H HB2  . SER A 1 72 ? 151.746 16.995  6.770   1.00 0.00 ? 71 SER A HB2  4  
ATOM 5821  H HB3  . SER A 1 72 ? 151.010 18.306  7.692   1.00 0.00 ? 71 SER A HB3  4  
ATOM 5822  H HG   . SER A 1 72 ? 152.875 16.725  8.524   1.00 0.00 ? 71 SER A HG   4  
ATOM 5823  N N    . MET A 1 73 ? 150.518 14.159  7.570   1.00 0.00 ? 72 MET A N    4  
ATOM 5824  C CA   . MET A 1 73 ? 150.712 12.847  6.956   1.00 0.00 ? 72 MET A CA   4  
ATOM 5825  C C    . MET A 1 73 ? 149.378 12.247  6.508   1.00 0.00 ? 72 MET A C    4  
ATOM 5826  O O    . MET A 1 73 ? 148.619 11.718  7.322   1.00 0.00 ? 72 MET A O    4  
ATOM 5827  C CB   . MET A 1 73 ? 151.420 11.901  7.932   1.00 0.00 ? 72 MET A CB   4  
ATOM 5828  C CG   . MET A 1 73 ? 152.437 10.986  7.269   1.00 0.00 ? 72 MET A CG   4  
ATOM 5829  S SD   . MET A 1 73 ? 154.135 11.540  7.519   1.00 0.00 ? 72 MET A SD   4  
ATOM 5830  C CE   . MET A 1 73 ? 155.000 9.972   7.573   1.00 0.00 ? 72 MET A CE   4  
ATOM 5831  H H    . MET A 1 73 ? 150.781 14.292  8.505   1.00 0.00 ? 72 MET A H    4  
ATOM 5832  H HA   . MET A 1 73 ? 151.339 12.983  6.086   1.00 0.00 ? 72 MET A HA   4  
ATOM 5833  H HB2  . MET A 1 73 ? 151.932 12.490  8.679   1.00 0.00 ? 72 MET A HB2  4  
ATOM 5834  H HB3  . MET A 1 73 ? 150.679 11.285  8.421   1.00 0.00 ? 72 MET A HB3  4  
ATOM 5835  H HG2  . MET A 1 73 ? 152.332 9.995   7.684   1.00 0.00 ? 72 MET A HG2  4  
ATOM 5836  H HG3  . MET A 1 73 ? 152.236 10.953  6.208   1.00 0.00 ? 72 MET A HG3  4  
ATOM 5837  H HE1  . MET A 1 73 ? 154.546 9.335   8.316   1.00 0.00 ? 72 MET A HE1  4  
ATOM 5838  H HE2  . MET A 1 73 ? 156.037 10.141  7.828   1.00 0.00 ? 72 MET A HE2  4  
ATOM 5839  H HE3  . MET A 1 73 ? 154.941 9.495   6.605   1.00 0.00 ? 72 MET A HE3  4  
ATOM 5840  N N    . LYS A 1 74 ? 149.101 12.336  5.206   1.00 0.00 ? 73 LYS A N    4  
ATOM 5841  C CA   . LYS A 1 74 ? 147.862 11.802  4.639   1.00 0.00 ? 73 LYS A CA   4  
ATOM 5842  C C    . LYS A 1 74 ? 148.070 10.382  4.112   1.00 0.00 ? 73 LYS A C    4  
ATOM 5843  O O    . LYS A 1 74 ? 147.187 9.532   4.235   1.00 0.00 ? 73 LYS A O    4  
ATOM 5844  C CB   . LYS A 1 74 ? 147.359 12.706  3.510   1.00 0.00 ? 73 LYS A CB   4  
ATOM 5845  C CG   . LYS A 1 74 ? 146.358 13.759  3.966   1.00 0.00 ? 73 LYS A CG   4  
ATOM 5846  C CD   . LYS A 1 74 ? 144.987 13.545  3.337   1.00 0.00 ? 73 LYS A CD   4  
ATOM 5847  C CE   . LYS A 1 74 ? 145.037 13.644  1.816   1.00 0.00 ? 73 LYS A CE   4  
ATOM 5848  N NZ   . LYS A 1 74 ? 145.692 14.901  1.353   1.00 0.00 ? 73 LYS A NZ   4  
ATOM 5849  H H    . LYS A 1 74 ? 149.748 12.771  4.611   1.00 0.00 ? 73 LYS A H    4  
ATOM 5850  H HA   . LYS A 1 74 ? 147.123 11.777  5.425   1.00 0.00 ? 73 LYS A HA   4  
ATOM 5851  H HB2  . LYS A 1 74 ? 148.203 13.212  3.066   1.00 0.00 ? 73 LYS A HB2  4  
ATOM 5852  H HB3  . LYS A 1 74 ? 146.885 12.091  2.759   1.00 0.00 ? 73 LYS A HB3  4  
ATOM 5853  H HG2  . LYS A 1 74 ? 146.262 13.708  5.040   1.00 0.00 ? 73 LYS A HG2  4  
ATOM 5854  H HG3  . LYS A 1 74 ? 146.726 14.735  3.683   1.00 0.00 ? 73 LYS A HG3  4  
ATOM 5855  H HD2  . LYS A 1 74 ? 144.627 12.564  3.611   1.00 0.00 ? 73 LYS A HD2  4  
ATOM 5856  H HD3  . LYS A 1 74 ? 144.309 14.296  3.715   1.00 0.00 ? 73 LYS A HD3  4  
ATOM 5857  H HE2  . LYS A 1 74 ? 145.590 12.799  1.431   1.00 0.00 ? 73 LYS A HE2  4  
ATOM 5858  H HE3  . LYS A 1 74 ? 144.027 13.613  1.433   1.00 0.00 ? 73 LYS A HE3  4  
ATOM 5859  H HZ1  . LYS A 1 74 ? 146.710 14.874  1.567   1.00 0.00 ? 73 LYS A HZ1  4  
ATOM 5860  H HZ2  . LYS A 1 74 ? 145.271 15.722  1.833   1.00 0.00 ? 73 LYS A HZ2  4  
ATOM 5861  H HZ3  . LYS A 1 74 ? 145.566 15.014  0.327   1.00 0.00 ? 73 LYS A HZ3  4  
ATOM 5862  N N    . SER A 1 75 ? 149.242 10.136  3.526   1.00 0.00 ? 74 SER A N    4  
ATOM 5863  C CA   . SER A 1 75 ? 149.575 8.822   2.981   1.00 0.00 ? 74 SER A CA   4  
ATOM 5864  C C    . SER A 1 75 ? 150.837 8.266   3.642   1.00 0.00 ? 74 SER A C    4  
ATOM 5865  O O    . SER A 1 75 ? 151.478 8.946   4.446   1.00 0.00 ? 74 SER A O    4  
ATOM 5866  C CB   . SER A 1 75 ? 149.771 8.910   1.464   1.00 0.00 ? 74 SER A CB   4  
ATOM 5867  O OG   . SER A 1 75 ? 150.610 10.000  1.115   1.00 0.00 ? 74 SER A OG   4  
ATOM 5868  H H    . SER A 1 75 ? 149.902 10.857  3.459   1.00 0.00 ? 74 SER A H    4  
ATOM 5869  H HA   . SER A 1 75 ? 148.751 8.158   3.191   1.00 0.00 ? 74 SER A HA   4  
ATOM 5870  H HB2  . SER A 1 75 ? 150.224 7.997   1.109   1.00 0.00 ? 74 SER A HB2  4  
ATOM 5871  H HB3  . SER A 1 75 ? 148.811 9.044   0.989   1.00 0.00 ? 74 SER A HB3  4  
ATOM 5872  H HG   . SER A 1 75 ? 150.092 10.807  1.087   1.00 0.00 ? 74 SER A HG   4  
ATOM 5873  N N    . LEU A 1 76 ? 151.190 7.026   3.299   1.00 0.00 ? 75 LEU A N    4  
ATOM 5874  C CA   . LEU A 1 76 ? 152.376 6.379   3.862   1.00 0.00 ? 75 LEU A CA   4  
ATOM 5875  C C    . LEU A 1 76 ? 153.533 6.407   2.862   1.00 0.00 ? 75 LEU A C    4  
ATOM 5876  O O    . LEU A 1 76 ? 153.364 6.030   1.702   1.00 0.00 ? 75 LEU A O    4  
ATOM 5877  C CB   . LEU A 1 76 ? 152.061 4.928   4.256   1.00 0.00 ? 75 LEU A CB   4  
ATOM 5878  C CG   . LEU A 1 76 ? 150.859 4.735   5.195   1.00 0.00 ? 75 LEU A CG   4  
ATOM 5879  C CD1  . LEU A 1 76 ? 150.935 5.687   6.380   1.00 0.00 ? 75 LEU A CD1  4  
ATOM 5880  C CD2  . LEU A 1 76 ? 149.549 4.922   4.442   1.00 0.00 ? 75 LEU A CD2  4  
ATOM 5881  H H    . LEU A 1 76 ? 150.641 6.534   2.654   1.00 0.00 ? 75 LEU A H    4  
ATOM 5882  H HA   . LEU A 1 76 ? 152.666 6.928   4.745   1.00 0.00 ? 75 LEU A HA   4  
ATOM 5883  H HB2  . LEU A 1 76 ? 151.876 4.366   3.353   1.00 0.00 ? 75 LEU A HB2  4  
ATOM 5884  H HB3  . LEU A 1 76 ? 152.933 4.516   4.741   1.00 0.00 ? 75 LEU A HB3  4  
ATOM 5885  H HG   . LEU A 1 76 ? 150.879 3.726   5.582   1.00 0.00 ? 75 LEU A HG   4  
ATOM 5886  H HD11 . LEU A 1 76 ? 151.168 6.681   6.031   1.00 0.00 ? 75 LEU A HD11 4  
ATOM 5887  H HD12 . LEU A 1 76 ? 151.705 5.355   7.060   1.00 0.00 ? 75 LEU A HD12 4  
ATOM 5888  H HD13 . LEU A 1 76 ? 149.984 5.699   6.893   1.00 0.00 ? 75 LEU A HD13 4  
ATOM 5889  H HD21 . LEU A 1 76 ? 149.206 5.939   4.562   1.00 0.00 ? 75 LEU A HD21 4  
ATOM 5890  H HD22 . LEU A 1 76 ? 148.807 4.244   4.837   1.00 0.00 ? 75 LEU A HD22 4  
ATOM 5891  H HD23 . LEU A 1 76 ? 149.702 4.716   3.393   1.00 0.00 ? 75 LEU A HD23 4  
ATOM 5892  N N    . ARG A 1 77 ? 154.706 6.857   3.317   1.00 0.00 ? 76 ARG A N    4  
ATOM 5893  C CA   . ARG A 1 77 ? 155.888 6.934   2.456   1.00 0.00 ? 76 ARG A CA   4  
ATOM 5894  C C    . ARG A 1 77 ? 156.649 5.608   2.450   1.00 0.00 ? 76 ARG A C    4  
ATOM 5895  O O    . ARG A 1 77 ? 157.280 5.240   3.444   1.00 0.00 ? 76 ARG A O    4  
ATOM 5896  C CB   . ARG A 1 77 ? 156.819 8.064   2.914   1.00 0.00 ? 76 ARG A CB   4  
ATOM 5897  C CG   . ARG A 1 77 ? 156.238 9.458   2.726   1.00 0.00 ? 76 ARG A CG   4  
ATOM 5898  C CD   . ARG A 1 77 ? 157.303 10.453  2.283   1.00 0.00 ? 76 ARG A CD   4  
ATOM 5899  N NE   . ARG A 1 77 ? 157.045 11.800  2.793   1.00 0.00 ? 76 ARG A NE   4  
ATOM 5900  C CZ   . ARG A 1 77 ? 157.599 12.911  2.297   1.00 0.00 ? 76 ARG A CZ   4  
ATOM 5901  N NH1  . ARG A 1 77 ? 158.453 12.847  1.277   1.00 0.00 ? 76 ARG A NH1  4  
ATOM 5902  N NH2  . ARG A 1 77 ? 157.299 14.092  2.825   1.00 0.00 ? 76 ARG A NH2  4  
ATOM 5903  H H    . ARG A 1 77 ? 154.778 7.144   4.252   1.00 0.00 ? 76 ARG A H    4  
ATOM 5904  H HA   . ARG A 1 77 ? 155.552 7.144   1.451   1.00 0.00 ? 76 ARG A HA   4  
ATOM 5905  H HB2  . ARG A 1 77 ? 157.041 7.929   3.962   1.00 0.00 ? 76 ARG A HB2  4  
ATOM 5906  H HB3  . ARG A 1 77 ? 157.740 8.003   2.351   1.00 0.00 ? 76 ARG A HB3  4  
ATOM 5907  H HG2  . ARG A 1 77 ? 155.463 9.418   1.975   1.00 0.00 ? 76 ARG A HG2  4  
ATOM 5908  H HG3  . ARG A 1 77 ? 155.816 9.789   3.664   1.00 0.00 ? 76 ARG A HG3  4  
ATOM 5909  H HD2  . ARG A 1 77 ? 158.264 10.119  2.648   1.00 0.00 ? 76 ARG A HD2  4  
ATOM 5910  H HD3  . ARG A 1 77 ? 157.321 10.483  1.203   1.00 0.00 ? 76 ARG A HD3  4  
ATOM 5911  H HE   . ARG A 1 77 ? 156.423 11.883  3.547   1.00 0.00 ? 76 ARG A HE   4  
ATOM 5912  H HH11 . ARG A 1 77 ? 158.688 11.963  0.873   1.00 0.00 ? 76 ARG A HH11 4  
ATOM 5913  H HH12 . ARG A 1 77 ? 158.860 13.686  0.914   1.00 0.00 ? 76 ARG A HH12 4  
ATOM 5914  H HH21 . ARG A 1 77 ? 156.661 14.150  3.593   1.00 0.00 ? 76 ARG A HH21 4  
ATOM 5915  H HH22 . ARG A 1 77 ? 157.712 14.926  2.456   1.00 0.00 ? 76 ARG A HH22 4  
ATOM 5916  N N    . ILE A 1 78 ? 156.585 4.894   1.327   1.00 0.00 ? 77 ILE A N    4  
ATOM 5917  C CA   . ILE A 1 78 ? 157.265 3.609   1.192   1.00 0.00 ? 77 ILE A CA   4  
ATOM 5918  C C    . ILE A 1 78 ? 158.194 3.603   -0.022  1.00 0.00 ? 77 ILE A C    4  
ATOM 5919  O O    . ILE A 1 78 ? 157.798 3.999   -1.121  1.00 0.00 ? 77 ILE A O    4  
ATOM 5920  C CB   . ILE A 1 78 ? 156.254 2.448   1.058   1.00 0.00 ? 77 ILE A CB   4  
ATOM 5921  C CG1  . ILE A 1 78 ? 155.189 2.526   2.158   1.00 0.00 ? 77 ILE A CG1  4  
ATOM 5922  C CG2  . ILE A 1 78 ? 156.970 1.104   1.105   1.00 0.00 ? 77 ILE A CG2  4  
ATOM 5923  C CD1  . ILE A 1 78 ? 153.773 2.443   1.634   1.00 0.00 ? 77 ILE A CD1  4  
ATOM 5924  H H    . ILE A 1 78 ? 156.065 5.239   0.570   1.00 0.00 ? 77 ILE A H    4  
ATOM 5925  H HA   . ILE A 1 78 ? 157.853 3.446   2.084   1.00 0.00 ? 77 ILE A HA   4  
ATOM 5926  H HB   . ILE A 1 78 ? 155.771 2.533   0.096   1.00 0.00 ? 77 ILE A HB   4  
ATOM 5927  H HG12 . ILE A 1 78 ? 155.334 1.710   2.850   1.00 0.00 ? 77 ILE A HG12 4  
ATOM 5928  H HG13 . ILE A 1 78 ? 155.293 3.462   2.688   1.00 0.00 ? 77 ILE A HG13 4  
ATOM 5929  H HG21 . ILE A 1 78 ? 156.521 0.434   0.388   1.00 0.00 ? 77 ILE A HG21 4  
ATOM 5930  H HG22 . ILE A 1 78 ? 156.880 0.683   2.095   1.00 0.00 ? 77 ILE A HG22 4  
ATOM 5931  H HG23 . ILE A 1 78 ? 158.014 1.241   0.866   1.00 0.00 ? 77 ILE A HG23 4  
ATOM 5932  H HD11 . ILE A 1 78 ? 153.097 2.885   2.351   1.00 0.00 ? 77 ILE A HD11 4  
ATOM 5933  H HD12 . ILE A 1 78 ? 153.507 1.408   1.479   1.00 0.00 ? 77 ILE A HD12 4  
ATOM 5934  H HD13 . ILE A 1 78 ? 153.703 2.977   0.697   1.00 0.00 ? 77 ILE A HD13 4  
ATOM 5935  N N    . LEU A 1 79 ? 159.429 3.144   0.184   1.00 0.00 ? 78 LEU A N    4  
ATOM 5936  C CA   . LEU A 1 79 ? 160.414 3.076   -0.891  1.00 0.00 ? 78 LEU A CA   4  
ATOM 5937  C C    . LEU A 1 79 ? 160.548 1.644   -1.403  1.00 0.00 ? 78 LEU A C    4  
ATOM 5938  O O    . LEU A 1 79 ? 160.849 0.728   -0.637  1.00 0.00 ? 78 LEU A O    4  
ATOM 5939  C CB   . LEU A 1 79 ? 161.776 3.585   -0.406  1.00 0.00 ? 78 LEU A CB   4  
ATOM 5940  C CG   . LEU A 1 79 ? 162.567 4.405   -1.431  1.00 0.00 ? 78 LEU A CG   4  
ATOM 5941  C CD1  . LEU A 1 79 ? 162.103 5.854   -1.432  1.00 0.00 ? 78 LEU A CD1  4  
ATOM 5942  C CD2  . LEU A 1 79 ? 164.060 4.320   -1.143  1.00 0.00 ? 78 LEU A CD2  4  
ATOM 5943  H H    . LEU A 1 79 ? 159.681 2.838   1.082   1.00 0.00 ? 78 LEU A H    4  
ATOM 5944  H HA   . LEU A 1 79 ? 160.069 3.705   -1.698  1.00 0.00 ? 78 LEU A HA   4  
ATOM 5945  H HB2  . LEU A 1 79 ? 161.616 4.198   0.469   1.00 0.00 ? 78 LEU A HB2  4  
ATOM 5946  H HB3  . LEU A 1 79 ? 162.375 2.733   -0.122  1.00 0.00 ? 78 LEU A HB3  4  
ATOM 5947  H HG   . LEU A 1 79 ? 162.393 3.999   -2.417  1.00 0.00 ? 78 LEU A HG   4  
ATOM 5948  H HD11 . LEU A 1 79 ? 162.706 6.425   -2.123  1.00 0.00 ? 78 LEU A HD11 4  
ATOM 5949  H HD12 . LEU A 1 79 ? 162.206 6.267   -0.439  1.00 0.00 ? 78 LEU A HD12 4  
ATOM 5950  H HD13 . LEU A 1 79 ? 161.067 5.901   -1.736  1.00 0.00 ? 78 LEU A HD13 4  
ATOM 5951  H HD21 . LEU A 1 79 ? 164.576 5.096   -1.688  1.00 0.00 ? 78 LEU A HD21 4  
ATOM 5952  H HD22 . LEU A 1 79 ? 164.432 3.355   -1.452  1.00 0.00 ? 78 LEU A HD22 4  
ATOM 5953  H HD23 . LEU A 1 79 ? 164.231 4.451   -0.084  1.00 0.00 ? 78 LEU A HD23 4  
ATOM 5954  N N    . LEU A 1 80 ? 160.318 1.461   -2.702  1.00 0.00 ? 79 LEU A N    4  
ATOM 5955  C CA   . LEU A 1 80 ? 160.409 0.140   -3.317  1.00 0.00 ? 79 LEU A CA   4  
ATOM 5956  C C    . LEU A 1 80 ? 161.777 -0.074  -3.958  1.00 0.00 ? 79 LEU A C    4  
ATOM 5957  O O    . LEU A 1 80 ? 162.301 0.810   -4.638  1.00 0.00 ? 79 LEU A O    4  
ATOM 5958  C CB   . LEU A 1 80 ? 159.314 -0.037  -4.370  1.00 0.00 ? 79 LEU A CB   4  
ATOM 5959  C CG   . LEU A 1 80 ? 157.896 0.277   -3.892  1.00 0.00 ? 79 LEU A CG   4  
ATOM 5960  C CD1  . LEU A 1 80 ? 157.061 0.825   -5.038  1.00 0.00 ? 79 LEU A CD1  4  
ATOM 5961  C CD2  . LEU A 1 80 ? 157.245 -0.963  -3.295  1.00 0.00 ? 79 LEU A CD2  4  
ATOM 5962  H H    . LEU A 1 80 ? 160.079 2.233   -3.259  1.00 0.00 ? 79 LEU A H    4  
ATOM 5963  H HA   . LEU A 1 80 ? 160.270 -0.597  -2.540  1.00 0.00 ? 79 LEU A HA   4  
ATOM 5964  H HB2  . LEU A 1 80 ? 159.542 0.606   -5.208  1.00 0.00 ? 79 LEU A HB2  4  
ATOM 5965  H HB3  . LEU A 1 80 ? 159.336 -1.062  -4.709  1.00 0.00 ? 79 LEU A HB3  4  
ATOM 5966  H HG   . LEU A 1 80 ? 157.942 1.035   -3.123  1.00 0.00 ? 79 LEU A HG   4  
ATOM 5967  H HD11 . LEU A 1 80 ? 156.043 0.479   -4.939  1.00 0.00 ? 79 LEU A HD11 4  
ATOM 5968  H HD12 . LEU A 1 80 ? 157.468 0.482   -5.977  1.00 0.00 ? 79 LEU A HD12 4  
ATOM 5969  H HD13 . LEU A 1 80 ? 157.078 1.905   -5.012  1.00 0.00 ? 79 LEU A HD13 4  
ATOM 5970  H HD21 . LEU A 1 80 ? 157.515 -1.044  -2.252  1.00 0.00 ? 79 LEU A HD21 4  
ATOM 5971  H HD22 . LEU A 1 80 ? 157.586 -1.840  -3.824  1.00 0.00 ? 79 LEU A HD22 4  
ATOM 5972  H HD23 . LEU A 1 80 ? 156.171 -0.884  -3.383  1.00 0.00 ? 79 LEU A HD23 4  
ATOM 5973  N N    . LEU A 1 81 ? 162.348 -1.257  -3.738  1.00 0.00 ? 80 LEU A N    4  
ATOM 5974  C CA   . LEU A 1 81 ? 163.655 -1.596  -4.294  1.00 0.00 ? 80 LEU A CA   4  
ATOM 5975  C C    . LEU A 1 81 ? 163.803 -3.106  -4.461  1.00 0.00 ? 80 LEU A C    4  
ATOM 5976  O O    . LEU A 1 81 ? 163.441 -3.878  -3.571  1.00 0.00 ? 80 LEU A O    4  
ATOM 5977  C CB   . LEU A 1 81 ? 164.780 -1.054  -3.402  1.00 0.00 ? 80 LEU A CB   4  
ATOM 5978  C CG   . LEU A 1 81 ? 164.555 -1.204  -1.893  1.00 0.00 ? 80 LEU A CG   4  
ATOM 5979  C CD1  . LEU A 1 81 ? 165.536 -2.206  -1.301  1.00 0.00 ? 80 LEU A CD1  4  
ATOM 5980  C CD2  . LEU A 1 81 ? 164.682 0.146   -1.200  1.00 0.00 ? 80 LEU A CD2  4  
ATOM 5981  H H    . LEU A 1 81 ? 161.878 -1.920  -3.190  1.00 0.00 ? 80 LEU A H    4  
ATOM 5982  H HA   . LEU A 1 81 ? 163.728 -1.133  -5.267  1.00 0.00 ? 80 LEU A HA   4  
ATOM 5983  H HB2  . LEU A 1 81 ? 165.694 -1.570  -3.662  1.00 0.00 ? 80 LEU A HB2  4  
ATOM 5984  H HB3  . LEU A 1 81 ? 164.908 -0.005  -3.622  1.00 0.00 ? 80 LEU A HB3  4  
ATOM 5985  H HG   . LEU A 1 81 ? 163.555 -1.577  -1.720  1.00 0.00 ? 80 LEU A HG   4  
ATOM 5986  H HD11 . LEU A 1 81 ? 165.768 -1.927  -0.284  1.00 0.00 ? 80 LEU A HD11 4  
ATOM 5987  H HD12 . LEU A 1 81 ? 166.442 -2.213  -1.888  1.00 0.00 ? 80 LEU A HD12 4  
ATOM 5988  H HD13 . LEU A 1 81 ? 165.093 -3.192  -1.312  1.00 0.00 ? 80 LEU A HD13 4  
ATOM 5989  H HD21 . LEU A 1 81 ? 165.726 0.409   -1.113  1.00 0.00 ? 80 LEU A HD21 4  
ATOM 5990  H HD22 . LEU A 1 81 ? 164.241 0.089   -0.216  1.00 0.00 ? 80 LEU A HD22 4  
ATOM 5991  H HD23 . LEU A 1 81 ? 164.169 0.898   -1.781  1.00 0.00 ? 80 LEU A HD23 4  
ATOM 5992  N N    . SER A 1 82 ? 164.339 -3.518  -5.611  1.00 0.00 ? 81 SER A N    4  
ATOM 5993  C CA   . SER A 1 82 ? 164.542 -4.934  -5.909  1.00 0.00 ? 81 SER A CA   4  
ATOM 5994  C C    . SER A 1 82 ? 165.441 -5.590  -4.862  1.00 0.00 ? 81 SER A C    4  
ATOM 5995  O O    . SER A 1 82 ? 166.649 -5.344  -4.823  1.00 0.00 ? 81 SER A O    4  
ATOM 5996  C CB   . SER A 1 82 ? 165.149 -5.100  -7.306  1.00 0.00 ? 81 SER A CB   4  
ATOM 5997  O OG   . SER A 1 82 ? 166.228 -4.201  -7.507  1.00 0.00 ? 81 SER A OG   4  
ATOM 5998  H H    . SER A 1 82 ? 164.604 -2.850  -6.278  1.00 0.00 ? 81 SER A H    4  
ATOM 5999  H HA   . SER A 1 82 ? 163.576 -5.418  -5.888  1.00 0.00 ? 81 SER A HA   4  
ATOM 6000  H HB2  . SER A 1 82 ? 165.512 -6.111  -7.421  1.00 0.00 ? 81 SER A HB2  4  
ATOM 6001  H HB3  . SER A 1 82 ? 164.390 -4.904  -8.050  1.00 0.00 ? 81 SER A HB3  4  
ATOM 6002  H HG   . SER A 1 82 ? 166.114 -3.745  -8.343  1.00 0.00 ? 81 SER A HG   4  
ATOM 6003  N N    . GLN A 1 83 ? 164.841 -6.421  -4.012  1.00 0.00 ? 82 GLN A N    4  
ATOM 6004  C CA   . GLN A 1 83 ? 165.580 -7.110  -2.961  1.00 0.00 ? 82 GLN A CA   4  
ATOM 6005  C C    . GLN A 1 83 ? 165.432 -8.625  -3.093  1.00 0.00 ? 82 GLN A C    4  
ATOM 6006  O O    . GLN A 1 83 ? 164.898 -9.291  -2.203  1.00 0.00 ? 82 GLN A O    4  
ATOM 6007  C CB   . GLN A 1 83 ? 165.099 -6.641  -1.584  1.00 0.00 ? 82 GLN A CB   4  
ATOM 6008  C CG   . GLN A 1 83 ? 166.047 -7.001  -0.450  1.00 0.00 ? 82 GLN A CG   4  
ATOM 6009  C CD   . GLN A 1 83 ? 166.971 -5.858  -0.076  1.00 0.00 ? 82 GLN A CD   4  
ATOM 6010  O OE1  . GLN A 1 83 ? 166.789 -5.210  0.954   1.00 0.00 ? 82 GLN A OE1  4  
ATOM 6011  N NE2  . GLN A 1 83 ? 167.970 -5.604  -0.914  1.00 0.00 ? 82 GLN A NE2  4  
ATOM 6012  H H    . GLN A 1 83 ? 163.876 -6.572  -4.093  1.00 0.00 ? 82 GLN A H    4  
ATOM 6013  H HA   . GLN A 1 83 ? 166.623 -6.856  -3.072  1.00 0.00 ? 82 GLN A HA   4  
ATOM 6014  H HB2  . GLN A 1 83 ? 164.987 -5.567  -1.603  1.00 0.00 ? 82 GLN A HB2  4  
ATOM 6015  H HB3  . GLN A 1 83 ? 164.139 -7.090  -1.379  1.00 0.00 ? 82 GLN A HB3  4  
ATOM 6016  H HG2  . GLN A 1 83 ? 165.463 -7.270  0.417   1.00 0.00 ? 82 GLN A HG2  4  
ATOM 6017  H HG3  . GLN A 1 83 ? 166.647 -7.846  -0.754  1.00 0.00 ? 82 GLN A HG3  4  
ATOM 6018  H HE21 . GLN A 1 83 ? 168.056 -6.160  -1.716  1.00 0.00 ? 82 GLN A HE21 4  
ATOM 6019  H HE22 . GLN A 1 83 ? 168.581 -4.869  -0.696  1.00 0.00 ? 82 GLN A HE22 4  
ATOM 6020  N N    . ASP A 1 84 ? 165.919 -9.163  -4.209  1.00 0.00 ? 83 ASP A N    4  
ATOM 6021  C CA   . ASP A 1 84 ? 165.852 -10.599 -4.458  1.00 0.00 ? 83 ASP A CA   4  
ATOM 6022  C C    . ASP A 1 84 ? 167.184 -11.264 -4.108  1.00 0.00 ? 83 ASP A C    4  
ATOM 6023  O O    . ASP A 1 84 ? 167.745 -12.017 -4.905  1.00 0.00 ? 83 ASP A O    4  
ATOM 6024  C CB   . ASP A 1 84 ? 165.485 -10.873 -5.920  1.00 0.00 ? 83 ASP A CB   4  
ATOM 6025  C CG   . ASP A 1 84 ? 164.643 -12.123 -6.077  1.00 0.00 ? 83 ASP A CG   4  
ATOM 6026  O OD1  . ASP A 1 84 ? 163.443 -12.080 -5.730  1.00 0.00 ? 83 ASP A OD1  4  
ATOM 6027  O OD2  . ASP A 1 84 ? 165.183 -13.148 -6.543  1.00 0.00 ? 83 ASP A OD2  4  
ATOM 6028  H H    . ASP A 1 84 ? 166.338 -8.582  -4.877  1.00 0.00 ? 83 ASP A H    4  
ATOM 6029  H HA   . ASP A 1 84 ? 165.083 -11.007 -3.819  1.00 0.00 ? 83 ASP A HA   4  
ATOM 6030  H HB2  . ASP A 1 84 ? 164.928 -10.034 -6.309  1.00 0.00 ? 83 ASP A HB2  4  
ATOM 6031  H HB3  . ASP A 1 84 ? 166.391 -10.996 -6.495  1.00 0.00 ? 83 ASP A HB3  4  
ATOM 6032  N N    . ARG A 1 85 ? 167.684 -10.972 -2.903  1.00 0.00 ? 84 ARG A N    4  
ATOM 6033  C CA   . ARG A 1 85 ? 168.951 -11.530 -2.427  1.00 0.00 ? 84 ARG A CA   4  
ATOM 6034  C C    . ARG A 1 85 ? 170.086 -11.281 -3.432  1.00 0.00 ? 84 ARG A C    4  
ATOM 6035  O O    . ARG A 1 85 ? 170.994 -12.102 -3.571  1.00 0.00 ? 84 ARG A O    4  
ATOM 6036  C CB   . ARG A 1 85 ? 168.798 -13.031 -2.148  1.00 0.00 ? 84 ARG A CB   4  
ATOM 6037  C CG   . ARG A 1 85 ? 168.160 -13.337 -0.800  1.00 0.00 ? 84 ARG A CG   4  
ATOM 6038  C CD   . ARG A 1 85 ? 166.933 -14.227 -0.944  1.00 0.00 ? 84 ARG A CD   4  
ATOM 6039  N NE   . ARG A 1 85 ? 165.908 -13.626 -1.800  1.00 0.00 ? 84 ARG A NE   4  
ATOM 6040  C CZ   . ARG A 1 85 ? 164.627 -13.999 -1.806  1.00 0.00 ? 84 ARG A CZ   4  
ATOM 6041  N NH1  . ARG A 1 85 ? 164.199 -14.960 -0.993  1.00 0.00 ? 84 ARG A NH1  4  
ATOM 6042  N NH2  . ARG A 1 85 ? 163.767 -13.411 -2.631  1.00 0.00 ? 84 ARG A NH2  4  
ATOM 6043  H H    . ARG A 1 85 ? 167.186 -10.365 -2.316  1.00 0.00 ? 84 ARG A H    4  
ATOM 6044  H HA   . ARG A 1 85 ? 169.199 -11.031 -1.501  1.00 0.00 ? 84 ARG A HA   4  
ATOM 6045  H HB2  . ARG A 1 85 ? 168.185 -13.469 -2.922  1.00 0.00 ? 84 ARG A HB2  4  
ATOM 6046  H HB3  . ARG A 1 85 ? 169.775 -13.493 -2.172  1.00 0.00 ? 84 ARG A HB3  4  
ATOM 6047  H HG2  . ARG A 1 85 ? 168.882 -13.841 -0.175  1.00 0.00 ? 84 ARG A HG2  4  
ATOM 6048  H HG3  . ARG A 1 85 ? 167.865 -12.409 -0.333  1.00 0.00 ? 84 ARG A HG3  4  
ATOM 6049  H HD2  . ARG A 1 85 ? 167.238 -15.170 -1.373  1.00 0.00 ? 84 ARG A HD2  4  
ATOM 6050  H HD3  . ARG A 1 85 ? 166.515 -14.399 0.037   1.00 0.00 ? 84 ARG A HD3  4  
ATOM 6051  H HE   . ARG A 1 85 ? 166.190 -12.911 -2.407  1.00 0.00 ? 84 ARG A HE   4  
ATOM 6052  H HH11 . ARG A 1 85 ? 164.837 -15.411 -0.369  1.00 0.00 ? 84 ARG A HH11 4  
ATOM 6053  H HH12 . ARG A 1 85 ? 163.237 -15.231 -1.003  1.00 0.00 ? 84 ARG A HH12 4  
ATOM 6054  H HH21 . ARG A 1 85 ? 164.078 -12.688 -3.248  1.00 0.00 ? 84 ARG A HH21 4  
ATOM 6055  H HH22 . ARG A 1 85 ? 162.806 -13.690 -2.634  1.00 0.00 ? 84 ARG A HH22 4  
ATOM 6056  N N    . ASN A 1 86 ? 170.029 -10.139 -4.126  1.00 0.00 ? 85 ASN A N    4  
ATOM 6057  C CA   . ASN A 1 86 ? 171.051 -9.781  -5.112  1.00 0.00 ? 85 ASN A CA   4  
ATOM 6058  C C    . ASN A 1 86 ? 171.302 -8.272  -5.125  1.00 0.00 ? 85 ASN A C    4  
ATOM 6059  O O    . ASN A 1 86 ? 170.454 -7.490  -4.691  1.00 0.00 ? 85 ASN A O    4  
ATOM 6060  C CB   . ASN A 1 86 ? 170.635 -10.248 -6.511  1.00 0.00 ? 85 ASN A CB   4  
ATOM 6061  C CG   . ASN A 1 86 ? 171.778 -10.911 -7.257  1.00 0.00 ? 85 ASN A CG   4  
ATOM 6062  O OD1  . ASN A 1 86 ? 171.975 -12.122 -7.160  1.00 0.00 ? 85 ASN A OD1  4  
ATOM 6063  N ND2  . ASN A 1 86 ? 172.541 -10.120 -8.006  1.00 0.00 ? 85 ASN A ND2  4  
ATOM 6064  H H    . ASN A 1 86 ? 169.284 -9.521  -3.969  1.00 0.00 ? 85 ASN A H    4  
ATOM 6065  H HA   . ASN A 1 86 ? 171.966 -10.281 -4.832  1.00 0.00 ? 85 ASN A HA   4  
ATOM 6066  H HB2  . ASN A 1 86 ? 169.826 -10.960 -6.423  1.00 0.00 ? 85 ASN A HB2  4  
ATOM 6067  H HB3  . ASN A 1 86 ? 170.300 -9.397  -7.085  1.00 0.00 ? 85 ASN A HB3  4  
ATOM 6068  H HD21 . ASN A 1 86 ? 172.329 -9.162  -8.037  1.00 0.00 ? 85 ASN A HD21 4  
ATOM 6069  H HD22 . ASN A 1 86 ? 173.285 -10.525 -8.497  1.00 0.00 ? 85 ASN A HD22 4  
ATOM 6070  N N    . LEU A 1 87 ? 172.473 -7.875  -5.632  1.00 0.00 ? 86 LEU A N    4  
ATOM 6071  C CA   . LEU A 1 87 ? 172.844 -6.461  -5.711  1.00 0.00 ? 86 LEU A CA   4  
ATOM 6072  C C    . LEU A 1 87 ? 173.786 -6.199  -6.887  1.00 0.00 ? 86 LEU A C    4  
ATOM 6073  O O    . LEU A 1 87 ? 174.806 -6.874  -7.038  1.00 0.00 ? 86 LEU A O    4  
ATOM 6074  C CB   . LEU A 1 87 ? 173.506 -6.001  -4.406  1.00 0.00 ? 86 LEU A CB   4  
ATOM 6075  C CG   . LEU A 1 87 ? 174.638 -6.898  -3.894  1.00 0.00 ? 86 LEU A CG   4  
ATOM 6076  C CD1  . LEU A 1 87 ? 175.994 -6.347  -4.313  1.00 0.00 ? 86 LEU A CD1  4  
ATOM 6077  C CD2  . LEU A 1 87 ? 174.560 -7.039  -2.380  1.00 0.00 ? 86 LEU A CD2  4  
ATOM 6078  H H    . LEU A 1 87 ? 173.102 -8.550  -5.964  1.00 0.00 ? 86 LEU A H    4  
ATOM 6079  H HA   . LEU A 1 87 ? 171.939 -5.891  -5.861  1.00 0.00 ? 86 LEU A HA   4  
ATOM 6080  H HB2  . LEU A 1 87 ? 173.904 -5.009  -4.561  1.00 0.00 ? 86 LEU A HB2  4  
ATOM 6081  H HB3  . LEU A 1 87 ? 172.745 -5.949  -3.642  1.00 0.00 ? 86 LEU A HB3  4  
ATOM 6082  H HG   . LEU A 1 87 ? 174.532 -7.882  -4.327  1.00 0.00 ? 86 LEU A HG   4  
ATOM 6083  H HD11 . LEU A 1 87 ? 175.871 -5.695  -5.165  1.00 0.00 ? 86 LEU A HD11 4  
ATOM 6084  H HD12 . LEU A 1 87 ? 176.647 -7.166  -4.579  1.00 0.00 ? 86 LEU A HD12 4  
ATOM 6085  H HD13 . LEU A 1 87 ? 176.427 -5.793  -3.494  1.00 0.00 ? 86 LEU A HD13 4  
ATOM 6086  H HD21 . LEU A 1 87 ? 174.452 -6.062  -1.933  1.00 0.00 ? 86 LEU A HD21 4  
ATOM 6087  H HD22 . LEU A 1 87 ? 175.463 -7.505  -2.014  1.00 0.00 ? 86 LEU A HD22 4  
ATOM 6088  H HD23 . LEU A 1 87 ? 173.708 -7.650  -2.120  1.00 0.00 ? 86 LEU A HD23 4  
ATOM 6089  N N    . GLU A 1 88 ? 173.439 -5.212  -7.713  1.00 0.00 ? 87 GLU A N    4  
ATOM 6090  C CA   . GLU A 1 88 ? 174.254 -4.854  -8.871  1.00 0.00 ? 87 GLU A CA   4  
ATOM 6091  C C    . GLU A 1 88 ? 174.813 -3.441  -8.724  1.00 0.00 ? 87 GLU A C    4  
ATOM 6092  O O    . GLU A 1 88 ? 174.340 -2.501  -9.368  1.00 0.00 ? 87 GLU A O    4  
ATOM 6093  C CB   . GLU A 1 88 ? 173.429 -4.964  -10.156 1.00 0.00 ? 87 GLU A CB   4  
ATOM 6094  C CG   . GLU A 1 88 ? 173.402 -6.366  -10.743 1.00 0.00 ? 87 GLU A CG   4  
ATOM 6095  C CD   . GLU A 1 88 ? 172.037 -7.017  -10.635 1.00 0.00 ? 87 GLU A CD   4  
ATOM 6096  O OE1  . GLU A 1 88 ? 171.074 -6.480  -11.221 1.00 0.00 ? 87 GLU A OE1  4  
ATOM 6097  O OE2  . GLU A 1 88 ? 171.929 -8.063  -9.962  1.00 0.00 ? 87 GLU A OE2  4  
ATOM 6098  H H    . GLU A 1 88 ? 172.616 -4.708  -7.536  1.00 0.00 ? 87 GLU A H    4  
ATOM 6099  H HA   . GLU A 1 88 ? 175.079 -5.550  -8.925  1.00 0.00 ? 87 GLU A HA   4  
ATOM 6100  H HB2  . GLU A 1 88 ? 172.413 -4.664  -9.944  1.00 0.00 ? 87 GLU A HB2  4  
ATOM 6101  H HB3  . GLU A 1 88 ? 173.844 -4.295  -10.896 1.00 0.00 ? 87 GLU A HB3  4  
ATOM 6102  H HG2  . GLU A 1 88 ? 173.675 -6.310  -11.787 1.00 0.00 ? 87 GLU A HG2  4  
ATOM 6103  H HG3  . GLU A 1 88 ? 174.121 -6.977  -10.216 1.00 0.00 ? 87 GLU A HG3  4  
ATOM 6104  N N    . HIS A 1 89 ? 175.824 -3.296  -7.869  1.00 0.00 ? 88 HIS A N    4  
ATOM 6105  C CA   . HIS A 1 89 ? 176.449 -1.997  -7.634  1.00 0.00 ? 88 HIS A CA   4  
ATOM 6106  C C    . HIS A 1 89 ? 177.533 -1.716  -8.676  1.00 0.00 ? 88 HIS A C    4  
ATOM 6107  O O    . HIS A 1 89 ? 178.723 -1.912  -8.420  1.00 0.00 ? 88 HIS A O    4  
ATOM 6108  C CB   . HIS A 1 89 ? 177.037 -1.938  -6.220  1.00 0.00 ? 88 HIS A CB   4  
ATOM 6109  C CG   . HIS A 1 89 ? 176.264 -1.058  -5.288  1.00 0.00 ? 88 HIS A CG   4  
ATOM 6110  N ND1  . HIS A 1 89 ? 176.188 0.311   -5.434  1.00 0.00 ? 88 HIS A ND1  4  
ATOM 6111  C CD2  . HIS A 1 89 ? 175.527 -1.359  -4.192  1.00 0.00 ? 88 HIS A CD2  4  
ATOM 6112  C CE1  . HIS A 1 89 ? 175.441 0.814   -4.467  1.00 0.00 ? 88 HIS A CE1  4  
ATOM 6113  N NE2  . HIS A 1 89 ? 175.027 -0.178  -3.701  1.00 0.00 ? 88 HIS A NE2  4  
ATOM 6114  H H    . HIS A 1 89 ? 176.157 -4.081  -7.384  1.00 0.00 ? 88 HIS A H    4  
ATOM 6115  H HA   . HIS A 1 89 ? 175.680 -1.244  -7.723  1.00 0.00 ? 88 HIS A HA   4  
ATOM 6116  H HB2  . HIS A 1 89 ? 177.052 -2.934  -5.801  1.00 0.00 ? 88 HIS A HB2  4  
ATOM 6117  H HB3  . HIS A 1 89 ? 178.048 -1.561  -6.272  1.00 0.00 ? 88 HIS A HB3  4  
ATOM 6118  H HD1  . HIS A 1 89 ? 176.618 0.836   -6.140  1.00 0.00 ? 88 HIS A HD1  4  
ATOM 6119  H HD2  . HIS A 1 89 ? 175.361 -2.346  -3.782  1.00 0.00 ? 88 HIS A HD2  4  
ATOM 6120  H HE1  . HIS A 1 89 ? 175.207 1.859   -4.328  1.00 0.00 ? 88 HIS A HE1  4  
ATOM 6121  H HE2  . HIS A 1 89 ? 174.528 -0.076  -2.864  1.00 0.00 ? 88 HIS A HE2  4  
ATOM 6122  N N    . HIS A 1 90 ? 177.107 -1.259  -9.854  1.00 0.00 ? 89 HIS A N    4  
ATOM 6123  C CA   . HIS A 1 90 ? 178.030 -0.951  -10.946 1.00 0.00 ? 89 HIS A CA   4  
ATOM 6124  C C    . HIS A 1 90 ? 177.394 0.025   -11.942 1.00 0.00 ? 89 HIS A C    4  
ATOM 6125  O O    . HIS A 1 90 ? 176.271 0.493   -11.738 1.00 0.00 ? 89 HIS A O    4  
ATOM 6126  C CB   . HIS A 1 90 ? 178.449 -2.243  -11.663 1.00 0.00 ? 89 HIS A CB   4  
ATOM 6127  C CG   . HIS A 1 90 ? 179.933 -2.403  -11.829 1.00 0.00 ? 89 HIS A CG   4  
ATOM 6128  N ND1  . HIS A 1 90 ? 180.822 -1.346  -11.780 1.00 0.00 ? 89 HIS A ND1  4  
ATOM 6129  C CD2  . HIS A 1 90 ? 180.685 -3.510  -12.049 1.00 0.00 ? 89 HIS A CD2  4  
ATOM 6130  C CE1  . HIS A 1 90 ? 182.050 -1.796  -11.965 1.00 0.00 ? 89 HIS A CE1  4  
ATOM 6131  N NE2  . HIS A 1 90 ? 181.995 -3.104  -12.129 1.00 0.00 ? 89 HIS A NE2  4  
ATOM 6132  H H    . HIS A 1 90 ? 176.145 -1.127  -9.994  1.00 0.00 ? 89 HIS A H    4  
ATOM 6133  H HA   . HIS A 1 90 ? 178.905 -0.487  -10.515 1.00 0.00 ? 89 HIS A HA   4  
ATOM 6134  H HB2  . HIS A 1 90 ? 178.089 -3.090  -11.099 1.00 0.00 ? 89 HIS A HB2  4  
ATOM 6135  H HB3  . HIS A 1 90 ? 178.001 -2.259  -12.647 1.00 0.00 ? 89 HIS A HB3  4  
ATOM 6136  H HD1  . HIS A 1 90 ? 180.587 -0.406  -11.634 1.00 0.00 ? 89 HIS A HD1  4  
ATOM 6137  H HD2  . HIS A 1 90 ? 180.321 -4.523  -12.146 1.00 0.00 ? 89 HIS A HD2  4  
ATOM 6138  H HE1  . HIS A 1 90 ? 182.948 -1.195  -11.978 1.00 0.00 ? 89 HIS A HE1  4  
ATOM 6139  H HE2  . HIS A 1 90 ? 182.772 -3.699  -12.196 1.00 0.00 ? 89 HIS A HE2  4  
ATOM 6140  N N    . HIS A 1 91 ? 178.120 0.327   -13.019 1.00 0.00 ? 90 HIS A N    4  
ATOM 6141  C CA   . HIS A 1 91 ? 177.633 1.243   -14.048 1.00 0.00 ? 90 HIS A CA   4  
ATOM 6142  C C    . HIS A 1 91 ? 176.672 0.534   -15.002 1.00 0.00 ? 90 HIS A C    4  
ATOM 6143  O O    . HIS A 1 91 ? 176.788 -0.671  -15.236 1.00 0.00 ? 90 HIS A O    4  
ATOM 6144  C CB   . HIS A 1 91 ? 178.810 1.839   -14.829 1.00 0.00 ? 90 HIS A CB   4  
ATOM 6145  C CG   . HIS A 1 91 ? 179.470 2.989   -14.129 1.00 0.00 ? 90 HIS A CG   4  
ATOM 6146  N ND1  . HIS A 1 91 ? 178.889 4.236   -14.015 1.00 0.00 ? 90 HIS A ND1  4  
ATOM 6147  C CD2  . HIS A 1 91 ? 180.664 3.076   -13.494 1.00 0.00 ? 90 HIS A CD2  4  
ATOM 6148  C CE1  . HIS A 1 91 ? 179.697 5.037   -13.343 1.00 0.00 ? 90 HIS A CE1  4  
ATOM 6149  N NE2  . HIS A 1 91 ? 180.780 4.358   -13.015 1.00 0.00 ? 90 HIS A NE2  4  
ATOM 6150  H H    . HIS A 1 91 ? 179.005 -0.078  -13.126 1.00 0.00 ? 90 HIS A H    4  
ATOM 6151  H HA   . HIS A 1 91 ? 177.101 2.042   -13.553 1.00 0.00 ? 90 HIS A HA   4  
ATOM 6152  H HB2  . HIS A 1 91 ? 179.556 1.072   -14.981 1.00 0.00 ? 90 HIS A HB2  4  
ATOM 6153  H HB3  . HIS A 1 91 ? 178.459 2.188   -15.789 1.00 0.00 ? 90 HIS A HB3  4  
ATOM 6154  H HD1  . HIS A 1 91 ? 178.015 4.496   -14.377 1.00 0.00 ? 90 HIS A HD1  4  
ATOM 6155  H HD2  . HIS A 1 91 ? 181.392 2.284   -13.386 1.00 0.00 ? 90 HIS A HD2  4  
ATOM 6156  H HE1  . HIS A 1 91 ? 179.501 6.072   -13.100 1.00 0.00 ? 90 HIS A HE1  4  
ATOM 6157  H HE2  . HIS A 1 91 ? 181.493 4.684   -12.427 1.00 0.00 ? 90 HIS A HE2  4  
ATOM 6158  N N    . HIS A 1 92 ? 175.719 1.294   -15.544 1.00 0.00 ? 91 HIS A N    4  
ATOM 6159  C CA   . HIS A 1 92 ? 174.729 0.749   -16.469 1.00 0.00 ? 91 HIS A CA   4  
ATOM 6160  C C    . HIS A 1 92 ? 174.426 1.741   -17.594 1.00 0.00 ? 91 HIS A C    4  
ATOM 6161  O O    . HIS A 1 92 ? 174.427 2.956   -17.382 1.00 0.00 ? 91 HIS A O    4  
ATOM 6162  C CB   . HIS A 1 92 ? 173.440 0.381   -15.717 1.00 0.00 ? 91 HIS A CB   4  
ATOM 6163  C CG   . HIS A 1 92 ? 172.901 1.481   -14.846 1.00 0.00 ? 91 HIS A CG   4  
ATOM 6164  N ND1  . HIS A 1 92 ? 173.558 1.947   -13.725 1.00 0.00 ? 91 HIS A ND1  4  
ATOM 6165  C CD2  . HIS A 1 92 ? 171.759 2.208   -14.936 1.00 0.00 ? 91 HIS A CD2  4  
ATOM 6166  C CE1  . HIS A 1 92 ? 172.847 2.911   -13.167 1.00 0.00 ? 91 HIS A CE1  4  
ATOM 6167  N NE2  . HIS A 1 92 ? 171.751 3.088   -13.881 1.00 0.00 ? 91 HIS A NE2  4  
ATOM 6168  H H    . HIS A 1 92 ? 175.679 2.244   -15.313 1.00 0.00 ? 91 HIS A H    4  
ATOM 6169  H HA   . HIS A 1 92 ? 175.146 -0.146  -16.905 1.00 0.00 ? 91 HIS A HA   4  
ATOM 6170  H HB2  . HIS A 1 92 ? 172.676 0.119   -16.434 1.00 0.00 ? 91 HIS A HB2  4  
ATOM 6171  H HB3  . HIS A 1 92 ? 173.638 -0.473  -15.087 1.00 0.00 ? 91 HIS A HB3  4  
ATOM 6172  H HD1  . HIS A 1 92 ? 174.415 1.615   -13.384 1.00 0.00 ? 91 HIS A HD1  4  
ATOM 6173  H HD2  . HIS A 1 92 ? 170.992 2.107   -15.692 1.00 0.00 ? 91 HIS A HD2  4  
ATOM 6174  H HE1  . HIS A 1 92 ? 173.119 3.463   -12.278 1.00 0.00 ? 91 HIS A HE1  4  
ATOM 6175  H HE2  . HIS A 1 92 ? 170.988 3.642   -13.610 1.00 0.00 ? 91 HIS A HE2  4  
ATOM 6176  N N    . HIS A 1 93 ? 174.178 1.213   -18.796 1.00 0.00 ? 92 HIS A N    4  
ATOM 6177  C CA   . HIS A 1 93 ? 173.885 2.048   -19.958 1.00 0.00 ? 92 HIS A CA   4  
ATOM 6178  C C    . HIS A 1 93 ? 172.415 1.942   -20.364 1.00 0.00 ? 92 HIS A C    4  
ATOM 6179  O O    . HIS A 1 93 ? 171.918 0.851   -20.652 1.00 0.00 ? 92 HIS A O    4  
ATOM 6180  C CB   . HIS A 1 93 ? 174.779 1.649   -21.134 1.00 0.00 ? 92 HIS A CB   4  
ATOM 6181  C CG   . HIS A 1 93 ? 176.136 2.281   -21.096 1.00 0.00 ? 92 HIS A CG   4  
ATOM 6182  N ND1  . HIS A 1 93 ? 177.307 1.552   -21.073 1.00 0.00 ? 92 HIS A ND1  4  
ATOM 6183  C CD2  . HIS A 1 93 ? 176.506 3.583   -21.076 1.00 0.00 ? 92 HIS A CD2  4  
ATOM 6184  C CE1  . HIS A 1 93 ? 178.337 2.378   -21.041 1.00 0.00 ? 92 HIS A CE1  4  
ATOM 6185  N NE2  . HIS A 1 93 ? 177.878 3.616   -21.042 1.00 0.00 ? 92 HIS A NE2  4  
ATOM 6186  H H    . HIS A 1 93 ? 174.201 0.240   -18.904 1.00 0.00 ? 92 HIS A H    4  
ATOM 6187  H HA   . HIS A 1 93 ? 174.097 3.070   -19.691 1.00 0.00 ? 92 HIS A HA   4  
ATOM 6188  H HB2  . HIS A 1 93 ? 174.913 0.577   -21.130 1.00 0.00 ? 92 HIS A HB2  4  
ATOM 6189  H HB3  . HIS A 1 93 ? 174.300 1.943   -22.056 1.00 0.00 ? 92 HIS A HB3  4  
ATOM 6190  H HD1  . HIS A 1 93 ? 177.372 0.574   -21.077 1.00 0.00 ? 92 HIS A HD1  4  
ATOM 6191  H HD2  . HIS A 1 93 ? 175.844 4.438   -21.084 1.00 0.00 ? 92 HIS A HD2  4  
ATOM 6192  H HE1  . HIS A 1 93 ? 179.378 2.090   -21.019 1.00 0.00 ? 92 HIS A HE1  4  
ATOM 6193  H HE2  . HIS A 1 93 ? 178.429 4.422   -21.135 1.00 0.00 ? 92 HIS A HE2  4  
ATOM 6194  N N    . HIS A 1 94 ? 171.729 3.088   -20.386 1.00 0.00 ? 93 HIS A N    4  
ATOM 6195  C CA   . HIS A 1 94 ? 170.310 3.146   -20.756 1.00 0.00 ? 93 HIS A CA   4  
ATOM 6196  C C    . HIS A 1 94 ? 169.430 2.468   -19.699 1.00 0.00 ? 93 HIS A C    4  
ATOM 6197  O O    . HIS A 1 94 ? 169.980 1.967   -18.694 1.00 0.00 ? 93 HIS A O    4  
ATOM 6198  C CB   . HIS A 1 94 ? 170.081 2.500   -22.135 1.00 0.00 ? 93 HIS A CB   4  
ATOM 6199  C CG   . HIS A 1 94 ? 169.874 3.490   -23.246 1.00 0.00 ? 93 HIS A CG   4  
ATOM 6200  N ND1  . HIS A 1 94 ? 169.588 3.117   -24.544 1.00 0.00 ? 93 HIS A ND1  4  
ATOM 6201  C CD2  . HIS A 1 94 ? 169.912 4.845   -23.248 1.00 0.00 ? 93 HIS A CD2  4  
ATOM 6202  C CE1  . HIS A 1 94 ? 169.462 4.198   -25.294 1.00 0.00 ? 93 HIS A CE1  4  
ATOM 6203  N NE2  . HIS A 1 94 ? 169.653 5.259   -24.531 1.00 0.00 ? 93 HIS A NE2  4  
ATOM 6204  O OXT  . HIS A 1 94 ? 168.195 2.454   -19.881 1.00 0.00 ? 93 HIS A OXT  4  
ATOM 6205  H H    . HIS A 1 94 ? 172.188 3.921   -20.144 1.00 0.00 ? 93 HIS A H    4  
ATOM 6206  H HA   . HIS A 1 94 ? 170.032 4.190   -20.811 1.00 0.00 ? 93 HIS A HA   4  
ATOM 6207  H HB2  . HIS A 1 94 ? 170.938 1.896   -22.389 1.00 0.00 ? 93 HIS A HB2  4  
ATOM 6208  H HB3  . HIS A 1 94 ? 169.205 1.867   -22.087 1.00 0.00 ? 93 HIS A HB3  4  
ATOM 6209  H HD1  . HIS A 1 94 ? 169.493 2.196   -24.867 1.00 0.00 ? 93 HIS A HD1  4  
ATOM 6210  H HD2  . HIS A 1 94 ? 170.111 5.481   -22.396 1.00 0.00 ? 93 HIS A HD2  4  
ATOM 6211  H HE1  . HIS A 1 94 ? 169.240 4.211   -26.350 1.00 0.00 ? 93 HIS A HE1  4  
ATOM 6212  H HE2  . HIS A 1 94 ? 169.507 6.187   -24.810 1.00 0.00 ? 93 HIS A HE2  4  
ATOM 6213  N N    . GLN A 1 2  ? 139.200 -7.287  10.483  1.00 0.00 ? 1  GLN A N    5  
ATOM 6214  C CA   . GLN A 1 2  ? 139.930 -8.550  10.179  1.00 0.00 ? 1  GLN A CA   5  
ATOM 6215  C C    . GLN A 1 2  ? 140.004 -8.800  8.675   1.00 0.00 ? 1  GLN A C    5  
ATOM 6216  O O    . GLN A 1 2  ? 139.068 -8.478  7.942   1.00 0.00 ? 1  GLN A O    5  
ATOM 6217  C CB   . GLN A 1 2  ? 139.211 -9.715  10.869  1.00 0.00 ? 1  GLN A CB   5  
ATOM 6218  C CG   . GLN A 1 2  ? 138.948 -9.481  12.349  1.00 0.00 ? 1  GLN A CG   5  
ATOM 6219  C CD   . GLN A 1 2  ? 138.692 -10.767 13.113  1.00 0.00 ? 1  GLN A CD   5  
ATOM 6220  O OE1  . GLN A 1 2  ? 139.589 -11.302 13.763  1.00 0.00 ? 1  GLN A OE1  5  
ATOM 6221  N NE2  . GLN A 1 2  ? 137.465 -11.271 13.037  1.00 0.00 ? 1  GLN A NE2  5  
ATOM 6222  H HA   . GLN A 1 2  ? 140.933 -8.469  10.572  1.00 0.00 ? 1  GLN A HA   5  
ATOM 6223  H HB2  . GLN A 1 2  ? 138.262 -9.877  10.377  1.00 0.00 ? 1  GLN A HB2  5  
ATOM 6224  H HB3  . GLN A 1 2  ? 139.815 -10.605 10.769  1.00 0.00 ? 1  GLN A HB3  5  
ATOM 6225  H HG2  . GLN A 1 2  ? 139.806 -8.990  12.782  1.00 0.00 ? 1  GLN A HG2  5  
ATOM 6226  H HG3  . GLN A 1 2  ? 138.081 -8.843  12.450  1.00 0.00 ? 1  GLN A HG3  5  
ATOM 6227  H HE21 . GLN A 1 2  ? 136.799 -10.794 12.499  1.00 0.00 ? 1  GLN A HE21 5  
ATOM 6228  H HE22 . GLN A 1 2  ? 137.275 -12.099 13.525  1.00 0.00 ? 1  GLN A HE22 5  
ATOM 6229  N N    . SER A 1 3  ? 141.125 -9.378  8.229   1.00 0.00 ? 2  SER A N    5  
ATOM 6230  C CA   . SER A 1 3  ? 141.343 -9.681  6.813   1.00 0.00 ? 2  SER A CA   5  
ATOM 6231  C C    . SER A 1 3  ? 141.482 -8.401  5.991   1.00 0.00 ? 2  SER A C    5  
ATOM 6232  O O    . SER A 1 3  ? 140.883 -7.375  6.317   1.00 0.00 ? 2  SER A O    5  
ATOM 6233  C CB   . SER A 1 3  ? 140.207 -10.545 6.265   1.00 0.00 ? 2  SER A CB   5  
ATOM 6234  O OG   . SER A 1 3  ? 140.447 -11.921 6.514   1.00 0.00 ? 2  SER A OG   5  
ATOM 6235  H H    . SER A 1 3  ? 141.828 -9.606  8.872   1.00 0.00 ? 2  SER A H    5  
ATOM 6236  H HA   . SER A 1 3  ? 142.268 -10.236 6.739   1.00 0.00 ? 2  SER A HA   5  
ATOM 6237  H HB2  . SER A 1 3  ? 139.282 -10.264 6.742   1.00 0.00 ? 2  SER A HB2  5  
ATOM 6238  H HB3  . SER A 1 3  ? 140.124 -10.394 5.199   1.00 0.00 ? 2  SER A HB3  5  
ATOM 6239  H HG   . SER A 1 3  ? 140.364 -12.096 7.454   1.00 0.00 ? 2  SER A HG   5  
ATOM 6240  N N    . ASP A 1 4  ? 142.291 -8.471  4.932   1.00 0.00 ? 3  ASP A N    5  
ATOM 6241  C CA   . ASP A 1 4  ? 142.541 -7.323  4.058   1.00 0.00 ? 3  ASP A CA   5  
ATOM 6242  C C    . ASP A 1 4  ? 143.269 -6.214  4.816   1.00 0.00 ? 3  ASP A C    5  
ATOM 6243  O O    . ASP A 1 4  ? 143.291 -6.200  6.048   1.00 0.00 ? 3  ASP A O    5  
ATOM 6244  C CB   . ASP A 1 4  ? 141.235 -6.779  3.463   1.00 0.00 ? 3  ASP A CB   5  
ATOM 6245  C CG   . ASP A 1 4  ? 140.513 -7.800  2.602   1.00 0.00 ? 3  ASP A CG   5  
ATOM 6246  O OD1  . ASP A 1 4  ? 141.191 -8.534  1.851   1.00 0.00 ? 3  ASP A OD1  5  
ATOM 6247  O OD2  . ASP A 1 4  ? 139.268 -7.862  2.677   1.00 0.00 ? 3  ASP A OD2  5  
ATOM 6248  H H    . ASP A 1 4  ? 142.744 -9.318  4.738   1.00 0.00 ? 3  ASP A H    5  
ATOM 6249  H HA   . ASP A 1 4  ? 143.175 -7.660  3.252   1.00 0.00 ? 3  ASP A HA   5  
ATOM 6250  H HB2  . ASP A 1 4  ? 140.576 -6.480  4.264   1.00 0.00 ? 3  ASP A HB2  5  
ATOM 6251  H HB3  . ASP A 1 4  ? 141.462 -5.918  2.851   1.00 0.00 ? 3  ASP A HB3  5  
ATOM 6252  N N    . VAL A 1 5  ? 143.870 -5.289  4.072   1.00 0.00 ? 4  VAL A N    5  
ATOM 6253  C CA   . VAL A 1 5  ? 144.601 -4.180  4.677   1.00 0.00 ? 4  VAL A CA   5  
ATOM 6254  C C    . VAL A 1 5  ? 144.448 -2.906  3.849   1.00 0.00 ? 4  VAL A C    5  
ATOM 6255  O O    . VAL A 1 5  ? 144.610 -2.927  2.628   1.00 0.00 ? 4  VAL A O    5  
ATOM 6256  C CB   . VAL A 1 5  ? 146.105 -4.497  4.826   1.00 0.00 ? 4  VAL A CB   5  
ATOM 6257  C CG1  . VAL A 1 5  ? 146.800 -3.412  5.636   1.00 0.00 ? 4  VAL A CG1  5  
ATOM 6258  C CG2  . VAL A 1 5  ? 146.315 -5.862  5.469   1.00 0.00 ? 4  VAL A CG2  5  
ATOM 6259  H H    . VAL A 1 5  ? 143.824 -5.355  3.095   1.00 0.00 ? 4  VAL A H    5  
ATOM 6260  H HA   . VAL A 1 5  ? 144.191 -4.011  5.661   1.00 0.00 ? 4  VAL A HA   5  
ATOM 6261  H HB   . VAL A 1 5  ? 146.547 -4.516  3.840   1.00 0.00 ? 4  VAL A HB   5  
ATOM 6262  H HG11 . VAL A 1 5  ? 146.427 -3.424  6.649   1.00 0.00 ? 4  VAL A HG11 5  
ATOM 6263  H HG12 . VAL A 1 5  ? 146.601 -2.448  5.191   1.00 0.00 ? 4  VAL A HG12 5  
ATOM 6264  H HG13 . VAL A 1 5  ? 147.865 -3.592  5.642   1.00 0.00 ? 4  VAL A HG13 5  
ATOM 6265  H HG21 . VAL A 1 5  ? 147.365 -6.112  5.446   1.00 0.00 ? 4  VAL A HG21 5  
ATOM 6266  H HG22 . VAL A 1 5  ? 145.756 -6.607  4.924   1.00 0.00 ? 4  VAL A HG22 5  
ATOM 6267  H HG23 . VAL A 1 5  ? 145.974 -5.833  6.493   1.00 0.00 ? 4  VAL A HG23 5  
ATOM 6268  N N    . ARG A 1 6  ? 144.142 -1.799  4.525   1.00 0.00 ? 5  ARG A N    5  
ATOM 6269  C CA   . ARG A 1 6  ? 143.976 -0.512  3.853   1.00 0.00 ? 5  ARG A CA   5  
ATOM 6270  C C    . ARG A 1 6  ? 145.320 0.198   3.718   1.00 0.00 ? 5  ARG A C    5  
ATOM 6271  O O    . ARG A 1 6  ? 145.906 0.630   4.712   1.00 0.00 ? 5  ARG A O    5  
ATOM 6272  C CB   . ARG A 1 6  ? 142.995 0.373   4.628   1.00 0.00 ? 5  ARG A CB   5  
ATOM 6273  C CG   . ARG A 1 6  ? 141.554 0.242   4.162   1.00 0.00 ? 5  ARG A CG   5  
ATOM 6274  C CD   . ARG A 1 6  ? 140.774 -0.742  5.020   1.00 0.00 ? 5  ARG A CD   5  
ATOM 6275  N NE   . ARG A 1 6  ? 139.407 -0.288  5.266   1.00 0.00 ? 5  ARG A NE   5  
ATOM 6276  C CZ   . ARG A 1 6  ? 138.428 -0.336  4.357   1.00 0.00 ? 5  ARG A CZ   5  
ATOM 6277  N NH1  . ARG A 1 6  ? 138.662 -0.820  3.138   1.00 0.00 ? 5  ARG A NH1  5  
ATOM 6278  N NH2  . ARG A 1 6  ? 137.213 0.100   4.668   1.00 0.00 ? 5  ARG A NH2  5  
ATOM 6279  H H    . ARG A 1 6  ? 144.031 -1.847  5.497   1.00 0.00 ? 5  ARG A H    5  
ATOM 6280  H HA   . ARG A 1 6  ? 143.578 -0.700  2.865   1.00 0.00 ? 5  ARG A HA   5  
ATOM 6281  H HB2  . ARG A 1 6  ? 143.038 0.108   5.674   1.00 0.00 ? 5  ARG A HB2  5  
ATOM 6282  H HB3  . ARG A 1 6  ? 143.294 1.404   4.515   1.00 0.00 ? 5  ARG A HB3  5  
ATOM 6283  H HG2  . ARG A 1 6  ? 141.079 1.210   4.221   1.00 0.00 ? 5  ARG A HG2  5  
ATOM 6284  H HG3  . ARG A 1 6  ? 141.547 -0.103  3.138   1.00 0.00 ? 5  ARG A HG3  5  
ATOM 6285  H HD2  . ARG A 1 6  ? 140.742 -1.695  4.514   1.00 0.00 ? 5  ARG A HD2  5  
ATOM 6286  H HD3  . ARG A 1 6  ? 141.282 -0.856  5.968   1.00 0.00 ? 5  ARG A HD3  5  
ATOM 6287  H HE   . ARG A 1 6  ? 139.205 0.074   6.155   1.00 0.00 ? 5  ARG A HE   5  
ATOM 6288  H HH11 . ARG A 1 6  ? 139.574 -1.150  2.894   1.00 0.00 ? 5  ARG A HH11 5  
ATOM 6289  H HH12 . ARG A 1 6  ? 137.924 -0.854  2.463   1.00 0.00 ? 5  ARG A HH12 5  
ATOM 6290  H HH21 . ARG A 1 6  ? 137.031 0.466   5.581   1.00 0.00 ? 5  ARG A HH21 5  
ATOM 6291  H HH22 . ARG A 1 6  ? 136.479 0.064   3.989   1.00 0.00 ? 5  ARG A HH22 5  
ATOM 6292  N N    . ILE A 1 7  ? 145.805 0.311   2.483   1.00 0.00 ? 6  ILE A N    5  
ATOM 6293  C CA   . ILE A 1 7  ? 147.081 0.966   2.220   1.00 0.00 ? 6  ILE A CA   5  
ATOM 6294  C C    . ILE A 1 7  ? 146.870 2.326   1.558   1.00 0.00 ? 6  ILE A C    5  
ATOM 6295  O O    . ILE A 1 7  ? 146.316 2.414   0.460   1.00 0.00 ? 6  ILE A O    5  
ATOM 6296  C CB   . ILE A 1 7  ? 147.990 0.096   1.321   1.00 0.00 ? 6  ILE A CB   5  
ATOM 6297  C CG1  . ILE A 1 7  ? 148.077 -1.332  1.873   1.00 0.00 ? 6  ILE A CG1  5  
ATOM 6298  C CG2  . ILE A 1 7  ? 149.379 0.712   1.212   1.00 0.00 ? 6  ILE A CG2  5  
ATOM 6299  C CD1  . ILE A 1 7  ? 148.970 -2.246  1.060   1.00 0.00 ? 6  ILE A CD1  5  
ATOM 6300  H H    . ILE A 1 7  ? 145.294 -0.056  1.730   1.00 0.00 ? 6  ILE A H    5  
ATOM 6301  H HA   . ILE A 1 7  ? 147.581 1.113   3.166   1.00 0.00 ? 6  ILE A HA   5  
ATOM 6302  H HB   . ILE A 1 7  ? 147.559 0.066   0.332   1.00 0.00 ? 6  ILE A HB   5  
ATOM 6303  H HG12 . ILE A 1 7  ? 148.468 -1.299  2.879   1.00 0.00 ? 6  ILE A HG12 5  
ATOM 6304  H HG13 . ILE A 1 7  ? 147.087 -1.764  1.890   1.00 0.00 ? 6  ILE A HG13 5  
ATOM 6305  H HG21 . ILE A 1 7  ? 149.299 1.789   1.214   1.00 0.00 ? 6  ILE A HG21 5  
ATOM 6306  H HG22 . ILE A 1 7  ? 149.844 0.388   0.293   1.00 0.00 ? 6  ILE A HG22 5  
ATOM 6307  H HG23 . ILE A 1 7  ? 149.981 0.394   2.051   1.00 0.00 ? 6  ILE A HG23 5  
ATOM 6308  H HD11 . ILE A 1 7  ? 149.518 -1.663  0.333   1.00 0.00 ? 6  ILE A HD11 5  
ATOM 6309  H HD12 . ILE A 1 7  ? 148.365 -2.979  0.550   1.00 0.00 ? 6  ILE A HD12 5  
ATOM 6310  H HD13 . ILE A 1 7  ? 149.665 -2.748  1.716   1.00 0.00 ? 6  ILE A HD13 5  
ATOM 6311  N N    . LYS A 1 8  ? 147.314 3.382   2.237   1.00 0.00 ? 7  LYS A N    5  
ATOM 6312  C CA   . LYS A 1 8  ? 147.177 4.740   1.723   1.00 0.00 ? 7  LYS A CA   5  
ATOM 6313  C C    . LYS A 1 8  ? 148.457 5.190   1.023   1.00 0.00 ? 7  LYS A C    5  
ATOM 6314  O O    . LYS A 1 8  ? 149.536 5.189   1.620   1.00 0.00 ? 7  LYS A O    5  
ATOM 6315  C CB   . LYS A 1 8  ? 146.833 5.707   2.859   1.00 0.00 ? 7  LYS A CB   5  
ATOM 6316  C CG   . LYS A 1 8  ? 145.357 6.062   2.932   1.00 0.00 ? 7  LYS A CG   5  
ATOM 6317  C CD   . LYS A 1 8  ? 145.111 7.232   3.870   1.00 0.00 ? 7  LYS A CD   5  
ATOM 6318  C CE   . LYS A 1 8  ? 143.833 7.046   4.671   1.00 0.00 ? 7  LYS A CE   5  
ATOM 6319  N NZ   . LYS A 1 8  ? 143.605 8.165   5.627   1.00 0.00 ? 7  LYS A NZ   5  
ATOM 6320  H H    . LYS A 1 8  ? 147.746 3.244   3.108   1.00 0.00 ? 7  LYS A H    5  
ATOM 6321  H HA   . LYS A 1 8  ? 146.369 4.741   1.005   1.00 0.00 ? 7  LYS A HA   5  
ATOM 6322  H HB2  . LYS A 1 8  ? 147.120 5.257   3.799   1.00 0.00 ? 7  LYS A HB2  5  
ATOM 6323  H HB3  . LYS A 1 8  ? 147.395 6.620   2.722   1.00 0.00 ? 7  LYS A HB3  5  
ATOM 6324  H HG2  . LYS A 1 8  ? 145.011 6.328   1.944   1.00 0.00 ? 7  LYS A HG2  5  
ATOM 6325  H HG3  . LYS A 1 8  ? 144.808 5.203   3.289   1.00 0.00 ? 7  LYS A HG3  5  
ATOM 6326  H HD2  . LYS A 1 8  ? 145.943 7.315   4.553   1.00 0.00 ? 7  LYS A HD2  5  
ATOM 6327  H HD3  . LYS A 1 8  ? 145.031 8.138   3.286   1.00 0.00 ? 7  LYS A HD3  5  
ATOM 6328  H HE2  . LYS A 1 8  ? 142.999 6.994   3.987   1.00 0.00 ? 7  LYS A HE2  5  
ATOM 6329  H HE3  . LYS A 1 8  ? 143.901 6.120   5.223   1.00 0.00 ? 7  LYS A HE3  5  
ATOM 6330  H HZ1  . LYS A 1 8  ? 143.141 8.961   5.142   1.00 0.00 ? 7  LYS A HZ1  5  
ATOM 6331  H HZ2  . LYS A 1 8  ? 144.511 8.494   6.017   1.00 0.00 ? 7  LYS A HZ2  5  
ATOM 6332  H HZ3  . LYS A 1 8  ? 142.998 7.849   6.409   1.00 0.00 ? 7  LYS A HZ3  5  
ATOM 6333  N N    . PHE A 1 9  ? 148.329 5.576   -0.246  1.00 0.00 ? 8  PHE A N    5  
ATOM 6334  C CA   . PHE A 1 9  ? 149.472 6.033   -1.032  1.00 0.00 ? 8  PHE A CA   5  
ATOM 6335  C C    . PHE A 1 9  ? 149.312 7.500   -1.424  1.00 0.00 ? 8  PHE A C    5  
ATOM 6336  O O    . PHE A 1 9  ? 148.289 7.889   -1.990  1.00 0.00 ? 8  PHE A O    5  
ATOM 6337  C CB   . PHE A 1 9  ? 149.631 5.171   -2.288  1.00 0.00 ? 8  PHE A CB   5  
ATOM 6338  C CG   . PHE A 1 9  ? 150.228 3.817   -2.018  1.00 0.00 ? 8  PHE A CG   5  
ATOM 6339  C CD1  . PHE A 1 9  ? 151.463 3.700   -1.399  1.00 0.00 ? 8  PHE A CD1  5  
ATOM 6340  C CD2  . PHE A 1 9  ? 149.554 2.663   -2.384  1.00 0.00 ? 8  PHE A CD2  5  
ATOM 6341  C CE1  . PHE A 1 9  ? 152.013 2.458   -1.150  1.00 0.00 ? 8  PHE A CE1  5  
ATOM 6342  C CE2  . PHE A 1 9  ? 150.100 1.418   -2.137  1.00 0.00 ? 8  PHE A CE2  5  
ATOM 6343  C CZ   . PHE A 1 9  ? 151.332 1.315   -1.520  1.00 0.00 ? 8  PHE A CZ   5  
ATOM 6344  H H    . PHE A 1 9  ? 147.442 5.555   -0.664  1.00 0.00 ? 8  PHE A H    5  
ATOM 6345  H HA   . PHE A 1 9  ? 150.357 5.930   -0.421  1.00 0.00 ? 8  PHE A HA   5  
ATOM 6346  H HB2  . PHE A 1 9  ? 148.660 5.022   -2.737  1.00 0.00 ? 8  PHE A HB2  5  
ATOM 6347  H HB3  . PHE A 1 9  ? 150.271 5.685   -2.989  1.00 0.00 ? 8  PHE A HB3  5  
ATOM 6348  H HD1  . PHE A 1 9  ? 151.997 4.593   -1.109  1.00 0.00 ? 8  PHE A HD1  5  
ATOM 6349  H HD2  . PHE A 1 9  ? 148.591 2.741   -2.866  1.00 0.00 ? 8  PHE A HD2  5  
ATOM 6350  H HE1  . PHE A 1 9  ? 152.975 2.382   -0.667  1.00 0.00 ? 8  PHE A HE1  5  
ATOM 6351  H HE2  . PHE A 1 9  ? 149.565 0.526   -2.427  1.00 0.00 ? 8  PHE A HE2  5  
ATOM 6352  H HZ   . PHE A 1 9  ? 151.760 0.343   -1.326  1.00 0.00 ? 8  PHE A HZ   5  
ATOM 6353  N N    . GLU A 1 10 ? 150.327 8.309   -1.122  1.00 0.00 ? 9  GLU A N    5  
ATOM 6354  C CA   . GLU A 1 10 ? 150.297 9.734   -1.445  1.00 0.00 ? 9  GLU A CA   5  
ATOM 6355  C C    . GLU A 1 10 ? 151.478 10.120  -2.332  1.00 0.00 ? 9  GLU A C    5  
ATOM 6356  O O    . GLU A 1 10 ? 152.622 9.751   -2.057  1.00 0.00 ? 9  GLU A O    5  
ATOM 6357  C CB   . GLU A 1 10 ? 150.305 10.573  -0.164  1.00 0.00 ? 9  GLU A CB   5  
ATOM 6358  C CG   . GLU A 1 10 ? 149.520 11.872  -0.282  1.00 0.00 ? 9  GLU A CG   5  
ATOM 6359  C CD   . GLU A 1 10 ? 149.124 12.442  1.068   1.00 0.00 ? 9  GLU A CD   5  
ATOM 6360  O OE1  . GLU A 1 10 ? 150.023 12.885  1.813   1.00 0.00 ? 9  GLU A OE1  5  
ATOM 6361  O OE2  . GLU A 1 10 ? 147.914 12.448  1.378   1.00 0.00 ? 9  GLU A OE2  5  
ATOM 6362  H H    . GLU A 1 10 ? 151.116 7.939   -0.672  1.00 0.00 ? 9  GLU A H    5  
ATOM 6363  H HA   . GLU A 1 10 ? 149.382 9.929   -1.985  1.00 0.00 ? 9  GLU A HA   5  
ATOM 6364  H HB2  . GLU A 1 10 ? 149.876 9.989   0.638   1.00 0.00 ? 9  GLU A HB2  5  
ATOM 6365  H HB3  . GLU A 1 10 ? 151.326 10.817  0.088   1.00 0.00 ? 9  GLU A HB3  5  
ATOM 6366  H HG2  . GLU A 1 10 ? 150.128 12.600  -0.797  1.00 0.00 ? 9  GLU A HG2  5  
ATOM 6367  H HG3  . GLU A 1 10 ? 148.623 11.685  -0.854  1.00 0.00 ? 9  GLU A HG3  5  
ATOM 6368  N N    . HIS A 1 11 ? 151.189 10.863  -3.399  1.00 0.00 ? 10 HIS A N    5  
ATOM 6369  C CA   . HIS A 1 11 ? 152.216 11.304  -4.335  1.00 0.00 ? 10 HIS A CA   5  
ATOM 6370  C C    . HIS A 1 11 ? 151.879 12.685  -4.893  1.00 0.00 ? 10 HIS A C    5  
ATOM 6371  O O    . HIS A 1 11 ? 150.861 12.858  -5.565  1.00 0.00 ? 10 HIS A O    5  
ATOM 6372  C CB   . HIS A 1 11 ? 152.353 10.295  -5.479  1.00 0.00 ? 10 HIS A CB   5  
ATOM 6373  C CG   . HIS A 1 11 ? 153.614 10.439  -6.275  1.00 0.00 ? 10 HIS A CG   5  
ATOM 6374  N ND1  . HIS A 1 11 ? 153.963 9.570   -7.287  1.00 0.00 ? 10 HIS A ND1  5  
ATOM 6375  C CD2  . HIS A 1 11 ? 154.610 11.358  -6.212  1.00 0.00 ? 10 HIS A CD2  5  
ATOM 6376  C CE1  . HIS A 1 11 ? 155.117 9.946   -7.810  1.00 0.00 ? 10 HIS A CE1  5  
ATOM 6377  N NE2  . HIS A 1 11 ? 155.529 11.028  -7.176  1.00 0.00 ? 10 HIS A NE2  5  
ATOM 6378  H H    . HIS A 1 11 ? 150.256 11.121  -3.561  1.00 0.00 ? 10 HIS A H    5  
ATOM 6379  H HA   . HIS A 1 11 ? 153.153 11.360  -3.801  1.00 0.00 ? 10 HIS A HA   5  
ATOM 6380  H HB2  . HIS A 1 11 ? 152.335 9.296   -5.070  1.00 0.00 ? 10 HIS A HB2  5  
ATOM 6381  H HB3  . HIS A 1 11 ? 151.517 10.415  -6.154  1.00 0.00 ? 10 HIS A HB3  5  
ATOM 6382  H HD1  . HIS A 1 11 ? 153.443 8.793   -7.578  1.00 0.00 ? 10 HIS A HD1  5  
ATOM 6383  H HD2  . HIS A 1 11 ? 154.669 12.194  -5.529  1.00 0.00 ? 10 HIS A HD2  5  
ATOM 6384  H HE1  . HIS A 1 11 ? 155.634 9.451   -8.619  1.00 0.00 ? 10 HIS A HE1  5  
ATOM 6385  H HE2  . HIS A 1 11 ? 156.309 11.566  -7.427  1.00 0.00 ? 10 HIS A HE2  5  
ATOM 6386  N N    . ASN A 1 12 ? 152.741 13.663  -4.608  1.00 0.00 ? 11 ASN A N    5  
ATOM 6387  C CA   . ASN A 1 12 ? 152.542 15.036  -5.076  1.00 0.00 ? 11 ASN A CA   5  
ATOM 6388  C C    . ASN A 1 12 ? 151.221 15.613  -4.556  1.00 0.00 ? 11 ASN A C    5  
ATOM 6389  O O    . ASN A 1 12 ? 150.571 16.412  -5.235  1.00 0.00 ? 11 ASN A O    5  
ATOM 6390  C CB   . ASN A 1 12 ? 152.576 15.087  -6.608  1.00 0.00 ? 11 ASN A CB   5  
ATOM 6391  C CG   . ASN A 1 12 ? 153.580 16.098  -7.128  1.00 0.00 ? 11 ASN A CG   5  
ATOM 6392  O OD1  . ASN A 1 12 ? 153.340 17.304  -7.087  1.00 0.00 ? 11 ASN A OD1  5  
ATOM 6393  N ND2  . ASN A 1 12 ? 154.715 15.611  -7.618  1.00 0.00 ? 11 ASN A ND2  5  
ATOM 6394  H H    . ASN A 1 12 ? 153.531 13.457  -4.067  1.00 0.00 ? 11 ASN A H    5  
ATOM 6395  H HA   . ASN A 1 12 ? 153.354 15.634  -4.690  1.00 0.00 ? 11 ASN A HA   5  
ATOM 6396  H HB2  . ASN A 1 12 ? 152.842 14.113  -6.989  1.00 0.00 ? 11 ASN A HB2  5  
ATOM 6397  H HB3  . ASN A 1 12 ? 151.596 15.356  -6.977  1.00 0.00 ? 11 ASN A HB3  5  
ATOM 6398  H HD21 . ASN A 1 12 ? 154.841 14.638  -7.620  1.00 0.00 ? 11 ASN A HD21 5  
ATOM 6399  H HD22 . ASN A 1 12 ? 155.381 16.244  -7.958  1.00 0.00 ? 11 ASN A HD22 5  
ATOM 6400  N N    . GLY A 1 13 ? 150.828 15.203  -3.348  1.00 0.00 ? 12 GLY A N    5  
ATOM 6401  C CA   . GLY A 1 13 ? 149.588 15.685  -2.762  1.00 0.00 ? 12 GLY A CA   5  
ATOM 6402  C C    . GLY A 1 13 ? 148.384 14.819  -3.115  1.00 0.00 ? 12 GLY A C    5  
ATOM 6403  O O    . GLY A 1 13 ? 147.326 14.945  -2.497  1.00 0.00 ? 12 GLY A O    5  
ATOM 6404  H H    . GLY A 1 13 ? 151.384 14.567  -2.852  1.00 0.00 ? 12 GLY A H    5  
ATOM 6405  H HA2  . GLY A 1 13 ? 149.698 15.707  -1.688  1.00 0.00 ? 12 GLY A HA2  5  
ATOM 6406  H HA3  . GLY A 1 13 ? 149.407 16.691  -3.111  1.00 0.00 ? 12 GLY A HA3  5  
ATOM 6407  N N    . GLU A 1 14 ? 148.541 13.940  -4.110  1.00 0.00 ? 13 GLU A N    5  
ATOM 6408  C CA   . GLU A 1 14 ? 147.459 13.058  -4.539  1.00 0.00 ? 13 GLU A CA   5  
ATOM 6409  C C    . GLU A 1 14 ? 147.457 11.765  -3.728  1.00 0.00 ? 13 GLU A C    5  
ATOM 6410  O O    . GLU A 1 14 ? 148.359 10.937  -3.864  1.00 0.00 ? 13 GLU A O    5  
ATOM 6411  C CB   . GLU A 1 14 ? 147.595 12.740  -6.032  1.00 0.00 ? 13 GLU A CB   5  
ATOM 6412  C CG   . GLU A 1 14 ? 147.511 13.970  -6.926  1.00 0.00 ? 13 GLU A CG   5  
ATOM 6413  C CD   . GLU A 1 14 ? 146.176 14.102  -7.639  1.00 0.00 ? 13 GLU A CD   5  
ATOM 6414  O OE1  . GLU A 1 14 ? 145.140 13.733  -7.044  1.00 0.00 ? 13 GLU A OE1  5  
ATOM 6415  O OE2  . GLU A 1 14 ? 146.166 14.581  -8.792  1.00 0.00 ? 13 GLU A OE2  5  
ATOM 6416  H H    . GLU A 1 14 ? 149.405 13.882  -4.568  1.00 0.00 ? 13 GLU A H    5  
ATOM 6417  H HA   . GLU A 1 14 ? 146.525 13.574  -4.374  1.00 0.00 ? 13 GLU A HA   5  
ATOM 6418  H HB2  . GLU A 1 14 ? 148.549 12.264  -6.201  1.00 0.00 ? 13 GLU A HB2  5  
ATOM 6419  H HB3  . GLU A 1 14 ? 146.806 12.058  -6.316  1.00 0.00 ? 13 GLU A HB3  5  
ATOM 6420  H HG2  . GLU A 1 14 ? 147.662 14.850  -6.319  1.00 0.00 ? 13 GLU A HG2  5  
ATOM 6421  H HG3  . GLU A 1 14 ? 148.293 13.911  -7.669  1.00 0.00 ? 13 GLU A HG3  5  
ATOM 6422  N N    . ARG A 1 15 ? 146.439 11.600  -2.883  1.00 0.00 ? 14 ARG A N    5  
ATOM 6423  C CA   . ARG A 1 15 ? 146.324 10.405  -2.050  1.00 0.00 ? 14 ARG A CA   5  
ATOM 6424  C C    . ARG A 1 15 ? 145.341 9.404   -2.653  1.00 0.00 ? 14 ARG A C    5  
ATOM 6425  O O    . ARG A 1 15 ? 144.330 9.788   -3.245  1.00 0.00 ? 14 ARG A O    5  
ATOM 6426  C CB   . ARG A 1 15 ? 145.893 10.776  -0.626  1.00 0.00 ? 14 ARG A CB   5  
ATOM 6427  C CG   . ARG A 1 15 ? 144.492 11.361  -0.533  1.00 0.00 ? 14 ARG A CG   5  
ATOM 6428  C CD   . ARG A 1 15 ? 144.318 12.201  0.723   1.00 0.00 ? 14 ARG A CD   5  
ATOM 6429  N NE   . ARG A 1 15 ? 143.643 13.467  0.444   1.00 0.00 ? 14 ARG A NE   5  
ATOM 6430  C CZ   . ARG A 1 15 ? 144.245 14.532  -0.092  1.00 0.00 ? 14 ARG A CZ   5  
ATOM 6431  N NH1  . ARG A 1 15 ? 145.539 14.490  -0.401  1.00 0.00 ? 14 ARG A NH1  5  
ATOM 6432  N NH2  . ARG A 1 15 ? 143.550 15.641  -0.320  1.00 0.00 ? 14 ARG A NH2  5  
ATOM 6433  H H    . ARG A 1 15 ? 145.752 12.296  -2.818  1.00 0.00 ? 14 ARG A H    5  
ATOM 6434  H HA   . ARG A 1 15 ? 147.300 9.945   -2.007  1.00 0.00 ? 14 ARG A HA   5  
ATOM 6435  H HB2  . ARG A 1 15 ? 145.928 9.888   -0.013  1.00 0.00 ? 14 ARG A HB2  5  
ATOM 6436  H HB3  . ARG A 1 15 ? 146.589 11.500  -0.231  1.00 0.00 ? 14 ARG A HB3  5  
ATOM 6437  H HG2  . ARG A 1 15 ? 144.314 11.983  -1.397  1.00 0.00 ? 14 ARG A HG2  5  
ATOM 6438  H HG3  . ARG A 1 15 ? 143.775 10.552  -0.517  1.00 0.00 ? 14 ARG A HG3  5  
ATOM 6439  H HD2  . ARG A 1 15 ? 143.733 11.642  1.437   1.00 0.00 ? 14 ARG A HD2  5  
ATOM 6440  H HD3  . ARG A 1 15 ? 145.293 12.408  1.142   1.00 0.00 ? 14 ARG A HD3  5  
ATOM 6441  H HE   . ARG A 1 15 ? 142.689 13.527  0.664   1.00 0.00 ? 14 ARG A HE   5  
ATOM 6442  H HH11 . ARG A 1 15 ? 146.070 13.659  -0.233  1.00 0.00 ? 14 ARG A HH11 5  
ATOM 6443  H HH12 . ARG A 1 15 ? 145.984 15.291  -0.806  1.00 0.00 ? 14 ARG A HH12 5  
ATOM 6444  H HH21 . ARG A 1 15 ? 142.576 15.677  -0.091  1.00 0.00 ? 14 ARG A HH21 5  
ATOM 6445  H HH22 . ARG A 1 15 ? 143.998 16.440  -0.720  1.00 0.00 ? 14 ARG A HH22 5  
ATOM 6446  N N    . ARG A 1 16 ? 145.648 8.116   -2.496  1.00 0.00 ? 15 ARG A N    5  
ATOM 6447  C CA   . ARG A 1 16 ? 144.800 7.049   -3.022  1.00 0.00 ? 15 ARG A CA   5  
ATOM 6448  C C    . ARG A 1 16 ? 144.575 5.960   -1.972  1.00 0.00 ? 15 ARG A C    5  
ATOM 6449  O O    . ARG A 1 16 ? 145.431 5.721   -1.117  1.00 0.00 ? 15 ARG A O    5  
ATOM 6450  C CB   . ARG A 1 16 ? 145.431 6.443   -4.279  1.00 0.00 ? 15 ARG A CB   5  
ATOM 6451  C CG   . ARG A 1 16 ? 145.560 7.427   -5.432  1.00 0.00 ? 15 ARG A CG   5  
ATOM 6452  C CD   . ARG A 1 16 ? 146.136 6.764   -6.674  1.00 0.00 ? 15 ARG A CD   5  
ATOM 6453  N NE   . ARG A 1 16 ? 145.507 7.256   -7.899  1.00 0.00 ? 15 ARG A NE   5  
ATOM 6454  C CZ   . ARG A 1 16 ? 145.797 8.429   -8.471  1.00 0.00 ? 15 ARG A CZ   5  
ATOM 6455  N NH1  . ARG A 1 16 ? 146.704 9.240   -7.929  1.00 0.00 ? 15 ARG A NH1  5  
ATOM 6456  N NH2  . ARG A 1 16 ? 145.174 8.792   -9.587  1.00 0.00 ? 15 ARG A NH2  5  
ATOM 6457  H H    . ARG A 1 16 ? 146.469 7.877   -2.015  1.00 0.00 ? 15 ARG A H    5  
ATOM 6458  H HA   . ARG A 1 16 ? 143.846 7.484   -3.282  1.00 0.00 ? 15 ARG A HA   5  
ATOM 6459  H HB2  . ARG A 1 16 ? 146.418 6.079   -4.032  1.00 0.00 ? 15 ARG A HB2  5  
ATOM 6460  H HB3  . ARG A 1 16 ? 144.823 5.613   -4.608  1.00 0.00 ? 15 ARG A HB3  5  
ATOM 6461  H HG2  . ARG A 1 16 ? 144.582 7.821   -5.668  1.00 0.00 ? 15 ARG A HG2  5  
ATOM 6462  H HG3  . ARG A 1 16 ? 146.211 8.234   -5.131  1.00 0.00 ? 15 ARG A HG3  5  
ATOM 6463  H HD2  . ARG A 1 16 ? 147.196 6.971   -6.717  1.00 0.00 ? 15 ARG A HD2  5  
ATOM 6464  H HD3  . ARG A 1 16 ? 145.982 5.698   -6.603  1.00 0.00 ? 15 ARG A HD3  5  
ATOM 6465  H HE   . ARG A 1 16 ? 144.832 6.681   -8.319  1.00 0.00 ? 15 ARG A HE   5  
ATOM 6466  H HH11 . ARG A 1 16 ? 147.176 8.976   -7.088  1.00 0.00 ? 15 ARG A HH11 5  
ATOM 6467  H HH12 . ARG A 1 16 ? 146.915 10.116  -8.364  1.00 0.00 ? 15 ARG A HH12 5  
ATOM 6468  H HH21 . ARG A 1 16 ? 144.491 8.189   -9.998  1.00 0.00 ? 15 ARG A HH21 5  
ATOM 6469  H HH22 . ARG A 1 16 ? 145.389 9.670   -10.018 1.00 0.00 ? 15 ARG A HH22 5  
ATOM 6470  N N    . ILE A 1 17 ? 143.415 5.306   -2.043  1.00 0.00 ? 16 ILE A N    5  
ATOM 6471  C CA   . ILE A 1 17 ? 143.066 4.242   -1.102  1.00 0.00 ? 16 ILE A CA   5  
ATOM 6472  C C    . ILE A 1 17 ? 142.928 2.901   -1.825  1.00 0.00 ? 16 ILE A C    5  
ATOM 6473  O O    . ILE A 1 17 ? 142.014 2.714   -2.631  1.00 0.00 ? 16 ILE A O    5  
ATOM 6474  C CB   . ILE A 1 17 ? 141.746 4.556   -0.359  1.00 0.00 ? 16 ILE A CB   5  
ATOM 6475  C CG1  . ILE A 1 17 ? 141.777 5.975   0.224   1.00 0.00 ? 16 ILE A CG1  5  
ATOM 6476  C CG2  . ILE A 1 17 ? 141.492 3.534   0.742   1.00 0.00 ? 16 ILE A CG2  5  
ATOM 6477  C CD1  . ILE A 1 17 ? 141.425 7.054   -0.779  1.00 0.00 ? 16 ILE A CD1  5  
ATOM 6478  H H    . ILE A 1 17 ? 142.776 5.546   -2.746  1.00 0.00 ? 16 ILE A H    5  
ATOM 6479  H HA   . ILE A 1 17 ? 143.860 4.168   -0.372  1.00 0.00 ? 16 ILE A HA   5  
ATOM 6480  H HB   . ILE A 1 17 ? 140.936 4.487   -1.071  1.00 0.00 ? 16 ILE A HB   5  
ATOM 6481  H HG12 . ILE A 1 17 ? 141.070 6.038   1.037   1.00 0.00 ? 16 ILE A HG12 5  
ATOM 6482  H HG13 . ILE A 1 17 ? 142.770 6.180   0.600   1.00 0.00 ? 16 ILE A HG13 5  
ATOM 6483  H HG21 . ILE A 1 17 ? 142.247 3.631   1.508   1.00 0.00 ? 16 ILE A HG21 5  
ATOM 6484  H HG22 . ILE A 1 17 ? 141.528 2.538   0.325   1.00 0.00 ? 16 ILE A HG22 5  
ATOM 6485  H HG23 . ILE A 1 17 ? 140.517 3.707   1.174   1.00 0.00 ? 16 ILE A HG23 5  
ATOM 6486  H HD11 . ILE A 1 17 ? 140.965 7.886   -0.267  1.00 0.00 ? 16 ILE A HD11 5  
ATOM 6487  H HD12 . ILE A 1 17 ? 140.738 6.657   -1.511  1.00 0.00 ? 16 ILE A HD12 5  
ATOM 6488  H HD13 . ILE A 1 17 ? 142.323 7.391   -1.275  1.00 0.00 ? 16 ILE A HD13 5  
ATOM 6489  N N    . ILE A 1 18 ? 143.843 1.973   -1.535  1.00 0.00 ? 17 ILE A N    5  
ATOM 6490  C CA   . ILE A 1 18 ? 143.824 0.652   -2.162  1.00 0.00 ? 17 ILE A CA   5  
ATOM 6491  C C    . ILE A 1 18 ? 143.767 -0.460  -1.114  1.00 0.00 ? 17 ILE A C    5  
ATOM 6492  O O    . ILE A 1 18 ? 144.469 -0.412  -0.103  1.00 0.00 ? 17 ILE A O    5  
ATOM 6493  C CB   . ILE A 1 18 ? 145.062 0.431   -3.060  1.00 0.00 ? 17 ILE A CB   5  
ATOM 6494  C CG1  . ILE A 1 18 ? 145.275 1.627   -3.996  1.00 0.00 ? 17 ILE A CG1  5  
ATOM 6495  C CG2  . ILE A 1 18 ? 144.912 -0.854  -3.864  1.00 0.00 ? 17 ILE A CG2  5  
ATOM 6496  C CD1  . ILE A 1 18 ? 145.995 2.789   -3.344  1.00 0.00 ? 17 ILE A CD1  5  
ATOM 6497  H H    . ILE A 1 18 ? 144.550 2.184   -0.889  1.00 0.00 ? 17 ILE A H    5  
ATOM 6498  H HA   . ILE A 1 18 ? 142.942 0.593   -2.783  1.00 0.00 ? 17 ILE A HA   5  
ATOM 6499  H HB   . ILE A 1 18 ? 145.927 0.325   -2.422  1.00 0.00 ? 17 ILE A HB   5  
ATOM 6500  H HG12 . ILE A 1 18 ? 145.862 1.311   -4.845  1.00 0.00 ? 17 ILE A HG12 5  
ATOM 6501  H HG13 . ILE A 1 18 ? 144.314 1.982   -4.340  1.00 0.00 ? 17 ILE A HG13 5  
ATOM 6502  H HG21 . ILE A 1 18 ? 143.992 -0.821  -4.429  1.00 0.00 ? 17 ILE A HG21 5  
ATOM 6503  H HG22 . ILE A 1 18 ? 144.890 -1.699  -3.193  1.00 0.00 ? 17 ILE A HG22 5  
ATOM 6504  H HG23 . ILE A 1 18 ? 145.747 -0.954  -4.542  1.00 0.00 ? 17 ILE A HG23 5  
ATOM 6505  H HD11 . ILE A 1 18 ? 146.582 2.430   -2.512  1.00 0.00 ? 17 ILE A HD11 5  
ATOM 6506  H HD12 . ILE A 1 18 ? 145.270 3.508   -2.990  1.00 0.00 ? 17 ILE A HD12 5  
ATOM 6507  H HD13 . ILE A 1 18 ? 146.645 3.262   -4.066  1.00 0.00 ? 17 ILE A HD13 5  
ATOM 6508  N N    . ALA A 1 19 ? 142.927 -1.465  -1.371  1.00 0.00 ? 18 ALA A N    5  
ATOM 6509  C CA   . ALA A 1 19 ? 142.774 -2.597  -0.460  1.00 0.00 ? 18 ALA A CA   5  
ATOM 6510  C C    . ALA A 1 19 ? 143.666 -3.764  -0.881  1.00 0.00 ? 18 ALA A C    5  
ATOM 6511  O O    . ALA A 1 19 ? 143.656 -4.176  -2.042  1.00 0.00 ? 18 ALA A O    5  
ATOM 6512  C CB   . ALA A 1 19 ? 141.317 -3.036  -0.402  1.00 0.00 ? 18 ALA A CB   5  
ATOM 6513  H H    . ALA A 1 19 ? 142.399 -1.444  -2.196  1.00 0.00 ? 18 ALA A H    5  
ATOM 6514  H HA   . ALA A 1 19 ? 143.067 -2.271  0.528   1.00 0.00 ? 18 ALA A HA   5  
ATOM 6515  H HB1  . ALA A 1 19 ? 141.124 -3.747  -1.192  1.00 0.00 ? 18 ALA A HB1  5  
ATOM 6516  H HB2  . ALA A 1 19 ? 140.676 -2.176  -0.528  1.00 0.00 ? 18 ALA A HB2  5  
ATOM 6517  H HB3  . ALA A 1 19 ? 141.118 -3.496  0.554   1.00 0.00 ? 18 ALA A HB3  5  
ATOM 6518  N N    . PHE A 1 20 ? 144.435 -4.290  0.071   1.00 0.00 ? 19 PHE A N    5  
ATOM 6519  C CA   . PHE A 1 20 ? 145.336 -5.410  -0.196  1.00 0.00 ? 19 PHE A CA   5  
ATOM 6520  C C    . PHE A 1 20 ? 145.059 -6.574  0.756   1.00 0.00 ? 19 PHE A C    5  
ATOM 6521  O O    . PHE A 1 20 ? 145.052 -6.401  1.975   1.00 0.00 ? 19 PHE A O    5  
ATOM 6522  C CB   . PHE A 1 20 ? 146.794 -4.961  -0.055  1.00 0.00 ? 19 PHE A CB   5  
ATOM 6523  C CG   . PHE A 1 20 ? 147.360 -4.333  -1.300  1.00 0.00 ? 19 PHE A CG   5  
ATOM 6524  C CD1  . PHE A 1 20 ? 147.022 -3.037  -1.657  1.00 0.00 ? 19 PHE A CD1  5  
ATOM 6525  C CD2  . PHE A 1 20 ? 148.234 -5.040  -2.113  1.00 0.00 ? 19 PHE A CD2  5  
ATOM 6526  C CE1  . PHE A 1 20 ? 147.544 -2.458  -2.798  1.00 0.00 ? 19 PHE A CE1  5  
ATOM 6527  C CE2  . PHE A 1 20 ? 148.759 -4.466  -3.255  1.00 0.00 ? 19 PHE A CE2  5  
ATOM 6528  C CZ   . PHE A 1 20 ? 148.413 -3.173  -3.598  1.00 0.00 ? 19 PHE A CZ   5  
ATOM 6529  H H    . PHE A 1 20 ? 144.397 -3.916  0.977   1.00 0.00 ? 19 PHE A H    5  
ATOM 6530  H HA   . PHE A 1 20 ? 145.166 -5.741  -1.209  1.00 0.00 ? 19 PHE A HA   5  
ATOM 6531  H HB2  . PHE A 1 20 ? 146.863 -4.236  0.741   1.00 0.00 ? 19 PHE A HB2  5  
ATOM 6532  H HB3  . PHE A 1 20 ? 147.404 -5.818  0.194   1.00 0.00 ? 19 PHE A HB3  5  
ATOM 6533  H HD1  . PHE A 1 20 ? 146.343 -2.476  -1.032  1.00 0.00 ? 19 PHE A HD1  5  
ATOM 6534  H HD2  . PHE A 1 20 ? 148.505 -6.051  -1.847  1.00 0.00 ? 19 PHE A HD2  5  
ATOM 6535  H HE1  . PHE A 1 20 ? 147.273 -1.448  -3.064  1.00 0.00 ? 19 PHE A HE1  5  
ATOM 6536  H HE2  . PHE A 1 20 ? 149.439 -5.027  -3.878  1.00 0.00 ? 19 PHE A HE2  5  
ATOM 6537  H HZ   . PHE A 1 20 ? 148.823 -2.723  -4.489  1.00 0.00 ? 19 PHE A HZ   5  
ATOM 6538  N N    . SER A 1 21 ? 144.834 -7.762  0.192   1.00 0.00 ? 20 SER A N    5  
ATOM 6539  C CA   . SER A 1 21 ? 144.558 -8.958  0.990   1.00 0.00 ? 20 SER A CA   5  
ATOM 6540  C C    . SER A 1 21 ? 145.780 -9.366  1.814   1.00 0.00 ? 20 SER A C    5  
ATOM 6541  O O    . SER A 1 21 ? 146.904 -9.378  1.309   1.00 0.00 ? 20 SER A O    5  
ATOM 6542  C CB   . SER A 1 21 ? 144.134 -10.118 0.081   1.00 0.00 ? 20 SER A CB   5  
ATOM 6543  O OG   . SER A 1 21 ? 144.870 -10.117 -1.133  1.00 0.00 ? 20 SER A OG   5  
ATOM 6544  H H    . SER A 1 21 ? 144.856 -7.837  -0.786  1.00 0.00 ? 20 SER A H    5  
ATOM 6545  H HA   . SER A 1 21 ? 143.746 -8.727  1.663   1.00 0.00 ? 20 SER A HA   5  
ATOM 6546  H HB2  . SER A 1 21 ? 144.309 -11.054 0.591   1.00 0.00 ? 20 SER A HB2  5  
ATOM 6547  H HB3  . SER A 1 21 ? 143.083 -10.025 -0.149  1.00 0.00 ? 20 SER A HB3  5  
ATOM 6548  H HG   . SER A 1 21 ? 145.808 -10.209 -0.941  1.00 0.00 ? 20 SER A HG   5  
ATOM 6549  N N    . ARG A 1 22 ? 145.551 -9.705  3.084   1.00 0.00 ? 21 ARG A N    5  
ATOM 6550  C CA   . ARG A 1 22 ? 146.634 -10.118 3.978   1.00 0.00 ? 21 ARG A CA   5  
ATOM 6551  C C    . ARG A 1 22 ? 146.681 -11.641 4.117   1.00 0.00 ? 21 ARG A C    5  
ATOM 6552  O O    . ARG A 1 22 ? 145.643 -12.305 4.088   1.00 0.00 ? 21 ARG A O    5  
ATOM 6553  C CB   . ARG A 1 22 ? 146.475 -9.473  5.361   1.00 0.00 ? 21 ARG A CB   5  
ATOM 6554  C CG   . ARG A 1 22 ? 145.060 -9.540  5.917   1.00 0.00 ? 21 ARG A CG   5  
ATOM 6555  C CD   . ARG A 1 22 ? 145.057 -9.600  7.437   1.00 0.00 ? 21 ARG A CD   5  
ATOM 6556  N NE   . ARG A 1 22 ? 145.085 -8.268  8.041   1.00 0.00 ? 21 ARG A NE   5  
ATOM 6557  C CZ   . ARG A 1 22 ? 145.347 -8.038  9.329   1.00 0.00 ? 21 ARG A CZ   5  
ATOM 6558  N NH1  . ARG A 1 22 ? 145.582 -9.050  10.160  1.00 0.00 ? 21 ARG A NH1  5  
ATOM 6559  N NH2  . ARG A 1 22 ? 145.371 -6.793  9.790   1.00 0.00 ? 21 ARG A NH2  5  
ATOM 6560  H H    . ARG A 1 22 ? 144.633 -9.679  3.425   1.00 0.00 ? 21 ARG A H    5  
ATOM 6561  H HA   . ARG A 1 22 ? 147.562 -9.782  3.541   1.00 0.00 ? 21 ARG A HA   5  
ATOM 6562  H HB2  . ARG A 1 22 ? 147.133 -9.976  6.054   1.00 0.00 ? 21 ARG A HB2  5  
ATOM 6563  H HB3  . ARG A 1 22 ? 146.764 -8.435  5.295   1.00 0.00 ? 21 ARG A HB3  5  
ATOM 6564  H HG2  . ARG A 1 22 ? 144.520 -8.660  5.602   1.00 0.00 ? 21 ARG A HG2  5  
ATOM 6565  H HG3  . ARG A 1 22 ? 144.572 -10.422 5.530   1.00 0.00 ? 21 ARG A HG3  5  
ATOM 6566  H HD2  . ARG A 1 22 ? 144.164 -10.113 7.762   1.00 0.00 ? 21 ARG A HD2  5  
ATOM 6567  H HD3  . ARG A 1 22 ? 145.927 -10.151 7.763   1.00 0.00 ? 21 ARG A HD3  5  
ATOM 6568  H HE   . ARG A 1 22 ? 144.904 -7.502  7.454   1.00 0.00 ? 21 ARG A HE   5  
ATOM 6569  H HH11 . ARG A 1 22 ? 145.562 -9.992  9.823   1.00 0.00 ? 21 ARG A HH11 5  
ATOM 6570  H HH12 . ARG A 1 22 ? 145.778 -8.871  11.124  1.00 0.00 ? 21 ARG A HH12 5  
ATOM 6571  H HH21 . ARG A 1 22 ? 145.192 -6.027  9.172   1.00 0.00 ? 21 ARG A HH21 5  
ATOM 6572  H HH22 . ARG A 1 22 ? 145.568 -6.620  10.755  1.00 0.00 ? 21 ARG A HH22 5  
ATOM 6573  N N    . PRO A 1 23 ? 147.891 -12.220 4.273   1.00 0.00 ? 22 PRO A N    5  
ATOM 6574  C CA   . PRO A 1 23 ? 149.149 -11.463 4.312   1.00 0.00 ? 22 PRO A CA   5  
ATOM 6575  C C    . PRO A 1 23 ? 149.595 -10.998 2.926   1.00 0.00 ? 22 PRO A C    5  
ATOM 6576  O O    . PRO A 1 23 ? 149.759 -11.809 2.012   1.00 0.00 ? 22 PRO A O    5  
ATOM 6577  C CB   . PRO A 1 23 ? 150.144 -12.472 4.887   1.00 0.00 ? 22 PRO A CB   5  
ATOM 6578  C CG   . PRO A 1 23 ? 149.620 -13.800 4.463   1.00 0.00 ? 22 PRO A CG   5  
ATOM 6579  C CD   . PRO A 1 23 ? 148.119 -13.671 4.422   1.00 0.00 ? 22 PRO A CD   5  
ATOM 6580  H HA   . PRO A 1 23 ? 149.078 -10.609 4.971   1.00 0.00 ? 22 PRO A HA   5  
ATOM 6581  H HB2  . PRO A 1 23 ? 151.127 -12.285 4.478   1.00 0.00 ? 22 PRO A HB2  5  
ATOM 6582  H HB3  . PRO A 1 23 ? 150.172 -12.384 5.962   1.00 0.00 ? 22 PRO A HB3  5  
ATOM 6583  H HG2  . PRO A 1 23 ? 150.001 -14.049 3.482   1.00 0.00 ? 22 PRO A HG2  5  
ATOM 6584  H HG3  . PRO A 1 23 ? 149.911 -14.554 5.179   1.00 0.00 ? 22 PRO A HG3  5  
ATOM 6585  H HD2  . PRO A 1 23 ? 147.717 -14.212 3.577   1.00 0.00 ? 22 PRO A HD2  5  
ATOM 6586  H HD3  . PRO A 1 23 ? 147.686 -14.034 5.342   1.00 0.00 ? 22 PRO A HD3  5  
ATOM 6587  N N    . VAL A 1 24 ? 149.786 -9.688  2.776   1.00 0.00 ? 23 VAL A N    5  
ATOM 6588  C CA   . VAL A 1 24 ? 150.208 -9.114  1.501   1.00 0.00 ? 23 VAL A CA   5  
ATOM 6589  C C    . VAL A 1 24 ? 151.724 -9.219  1.320   1.00 0.00 ? 23 VAL A C    5  
ATOM 6590  O O    . VAL A 1 24 ? 152.496 -8.849  2.207   1.00 0.00 ? 23 VAL A O    5  
ATOM 6591  C CB   . VAL A 1 24 ? 149.766 -7.636  1.370   1.00 0.00 ? 23 VAL A CB   5  
ATOM 6592  C CG1  . VAL A 1 24 ? 150.433 -6.767  2.428   1.00 0.00 ? 23 VAL A CG1  5  
ATOM 6593  C CG2  . VAL A 1 24 ? 150.060 -7.110  -0.027  1.00 0.00 ? 23 VAL A CG2  5  
ATOM 6594  H H    . VAL A 1 24 ? 149.637 -9.093  3.540   1.00 0.00 ? 23 VAL A H    5  
ATOM 6595  H HA   . VAL A 1 24 ? 149.727 -9.678  0.714   1.00 0.00 ? 23 VAL A HA   5  
ATOM 6596  H HB   . VAL A 1 24 ? 148.698 -7.591  1.527   1.00 0.00 ? 23 VAL A HB   5  
ATOM 6597  H HG11 . VAL A 1 24 ? 150.196 -7.148  3.410   1.00 0.00 ? 23 VAL A HG11 5  
ATOM 6598  H HG12 . VAL A 1 24 ? 150.073 -5.752  2.339   1.00 0.00 ? 23 VAL A HG12 5  
ATOM 6599  H HG13 . VAL A 1 24 ? 151.503 -6.782  2.284   1.00 0.00 ? 23 VAL A HG13 5  
ATOM 6600  H HG21 . VAL A 1 24 ? 149.951 -6.035  -0.038  1.00 0.00 ? 23 VAL A HG21 5  
ATOM 6601  H HG22 . VAL A 1 24 ? 149.368 -7.548  -0.731  1.00 0.00 ? 23 VAL A HG22 5  
ATOM 6602  H HG23 . VAL A 1 24 ? 151.070 -7.371  -0.307  1.00 0.00 ? 23 VAL A HG23 5  
ATOM 6603  N N    . LYS A 1 25 ? 152.139 -9.731  0.162   1.00 0.00 ? 24 LYS A N    5  
ATOM 6604  C CA   . LYS A 1 25 ? 153.556 -9.893  -0.146  1.00 0.00 ? 24 LYS A CA   5  
ATOM 6605  C C    . LYS A 1 25 ? 154.117 -8.643  -0.820  1.00 0.00 ? 24 LYS A C    5  
ATOM 6606  O O    . LYS A 1 25 ? 153.418 -7.969  -1.577  1.00 0.00 ? 24 LYS A O    5  
ATOM 6607  C CB   . LYS A 1 25 ? 153.762 -11.109 -1.053  1.00 0.00 ? 24 LYS A CB   5  
ATOM 6608  C CG   . LYS A 1 25 ? 154.950 -11.973 -0.660  1.00 0.00 ? 24 LYS A CG   5  
ATOM 6609  C CD   . LYS A 1 25 ? 154.512 -13.371 -0.247  1.00 0.00 ? 24 LYS A CD   5  
ATOM 6610  C CE   . LYS A 1 25 ? 154.442 -13.513 1.267   1.00 0.00 ? 24 LYS A CE   5  
ATOM 6611  N NZ   . LYS A 1 25 ? 154.818 -14.883 1.717   1.00 0.00 ? 24 LYS A NZ   5  
ATOM 6612  H H    . LYS A 1 25 ? 151.474 -10.009 -0.502  1.00 0.00 ? 24 LYS A H    5  
ATOM 6613  H HA   . LYS A 1 25 ? 154.082 -10.055 0.783   1.00 0.00 ? 24 LYS A HA   5  
ATOM 6614  H HB2  . LYS A 1 25 ? 152.873 -11.721 -1.021  1.00 0.00 ? 24 LYS A HB2  5  
ATOM 6615  H HB3  . LYS A 1 25 ? 153.914 -10.766 -2.066  1.00 0.00 ? 24 LYS A HB3  5  
ATOM 6616  H HG2  . LYS A 1 25 ? 155.619 -12.052 -1.503  1.00 0.00 ? 24 LYS A HG2  5  
ATOM 6617  H HG3  . LYS A 1 25 ? 155.465 -11.507 0.167   1.00 0.00 ? 24 LYS A HG3  5  
ATOM 6618  H HD2  . LYS A 1 25 ? 153.535 -13.569 -0.662  1.00 0.00 ? 24 LYS A HD2  5  
ATOM 6619  H HD3  . LYS A 1 25 ? 155.222 -14.087 -0.635  1.00 0.00 ? 24 LYS A HD3  5  
ATOM 6620  H HE2  . LYS A 1 25 ? 155.119 -12.799 1.714   1.00 0.00 ? 24 LYS A HE2  5  
ATOM 6621  H HE3  . LYS A 1 25 ? 153.433 -13.301 1.589   1.00 0.00 ? 24 LYS A HE3  5  
ATOM 6622  H HZ1  . LYS A 1 25 ? 154.329 -15.113 2.606   1.00 0.00 ? 24 LYS A HZ1  5  
ATOM 6623  H HZ2  . LYS A 1 25 ? 155.845 -14.938 1.876   1.00 0.00 ? 24 LYS A HZ2  5  
ATOM 6624  H HZ3  . LYS A 1 25 ? 154.552 -15.583 0.996   1.00 0.00 ? 24 LYS A HZ3  5  
ATOM 6625  N N    . TYR A 1 26 ? 155.388 -8.345  -0.542  1.00 0.00 ? 25 TYR A N    5  
ATOM 6626  C CA   . TYR A 1 26 ? 156.055 -7.179  -1.124  1.00 0.00 ? 25 TYR A CA   5  
ATOM 6627  C C    . TYR A 1 26 ? 156.013 -7.227  -2.653  1.00 0.00 ? 25 TYR A C    5  
ATOM 6628  O O    . TYR A 1 26 ? 155.855 -6.195  -3.307  1.00 0.00 ? 25 TYR A O    5  
ATOM 6629  C CB   . TYR A 1 26 ? 157.507 -7.102  -0.641  1.00 0.00 ? 25 TYR A CB   5  
ATOM 6630  C CG   . TYR A 1 26 ? 158.263 -5.891  -1.147  1.00 0.00 ? 25 TYR A CG   5  
ATOM 6631  C CD1  . TYR A 1 26 ? 158.084 -4.643  -0.563  1.00 0.00 ? 25 TYR A CD1  5  
ATOM 6632  C CD2  . TYR A 1 26 ? 159.158 -5.999  -2.205  1.00 0.00 ? 25 TYR A CD2  5  
ATOM 6633  C CE1  . TYR A 1 26 ? 158.775 -3.536  -1.020  1.00 0.00 ? 25 TYR A CE1  5  
ATOM 6634  C CE2  . TYR A 1 26 ? 159.853 -4.897  -2.667  1.00 0.00 ? 25 TYR A CE2  5  
ATOM 6635  C CZ   . TYR A 1 26 ? 159.659 -3.668  -2.072  1.00 0.00 ? 25 TYR A CZ   5  
ATOM 6636  O OH   . TYR A 1 26 ? 160.347 -2.569  -2.530  1.00 0.00 ? 25 TYR A OH   5  
ATOM 6637  H H    . TYR A 1 26 ? 155.891 -8.927  0.065   1.00 0.00 ? 25 TYR A H    5  
ATOM 6638  H HA   . TYR A 1 26 ? 155.529 -6.297  -0.791  1.00 0.00 ? 25 TYR A HA   5  
ATOM 6639  H HB2  . TYR A 1 26 ? 157.517 -7.069  0.439   1.00 0.00 ? 25 TYR A HB2  5  
ATOM 6640  H HB3  . TYR A 1 26 ? 158.034 -7.985  -0.972  1.00 0.00 ? 25 TYR A HB3  5  
ATOM 6641  H HD1  . TYR A 1 26 ? 157.393 -4.541  0.260   1.00 0.00 ? 25 TYR A HD1  5  
ATOM 6642  H HD2  . TYR A 1 26 ? 159.308 -6.962  -2.669  1.00 0.00 ? 25 TYR A HD2  5  
ATOM 6643  H HE1  . TYR A 1 26 ? 158.622 -2.574  -0.555  1.00 0.00 ? 25 TYR A HE1  5  
ATOM 6644  H HE2  . TYR A 1 26 ? 160.543 -5.001  -3.491  1.00 0.00 ? 25 TYR A HE2  5  
ATOM 6645  H HH   . TYR A 1 26 ? 161.158 -2.464  -2.028  1.00 0.00 ? 25 TYR A HH   5  
ATOM 6646  N N    . GLU A 1 27 ? 156.149 -8.430  -3.213  1.00 0.00 ? 26 GLU A N    5  
ATOM 6647  C CA   . GLU A 1 27 ? 156.119 -8.610  -4.663  1.00 0.00 ? 26 GLU A CA   5  
ATOM 6648  C C    . GLU A 1 27 ? 154.777 -8.165  -5.240  1.00 0.00 ? 26 GLU A C    5  
ATOM 6649  O O    . GLU A 1 27 ? 154.727 -7.490  -6.269  1.00 0.00 ? 26 GLU A O    5  
ATOM 6650  C CB   . GLU A 1 27 ? 156.379 -10.075 -5.027  1.00 0.00 ? 26 GLU A CB   5  
ATOM 6651  C CG   . GLU A 1 27 ? 157.331 -10.250 -6.200  1.00 0.00 ? 26 GLU A CG   5  
ATOM 6652  C CD   . GLU A 1 27 ? 158.162 -11.514 -6.094  1.00 0.00 ? 26 GLU A CD   5  
ATOM 6653  O OE1  . GLU A 1 27 ? 159.163 -11.504 -5.347  1.00 0.00 ? 26 GLU A OE1  5  
ATOM 6654  O OE2  . GLU A 1 27 ? 157.813 -12.512 -6.758  1.00 0.00 ? 26 GLU A OE2  5  
ATOM 6655  H H    . GLU A 1 27 ? 156.268 -9.215  -2.638  1.00 0.00 ? 26 GLU A H    5  
ATOM 6656  H HA   . GLU A 1 27 ? 156.901 -7.998  -5.089  1.00 0.00 ? 26 GLU A HA   5  
ATOM 6657  H HB2  . GLU A 1 27 ? 156.801 -10.579 -4.169  1.00 0.00 ? 26 GLU A HB2  5  
ATOM 6658  H HB3  . GLU A 1 27 ? 155.439 -10.543 -5.281  1.00 0.00 ? 26 GLU A HB3  5  
ATOM 6659  H HG2  . GLU A 1 27 ? 156.753 -10.294 -7.111  1.00 0.00 ? 26 GLU A HG2  5  
ATOM 6660  H HG3  . GLU A 1 27 ? 157.996 -9.401  -6.237  1.00 0.00 ? 26 GLU A HG3  5  
ATOM 6661  N N    . ASP A 1 28 ? 153.691 -8.548  -4.568  1.00 0.00 ? 27 ASP A N    5  
ATOM 6662  C CA   . ASP A 1 28 ? 152.347 -8.190  -5.012  1.00 0.00 ? 27 ASP A CA   5  
ATOM 6663  C C    . ASP A 1 28 ? 152.114 -6.685  -4.904  1.00 0.00 ? 27 ASP A C    5  
ATOM 6664  O O    . ASP A 1 28 ? 151.485 -6.084  -5.776  1.00 0.00 ? 27 ASP A O    5  
ATOM 6665  C CB   . ASP A 1 28 ? 151.291 -8.943  -4.195  1.00 0.00 ? 27 ASP A CB   5  
ATOM 6666  C CG   . ASP A 1 28 ? 150.087 -9.334  -5.031  1.00 0.00 ? 27 ASP A CG   5  
ATOM 6667  O OD1  . ASP A 1 28 ? 150.258 -10.123 -5.985  1.00 0.00 ? 27 ASP A OD1  5  
ATOM 6668  O OD2  . ASP A 1 28 ? 148.976 -8.848  -4.734  1.00 0.00 ? 27 ASP A OD2  5  
ATOM 6669  H H    . ASP A 1 28 ? 153.798 -9.085  -3.754  1.00 0.00 ? 27 ASP A H    5  
ATOM 6670  H HA   . ASP A 1 28 ? 152.257 -8.479  -6.048  1.00 0.00 ? 27 ASP A HA   5  
ATOM 6671  H HB2  . ASP A 1 28 ? 151.731 -9.842  -3.791  1.00 0.00 ? 27 ASP A HB2  5  
ATOM 6672  H HB3  . ASP A 1 28 ? 150.955 -8.314  -3.384  1.00 0.00 ? 27 ASP A HB3  5  
ATOM 6673  N N    . VAL A 1 29 ? 152.625 -6.078  -3.832  1.00 0.00 ? 28 VAL A N    5  
ATOM 6674  C CA   . VAL A 1 29 ? 152.467 -4.640  -3.622  1.00 0.00 ? 28 VAL A CA   5  
ATOM 6675  C C    . VAL A 1 29 ? 153.256 -3.849  -4.661  1.00 0.00 ? 28 VAL A C    5  
ATOM 6676  O O    . VAL A 1 29 ? 152.724 -2.930  -5.285  1.00 0.00 ? 28 VAL A O    5  
ATOM 6677  C CB   . VAL A 1 29 ? 152.917 -4.205  -2.209  1.00 0.00 ? 28 VAL A CB   5  
ATOM 6678  C CG1  . VAL A 1 29 ? 152.530 -2.755  -1.948  1.00 0.00 ? 28 VAL A CG1  5  
ATOM 6679  C CG2  . VAL A 1 29 ? 152.325 -5.120  -1.146  1.00 0.00 ? 28 VAL A CG2  5  
ATOM 6680  H H    . VAL A 1 29 ? 153.120 -6.607  -3.170  1.00 0.00 ? 28 VAL A H    5  
ATOM 6681  H HA   . VAL A 1 29 ? 151.419 -4.405  -3.731  1.00 0.00 ? 28 VAL A HA   5  
ATOM 6682  H HB   . VAL A 1 29 ? 153.994 -4.280  -2.157  1.00 0.00 ? 28 VAL A HB   5  
ATOM 6683  H HG11 . VAL A 1 29 ? 151.480 -2.702  -1.700  1.00 0.00 ? 28 VAL A HG11 5  
ATOM 6684  H HG12 . VAL A 1 29 ? 152.721 -2.166  -2.833  1.00 0.00 ? 28 VAL A HG12 5  
ATOM 6685  H HG13 . VAL A 1 29 ? 153.114 -2.369  -1.126  1.00 0.00 ? 28 VAL A HG13 5  
ATOM 6686  H HG21 . VAL A 1 29 ? 153.105 -5.737  -0.726  1.00 0.00 ? 28 VAL A HG21 5  
ATOM 6687  H HG22 . VAL A 1 29 ? 151.569 -5.750  -1.593  1.00 0.00 ? 28 VAL A HG22 5  
ATOM 6688  H HG23 . VAL A 1 29 ? 151.878 -4.523  -0.364  1.00 0.00 ? 28 VAL A HG23 5  
ATOM 6689  N N    . GLU A 1 30 ? 154.524 -4.213  -4.847  1.00 0.00 ? 29 GLU A N    5  
ATOM 6690  C CA   . GLU A 1 30 ? 155.380 -3.535  -5.816  1.00 0.00 ? 29 GLU A CA   5  
ATOM 6691  C C    . GLU A 1 30 ? 154.787 -3.619  -7.220  1.00 0.00 ? 29 GLU A C    5  
ATOM 6692  O O    . GLU A 1 30 ? 154.754 -2.626  -7.945  1.00 0.00 ? 29 GLU A O    5  
ATOM 6693  C CB   . GLU A 1 30 ? 156.786 -4.138  -5.808  1.00 0.00 ? 29 GLU A CB   5  
ATOM 6694  C CG   . GLU A 1 30 ? 157.878 -3.133  -5.476  1.00 0.00 ? 29 GLU A CG   5  
ATOM 6695  C CD   . GLU A 1 30 ? 159.113 -3.306  -6.338  1.00 0.00 ? 29 GLU A CD   5  
ATOM 6696  O OE1  . GLU A 1 30 ? 159.927 -4.203  -6.032  1.00 0.00 ? 29 GLU A OE1  5  
ATOM 6697  O OE2  . GLU A 1 30 ? 159.266 -2.548  -7.319  1.00 0.00 ? 29 GLU A OE2  5  
ATOM 6698  H H    . GLU A 1 30 ? 154.890 -4.957  -4.321  1.00 0.00 ? 29 GLU A H    5  
ATOM 6699  H HA   . GLU A 1 30 ? 155.442 -2.496  -5.528  1.00 0.00 ? 29 GLU A HA   5  
ATOM 6700  H HB2  . GLU A 1 30 ? 156.822 -4.931  -5.075  1.00 0.00 ? 29 GLU A HB2  5  
ATOM 6701  H HB3  . GLU A 1 30 ? 156.993 -4.552  -6.784  1.00 0.00 ? 29 GLU A HB3  5  
ATOM 6702  H HG2  . GLU A 1 30 ? 157.491 -2.135  -5.625  1.00 0.00 ? 29 GLU A HG2  5  
ATOM 6703  H HG3  . GLU A 1 30 ? 158.159 -3.257  -4.441  1.00 0.00 ? 29 GLU A HG3  5  
ATOM 6704  N N    . HIS A 1 31 ? 154.314 -4.809  -7.594  1.00 0.00 ? 30 HIS A N    5  
ATOM 6705  C CA   . HIS A 1 31 ? 153.716 -5.021  -8.910  1.00 0.00 ? 30 HIS A CA   5  
ATOM 6706  C C    . HIS A 1 31 ? 152.497 -4.118  -9.114  1.00 0.00 ? 30 HIS A C    5  
ATOM 6707  O O    . HIS A 1 31 ? 152.266 -3.615  -10.215 1.00 0.00 ? 30 HIS A O    5  
ATOM 6708  C CB   . HIS A 1 31 ? 153.317 -6.489  -9.086  1.00 0.00 ? 30 HIS A CB   5  
ATOM 6709  C CG   . HIS A 1 31 ? 154.315 -7.289  -9.864  1.00 0.00 ? 30 HIS A CG   5  
ATOM 6710  N ND1  . HIS A 1 31 ? 155.358 -7.973  -9.275  1.00 0.00 ? 30 HIS A ND1  5  
ATOM 6711  C CD2  . HIS A 1 31 ? 154.428 -7.510  -11.196 1.00 0.00 ? 30 HIS A CD2  5  
ATOM 6712  C CE1  . HIS A 1 31 ? 156.069 -8.578  -10.209 1.00 0.00 ? 30 HIS A CE1  5  
ATOM 6713  N NE2  . HIS A 1 31 ? 155.526 -8.314  -11.384 1.00 0.00 ? 30 HIS A NE2  5  
ATOM 6714  H H    . HIS A 1 31 ? 154.367 -5.562  -6.966  1.00 0.00 ? 30 HIS A H    5  
ATOM 6715  H HA   . HIS A 1 31 ? 154.460 -4.770  -9.652  1.00 0.00 ? 30 HIS A HA   5  
ATOM 6716  H HB2  . HIS A 1 31 ? 153.211 -6.945  -8.112  1.00 0.00 ? 30 HIS A HB2  5  
ATOM 6717  H HB3  . HIS A 1 31 ? 152.371 -6.537  -9.605  1.00 0.00 ? 30 HIS A HB3  5  
ATOM 6718  H HD1  . HIS A 1 31 ? 155.549 -8.007  -8.314  1.00 0.00 ? 30 HIS A HD1  5  
ATOM 6719  H HD2  . HIS A 1 31 ? 153.775 -7.125  -11.968 1.00 0.00 ? 30 HIS A HD2  5  
ATOM 6720  H HE1  . HIS A 1 31 ? 156.945 -9.187  -10.042 1.00 0.00 ? 30 HIS A HE1  5  
ATOM 6721  H HE2  . HIS A 1 31 ? 155.919 -8.542  -12.251 1.00 0.00 ? 30 HIS A HE2  5  
ATOM 6722  N N    . LYS A 1 32 ? 151.723 -3.912  -8.047  1.00 0.00 ? 31 LYS A N    5  
ATOM 6723  C CA   . LYS A 1 32 ? 150.536 -3.064  -8.112  1.00 0.00 ? 31 LYS A CA   5  
ATOM 6724  C C    . LYS A 1 32 ? 150.925 -1.594  -8.252  1.00 0.00 ? 31 LYS A C    5  
ATOM 6725  O O    . LYS A 1 32 ? 150.391 -0.881  -9.102  1.00 0.00 ? 31 LYS A O    5  
ATOM 6726  C CB   . LYS A 1 32 ? 149.667 -3.252  -6.863  1.00 0.00 ? 31 LYS A CB   5  
ATOM 6727  C CG   . LYS A 1 32 ? 148.188 -2.991  -7.107  1.00 0.00 ? 31 LYS A CG   5  
ATOM 6728  C CD   . LYS A 1 32 ? 147.784 -1.587  -6.677  1.00 0.00 ? 31 LYS A CD   5  
ATOM 6729  C CE   . LYS A 1 32 ? 146.767 -0.979  -7.632  1.00 0.00 ? 31 LYS A CE   5  
ATOM 6730  N NZ   . LYS A 1 32 ? 145.374 -1.403  -7.315  1.00 0.00 ? 31 LYS A NZ   5  
ATOM 6731  H H    . LYS A 1 32 ? 151.959 -4.338  -7.194  1.00 0.00 ? 31 LYS A H    5  
ATOM 6732  H HA   . LYS A 1 32 ? 149.968 -3.356  -8.982  1.00 0.00 ? 31 LYS A HA   5  
ATOM 6733  H HB2  . LYS A 1 32 ? 149.777 -4.266  -6.509  1.00 0.00 ? 31 LYS A HB2  5  
ATOM 6734  H HB3  . LYS A 1 32 ? 150.008 -2.573  -6.096  1.00 0.00 ? 31 LYS A HB3  5  
ATOM 6735  H HG2  . LYS A 1 32 ? 147.982 -3.106  -8.161  1.00 0.00 ? 31 LYS A HG2  5  
ATOM 6736  H HG3  . LYS A 1 32 ? 147.608 -3.710  -6.546  1.00 0.00 ? 31 LYS A HG3  5  
ATOM 6737  H HD2  . LYS A 1 32 ? 147.350 -1.635  -5.690  1.00 0.00 ? 31 LYS A HD2  5  
ATOM 6738  H HD3  . LYS A 1 32 ? 148.663 -0.960  -6.655  1.00 0.00 ? 31 LYS A HD3  5  
ATOM 6739  H HE2  . LYS A 1 32 ? 146.829 0.097   -7.565  1.00 0.00 ? 31 LYS A HE2  5  
ATOM 6740  H HE3  . LYS A 1 32 ? 147.008 -1.289  -8.639  1.00 0.00 ? 31 LYS A HE3  5  
ATOM 6741  H HZ1  . LYS A 1 32 ? 144.979 -0.800  -6.565  1.00 0.00 ? 31 LYS A HZ1  5  
ATOM 6742  H HZ2  . LYS A 1 32 ? 145.362 -2.391  -6.992  1.00 0.00 ? 31 LYS A HZ2  5  
ATOM 6743  H HZ3  . LYS A 1 32 ? 144.774 -1.320  -8.162  1.00 0.00 ? 31 LYS A HZ3  5  
ATOM 6744  N N    . VAL A 1 33 ? 151.858 -1.146  -7.411  1.00 0.00 ? 32 VAL A N    5  
ATOM 6745  C CA   . VAL A 1 33 ? 152.314 0.243   -7.441  1.00 0.00 ? 32 VAL A CA   5  
ATOM 6746  C C    . VAL A 1 33 ? 153.038 0.565   -8.748  1.00 0.00 ? 32 VAL A C    5  
ATOM 6747  O O    . VAL A 1 33 ? 152.790 1.603   -9.361  1.00 0.00 ? 32 VAL A O    5  
ATOM 6748  C CB   . VAL A 1 33 ? 153.252 0.565   -6.254  1.00 0.00 ? 32 VAL A CB   5  
ATOM 6749  C CG1  . VAL A 1 33 ? 153.591 2.049   -6.224  1.00 0.00 ? 32 VAL A CG1  5  
ATOM 6750  C CG2  . VAL A 1 33 ? 152.626 0.132   -4.934  1.00 0.00 ? 32 VAL A CG2  5  
ATOM 6751  H H    . VAL A 1 33 ? 152.247 -1.765  -6.755  1.00 0.00 ? 32 VAL A H    5  
ATOM 6752  H HA   . VAL A 1 33 ? 151.442 0.876   -7.362  1.00 0.00 ? 32 VAL A HA   5  
ATOM 6753  H HB   . VAL A 1 33 ? 154.171 0.013   -6.389  1.00 0.00 ? 32 VAL A HB   5  
ATOM 6754  H HG11 . VAL A 1 33 ? 154.146 2.275   -5.326  1.00 0.00 ? 32 VAL A HG11 5  
ATOM 6755  H HG12 . VAL A 1 33 ? 152.679 2.626   -6.239  1.00 0.00 ? 32 VAL A HG12 5  
ATOM 6756  H HG13 . VAL A 1 33 ? 154.188 2.299   -7.089  1.00 0.00 ? 32 VAL A HG13 5  
ATOM 6757  H HG21 . VAL A 1 33 ? 153.106 -0.771  -4.588  1.00 0.00 ? 32 VAL A HG21 5  
ATOM 6758  H HG22 . VAL A 1 33 ? 151.572 -0.054  -5.078  1.00 0.00 ? 32 VAL A HG22 5  
ATOM 6759  H HG23 . VAL A 1 33 ? 152.757 0.912   -4.199  1.00 0.00 ? 32 VAL A HG23 5  
ATOM 6760  N N    . THR A 1 34 ? 153.938 -0.326  -9.166  1.00 0.00 ? 33 THR A N    5  
ATOM 6761  C CA   . THR A 1 34 ? 154.700 -0.122  -10.396 1.00 0.00 ? 33 THR A CA   5  
ATOM 6762  C C    . THR A 1 34 ? 153.786 -0.034  -11.620 1.00 0.00 ? 33 THR A C    5  
ATOM 6763  O O    . THR A 1 34 ? 154.035 0.761   -12.524 1.00 0.00 ? 33 THR A O    5  
ATOM 6764  C CB   . THR A 1 34 ? 155.754 -1.224  -10.587 1.00 0.00 ? 33 THR A CB   5  
ATOM 6765  O OG1  . THR A 1 34 ? 156.618 -0.907  -11.665 1.00 0.00 ? 33 THR A OG1  5  
ATOM 6766  C CG2  . THR A 1 34 ? 155.173 -2.595  -10.862 1.00 0.00 ? 33 THR A CG2  5  
ATOM 6767  H H    . THR A 1 34 ? 154.098 -1.134  -8.633  1.00 0.00 ? 33 THR A H    5  
ATOM 6768  H HA   . THR A 1 34 ? 155.211 0.824   -10.295 1.00 0.00 ? 33 THR A HA   5  
ATOM 6769  H HB   . THR A 1 34 ? 156.349 -1.293  -9.687  1.00 0.00 ? 33 THR A HB   5  
ATOM 6770  H HG1  . THR A 1 34 ? 157.043 -0.063  -11.498 1.00 0.00 ? 33 THR A HG1  5  
ATOM 6771  H HG21 . THR A 1 34 ? 155.903 -3.352  -10.612 1.00 0.00 ? 33 THR A HG21 5  
ATOM 6772  H HG22 . THR A 1 34 ? 154.917 -2.676  -11.907 1.00 0.00 ? 33 THR A HG22 5  
ATOM 6773  H HG23 . THR A 1 34 ? 154.288 -2.739  -10.262 1.00 0.00 ? 33 THR A HG23 5  
ATOM 6774  N N    . THR A 1 35 ? 152.735 -0.857  -11.653 1.00 0.00 ? 34 THR A N    5  
ATOM 6775  C CA   . THR A 1 35 ? 151.801 -0.858  -12.782 1.00 0.00 ? 34 THR A CA   5  
ATOM 6776  C C    . THR A 1 35 ? 150.933 0.404   -12.803 1.00 0.00 ? 34 THR A C    5  
ATOM 6777  O O    . THR A 1 35 ? 150.723 0.994   -13.862 1.00 0.00 ? 34 THR A O    5  
ATOM 6778  C CB   . THR A 1 35 ? 150.912 -2.107  -12.751 1.00 0.00 ? 34 THR A CB   5  
ATOM 6779  O OG1  . THR A 1 35 ? 151.693 -3.280  -12.905 1.00 0.00 ? 34 THR A OG1  5  
ATOM 6780  C CG2  . THR A 1 35 ? 149.854 -2.121  -13.835 1.00 0.00 ? 34 THR A CG2  5  
ATOM 6781  H H    . THR A 1 35 ? 152.585 -1.476  -10.907 1.00 0.00 ? 34 THR A H    5  
ATOM 6782  H HA   . THR A 1 35 ? 152.390 -0.879  -13.687 1.00 0.00 ? 34 THR A HA   5  
ATOM 6783  H HB   . THR A 1 35 ? 150.408 -2.158  -11.796 1.00 0.00 ? 34 THR A HB   5  
ATOM 6784  H HG1  . THR A 1 35 ? 151.363 -3.963  -12.317 1.00 0.00 ? 34 THR A HG1  5  
ATOM 6785  H HG21 . THR A 1 35 ? 150.228 -1.608  -14.709 1.00 0.00 ? 34 THR A HG21 5  
ATOM 6786  H HG22 . THR A 1 35 ? 148.965 -1.621  -13.480 1.00 0.00 ? 34 THR A HG22 5  
ATOM 6787  H HG23 . THR A 1 35 ? 149.614 -3.142  -14.092 1.00 0.00 ? 34 THR A HG23 5  
ATOM 6788  N N    . VAL A 1 36 ? 150.422 0.808   -11.639 1.00 0.00 ? 35 VAL A N    5  
ATOM 6789  C CA   . VAL A 1 36 ? 149.570 1.996   -11.554 1.00 0.00 ? 35 VAL A CA   5  
ATOM 6790  C C    . VAL A 1 36 ? 150.343 3.264   -11.914 1.00 0.00 ? 35 VAL A C    5  
ATOM 6791  O O    . VAL A 1 36 ? 149.891 4.061   -12.738 1.00 0.00 ? 35 VAL A O    5  
ATOM 6792  C CB   . VAL A 1 36 ? 148.953 2.166   -10.148 1.00 0.00 ? 35 VAL A CB   5  
ATOM 6793  C CG1  . VAL A 1 36 ? 148.019 3.369   -10.112 1.00 0.00 ? 35 VAL A CG1  5  
ATOM 6794  C CG2  . VAL A 1 36 ? 148.214 0.903   -9.727  1.00 0.00 ? 35 VAL A CG2  5  
ATOM 6795  H H    . VAL A 1 36 ? 150.616 0.296   -10.824 1.00 0.00 ? 35 VAL A H    5  
ATOM 6796  H HA   . VAL A 1 36 ? 148.763 1.871   -12.262 1.00 0.00 ? 35 VAL A HA   5  
ATOM 6797  H HB   . VAL A 1 36 ? 149.753 2.340   -9.444  1.00 0.00 ? 35 VAL A HB   5  
ATOM 6798  H HG11 . VAL A 1 36 ? 147.528 3.415   -9.151  1.00 0.00 ? 35 VAL A HG11 5  
ATOM 6799  H HG12 . VAL A 1 36 ? 147.278 3.272   -10.891 1.00 0.00 ? 35 VAL A HG12 5  
ATOM 6800  H HG13 . VAL A 1 36 ? 148.590 4.272   -10.269 1.00 0.00 ? 35 VAL A HG13 5  
ATOM 6801  H HG21 . VAL A 1 36 ? 147.150 1.055   -9.831  1.00 0.00 ? 35 VAL A HG21 5  
ATOM 6802  H HG22 . VAL A 1 36 ? 148.446 0.678   -8.697  1.00 0.00 ? 35 VAL A HG22 5  
ATOM 6803  H HG23 . VAL A 1 36 ? 148.523 0.079   -10.352 1.00 0.00 ? 35 VAL A HG23 5  
ATOM 6804  N N    . PHE A 1 37 ? 151.505 3.450   -11.288 1.00 0.00 ? 36 PHE A N    5  
ATOM 6805  C CA   . PHE A 1 37 ? 152.335 4.628   -11.541 1.00 0.00 ? 36 PHE A CA   5  
ATOM 6806  C C    . PHE A 1 37 ? 153.225 4.454   -12.775 1.00 0.00 ? 36 PHE A C    5  
ATOM 6807  O O    . PHE A 1 37 ? 153.802 5.426   -13.265 1.00 0.00 ? 36 PHE A O    5  
ATOM 6808  C CB   . PHE A 1 37 ? 153.198 4.942   -10.316 1.00 0.00 ? 36 PHE A CB   5  
ATOM 6809  C CG   . PHE A 1 37 ? 152.392 5.344   -9.113  1.00 0.00 ? 36 PHE A CG   5  
ATOM 6810  C CD1  . PHE A 1 37 ? 151.860 6.620   -9.015  1.00 0.00 ? 36 PHE A CD1  5  
ATOM 6811  C CD2  . PHE A 1 37 ? 152.158 4.443   -8.087  1.00 0.00 ? 36 PHE A CD2  5  
ATOM 6812  C CE1  . PHE A 1 37 ? 151.112 6.989   -7.915  1.00 0.00 ? 36 PHE A CE1  5  
ATOM 6813  C CE2  . PHE A 1 37 ? 151.410 4.807   -6.986  1.00 0.00 ? 36 PHE A CE2  5  
ATOM 6814  C CZ   . PHE A 1 37 ? 150.887 6.081   -6.899  1.00 0.00 ? 36 PHE A CZ   5  
ATOM 6815  H H    . PHE A 1 37 ? 151.809 2.782   -10.637 1.00 0.00 ? 36 PHE A H    5  
ATOM 6816  H HA   . PHE A 1 37 ? 151.670 5.461   -11.715 1.00 0.00 ? 36 PHE A HA   5  
ATOM 6817  H HB2  . PHE A 1 37 ? 153.776 4.067   -10.055 1.00 0.00 ? 36 PHE A HB2  5  
ATOM 6818  H HB3  . PHE A 1 37 ? 153.870 5.753   -10.555 1.00 0.00 ? 36 PHE A HB3  5  
ATOM 6819  H HD1  . PHE A 1 37 ? 152.036 7.330   -9.810  1.00 0.00 ? 36 PHE A HD1  5  
ATOM 6820  H HD2  . PHE A 1 37 ? 152.568 3.447   -8.154  1.00 0.00 ? 36 PHE A HD2  5  
ATOM 6821  H HE1  . PHE A 1 37 ? 150.704 7.988   -7.849  1.00 0.00 ? 36 PHE A HE1  5  
ATOM 6822  H HE2  . PHE A 1 37 ? 151.235 4.096   -6.193  1.00 0.00 ? 36 PHE A HE2  5  
ATOM 6823  H HZ   . PHE A 1 37 ? 150.302 6.367   -6.039  1.00 0.00 ? 36 PHE A HZ   5  
ATOM 6824  N N    . GLY A 1 38 ? 153.341 3.220   -13.270 1.00 0.00 ? 37 GLY A N    5  
ATOM 6825  C CA   . GLY A 1 38 ? 154.170 2.958   -14.436 1.00 0.00 ? 37 GLY A CA   5  
ATOM 6826  C C    . GLY A 1 38 ? 155.653 3.187   -14.172 1.00 0.00 ? 37 GLY A C    5  
ATOM 6827  O O    . GLY A 1 38 ? 156.417 3.445   -15.103 1.00 0.00 ? 37 GLY A O    5  
ATOM 6828  H H    . GLY A 1 38 ? 152.865 2.481   -12.839 1.00 0.00 ? 37 GLY A H    5  
ATOM 6829  H HA2  . GLY A 1 38 ? 154.026 1.933   -14.741 1.00 0.00 ? 37 GLY A HA2  5  
ATOM 6830  H HA3  . GLY A 1 38 ? 153.855 3.607   -15.240 1.00 0.00 ? 37 GLY A HA3  5  
ATOM 6831  N N    . GLN A 1 39 ? 156.059 3.096   -12.902 1.00 0.00 ? 38 GLN A N    5  
ATOM 6832  C CA   . GLN A 1 39 ? 157.456 3.298   -12.521 1.00 0.00 ? 38 GLN A CA   5  
ATOM 6833  C C    . GLN A 1 39 ? 157.790 2.532   -11.240 1.00 0.00 ? 38 GLN A C    5  
ATOM 6834  O O    . GLN A 1 39 ? 156.938 2.381   -10.364 1.00 0.00 ? 38 GLN A O    5  
ATOM 6835  C CB   . GLN A 1 39 ? 157.740 4.788   -12.311 1.00 0.00 ? 38 GLN A CB   5  
ATOM 6836  C CG   . GLN A 1 39 ? 158.210 5.506   -13.566 1.00 0.00 ? 38 GLN A CG   5  
ATOM 6837  C CD   . GLN A 1 39 ? 159.644 5.175   -13.927 1.00 0.00 ? 38 GLN A CD   5  
ATOM 6838  O OE1  . GLN A 1 39 ? 159.906 4.520   -14.936 1.00 0.00 ? 38 GLN A OE1  5  
ATOM 6839  N NE2  . GLN A 1 39 ? 160.585 5.624   -13.103 1.00 0.00 ? 38 GLN A NE2  5  
ATOM 6840  H H    . GLN A 1 39 ? 155.404 2.888   -12.204 1.00 0.00 ? 38 GLN A H    5  
ATOM 6841  H HA   . GLN A 1 39 ? 158.078 2.929   -13.323 1.00 0.00 ? 38 GLN A HA   5  
ATOM 6842  H HB2  . GLN A 1 39 ? 156.837 5.269   -11.965 1.00 0.00 ? 38 GLN A HB2  5  
ATOM 6843  H HB3  . GLN A 1 39 ? 158.505 4.893   -11.556 1.00 0.00 ? 38 GLN A HB3  5  
ATOM 6844  H HG2  . GLN A 1 39 ? 157.572 5.221   -14.388 1.00 0.00 ? 38 GLN A HG2  5  
ATOM 6845  H HG3  . GLN A 1 39 ? 158.132 6.571   -13.404 1.00 0.00 ? 38 GLN A HG3  5  
ATOM 6846  H HE21 . GLN A 1 39 ? 160.305 6.137   -12.316 1.00 0.00 ? 38 GLN A HE21 5  
ATOM 6847  H HE22 . GLN A 1 39 ? 161.520 5.423   -13.316 1.00 0.00 ? 38 GLN A HE22 5  
ATOM 6848  N N    . PRO A 1 40 ? 159.041 2.047   -11.110 1.00 0.00 ? 39 PRO A N    5  
ATOM 6849  C CA   . PRO A 1 40 ? 159.481 1.306   -9.923  1.00 0.00 ? 39 PRO A CA   5  
ATOM 6850  C C    . PRO A 1 40 ? 159.720 2.228   -8.723  1.00 0.00 ? 39 PRO A C    5  
ATOM 6851  O O    . PRO A 1 40 ? 160.862 2.470   -8.326  1.00 0.00 ? 39 PRO A O    5  
ATOM 6852  C CB   . PRO A 1 40 ? 160.789 0.657   -10.384 1.00 0.00 ? 39 PRO A CB   5  
ATOM 6853  C CG   . PRO A 1 40 ? 161.324 1.585   -11.419 1.00 0.00 ? 39 PRO A CG   5  
ATOM 6854  C CD   . PRO A 1 40 ? 160.126 2.188   -12.105 1.00 0.00 ? 39 PRO A CD   5  
ATOM 6855  H HA   . PRO A 1 40 ? 158.771 0.539   -9.650  1.00 0.00 ? 39 PRO A HA   5  
ATOM 6856  H HB2  . PRO A 1 40 ? 161.466 0.564   -9.546  1.00 0.00 ? 39 PRO A HB2  5  
ATOM 6857  H HB3  . PRO A 1 40 ? 160.584 -0.320  -10.798 1.00 0.00 ? 39 PRO A HB3  5  
ATOM 6858  H HG2  . PRO A 1 40 ? 161.913 2.358   -10.949 1.00 0.00 ? 39 PRO A HG2  5  
ATOM 6859  H HG3  . PRO A 1 40 ? 161.924 1.036   -12.130 1.00 0.00 ? 39 PRO A HG3  5  
ATOM 6860  H HD2  . PRO A 1 40 ? 160.307 3.228   -12.333 1.00 0.00 ? 39 PRO A HD2  5  
ATOM 6861  H HD3  . PRO A 1 40 ? 159.894 1.639   -13.007 1.00 0.00 ? 39 PRO A HD3  5  
ATOM 6862  N N    . LEU A 1 41 ? 158.629 2.744   -8.154  1.00 0.00 ? 40 LEU A N    5  
ATOM 6863  C CA   . LEU A 1 41 ? 158.714 3.642   -7.003  1.00 0.00 ? 40 LEU A CA   5  
ATOM 6864  C C    . LEU A 1 41 ? 158.998 2.860   -5.724  1.00 0.00 ? 40 LEU A C    5  
ATOM 6865  O O    . LEU A 1 41 ? 158.343 1.856   -5.441  1.00 0.00 ? 40 LEU A O    5  
ATOM 6866  C CB   . LEU A 1 41 ? 157.416 4.441   -6.847  1.00 0.00 ? 40 LEU A CB   5  
ATOM 6867  C CG   . LEU A 1 41 ? 157.273 5.647   -7.781  1.00 0.00 ? 40 LEU A CG   5  
ATOM 6868  C CD1  . LEU A 1 41 ? 156.674 5.227   -9.115  1.00 0.00 ? 40 LEU A CD1  5  
ATOM 6869  C CD2  . LEU A 1 41 ? 156.419 6.724   -7.128  1.00 0.00 ? 40 LEU A CD2  5  
ATOM 6870  H H    . LEU A 1 41 ? 157.748 2.518   -8.518  1.00 0.00 ? 40 LEU A H    5  
ATOM 6871  H HA   . LEU A 1 41 ? 159.531 4.327   -7.179  1.00 0.00 ? 40 LEU A HA   5  
ATOM 6872  H HB2  . LEU A 1 41 ? 156.583 3.774   -7.022  1.00 0.00 ? 40 LEU A HB2  5  
ATOM 6873  H HB3  . LEU A 1 41 ? 157.360 4.796   -5.828  1.00 0.00 ? 40 LEU A HB3  5  
ATOM 6874  H HG   . LEU A 1 41 ? 158.250 6.064   -7.972  1.00 0.00 ? 40 LEU A HG   5  
ATOM 6875  H HD11 . LEU A 1 41 ? 156.039 4.365   -8.972  1.00 0.00 ? 40 LEU A HD11 5  
ATOM 6876  H HD12 . LEU A 1 41 ? 157.469 4.977   -9.802  1.00 0.00 ? 40 LEU A HD12 5  
ATOM 6877  H HD13 . LEU A 1 41 ? 156.091 6.041   -9.521  1.00 0.00 ? 40 LEU A HD13 5  
ATOM 6878  H HD21 . LEU A 1 41 ? 156.835 6.979   -6.165  1.00 0.00 ? 40 LEU A HD21 5  
ATOM 6879  H HD22 . LEU A 1 41 ? 155.412 6.357   -6.998  1.00 0.00 ? 40 LEU A HD22 5  
ATOM 6880  H HD23 . LEU A 1 41 ? 156.403 7.602   -7.757  1.00 0.00 ? 40 LEU A HD23 5  
ATOM 6881  N N    . ASP A 1 42 ? 159.980 3.329   -4.955  1.00 0.00 ? 41 ASP A N    5  
ATOM 6882  C CA   . ASP A 1 42 ? 160.354 2.676   -3.703  1.00 0.00 ? 41 ASP A CA   5  
ATOM 6883  C C    . ASP A 1 42 ? 159.353 3.000   -2.597  1.00 0.00 ? 41 ASP A C    5  
ATOM 6884  O O    . ASP A 1 42 ? 158.881 4.133   -2.485  1.00 0.00 ? 41 ASP A O    5  
ATOM 6885  C CB   . ASP A 1 42 ? 161.760 3.105   -3.276  1.00 0.00 ? 41 ASP A CB   5  
ATOM 6886  C CG   . ASP A 1 42 ? 162.528 1.985   -2.598  1.00 0.00 ? 41 ASP A CG   5  
ATOM 6887  O OD1  . ASP A 1 42 ? 162.286 1.741   -1.396  1.00 0.00 ? 41 ASP A OD1  5  
ATOM 6888  O OD2  . ASP A 1 42 ? 163.372 1.353   -3.267  1.00 0.00 ? 41 ASP A OD2  5  
ATOM 6889  H H    . ASP A 1 42 ? 160.465 4.134   -5.236  1.00 0.00 ? 41 ASP A H    5  
ATOM 6890  H HA   . ASP A 1 42 ? 160.350 1.610   -3.874  1.00 0.00 ? 41 ASP A HA   5  
ATOM 6891  H HB2  . ASP A 1 42 ? 162.312 3.419   -4.149  1.00 0.00 ? 41 ASP A HB2  5  
ATOM 6892  H HB3  . ASP A 1 42 ? 161.682 3.933   -2.587  1.00 0.00 ? 41 ASP A HB3  5  
ATOM 6893  N N    . LEU A 1 43 ? 159.037 1.995   -1.783  1.00 0.00 ? 42 LEU A N    5  
ATOM 6894  C CA   . LEU A 1 43 ? 158.092 2.163   -0.683  1.00 0.00 ? 42 LEU A CA   5  
ATOM 6895  C C    . LEU A 1 43 ? 158.779 2.773   0.537   1.00 0.00 ? 42 LEU A C    5  
ATOM 6896  O O    . LEU A 1 43 ? 159.707 2.185   1.096   1.00 0.00 ? 42 LEU A O    5  
ATOM 6897  C CB   . LEU A 1 43 ? 157.465 0.816   -0.310  1.00 0.00 ? 42 LEU A CB   5  
ATOM 6898  C CG   . LEU A 1 43 ? 156.359 0.331   -1.250  1.00 0.00 ? 42 LEU A CG   5  
ATOM 6899  C CD1  . LEU A 1 43 ? 156.079 -1.148  -1.027  1.00 0.00 ? 42 LEU A CD1  5  
ATOM 6900  C CD2  . LEU A 1 43 ? 155.092 1.152   -1.052  1.00 0.00 ? 42 LEU A CD2  5  
ATOM 6901  H H    . LEU A 1 43 ? 159.450 1.117   -1.927  1.00 0.00 ? 42 LEU A H    5  
ATOM 6902  H HA   . LEU A 1 43 ? 157.313 2.833   -1.015  1.00 0.00 ? 42 LEU A HA   5  
ATOM 6903  H HB2  . LEU A 1 43 ? 158.248 0.071   -0.294  1.00 0.00 ? 42 LEU A HB2  5  
ATOM 6904  H HB3  . LEU A 1 43 ? 157.051 0.899   0.684   1.00 0.00 ? 42 LEU A HB3  5  
ATOM 6905  H HG   . LEU A 1 43 ? 156.684 0.458   -2.272  1.00 0.00 ? 42 LEU A HG   5  
ATOM 6906  H HD11 . LEU A 1 43 ? 155.145 -1.414  -1.499  1.00 0.00 ? 42 LEU A HD11 5  
ATOM 6907  H HD12 . LEU A 1 43 ? 156.017 -1.348  0.033   1.00 0.00 ? 42 LEU A HD12 5  
ATOM 6908  H HD13 . LEU A 1 43 ? 156.878 -1.733  -1.456  1.00 0.00 ? 42 LEU A HD13 5  
ATOM 6909  H HD21 . LEU A 1 43 ? 155.354 2.141   -0.705  1.00 0.00 ? 42 LEU A HD21 5  
ATOM 6910  H HD22 . LEU A 1 43 ? 154.461 0.670   -0.320  1.00 0.00 ? 42 LEU A HD22 5  
ATOM 6911  H HD23 . LEU A 1 43 ? 154.563 1.229   -1.990  1.00 0.00 ? 42 LEU A HD23 5  
ATOM 6912  N N    . HIS A 1 44 ? 158.317 3.953   0.948   1.00 0.00 ? 43 HIS A N    5  
ATOM 6913  C CA   . HIS A 1 44 ? 158.886 4.638   2.104   1.00 0.00 ? 43 HIS A CA   5  
ATOM 6914  C C    . HIS A 1 44 ? 157.850 4.790   3.214   1.00 0.00 ? 43 HIS A C    5  
ATOM 6915  O O    . HIS A 1 44 ? 156.807 5.420   3.024   1.00 0.00 ? 43 HIS A O    5  
ATOM 6916  C CB   . HIS A 1 44 ? 159.429 6.010   1.696   1.00 0.00 ? 43 HIS A CB   5  
ATOM 6917  C CG   . HIS A 1 44 ? 160.922 6.102   1.768   1.00 0.00 ? 43 HIS A CG   5  
ATOM 6918  N ND1  . HIS A 1 44 ? 161.615 6.169   2.958   1.00 0.00 ? 43 HIS A ND1  5  
ATOM 6919  C CD2  . HIS A 1 44 ? 161.856 6.135   0.788   1.00 0.00 ? 43 HIS A CD2  5  
ATOM 6920  C CE1  . HIS A 1 44 ? 162.910 6.241   2.707   1.00 0.00 ? 43 HIS A CE1  5  
ATOM 6921  N NE2  . HIS A 1 44 ? 163.083 6.222   1.398   1.00 0.00 ? 43 HIS A NE2  5  
ATOM 6922  H H    . HIS A 1 44 ? 157.576 4.372   0.462   1.00 0.00 ? 43 HIS A H    5  
ATOM 6923  H HA   . HIS A 1 44 ? 159.702 4.036   2.474   1.00 0.00 ? 43 HIS A HA   5  
ATOM 6924  H HB2  . HIS A 1 44 ? 159.131 6.221   0.680   1.00 0.00 ? 43 HIS A HB2  5  
ATOM 6925  H HB3  . HIS A 1 44 ? 159.016 6.763   2.352   1.00 0.00 ? 43 HIS A HB3  5  
ATOM 6926  H HD1  . HIS A 1 44 ? 161.218 6.162   3.854   1.00 0.00 ? 43 HIS A HD1  5  
ATOM 6927  H HD2  . HIS A 1 44 ? 161.670 6.096   -0.276  1.00 0.00 ? 43 HIS A HD2  5  
ATOM 6928  H HE1  . HIS A 1 44 ? 163.694 6.303   3.447   1.00 0.00 ? 43 HIS A HE1  5  
ATOM 6929  H HE2  . HIS A 1 44 ? 163.932 6.394   0.940   1.00 0.00 ? 43 HIS A HE2  5  
ATOM 6930  N N    . TYR A 1 45 ? 158.146 4.208   4.373   1.00 0.00 ? 44 TYR A N    5  
ATOM 6931  C CA   . TYR A 1 45 ? 157.248 4.272   5.520   1.00 0.00 ? 44 TYR A CA   5  
ATOM 6932  C C    . TYR A 1 45 ? 157.567 5.484   6.392   1.00 0.00 ? 44 TYR A C    5  
ATOM 6933  O O    . TYR A 1 45 ? 158.660 5.589   6.950   1.00 0.00 ? 44 TYR A O    5  
ATOM 6934  C CB   . TYR A 1 45 ? 157.352 2.987   6.347   1.00 0.00 ? 44 TYR A CB   5  
ATOM 6935  C CG   . TYR A 1 45 ? 156.018 2.469   6.838   1.00 0.00 ? 44 TYR A CG   5  
ATOM 6936  C CD1  . TYR A 1 45 ? 155.136 1.833   5.972   1.00 0.00 ? 44 TYR A CD1  5  
ATOM 6937  C CD2  . TYR A 1 45 ? 155.642 2.612   8.168   1.00 0.00 ? 44 TYR A CD2  5  
ATOM 6938  C CE1  . TYR A 1 45 ? 153.918 1.357   6.418   1.00 0.00 ? 44 TYR A CE1  5  
ATOM 6939  C CE2  . TYR A 1 45 ? 154.426 2.138   8.621   1.00 0.00 ? 44 TYR A CE2  5  
ATOM 6940  C CZ   . TYR A 1 45 ? 153.568 1.511   7.743   1.00 0.00 ? 44 TYR A CZ   5  
ATOM 6941  O OH   . TYR A 1 45 ? 152.356 1.038   8.192   1.00 0.00 ? 44 TYR A OH   5  
ATOM 6942  H H    . TYR A 1 45 ? 158.995 3.722   4.460   1.00 0.00 ? 44 TYR A H    5  
ATOM 6943  H HA   . TYR A 1 45 ? 156.239 4.368   5.146   1.00 0.00 ? 44 TYR A HA   5  
ATOM 6944  H HB2  . TYR A 1 45 ? 157.804 2.215   5.742   1.00 0.00 ? 44 TYR A HB2  5  
ATOM 6945  H HB3  . TYR A 1 45 ? 157.975 3.172   7.209   1.00 0.00 ? 44 TYR A HB3  5  
ATOM 6946  H HD1  . TYR A 1 45 ? 155.412 1.713   4.935   1.00 0.00 ? 44 TYR A HD1  5  
ATOM 6947  H HD2  . TYR A 1 45 ? 156.316 3.104   8.853   1.00 0.00 ? 44 TYR A HD2  5  
ATOM 6948  H HE1  . TYR A 1 45 ? 153.246 0.866   5.729   1.00 0.00 ? 44 TYR A HE1  5  
ATOM 6949  H HE2  . TYR A 1 45 ? 154.152 2.259   9.658   1.00 0.00 ? 44 TYR A HE2  5  
ATOM 6950  H HH   . TYR A 1 45 ? 152.455 0.129   8.487   1.00 0.00 ? 44 TYR A HH   5  
ATOM 6951  N N    . MET A 1 46 ? 156.604 6.397   6.503   1.00 0.00 ? 45 MET A N    5  
ATOM 6952  C CA   . MET A 1 46 ? 156.778 7.605   7.304   1.00 0.00 ? 45 MET A CA   5  
ATOM 6953  C C    . MET A 1 46 ? 155.695 7.706   8.377   1.00 0.00 ? 45 MET A C    5  
ATOM 6954  O O    . MET A 1 46 ? 154.510 7.832   8.066   1.00 0.00 ? 45 MET A O    5  
ATOM 6955  C CB   . MET A 1 46 ? 156.745 8.844   6.406   1.00 0.00 ? 45 MET A CB   5  
ATOM 6956  C CG   . MET A 1 46 ? 158.124 9.373   6.048   1.00 0.00 ? 45 MET A CG   5  
ATOM 6957  S SD   . MET A 1 46 ? 158.435 11.016  6.722   1.00 0.00 ? 45 MET A SD   5  
ATOM 6958  C CE   . MET A 1 46 ? 158.920 11.905  5.244   1.00 0.00 ? 45 MET A CE   5  
ATOM 6959  H H    . MET A 1 46 ? 155.755 6.256   6.033   1.00 0.00 ? 45 MET A H    5  
ATOM 6960  H HA   . MET A 1 46 ? 157.741 7.547   7.788   1.00 0.00 ? 45 MET A HA   5  
ATOM 6961  H HB2  . MET A 1 46 ? 156.231 8.595   5.490   1.00 0.00 ? 45 MET A HB2  5  
ATOM 6962  H HB3  . MET A 1 46 ? 156.202 9.628   6.912   1.00 0.00 ? 45 MET A HB3  5  
ATOM 6963  H HG2  . MET A 1 46 ? 158.868 8.694   6.437   1.00 0.00 ? 45 MET A HG2  5  
ATOM 6964  H HG3  . MET A 1 46 ? 158.208 9.418   4.972   1.00 0.00 ? 45 MET A HG3  5  
ATOM 6965  H HE1  . MET A 1 46 ? 158.250 12.738  5.089   1.00 0.00 ? 45 MET A HE1  5  
ATOM 6966  H HE2  . MET A 1 46 ? 158.873 11.242  4.393   1.00 0.00 ? 45 MET A HE2  5  
ATOM 6967  H HE3  . MET A 1 46 ? 159.929 12.272  5.360   1.00 0.00 ? 45 MET A HE3  5  
ATOM 6968  N N    . ASN A 1 47 ? 156.112 7.645   9.642   1.00 0.00 ? 46 ASN A N    5  
ATOM 6969  C CA   . ASN A 1 47 ? 155.176 7.725   10.763  1.00 0.00 ? 46 ASN A CA   5  
ATOM 6970  C C    . ASN A 1 47 ? 154.904 9.180   11.149  1.00 0.00 ? 46 ASN A C    5  
ATOM 6971  O O    . ASN A 1 47 ? 153.819 9.704   10.894  1.00 0.00 ? 46 ASN A O    5  
ATOM 6972  C CB   . ASN A 1 47 ? 155.717 6.948   11.970  1.00 0.00 ? 46 ASN A CB   5  
ATOM 6973  C CG   . ASN A 1 47 ? 155.041 5.599   12.145  1.00 0.00 ? 46 ASN A CG   5  
ATOM 6974  O OD1  . ASN A 1 47 ? 153.847 5.451   11.882  1.00 0.00 ? 46 ASN A OD1  5  
ATOM 6975  N ND2  . ASN A 1 47 ? 155.802 4.606   12.592  1.00 0.00 ? 46 ASN A ND2  5  
ATOM 6976  H H    . ASN A 1 47 ? 157.071 7.542   9.824   1.00 0.00 ? 46 ASN A H    5  
ATOM 6977  H HA   . ASN A 1 47 ? 154.247 7.275   10.446  1.00 0.00 ? 46 ASN A HA   5  
ATOM 6978  H HB2  . ASN A 1 47 ? 156.776 6.785   11.839  1.00 0.00 ? 46 ASN A HB2  5  
ATOM 6979  H HB3  . ASN A 1 47 ? 155.555 7.528   12.867  1.00 0.00 ? 46 ASN A HB3  5  
ATOM 6980  H HD21 . ASN A 1 47 ? 156.746 4.792   12.782  1.00 0.00 ? 46 ASN A HD21 5  
ATOM 6981  H HD22 . ASN A 1 47 ? 155.389 3.726   12.713  1.00 0.00 ? 46 ASN A HD22 5  
ATOM 6982  N N    . ASN A 1 48 ? 155.895 9.825   11.764  1.00 0.00 ? 47 ASN A N    5  
ATOM 6983  C CA   . ASN A 1 48 ? 155.762 11.220  12.181  1.00 0.00 ? 47 ASN A CA   5  
ATOM 6984  C C    . ASN A 1 48 ? 157.011 12.014  11.807  1.00 0.00 ? 47 ASN A C    5  
ATOM 6985  O O    . ASN A 1 48 ? 156.962 12.891  10.943  1.00 0.00 ? 47 ASN A O    5  
ATOM 6986  C CB   . ASN A 1 48 ? 155.513 11.311  13.692  1.00 0.00 ? 47 ASN A CB   5  
ATOM 6987  C CG   . ASN A 1 48 ? 154.337 10.464  14.144  1.00 0.00 ? 47 ASN A CG   5  
ATOM 6988  O OD1  . ASN A 1 48 ? 154.509 9.322   14.571  1.00 0.00 ? 47 ASN A OD1  5  
ATOM 6989  N ND2  . ASN A 1 48 ? 153.132 11.019  14.052  1.00 0.00 ? 47 ASN A ND2  5  
ATOM 6990  H H    . ASN A 1 48 ? 156.736 9.354   11.938  1.00 0.00 ? 47 ASN A H    5  
ATOM 6991  H HA   . ASN A 1 48 ? 154.916 11.642  11.660  1.00 0.00 ? 47 ASN A HA   5  
ATOM 6992  H HB2  . ASN A 1 48 ? 156.394 10.976  14.218  1.00 0.00 ? 47 ASN A HB2  5  
ATOM 6993  H HB3  . ASN A 1 48 ? 155.313 12.340  13.954  1.00 0.00 ? 47 ASN A HB3  5  
ATOM 6994  H HD21 . ASN A 1 48 ? 153.066 11.933  13.704  1.00 0.00 ? 47 ASN A HD21 5  
ATOM 6995  H HD22 . ASN A 1 48 ? 152.358 10.490  14.336  1.00 0.00 ? 47 ASN A HD22 5  
ATOM 6996  N N    . GLU A 1 49 ? 158.131 11.695  12.456  1.00 0.00 ? 48 GLU A N    5  
ATOM 6997  C CA   . GLU A 1 49 ? 159.397 12.371  12.185  1.00 0.00 ? 48 GLU A CA   5  
ATOM 6998  C C    . GLU A 1 49 ? 160.483 11.370  11.771  1.00 0.00 ? 48 GLU A C    5  
ATOM 6999  O O    . GLU A 1 49 ? 161.675 11.679  11.830  1.00 0.00 ? 48 GLU A O    5  
ATOM 7000  C CB   . GLU A 1 49 ? 159.853 13.162  13.417  1.00 0.00 ? 48 GLU A CB   5  
ATOM 7001  C CG   . GLU A 1 49 ? 158.746 13.975  14.071  1.00 0.00 ? 48 GLU A CG   5  
ATOM 7002  C CD   . GLU A 1 49 ? 159.282 15.027  15.023  1.00 0.00 ? 48 GLU A CD   5  
ATOM 7003  O OE1  . GLU A 1 49 ? 159.526 14.694  16.201  1.00 0.00 ? 48 GLU A OE1  5  
ATOM 7004  O OE2  . GLU A 1 49 ? 159.459 16.184  14.587  1.00 0.00 ? 48 GLU A OE2  5  
ATOM 7005  H H    . GLU A 1 49 ? 158.106 10.983  13.129  1.00 0.00 ? 48 GLU A H    5  
ATOM 7006  H HA   . GLU A 1 49 ? 159.234 13.060  11.369  1.00 0.00 ? 48 GLU A HA   5  
ATOM 7007  H HB2  . GLU A 1 49 ? 160.242 12.472  14.149  1.00 0.00 ? 48 GLU A HB2  5  
ATOM 7008  H HB3  . GLU A 1 49 ? 160.640 13.840  13.121  1.00 0.00 ? 48 GLU A HB3  5  
ATOM 7009  H HG2  . GLU A 1 49 ? 158.174 14.468  13.299  1.00 0.00 ? 48 GLU A HG2  5  
ATOM 7010  H HG3  . GLU A 1 49 ? 158.104 13.305  14.623  1.00 0.00 ? 48 GLU A HG3  5  
ATOM 7011  N N    . LEU A 1 50 ? 160.067 10.170  11.351  1.00 0.00 ? 49 LEU A N    5  
ATOM 7012  C CA   . LEU A 1 50 ? 161.005 9.134   10.929  1.00 0.00 ? 49 LEU A CA   5  
ATOM 7013  C C    . LEU A 1 50 ? 160.585 8.528   9.591   1.00 0.00 ? 49 LEU A C    5  
ATOM 7014  O O    . LEU A 1 50 ? 159.402 8.270   9.363   1.00 0.00 ? 49 LEU A O    5  
ATOM 7015  C CB   . LEU A 1 50 ? 161.099 8.035   11.992  1.00 0.00 ? 49 LEU A CB   5  
ATOM 7016  C CG   . LEU A 1 50 ? 162.419 7.260   12.012  1.00 0.00 ? 49 LEU A CG   5  
ATOM 7017  C CD1  . LEU A 1 50 ? 163.541 8.128   12.567  1.00 0.00 ? 49 LEU A CD1  5  
ATOM 7018  C CD2  . LEU A 1 50 ? 162.271 5.985   12.830  1.00 0.00 ? 49 LEU A CD2  5  
ATOM 7019  H H    . LEU A 1 50 ? 159.107 9.978   11.321  1.00 0.00 ? 49 LEU A H    5  
ATOM 7020  H HA   . LEU A 1 50 ? 161.975 9.595   10.813  1.00 0.00 ? 49 LEU A HA   5  
ATOM 7021  H HB2  . LEU A 1 50 ? 160.958 8.490   12.962  1.00 0.00 ? 49 LEU A HB2  5  
ATOM 7022  H HB3  . LEU A 1 50 ? 160.298 7.331   11.824  1.00 0.00 ? 49 LEU A HB3  5  
ATOM 7023  H HG   . LEU A 1 50 ? 162.682 6.982   11.002  1.00 0.00 ? 49 LEU A HG   5  
ATOM 7024  H HD11 . LEU A 1 50 ? 164.417 7.519   12.739  1.00 0.00 ? 49 LEU A HD11 5  
ATOM 7025  H HD12 . LEU A 1 50 ? 163.224 8.575   13.498  1.00 0.00 ? 49 LEU A HD12 5  
ATOM 7026  H HD13 . LEU A 1 50 ? 163.778 8.907   11.857  1.00 0.00 ? 49 LEU A HD13 5  
ATOM 7027  H HD21 . LEU A 1 50 ? 162.861 5.199   12.381  1.00 0.00 ? 49 LEU A HD21 5  
ATOM 7028  H HD22 . LEU A 1 50 ? 161.232 5.688   12.849  1.00 0.00 ? 49 LEU A HD22 5  
ATOM 7029  H HD23 . LEU A 1 50 ? 162.613 6.161   13.839  1.00 0.00 ? 49 LEU A HD23 5  
ATOM 7030  N N    . SER A 1 51 ? 161.563 8.300   8.714   1.00 0.00 ? 50 SER A N    5  
ATOM 7031  C CA   . SER A 1 51 ? 161.297 7.720   7.399   1.00 0.00 ? 50 SER A CA   5  
ATOM 7032  C C    . SER A 1 51 ? 162.088 6.429   7.207   1.00 0.00 ? 50 SER A C    5  
ATOM 7033  O O    . SER A 1 51 ? 163.317 6.423   7.305   1.00 0.00 ? 50 SER A O    5  
ATOM 7034  C CB   . SER A 1 51 ? 161.652 8.714   6.287   1.00 0.00 ? 50 SER A CB   5  
ATOM 7035  O OG   . SER A 1 51 ? 161.532 10.055  6.731   1.00 0.00 ? 50 SER A OG   5  
ATOM 7036  H H    . SER A 1 51 ? 162.486 8.525   8.958   1.00 0.00 ? 50 SER A H    5  
ATOM 7037  H HA   . SER A 1 51 ? 160.241 7.494   7.346   1.00 0.00 ? 50 SER A HA   5  
ATOM 7038  H HB2  . SER A 1 51 ? 162.671 8.545   5.970   1.00 0.00 ? 50 SER A HB2  5  
ATOM 7039  H HB3  . SER A 1 51 ? 160.987 8.564   5.449   1.00 0.00 ? 50 SER A HB3  5  
ATOM 7040  H HG   . SER A 1 51 ? 162.351 10.328  7.153   1.00 0.00 ? 50 SER A HG   5  
ATOM 7041  N N    . ILE A 1 52 ? 161.375 5.338   6.933   1.00 0.00 ? 51 ILE A N    5  
ATOM 7042  C CA   . ILE A 1 52 ? 162.005 4.036   6.726   1.00 0.00 ? 51 ILE A CA   5  
ATOM 7043  C C    . ILE A 1 52 ? 161.809 3.564   5.284   1.00 0.00 ? 51 ILE A C    5  
ATOM 7044  O O    . ILE A 1 52 ? 160.696 3.597   4.757   1.00 0.00 ? 51 ILE A O    5  
ATOM 7045  C CB   . ILE A 1 52 ? 161.438 2.975   7.700   1.00 0.00 ? 51 ILE A CB   5  
ATOM 7046  C CG1  . ILE A 1 52 ? 161.318 3.549   9.118   1.00 0.00 ? 51 ILE A CG1  5  
ATOM 7047  C CG2  . ILE A 1 52 ? 162.316 1.730   7.707   1.00 0.00 ? 51 ILE A CG2  5  
ATOM 7048  C CD1  . ILE A 1 52 ? 159.936 4.075   9.445   1.00 0.00 ? 51 ILE A CD1  5  
ATOM 7049  H H    . ILE A 1 52 ? 160.397 5.411   6.868   1.00 0.00 ? 51 ILE A H    5  
ATOM 7050  H HA   . ILE A 1 52 ? 163.063 4.143   6.918   1.00 0.00 ? 51 ILE A HA   5  
ATOM 7051  H HB   . ILE A 1 52 ? 160.458 2.689   7.351   1.00 0.00 ? 51 ILE A HB   5  
ATOM 7052  H HG12 . ILE A 1 52 ? 161.554 2.777   9.834   1.00 0.00 ? 51 ILE A HG12 5  
ATOM 7053  H HG13 . ILE A 1 52 ? 162.019 4.364   9.230   1.00 0.00 ? 51 ILE A HG13 5  
ATOM 7054  H HG21 . ILE A 1 52 ? 161.886 0.983   7.058   1.00 0.00 ? 51 ILE A HG21 5  
ATOM 7055  H HG22 . ILE A 1 52 ? 162.379 1.339   8.711   1.00 0.00 ? 51 ILE A HG22 5  
ATOM 7056  H HG23 . ILE A 1 52 ? 163.305 1.983   7.357   1.00 0.00 ? 51 ILE A HG23 5  
ATOM 7057  H HD11 . ILE A 1 52 ? 159.769 4.010   10.511  1.00 0.00 ? 51 ILE A HD11 5  
ATOM 7058  H HD12 . ILE A 1 52 ? 159.194 3.485   8.929   1.00 0.00 ? 51 ILE A HD12 5  
ATOM 7059  H HD13 . ILE A 1 52 ? 159.860 5.105   9.131   1.00 0.00 ? 51 ILE A HD13 5  
ATOM 7060  N N    . LEU A 1 53 ? 162.898 3.132   4.647   1.00 0.00 ? 52 LEU A N    5  
ATOM 7061  C CA   . LEU A 1 53 ? 162.845 2.663   3.264   1.00 0.00 ? 52 LEU A CA   5  
ATOM 7062  C C    . LEU A 1 53 ? 162.620 1.151   3.203   1.00 0.00 ? 52 LEU A C    5  
ATOM 7063  O O    . LEU A 1 53 ? 163.344 0.378   3.833   1.00 0.00 ? 52 LEU A O    5  
ATOM 7064  C CB   . LEU A 1 53 ? 164.136 3.040   2.527   1.00 0.00 ? 52 LEU A CB   5  
ATOM 7065  C CG   . LEU A 1 53 ? 164.181 2.654   1.045   1.00 0.00 ? 52 LEU A CG   5  
ATOM 7066  C CD1  . LEU A 1 53 ? 165.006 3.655   0.248   1.00 0.00 ? 52 LEU A CD1  5  
ATOM 7067  C CD2  . LEU A 1 53 ? 164.740 1.248   0.871   1.00 0.00 ? 52 LEU A CD2  5  
ATOM 7068  H H    . LEU A 1 53 ? 163.757 3.133   5.115   1.00 0.00 ? 52 LEU A H    5  
ATOM 7069  H HA   . LEU A 1 53 ? 162.014 3.154   2.782   1.00 0.00 ? 52 LEU A HA   5  
ATOM 7070  H HB2  . LEU A 1 53 ? 164.265 4.110   2.602   1.00 0.00 ? 52 LEU A HB2  5  
ATOM 7071  H HB3  . LEU A 1 53 ? 164.963 2.560   3.027   1.00 0.00 ? 52 LEU A HB3  5  
ATOM 7072  H HG   . LEU A 1 53 ? 163.176 2.664   0.650   1.00 0.00 ? 52 LEU A HG   5  
ATOM 7073  H HD11 . LEU A 1 53 ? 165.896 3.914   0.803   1.00 0.00 ? 52 LEU A HD11 5  
ATOM 7074  H HD12 . LEU A 1 53 ? 164.421 4.545   0.071   1.00 0.00 ? 52 LEU A HD12 5  
ATOM 7075  H HD13 . LEU A 1 53 ? 165.288 3.216   -0.697  1.00 0.00 ? 52 LEU A HD13 5  
ATOM 7076  H HD21 . LEU A 1 53 ? 165.283 1.189   -0.061  1.00 0.00 ? 52 LEU A HD21 5  
ATOM 7077  H HD22 . LEU A 1 53 ? 163.928 0.537   0.858   1.00 0.00 ? 52 LEU A HD22 5  
ATOM 7078  H HD23 . LEU A 1 53 ? 165.405 1.019   1.690   1.00 0.00 ? 52 LEU A HD23 5  
ATOM 7079  N N    . LEU A 1 54 ? 161.613 0.740   2.434   1.00 0.00 ? 53 LEU A N    5  
ATOM 7080  C CA   . LEU A 1 54 ? 161.287 -0.675  2.277   1.00 0.00 ? 53 LEU A CA   5  
ATOM 7081  C C    . LEU A 1 54 ? 161.996 -1.263  1.057   1.00 0.00 ? 53 LEU A C    5  
ATOM 7082  O O    . LEU A 1 54 ? 161.461 -1.247  -0.053  1.00 0.00 ? 53 LEU A O    5  
ATOM 7083  C CB   . LEU A 1 54 ? 159.772 -0.863  2.140   1.00 0.00 ? 53 LEU A CB   5  
ATOM 7084  C CG   . LEU A 1 54 ? 158.964 -0.638  3.422   1.00 0.00 ? 53 LEU A CG   5  
ATOM 7085  C CD1  . LEU A 1 54 ? 158.594 0.828   3.577   1.00 0.00 ? 53 LEU A CD1  5  
ATOM 7086  C CD2  . LEU A 1 54 ? 157.713 -1.501  3.420   1.00 0.00 ? 53 LEU A CD2  5  
ATOM 7087  H H    . LEU A 1 54 ? 161.078 1.408   1.954   1.00 0.00 ? 53 LEU A H    5  
ATOM 7088  H HA   . LEU A 1 54 ? 161.626 -1.194  3.162   1.00 0.00 ? 53 LEU A HA   5  
ATOM 7089  H HB2  . LEU A 1 54 ? 159.413 -0.176  1.387   1.00 0.00 ? 53 LEU A HB2  5  
ATOM 7090  H HB3  . LEU A 1 54 ? 159.587 -1.870  1.799   1.00 0.00 ? 53 LEU A HB3  5  
ATOM 7091  H HG   . LEU A 1 54 ? 159.564 -0.922  4.273   1.00 0.00 ? 53 LEU A HG   5  
ATOM 7092  H HD11 . LEU A 1 54 ? 159.465 1.390   3.881   1.00 0.00 ? 53 LEU A HD11 5  
ATOM 7093  H HD12 . LEU A 1 54 ? 157.823 0.926   4.327   1.00 0.00 ? 53 LEU A HD12 5  
ATOM 7094  H HD13 . LEU A 1 54 ? 158.229 1.208   2.635   1.00 0.00 ? 53 LEU A HD13 5  
ATOM 7095  H HD21 . LEU A 1 54 ? 157.994 -2.543  3.399   1.00 0.00 ? 53 LEU A HD21 5  
ATOM 7096  H HD22 . LEU A 1 54 ? 157.118 -1.270  2.550   1.00 0.00 ? 53 LEU A HD22 5  
ATOM 7097  H HD23 . LEU A 1 54 ? 157.138 -1.301  4.313   1.00 0.00 ? 53 LEU A HD23 5  
ATOM 7098  N N    . LYS A 1 55 ? 163.202 -1.781  1.272   1.00 0.00 ? 54 LYS A N    5  
ATOM 7099  C CA   . LYS A 1 55 ? 163.985 -2.377  0.191   1.00 0.00 ? 54 LYS A CA   5  
ATOM 7100  C C    . LYS A 1 55 ? 163.722 -3.880  0.083   1.00 0.00 ? 54 LYS A C    5  
ATOM 7101  O O    . LYS A 1 55 ? 163.778 -4.451  -1.009  1.00 0.00 ? 54 LYS A O    5  
ATOM 7102  C CB   . LYS A 1 55 ? 165.479 -2.117  0.416   1.00 0.00 ? 54 LYS A CB   5  
ATOM 7103  C CG   . LYS A 1 55 ? 166.245 -1.785  -0.857  1.00 0.00 ? 54 LYS A CG   5  
ATOM 7104  C CD   . LYS A 1 55 ? 167.217 -0.630  -0.647  1.00 0.00 ? 54 LYS A CD   5  
ATOM 7105  C CE   . LYS A 1 55 ? 167.216 0.328   -1.830  1.00 0.00 ? 54 LYS A CE   5  
ATOM 7106  N NZ   . LYS A 1 55 ? 168.368 1.274   -1.787  1.00 0.00 ? 54 LYS A NZ   5  
ATOM 7107  H H    . LYS A 1 55 ? 163.574 -1.767  2.179   1.00 0.00 ? 54 LYS A H    5  
ATOM 7108  H HA   . LYS A 1 55 ? 163.684 -1.906  -0.732  1.00 0.00 ? 54 LYS A HA   5  
ATOM 7109  H HB2  . LYS A 1 55 ? 165.588 -1.290  1.102   1.00 0.00 ? 54 LYS A HB2  5  
ATOM 7110  H HB3  . LYS A 1 55 ? 165.923 -2.998  0.858   1.00 0.00 ? 54 LYS A HB3  5  
ATOM 7111  H HG2  . LYS A 1 55 ? 166.804 -2.657  -1.166  1.00 0.00 ? 54 LYS A HG2  5  
ATOM 7112  H HG3  . LYS A 1 55 ? 165.541 -1.516  -1.631  1.00 0.00 ? 54 LYS A HG3  5  
ATOM 7113  H HD2  . LYS A 1 55 ? 166.932 -0.088  0.242   1.00 0.00 ? 54 LYS A HD2  5  
ATOM 7114  H HD3  . LYS A 1 55 ? 168.213 -1.031  -0.521  1.00 0.00 ? 54 LYS A HD3  5  
ATOM 7115  H HE2  . LYS A 1 55 ? 167.270 -0.247  -2.743  1.00 0.00 ? 54 LYS A HE2  5  
ATOM 7116  H HE3  . LYS A 1 55 ? 166.295 0.894   -1.818  1.00 0.00 ? 54 LYS A HE3  5  
ATOM 7117  H HZ1  . LYS A 1 55 ? 168.205 2.003   -1.064  1.00 0.00 ? 54 LYS A HZ1  5  
ATOM 7118  H HZ2  . LYS A 1 55 ? 168.484 1.738   -2.710  1.00 0.00 ? 54 LYS A HZ2  5  
ATOM 7119  H HZ3  . LYS A 1 55 ? 169.244 0.762   -1.556  1.00 0.00 ? 54 LYS A HZ3  5  
ATOM 7120  N N    . ASN A 1 56 ? 163.441 -4.515  1.222   1.00 0.00 ? 55 ASN A N    5  
ATOM 7121  C CA   . ASN A 1 56 ? 163.175 -5.951  1.261   1.00 0.00 ? 55 ASN A CA   5  
ATOM 7122  C C    . ASN A 1 56 ? 161.913 -6.253  2.073   1.00 0.00 ? 55 ASN A C    5  
ATOM 7123  O O    . ASN A 1 56 ? 161.324 -5.355  2.677   1.00 0.00 ? 55 ASN A O    5  
ATOM 7124  C CB   . ASN A 1 56 ? 164.377 -6.691  1.862   1.00 0.00 ? 55 ASN A CB   5  
ATOM 7125  C CG   . ASN A 1 56 ? 164.870 -6.049  3.148   1.00 0.00 ? 55 ASN A CG   5  
ATOM 7126  O OD1  . ASN A 1 56 ? 164.172 -6.047  4.159   1.00 0.00 ? 55 ASN A OD1  5  
ATOM 7127  N ND2  . ASN A 1 56 ? 166.079 -5.495  3.113   1.00 0.00 ? 55 ASN A ND2  5  
ATOM 7128  H H    . ASN A 1 56 ? 163.416 -4.006  2.059   1.00 0.00 ? 55 ASN A H    5  
ATOM 7129  H HA   . ASN A 1 56 ? 163.025 -6.290  0.247   1.00 0.00 ? 55 ASN A HA   5  
ATOM 7130  H HB2  . ASN A 1 56 ? 164.096 -7.711  2.076   1.00 0.00 ? 55 ASN A HB2  5  
ATOM 7131  H HB3  . ASN A 1 56 ? 165.185 -6.688  1.146   1.00 0.00 ? 55 ASN A HB3  5  
ATOM 7132  H HD21 . ASN A 1 56 ? 166.581 -5.528  2.272   1.00 0.00 ? 55 ASN A HD21 5  
ATOM 7133  H HD22 . ASN A 1 56 ? 166.419 -5.076  3.932   1.00 0.00 ? 55 ASN A HD22 5  
ATOM 7134  N N    . GLN A 1 57 ? 161.505 -7.524  2.084   1.00 0.00 ? 56 GLN A N    5  
ATOM 7135  C CA   . GLN A 1 57 ? 160.314 -7.945  2.825   1.00 0.00 ? 56 GLN A CA   5  
ATOM 7136  C C    . GLN A 1 57 ? 160.481 -7.707  4.326   1.00 0.00 ? 56 GLN A C    5  
ATOM 7137  O O    . GLN A 1 57 ? 159.505 -7.429  5.025   1.00 0.00 ? 56 GLN A O    5  
ATOM 7138  C CB   . GLN A 1 57 ? 160.009 -9.424  2.569   1.00 0.00 ? 56 GLN A CB   5  
ATOM 7139  C CG   . GLN A 1 57 ? 158.790 -9.652  1.688   1.00 0.00 ? 56 GLN A CG   5  
ATOM 7140  C CD   . GLN A 1 57 ? 157.551 -10.019 2.485   1.00 0.00 ? 56 GLN A CD   5  
ATOM 7141  O OE1  . GLN A 1 57 ? 157.343 -11.182 2.829   1.00 0.00 ? 56 GLN A OE1  5  
ATOM 7142  N NE2  . GLN A 1 57 ? 156.720 -9.025  2.782   1.00 0.00 ? 56 GLN A NE2  5  
ATOM 7143  H H    . GLN A 1 57 ? 162.018 -8.194  1.584   1.00 0.00 ? 56 GLN A H    5  
ATOM 7144  H HA   . GLN A 1 57 ? 159.483 -7.351  2.472   1.00 0.00 ? 56 GLN A HA   5  
ATOM 7145  H HB2  . GLN A 1 57 ? 160.863 -9.880  2.090   1.00 0.00 ? 56 GLN A HB2  5  
ATOM 7146  H HB3  . GLN A 1 57 ? 159.837 -9.913  3.517   1.00 0.00 ? 56 GLN A HB3  5  
ATOM 7147  H HG2  . GLN A 1 57 ? 158.588 -8.748  1.134   1.00 0.00 ? 56 GLN A HG2  5  
ATOM 7148  H HG3  . GLN A 1 57 ? 159.006 -10.454 0.998   1.00 0.00 ? 56 GLN A HG3  5  
ATOM 7149  H HE21 . GLN A 1 57 ? 156.948 -8.122  2.476   1.00 0.00 ? 56 GLN A HE21 5  
ATOM 7150  H HE22 . GLN A 1 57 ? 155.912 -9.236  3.294   1.00 0.00 ? 56 GLN A HE22 5  
ATOM 7151  N N    . ASP A 1 58 ? 161.719 -7.821  4.815   1.00 0.00 ? 57 ASP A N    5  
ATOM 7152  C CA   . ASP A 1 58 ? 162.010 -7.618  6.235   1.00 0.00 ? 57 ASP A CA   5  
ATOM 7153  C C    . ASP A 1 58 ? 161.494 -6.258  6.710   1.00 0.00 ? 57 ASP A C    5  
ATOM 7154  O O    . ASP A 1 58 ? 160.923 -6.146  7.796   1.00 0.00 ? 57 ASP A O    5  
ATOM 7155  C CB   . ASP A 1 58 ? 163.518 -7.723  6.493   1.00 0.00 ? 57 ASP A CB   5  
ATOM 7156  C CG   . ASP A 1 58 ? 163.849 -8.303  7.858   1.00 0.00 ? 57 ASP A CG   5  
ATOM 7157  O OD1  . ASP A 1 58 ? 163.030 -8.151  8.790   1.00 0.00 ? 57 ASP A OD1  5  
ATOM 7158  O OD2  . ASP A 1 58 ? 164.934 -8.906  7.996   1.00 0.00 ? 57 ASP A OD2  5  
ATOM 7159  H H    . ASP A 1 58 ? 162.454 -8.046  4.207   1.00 0.00 ? 57 ASP A H    5  
ATOM 7160  H HA   . ASP A 1 58 ? 161.505 -8.394  6.790   1.00 0.00 ? 57 ASP A HA   5  
ATOM 7161  H HB2  . ASP A 1 58 ? 163.961 -8.359  5.741   1.00 0.00 ? 57 ASP A HB2  5  
ATOM 7162  H HB3  . ASP A 1 58 ? 163.957 -6.738  6.425   1.00 0.00 ? 57 ASP A HB3  5  
ATOM 7163  N N    . ASP A 1 59 ? 161.697 -5.231  5.886   1.00 0.00 ? 58 ASP A N    5  
ATOM 7164  C CA   . ASP A 1 59 ? 161.253 -3.877  6.211   1.00 0.00 ? 58 ASP A CA   5  
ATOM 7165  C C    . ASP A 1 59 ? 159.726 -3.801  6.294   1.00 0.00 ? 58 ASP A C    5  
ATOM 7166  O O    . ASP A 1 59 ? 159.178 -3.229  7.237   1.00 0.00 ? 58 ASP A O    5  
ATOM 7167  C CB   . ASP A 1 59 ? 161.774 -2.888  5.165   1.00 0.00 ? 58 ASP A CB   5  
ATOM 7168  C CG   . ASP A 1 59 ? 162.079 -1.526  5.755   1.00 0.00 ? 58 ASP A CG   5  
ATOM 7169  O OD1  . ASP A 1 59 ? 163.204 -1.339  6.261   1.00 0.00 ? 58 ASP A OD1  5  
ATOM 7170  O OD2  . ASP A 1 59 ? 161.192 -0.650  5.717   1.00 0.00 ? 58 ASP A OD2  5  
ATOM 7171  H H    . ASP A 1 59 ? 162.158 -5.390  5.034   1.00 0.00 ? 58 ASP A H    5  
ATOM 7172  H HA   . ASP A 1 59 ? 161.664 -3.617  7.174   1.00 0.00 ? 58 ASP A HA   5  
ATOM 7173  H HB2  . ASP A 1 59 ? 162.681 -3.281  4.733   1.00 0.00 ? 58 ASP A HB2  5  
ATOM 7174  H HB3  . ASP A 1 59 ? 161.031 -2.769  4.390   1.00 0.00 ? 58 ASP A HB3  5  
ATOM 7175  N N    . LEU A 1 60 ? 159.045 -4.388  5.305   1.00 0.00 ? 59 LEU A N    5  
ATOM 7176  C CA   . LEU A 1 60 ? 157.581 -4.391  5.277   1.00 0.00 ? 59 LEU A CA   5  
ATOM 7177  C C    . LEU A 1 60 ? 157.022 -5.124  6.494   1.00 0.00 ? 59 LEU A C    5  
ATOM 7178  O O    . LEU A 1 60 ? 156.053 -4.675  7.108   1.00 0.00 ? 59 LEU A O    5  
ATOM 7179  C CB   . LEU A 1 60 ? 157.064 -5.052  3.993   1.00 0.00 ? 59 LEU A CB   5  
ATOM 7180  C CG   . LEU A 1 60 ? 155.614 -4.709  3.622   1.00 0.00 ? 59 LEU A CG   5  
ATOM 7181  C CD1  . LEU A 1 60 ? 155.570 -3.541  2.649   1.00 0.00 ? 59 LEU A CD1  5  
ATOM 7182  C CD2  . LEU A 1 60 ? 154.902 -5.921  3.033   1.00 0.00 ? 59 LEU A CD2  5  
ATOM 7183  H H    . LEU A 1 60 ? 159.537 -4.834  4.585   1.00 0.00 ? 59 LEU A H    5  
ATOM 7184  H HA   . LEU A 1 60 ? 157.246 -3.363  5.304   1.00 0.00 ? 59 LEU A HA   5  
ATOM 7185  H HB2  . LEU A 1 60 ? 157.705 -4.751  3.176   1.00 0.00 ? 59 LEU A HB2  5  
ATOM 7186  H HB3  . LEU A 1 60 ? 157.139 -6.122  4.111   1.00 0.00 ? 59 LEU A HB3  5  
ATOM 7187  H HG   . LEU A 1 60 ? 155.085 -4.414  4.517   1.00 0.00 ? 59 LEU A HG   5  
ATOM 7188  H HD11 . LEU A 1 60 ? 155.438 -2.621  3.199   1.00 0.00 ? 59 LEU A HD11 5  
ATOM 7189  H HD12 . LEU A 1 60 ? 154.745 -3.672  1.965   1.00 0.00 ? 59 LEU A HD12 5  
ATOM 7190  H HD13 . LEU A 1 60 ? 156.495 -3.499  2.093   1.00 0.00 ? 59 LEU A HD13 5  
ATOM 7191  H HD21 . LEU A 1 60 ? 154.387 -6.454  3.819   1.00 0.00 ? 59 LEU A HD21 5  
ATOM 7192  H HD22 . LEU A 1 60 ? 155.623 -6.575  2.568   1.00 0.00 ? 59 LEU A HD22 5  
ATOM 7193  H HD23 . LEU A 1 60 ? 154.186 -5.593  2.294   1.00 0.00 ? 59 LEU A HD23 5  
ATOM 7194  N N    . ASP A 1 61 ? 157.647 -6.253  6.837   1.00 0.00 ? 60 ASP A N    5  
ATOM 7195  C CA   . ASP A 1 61 ? 157.221 -7.053  7.983   1.00 0.00 ? 60 ASP A CA   5  
ATOM 7196  C C    . ASP A 1 61 ? 157.337 -6.249  9.277   1.00 0.00 ? 60 ASP A C    5  
ATOM 7197  O O    . ASP A 1 61 ? 156.449 -6.301  10.129  1.00 0.00 ? 60 ASP A O    5  
ATOM 7198  C CB   . ASP A 1 61 ? 158.054 -8.338  8.083   1.00 0.00 ? 60 ASP A CB   5  
ATOM 7199  C CG   . ASP A 1 61 ? 157.395 -9.404  8.945   1.00 0.00 ? 60 ASP A CG   5  
ATOM 7200  O OD1  . ASP A 1 61 ? 156.147 -9.416  9.038   1.00 0.00 ? 60 ASP A OD1  5  
ATOM 7201  O OD2  . ASP A 1 61 ? 158.128 -10.228 9.528   1.00 0.00 ? 60 ASP A OD2  5  
ATOM 7202  H H    . ASP A 1 61 ? 158.416 -6.551  6.305   1.00 0.00 ? 60 ASP A H    5  
ATOM 7203  H HA   . ASP A 1 61 ? 156.186 -7.318  7.831   1.00 0.00 ? 60 ASP A HA   5  
ATOM 7204  H HB2  . ASP A 1 61 ? 158.196 -8.745  7.094   1.00 0.00 ? 60 ASP A HB2  5  
ATOM 7205  H HB3  . ASP A 1 61 ? 159.018 -8.103  8.512   1.00 0.00 ? 60 ASP A HB3  5  
ATOM 7206  N N    . LYS A 1 62 ? 158.433 -5.499  9.410   1.00 0.00 ? 61 LYS A N    5  
ATOM 7207  C CA   . LYS A 1 62 ? 158.664 -4.671  10.592  1.00 0.00 ? 61 LYS A CA   5  
ATOM 7208  C C    . LYS A 1 62 ? 157.602 -3.578  10.706  1.00 0.00 ? 61 LYS A C    5  
ATOM 7209  O O    . LYS A 1 62 ? 157.136 -3.267  11.803  1.00 0.00 ? 61 LYS A O    5  
ATOM 7210  C CB   . LYS A 1 62 ? 160.056 -4.033  10.538  1.00 0.00 ? 61 LYS A CB   5  
ATOM 7211  C CG   . LYS A 1 62 ? 160.682 -3.815  11.908  1.00 0.00 ? 61 LYS A CG   5  
ATOM 7212  C CD   . LYS A 1 62 ? 160.212 -2.512  12.541  1.00 0.00 ? 61 LYS A CD   5  
ATOM 7213  C CE   . LYS A 1 62 ? 161.228 -1.395  12.348  1.00 0.00 ? 61 LYS A CE   5  
ATOM 7214  N NZ   . LYS A 1 62 ? 161.233 -0.874  10.950  1.00 0.00 ? 61 LYS A NZ   5  
ATOM 7215  H H    . LYS A 1 62 ? 159.099 -5.497  8.690   1.00 0.00 ? 61 LYS A H    5  
ATOM 7216  H HA   . LYS A 1 62 ? 158.603 -5.311  11.461  1.00 0.00 ? 61 LYS A HA   5  
ATOM 7217  H HB2  . LYS A 1 62 ? 160.712 -4.673  9.965   1.00 0.00 ? 61 LYS A HB2  5  
ATOM 7218  H HB3  . LYS A 1 62 ? 159.981 -3.076  10.044  1.00 0.00 ? 61 LYS A HB3  5  
ATOM 7219  H HG2  . LYS A 1 62 ? 160.405 -4.636  12.553  1.00 0.00 ? 61 LYS A HG2  5  
ATOM 7220  H HG3  . LYS A 1 62 ? 161.756 -3.786  11.801  1.00 0.00 ? 61 LYS A HG3  5  
ATOM 7221  H HD2  . LYS A 1 62 ? 159.278 -2.217  12.086  1.00 0.00 ? 61 LYS A HD2  5  
ATOM 7222  H HD3  . LYS A 1 62 ? 160.063 -2.672  13.599  1.00 0.00 ? 61 LYS A HD3  5  
ATOM 7223  H HE2  . LYS A 1 62 ? 160.985 -0.586  13.022  1.00 0.00 ? 61 LYS A HE2  5  
ATOM 7224  H HE3  . LYS A 1 62 ? 162.211 -1.775  12.585  1.00 0.00 ? 61 LYS A HE3  5  
ATOM 7225  H HZ1  . LYS A 1 62 ? 161.458 0.141   10.947  1.00 0.00 ? 61 LYS A HZ1  5  
ATOM 7226  H HZ2  . LYS A 1 62 ? 160.300 -1.012  10.511  1.00 0.00 ? 61 LYS A HZ2  5  
ATOM 7227  H HZ3  . LYS A 1 62 ? 161.947 -1.377  10.385  1.00 0.00 ? 61 LYS A HZ3  5  
ATOM 7228  N N    . ALA A 1 63 ? 157.229 -2.998  9.564   1.00 0.00 ? 62 ALA A N    5  
ATOM 7229  C CA   . ALA A 1 63 ? 156.223 -1.938  9.530   1.00 0.00 ? 62 ALA A CA   5  
ATOM 7230  C C    . ALA A 1 63 ? 154.867 -2.443  10.019  1.00 0.00 ? 62 ALA A C    5  
ATOM 7231  O O    . ALA A 1 63 ? 154.146 -1.727  10.717  1.00 0.00 ? 62 ALA A O    5  
ATOM 7232  C CB   . ALA A 1 63 ? 156.100 -1.368  8.124   1.00 0.00 ? 62 ALA A CB   5  
ATOM 7233  H H    . ALA A 1 63 ? 157.640 -3.292  8.724   1.00 0.00 ? 62 ALA A H    5  
ATOM 7234  H HA   . ALA A 1 63 ? 156.556 -1.145  10.185  1.00 0.00 ? 62 ALA A HA   5  
ATOM 7235  H HB1  . ALA A 1 63 ? 156.340 -2.135  7.403   1.00 0.00 ? 62 ALA A HB1  5  
ATOM 7236  H HB2  . ALA A 1 63 ? 156.784 -0.541  8.011   1.00 0.00 ? 62 ALA A HB2  5  
ATOM 7237  H HB3  . ALA A 1 63 ? 155.089 -1.025  7.962   1.00 0.00 ? 62 ALA A HB3  5  
ATOM 7238  N N    . ILE A 1 64 ? 154.527 -3.680  9.656   1.00 0.00 ? 63 ILE A N    5  
ATOM 7239  C CA   . ILE A 1 64 ? 153.258 -4.274  10.068  1.00 0.00 ? 63 ILE A CA   5  
ATOM 7240  C C    . ILE A 1 64 ? 153.210 -4.440  11.585  1.00 0.00 ? 63 ILE A C    5  
ATOM 7241  O O    . ILE A 1 64 ? 152.199 -4.129  12.218  1.00 0.00 ? 63 ILE A O    5  
ATOM 7242  C CB   . ILE A 1 64 ? 153.018 -5.647  9.399   1.00 0.00 ? 63 ILE A CB   5  
ATOM 7243  C CG1  . ILE A 1 64 ? 153.178 -5.539  7.878   1.00 0.00 ? 63 ILE A CG1  5  
ATOM 7244  C CG2  . ILE A 1 64 ? 151.631 -6.174  9.753   1.00 0.00 ? 63 ILE A CG2  5  
ATOM 7245  C CD1  . ILE A 1 64 ? 153.768 -6.778  7.239   1.00 0.00 ? 63 ILE A CD1  5  
ATOM 7246  H H    . ILE A 1 64 ? 155.145 -4.204  9.104   1.00 0.00 ? 63 ILE A H    5  
ATOM 7247  H HA   . ILE A 1 64 ? 152.465 -3.606  9.765   1.00 0.00 ? 63 ILE A HA   5  
ATOM 7248  H HB   . ILE A 1 64 ? 153.749 -6.344  9.783   1.00 0.00 ? 63 ILE A HB   5  
ATOM 7249  H HG12 . ILE A 1 64 ? 152.211 -5.366  7.431   1.00 0.00 ? 63 ILE A HG12 5  
ATOM 7250  H HG13 . ILE A 1 64 ? 153.827 -4.707  7.650   1.00 0.00 ? 63 ILE A HG13 5  
ATOM 7251  H HG21 . ILE A 1 64 ? 151.682 -7.240  9.918   1.00 0.00 ? 63 ILE A HG21 5  
ATOM 7252  H HG22 . ILE A 1 64 ? 150.948 -5.968  8.943   1.00 0.00 ? 63 ILE A HG22 5  
ATOM 7253  H HG23 . ILE A 1 64 ? 151.280 -5.688  10.651  1.00 0.00 ? 63 ILE A HG23 5  
ATOM 7254  H HD11 . ILE A 1 64 ? 154.674 -6.514  6.713   1.00 0.00 ? 63 ILE A HD11 5  
ATOM 7255  H HD12 . ILE A 1 64 ? 153.057 -7.197  6.543   1.00 0.00 ? 63 ILE A HD12 5  
ATOM 7256  H HD13 . ILE A 1 64 ? 153.996 -7.506  8.003   1.00 0.00 ? 63 ILE A HD13 5  
ATOM 7257  N N    . ASP A 1 65 ? 154.312 -4.925  12.161  1.00 0.00 ? 64 ASP A N    5  
ATOM 7258  C CA   . ASP A 1 65 ? 154.402 -5.129  13.605  1.00 0.00 ? 64 ASP A CA   5  
ATOM 7259  C C    . ASP A 1 65 ? 154.107 -3.834  14.362  1.00 0.00 ? 64 ASP A C    5  
ATOM 7260  O O    . ASP A 1 65 ? 153.400 -3.844  15.370  1.00 0.00 ? 64 ASP A O    5  
ATOM 7261  C CB   . ASP A 1 65 ? 155.793 -5.648  13.992  1.00 0.00 ? 64 ASP A CB   5  
ATOM 7262  C CG   . ASP A 1 65 ? 155.755 -6.630  15.152  1.00 0.00 ? 64 ASP A CG   5  
ATOM 7263  O OD1  . ASP A 1 65 ? 154.836 -6.528  15.994  1.00 0.00 ? 64 ASP A OD1  5  
ATOM 7264  O OD2  . ASP A 1 65 ? 156.649 -7.498  15.221  1.00 0.00 ? 64 ASP A OD2  5  
ATOM 7265  H H    . ASP A 1 65 ? 155.085 -5.148  11.599  1.00 0.00 ? 64 ASP A H    5  
ATOM 7266  H HA   . ASP A 1 65 ? 153.664 -5.866  13.878  1.00 0.00 ? 64 ASP A HA   5  
ATOM 7267  H HB2  . ASP A 1 65 ? 156.233 -6.146  13.141  1.00 0.00 ? 64 ASP A HB2  5  
ATOM 7268  H HB3  . ASP A 1 65 ? 156.416 -4.812  14.273  1.00 0.00 ? 64 ASP A HB3  5  
ATOM 7269  N N    . ILE A 1 66 ? 154.651 -2.721  13.868  1.00 0.00 ? 65 ILE A N    5  
ATOM 7270  C CA   . ILE A 1 66 ? 154.443 -1.419  14.499  1.00 0.00 ? 65 ILE A CA   5  
ATOM 7271  C C    . ILE A 1 66 ? 152.979 -0.988  14.403  1.00 0.00 ? 65 ILE A C    5  
ATOM 7272  O O    . ILE A 1 66 ? 152.395 -0.529  15.385  1.00 0.00 ? 65 ILE A O    5  
ATOM 7273  C CB   . ILE A 1 66 ? 155.334 -0.325  13.868  1.00 0.00 ? 65 ILE A CB   5  
ATOM 7274  C CG1  . ILE A 1 66 ? 156.799 -0.772  13.838  1.00 0.00 ? 65 ILE A CG1  5  
ATOM 7275  C CG2  . ILE A 1 66 ? 155.193 0.985   14.634  1.00 0.00 ? 65 ILE A CG2  5  
ATOM 7276  C CD1  . ILE A 1 66 ? 157.616 -0.092  12.761  1.00 0.00 ? 65 ILE A CD1  5  
ATOM 7277  H H    . ILE A 1 66 ? 155.203 -2.778  13.060  1.00 0.00 ? 65 ILE A H    5  
ATOM 7278  H HA   . ILE A 1 66 ? 154.709 -1.511  15.543  1.00 0.00 ? 65 ILE A HA   5  
ATOM 7279  H HB   . ILE A 1 66 ? 154.996 -0.159  12.857  1.00 0.00 ? 65 ILE A HB   5  
ATOM 7280  H HG12 . ILE A 1 66 ? 157.257 -0.550  14.790  1.00 0.00 ? 65 ILE A HG12 5  
ATOM 7281  H HG13 . ILE A 1 66 ? 156.842 -1.837  13.664  1.00 0.00 ? 65 ILE A HG13 5  
ATOM 7282  H HG21 . ILE A 1 66 ? 154.148 1.246   14.711  1.00 0.00 ? 65 ILE A HG21 5  
ATOM 7283  H HG22 . ILE A 1 66 ? 155.721 1.767   14.110  1.00 0.00 ? 65 ILE A HG22 5  
ATOM 7284  H HG23 . ILE A 1 66 ? 155.609 0.870   15.624  1.00 0.00 ? 65 ILE A HG23 5  
ATOM 7285  H HD11 . ILE A 1 66 ? 157.081 0.773   12.396  1.00 0.00 ? 65 ILE A HD11 5  
ATOM 7286  H HD12 . ILE A 1 66 ? 157.783 -0.781  11.946  1.00 0.00 ? 65 ILE A HD12 5  
ATOM 7287  H HD13 . ILE A 1 66 ? 158.565 0.219   13.171  1.00 0.00 ? 65 ILE A HD13 5  
ATOM 7288  N N    . LEU A 1 67 ? 152.394 -1.143  13.215  1.00 0.00 ? 66 LEU A N    5  
ATOM 7289  C CA   . LEU A 1 67 ? 150.997 -0.775  12.991  1.00 0.00 ? 66 LEU A CA   5  
ATOM 7290  C C    . LEU A 1 67 ? 150.074 -1.551  13.930  1.00 0.00 ? 66 LEU A C    5  
ATOM 7291  O O    . LEU A 1 67 ? 149.150 -0.983  14.512  1.00 0.00 ? 66 LEU A O    5  
ATOM 7292  C CB   . LEU A 1 67 ? 150.605 -1.033  11.533  1.00 0.00 ? 66 LEU A CB   5  
ATOM 7293  C CG   . LEU A 1 67 ? 149.382 -0.255  11.039  1.00 0.00 ? 66 LEU A CG   5  
ATOM 7294  C CD1  . LEU A 1 67 ? 149.760 1.177   10.688  1.00 0.00 ? 66 LEU A CD1  5  
ATOM 7295  C CD2  . LEU A 1 67 ? 148.755 -0.953  9.840   1.00 0.00 ? 66 LEU A CD2  5  
ATOM 7296  H H    . LEU A 1 67 ? 152.913 -1.518  12.471  1.00 0.00 ? 66 LEU A H    5  
ATOM 7297  H HA   . LEU A 1 67 ? 150.897 0.281   13.200  1.00 0.00 ? 66 LEU A HA   5  
ATOM 7298  H HB2  . LEU A 1 67 ? 151.447 -0.778  10.906  1.00 0.00 ? 66 LEU A HB2  5  
ATOM 7299  H HB3  . LEU A 1 67 ? 150.402 -2.088  11.421  1.00 0.00 ? 66 LEU A HB3  5  
ATOM 7300  H HG   . LEU A 1 67 ? 148.645 -0.219  11.828  1.00 0.00 ? 66 LEU A HG   5  
ATOM 7301  H HD11 . LEU A 1 67 ? 150.728 1.188   10.207  1.00 0.00 ? 66 LEU A HD11 5  
ATOM 7302  H HD12 . LEU A 1 67 ? 149.800 1.770   11.590  1.00 0.00 ? 66 LEU A HD12 5  
ATOM 7303  H HD13 . LEU A 1 67 ? 149.021 1.592   10.018  1.00 0.00 ? 66 LEU A HD13 5  
ATOM 7304  H HD21 . LEU A 1 67 ? 147.858 -0.427  9.546   1.00 0.00 ? 66 LEU A HD21 5  
ATOM 7305  H HD22 . LEU A 1 67 ? 148.505 -1.970  10.104  1.00 0.00 ? 66 LEU A HD22 5  
ATOM 7306  H HD23 . LEU A 1 67 ? 149.455 -0.957  9.018   1.00 0.00 ? 66 LEU A HD23 5  
ATOM 7307  N N    . ASP A 1 68 ? 150.338 -2.851  14.077  1.00 0.00 ? 67 ASP A N    5  
ATOM 7308  C CA   . ASP A 1 68 ? 149.534 -3.705  14.951  1.00 0.00 ? 67 ASP A CA   5  
ATOM 7309  C C    . ASP A 1 68 ? 149.756 -3.349  16.422  1.00 0.00 ? 67 ASP A C    5  
ATOM 7310  O O    . ASP A 1 68 ? 148.822 -3.388  17.224  1.00 0.00 ? 67 ASP A O    5  
ATOM 7311  C CB   . ASP A 1 68 ? 149.869 -5.181  14.716  1.00 0.00 ? 67 ASP A CB   5  
ATOM 7312  C CG   . ASP A 1 68 ? 148.718 -6.101  15.081  1.00 0.00 ? 67 ASP A CG   5  
ATOM 7313  O OD1  . ASP A 1 68 ? 147.719 -6.128  14.331  1.00 0.00 ? 67 ASP A OD1  5  
ATOM 7314  O OD2  . ASP A 1 68 ? 148.816 -6.794  16.115  1.00 0.00 ? 67 ASP A OD2  5  
ATOM 7315  H H    . ASP A 1 68 ? 151.093 -3.244  13.588  1.00 0.00 ? 67 ASP A H    5  
ATOM 7316  H HA   . ASP A 1 68 ? 148.495 -3.540  14.708  1.00 0.00 ? 67 ASP A HA   5  
ATOM 7317  H HB2  . ASP A 1 68 ? 150.108 -5.329  13.674  1.00 0.00 ? 67 ASP A HB2  5  
ATOM 7318  H HB3  . ASP A 1 68 ? 150.725 -5.450  15.319  1.00 0.00 ? 67 ASP A HB3  5  
ATOM 7319  N N    . ARG A 1 69 ? 150.996 -2.998  16.767  1.00 0.00 ? 68 ARG A N    5  
ATOM 7320  C CA   . ARG A 1 69 ? 151.342 -2.628  18.141  1.00 0.00 ? 68 ARG A CA   5  
ATOM 7321  C C    . ARG A 1 69 ? 150.596 -1.362  18.581  1.00 0.00 ? 68 ARG A C    5  
ATOM 7322  O O    . ARG A 1 69 ? 150.355 -1.161  19.772  1.00 0.00 ? 68 ARG A O    5  
ATOM 7323  C CB   . ARG A 1 69 ? 152.856 -2.414  18.268  1.00 0.00 ? 68 ARG A CB   5  
ATOM 7324  C CG   . ARG A 1 69 ? 153.438 -2.900  19.588  1.00 0.00 ? 68 ARG A CG   5  
ATOM 7325  C CD   . ARG A 1 69 ? 154.675 -3.762  19.372  1.00 0.00 ? 68 ARG A CD   5  
ATOM 7326  N NE   . ARG A 1 69 ? 155.154 -4.358  20.619  1.00 0.00 ? 68 ARG A NE   5  
ATOM 7327  C CZ   . ARG A 1 69 ? 155.864 -3.702  21.542  1.00 0.00 ? 68 ARG A CZ   5  
ATOM 7328  N NH1  . ARG A 1 69 ? 156.184 -2.421  21.364  1.00 0.00 ? 68 ARG A NH1  5  
ATOM 7329  N NH2  . ARG A 1 69 ? 156.257 -4.329  22.645  1.00 0.00 ? 68 ARG A NH2  5  
ATOM 7330  H H    . ARG A 1 69 ? 151.697 -2.986  16.081  1.00 0.00 ? 68 ARG A H    5  
ATOM 7331  H HA   . ARG A 1 69 ? 151.049 -3.445  18.785  1.00 0.00 ? 68 ARG A HA   5  
ATOM 7332  H HB2  . ARG A 1 69 ? 153.350 -2.942  17.466  1.00 0.00 ? 68 ARG A HB2  5  
ATOM 7333  H HB3  . ARG A 1 69 ? 153.066 -1.359  18.175  1.00 0.00 ? 68 ARG A HB3  5  
ATOM 7334  H HG2  . ARG A 1 69 ? 153.710 -2.044  20.185  1.00 0.00 ? 68 ARG A HG2  5  
ATOM 7335  H HG3  . ARG A 1 69 ? 152.691 -3.482  20.109  1.00 0.00 ? 68 ARG A HG3  5  
ATOM 7336  H HD2  . ARG A 1 69 ? 154.430 -4.552  18.677  1.00 0.00 ? 68 ARG A HD2  5  
ATOM 7337  H HD3  . ARG A 1 69 ? 155.457 -3.147  18.954  1.00 0.00 ? 68 ARG A HD3  5  
ATOM 7338  H HE   . ARG A 1 69 ? 154.936 -5.302  20.779  1.00 0.00 ? 68 ARG A HE   5  
ATOM 7339  H HH11 . ARG A 1 69 ? 155.894 -1.941  20.537  1.00 0.00 ? 68 ARG A HH11 5  
ATOM 7340  H HH12 . ARG A 1 69 ? 156.716 -1.937  22.060  1.00 0.00 ? 68 ARG A HH12 5  
ATOM 7341  H HH21 . ARG A 1 69 ? 156.021 -5.291  22.785  1.00 0.00 ? 68 ARG A HH21 5  
ATOM 7342  H HH22 . ARG A 1 69 ? 156.788 -3.841  23.338  1.00 0.00 ? 68 ARG A HH22 5  
ATOM 7343  N N    . SER A 1 70 ? 150.235 -0.512  17.613  1.00 0.00 ? 69 SER A N    5  
ATOM 7344  C CA   . SER A 1 70 ? 149.520 0.733   17.902  1.00 0.00 ? 69 SER A CA   5  
ATOM 7345  C C    . SER A 1 70 ? 148.155 0.458   18.537  1.00 0.00 ? 69 SER A C    5  
ATOM 7346  O O    . SER A 1 70 ? 147.650 -0.664  18.490  1.00 0.00 ? 69 SER A O    5  
ATOM 7347  C CB   . SER A 1 70 ? 149.339 1.550   16.617  1.00 0.00 ? 69 SER A CB   5  
ATOM 7348  O OG   . SER A 1 70 ? 148.616 2.746   16.863  1.00 0.00 ? 69 SER A OG   5  
ATOM 7349  H H    . SER A 1 70 ? 150.458 -0.726  16.683  1.00 0.00 ? 69 SER A H    5  
ATOM 7350  H HA   . SER A 1 70 ? 150.118 1.303   18.596  1.00 0.00 ? 69 SER A HA   5  
ATOM 7351  H HB2  . SER A 1 70 ? 150.309 1.807   16.219  1.00 0.00 ? 69 SER A HB2  5  
ATOM 7352  H HB3  . SER A 1 70 ? 148.799 0.959   15.893  1.00 0.00 ? 69 SER A HB3  5  
ATOM 7353  H HG   . SER A 1 70 ? 149.170 3.504   16.663  1.00 0.00 ? 69 SER A HG   5  
ATOM 7354  N N    . SER A 1 71 ? 147.560 1.498   19.125  1.00 0.00 ? 70 SER A N    5  
ATOM 7355  C CA   . SER A 1 71 ? 146.251 1.379   19.765  1.00 0.00 ? 70 SER A CA   5  
ATOM 7356  C C    . SER A 1 71 ? 145.167 1.031   18.745  1.00 0.00 ? 70 SER A C    5  
ATOM 7357  O O    . SER A 1 71 ? 144.284 0.216   19.021  1.00 0.00 ? 70 SER A O    5  
ATOM 7358  C CB   . SER A 1 71 ? 145.888 2.680   20.490  1.00 0.00 ? 70 SER A CB   5  
ATOM 7359  O OG   . SER A 1 71 ? 146.438 3.810   19.831  1.00 0.00 ? 70 SER A OG   5  
ATOM 7360  H H    . SER A 1 71 ? 148.011 2.369   19.122  1.00 0.00 ? 70 SER A H    5  
ATOM 7361  H HA   . SER A 1 71 ? 146.312 0.582   20.491  1.00 0.00 ? 70 SER A HA   5  
ATOM 7362  H HB2  . SER A 1 71 ? 144.813 2.784   20.520  1.00 0.00 ? 70 SER A HB2  5  
ATOM 7363  H HB3  . SER A 1 71 ? 146.273 2.644   21.499  1.00 0.00 ? 70 SER A HB3  5  
ATOM 7364  H HG   . SER A 1 71 ? 145.837 4.107   19.144  1.00 0.00 ? 70 SER A HG   5  
ATOM 7365  N N    . SER A 1 72 ? 145.236 1.652   17.568  1.00 0.00 ? 71 SER A N    5  
ATOM 7366  C CA   . SER A 1 72 ? 144.257 1.402   16.513  1.00 0.00 ? 71 SER A CA   5  
ATOM 7367  C C    . SER A 1 72 ? 144.759 1.909   15.160  1.00 0.00 ? 71 SER A C    5  
ATOM 7368  O O    . SER A 1 72 ? 144.966 1.122   14.236  1.00 0.00 ? 71 SER A O    5  
ATOM 7369  C CB   . SER A 1 72 ? 142.918 2.062   16.859  1.00 0.00 ? 71 SER A CB   5  
ATOM 7370  O OG   . SER A 1 72 ? 143.101 3.405   17.279  1.00 0.00 ? 71 SER A OG   5  
ATOM 7371  H H    . SER A 1 72 ? 145.959 2.293   17.405  1.00 0.00 ? 71 SER A H    5  
ATOM 7372  H HA   . SER A 1 72 ? 144.112 0.334   16.449  1.00 0.00 ? 71 SER A HA   5  
ATOM 7373  H HB2  . SER A 1 72 ? 142.281 2.055   15.986  1.00 0.00 ? 71 SER A HB2  5  
ATOM 7374  H HB3  . SER A 1 72 ? 142.442 1.510   17.655  1.00 0.00 ? 71 SER A HB3  5  
ATOM 7375  H HG   . SER A 1 72 ? 143.328 3.422   18.213  1.00 0.00 ? 71 SER A HG   5  
ATOM 7376  N N    . MET A 1 73 ? 144.949 3.228   15.052  1.00 0.00 ? 72 MET A N    5  
ATOM 7377  C CA   . MET A 1 73 ? 145.423 3.846   13.811  1.00 0.00 ? 72 MET A CA   5  
ATOM 7378  C C    . MET A 1 73 ? 144.418 3.640   12.672  1.00 0.00 ? 72 MET A C    5  
ATOM 7379  O O    . MET A 1 73 ? 143.345 3.067   12.875  1.00 0.00 ? 72 MET A O    5  
ATOM 7380  C CB   . MET A 1 73 ? 146.796 3.282   13.422  1.00 0.00 ? 72 MET A CB   5  
ATOM 7381  C CG   . MET A 1 73 ? 147.758 4.332   12.884  1.00 0.00 ? 72 MET A CG   5  
ATOM 7382  S SD   . MET A 1 73 ? 149.463 4.042   13.393  1.00 0.00 ? 72 MET A SD   5  
ATOM 7383  C CE   . MET A 1 73 ? 150.343 5.053   12.205  1.00 0.00 ? 72 MET A CE   5  
ATOM 7384  H H    . MET A 1 73 ? 144.762 3.800   15.825  1.00 0.00 ? 72 MET A H    5  
ATOM 7385  H HA   . MET A 1 73 ? 145.521 4.907   13.992  1.00 0.00 ? 72 MET A HA   5  
ATOM 7386  H HB2  . MET A 1 73 ? 147.246 2.827   14.293  1.00 0.00 ? 72 MET A HB2  5  
ATOM 7387  H HB3  . MET A 1 73 ? 146.662 2.526   12.662  1.00 0.00 ? 72 MET A HB3  5  
ATOM 7388  H HG2  . MET A 1 73 ? 147.714 4.323   11.805  1.00 0.00 ? 72 MET A HG2  5  
ATOM 7389  H HG3  . MET A 1 73 ? 147.449 5.302   13.246  1.00 0.00 ? 72 MET A HG3  5  
ATOM 7390  H HE1  . MET A 1 73 ? 149.634 5.546   11.557  1.00 0.00 ? 72 MET A HE1  5  
ATOM 7391  H HE2  . MET A 1 73 ? 150.995 4.427   11.614  1.00 0.00 ? 72 MET A HE2  5  
ATOM 7392  H HE3  . MET A 1 73 ? 150.930 5.794   12.728  1.00 0.00 ? 72 MET A HE3  5  
ATOM 7393  N N    . LYS A 1 74 ? 144.768 4.119   11.476  1.00 0.00 ? 73 LYS A N    5  
ATOM 7394  C CA   . LYS A 1 74 ? 143.895 3.993   10.311  1.00 0.00 ? 73 LYS A CA   5  
ATOM 7395  C C    . LYS A 1 74 ? 144.712 3.974   9.021   1.00 0.00 ? 73 LYS A C    5  
ATOM 7396  O O    . LYS A 1 74 ? 145.366 4.961   8.680   1.00 0.00 ? 73 LYS A O    5  
ATOM 7397  C CB   . LYS A 1 74 ? 142.893 5.150   10.277  1.00 0.00 ? 73 LYS A CB   5  
ATOM 7398  C CG   . LYS A 1 74 ? 141.569 4.833   10.954  1.00 0.00 ? 73 LYS A CG   5  
ATOM 7399  C CD   . LYS A 1 74 ? 140.394 5.386   10.162  1.00 0.00 ? 73 LYS A CD   5  
ATOM 7400  C CE   . LYS A 1 74 ? 139.155 5.543   11.031  1.00 0.00 ? 73 LYS A CE   5  
ATOM 7401  N NZ   . LYS A 1 74 ? 138.257 4.357   10.945  1.00 0.00 ? 73 LYS A NZ   5  
ATOM 7402  H H    . LYS A 1 74 ? 145.630 4.572   11.375  1.00 0.00 ? 73 LYS A H    5  
ATOM 7403  H HA   . LYS A 1 74 ? 143.356 3.061   10.398  1.00 0.00 ? 73 LYS A HA   5  
ATOM 7404  H HB2  . LYS A 1 74 ? 143.331 6.003   10.776  1.00 0.00 ? 73 LYS A HB2  5  
ATOM 7405  H HB3  . LYS A 1 74 ? 142.695 5.409   9.248   1.00 0.00 ? 73 LYS A HB3  5  
ATOM 7406  H HG2  . LYS A 1 74 ? 141.463 3.762   11.035  1.00 0.00 ? 73 LYS A HG2  5  
ATOM 7407  H HG3  . LYS A 1 74 ? 141.566 5.273   11.941  1.00 0.00 ? 73 LYS A HG3  5  
ATOM 7408  H HD2  . LYS A 1 74 ? 140.665 6.353   9.763   1.00 0.00 ? 73 LYS A HD2  5  
ATOM 7409  H HD3  . LYS A 1 74 ? 140.171 4.710   9.350   1.00 0.00 ? 73 LYS A HD3  5  
ATOM 7410  H HE2  . LYS A 1 74 ? 139.464 5.675   12.057  1.00 0.00 ? 73 LYS A HE2  5  
ATOM 7411  H HE3  . LYS A 1 74 ? 138.612 6.419   10.705  1.00 0.00 ? 73 LYS A HE3  5  
ATOM 7412  H HZ1  . LYS A 1 74 ? 138.698 3.539   11.412  1.00 0.00 ? 73 LYS A HZ1  5  
ATOM 7413  H HZ2  . LYS A 1 74 ? 138.075 4.116   9.949   1.00 0.00 ? 73 LYS A HZ2  5  
ATOM 7414  H HZ3  . LYS A 1 74 ? 137.350 4.561   11.411  1.00 0.00 ? 73 LYS A HZ3  5  
ATOM 7415  N N    . SER A 1 75 ? 144.669 2.844   8.309   1.00 0.00 ? 74 SER A N    5  
ATOM 7416  C CA   . SER A 1 75 ? 145.408 2.691   7.054   1.00 0.00 ? 74 SER A CA   5  
ATOM 7417  C C    . SER A 1 75 ? 146.918 2.767   7.295   1.00 0.00 ? 74 SER A C    5  
ATOM 7418  O O    . SER A 1 75 ? 147.374 2.790   8.441   1.00 0.00 ? 74 SER A O    5  
ATOM 7419  C CB   . SER A 1 75 ? 144.980 3.766   6.049   1.00 0.00 ? 74 SER A CB   5  
ATOM 7420  O OG   . SER A 1 75 ? 144.994 3.266   4.721   1.00 0.00 ? 74 SER A OG   5  
ATOM 7421  H H    . SER A 1 75 ? 144.129 2.094   8.636   1.00 0.00 ? 74 SER A H    5  
ATOM 7422  H HA   . SER A 1 75 ? 145.171 1.718   6.650   1.00 0.00 ? 74 SER A HA   5  
ATOM 7423  H HB2  . SER A 1 75 ? 143.979 4.098   6.284   1.00 0.00 ? 74 SER A HB2  5  
ATOM 7424  H HB3  . SER A 1 75 ? 145.658 4.604   6.112   1.00 0.00 ? 74 SER A HB3  5  
ATOM 7425  H HG   . SER A 1 75 ? 144.107 3.298   4.358   1.00 0.00 ? 74 SER A HG   5  
ATOM 7426  N N    . LEU A 1 76 ? 147.690 2.802   6.209   1.00 0.00 ? 75 LEU A N    5  
ATOM 7427  C CA   . LEU A 1 76 ? 149.145 2.876   6.303   1.00 0.00 ? 75 LEU A CA   5  
ATOM 7428  C C    . LEU A 1 76 ? 149.678 4.066   5.508   1.00 0.00 ? 75 LEU A C    5  
ATOM 7429  O O    . LEU A 1 76 ? 149.385 4.205   4.319   1.00 0.00 ? 75 LEU A O    5  
ATOM 7430  C CB   . LEU A 1 76 ? 149.779 1.577   5.792   1.00 0.00 ? 75 LEU A CB   5  
ATOM 7431  C CG   . LEU A 1 76 ? 149.688 0.385   6.752   1.00 0.00 ? 75 LEU A CG   5  
ATOM 7432  C CD1  . LEU A 1 76 ? 148.269 -0.163  6.801   1.00 0.00 ? 75 LEU A CD1  5  
ATOM 7433  C CD2  . LEU A 1 76 ? 150.667 -0.707  6.342   1.00 0.00 ? 75 LEU A CD2  5  
ATOM 7434  H H    . LEU A 1 76 ? 147.272 2.778   5.324   1.00 0.00 ? 75 LEU A H    5  
ATOM 7435  H HA   . LEU A 1 76 ? 149.405 3.009   7.343   1.00 0.00 ? 75 LEU A HA   5  
ATOM 7436  H HB2  . LEU A 1 76 ? 149.295 1.305   4.864   1.00 0.00 ? 75 LEU A HB2  5  
ATOM 7437  H HB3  . LEU A 1 76 ? 150.822 1.768   5.590   1.00 0.00 ? 75 LEU A HB3  5  
ATOM 7438  H HG   . LEU A 1 76 ? 149.952 0.713   7.747   1.00 0.00 ? 75 LEU A HG   5  
ATOM 7439  H HD11 . LEU A 1 76 ? 147.784 0.005   5.852   1.00 0.00 ? 75 LEU A HD11 5  
ATOM 7440  H HD12 . LEU A 1 76 ? 147.717 0.339   7.582   1.00 0.00 ? 75 LEU A HD12 5  
ATOM 7441  H HD13 . LEU A 1 76 ? 148.299 -1.223  7.007   1.00 0.00 ? 75 LEU A HD13 5  
ATOM 7442  H HD21 . LEU A 1 76 ? 151.643 -0.274  6.180   1.00 0.00 ? 75 LEU A HD21 5  
ATOM 7443  H HD22 . LEU A 1 76 ? 150.325 -1.173  5.430   1.00 0.00 ? 75 LEU A HD22 5  
ATOM 7444  H HD23 . LEU A 1 76 ? 150.727 -1.448  7.124   1.00 0.00 ? 75 LEU A HD23 5  
ATOM 7445  N N    . ARG A 1 77 ? 150.460 4.923   6.169   1.00 0.00 ? 76 ARG A N    5  
ATOM 7446  C CA   . ARG A 1 77 ? 151.027 6.098   5.513   1.00 0.00 ? 76 ARG A CA   5  
ATOM 7447  C C    . ARG A 1 77 ? 152.340 5.745   4.820   1.00 0.00 ? 76 ARG A C    5  
ATOM 7448  O O    . ARG A 1 77 ? 153.363 5.526   5.474   1.00 0.00 ? 76 ARG A O    5  
ATOM 7449  C CB   . ARG A 1 77 ? 151.252 7.228   6.527   1.00 0.00 ? 76 ARG A CB   5  
ATOM 7450  C CG   . ARG A 1 77 ? 151.329 8.610   5.894   1.00 0.00 ? 76 ARG A CG   5  
ATOM 7451  C CD   . ARG A 1 77 ? 151.496 9.702   6.943   1.00 0.00 ? 76 ARG A CD   5  
ATOM 7452  N NE   . ARG A 1 77 ? 150.225 10.348  7.274   1.00 0.00 ? 76 ARG A NE   5  
ATOM 7453  C CZ   . ARG A 1 77 ? 150.122 11.534  7.882   1.00 0.00 ? 76 ARG A CZ   5  
ATOM 7454  N NH1  . ARG A 1 77 ? 151.213 12.207  8.240   1.00 0.00 ? 76 ARG A NH1  5  
ATOM 7455  N NH2  . ARG A 1 77 ? 148.924 12.047  8.136   1.00 0.00 ? 76 ARG A NH2  5  
ATOM 7456  H H    . ARG A 1 77 ? 150.659 4.759   7.115   1.00 0.00 ? 76 ARG A H    5  
ATOM 7457  H HA   . ARG A 1 77 ? 150.321 6.432   4.766   1.00 0.00 ? 76 ARG A HA   5  
ATOM 7458  H HB2  . ARG A 1 77 ? 150.437 7.226   7.236   1.00 0.00 ? 76 ARG A HB2  5  
ATOM 7459  H HB3  . ARG A 1 77 ? 152.177 7.045   7.054   1.00 0.00 ? 76 ARG A HB3  5  
ATOM 7460  H HG2  . ARG A 1 77 ? 152.175 8.641   5.223   1.00 0.00 ? 76 ARG A HG2  5  
ATOM 7461  H HG3  . ARG A 1 77 ? 150.421 8.793   5.339   1.00 0.00 ? 76 ARG A HG3  5  
ATOM 7462  H HD2  . ARG A 1 77 ? 151.911 9.264   7.839   1.00 0.00 ? 76 ARG A HD2  5  
ATOM 7463  H HD3  . ARG A 1 77 ? 152.178 10.447  6.559   1.00 0.00 ? 76 ARG A HD3  5  
ATOM 7464  H HE   . ARG A 1 77 ? 149.402 9.874   7.029   1.00 0.00 ? 76 ARG A HE   5  
ATOM 7465  H HH11 . ARG A 1 77 ? 152.120 11.829  8.057   1.00 0.00 ? 76 ARG A HH11 5  
ATOM 7466  H HH12 . ARG A 1 77 ? 151.127 13.095  8.693   1.00 0.00 ? 76 ARG A HH12 5  
ATOM 7467  H HH21 . ARG A 1 77 ? 148.099 11.547  7.873   1.00 0.00 ? 76 ARG A HH21 5  
ATOM 7468  H HH22 . ARG A 1 77 ? 148.846 12.936  8.590   1.00 0.00 ? 76 ARG A HH22 5  
ATOM 7469  N N    . ILE A 1 78 ? 152.299 5.686   3.491   1.00 0.00 ? 77 ILE A N    5  
ATOM 7470  C CA   . ILE A 1 78 ? 153.477 5.357   2.697   1.00 0.00 ? 77 ILE A CA   5  
ATOM 7471  C C    . ILE A 1 78 ? 153.708 6.407   1.612   1.00 0.00 ? 77 ILE A C    5  
ATOM 7472  O O    . ILE A 1 78 ? 152.783 6.774   0.886   1.00 0.00 ? 77 ILE A O    5  
ATOM 7473  C CB   . ILE A 1 78 ? 153.341 3.965   2.039   1.00 0.00 ? 77 ILE A CB   5  
ATOM 7474  C CG1  . ILE A 1 78 ? 152.991 2.903   3.088   1.00 0.00 ? 77 ILE A CG1  5  
ATOM 7475  C CG2  . ILE A 1 78 ? 154.624 3.587   1.308   1.00 0.00 ? 77 ILE A CG2  5  
ATOM 7476  C CD1  . ILE A 1 78 ? 152.104 1.798   2.555   1.00 0.00 ? 77 ILE A CD1  5  
ATOM 7477  H H    . ILE A 1 78 ? 151.453 5.867   3.031   1.00 0.00 ? 77 ILE A H    5  
ATOM 7478  H HA   . ILE A 1 78 ? 154.332 5.340   3.359   1.00 0.00 ? 77 ILE A HA   5  
ATOM 7479  H HB   . ILE A 1 78 ? 152.545 4.014   1.310   1.00 0.00 ? 77 ILE A HB   5  
ATOM 7480  H HG12 . ILE A 1 78 ? 153.901 2.450   3.451   1.00 0.00 ? 77 ILE A HG12 5  
ATOM 7481  H HG13 . ILE A 1 78 ? 152.475 3.374   3.911   1.00 0.00 ? 77 ILE A HG13 5  
ATOM 7482  H HG21 . ILE A 1 78 ? 154.543 3.872   0.270   1.00 0.00 ? 77 ILE A HG21 5  
ATOM 7483  H HG22 . ILE A 1 78 ? 154.777 2.521   1.378   1.00 0.00 ? 77 ILE A HG22 5  
ATOM 7484  H HG23 . ILE A 1 78 ? 155.460 4.101   1.758   1.00 0.00 ? 77 ILE A HG23 5  
ATOM 7485  H HD11 . ILE A 1 78 ? 152.334 1.622   1.515   1.00 0.00 ? 77 ILE A HD11 5  
ATOM 7486  H HD12 . ILE A 1 78 ? 151.069 2.091   2.650   1.00 0.00 ? 77 ILE A HD12 5  
ATOM 7487  H HD13 . ILE A 1 78 ? 152.277 0.894   3.120   1.00 0.00 ? 77 ILE A HD13 5  
ATOM 7488  N N    . LEU A 1 79 ? 154.947 6.884   1.510   1.00 0.00 ? 78 LEU A N    5  
ATOM 7489  C CA   . LEU A 1 79 ? 155.303 7.890   0.515   1.00 0.00 ? 78 LEU A CA   5  
ATOM 7490  C C    . LEU A 1 79 ? 156.027 7.245   -0.663  1.00 0.00 ? 78 LEU A C    5  
ATOM 7491  O O    . LEU A 1 79 ? 156.989 6.497   -0.477  1.00 0.00 ? 78 LEU A O    5  
ATOM 7492  C CB   . LEU A 1 79 ? 156.183 8.976   1.142   1.00 0.00 ? 78 LEU A CB   5  
ATOM 7493  C CG   . LEU A 1 79 ? 155.428 10.161  1.758   1.00 0.00 ? 78 LEU A CG   5  
ATOM 7494  C CD1  . LEU A 1 79 ? 154.488 10.790  0.739   1.00 0.00 ? 78 LEU A CD1  5  
ATOM 7495  C CD2  . LEU A 1 79 ? 154.661 9.723   2.999   1.00 0.00 ? 78 LEU A CD2  5  
ATOM 7496  H H    . LEU A 1 79 ? 155.640 6.549   2.119   1.00 0.00 ? 78 LEU A H    5  
ATOM 7497  H HA   . LEU A 1 79 ? 154.388 8.341   0.157   1.00 0.00 ? 78 LEU A HA   5  
ATOM 7498  H HB2  . LEU A 1 79 ? 156.784 8.519   1.916   1.00 0.00 ? 78 LEU A HB2  5  
ATOM 7499  H HB3  . LEU A 1 79 ? 156.843 9.358   0.379   1.00 0.00 ? 78 LEU A HB3  5  
ATOM 7500  H HG   . LEU A 1 79 ? 156.143 10.913  2.056   1.00 0.00 ? 78 LEU A HG   5  
ATOM 7501  H HD11 . LEU A 1 79 ? 153.497 10.377  0.858   1.00 0.00 ? 78 LEU A HD11 5  
ATOM 7502  H HD12 . LEU A 1 79 ? 154.846 10.584  -0.259  1.00 0.00 ? 78 LEU A HD12 5  
ATOM 7503  H HD13 . LEU A 1 79 ? 154.453 11.859  0.894   1.00 0.00 ? 78 LEU A HD13 5  
ATOM 7504  H HD21 . LEU A 1 79 ? 154.202 8.763   2.820   1.00 0.00 ? 78 LEU A HD21 5  
ATOM 7505  H HD22 . LEU A 1 79 ? 153.896 10.452  3.225   1.00 0.00 ? 78 LEU A HD22 5  
ATOM 7506  H HD23 . LEU A 1 79 ? 155.342 9.647   3.834   1.00 0.00 ? 78 LEU A HD23 5  
ATOM 7507  N N    . LEU A 1 80 ? 155.553 7.535   -1.872  1.00 0.00 ? 79 LEU A N    5  
ATOM 7508  C CA   . LEU A 1 80 ? 156.148 6.979   -3.085  1.00 0.00 ? 79 LEU A CA   5  
ATOM 7509  C C    . LEU A 1 80 ? 157.182 7.934   -3.675  1.00 0.00 ? 79 LEU A C    5  
ATOM 7510  O O    . LEU A 1 80 ? 156.932 9.135   -3.798  1.00 0.00 ? 79 LEU A O    5  
ATOM 7511  C CB   . LEU A 1 80 ? 155.061 6.679   -4.121  1.00 0.00 ? 79 LEU A CB   5  
ATOM 7512  C CG   . LEU A 1 80 ? 153.800 6.013   -3.566  1.00 0.00 ? 79 LEU A CG   5  
ATOM 7513  C CD1  . LEU A 1 80 ? 152.570 6.475   -4.332  1.00 0.00 ? 79 LEU A CD1  5  
ATOM 7514  C CD2  . LEU A 1 80 ? 153.931 4.497   -3.621  1.00 0.00 ? 79 LEU A CD2  5  
ATOM 7515  H H    . LEU A 1 80 ? 154.780 8.134   -1.951  1.00 0.00 ? 79 LEU A H    5  
ATOM 7516  H HA   . LEU A 1 80 ? 156.641 6.055   -2.818  1.00 0.00 ? 79 LEU A HA   5  
ATOM 7517  H HB2  . LEU A 1 80 ? 154.776 7.610   -4.591  1.00 0.00 ? 79 LEU A HB2  5  
ATOM 7518  H HB3  . LEU A 1 80 ? 155.482 6.030   -4.873  1.00 0.00 ? 79 LEU A HB3  5  
ATOM 7519  H HG   . LEU A 1 80 ? 153.674 6.300   -2.532  1.00 0.00 ? 79 LEU A HG   5  
ATOM 7520  H HD11 . LEU A 1 80 ? 152.179 7.374   -3.877  1.00 0.00 ? 79 LEU A HD11 5  
ATOM 7521  H HD12 . LEU A 1 80 ? 151.817 5.702   -4.305  1.00 0.00 ? 79 LEU A HD12 5  
ATOM 7522  H HD13 . LEU A 1 80 ? 152.840 6.680   -5.358  1.00 0.00 ? 79 LEU A HD13 5  
ATOM 7523  H HD21 . LEU A 1 80 ? 154.636 4.223   -4.392  1.00 0.00 ? 79 LEU A HD21 5  
ATOM 7524  H HD22 . LEU A 1 80 ? 152.969 4.059   -3.840  1.00 0.00 ? 79 LEU A HD22 5  
ATOM 7525  H HD23 . LEU A 1 80 ? 154.283 4.133   -2.667  1.00 0.00 ? 79 LEU A HD23 5  
ATOM 7526  N N    . LEU A 1 81 ? 158.344 7.392   -4.039  1.00 0.00 ? 80 LEU A N    5  
ATOM 7527  C CA   . LEU A 1 81 ? 159.421 8.193   -4.615  1.00 0.00 ? 80 LEU A CA   5  
ATOM 7528  C C    . LEU A 1 81 ? 160.038 7.497   -5.826  1.00 0.00 ? 80 LEU A C    5  
ATOM 7529  O O    . LEU A 1 81 ? 160.166 6.271   -5.853  1.00 0.00 ? 80 LEU A O    5  
ATOM 7530  C CB   . LEU A 1 81 ? 160.501 8.464   -3.563  1.00 0.00 ? 80 LEU A CB   5  
ATOM 7531  C CG   . LEU A 1 81 ? 160.012 9.177   -2.300  1.00 0.00 ? 80 LEU A CG   5  
ATOM 7532  C CD1  . LEU A 1 81 ? 160.855 8.775   -1.098  1.00 0.00 ? 80 LEU A CD1  5  
ATOM 7533  C CD2  . LEU A 1 81 ? 160.041 10.686  -2.497  1.00 0.00 ? 80 LEU A CD2  5  
ATOM 7534  H H    . LEU A 1 81 ? 158.482 6.429   -3.914  1.00 0.00 ? 80 LEU A H    5  
ATOM 7535  H HA   . LEU A 1 81 ? 159.000 9.134   -4.934  1.00 0.00 ? 80 LEU A HA   5  
ATOM 7536  H HB2  . LEU A 1 81 ? 160.937 7.519   -3.273  1.00 0.00 ? 80 LEU A HB2  5  
ATOM 7537  H HB3  . LEU A 1 81 ? 161.270 9.072   -4.017  1.00 0.00 ? 80 LEU A HB3  5  
ATOM 7538  H HG   . LEU A 1 81 ? 158.991 8.885   -2.101  1.00 0.00 ? 80 LEU A HG   5  
ATOM 7539  H HD11 . LEU A 1 81 ? 160.226 8.707   -0.223  1.00 0.00 ? 80 LEU A HD11 5  
ATOM 7540  H HD12 . LEU A 1 81 ? 161.623 9.517   -0.932  1.00 0.00 ? 80 LEU A HD12 5  
ATOM 7541  H HD13 . LEU A 1 81 ? 161.316 7.818   -1.286  1.00 0.00 ? 80 LEU A HD13 5  
ATOM 7542  H HD21 . LEU A 1 81 ? 159.284 10.970  -3.213  1.00 0.00 ? 80 LEU A HD21 5  
ATOM 7543  H HD22 . LEU A 1 81 ? 161.012 10.983  -2.864  1.00 0.00 ? 80 LEU A HD22 5  
ATOM 7544  H HD23 . LEU A 1 81 ? 159.847 11.177  -1.555  1.00 0.00 ? 80 LEU A HD23 5  
ATOM 7545  N N    . SER A 1 82 ? 160.421 8.290   -6.825  1.00 0.00 ? 81 SER A N    5  
ATOM 7546  C CA   . SER A 1 82 ? 161.028 7.756   -8.040  1.00 0.00 ? 81 SER A CA   5  
ATOM 7547  C C    . SER A 1 82 ? 162.542 7.636   -7.885  1.00 0.00 ? 81 SER A C    5  
ATOM 7548  O O    . SER A 1 82 ? 163.270 8.625   -7.996  1.00 0.00 ? 81 SER A O    5  
ATOM 7549  C CB   . SER A 1 82 ? 160.689 8.644   -9.244  1.00 0.00 ? 81 SER A CB   5  
ATOM 7550  O OG   . SER A 1 82 ? 161.307 8.165   -10.429 1.00 0.00 ? 81 SER A OG   5  
ATOM 7551  H H    . SER A 1 82 ? 160.296 9.259   -6.741  1.00 0.00 ? 81 SER A H    5  
ATOM 7552  H HA   . SER A 1 82 ? 160.618 6.771   -8.207  1.00 0.00 ? 81 SER A HA   5  
ATOM 7553  H HB2  . SER A 1 82 ? 159.620 8.654   -9.391  1.00 0.00 ? 81 SER A HB2  5  
ATOM 7554  H HB3  . SER A 1 82 ? 161.034 9.651   -9.054  1.00 0.00 ? 81 SER A HB3  5  
ATOM 7555  H HG   . SER A 1 82 ? 161.137 7.225   -10.524 1.00 0.00 ? 81 SER A HG   5  
ATOM 7556  N N    . GLN A 1 83 ? 163.008 6.415   -7.634  1.00 0.00 ? 82 GLN A N    5  
ATOM 7557  C CA   . GLN A 1 83 ? 164.435 6.151   -7.471  1.00 0.00 ? 82 GLN A CA   5  
ATOM 7558  C C    . GLN A 1 83 ? 164.949 5.243   -8.590  1.00 0.00 ? 82 GLN A C    5  
ATOM 7559  O O    . GLN A 1 83 ? 165.884 4.464   -8.389  1.00 0.00 ? 82 GLN A O    5  
ATOM 7560  C CB   . GLN A 1 83 ? 164.700 5.507   -6.107  1.00 0.00 ? 82 GLN A CB   5  
ATOM 7561  C CG   . GLN A 1 83 ? 165.452 6.410   -5.144  1.00 0.00 ? 82 GLN A CG   5  
ATOM 7562  C CD   . GLN A 1 83 ? 166.952 6.190   -5.189  1.00 0.00 ? 82 GLN A CD   5  
ATOM 7563  O OE1  . GLN A 1 83 ? 167.482 5.303   -4.519  1.00 0.00 ? 82 GLN A OE1  5  
ATOM 7564  N NE2  . GLN A 1 83 ? 167.648 6.999   -5.981  1.00 0.00 ? 82 GLN A NE2  5  
ATOM 7565  H H    . GLN A 1 83 ? 162.377 5.669   -7.561  1.00 0.00 ? 82 GLN A H    5  
ATOM 7566  H HA   . GLN A 1 83 ? 164.956 7.096   -7.523  1.00 0.00 ? 82 GLN A HA   5  
ATOM 7567  H HB2  . GLN A 1 83 ? 163.755 5.242   -5.656  1.00 0.00 ? 82 GLN A HB2  5  
ATOM 7568  H HB3  . GLN A 1 83 ? 165.282 4.609   -6.252  1.00 0.00 ? 82 GLN A HB3  5  
ATOM 7569  H HG2  . GLN A 1 83 ? 165.246 7.439   -5.399  1.00 0.00 ? 82 GLN A HG2  5  
ATOM 7570  H HG3  . GLN A 1 83 ? 165.104 6.213   -4.141  1.00 0.00 ? 82 GLN A HG3  5  
ATOM 7571  H HE21 . GLN A 1 83 ? 167.163 7.685   -6.486  1.00 0.00 ? 82 GLN A HE21 5  
ATOM 7572  H HE22 . GLN A 1 83 ? 168.619 6.877   -6.028  1.00 0.00 ? 82 GLN A HE22 5  
ATOM 7573  N N    . ASP A 1 84 ? 164.334 5.344   -9.770  1.00 0.00 ? 83 ASP A N    5  
ATOM 7574  C CA   . ASP A 1 84 ? 164.732 4.528   -10.911 1.00 0.00 ? 83 ASP A CA   5  
ATOM 7575  C C    . ASP A 1 84 ? 166.072 4.991   -11.474 1.00 0.00 ? 83 ASP A C    5  
ATOM 7576  O O    . ASP A 1 84 ? 166.212 6.136   -11.910 1.00 0.00 ? 83 ASP A O    5  
ATOM 7577  C CB   . ASP A 1 84 ? 163.657 4.570   -12.002 1.00 0.00 ? 83 ASP A CB   5  
ATOM 7578  C CG   . ASP A 1 84 ? 163.903 3.557   -13.105 1.00 0.00 ? 83 ASP A CG   5  
ATOM 7579  O OD1  . ASP A 1 84 ? 164.103 2.366   -12.786 1.00 0.00 ? 83 ASP A OD1  5  
ATOM 7580  O OD2  . ASP A 1 84 ? 163.897 3.956   -14.288 1.00 0.00 ? 83 ASP A OD2  5  
ATOM 7581  H H    . ASP A 1 84 ? 163.596 5.981   -9.874  1.00 0.00 ? 83 ASP A H    5  
ATOM 7582  H HA   . ASP A 1 84 ? 164.836 3.511   -10.565 1.00 0.00 ? 83 ASP A HA   5  
ATOM 7583  H HB2  . ASP A 1 84 ? 162.696 4.360   -11.559 1.00 0.00 ? 83 ASP A HB2  5  
ATOM 7584  H HB3  . ASP A 1 84 ? 163.638 5.557   -12.442 1.00 0.00 ? 83 ASP A HB3  5  
ATOM 7585  N N    . ARG A 1 85 ? 167.055 4.091   -11.458 1.00 0.00 ? 84 ARG A N    5  
ATOM 7586  C CA   . ARG A 1 85 ? 168.391 4.393   -11.966 1.00 0.00 ? 84 ARG A CA   5  
ATOM 7587  C C    . ARG A 1 85 ? 168.929 3.236   -12.803 1.00 0.00 ? 84 ARG A C    5  
ATOM 7588  O O    . ARG A 1 85 ? 169.328 3.424   -13.952 1.00 0.00 ? 84 ARG A O    5  
ATOM 7589  C CB   . ARG A 1 85 ? 169.347 4.692   -10.806 1.00 0.00 ? 84 ARG A CB   5  
ATOM 7590  C CG   . ARG A 1 85 ? 169.000 5.960   -10.040 1.00 0.00 ? 84 ARG A CG   5  
ATOM 7591  C CD   . ARG A 1 85 ? 170.220 6.850   -9.847  1.00 0.00 ? 84 ARG A CD   5  
ATOM 7592  N NE   . ARG A 1 85 ? 170.540 7.050   -8.434  1.00 0.00 ? 84 ARG A NE   5  
ATOM 7593  C CZ   . ARG A 1 85 ? 171.689 7.569   -7.995  1.00 0.00 ? 84 ARG A CZ   5  
ATOM 7594  N NH1  . ARG A 1 85 ? 172.631 7.949   -8.855  1.00 0.00 ? 84 ARG A NH1  5  
ATOM 7595  N NH2  . ARG A 1 85 ? 171.899 7.712   -6.691  1.00 0.00 ? 84 ARG A NH2  5  
ATOM 7596  H H    . ARG A 1 85 ? 166.874 3.198   -11.097 1.00 0.00 ? 84 ARG A H    5  
ATOM 7597  H HA   . ARG A 1 85 ? 168.316 5.266   -12.592 1.00 0.00 ? 84 ARG A HA   5  
ATOM 7598  H HB2  . ARG A 1 85 ? 169.327 3.863   -10.115 1.00 0.00 ? 84 ARG A HB2  5  
ATOM 7599  H HB3  . ARG A 1 85 ? 170.348 4.798   -11.199 1.00 0.00 ? 84 ARG A HB3  5  
ATOM 7600  H HG2  . ARG A 1 85 ? 168.252 6.509   -10.594 1.00 0.00 ? 84 ARG A HG2  5  
ATOM 7601  H HG3  . ARG A 1 85 ? 168.605 5.687   -9.072  1.00 0.00 ? 84 ARG A HG3  5  
ATOM 7602  H HD2  . ARG A 1 85 ? 171.066 6.390   -10.335 1.00 0.00 ? 84 ARG A HD2  5  
ATOM 7603  H HD3  . ARG A 1 85 ? 170.022 7.811   -10.301 1.00 0.00 ? 84 ARG A HD3  5  
ATOM 7604  H HE   . ARG A 1 85 ? 169.864 6.783   -7.776  1.00 0.00 ? 84 ARG A HE   5  
ATOM 7605  H HH11 . ARG A 1 85 ? 172.483 7.848   -9.839  1.00 0.00 ? 84 ARG A HH11 5  
ATOM 7606  H HH12 . ARG A 1 85 ? 173.489 8.335   -8.517  1.00 0.00 ? 84 ARG A HH12 5  
ATOM 7607  H HH21 . ARG A 1 85 ? 171.195 7.432   -6.038  1.00 0.00 ? 84 ARG A HH21 5  
ATOM 7608  H HH22 . ARG A 1 85 ? 172.760 8.099   -6.361  1.00 0.00 ? 84 ARG A HH22 5  
ATOM 7609  N N    . ASN A 1 86 ? 168.930 2.040   -12.212 1.00 0.00 ? 85 ASN A N    5  
ATOM 7610  C CA   . ASN A 1 86 ? 169.411 0.829   -12.882 1.00 0.00 ? 85 ASN A CA   5  
ATOM 7611  C C    . ASN A 1 86 ? 170.915 0.900   -13.149 1.00 0.00 ? 85 ASN A C    5  
ATOM 7612  O O    . ASN A 1 86 ? 171.468 1.981   -13.361 1.00 0.00 ? 85 ASN A O    5  
ATOM 7613  C CB   . ASN A 1 86 ? 168.649 0.600   -14.190 1.00 0.00 ? 85 ASN A CB   5  
ATOM 7614  C CG   . ASN A 1 86 ? 168.609 -0.864  -14.596 1.00 0.00 ? 85 ASN A CG   5  
ATOM 7615  O OD1  . ASN A 1 86 ? 169.125 -1.732  -13.890 1.00 0.00 ? 85 ASN A OD1  5  
ATOM 7616  N ND2  . ASN A 1 86 ? 167.994 -1.146  -15.739 1.00 0.00 ? 85 ASN A ND2  5  
ATOM 7617  H H    . ASN A 1 86 ? 168.594 1.970   -11.296 1.00 0.00 ? 85 ASN A H    5  
ATOM 7618  H HA   . ASN A 1 86 ? 169.222 -0.003  -12.220 1.00 0.00 ? 85 ASN A HA   5  
ATOM 7619  H HB2  . ASN A 1 86 ? 167.634 0.946   -14.070 1.00 0.00 ? 85 ASN A HB2  5  
ATOM 7620  H HB3  . ASN A 1 86 ? 169.126 1.162   -14.979 1.00 0.00 ? 85 ASN A HB3  5  
ATOM 7621  H HD21 . ASN A 1 86 ? 167.605 -0.407  -16.252 1.00 0.00 ? 85 ASN A HD21 5  
ATOM 7622  H HD22 . ASN A 1 86 ? 167.956 -2.083  -16.022 1.00 0.00 ? 85 ASN A HD22 5  
ATOM 7623  N N    . LEU A 1 87 ? 171.568 -0.263  -13.122 1.00 0.00 ? 86 LEU A N    5  
ATOM 7624  C CA   . LEU A 1 87 ? 173.013 -0.355  -13.343 1.00 0.00 ? 86 LEU A CA   5  
ATOM 7625  C C    . LEU A 1 87 ? 173.777 0.268   -12.176 1.00 0.00 ? 86 LEU A C    5  
ATOM 7626  O O    . LEU A 1 87 ? 173.320 1.238   -11.569 1.00 0.00 ? 86 LEU A O    5  
ATOM 7627  C CB   . LEU A 1 87 ? 173.424 0.328   -14.655 1.00 0.00 ? 86 LEU A CB   5  
ATOM 7628  C CG   . LEU A 1 87 ? 172.764 -0.221  -15.925 1.00 0.00 ? 86 LEU A CG   5  
ATOM 7629  C CD1  . LEU A 1 87 ? 173.227 0.564   -17.145 1.00 0.00 ? 86 LEU A CD1  5  
ATOM 7630  C CD2  . LEU A 1 87 ? 173.071 -1.703  -16.098 1.00 0.00 ? 86 LEU A CD2  5  
ATOM 7631  H H    . LEU A 1 87 ? 171.066 -1.085  -12.937 1.00 0.00 ? 86 LEU A H    5  
ATOM 7632  H HA   . LEU A 1 87 ? 173.267 -1.402  -13.401 1.00 0.00 ? 86 LEU A HA   5  
ATOM 7633  H HB2  . LEU A 1 87 ? 173.186 1.378   -14.579 1.00 0.00 ? 86 LEU A HB2  5  
ATOM 7634  H HB3  . LEU A 1 87 ? 174.493 0.228   -14.763 1.00 0.00 ? 86 LEU A HB3  5  
ATOM 7635  H HG   . LEU A 1 87 ? 171.693 -0.107  -15.844 1.00 0.00 ? 86 LEU A HG   5  
ATOM 7636  H HD11 . LEU A 1 87 ? 172.816 1.562   -17.108 1.00 0.00 ? 86 LEU A HD11 5  
ATOM 7637  H HD12 . LEU A 1 87 ? 172.889 0.069   -18.043 1.00 0.00 ? 86 LEU A HD12 5  
ATOM 7638  H HD13 . LEU A 1 87 ? 174.306 0.620   -17.149 1.00 0.00 ? 86 LEU A HD13 5  
ATOM 7639  H HD21 . LEU A 1 87 ? 172.275 -2.288  -15.662 1.00 0.00 ? 86 LEU A HD21 5  
ATOM 7640  H HD22 . LEU A 1 87 ? 174.002 -1.940  -15.605 1.00 0.00 ? 86 LEU A HD22 5  
ATOM 7641  H HD23 . LEU A 1 87 ? 173.152 -1.934  -17.150 1.00 0.00 ? 86 LEU A HD23 5  
ATOM 7642  N N    . GLU A 1 88 ? 174.945 -0.298  -11.872 1.00 0.00 ? 87 GLU A N    5  
ATOM 7643  C CA   . GLU A 1 88 ? 175.787 0.195   -10.782 1.00 0.00 ? 87 GLU A CA   5  
ATOM 7644  C C    . GLU A 1 88 ? 175.078 0.075   -9.430  1.00 0.00 ? 87 GLU A C    5  
ATOM 7645  O O    . GLU A 1 88 ? 174.256 0.920   -9.070  1.00 0.00 ? 87 GLU A O    5  
ATOM 7646  C CB   . GLU A 1 88 ? 176.196 1.651   -11.040 1.00 0.00 ? 87 GLU A CB   5  
ATOM 7647  C CG   . GLU A 1 88 ? 177.701 1.855   -11.159 1.00 0.00 ? 87 GLU A CG   5  
ATOM 7648  C CD   . GLU A 1 88 ? 178.285 1.279   -12.438 1.00 0.00 ? 87 GLU A CD   5  
ATOM 7649  O OE1  . GLU A 1 88 ? 177.791 0.231   -12.905 1.00 0.00 ? 87 GLU A OE1  5  
ATOM 7650  O OE2  . GLU A 1 88 ? 179.240 1.879   -12.972 1.00 0.00 ? 87 GLU A OE2  5  
ATOM 7651  H H    . GLU A 1 88 ? 175.252 -1.066  -12.399 1.00 0.00 ? 87 GLU A H    5  
ATOM 7652  H HA   . GLU A 1 88 ? 176.677 -0.417  -10.758 1.00 0.00 ? 87 GLU A HA   5  
ATOM 7653  H HB2  . GLU A 1 88 ? 175.738 1.984   -11.959 1.00 0.00 ? 87 GLU A HB2  5  
ATOM 7654  H HB3  . GLU A 1 88 ? 175.836 2.264   -10.226 1.00 0.00 ? 87 GLU A HB3  5  
ATOM 7655  H HG2  . GLU A 1 88 ? 177.907 2.914   -11.139 1.00 0.00 ? 87 GLU A HG2  5  
ATOM 7656  H HG3  . GLU A 1 88 ? 178.183 1.381   -10.317 1.00 0.00 ? 87 GLU A HG3  5  
ATOM 7657  N N    . HIS A 1 89 ? 175.409 -0.983  -8.686  1.00 0.00 ? 88 HIS A N    5  
ATOM 7658  C CA   . HIS A 1 89 ? 174.815 -1.225  -7.371  1.00 0.00 ? 88 HIS A CA   5  
ATOM 7659  C C    . HIS A 1 89 ? 175.892 -1.611  -6.352  1.00 0.00 ? 88 HIS A C    5  
ATOM 7660  O O    . HIS A 1 89 ? 176.255 -0.810  -5.489  1.00 0.00 ? 88 HIS A O    5  
ATOM 7661  C CB   . HIS A 1 89 ? 173.751 -2.325  -7.466  1.00 0.00 ? 88 HIS A CB   5  
ATOM 7662  C CG   . HIS A 1 89 ? 172.463 -1.982  -6.784  1.00 0.00 ? 88 HIS A CG   5  
ATOM 7663  N ND1  . HIS A 1 89 ? 172.342 -1.869  -5.415  1.00 0.00 ? 88 HIS A ND1  5  
ATOM 7664  C CD2  . HIS A 1 89 ? 171.230 -1.739  -7.290  1.00 0.00 ? 88 HIS A CD2  5  
ATOM 7665  C CE1  . HIS A 1 89 ? 171.091 -1.574  -5.108  1.00 0.00 ? 88 HIS A CE1  5  
ATOM 7666  N NE2  . HIS A 1 89 ? 170.397 -1.489  -6.228  1.00 0.00 ? 88 HIS A NE2  5  
ATOM 7667  H H    . HIS A 1 89 ? 176.071 -1.617  -9.032  1.00 0.00 ? 88 HIS A H    5  
ATOM 7668  H HA   . HIS A 1 89 ? 174.345 -0.308  -7.047  1.00 0.00 ? 88 HIS A HA   5  
ATOM 7669  H HB2  . HIS A 1 89 ? 173.533 -2.515  -8.506  1.00 0.00 ? 88 HIS A HB2  5  
ATOM 7670  H HB3  . HIS A 1 89 ? 174.135 -3.227  -7.016  1.00 0.00 ? 88 HIS A HB3  5  
ATOM 7671  H HD1  . HIS A 1 89 ? 173.066 -1.987  -4.765  1.00 0.00 ? 88 HIS A HD1  5  
ATOM 7672  H HD2  . HIS A 1 89 ? 170.954 -1.739  -8.335  1.00 0.00 ? 88 HIS A HD2  5  
ATOM 7673  H HE1  . HIS A 1 89 ? 170.703 -1.427  -4.111  1.00 0.00 ? 88 HIS A HE1  5  
ATOM 7674  H HE2  . HIS A 1 89 ? 169.422 -1.401  -6.280  1.00 0.00 ? 88 HIS A HE2  5  
ATOM 7675  N N    . HIS A 1 90 ? 176.402 -2.840  -6.463  1.00 0.00 ? 89 HIS A N    5  
ATOM 7676  C CA   . HIS A 1 90 ? 177.442 -3.341  -5.560  1.00 0.00 ? 89 HIS A CA   5  
ATOM 7677  C C    . HIS A 1 90 ? 177.966 -4.697  -6.047  1.00 0.00 ? 89 HIS A C    5  
ATOM 7678  O O    . HIS A 1 90 ? 178.185 -5.616  -5.253  1.00 0.00 ? 89 HIS A O    5  
ATOM 7679  C CB   . HIS A 1 90 ? 176.898 -3.459  -4.128  1.00 0.00 ? 89 HIS A CB   5  
ATOM 7680  C CG   . HIS A 1 90 ? 177.565 -2.535  -3.155  1.00 0.00 ? 89 HIS A CG   5  
ATOM 7681  N ND1  . HIS A 1 90 ? 178.823 -2.765  -2.637  1.00 0.00 ? 89 HIS A ND1  5  
ATOM 7682  C CD2  . HIS A 1 90 ? 177.142 -1.371  -2.605  1.00 0.00 ? 89 HIS A CD2  5  
ATOM 7683  C CE1  . HIS A 1 90 ? 179.143 -1.784  -1.811  1.00 0.00 ? 89 HIS A CE1  5  
ATOM 7684  N NE2  . HIS A 1 90 ? 178.141 -0.926  -1.775  1.00 0.00 ? 89 HIS A NE2  5  
ATOM 7685  H H    . HIS A 1 90 ? 176.073 -3.428  -7.174  1.00 0.00 ? 89 HIS A H    5  
ATOM 7686  H HA   . HIS A 1 90 ? 178.257 -2.631  -5.570  1.00 0.00 ? 89 HIS A HA   5  
ATOM 7687  H HB2  . HIS A 1 90 ? 175.843 -3.230  -4.131  1.00 0.00 ? 89 HIS A HB2  5  
ATOM 7688  H HB3  . HIS A 1 90 ? 177.040 -4.470  -3.776  1.00 0.00 ? 89 HIS A HB3  5  
ATOM 7689  H HD1  . HIS A 1 90 ? 179.395 -3.533  -2.844  1.00 0.00 ? 89 HIS A HD1  5  
ATOM 7690  H HD2  . HIS A 1 90 ? 176.194 -0.884  -2.787  1.00 0.00 ? 89 HIS A HD2  5  
ATOM 7691  H HE1  . HIS A 1 90 ? 180.068 -1.699  -1.261  1.00 0.00 ? 89 HIS A HE1  5  
ATOM 7692  H HE2  . HIS A 1 90 ? 178.157 -0.058  -1.320  1.00 0.00 ? 89 HIS A HE2  5  
ATOM 7693  N N    . HIS A 1 91 ? 178.162 -4.810  -7.363  1.00 0.00 ? 90 HIS A N    5  
ATOM 7694  C CA   . HIS A 1 91 ? 178.654 -6.046  -7.970  1.00 0.00 ? 90 HIS A CA   5  
ATOM 7695  C C    . HIS A 1 91 ? 179.499 -5.752  -9.211  1.00 0.00 ? 90 HIS A C    5  
ATOM 7696  O O    . HIS A 1 91 ? 180.589 -6.300  -9.371  1.00 0.00 ? 90 HIS A O    5  
ATOM 7697  C CB   . HIS A 1 91 ? 177.481 -6.963  -8.340  1.00 0.00 ? 90 HIS A CB   5  
ATOM 7698  C CG   . HIS A 1 91 ? 177.534 -8.308  -7.678  1.00 0.00 ? 90 HIS A CG   5  
ATOM 7699  N ND1  . HIS A 1 91 ? 177.863 -8.482  -6.350  1.00 0.00 ? 90 HIS A ND1  5  
ATOM 7700  C CD2  . HIS A 1 91 ? 177.296 -9.549  -8.169  1.00 0.00 ? 90 HIS A CD2  5  
ATOM 7701  C CE1  . HIS A 1 91 ? 177.825 -9.769  -6.053  1.00 0.00 ? 90 HIS A CE1  5  
ATOM 7702  N NE2  . HIS A 1 91 ? 177.483 -10.438 -7.139  1.00 0.00 ? 90 HIS A NE2  5  
ATOM 7703  H H    . HIS A 1 91 ? 177.969 -4.043  -7.939  1.00 0.00 ? 90 HIS A H    5  
ATOM 7704  H HA   . HIS A 1 91 ? 179.274 -6.547  -7.241  1.00 0.00 ? 90 HIS A HA   5  
ATOM 7705  H HB2  . HIS A 1 91 ? 176.556 -6.488  -8.048  1.00 0.00 ? 90 HIS A HB2  5  
ATOM 7706  H HB3  . HIS A 1 91 ? 177.477 -7.118  -9.409  1.00 0.00 ? 90 HIS A HB3  5  
ATOM 7707  H HD1  . HIS A 1 91 ? 178.093 -7.767  -5.718  1.00 0.00 ? 90 HIS A HD1  5  
ATOM 7708  H HD2  . HIS A 1 91 ? 177.011 -9.794  -9.183  1.00 0.00 ? 90 HIS A HD2  5  
ATOM 7709  H HE1  . HIS A 1 91 ? 178.035 -10.200 -5.085  1.00 0.00 ? 90 HIS A HE1  5  
ATOM 7710  H HE2  . HIS A 1 91 ? 177.503 -11.414 -7.228  1.00 0.00 ? 90 HIS A HE2  5  
ATOM 7711  N N    . HIS A 1 92 ? 178.984 -4.882  -10.089 1.00 0.00 ? 91 HIS A N    5  
ATOM 7712  C CA   . HIS A 1 92 ? 179.683 -4.505  -11.322 1.00 0.00 ? 91 HIS A CA   5  
ATOM 7713  C C    . HIS A 1 92 ? 179.861 -5.706  -12.263 1.00 0.00 ? 91 HIS A C    5  
ATOM 7714  O O    . HIS A 1 92 ? 180.810 -5.749  -13.050 1.00 0.00 ? 91 HIS A O    5  
ATOM 7715  C CB   . HIS A 1 92 ? 181.048 -3.884  -10.998 1.00 0.00 ? 91 HIS A CB   5  
ATOM 7716  C CG   . HIS A 1 92 ? 180.966 -2.483  -10.471 1.00 0.00 ? 91 HIS A CG   5  
ATOM 7717  N ND1  . HIS A 1 92 ? 180.777 -1.381  -11.281 1.00 0.00 ? 91 HIS A ND1  5  
ATOM 7718  C CD2  . HIS A 1 92 ? 181.060 -2.005  -9.206  1.00 0.00 ? 91 HIS A CD2  5  
ATOM 7719  C CE1  . HIS A 1 92 ? 180.761 -0.288  -10.538 1.00 0.00 ? 91 HIS A CE1  5  
ATOM 7720  N NE2  . HIS A 1 92 ? 180.929 -0.640  -9.276  1.00 0.00 ? 91 HIS A NE2  5  
ATOM 7721  H H    . HIS A 1 92 ? 178.110 -4.482  -9.902  1.00 0.00 ? 91 HIS A H    5  
ATOM 7722  H HA   . HIS A 1 92 ? 179.078 -3.764  -11.825 1.00 0.00 ? 91 HIS A HA   5  
ATOM 7723  H HB2  . HIS A 1 92 ? 181.543 -4.489  -10.255 1.00 0.00 ? 91 HIS A HB2  5  
ATOM 7724  H HB3  . HIS A 1 92 ? 181.648 -3.867  -11.897 1.00 0.00 ? 91 HIS A HB3  5  
ATOM 7725  H HD1  . HIS A 1 92 ? 180.668 -1.397  -12.255 1.00 0.00 ? 91 HIS A HD1  5  
ATOM 7726  H HD2  . HIS A 1 92 ? 181.209 -2.590  -8.310  1.00 0.00 ? 91 HIS A HD2  5  
ATOM 7727  H HE1  . HIS A 1 92 ? 180.633 0.721   -10.901 1.00 0.00 ? 91 HIS A HE1  5  
ATOM 7728  H HE2  . HIS A 1 92 ? 181.052 -0.017  -8.529  1.00 0.00 ? 91 HIS A HE2  5  
ATOM 7729  N N    . HIS A 1 93 ? 178.936 -6.670  -12.182 1.00 0.00 ? 92 HIS A N    5  
ATOM 7730  C CA   . HIS A 1 93 ? 178.975 -7.869  -13.023 1.00 0.00 ? 92 HIS A CA   5  
ATOM 7731  C C    . HIS A 1 93 ? 180.128 -8.793  -12.626 1.00 0.00 ? 92 HIS A C    5  
ATOM 7732  O O    . HIS A 1 93 ? 181.241 -8.336  -12.366 1.00 0.00 ? 92 HIS A O    5  
ATOM 7733  C CB   . HIS A 1 93 ? 179.086 -7.488  -14.502 1.00 0.00 ? 92 HIS A CB   5  
ATOM 7734  C CG   . HIS A 1 93 ? 177.928 -7.957  -15.327 1.00 0.00 ? 92 HIS A CG   5  
ATOM 7735  N ND1  . HIS A 1 93 ? 176.673 -7.389  -15.254 1.00 0.00 ? 92 HIS A ND1  5  
ATOM 7736  C CD2  . HIS A 1 93 ? 177.837 -8.948  -16.246 1.00 0.00 ? 92 HIS A CD2  5  
ATOM 7737  C CE1  . HIS A 1 93 ? 175.861 -8.009  -16.092 1.00 0.00 ? 92 HIS A CE1  5  
ATOM 7738  N NE2  . HIS A 1 93 ? 176.543 -8.958  -16.706 1.00 0.00 ? 92 HIS A NE2  5  
ATOM 7739  H H    . HIS A 1 93 ? 178.204 -6.571  -11.542 1.00 0.00 ? 92 HIS A H    5  
ATOM 7740  H HA   . HIS A 1 93 ? 178.046 -8.399  -12.872 1.00 0.00 ? 92 HIS A HA   5  
ATOM 7741  H HB2  . HIS A 1 93 ? 179.138 -6.413  -14.587 1.00 0.00 ? 92 HIS A HB2  5  
ATOM 7742  H HB3  . HIS A 1 93 ? 179.987 -7.921  -14.914 1.00 0.00 ? 92 HIS A HB3  5  
ATOM 7743  H HD1  . HIS A 1 93 ? 176.413 -6.646  -14.669 1.00 0.00 ? 92 HIS A HD1  5  
ATOM 7744  H HD2  . HIS A 1 93 ? 178.633 -9.610  -16.556 1.00 0.00 ? 92 HIS A HD2  5  
ATOM 7745  H HE1  . HIS A 1 93 ? 174.818 -7.777  -16.251 1.00 0.00 ? 92 HIS A HE1  5  
ATOM 7746  H HE2  . HIS A 1 93 ? 176.171 -9.597  -17.349 1.00 0.00 ? 92 HIS A HE2  5  
ATOM 7747  N N    . HIS A 1 94 ? 179.842 -10.097 -12.580 1.00 0.00 ? 93 HIS A N    5  
ATOM 7748  C CA   . HIS A 1 94 ? 180.836 -11.110 -12.214 1.00 0.00 ? 93 HIS A CA   5  
ATOM 7749  C C    . HIS A 1 94 ? 181.247 -10.971 -10.743 1.00 0.00 ? 93 HIS A C    5  
ATOM 7750  O O    . HIS A 1 94 ? 180.531 -11.524 -9.881  1.00 0.00 ? 93 HIS A O    5  
ATOM 7751  C CB   . HIS A 1 94 ? 182.067 -11.025 -13.134 1.00 0.00 ? 93 HIS A CB   5  
ATOM 7752  C CG   . HIS A 1 94 ? 181.885 -11.710 -14.457 1.00 0.00 ? 93 HIS A CG   5  
ATOM 7753  N ND1  . HIS A 1 94 ? 180.753 -11.565 -15.232 1.00 0.00 ? 93 HIS A ND1  5  
ATOM 7754  C CD2  . HIS A 1 94 ? 182.701 -12.549 -15.142 1.00 0.00 ? 93 HIS A CD2  5  
ATOM 7755  C CE1  . HIS A 1 94 ? 180.880 -12.284 -16.333 1.00 0.00 ? 93 HIS A CE1  5  
ATOM 7756  N NE2  . HIS A 1 94 ? 182.052 -12.890 -16.304 1.00 0.00 ? 93 HIS A NE2  5  
ATOM 7757  O OXT  . HIS A 1 94 ? 182.268 -10.307 -10.462 1.00 0.00 ? 93 HIS A OXT  5  
ATOM 7758  H H    . HIS A 1 94 ? 178.930 -10.389 -12.795 1.00 0.00 ? 93 HIS A H    5  
ATOM 7759  H HA   . HIS A 1 94 ? 180.373 -12.077 -12.345 1.00 0.00 ? 93 HIS A HA   5  
ATOM 7760  H HB2  . HIS A 1 94 ? 182.294 -9.988  -13.328 1.00 0.00 ? 93 HIS A HB2  5  
ATOM 7761  H HB3  . HIS A 1 94 ? 182.909 -11.483 -12.635 1.00 0.00 ? 93 HIS A HB3  5  
ATOM 7762  H HD1  . HIS A 1 94 ? 179.973 -11.016 -15.008 1.00 0.00 ? 93 HIS A HD1  5  
ATOM 7763  H HD2  . HIS A 1 94 ? 183.680 -12.885 -14.832 1.00 0.00 ? 93 HIS A HD2  5  
ATOM 7764  H HE1  . HIS A 1 94 ? 180.147 -12.365 -17.122 1.00 0.00 ? 93 HIS A HE1  5  
ATOM 7765  H HE2  . HIS A 1 94 ? 182.354 -13.566 -16.945 1.00 0.00 ? 93 HIS A HE2  5  
ATOM 7766  N N    . GLN A 1 2  ? 135.957 -7.941  4.336   1.00 0.00 ? 1  GLN A N    6  
ATOM 7767  C CA   . GLN A 1 2  ? 136.499 -8.236  5.693   1.00 0.00 ? 1  GLN A CA   6  
ATOM 7768  C C    . GLN A 1 2  ? 137.139 -7.001  6.324   1.00 0.00 ? 1  GLN A C    6  
ATOM 7769  O O    . GLN A 1 2  ? 136.857 -6.669  7.478   1.00 0.00 ? 1  GLN A O    6  
ATOM 7770  C CB   . GLN A 1 2  ? 137.529 -9.366  5.587   1.00 0.00 ? 1  GLN A CB   6  
ATOM 7771  C CG   . GLN A 1 2  ? 136.939 -10.678 5.092   1.00 0.00 ? 1  GLN A CG   6  
ATOM 7772  C CD   . GLN A 1 2  ? 137.966 -11.573 4.421   1.00 0.00 ? 1  GLN A CD   6  
ATOM 7773  O OE1  . GLN A 1 2  ? 138.416 -12.561 5.000   1.00 0.00 ? 1  GLN A OE1  6  
ATOM 7774  N NE2  . GLN A 1 2  ? 138.344 -11.231 3.193   1.00 0.00 ? 1  GLN A NE2  6  
ATOM 7775  H HA   . GLN A 1 2  ? 135.686 -8.560  6.319   1.00 0.00 ? 1  GLN A HA   6  
ATOM 7776  H HB2  . GLN A 1 2  ? 138.311 -9.064  4.906   1.00 0.00 ? 1  GLN A HB2  6  
ATOM 7777  H HB3  . GLN A 1 2  ? 137.959 -9.536  6.563   1.00 0.00 ? 1  GLN A HB3  6  
ATOM 7778  H HG2  . GLN A 1 2  ? 136.521 -11.207 5.935   1.00 0.00 ? 1  GLN A HG2  6  
ATOM 7779  H HG3  . GLN A 1 2  ? 136.155 -10.458 4.382   1.00 0.00 ? 1  GLN A HG3  6  
ATOM 7780  H HE21 . GLN A 1 2  ? 137.948 -10.430 2.791   1.00 0.00 ? 1  GLN A HE21 6  
ATOM 7781  H HE22 . GLN A 1 2  ? 138.999 -11.799 2.735   1.00 0.00 ? 1  GLN A HE22 6  
ATOM 7782  N N    . SER A 1 3  ? 138.001 -6.327  5.565   1.00 0.00 ? 2  SER A N    6  
ATOM 7783  C CA   . SER A 1 3  ? 138.683 -5.131  6.056   1.00 0.00 ? 2  SER A CA   6  
ATOM 7784  C C    . SER A 1 3  ? 139.024 -4.174  4.909   1.00 0.00 ? 2  SER A C    6  
ATOM 7785  O O    . SER A 1 3  ? 138.638 -4.406  3.761   1.00 0.00 ? 2  SER A O    6  
ATOM 7786  C CB   . SER A 1 3  ? 139.954 -5.522  6.819   1.00 0.00 ? 2  SER A CB   6  
ATOM 7787  O OG   . SER A 1 3  ? 139.727 -6.635  7.671   1.00 0.00 ? 2  SER A OG   6  
ATOM 7788  H H    . SER A 1 3  ? 138.185 -6.643  4.659   1.00 0.00 ? 2  SER A H    6  
ATOM 7789  H HA   . SER A 1 3  ? 138.010 -4.627  6.733   1.00 0.00 ? 2  SER A HA   6  
ATOM 7790  H HB2  . SER A 1 3  ? 140.729 -5.776  6.116   1.00 0.00 ? 2  SER A HB2  6  
ATOM 7791  H HB3  . SER A 1 3  ? 140.278 -4.686  7.419   1.00 0.00 ? 2  SER A HB3  6  
ATOM 7792  H HG   . SER A 1 3  ? 138.990 -6.445  8.255   1.00 0.00 ? 2  SER A HG   6  
ATOM 7793  N N    . ASP A 1 4  ? 139.745 -3.093  5.231   1.00 0.00 ? 3  ASP A N    6  
ATOM 7794  C CA   . ASP A 1 4  ? 140.135 -2.092  4.235   1.00 0.00 ? 3  ASP A CA   6  
ATOM 7795  C C    . ASP A 1 4  ? 141.159 -1.109  4.809   1.00 0.00 ? 3  ASP A C    6  
ATOM 7796  O O    . ASP A 1 4  ? 141.025 -0.655  5.948   1.00 0.00 ? 3  ASP A O    6  
ATOM 7797  C CB   . ASP A 1 4  ? 138.903 -1.324  3.738   1.00 0.00 ? 3  ASP A CB   6  
ATOM 7798  C CG   . ASP A 1 4  ? 138.120 -0.677  4.867   1.00 0.00 ? 3  ASP A CG   6  
ATOM 7799  O OD1  . ASP A 1 4  ? 137.292 -1.375  5.491   1.00 0.00 ? 3  ASP A OD1  6  
ATOM 7800  O OD2  . ASP A 1 4  ? 138.334 0.526   5.126   1.00 0.00 ? 3  ASP A OD2  6  
ATOM 7801  H H    . ASP A 1 4  ? 140.019 -2.963  6.162   1.00 0.00 ? 3  ASP A H    6  
ATOM 7802  H HA   . ASP A 1 4  ? 140.583 -2.612  3.402   1.00 0.00 ? 3  ASP A HA   6  
ATOM 7803  H HB2  . ASP A 1 4  ? 139.222 -0.547  3.059   1.00 0.00 ? 3  ASP A HB2  6  
ATOM 7804  H HB3  . ASP A 1 4  ? 138.249 -2.005  3.216   1.00 0.00 ? 3  ASP A HB3  6  
ATOM 7805  N N    . VAL A 1 5  ? 142.181 -0.787  4.011   1.00 0.00 ? 4  VAL A N    6  
ATOM 7806  C CA   . VAL A 1 5  ? 143.235 0.141   4.431   1.00 0.00 ? 4  VAL A CA   6  
ATOM 7807  C C    . VAL A 1 5  ? 143.622 1.092   3.295   1.00 0.00 ? 4  VAL A C    6  
ATOM 7808  O O    . VAL A 1 5  ? 143.690 0.689   2.131   1.00 0.00 ? 4  VAL A O    6  
ATOM 7809  C CB   . VAL A 1 5  ? 144.502 -0.613  4.900   1.00 0.00 ? 4  VAL A CB   6  
ATOM 7810  C CG1  . VAL A 1 5  ? 145.506 0.349   5.523   1.00 0.00 ? 4  VAL A CG1  6  
ATOM 7811  C CG2  . VAL A 1 5  ? 144.141 -1.725  5.875   1.00 0.00 ? 4  VAL A CG2  6  
ATOM 7812  H H    . VAL A 1 5  ? 142.231 -1.186  3.117   1.00 0.00 ? 4  VAL A H    6  
ATOM 7813  H HA   . VAL A 1 5  ? 142.858 0.722   5.260   1.00 0.00 ? 4  VAL A HA   6  
ATOM 7814  H HB   . VAL A 1 5  ? 144.964 -1.062  4.033   1.00 0.00 ? 4  VAL A HB   6  
ATOM 7815  H HG11 . VAL A 1 5  ? 144.983 1.195   5.945   1.00 0.00 ? 4  VAL A HG11 6  
ATOM 7816  H HG12 . VAL A 1 5  ? 146.193 0.693   4.765   1.00 0.00 ? 4  VAL A HG12 6  
ATOM 7817  H HG13 . VAL A 1 5  ? 146.055 -0.159  6.302   1.00 0.00 ? 4  VAL A HG13 6  
ATOM 7818  H HG21 . VAL A 1 5  ? 143.913 -2.625  5.324   1.00 0.00 ? 4  VAL A HG21 6  
ATOM 7819  H HG22 . VAL A 1 5  ? 143.278 -1.430  6.455   1.00 0.00 ? 4  VAL A HG22 6  
ATOM 7820  H HG23 . VAL A 1 5  ? 144.974 -1.908  6.537   1.00 0.00 ? 4  VAL A HG23 6  
ATOM 7821  N N    . ARG A 1 6  ? 143.883 2.355   3.644   1.00 0.00 ? 5  ARG A N    6  
ATOM 7822  C CA   . ARG A 1 6  ? 144.271 3.366   2.661   1.00 0.00 ? 5  ARG A CA   6  
ATOM 7823  C C    . ARG A 1 6  ? 145.793 3.492   2.579   1.00 0.00 ? 5  ARG A C    6  
ATOM 7824  O O    . ARG A 1 6  ? 146.424 4.063   3.472   1.00 0.00 ? 5  ARG A O    6  
ATOM 7825  C CB   . ARG A 1 6  ? 143.655 4.725   3.018   1.00 0.00 ? 5  ARG A CB   6  
ATOM 7826  C CG   . ARG A 1 6  ? 142.359 5.026   2.281   1.00 0.00 ? 5  ARG A CG   6  
ATOM 7827  C CD   . ARG A 1 6  ? 142.160 6.524   2.091   1.00 0.00 ? 5  ARG A CD   6  
ATOM 7828  N NE   . ARG A 1 6  ? 141.100 6.822   1.126   1.00 0.00 ? 5  ARG A NE   6  
ATOM 7829  C CZ   . ARG A 1 6  ? 140.507 8.016   1.009   1.00 0.00 ? 5  ARG A CZ   6  
ATOM 7830  N NH1  . ARG A 1 6  ? 140.871 9.033   1.787   1.00 0.00 ? 5  ARG A NH1  6  
ATOM 7831  N NH2  . ARG A 1 6  ? 139.547 8.194   0.106   1.00 0.00 ? 5  ARG A NH2  6  
ATOM 7832  H H    . ARG A 1 6  ? 143.817 2.611   4.588   1.00 0.00 ? 5  ARG A H    6  
ATOM 7833  H HA   . ARG A 1 6  ? 143.896 3.053   1.698   1.00 0.00 ? 5  ARG A HA   6  
ATOM 7834  H HB2  . ARG A 1 6  ? 143.452 4.748   4.079   1.00 0.00 ? 5  ARG A HB2  6  
ATOM 7835  H HB3  . ARG A 1 6  ? 144.367 5.503   2.782   1.00 0.00 ? 5  ARG A HB3  6  
ATOM 7836  H HG2  . ARG A 1 6  ? 142.387 4.550   1.311   1.00 0.00 ? 5  ARG A HG2  6  
ATOM 7837  H HG3  . ARG A 1 6  ? 141.532 4.632   2.854   1.00 0.00 ? 5  ARG A HG3  6  
ATOM 7838  H HD2  . ARG A 1 6  ? 141.898 6.961   3.043   1.00 0.00 ? 5  ARG A HD2  6  
ATOM 7839  H HD3  . ARG A 1 6  ? 143.086 6.957   1.740   1.00 0.00 ? 5  ARG A HD3  6  
ATOM 7840  H HE   . ARG A 1 6  ? 140.812 6.095   0.535   1.00 0.00 ? 5  ARG A HE   6  
ATOM 7841  H HH11 . ARG A 1 6  ? 141.594 8.911   2.467   1.00 0.00 ? 5  ARG A HH11 6  
ATOM 7842  H HH12 . ARG A 1 6  ? 140.419 9.921   1.694   1.00 0.00 ? 5  ARG A HH12 6  
ATOM 7843  H HH21 . ARG A 1 6  ? 139.268 7.438   -0.486  1.00 0.00 ? 5  ARG A HH21 6  
ATOM 7844  H HH22 . ARG A 1 6  ? 139.101 9.085   0.020   1.00 0.00 ? 5  ARG A HH22 6  
ATOM 7845  N N    . ILE A 1 7  ? 146.377 2.961   1.504   1.00 0.00 ? 6  ILE A N    6  
ATOM 7846  C CA   . ILE A 1 7  ? 147.825 3.018   1.307   1.00 0.00 ? 6  ILE A CA   6  
ATOM 7847  C C    . ILE A 1 7  ? 148.180 3.933   0.134   1.00 0.00 ? 6  ILE A C    6  
ATOM 7848  O O    . ILE A 1 7  ? 147.809 3.661   -1.010  1.00 0.00 ? 6  ILE A O    6  
ATOM 7849  C CB   . ILE A 1 7  ? 148.420 1.613   1.053   1.00 0.00 ? 6  ILE A CB   6  
ATOM 7850  C CG1  . ILE A 1 7  ? 147.949 0.620   2.121   1.00 0.00 ? 6  ILE A CG1  6  
ATOM 7851  C CG2  . ILE A 1 7  ? 149.942 1.671   1.024   1.00 0.00 ? 6  ILE A CG2  6  
ATOM 7852  C CD1  . ILE A 1 7  ? 147.313 -0.628  1.548   1.00 0.00 ? 6  ILE A CD1  6  
ATOM 7853  H H    . ILE A 1 7  ? 145.821 2.522   0.825   1.00 0.00 ? 6  ILE A H    6  
ATOM 7854  H HA   . ILE A 1 7  ? 148.269 3.417   2.209   1.00 0.00 ? 6  ILE A HA   6  
ATOM 7855  H HB   . ILE A 1 7  ? 148.081 1.275   0.085   1.00 0.00 ? 6  ILE A HB   6  
ATOM 7856  H HG12 . ILE A 1 7  ? 148.797 0.312   2.716   1.00 0.00 ? 6  ILE A HG12 6  
ATOM 7857  H HG13 . ILE A 1 7  ? 147.223 1.100   2.760   1.00 0.00 ? 6  ILE A HG13 6  
ATOM 7858  H HG21 . ILE A 1 7  ? 150.261 2.671   0.771   1.00 0.00 ? 6  ILE A HG21 6  
ATOM 7859  H HG22 . ILE A 1 7  ? 150.313 0.978   0.285   1.00 0.00 ? 6  ILE A HG22 6  
ATOM 7860  H HG23 . ILE A 1 7  ? 150.331 1.404   1.994   1.00 0.00 ? 6  ILE A HG23 6  
ATOM 7861  H HD11 . ILE A 1 7  ? 147.623 -1.488  2.123   1.00 0.00 ? 6  ILE A HD11 6  
ATOM 7862  H HD12 . ILE A 1 7  ? 147.624 -0.751  0.520   1.00 0.00 ? 6  ILE A HD12 6  
ATOM 7863  H HD13 . ILE A 1 7  ? 146.238 -0.535  1.589   1.00 0.00 ? 6  ILE A HD13 6  
ATOM 7864  N N    . LYS A 1 8  ? 148.901 5.015   0.427   1.00 0.00 ? 7  LYS A N    6  
ATOM 7865  C CA   . LYS A 1 8  ? 149.309 5.967   -0.602  1.00 0.00 ? 7  LYS A CA   6  
ATOM 7866  C C    . LYS A 1 8  ? 150.727 5.664   -1.089  1.00 0.00 ? 7  LYS A C    6  
ATOM 7867  O O    . LYS A 1 8  ? 151.684 5.705   -0.312  1.00 0.00 ? 7  LYS A O    6  
ATOM 7868  C CB   . LYS A 1 8  ? 149.223 7.401   -0.068  1.00 0.00 ? 7  LYS A CB   6  
ATOM 7869  C CG   . LYS A 1 8  ? 147.879 8.067   -0.328  1.00 0.00 ? 7  LYS A CG   6  
ATOM 7870  C CD   . LYS A 1 8  ? 147.512 9.039   0.784   1.00 0.00 ? 7  LYS A CD   6  
ATOM 7871  C CE   . LYS A 1 8  ? 146.667 10.196  0.265   1.00 0.00 ? 7  LYS A CE   6  
ATOM 7872  N NZ   . LYS A 1 8  ? 147.492 11.399  -0.040  1.00 0.00 ? 7  LYS A NZ   6  
ATOM 7873  H H    . LYS A 1 8  ? 149.167 5.177   1.358   1.00 0.00 ? 7  LYS A H    6  
ATOM 7874  H HA   . LYS A 1 8  ? 148.629 5.862   -1.435  1.00 0.00 ? 7  LYS A HA   6  
ATOM 7875  H HB2  . LYS A 1 8  ? 149.394 7.387   0.999   1.00 0.00 ? 7  LYS A HB2  6  
ATOM 7876  H HB3  . LYS A 1 8  ? 149.992 7.995   -0.539  1.00 0.00 ? 7  LYS A HB3  6  
ATOM 7877  H HG2  . LYS A 1 8  ? 147.931 8.606   -1.262  1.00 0.00 ? 7  LYS A HG2  6  
ATOM 7878  H HG3  . LYS A 1 8  ? 147.117 7.304   -0.393  1.00 0.00 ? 7  LYS A HG3  6  
ATOM 7879  H HD2  . LYS A 1 8  ? 146.952 8.510   1.540   1.00 0.00 ? 7  LYS A HD2  6  
ATOM 7880  H HD3  . LYS A 1 8  ? 148.420 9.434   1.217   1.00 0.00 ? 7  LYS A HD3  6  
ATOM 7881  H HE2  . LYS A 1 8  ? 146.161 9.880   -0.635  1.00 0.00 ? 7  LYS A HE2  6  
ATOM 7882  H HE3  . LYS A 1 8  ? 145.935 10.454  1.016   1.00 0.00 ? 7  LYS A HE3  6  
ATOM 7883  H HZ1  . LYS A 1 8  ? 148.205 11.544  0.704   1.00 0.00 ? 7  LYS A HZ1  6  
ATOM 7884  H HZ2  . LYS A 1 8  ? 146.887 12.243  -0.092  1.00 0.00 ? 7  LYS A HZ2  6  
ATOM 7885  H HZ3  . LYS A 1 8  ? 147.977 11.278  -0.953  1.00 0.00 ? 7  LYS A HZ3  6  
ATOM 7886  N N    . PHE A 1 9  ? 150.847 5.350   -2.381  1.00 0.00 ? 8  PHE A N    6  
ATOM 7887  C CA   . PHE A 1 9  ? 152.141 5.026   -2.989  1.00 0.00 ? 8  PHE A CA   6  
ATOM 7888  C C    . PHE A 1 9  ? 152.744 6.250   -3.681  1.00 0.00 ? 8  PHE A C    6  
ATOM 7889  O O    . PHE A 1 9  ? 152.076 6.907   -4.480  1.00 0.00 ? 8  PHE A O    6  
ATOM 7890  C CB   . PHE A 1 9  ? 151.975 3.883   -4.000  1.00 0.00 ? 8  PHE A CB   6  
ATOM 7891  C CG   . PHE A 1 9  ? 151.637 2.556   -3.372  1.00 0.00 ? 8  PHE A CG   6  
ATOM 7892  C CD1  . PHE A 1 9  ? 150.374 2.321   -2.846  1.00 0.00 ? 8  PHE A CD1  6  
ATOM 7893  C CD2  . PHE A 1 9  ? 152.582 1.543   -3.307  1.00 0.00 ? 8  PHE A CD2  6  
ATOM 7894  C CE1  . PHE A 1 9  ? 150.063 1.104   -2.270  1.00 0.00 ? 8  PHE A CE1  6  
ATOM 7895  C CE2  . PHE A 1 9  ? 152.275 0.324   -2.732  1.00 0.00 ? 8  PHE A CE2  6  
ATOM 7896  C CZ   . PHE A 1 9  ? 151.014 0.105   -2.212  1.00 0.00 ? 8  PHE A CZ   6  
ATOM 7897  H H    . PHE A 1 9  ? 150.041 5.331   -2.941  1.00 0.00 ? 8  PHE A H    6  
ATOM 7898  H HA   . PHE A 1 9  ? 152.808 4.704   -2.202  1.00 0.00 ? 8  PHE A HA   6  
ATOM 7899  H HB2  . PHE A 1 9  ? 151.182 4.135   -4.688  1.00 0.00 ? 8  PHE A HB2  6  
ATOM 7900  H HB3  . PHE A 1 9  ? 152.896 3.765   -4.552  1.00 0.00 ? 8  PHE A HB3  6  
ATOM 7901  H HD1  . PHE A 1 9  ? 149.628 3.101   -2.890  1.00 0.00 ? 8  PHE A HD1  6  
ATOM 7902  H HD2  . PHE A 1 9  ? 153.568 1.713   -3.712  1.00 0.00 ? 8  PHE A HD2  6  
ATOM 7903  H HE1  . PHE A 1 9  ? 149.076 0.935   -1.864  1.00 0.00 ? 8  PHE A HE1  6  
ATOM 7904  H HE2  . PHE A 1 9  ? 153.020 -0.455  -2.688  1.00 0.00 ? 8  PHE A HE2  6  
ATOM 7905  H HZ   . PHE A 1 9  ? 150.773 -0.847  -1.762  1.00 0.00 ? 8  PHE A HZ   6  
ATOM 7906  N N    . GLU A 1 10 ? 154.008 6.554   -3.370  1.00 0.00 ? 9  GLU A N    6  
ATOM 7907  C CA   . GLU A 1 10 ? 154.688 7.706   -3.965  1.00 0.00 ? 9  GLU A CA   6  
ATOM 7908  C C    . GLU A 1 10 ? 155.923 7.283   -4.765  1.00 0.00 ? 9  GLU A C    6  
ATOM 7909  O O    . GLU A 1 10 ? 156.784 6.556   -4.263  1.00 0.00 ? 9  GLU A O    6  
ATOM 7910  C CB   . GLU A 1 10 ? 155.087 8.710   -2.878  1.00 0.00 ? 9  GLU A CB   6  
ATOM 7911  C CG   . GLU A 1 10 ? 154.880 10.161  -3.286  1.00 0.00 ? 9  GLU A CG   6  
ATOM 7912  C CD   . GLU A 1 10 ? 154.937 11.114  -2.108  1.00 0.00 ? 9  GLU A CD   6  
ATOM 7913  O OE1  . GLU A 1 10 ? 156.048 11.569  -1.764  1.00 0.00 ? 9  GLU A OE1  6  
ATOM 7914  O OE2  . GLU A 1 10 ? 153.869 11.406  -1.528  1.00 0.00 ? 9  GLU A OE2  6  
ATOM 7915  H H    . GLU A 1 10 ? 154.490 5.996   -2.724  1.00 0.00 ? 9  GLU A H    6  
ATOM 7916  H HA   . GLU A 1 10 ? 153.992 8.183   -4.638  1.00 0.00 ? 9  GLU A HA   6  
ATOM 7917  H HB2  . GLU A 1 10 ? 154.495 8.520   -1.994  1.00 0.00 ? 9  GLU A HB2  6  
ATOM 7918  H HB3  . GLU A 1 10 ? 156.131 8.571   -2.638  1.00 0.00 ? 9  GLU A HB3  6  
ATOM 7919  H HG2  . GLU A 1 10 ? 155.651 10.438  -3.989  1.00 0.00 ? 9  GLU A HG2  6  
ATOM 7920  H HG3  . GLU A 1 10 ? 153.913 10.255  -3.759  1.00 0.00 ? 9  GLU A HG3  6  
ATOM 7921  N N    . HIS A 1 11 ? 156.000 7.754   -6.012  1.00 0.00 ? 10 HIS A N    6  
ATOM 7922  C CA   . HIS A 1 11 ? 157.123 7.446   -6.897  1.00 0.00 ? 10 HIS A CA   6  
ATOM 7923  C C    . HIS A 1 11 ? 157.487 8.663   -7.743  1.00 0.00 ? 10 HIS A C    6  
ATOM 7924  O O    . HIS A 1 11 ? 156.660 9.159   -8.510  1.00 0.00 ? 10 HIS A O    6  
ATOM 7925  C CB   . HIS A 1 11 ? 156.773 6.275   -7.818  1.00 0.00 ? 10 HIS A CB   6  
ATOM 7926  C CG   . HIS A 1 11 ? 157.947 5.743   -8.586  1.00 0.00 ? 10 HIS A CG   6  
ATOM 7927  N ND1  . HIS A 1 11 ? 158.030 5.786   -9.963  1.00 0.00 ? 10 HIS A ND1  6  
ATOM 7928  C CD2  . HIS A 1 11 ? 159.085 5.144   -8.162  1.00 0.00 ? 10 HIS A CD2  6  
ATOM 7929  C CE1  . HIS A 1 11 ? 159.167 5.234   -10.351 1.00 0.00 ? 10 HIS A CE1  6  
ATOM 7930  N NE2  . HIS A 1 11 ? 159.824 4.838   -9.278  1.00 0.00 ? 10 HIS A NE2  6  
ATOM 7931  H H    . HIS A 1 11 ? 155.281 8.332   -6.345  1.00 0.00 ? 10 HIS A H    6  
ATOM 7932  H HA   . HIS A 1 11 ? 157.970 7.176   -6.284  1.00 0.00 ? 10 HIS A HA   6  
ATOM 7933  H HB2  . HIS A 1 11 ? 156.367 5.467   -7.226  1.00 0.00 ? 10 HIS A HB2  6  
ATOM 7934  H HB3  . HIS A 1 11 ? 156.029 6.600   -8.532  1.00 0.00 ? 10 HIS A HB3  6  
ATOM 7935  H HD1  . HIS A 1 11 ? 157.360 6.170   -10.566 1.00 0.00 ? 10 HIS A HD1  6  
ATOM 7936  H HD2  . HIS A 1 11 ? 159.361 4.948   -7.136  1.00 0.00 ? 10 HIS A HD2  6  
ATOM 7937  H HE1  . HIS A 1 11 ? 159.499 5.122   -11.373 1.00 0.00 ? 10 HIS A HE1  6  
ATOM 7938  H HE2  . HIS A 1 11 ? 160.713 4.425   -9.278  1.00 0.00 ? 10 HIS A HE2  6  
ATOM 7939  N N    . ASN A 1 12 ? 158.728 9.135   -7.605  1.00 0.00 ? 11 ASN A N    6  
ATOM 7940  C CA   . ASN A 1 12 ? 159.202 10.294  -8.364  1.00 0.00 ? 11 ASN A CA   6  
ATOM 7941  C C    . ASN A 1 12 ? 158.280 11.504  -8.157  1.00 0.00 ? 11 ASN A C    6  
ATOM 7942  O O    . ASN A 1 12 ? 158.015 12.263  -9.092  1.00 0.00 ? 11 ASN A O    6  
ATOM 7943  C CB   . ASN A 1 12 ? 159.297 9.941   -9.856  1.00 0.00 ? 11 ASN A CB   6  
ATOM 7944  C CG   . ASN A 1 12 ? 160.142 10.925  -10.647 1.00 0.00 ? 11 ASN A CG   6  
ATOM 7945  O OD1  . ASN A 1 12 ? 160.874 11.736  -10.077 1.00 0.00 ? 11 ASN A OD1  6  
ATOM 7946  N ND2  . ASN A 1 12 ? 160.043 10.863  -11.973 1.00 0.00 ? 11 ASN A ND2  6  
ATOM 7947  H H    . ASN A 1 12 ? 159.341 8.693   -6.982  1.00 0.00 ? 11 ASN A H    6  
ATOM 7948  H HA   . ASN A 1 12 ? 160.187 10.545  -8.001  1.00 0.00 ? 11 ASN A HA   6  
ATOM 7949  H HB2  . ASN A 1 12 ? 159.739 8.963   -9.958  1.00 0.00 ? 11 ASN A HB2  6  
ATOM 7950  H HB3  . ASN A 1 12 ? 158.301 9.926   -10.278 1.00 0.00 ? 11 ASN A HB3  6  
ATOM 7951  H HD21 . ASN A 1 12 ? 159.439 10.195  -12.363 1.00 0.00 ? 11 ASN A HD21 6  
ATOM 7952  H HD22 . ASN A 1 12 ? 160.578 11.487  -12.507 1.00 0.00 ? 11 ASN A HD22 6  
ATOM 7953  N N    . GLY A 1 13 ? 157.789 11.673  -6.924  1.00 0.00 ? 12 GLY A N    6  
ATOM 7954  C CA   . GLY A 1 13 ? 156.899 12.785  -6.612  1.00 0.00 ? 12 GLY A CA   6  
ATOM 7955  C C    . GLY A 1 13 ? 155.434 12.505  -6.938  1.00 0.00 ? 12 GLY A C    6  
ATOM 7956  O O    . GLY A 1 13 ? 154.549 13.235  -6.484  1.00 0.00 ? 12 GLY A O    6  
ATOM 7957  H H    . GLY A 1 13 ? 158.032 11.036  -6.220  1.00 0.00 ? 12 GLY A H    6  
ATOM 7958  H HA2  . GLY A 1 13 ? 156.983 13.008  -5.558  1.00 0.00 ? 12 GLY A HA2  6  
ATOM 7959  H HA3  . GLY A 1 13 ? 157.217 13.650  -7.173  1.00 0.00 ? 12 GLY A HA3  6  
ATOM 7960  N N    . GLU A 1 14 ? 155.172 11.453  -7.718  1.00 0.00 ? 13 GLU A N    6  
ATOM 7961  C CA   . GLU A 1 14 ? 153.806 11.096  -8.093  1.00 0.00 ? 13 GLU A CA   6  
ATOM 7962  C C    . GLU A 1 14 ? 153.174 10.183  -7.042  1.00 0.00 ? 13 GLU A C    6  
ATOM 7963  O O    . GLU A 1 14 ? 153.689 9.100   -6.760  1.00 0.00 ? 13 GLU A O    6  
ATOM 7964  C CB   . GLU A 1 14 ? 153.800 10.406  -9.461  1.00 0.00 ? 13 GLU A CB   6  
ATOM 7965  C CG   . GLU A 1 14 ? 152.767 10.964  -10.429 1.00 0.00 ? 13 GLU A CG   6  
ATOM 7966  C CD   . GLU A 1 14 ? 152.980 10.482  -11.852 1.00 0.00 ? 13 GLU A CD   6  
ATOM 7967  O OE1  . GLU A 1 14 ? 152.463 9.397   -12.195 1.00 0.00 ? 13 GLU A OE1  6  
ATOM 7968  O OE2  . GLU A 1 14 ? 153.665 11.186  -12.623 1.00 0.00 ? 13 GLU A OE2  6  
ATOM 7969  H H    . GLU A 1 14 ? 155.912 10.905  -8.048  1.00 0.00 ? 13 GLU A H    6  
ATOM 7970  H HA   . GLU A 1 14 ? 153.231 12.006  -8.154  1.00 0.00 ? 13 GLU A HA   6  
ATOM 7971  H HB2  . GLU A 1 14 ? 154.777 10.517  -9.909  1.00 0.00 ? 13 GLU A HB2  6  
ATOM 7972  H HB3  . GLU A 1 14 ? 153.599 9.354   -9.320  1.00 0.00 ? 13 GLU A HB3  6  
ATOM 7973  H HG2  . GLU A 1 14 ? 151.785 10.656  -10.104 1.00 0.00 ? 13 GLU A HG2  6  
ATOM 7974  H HG3  . GLU A 1 14 ? 152.827 12.044  -10.417 1.00 0.00 ? 13 GLU A HG3  6  
ATOM 7975  N N    . ARG A 1 15 ? 152.057 10.633  -6.466  1.00 0.00 ? 14 ARG A N    6  
ATOM 7976  C CA   . ARG A 1 15 ? 151.350 9.862   -5.442  1.00 0.00 ? 14 ARG A CA   6  
ATOM 7977  C C    . ARG A 1 15 ? 150.141 9.131   -6.030  1.00 0.00 ? 14 ARG A C    6  
ATOM 7978  O O    . ARG A 1 15 ? 149.576 9.557   -7.040  1.00 0.00 ? 14 ARG A O    6  
ATOM 7979  C CB   . ARG A 1 15 ? 150.899 10.775  -4.293  1.00 0.00 ? 14 ARG A CB   6  
ATOM 7980  C CG   . ARG A 1 15 ? 149.900 11.846  -4.710  1.00 0.00 ? 14 ARG A CG   6  
ATOM 7981  C CD   . ARG A 1 15 ? 149.213 12.472  -3.504  1.00 0.00 ? 14 ARG A CD   6  
ATOM 7982  N NE   . ARG A 1 15 ? 148.839 13.866  -3.746  1.00 0.00 ? 14 ARG A NE   6  
ATOM 7983  C CZ   . ARG A 1 15 ? 148.570 14.749  -2.779  1.00 0.00 ? 14 ARG A CZ   6  
ATOM 7984  N NH1  . ARG A 1 15 ? 148.635 14.389  -1.499  1.00 0.00 ? 14 ARG A NH1  6  
ATOM 7985  N NH2  . ARG A 1 15 ? 148.239 15.997  -3.092  1.00 0.00 ? 14 ARG A NH2  6  
ATOM 7986  H H    . ARG A 1 15 ? 151.699 11.506  -6.734  1.00 0.00 ? 14 ARG A H    6  
ATOM 7987  H HA   . ARG A 1 15 ? 152.039 9.128   -5.052  1.00 0.00 ? 14 ARG A HA   6  
ATOM 7988  H HB2  . ARG A 1 15 ? 150.440 10.167  -3.528  1.00 0.00 ? 14 ARG A HB2  6  
ATOM 7989  H HB3  . ARG A 1 15 ? 151.767 11.265  -3.877  1.00 0.00 ? 14 ARG A HB3  6  
ATOM 7990  H HG2  . ARG A 1 15 ? 150.422 12.618  -5.254  1.00 0.00 ? 14 ARG A HG2  6  
ATOM 7991  H HG3  . ARG A 1 15 ? 149.150 11.398  -5.347  1.00 0.00 ? 14 ARG A HG3  6  
ATOM 7992  H HD2  . ARG A 1 15 ? 148.322 11.905  -3.279  1.00 0.00 ? 14 ARG A HD2  6  
ATOM 7993  H HD3  . ARG A 1 15 ? 149.888 12.430  -2.662  1.00 0.00 ? 14 ARG A HD3  6  
ATOM 7994  H HE   . ARG A 1 15 ? 148.786 14.162  -4.680  1.00 0.00 ? 14 ARG A HE   6  
ATOM 7995  H HH11 . ARG A 1 15 ? 148.885 13.454  -1.252  1.00 0.00 ? 14 ARG A HH11 6  
ATOM 7996  H HH12 . ARG A 1 15 ? 148.432 15.056  -0.781  1.00 0.00 ? 14 ARG A HH12 6  
ATOM 7997  H HH21 . ARG A 1 15 ? 148.191 16.276  -4.052  1.00 0.00 ? 14 ARG A HH21 6  
ATOM 7998  H HH22 . ARG A 1 15 ? 148.038 16.659  -2.370  1.00 0.00 ? 14 ARG A HH22 6  
ATOM 7999  N N    . ARG A 1 16 ? 149.746 8.031   -5.386  1.00 0.00 ? 15 ARG A N    6  
ATOM 8000  C CA   . ARG A 1 16 ? 148.604 7.237   -5.834  1.00 0.00 ? 15 ARG A CA   6  
ATOM 8001  C C    . ARG A 1 16 ? 147.774 6.755   -4.644  1.00 0.00 ? 15 ARG A C    6  
ATOM 8002  O O    . ARG A 1 16 ? 148.324 6.370   -3.610  1.00 0.00 ? 15 ARG A O    6  
ATOM 8003  C CB   . ARG A 1 16 ? 149.081 6.040   -6.661  1.00 0.00 ? 15 ARG A CB   6  
ATOM 8004  C CG   . ARG A 1 16 ? 148.921 6.232   -8.160  1.00 0.00 ? 15 ARG A CG   6  
ATOM 8005  C CD   . ARG A 1 16 ? 149.751 5.227   -8.943  1.00 0.00 ? 15 ARG A CD   6  
ATOM 8006  N NE   . ARG A 1 16 ? 149.565 5.369   -10.387 1.00 0.00 ? 15 ARG A NE   6  
ATOM 8007  C CZ   . ARG A 1 16 ? 148.508 4.898   -11.056 1.00 0.00 ? 15 ARG A CZ   6  
ATOM 8008  N NH1  . ARG A 1 16 ? 147.537 4.247   -10.416 1.00 0.00 ? 15 ARG A NH1  6  
ATOM 8009  N NH2  . ARG A 1 16 ? 148.420 5.080   -12.370 1.00 0.00 ? 15 ARG A NH2  6  
ATOM 8010  H H    . ARG A 1 16 ? 150.237 7.746   -4.585  1.00 0.00 ? 15 ARG A H    6  
ATOM 8011  H HA   . ARG A 1 16 ? 147.986 7.869   -6.454  1.00 0.00 ? 15 ARG A HA   6  
ATOM 8012  H HB2  . ARG A 1 16 ? 150.127 5.867   -6.451  1.00 0.00 ? 15 ARG A HB2  6  
ATOM 8013  H HB3  . ARG A 1 16 ? 148.516 5.166   -6.370  1.00 0.00 ? 15 ARG A HB3  6  
ATOM 8014  H HG2  . ARG A 1 16 ? 147.881 6.105   -8.420  1.00 0.00 ? 15 ARG A HG2  6  
ATOM 8015  H HG3  . ARG A 1 16 ? 149.240 7.232   -8.422  1.00 0.00 ? 15 ARG A HG3  6  
ATOM 8016  H HD2  . ARG A 1 16 ? 150.795 5.377   -8.707  1.00 0.00 ? 15 ARG A HD2  6  
ATOM 8017  H HD3  . ARG A 1 16 ? 149.457 4.230   -8.648  1.00 0.00 ? 15 ARG A HD3  6  
ATOM 8018  H HE   . ARG A 1 16 ? 150.266 5.841   -10.886 1.00 0.00 ? 15 ARG A HE   6  
ATOM 8019  H HH11 . ARG A 1 16 ? 147.594 4.104   -9.428  1.00 0.00 ? 15 ARG A HH11 6  
ATOM 8020  H HH12 . ARG A 1 16 ? 146.749 3.898   -10.925 1.00 0.00 ? 15 ARG A HH12 6  
ATOM 8021  H HH21 . ARG A 1 16 ? 149.146 5.568   -12.857 1.00 0.00 ? 15 ARG A HH21 6  
ATOM 8022  H HH22 . ARG A 1 16 ? 147.631 4.730   -12.874 1.00 0.00 ? 15 ARG A HH22 6  
ATOM 8023  N N    . ILE A 1 17 ? 146.449 6.784   -4.796  1.00 0.00 ? 16 ILE A N    6  
ATOM 8024  C CA   . ILE A 1 17 ? 145.541 6.355   -3.734  1.00 0.00 ? 16 ILE A CA   6  
ATOM 8025  C C    . ILE A 1 17 ? 144.866 5.028   -4.085  1.00 0.00 ? 16 ILE A C    6  
ATOM 8026  O O    . ILE A 1 17 ? 144.087 4.952   -5.037  1.00 0.00 ? 16 ILE A O    6  
ATOM 8027  C CB   . ILE A 1 17 ? 144.448 7.416   -3.462  1.00 0.00 ? 16 ILE A CB   6  
ATOM 8028  C CG1  . ILE A 1 17 ? 145.071 8.806   -3.298  1.00 0.00 ? 16 ILE A CG1  6  
ATOM 8029  C CG2  . ILE A 1 17 ? 143.637 7.045   -2.227  1.00 0.00 ? 16 ILE A CG2  6  
ATOM 8030  C CD1  . ILE A 1 17 ? 144.061 9.931   -3.370  1.00 0.00 ? 16 ILE A CD1  6  
ATOM 8031  H H    . ILE A 1 17 ? 146.073 7.105   -5.643  1.00 0.00 ? 16 ILE A H    6  
ATOM 8032  H HA   . ILE A 1 17 ? 146.122 6.226   -2.831  1.00 0.00 ? 16 ILE A HA   6  
ATOM 8033  H HB   . ILE A 1 17 ? 143.777 7.430   -4.308  1.00 0.00 ? 16 ILE A HB   6  
ATOM 8034  H HG12 . ILE A 1 17 ? 145.562 8.863   -2.338  1.00 0.00 ? 16 ILE A HG12 6  
ATOM 8035  H HG13 . ILE A 1 17 ? 145.799 8.963   -4.080  1.00 0.00 ? 16 ILE A HG13 6  
ATOM 8036  H HG21 . ILE A 1 17 ? 144.292 6.979   -1.371  1.00 0.00 ? 16 ILE A HG21 6  
ATOM 8037  H HG22 . ILE A 1 17 ? 143.155 6.091   -2.386  1.00 0.00 ? 16 ILE A HG22 6  
ATOM 8038  H HG23 . ILE A 1 17 ? 142.887 7.801   -2.049  1.00 0.00 ? 16 ILE A HG23 6  
ATOM 8039  H HD11 . ILE A 1 17 ? 144.427 10.781  -2.815  1.00 0.00 ? 16 ILE A HD11 6  
ATOM 8040  H HD12 . ILE A 1 17 ? 143.124 9.601   -2.946  1.00 0.00 ? 16 ILE A HD12 6  
ATOM 8041  H HD13 . ILE A 1 17 ? 143.909 10.212  -4.402  1.00 0.00 ? 16 ILE A HD13 6  
ATOM 8042  N N    . ILE A 1 18 ? 145.168 3.984   -3.309  1.00 0.00 ? 17 ILE A N    6  
ATOM 8043  C CA   . ILE A 1 18 ? 144.587 2.661   -3.538  1.00 0.00 ? 17 ILE A CA   6  
ATOM 8044  C C    . ILE A 1 18 ? 144.225 1.979   -2.218  1.00 0.00 ? 17 ILE A C    6  
ATOM 8045  O O    . ILE A 1 18 ? 145.003 2.005   -1.261  1.00 0.00 ? 17 ILE A O    6  
ATOM 8046  C CB   . ILE A 1 18 ? 145.545 1.743   -4.331  1.00 0.00 ? 17 ILE A CB   6  
ATOM 8047  C CG1  . ILE A 1 18 ? 146.123 2.480   -5.544  1.00 0.00 ? 17 ILE A CG1  6  
ATOM 8048  C CG2  . ILE A 1 18 ? 144.823 0.476   -4.773  1.00 0.00 ? 17 ILE A CG2  6  
ATOM 8049  C CD1  . ILE A 1 18 ? 147.237 1.726   -6.236  1.00 0.00 ? 17 ILE A CD1  6  
ATOM 8050  H H    . ILE A 1 18 ? 145.795 4.106   -2.564  1.00 0.00 ? 17 ILE A H    6  
ATOM 8051  H HA   . ILE A 1 18 ? 143.686 2.792   -4.120  1.00 0.00 ? 17 ILE A HA   6  
ATOM 8052  H HB   . ILE A 1 18 ? 146.354 1.455   -3.676  1.00 0.00 ? 17 ILE A HB   6  
ATOM 8053  H HG12 . ILE A 1 18 ? 145.337 2.645   -6.265  1.00 0.00 ? 17 ILE A HG12 6  
ATOM 8054  H HG13 . ILE A 1 18 ? 146.517 3.434   -5.225  1.00 0.00 ? 17 ILE A HG13 6  
ATOM 8055  H HG21 . ILE A 1 18 ? 143.812 0.719   -5.066  1.00 0.00 ? 17 ILE A HG21 6  
ATOM 8056  H HG22 . ILE A 1 18 ? 144.801 -0.230  -3.957  1.00 0.00 ? 17 ILE A HG22 6  
ATOM 8057  H HG23 . ILE A 1 18 ? 145.344 0.038   -5.612  1.00 0.00 ? 17 ILE A HG23 6  
ATOM 8058  H HD11 . ILE A 1 18 ? 148.143 2.315   -6.208  1.00 0.00 ? 17 ILE A HD11 6  
ATOM 8059  H HD12 . ILE A 1 18 ? 146.961 1.537   -7.262  1.00 0.00 ? 17 ILE A HD12 6  
ATOM 8060  H HD13 . ILE A 1 18 ? 147.404 0.786   -5.730  1.00 0.00 ? 17 ILE A HD13 6  
ATOM 8061  N N    . ALA A 1 19 ? 143.040 1.368   -2.176  1.00 0.00 ? 18 ALA A N    6  
ATOM 8062  C CA   . ALA A 1 19 ? 142.571 0.676   -0.978  1.00 0.00 ? 18 ALA A CA   6  
ATOM 8063  C C    . ALA A 1 19 ? 142.853 -0.824  -1.057  1.00 0.00 ? 18 ALA A C    6  
ATOM 8064  O O    . ALA A 1 19 ? 142.588 -1.461  -2.078  1.00 0.00 ? 18 ALA A O    6  
ATOM 8065  C CB   . ALA A 1 19 ? 141.082 0.924   -0.773  1.00 0.00 ? 18 ALA A CB   6  
ATOM 8066  H H    . ALA A 1 19 ? 142.468 1.382   -2.972  1.00 0.00 ? 18 ALA A H    6  
ATOM 8067  H HA   . ALA A 1 19 ? 143.099 1.086   -0.129  1.00 0.00 ? 18 ALA A HA   6  
ATOM 8068  H HB1  . ALA A 1 19 ? 140.946 1.792   -0.144  1.00 0.00 ? 18 ALA A HB1  6  
ATOM 8069  H HB2  . ALA A 1 19 ? 140.635 0.063   -0.299  1.00 0.00 ? 18 ALA A HB2  6  
ATOM 8070  H HB3  . ALA A 1 19 ? 140.610 1.095   -1.729  1.00 0.00 ? 18 ALA A HB3  6  
ATOM 8071  N N    . PHE A 1 20 ? 143.390 -1.380  0.030   1.00 0.00 ? 19 PHE A N    6  
ATOM 8072  C CA   . PHE A 1 20 ? 143.709 -2.806  0.092   1.00 0.00 ? 19 PHE A CA   6  
ATOM 8073  C C    . PHE A 1 20 ? 142.972 -3.480  1.251   1.00 0.00 ? 19 PHE A C    6  
ATOM 8074  O O    . PHE A 1 20 ? 143.025 -3.009  2.390   1.00 0.00 ? 19 PHE A O    6  
ATOM 8075  C CB   . PHE A 1 20 ? 145.220 -3.009  0.252   1.00 0.00 ? 19 PHE A CB   6  
ATOM 8076  C CG   . PHE A 1 20 ? 145.997 -2.858  -1.030  1.00 0.00 ? 19 PHE A CG   6  
ATOM 8077  C CD1  . PHE A 1 20 ? 146.118 -1.620  -1.644  1.00 0.00 ? 19 PHE A CD1  6  
ATOM 8078  C CD2  . PHE A 1 20 ? 146.608 -3.954  -1.620  1.00 0.00 ? 19 PHE A CD2  6  
ATOM 8079  C CE1  . PHE A 1 20 ? 146.832 -1.480  -2.819  1.00 0.00 ? 19 PHE A CE1  6  
ATOM 8080  C CE2  . PHE A 1 20 ? 147.323 -3.820  -2.795  1.00 0.00 ? 19 PHE A CE2  6  
ATOM 8081  C CZ   . PHE A 1 20 ? 147.435 -2.581  -3.395  1.00 0.00 ? 19 PHE A CZ   6  
ATOM 8082  H H    . PHE A 1 20 ? 143.574 -0.817  0.812   1.00 0.00 ? 19 PHE A H    6  
ATOM 8083  H HA   . PHE A 1 20 ? 143.388 -3.260  -0.834  1.00 0.00 ? 19 PHE A HA   6  
ATOM 8084  H HB2  . PHE A 1 20 ? 145.599 -2.285  0.956   1.00 0.00 ? 19 PHE A HB2  6  
ATOM 8085  H HB3  . PHE A 1 20 ? 145.402 -4.003  0.637   1.00 0.00 ? 19 PHE A HB3  6  
ATOM 8086  H HD1  . PHE A 1 20 ? 145.648 -0.758  -1.194  1.00 0.00 ? 19 PHE A HD1  6  
ATOM 8087  H HD2  . PHE A 1 20 ? 146.522 -4.925  -1.152  1.00 0.00 ? 19 PHE A HD2  6  
ATOM 8088  H HE1  . PHE A 1 20 ? 146.919 -0.511  -3.286  1.00 0.00 ? 19 PHE A HE1  6  
ATOM 8089  H HE2  . PHE A 1 20 ? 147.795 -4.682  -3.243  1.00 0.00 ? 19 PHE A HE2  6  
ATOM 8090  H HZ   . PHE A 1 20 ? 147.993 -2.473  -4.313  1.00 0.00 ? 19 PHE A HZ   6  
ATOM 8091  N N    . SER A 1 21 ? 142.292 -4.587  0.954   1.00 0.00 ? 20 SER A N    6  
ATOM 8092  C CA   . SER A 1 21 ? 141.546 -5.336  1.967   1.00 0.00 ? 20 SER A CA   6  
ATOM 8093  C C    . SER A 1 21 ? 142.478 -6.249  2.766   1.00 0.00 ? 20 SER A C    6  
ATOM 8094  O O    . SER A 1 21 ? 143.562 -6.605  2.301   1.00 0.00 ? 20 SER A O    6  
ATOM 8095  C CB   . SER A 1 21 ? 140.442 -6.170  1.307   1.00 0.00 ? 20 SER A CB   6  
ATOM 8096  O OG   . SER A 1 21 ? 140.784 -6.515  -0.027  1.00 0.00 ? 20 SER A OG   6  
ATOM 8097  H H    . SER A 1 21 ? 142.294 -4.913  0.029   1.00 0.00 ? 20 SER A H    6  
ATOM 8098  H HA   . SER A 1 21 ? 141.093 -4.623  2.643   1.00 0.00 ? 20 SER A HA   6  
ATOM 8099  H HB2  . SER A 1 21 ? 140.295 -7.079  1.870   1.00 0.00 ? 20 SER A HB2  6  
ATOM 8100  H HB3  . SER A 1 21 ? 139.524 -5.602  1.294   1.00 0.00 ? 20 SER A HB3  6  
ATOM 8101  H HG   . SER A 1 21 ? 140.302 -5.953  -0.639  1.00 0.00 ? 20 SER A HG   6  
ATOM 8102  N N    . ARG A 1 22 ? 142.047 -6.624  3.970   1.00 0.00 ? 21 ARG A N    6  
ATOM 8103  C CA   . ARG A 1 22 ? 142.842 -7.495  4.835   1.00 0.00 ? 21 ARG A CA   6  
ATOM 8104  C C    . ARG A 1 22 ? 142.213 -8.883  4.946   1.00 0.00 ? 21 ARG A C    6  
ATOM 8105  O O    . ARG A 1 22 ? 141.000 -9.038  4.782   1.00 0.00 ? 21 ARG A O    6  
ATOM 8106  C CB   . ARG A 1 22 ? 142.986 -6.876  6.228   1.00 0.00 ? 21 ARG A CB   6  
ATOM 8107  C CG   . ARG A 1 22 ? 143.360 -5.401  6.205   1.00 0.00 ? 21 ARG A CG   6  
ATOM 8108  C CD   . ARG A 1 22 ? 143.954 -4.954  7.531   1.00 0.00 ? 21 ARG A CD   6  
ATOM 8109  N NE   . ARG A 1 22 ? 143.008 -4.160  8.312   1.00 0.00 ? 21 ARG A NE   6  
ATOM 8110  C CZ   . ARG A 1 22 ? 142.114 -4.678  9.160   1.00 0.00 ? 21 ARG A CZ   6  
ATOM 8111  N NH1  . ARG A 1 22 ? 142.041 -5.996  9.349   1.00 0.00 ? 21 ARG A NH1  6  
ATOM 8112  N NH2  . ARG A 1 22 ? 141.284 -3.875  9.817   1.00 0.00 ? 21 ARG A NH2  6  
ATOM 8113  H H    . ARG A 1 22 ? 141.175 -6.309  4.284   1.00 0.00 ? 21 ARG A H    6  
ATOM 8114  H HA   . ARG A 1 22 ? 143.822 -7.592  4.393   1.00 0.00 ? 21 ARG A HA   6  
ATOM 8115  H HB2  . ARG A 1 22 ? 142.047 -6.981  6.753   1.00 0.00 ? 21 ARG A HB2  6  
ATOM 8116  H HB3  . ARG A 1 22 ? 143.751 -7.411  6.769   1.00 0.00 ? 21 ARG A HB3  6  
ATOM 8117  H HG2  . ARG A 1 22 ? 144.084 -5.235  5.423   1.00 0.00 ? 21 ARG A HG2  6  
ATOM 8118  H HG3  . ARG A 1 22 ? 142.472 -4.820  6.005   1.00 0.00 ? 21 ARG A HG3  6  
ATOM 8119  H HD2  . ARG A 1 22 ? 144.234 -5.827  8.101   1.00 0.00 ? 21 ARG A HD2  6  
ATOM 8120  H HD3  . ARG A 1 22 ? 144.833 -4.358  7.334   1.00 0.00 ? 21 ARG A HD3  6  
ATOM 8121  H HE   . ARG A 1 22 ? 143.037 -3.186  8.197   1.00 0.00 ? 21 ARG A HE   6  
ATOM 8122  H HH11 . ARG A 1 22 ? 142.657 -6.610  8.855   1.00 0.00 ? 21 ARG A HH11 6  
ATOM 8123  H HH12 . ARG A 1 22 ? 141.367 -6.374  9.985   1.00 0.00 ? 21 ARG A HH12 6  
ATOM 8124  H HH21 . ARG A 1 22 ? 141.329 -2.886  9.678   1.00 0.00 ? 21 ARG A HH21 6  
ATOM 8125  H HH22 . ARG A 1 22 ? 140.614 -4.259  10.453  1.00 0.00 ? 21 ARG A HH22 6  
ATOM 8126  N N    . PRO A 1 23 ? 143.033 -9.917  5.227   1.00 0.00 ? 22 PRO A N    6  
ATOM 8127  C CA   . PRO A 1 23 ? 144.481 -9.764  5.428   1.00 0.00 ? 22 PRO A CA   6  
ATOM 8128  C C    . PRO A 1 23 ? 145.242 -9.560  4.117   1.00 0.00 ? 22 PRO A C    6  
ATOM 8129  O O    . PRO A 1 23 ? 145.046 -10.303 3.153   1.00 0.00 ? 22 PRO A O    6  
ATOM 8130  C CB   . PRO A 1 23 ? 144.884 -11.089 6.073   1.00 0.00 ? 22 PRO A CB   6  
ATOM 8131  C CG   . PRO A 1 23 ? 143.893 -12.076 5.559   1.00 0.00 ? 22 PRO A CG   6  
ATOM 8132  C CD   . PRO A 1 23 ? 142.602 -11.321 5.372   1.00 0.00 ? 22 PRO A CD   6  
ATOM 8133  H HA   . PRO A 1 23 ? 144.704 -8.951  6.102   1.00 0.00 ? 22 PRO A HA   6  
ATOM 8134  H HB2  . PRO A 1 23 ? 145.890 -11.347 5.774   1.00 0.00 ? 22 PRO A HB2  6  
ATOM 8135  H HB3  . PRO A 1 23 ? 144.833 -11.001 7.147   1.00 0.00 ? 22 PRO A HB3  6  
ATOM 8136  H HG2  . PRO A 1 23 ? 144.231 -12.477 4.614   1.00 0.00 ? 22 PRO A HG2  6  
ATOM 8137  H HG3  . PRO A 1 23 ? 143.761 -12.870 6.278   1.00 0.00 ? 22 PRO A HG3  6  
ATOM 8138  H HD2  . PRO A 1 23 ? 142.092 -11.660 4.482   1.00 0.00 ? 22 PRO A HD2  6  
ATOM 8139  H HD3  . PRO A 1 23 ? 141.968 -11.440 6.239   1.00 0.00 ? 22 PRO A HD3  6  
ATOM 8140  N N    . VAL A 1 24 ? 146.116 -8.554  4.094   1.00 0.00 ? 23 VAL A N    6  
ATOM 8141  C CA   . VAL A 1 24 ? 146.913 -8.257  2.907   1.00 0.00 ? 23 VAL A CA   6  
ATOM 8142  C C    . VAL A 1 24 ? 148.365 -8.701  3.100   1.00 0.00 ? 23 VAL A C    6  
ATOM 8143  O O    . VAL A 1 24 ? 149.022 -8.317  4.071   1.00 0.00 ? 23 VAL A O    6  
ATOM 8144  C CB   . VAL A 1 24 ? 146.864 -6.752  2.547   1.00 0.00 ? 23 VAL A CB   6  
ATOM 8145  C CG1  . VAL A 1 24 ? 147.471 -5.898  3.653   1.00 0.00 ? 23 VAL A CG1  6  
ATOM 8146  C CG2  . VAL A 1 24 ? 147.566 -6.496  1.220   1.00 0.00 ? 23 VAL A CG2  6  
ATOM 8147  H H    . VAL A 1 24 ? 146.231 -8.002  4.896   1.00 0.00 ? 23 VAL A H    6  
ATOM 8148  H HA   . VAL A 1 24 ? 146.491 -8.813  2.082   1.00 0.00 ? 23 VAL A HA   6  
ATOM 8149  H HB   . VAL A 1 24 ? 145.828 -6.466  2.437   1.00 0.00 ? 23 VAL A HB   6  
ATOM 8150  H HG11 . VAL A 1 24 ? 148.539 -6.052  3.682   1.00 0.00 ? 23 VAL A HG11 6  
ATOM 8151  H HG12 . VAL A 1 24 ? 147.041 -6.180  4.602   1.00 0.00 ? 23 VAL A HG12 6  
ATOM 8152  H HG13 . VAL A 1 24 ? 147.263 -4.856  3.459   1.00 0.00 ? 23 VAL A HG13 6  
ATOM 8153  H HG21 . VAL A 1 24 ? 146.950 -6.860  0.411   1.00 0.00 ? 23 VAL A HG21 6  
ATOM 8154  H HG22 . VAL A 1 24 ? 148.516 -7.011  1.209   1.00 0.00 ? 23 VAL A HG22 6  
ATOM 8155  H HG23 . VAL A 1 24 ? 147.730 -5.436  1.097   1.00 0.00 ? 23 VAL A HG23 6  
ATOM 8156  N N    . LYS A 1 25 ? 148.857 -9.514  2.168   1.00 0.00 ? 24 LYS A N    6  
ATOM 8157  C CA   . LYS A 1 25 ? 150.227 -10.015 2.228   1.00 0.00 ? 24 LYS A CA   6  
ATOM 8158  C C    . LYS A 1 25 ? 151.190 -9.035  1.564   1.00 0.00 ? 24 LYS A C    6  
ATOM 8159  O O    . LYS A 1 25 ? 150.898 -8.496  0.494   1.00 0.00 ? 24 LYS A O    6  
ATOM 8160  C CB   . LYS A 1 25 ? 150.325 -11.382 1.543   1.00 0.00 ? 24 LYS A CB   6  
ATOM 8161  C CG   . LYS A 1 25 ? 150.080 -12.560 2.475   1.00 0.00 ? 24 LYS A CG   6  
ATOM 8162  C CD   . LYS A 1 25 ? 149.050 -13.519 1.898   1.00 0.00 ? 24 LYS A CD   6  
ATOM 8163  C CE   . LYS A 1 25 ? 149.560 -14.952 1.892   1.00 0.00 ? 24 LYS A CE   6  
ATOM 8164  N NZ   . LYS A 1 25 ? 148.645 -15.865 1.152   1.00 0.00 ? 24 LYS A NZ   6  
ATOM 8165  H H    . LYS A 1 25 ? 148.284 -9.785  1.420   1.00 0.00 ? 24 LYS A H    6  
ATOM 8166  H HA   . LYS A 1 25 ? 150.498 -10.120 3.268   1.00 0.00 ? 24 LYS A HA   6  
ATOM 8167  H HB2  . LYS A 1 25 ? 149.596 -11.424 0.748   1.00 0.00 ? 24 LYS A HB2  6  
ATOM 8168  H HB3  . LYS A 1 25 ? 151.312 -11.488 1.118   1.00 0.00 ? 24 LYS A HB3  6  
ATOM 8169  H HG2  . LYS A 1 25 ? 151.009 -13.090 2.621   1.00 0.00 ? 24 LYS A HG2  6  
ATOM 8170  H HG3  . LYS A 1 25 ? 149.722 -12.190 3.425   1.00 0.00 ? 24 LYS A HG3  6  
ATOM 8171  H HD2  . LYS A 1 25 ? 148.152 -13.470 2.496   1.00 0.00 ? 24 LYS A HD2  6  
ATOM 8172  H HD3  . LYS A 1 25 ? 148.826 -13.222 0.884   1.00 0.00 ? 24 LYS A HD3  6  
ATOM 8173  H HE2  . LYS A 1 25 ? 150.532 -14.973 1.421   1.00 0.00 ? 24 LYS A HE2  6  
ATOM 8174  H HE3  . LYS A 1 25 ? 149.648 -15.293 2.913   1.00 0.00 ? 24 LYS A HE3  6  
ATOM 8175  H HZ1  . LYS A 1 25 ? 148.337 -15.422 0.262   1.00 0.00 ? 24 LYS A HZ1  6  
ATOM 8176  H HZ2  . LYS A 1 25 ? 147.806 -16.076 1.729   1.00 0.00 ? 24 LYS A HZ2  6  
ATOM 8177  H HZ3  . LYS A 1 25 ? 149.132 -16.757 0.930   1.00 0.00 ? 24 LYS A HZ3  6  
ATOM 8178  N N    . TYR A 1 26 ? 152.344 -8.817  2.199   1.00 0.00 ? 25 TYR A N    6  
ATOM 8179  C CA   . TYR A 1 26 ? 153.363 -7.910  1.667   1.00 0.00 ? 25 TYR A CA   6  
ATOM 8180  C C    . TYR A 1 26 ? 153.762 -8.316  0.247   1.00 0.00 ? 25 TYR A C    6  
ATOM 8181  O O    . TYR A 1 26 ? 153.980 -7.460  -0.612  1.00 0.00 ? 25 TYR A O    6  
ATOM 8182  C CB   . TYR A 1 26 ? 154.600 -7.904  2.574   1.00 0.00 ? 25 TYR A CB   6  
ATOM 8183  C CG   . TYR A 1 26 ? 155.679 -6.934  2.136   1.00 0.00 ? 25 TYR A CG   6  
ATOM 8184  C CD1  . TYR A 1 26 ? 155.680 -5.619  2.585   1.00 0.00 ? 25 TYR A CD1  6  
ATOM 8185  C CD2  . TYR A 1 26 ? 156.694 -7.334  1.274   1.00 0.00 ? 25 TYR A CD2  6  
ATOM 8186  C CE1  . TYR A 1 26 ? 156.660 -4.731  2.188   1.00 0.00 ? 25 TYR A CE1  6  
ATOM 8187  C CE2  . TYR A 1 26 ? 157.679 -6.451  0.873   1.00 0.00 ? 25 TYR A CE2  6  
ATOM 8188  C CZ   . TYR A 1 26 ? 157.657 -5.151  1.332   1.00 0.00 ? 25 TYR A CZ   6  
ATOM 8189  O OH   . TYR A 1 26 ? 158.634 -4.268  0.934   1.00 0.00 ? 25 TYR A OH   6  
ATOM 8190  H H    . TYR A 1 26 ? 152.517 -9.284  3.043   1.00 0.00 ? 25 TYR A H    6  
ATOM 8191  H HA   . TYR A 1 26 ? 152.941 -6.916  1.640   1.00 0.00 ? 25 TYR A HA   6  
ATOM 8192  H HB2  . TYR A 1 26 ? 154.300 -7.635  3.575   1.00 0.00 ? 25 TYR A HB2  6  
ATOM 8193  H HB3  . TYR A 1 26 ? 155.029 -8.895  2.588   1.00 0.00 ? 25 TYR A HB3  6  
ATOM 8194  H HD1  . TYR A 1 26 ? 154.897 -5.293  3.255   1.00 0.00 ? 25 TYR A HD1  6  
ATOM 8195  H HD2  . TYR A 1 26 ? 156.707 -8.352  0.915   1.00 0.00 ? 25 TYR A HD2  6  
ATOM 8196  H HE1  . TYR A 1 26 ? 156.644 -3.714  2.548   1.00 0.00 ? 25 TYR A HE1  6  
ATOM 8197  H HE2  . TYR A 1 26 ? 158.459 -6.780  0.203   1.00 0.00 ? 25 TYR A HE2  6  
ATOM 8198  H HH   . TYR A 1 26 ? 158.516 -4.053  0.005   1.00 0.00 ? 25 TYR A HH   6  
ATOM 8199  N N    . GLU A 1 27 ? 153.851 -9.628  0.010   1.00 0.00 ? 26 GLU A N    6  
ATOM 8200  C CA   . GLU A 1 27 ? 154.218 -10.155 -1.305  1.00 0.00 ? 26 GLU A CA   6  
ATOM 8201  C C    . GLU A 1 27 ? 153.221 -9.713  -2.374  1.00 0.00 ? 26 GLU A C    6  
ATOM 8202  O O    . GLU A 1 27 ? 153.615 -9.326  -3.473  1.00 0.00 ? 26 GLU A O    6  
ATOM 8203  C CB   . GLU A 1 27 ? 154.286 -11.684 -1.270  1.00 0.00 ? 26 GLU A CB   6  
ATOM 8204  C CG   . GLU A 1 27 ? 155.379 -12.265 -2.155  1.00 0.00 ? 26 GLU A CG   6  
ATOM 8205  C CD   . GLU A 1 27 ? 155.073 -13.676 -2.623  1.00 0.00 ? 26 GLU A CD   6  
ATOM 8206  O OE1  . GLU A 1 27 ? 153.979 -13.896 -3.186  1.00 0.00 ? 26 GLU A OE1  6  
ATOM 8207  O OE2  . GLU A 1 27 ? 155.931 -14.562 -2.428  1.00 0.00 ? 26 GLU A OE2  6  
ATOM 8208  H H    . GLU A 1 27 ? 153.662 -10.257 0.738   1.00 0.00 ? 26 GLU A H    6  
ATOM 8209  H HA   . GLU A 1 27 ? 155.194 -9.766  -1.557  1.00 0.00 ? 26 GLU A HA   6  
ATOM 8210  H HB2  . GLU A 1 27 ? 154.466 -12.005 -0.254  1.00 0.00 ? 26 GLU A HB2  6  
ATOM 8211  H HB3  . GLU A 1 27 ? 153.336 -12.082 -1.601  1.00 0.00 ? 26 GLU A HB3  6  
ATOM 8212  H HG2  . GLU A 1 27 ? 155.495 -11.633 -3.022  1.00 0.00 ? 26 GLU A HG2  6  
ATOM 8213  H HG3  . GLU A 1 27 ? 156.303 -12.280 -1.596  1.00 0.00 ? 26 GLU A HG3  6  
ATOM 8214  N N    . ASP A 1 28 ? 151.928 -9.781  -2.047  1.00 0.00 ? 27 ASP A N    6  
ATOM 8215  C CA   . ASP A 1 28 ? 150.878 -9.390  -2.988  1.00 0.00 ? 27 ASP A CA   6  
ATOM 8216  C C    . ASP A 1 28 ? 150.986 -7.912  -3.351  1.00 0.00 ? 27 ASP A C    6  
ATOM 8217  O O    . ASP A 1 28 ? 150.870 -7.543  -4.520  1.00 0.00 ? 27 ASP A O    6  
ATOM 8218  C CB   . ASP A 1 28 ? 149.490 -9.688  -2.409  1.00 0.00 ? 27 ASP A CB   6  
ATOM 8219  C CG   . ASP A 1 28 ? 148.501 -10.143 -3.468  1.00 0.00 ? 27 ASP A CG   6  
ATOM 8220  O OD1  . ASP A 1 28 ? 148.846 -11.050 -4.256  1.00 0.00 ? 27 ASP A OD1  6  
ATOM 8221  O OD2  . ASP A 1 28 ? 147.380 -9.593  -3.510  1.00 0.00 ? 27 ASP A OD2  6  
ATOM 8222  H H    . ASP A 1 28 ? 151.676 -10.101 -1.155  1.00 0.00 ? 27 ASP A H    6  
ATOM 8223  H HA   . ASP A 1 28 ? 151.013 -9.975  -3.886  1.00 0.00 ? 27 ASP A HA   6  
ATOM 8224  H HB2  . ASP A 1 28 ? 149.574 -10.466 -1.666  1.00 0.00 ? 27 ASP A HB2  6  
ATOM 8225  H HB3  . ASP A 1 28 ? 149.101 -8.793  -1.943  1.00 0.00 ? 27 ASP A HB3  6  
ATOM 8226  N N    . VAL A 1 29 ? 151.219 -7.071  -2.344  1.00 0.00 ? 28 VAL A N    6  
ATOM 8227  C CA   . VAL A 1 29 ? 151.353 -5.634  -2.562  1.00 0.00 ? 28 VAL A CA   6  
ATOM 8228  C C    . VAL A 1 29 ? 152.643 -5.327  -3.322  1.00 0.00 ? 28 VAL A C    6  
ATOM 8229  O O    . VAL A 1 29 ? 152.642 -4.544  -4.274  1.00 0.00 ? 28 VAL A O    6  
ATOM 8230  C CB   . VAL A 1 29 ? 151.343 -4.852  -1.229  1.00 0.00 ? 28 VAL A CB   6  
ATOM 8231  C CG1  . VAL A 1 29 ? 151.360 -3.350  -1.483  1.00 0.00 ? 28 VAL A CG1  6  
ATOM 8232  C CG2  . VAL A 1 29 ? 150.133 -5.241  -0.390  1.00 0.00 ? 28 VAL A CG2  6  
ATOM 8233  H H    . VAL A 1 29 ? 151.310 -7.428  -1.434  1.00 0.00 ? 28 VAL A H    6  
ATOM 8234  H HA   . VAL A 1 29 ? 150.511 -5.307  -3.156  1.00 0.00 ? 28 VAL A HA   6  
ATOM 8235  H HB   . VAL A 1 29 ? 152.235 -5.110  -0.676  1.00 0.00 ? 28 VAL A HB   6  
ATOM 8236  H HG11 . VAL A 1 29 ? 151.025 -2.831  -0.597  1.00 0.00 ? 28 VAL A HG11 6  
ATOM 8237  H HG12 . VAL A 1 29 ? 150.702 -3.117  -2.308  1.00 0.00 ? 28 VAL A HG12 6  
ATOM 8238  H HG13 . VAL A 1 29 ? 152.365 -3.038  -1.726  1.00 0.00 ? 28 VAL A HG13 6  
ATOM 8239  H HG21 . VAL A 1 29 ? 150.333 -5.032  0.651   1.00 0.00 ? 28 VAL A HG21 6  
ATOM 8240  H HG22 . VAL A 1 29 ? 149.932 -6.294  -0.512  1.00 0.00 ? 28 VAL A HG22 6  
ATOM 8241  H HG23 . VAL A 1 29 ? 149.273 -4.671  -0.711  1.00 0.00 ? 28 VAL A HG23 6  
ATOM 8242  N N    . GLU A 1 30 ? 153.738 -5.961  -2.899  1.00 0.00 ? 29 GLU A N    6  
ATOM 8243  C CA   . GLU A 1 30 ? 155.041 -5.773  -3.535  1.00 0.00 ? 29 GLU A CA   6  
ATOM 8244  C C    . GLU A 1 30 ? 155.016 -6.218  -4.999  1.00 0.00 ? 29 GLU A C    6  
ATOM 8245  O O    . GLU A 1 30 ? 155.629 -5.582  -5.858  1.00 0.00 ? 29 GLU A O    6  
ATOM 8246  C CB   . GLU A 1 30 ? 156.116 -6.553  -2.771  1.00 0.00 ? 29 GLU A CB   6  
ATOM 8247  C CG   . GLU A 1 30 ? 157.489 -5.897  -2.801  1.00 0.00 ? 29 GLU A CG   6  
ATOM 8248  C CD   . GLU A 1 30 ? 158.297 -6.256  -4.038  1.00 0.00 ? 29 GLU A CD   6  
ATOM 8249  O OE1  . GLU A 1 30 ? 158.127 -7.378  -4.564  1.00 0.00 ? 29 GLU A OE1  6  
ATOM 8250  O OE2  . GLU A 1 30 ? 159.106 -5.413  -4.478  1.00 0.00 ? 29 GLU A OE2  6  
ATOM 8251  H H    . GLU A 1 30 ? 153.665 -6.579  -2.139  1.00 0.00 ? 29 GLU A H    6  
ATOM 8252  H HA   . GLU A 1 30 ? 155.278 -4.721  -3.496  1.00 0.00 ? 29 GLU A HA   6  
ATOM 8253  H HB2  . GLU A 1 30 ? 155.811 -6.645  -1.739  1.00 0.00 ? 29 GLU A HB2  6  
ATOM 8254  H HB3  . GLU A 1 30 ? 156.202 -7.540  -3.201  1.00 0.00 ? 29 GLU A HB3  6  
ATOM 8255  H HG2  . GLU A 1 30 ? 157.362 -4.825  -2.777  1.00 0.00 ? 29 GLU A HG2  6  
ATOM 8256  H HG3  . GLU A 1 30 ? 158.039 -6.211  -1.927  1.00 0.00 ? 29 GLU A HG3  6  
ATOM 8257  N N    . HIS A 1 31 ? 154.303 -7.312  -5.277  1.00 0.00 ? 30 HIS A N    6  
ATOM 8258  C CA   . HIS A 1 31 ? 154.201 -7.842  -6.636  1.00 0.00 ? 30 HIS A CA   6  
ATOM 8259  C C    . HIS A 1 31 ? 153.631 -6.791  -7.587  1.00 0.00 ? 30 HIS A C    6  
ATOM 8260  O O    . HIS A 1 31 ? 154.175 -6.566  -8.668  1.00 0.00 ? 30 HIS A O    6  
ATOM 8261  C CB   . HIS A 1 31 ? 153.316 -9.097  -6.655  1.00 0.00 ? 30 HIS A CB   6  
ATOM 8262  C CG   . HIS A 1 31 ? 153.752 -10.149 -7.634  1.00 0.00 ? 30 HIS A CG   6  
ATOM 8263  N ND1  . HIS A 1 31 ? 154.678 -9.924  -8.635  1.00 0.00 ? 30 HIS A ND1  6  
ATOM 8264  C CD2  . HIS A 1 31 ? 153.379 -11.446 -7.760  1.00 0.00 ? 30 HIS A CD2  6  
ATOM 8265  C CE1  . HIS A 1 31 ? 154.852 -11.035 -9.330  1.00 0.00 ? 30 HIS A CE1  6  
ATOM 8266  N NE2  . HIS A 1 31 ? 154.076 -11.973 -8.819  1.00 0.00 ? 30 HIS A NE2  6  
ATOM 8267  H H    . HIS A 1 31 ? 153.838 -7.778  -4.548  1.00 0.00 ? 30 HIS A H    6  
ATOM 8268  H HA   . HIS A 1 31 ? 155.195 -8.106  -6.963  1.00 0.00 ? 30 HIS A HA   6  
ATOM 8269  H HB2  . HIS A 1 31 ? 153.321 -9.544  -5.673  1.00 0.00 ? 30 HIS A HB2  6  
ATOM 8270  H HB3  . HIS A 1 31 ? 152.304 -8.810  -6.905  1.00 0.00 ? 30 HIS A HB3  6  
ATOM 8271  H HD1  . HIS A 1 31 ? 155.138 -9.076  -8.810  1.00 0.00 ? 30 HIS A HD1  6  
ATOM 8272  H HD2  . HIS A 1 31 ? 152.661 -11.969 -7.141  1.00 0.00 ? 30 HIS A HD2  6  
ATOM 8273  H HE1  . HIS A 1 31 ? 155.516 -11.154 -10.173 1.00 0.00 ? 30 HIS A HE1  6  
ATOM 8274  H HE2  . HIS A 1 31 ? 154.100 -12.921 -9.067  1.00 0.00 ? 30 HIS A HE2  6  
ATOM 8275  N N    . LYS A 1 32 ? 152.541 -6.143  -7.174  1.00 0.00 ? 31 LYS A N    6  
ATOM 8276  C CA   . LYS A 1 32 ? 151.911 -5.110  -7.992  1.00 0.00 ? 31 LYS A CA   6  
ATOM 8277  C C    . LYS A 1 32 ? 152.871 -3.950  -8.238  1.00 0.00 ? 31 LYS A C    6  
ATOM 8278  O O    . LYS A 1 32 ? 153.014 -3.486  -9.368  1.00 0.00 ? 31 LYS A O    6  
ATOM 8279  C CB   . LYS A 1 32 ? 150.632 -4.594  -7.328  1.00 0.00 ? 31 LYS A CB   6  
ATOM 8280  C CG   . LYS A 1 32 ? 149.367 -5.239  -7.870  1.00 0.00 ? 31 LYS A CG   6  
ATOM 8281  C CD   . LYS A 1 32 ? 148.186 -5.041  -6.930  1.00 0.00 ? 31 LYS A CD   6  
ATOM 8282  C CE   . LYS A 1 32 ? 147.809 -3.571  -6.796  1.00 0.00 ? 31 LYS A CE   6  
ATOM 8283  N NZ   . LYS A 1 32 ? 147.559 -2.932  -8.120  1.00 0.00 ? 31 LYS A NZ   6  
ATOM 8284  H H    . LYS A 1 32 ? 152.156 -6.362  -6.298  1.00 0.00 ? 31 LYS A H    6  
ATOM 8285  H HA   . LYS A 1 32 ? 151.657 -5.554  -8.943  1.00 0.00 ? 31 LYS A HA   6  
ATOM 8286  H HB2  . LYS A 1 32 ? 150.684 -4.788  -6.266  1.00 0.00 ? 31 LYS A HB2  6  
ATOM 8287  H HB3  . LYS A 1 32 ? 150.562 -3.527  -7.487  1.00 0.00 ? 31 LYS A HB3  6  
ATOM 8288  H HG2  . LYS A 1 32 ? 149.131 -4.798  -8.827  1.00 0.00 ? 31 LYS A HG2  6  
ATOM 8289  H HG3  . LYS A 1 32 ? 149.543 -6.298  -7.994  1.00 0.00 ? 31 LYS A HG3  6  
ATOM 8290  H HD2  . LYS A 1 32 ? 147.338 -5.586  -7.316  1.00 0.00 ? 31 LYS A HD2  6  
ATOM 8291  H HD3  . LYS A 1 32 ? 148.449 -5.427  -5.956  1.00 0.00 ? 31 LYS A HD3  6  
ATOM 8292  H HE2  . LYS A 1 32 ? 146.913 -3.497  -6.197  1.00 0.00 ? 31 LYS A HE2  6  
ATOM 8293  H HE3  . LYS A 1 32 ? 148.615 -3.050  -6.301  1.00 0.00 ? 31 LYS A HE3  6  
ATOM 8294  H HZ1  . LYS A 1 32 ? 147.037 -3.584  -8.741  1.00 0.00 ? 31 LYS A HZ1  6  
ATOM 8295  H HZ2  . LYS A 1 32 ? 148.461 -2.687  -8.574  1.00 0.00 ? 31 LYS A HZ2  6  
ATOM 8296  H HZ3  . LYS A 1 32 ? 146.999 -2.063  -7.998  1.00 0.00 ? 31 LYS A HZ3  6  
ATOM 8297  N N    . VAL A 1 33 ? 153.530 -3.491  -7.175  1.00 0.00 ? 32 VAL A N    6  
ATOM 8298  C CA   . VAL A 1 33 ? 154.481 -2.386  -7.279  1.00 0.00 ? 32 VAL A CA   6  
ATOM 8299  C C    . VAL A 1 33 ? 155.586 -2.710  -8.283  1.00 0.00 ? 32 VAL A C    6  
ATOM 8300  O O    . VAL A 1 33 ? 155.903 -1.897  -9.154  1.00 0.00 ? 32 VAL A O    6  
ATOM 8301  C CB   . VAL A 1 33 ? 155.119 -2.054  -5.912  1.00 0.00 ? 32 VAL A CB   6  
ATOM 8302  C CG1  . VAL A 1 33 ? 156.053 -0.857  -6.028  1.00 0.00 ? 32 VAL A CG1  6  
ATOM 8303  C CG2  . VAL A 1 33 ? 154.044 -1.798  -4.865  1.00 0.00 ? 32 VAL A CG2  6  
ATOM 8304  H H    . VAL A 1 33 ? 153.376 -3.909  -6.300  1.00 0.00 ? 32 VAL A H    6  
ATOM 8305  H HA   . VAL A 1 33 ? 153.940 -1.516  -7.623  1.00 0.00 ? 32 VAL A HA   6  
ATOM 8306  H HB   . VAL A 1 33 ? 155.702 -2.906  -5.595  1.00 0.00 ? 32 VAL A HB   6  
ATOM 8307  H HG11 . VAL A 1 33 ? 155.478 0.028   -6.250  1.00 0.00 ? 32 VAL A HG11 6  
ATOM 8308  H HG12 . VAL A 1 33 ? 156.766 -1.032  -6.820  1.00 0.00 ? 32 VAL A HG12 6  
ATOM 8309  H HG13 . VAL A 1 33 ? 156.579 -0.719  -5.095  1.00 0.00 ? 32 VAL A HG13 6  
ATOM 8310  H HG21 . VAL A 1 33 ? 153.975 -0.737  -4.670  1.00 0.00 ? 32 VAL A HG21 6  
ATOM 8311  H HG22 . VAL A 1 33 ? 154.300 -2.316  -3.953  1.00 0.00 ? 32 VAL A HG22 6  
ATOM 8312  H HG23 . VAL A 1 33 ? 153.093 -2.158  -5.228  1.00 0.00 ? 32 VAL A HG23 6  
ATOM 8313  N N    . THR A 1 34 ? 156.164 -3.904  -8.155  1.00 0.00 ? 33 THR A N    6  
ATOM 8314  C CA   . THR A 1 34 ? 157.234 -4.342  -9.048  1.00 0.00 ? 33 THR A CA   6  
ATOM 8315  C C    . THR A 1 34 ? 156.749 -4.433  -10.497 1.00 0.00 ? 33 THR A C    6  
ATOM 8316  O O    . THR A 1 34 ? 157.481 -4.078  -11.418 1.00 0.00 ? 33 THR A O    6  
ATOM 8317  C CB   . THR A 1 34 ? 157.792 -5.692  -8.589  1.00 0.00 ? 33 THR A CB   6  
ATOM 8318  O OG1  . THR A 1 34 ? 158.243 -5.612  -7.249  1.00 0.00 ? 33 THR A OG1  6  
ATOM 8319  C CG2  . THR A 1 34 ? 158.952 -6.186  -9.430  1.00 0.00 ? 33 THR A CG2  6  
ATOM 8320  H H    . THR A 1 34 ? 155.863 -4.506  -7.441  1.00 0.00 ? 33 THR A H    6  
ATOM 8321  H HA   . THR A 1 34 ? 158.022 -3.605  -8.996  1.00 0.00 ? 33 THR A HA   6  
ATOM 8322  H HB   . THR A 1 34 ? 157.007 -6.432  -8.639  1.00 0.00 ? 33 THR A HB   6  
ATOM 8323  H HG1  . THR A 1 34 ? 157.545 -5.904  -6.656  1.00 0.00 ? 33 THR A HG1  6  
ATOM 8324  H HG21 . THR A 1 34 ? 159.882 -5.974  -8.921  1.00 0.00 ? 33 THR A HG21 6  
ATOM 8325  H HG22 . THR A 1 34 ? 158.945 -5.686  -10.386 1.00 0.00 ? 33 THR A HG22 6  
ATOM 8326  H HG23 . THR A 1 34 ? 158.858 -7.252  -9.581  1.00 0.00 ? 33 THR A HG23 6  
ATOM 8327  N N    . THR A 1 35 ? 155.517 -4.914  -10.696 1.00 0.00 ? 34 THR A N    6  
ATOM 8328  C CA   . THR A 1 35 ? 154.953 -5.043  -12.042 1.00 0.00 ? 34 THR A CA   6  
ATOM 8329  C C    . THR A 1 35 ? 154.610 -3.677  -12.643 1.00 0.00 ? 34 THR A C    6  
ATOM 8330  O O    . THR A 1 35 ? 154.925 -3.410  -13.804 1.00 0.00 ? 34 THR A O    6  
ATOM 8331  C CB   . THR A 1 35 ? 153.709 -5.939  -12.036 1.00 0.00 ? 34 THR A CB   6  
ATOM 8332  O OG1  . THR A 1 35 ? 153.987 -7.183  -11.417 1.00 0.00 ? 34 THR A OG1  6  
ATOM 8333  C CG2  . THR A 1 35 ? 153.178 -6.231  -13.426 1.00 0.00 ? 34 THR A CG2  6  
ATOM 8334  H H    . THR A 1 35 ? 154.977 -5.185  -9.923  1.00 0.00 ? 34 THR A H    6  
ATOM 8335  H HA   . THR A 1 35 ? 155.707 -5.504  -12.664 1.00 0.00 ? 34 THR A HA   6  
ATOM 8336  H HB   . THR A 1 35 ? 152.924 -5.448  -11.479 1.00 0.00 ? 34 THR A HB   6  
ATOM 8337  H HG1  . THR A 1 35 ? 153.214 -7.478  -10.929 1.00 0.00 ? 34 THR A HG1  6  
ATOM 8338  H HG21 . THR A 1 35 ? 152.611 -7.150  -13.411 1.00 0.00 ? 34 THR A HG21 6  
ATOM 8339  H HG22 . THR A 1 35 ? 154.006 -6.330  -14.112 1.00 0.00 ? 34 THR A HG22 6  
ATOM 8340  H HG23 . THR A 1 35 ? 152.540 -5.421  -13.747 1.00 0.00 ? 34 THR A HG23 6  
ATOM 8341  N N    . VAL A 1 36 ? 153.952 -2.820  -11.858 1.00 0.00 ? 35 VAL A N    6  
ATOM 8342  C CA   . VAL A 1 36 ? 153.560 -1.490  -12.332 1.00 0.00 ? 35 VAL A CA   6  
ATOM 8343  C C    . VAL A 1 36 ? 154.780 -0.649  -12.714 1.00 0.00 ? 35 VAL A C    6  
ATOM 8344  O O    . VAL A 1 36 ? 154.822 -0.064  -13.797 1.00 0.00 ? 35 VAL A O    6  
ATOM 8345  C CB   . VAL A 1 36 ? 152.732 -0.718  -11.276 1.00 0.00 ? 35 VAL A CB   6  
ATOM 8346  C CG1  . VAL A 1 36 ? 152.312 0.645   -11.813 1.00 0.00 ? 35 VAL A CG1  6  
ATOM 8347  C CG2  . VAL A 1 36 ? 151.511 -1.522  -10.844 1.00 0.00 ? 35 VAL A CG2  6  
ATOM 8348  H H    . VAL A 1 36 ? 153.719 -3.090  -10.942 1.00 0.00 ? 35 VAL A H    6  
ATOM 8349  H HA   . VAL A 1 36 ? 152.943 -1.624  -13.209 1.00 0.00 ? 35 VAL A HA   6  
ATOM 8350  H HB   . VAL A 1 36 ? 153.355 -0.558  -10.408 1.00 0.00 ? 35 VAL A HB   6  
ATOM 8351  H HG11 . VAL A 1 36 ? 153.051 1.382   -11.538 1.00 0.00 ? 35 VAL A HG11 6  
ATOM 8352  H HG12 . VAL A 1 36 ? 151.356 0.919   -11.393 1.00 0.00 ? 35 VAL A HG12 6  
ATOM 8353  H HG13 . VAL A 1 36 ? 152.232 0.599   -12.889 1.00 0.00 ? 35 VAL A HG13 6  
ATOM 8354  H HG21 . VAL A 1 36 ? 151.609 -2.541  -11.186 1.00 0.00 ? 35 VAL A HG21 6  
ATOM 8355  H HG22 . VAL A 1 36 ? 150.620 -1.083  -11.268 1.00 0.00 ? 35 VAL A HG22 6  
ATOM 8356  H HG23 . VAL A 1 36 ? 151.437 -1.511  -9.766  1.00 0.00 ? 35 VAL A HG23 6  
ATOM 8357  N N    . PHE A 1 37 ? 155.761 -0.583  -11.815 1.00 0.00 ? 36 PHE A N    6  
ATOM 8358  C CA   . PHE A 1 37 ? 156.976 0.199   -12.054 1.00 0.00 ? 36 PHE A CA   6  
ATOM 8359  C C    . PHE A 1 37 ? 158.012 -0.572  -12.878 1.00 0.00 ? 36 PHE A C    6  
ATOM 8360  O O    . PHE A 1 37 ? 158.893 0.035   -13.489 1.00 0.00 ? 36 PHE A O    6  
ATOM 8361  C CB   . PHE A 1 37 ? 157.589 0.642   -10.723 1.00 0.00 ? 36 PHE A CB   6  
ATOM 8362  C CG   . PHE A 1 37 ? 156.701 1.565   -9.935  1.00 0.00 ? 36 PHE A CG   6  
ATOM 8363  C CD1  . PHE A 1 37 ? 156.443 2.851   -10.385 1.00 0.00 ? 36 PHE A CD1  6  
ATOM 8364  C CD2  . PHE A 1 37 ? 156.121 1.147   -8.748  1.00 0.00 ? 36 PHE A CD2  6  
ATOM 8365  C CE1  . PHE A 1 37 ? 155.626 3.700   -9.665  1.00 0.00 ? 36 PHE A CE1  6  
ATOM 8366  C CE2  . PHE A 1 37 ? 155.303 1.992   -8.025  1.00 0.00 ? 36 PHE A CE2  6  
ATOM 8367  C CZ   . PHE A 1 37 ? 155.055 3.270   -8.484  1.00 0.00 ? 36 PHE A CZ   6  
ATOM 8368  H H    . PHE A 1 37 ? 155.664 -1.066  -10.966 1.00 0.00 ? 36 PHE A H    6  
ATOM 8369  H HA   . PHE A 1 37 ? 156.688 1.080   -12.608 1.00 0.00 ? 36 PHE A HA   6  
ATOM 8370  H HB2  . PHE A 1 37 ? 157.787 -0.231  -10.116 1.00 0.00 ? 36 PHE A HB2  6  
ATOM 8371  H HB3  . PHE A 1 37 ? 158.519 1.157   -10.917 1.00 0.00 ? 36 PHE A HB3  6  
ATOM 8372  H HD1  . PHE A 1 37 ? 156.889 3.188   -11.310 1.00 0.00 ? 36 PHE A HD1  6  
ATOM 8373  H HD2  . PHE A 1 37 ? 156.315 0.148   -8.387  1.00 0.00 ? 36 PHE A HD2  6  
ATOM 8374  H HE1  . PHE A 1 37 ? 155.433 4.700   -10.026 1.00 0.00 ? 36 PHE A HE1  6  
ATOM 8375  H HE2  . PHE A 1 37 ? 154.857 1.653   -7.102  1.00 0.00 ? 36 PHE A HE2  6  
ATOM 8376  H HZ   . PHE A 1 37 ? 154.416 3.934   -7.920  1.00 0.00 ? 36 PHE A HZ   6  
ATOM 8377  N N    . GLY A 1 38 ? 157.913 -1.903  -12.889 1.00 0.00 ? 37 GLY A N    6  
ATOM 8378  C CA   . GLY A 1 38 ? 158.858 -2.719  -13.639 1.00 0.00 ? 37 GLY A CA   6  
ATOM 8379  C C    . GLY A 1 38 ? 160.236 -2.767  -12.996 1.00 0.00 ? 37 GLY A C    6  
ATOM 8380  O O    . GLY A 1 38 ? 161.244 -2.903  -13.691 1.00 0.00 ? 37 GLY A O    6  
ATOM 8381  H H    . GLY A 1 38 ? 157.197 -2.338  -12.380 1.00 0.00 ? 37 GLY A H    6  
ATOM 8382  H HA2  . GLY A 1 38 ? 158.473 -3.724  -13.709 1.00 0.00 ? 37 GLY A HA2  6  
ATOM 8383  H HA3  . GLY A 1 38 ? 158.954 -2.313  -14.635 1.00 0.00 ? 37 GLY A HA3  6  
ATOM 8384  N N    . GLN A 1 39 ? 160.279 -2.658  -11.666 1.00 0.00 ? 38 GLN A N    6  
ATOM 8385  C CA   . GLN A 1 39 ? 161.543 -2.689  -10.930 1.00 0.00 ? 38 GLN A CA   6  
ATOM 8386  C C    . GLN A 1 39 ? 161.301 -2.838  -9.427  1.00 0.00 ? 38 GLN A C    6  
ATOM 8387  O O    . GLN A 1 39 ? 160.265 -2.411  -8.915  1.00 0.00 ? 38 GLN A O    6  
ATOM 8388  C CB   . GLN A 1 39 ? 162.351 -1.413  -11.198 1.00 0.00 ? 38 GLN A CB   6  
ATOM 8389  C CG   . GLN A 1 39 ? 161.533 -0.131  -11.083 1.00 0.00 ? 38 GLN A CG   6  
ATOM 8390  C CD   . GLN A 1 39 ? 161.647 0.762   -12.308 1.00 0.00 ? 38 GLN A CD   6  
ATOM 8391  O OE1  . GLN A 1 39 ? 162.036 0.314   -13.387 1.00 0.00 ? 38 GLN A OE1  6  
ATOM 8392  N NE2  . GLN A 1 39 ? 161.302 2.036   -12.147 1.00 0.00 ? 38 GLN A NE2  6  
ATOM 8393  H H    . GLN A 1 39 ? 159.441 -2.552  -11.167 1.00 0.00 ? 38 GLN A H    6  
ATOM 8394  H HA   . GLN A 1 39 ? 162.107 -3.541  -11.279 1.00 0.00 ? 38 GLN A HA   6  
ATOM 8395  H HB2  . GLN A 1 39 ? 163.162 -1.361  -10.485 1.00 0.00 ? 38 GLN A HB2  6  
ATOM 8396  H HB3  . GLN A 1 39 ? 162.764 -1.466  -12.194 1.00 0.00 ? 38 GLN A HB3  6  
ATOM 8397  H HG2  . GLN A 1 39 ? 160.495 -0.394  -10.949 1.00 0.00 ? 38 GLN A HG2  6  
ATOM 8398  H HG3  . GLN A 1 39 ? 161.876 0.422   -10.221 1.00 0.00 ? 38 GLN A HG3  6  
ATOM 8399  H HE21 . GLN A 1 39 ? 160.999 2.328   -11.262 1.00 0.00 ? 38 GLN A HE21 6  
ATOM 8400  H HE22 . GLN A 1 39 ? 161.365 2.633   -12.923 1.00 0.00 ? 38 GLN A HE22 6  
ATOM 8401  N N    . PRO A 1 40 ? 162.260 -3.444  -8.699  1.00 0.00 ? 39 PRO A N    6  
ATOM 8402  C CA   . PRO A 1 40 ? 162.146 -3.640  -7.250  1.00 0.00 ? 39 PRO A CA   6  
ATOM 8403  C C    . PRO A 1 40 ? 162.381 -2.346  -6.471  1.00 0.00 ? 39 PRO A C    6  
ATOM 8404  O O    . PRO A 1 40 ? 163.513 -1.864  -6.375  1.00 0.00 ? 39 PRO A O    6  
ATOM 8405  C CB   . PRO A 1 40 ? 163.242 -4.663  -6.949  1.00 0.00 ? 39 PRO A CB   6  
ATOM 8406  C CG   . PRO A 1 40 ? 164.270 -4.440  -8.004  1.00 0.00 ? 39 PRO A CG   6  
ATOM 8407  C CD   . PRO A 1 40 ? 163.528 -3.983  -9.232  1.00 0.00 ? 39 PRO A CD   6  
ATOM 8408  H HA   . PRO A 1 40 ? 161.183 -4.050  -6.983  1.00 0.00 ? 39 PRO A HA   6  
ATOM 8409  H HB2  . PRO A 1 40 ? 163.642 -4.485  -5.960  1.00 0.00 ? 39 PRO A HB2  6  
ATOM 8410  H HB3  . PRO A 1 40 ? 162.832 -5.661  -7.002  1.00 0.00 ? 39 PRO A HB3  6  
ATOM 8411  H HG2  . PRO A 1 40 ? 164.965 -3.678  -7.682  1.00 0.00 ? 39 PRO A HG2  6  
ATOM 8412  H HG3  . PRO A 1 40 ? 164.794 -5.362  -8.206  1.00 0.00 ? 39 PRO A HG3  6  
ATOM 8413  H HD2  . PRO A 1 40 ? 164.087 -3.213  -9.744  1.00 0.00 ? 39 PRO A HD2  6  
ATOM 8414  H HD3  . PRO A 1 40 ? 163.344 -4.817  -9.892  1.00 0.00 ? 39 PRO A HD3  6  
ATOM 8415  N N    . LEU A 1 41 ? 161.305 -1.785  -5.919  1.00 0.00 ? 40 LEU A N    6  
ATOM 8416  C CA   . LEU A 1 41 ? 161.395 -0.545  -5.152  1.00 0.00 ? 40 LEU A CA   6  
ATOM 8417  C C    . LEU A 1 41 ? 161.266 -0.809  -3.654  1.00 0.00 ? 40 LEU A C    6  
ATOM 8418  O O    . LEU A 1 41 ? 160.495 -1.671  -3.226  1.00 0.00 ? 40 LEU A O    6  
ATOM 8419  C CB   . LEU A 1 41 ? 160.316 0.446   -5.596  1.00 0.00 ? 40 LEU A CB   6  
ATOM 8420  C CG   . LEU A 1 41 ? 160.391 0.877   -7.063  1.00 0.00 ? 40 LEU A CG   6  
ATOM 8421  C CD1  . LEU A 1 41 ? 159.343 0.147   -7.889  1.00 0.00 ? 40 LEU A CD1  6  
ATOM 8422  C CD2  . LEU A 1 41 ? 160.214 2.383   -7.185  1.00 0.00 ? 40 LEU A CD2  6  
ATOM 8423  H H    . LEU A 1 41 ? 160.430 -2.213  -6.033  1.00 0.00 ? 40 LEU A H    6  
ATOM 8424  H HA   . LEU A 1 41 ? 162.365 -0.113  -5.343  1.00 0.00 ? 40 LEU A HA   6  
ATOM 8425  H HB2  . LEU A 1 41 ? 159.349 -0.003  -5.421  1.00 0.00 ? 40 LEU A HB2  6  
ATOM 8426  H HB3  . LEU A 1 41 ? 160.399 1.330   -4.981  1.00 0.00 ? 40 LEU A HB3  6  
ATOM 8427  H HG   . LEU A 1 41 ? 161.363 0.620   -7.459  1.00 0.00 ? 40 LEU A HG   6  
ATOM 8428  H HD11 . LEU A 1 41 ? 159.715 -0.003  -8.891  1.00 0.00 ? 40 LEU A HD11 6  
ATOM 8429  H HD12 . LEU A 1 41 ? 158.439 0.736   -7.925  1.00 0.00 ? 40 LEU A HD12 6  
ATOM 8430  H HD13 . LEU A 1 41 ? 159.130 -0.811  -7.437  1.00 0.00 ? 40 LEU A HD13 6  
ATOM 8431  H HD21 . LEU A 1 41 ? 159.622 2.744   -6.358  1.00 0.00 ? 40 LEU A HD21 6  
ATOM 8432  H HD22 . LEU A 1 41 ? 159.713 2.613   -8.113  1.00 0.00 ? 40 LEU A HD22 6  
ATOM 8433  H HD23 . LEU A 1 41 ? 161.182 2.862   -7.171  1.00 0.00 ? 40 LEU A HD23 6  
ATOM 8434  N N    . ASP A 1 42 ? 162.025 -0.051  -2.865  1.00 0.00 ? 41 ASP A N    6  
ATOM 8435  C CA   . ASP A 1 42 ? 162.008 -0.182  -1.411  1.00 0.00 ? 41 ASP A CA   6  
ATOM 8436  C C    . ASP A 1 42 ? 160.933 0.713   -0.799  1.00 0.00 ? 41 ASP A C    6  
ATOM 8437  O O    . ASP A 1 42 ? 160.864 1.906   -1.100  1.00 0.00 ? 41 ASP A O    6  
ATOM 8438  C CB   . ASP A 1 42 ? 163.379 0.182   -0.836  1.00 0.00 ? 41 ASP A CB   6  
ATOM 8439  C CG   . ASP A 1 42 ? 163.631 -0.449  0.520   1.00 0.00 ? 41 ASP A CG   6  
ATOM 8440  O OD1  . ASP A 1 42 ? 163.598 -1.695  0.613   1.00 0.00 ? 41 ASP A OD1  6  
ATOM 8441  O OD2  . ASP A 1 42 ? 163.860 0.303   1.488   1.00 0.00 ? 41 ASP A OD2  6  
ATOM 8442  H H    . ASP A 1 42 ? 162.613 0.621   -3.273  1.00 0.00 ? 41 ASP A H    6  
ATOM 8443  H HA   . ASP A 1 42 ? 161.787 -1.211  -1.171  1.00 0.00 ? 41 ASP A HA   6  
ATOM 8444  H HB2  . ASP A 1 42 ? 164.147 -0.154  -1.515  1.00 0.00 ? 41 ASP A HB2  6  
ATOM 8445  H HB3  . ASP A 1 42 ? 163.443 1.256   -0.729  1.00 0.00 ? 41 ASP A HB3  6  
ATOM 8446  N N    . LEU A 1 43 ? 160.099 0.131   0.062   1.00 0.00 ? 42 LEU A N    6  
ATOM 8447  C CA   . LEU A 1 43 ? 159.028 0.879   0.718   1.00 0.00 ? 42 LEU A CA   6  
ATOM 8448  C C    . LEU A 1 43 ? 159.537 1.560   1.987   1.00 0.00 ? 42 LEU A C    6  
ATOM 8449  O O    . LEU A 1 43 ? 159.717 0.912   3.021   1.00 0.00 ? 42 LEU A O    6  
ATOM 8450  C CB   . LEU A 1 43 ? 157.855 -0.048  1.066   1.00 0.00 ? 42 LEU A CB   6  
ATOM 8451  C CG   . LEU A 1 43 ? 157.277 -0.849  -0.104  1.00 0.00 ? 42 LEU A CG   6  
ATOM 8452  C CD1  . LEU A 1 43 ? 156.272 -1.875  0.398   1.00 0.00 ? 42 LEU A CD1  6  
ATOM 8453  C CD2  . LEU A 1 43 ? 156.630 0.077   -1.120  1.00 0.00 ? 42 LEU A CD2  6  
ATOM 8454  H H    . LEU A 1 43 ? 160.207 -0.824  0.262   1.00 0.00 ? 42 LEU A H    6  
ATOM 8455  H HA   . LEU A 1 43 ? 158.684 1.636   0.030   1.00 0.00 ? 42 LEU A HA   6  
ATOM 8456  H HB2  . LEU A 1 43 ? 158.189 -0.746  1.820   1.00 0.00 ? 42 LEU A HB2  6  
ATOM 8457  H HB3  . LEU A 1 43 ? 157.063 0.555   1.485   1.00 0.00 ? 42 LEU A HB3  6  
ATOM 8458  H HG   . LEU A 1 43 ? 158.078 -1.381  -0.597  1.00 0.00 ? 42 LEU A HG   6  
ATOM 8459  H HD11 . LEU A 1 43 ? 155.824 -1.523  1.315   1.00 0.00 ? 42 LEU A HD11 6  
ATOM 8460  H HD12 . LEU A 1 43 ? 156.776 -2.811  0.579   1.00 0.00 ? 42 LEU A HD12 6  
ATOM 8461  H HD13 . LEU A 1 43 ? 155.503 -2.019  -0.346  1.00 0.00 ? 42 LEU A HD13 6  
ATOM 8462  H HD21 . LEU A 1 43 ? 156.761 -0.330  -2.112  1.00 0.00 ? 42 LEU A HD21 6  
ATOM 8463  H HD22 . LEU A 1 43 ? 157.093 1.052   -1.067  1.00 0.00 ? 42 LEU A HD22 6  
ATOM 8464  H HD23 . LEU A 1 43 ? 155.575 0.167   -0.906  1.00 0.00 ? 42 LEU A HD23 6  
ATOM 8465  N N    . HIS A 1 44 ? 159.770 2.871   1.904   1.00 0.00 ? 43 HIS A N    6  
ATOM 8466  C CA   . HIS A 1 44 ? 160.257 3.636   3.049   1.00 0.00 ? 43 HIS A CA   6  
ATOM 8467  C C    . HIS A 1 44 ? 159.099 4.251   3.832   1.00 0.00 ? 43 HIS A C    6  
ATOM 8468  O O    . HIS A 1 44 ? 158.315 5.033   3.288   1.00 0.00 ? 43 HIS A O    6  
ATOM 8469  C CB   . HIS A 1 44 ? 161.219 4.736   2.591   1.00 0.00 ? 43 HIS A CB   6  
ATOM 8470  C CG   . HIS A 1 44 ? 162.666 4.375   2.753   1.00 0.00 ? 43 HIS A CG   6  
ATOM 8471  N ND1  . HIS A 1 44 ? 163.664 4.902   1.962   1.00 0.00 ? 43 HIS A ND1  6  
ATOM 8472  C CD2  . HIS A 1 44 ? 163.281 3.535   3.620   1.00 0.00 ? 43 HIS A CD2  6  
ATOM 8473  C CE1  . HIS A 1 44 ? 164.829 4.401   2.333   1.00 0.00 ? 43 HIS A CE1  6  
ATOM 8474  N NE2  . HIS A 1 44 ? 164.624 3.569   3.337   1.00 0.00 ? 43 HIS A NE2  6  
ATOM 8475  H H    . HIS A 1 44 ? 159.609 3.333   1.053   1.00 0.00 ? 43 HIS A H    6  
ATOM 8476  H HA   . HIS A 1 44 ? 160.788 2.955   3.697   1.00 0.00 ? 43 HIS A HA   6  
ATOM 8477  H HB2  . HIS A 1 44 ? 161.045 4.945   1.546   1.00 0.00 ? 43 HIS A HB2  6  
ATOM 8478  H HB3  . HIS A 1 44 ? 161.032 5.630   3.167   1.00 0.00 ? 43 HIS A HB3  6  
ATOM 8479  H HD1  . HIS A 1 44 ? 163.537 5.549   1.237   1.00 0.00 ? 43 HIS A HD1  6  
ATOM 8480  H HD2  . HIS A 1 44 ? 162.803 2.949   4.392   1.00 0.00 ? 43 HIS A HD2  6  
ATOM 8481  H HE1  . HIS A 1 44 ? 165.786 4.634   1.890   1.00 0.00 ? 43 HIS A HE1  6  
ATOM 8482  H HE2  . HIS A 1 44 ? 165.297 2.964   3.712   1.00 0.00 ? 43 HIS A HE2  6  
ATOM 8483  N N    . TYR A 1 45 ? 159.003 3.894   5.112   1.00 0.00 ? 44 TYR A N    6  
ATOM 8484  C CA   . TYR A 1 45 ? 157.946 4.408   5.978   1.00 0.00 ? 44 TYR A CA   6  
ATOM 8485  C C    . TYR A 1 45 ? 158.440 5.596   6.797   1.00 0.00 ? 44 TYR A C    6  
ATOM 8486  O O    . TYR A 1 45 ? 159.447 5.499   7.501   1.00 0.00 ? 44 TYR A O    6  
ATOM 8487  C CB   . TYR A 1 45 ? 157.442 3.307   6.914   1.00 0.00 ? 44 TYR A CB   6  
ATOM 8488  C CG   . TYR A 1 45 ? 155.938 3.291   7.072   1.00 0.00 ? 44 TYR A CG   6  
ATOM 8489  C CD1  . TYR A 1 45 ? 155.112 2.973   6.001   1.00 0.00 ? 44 TYR A CD1  6  
ATOM 8490  C CD2  . TYR A 1 45 ? 155.345 3.593   8.291   1.00 0.00 ? 44 TYR A CD2  6  
ATOM 8491  C CE1  . TYR A 1 45 ? 153.738 2.957   6.140   1.00 0.00 ? 44 TYR A CE1  6  
ATOM 8492  C CE2  . TYR A 1 45 ? 153.972 3.578   8.439   1.00 0.00 ? 44 TYR A CE2  6  
ATOM 8493  C CZ   . TYR A 1 45 ? 153.173 3.259   7.361   1.00 0.00 ? 44 TYR A CZ   6  
ATOM 8494  O OH   . TYR A 1 45 ? 151.805 3.243   7.507   1.00 0.00 ? 44 TYR A OH   6  
ATOM 8495  H H    . TYR A 1 45 ? 159.660 3.268   5.484   1.00 0.00 ? 44 TYR A H    6  
ATOM 8496  H HA   . TYR A 1 45 ? 157.131 4.732   5.348   1.00 0.00 ? 44 TYR A HA   6  
ATOM 8497  H HB2  . TYR A 1 45 ? 157.745 2.346   6.524   1.00 0.00 ? 44 TYR A HB2  6  
ATOM 8498  H HB3  . TYR A 1 45 ? 157.878 3.447   7.892   1.00 0.00 ? 44 TYR A HB3  6  
ATOM 8499  H HD1  . TYR A 1 45 ? 155.557 2.737   5.046   1.00 0.00 ? 44 TYR A HD1  6  
ATOM 8500  H HD2  . TYR A 1 45 ? 155.973 3.842   9.133   1.00 0.00 ? 44 TYR A HD2  6  
ATOM 8501  H HE1  . TYR A 1 45 ? 153.113 2.708   5.296   1.00 0.00 ? 44 TYR A HE1  6  
ATOM 8502  H HE2  . TYR A 1 45 ? 153.529 3.818   9.394   1.00 0.00 ? 44 TYR A HE2  6  
ATOM 8503  H HH   . TYR A 1 45 ? 151.473 2.362   7.321   1.00 0.00 ? 44 TYR A HH   6  
ATOM 8504  N N    . MET A 1 46 ? 157.722 6.716   6.702   1.00 0.00 ? 45 MET A N    6  
ATOM 8505  C CA   . MET A 1 46 ? 158.084 7.927   7.437   1.00 0.00 ? 45 MET A CA   6  
ATOM 8506  C C    . MET A 1 46 ? 156.903 8.445   8.256   1.00 0.00 ? 45 MET A C    6  
ATOM 8507  O O    . MET A 1 46 ? 155.888 8.872   7.702   1.00 0.00 ? 45 MET A O    6  
ATOM 8508  C CB   . MET A 1 46 ? 158.579 9.016   6.477   1.00 0.00 ? 45 MET A CB   6  
ATOM 8509  C CG   . MET A 1 46 ? 157.671 9.252   5.278   1.00 0.00 ? 45 MET A CG   6  
ATOM 8510  S SD   . MET A 1 46 ? 157.538 10.997  4.841   1.00 0.00 ? 45 MET A SD   6  
ATOM 8511  C CE   . MET A 1 46 ? 159.255 11.410  4.533   1.00 0.00 ? 45 MET A CE   6  
ATOM 8512  H H    . MET A 1 46 ? 156.928 6.727   6.126   1.00 0.00 ? 45 MET A H    6  
ATOM 8513  H HA   . MET A 1 46 ? 158.886 7.670   8.114   1.00 0.00 ? 45 MET A HA   6  
ATOM 8514  H HB2  . MET A 1 46 ? 158.663 9.945   7.021   1.00 0.00 ? 45 MET A HB2  6  
ATOM 8515  H HB3  . MET A 1 46 ? 159.556 8.738   6.110   1.00 0.00 ? 45 MET A HB3  6  
ATOM 8516  H HG2  . MET A 1 46 ? 158.067 8.712   4.430   1.00 0.00 ? 45 MET A HG2  6  
ATOM 8517  H HG3  . MET A 1 46 ? 156.685 8.877   5.511   1.00 0.00 ? 45 MET A HG3  6  
ATOM 8518  H HE1  . MET A 1 46 ? 159.891 10.791  5.149   1.00 0.00 ? 45 MET A HE1  6  
ATOM 8519  H HE2  . MET A 1 46 ? 159.424 12.449  4.774   1.00 0.00 ? 45 MET A HE2  6  
ATOM 8520  H HE3  . MET A 1 46 ? 159.485 11.240  3.492   1.00 0.00 ? 45 MET A HE3  6  
ATOM 8521  N N    . ASN A 1 47 ? 157.046 8.406   9.581   1.00 0.00 ? 46 ASN A N    6  
ATOM 8522  C CA   . ASN A 1 47 ? 155.994 8.873   10.484  1.00 0.00 ? 46 ASN A CA   6  
ATOM 8523  C C    . ASN A 1 47 ? 156.123 10.376  10.737  1.00 0.00 ? 46 ASN A C    6  
ATOM 8524  O O    . ASN A 1 47 ? 155.174 11.132  10.529  1.00 0.00 ? 46 ASN A O    6  
ATOM 8525  C CB   . ASN A 1 47 ? 156.054 8.106   11.810  1.00 0.00 ? 46 ASN A CB   6  
ATOM 8526  C CG   . ASN A 1 47 ? 154.684 7.917   12.437  1.00 0.00 ? 46 ASN A CG   6  
ATOM 8527  O OD1  . ASN A 1 47 ? 153.694 7.698   11.739  1.00 0.00 ? 46 ASN A OD1  6  
ATOM 8528  N ND2  . ASN A 1 47 ? 154.620 7.998   13.762  1.00 0.00 ? 46 ASN A ND2  6  
ATOM 8529  H H    . ASN A 1 47 ? 157.880 8.055   9.961   1.00 0.00 ? 46 ASN A H    6  
ATOM 8530  H HA   . ASN A 1 47 ? 155.042 8.682   10.011  1.00 0.00 ? 46 ASN A HA   6  
ATOM 8531  H HB2  . ASN A 1 47 ? 156.484 7.131   11.633  1.00 0.00 ? 46 ASN A HB2  6  
ATOM 8532  H HB3  . ASN A 1 47 ? 156.678 8.648   12.505  1.00 0.00 ? 46 ASN A HB3  6  
ATOM 8533  H HD21 . ASN A 1 47 ? 155.447 8.173   14.259  1.00 0.00 ? 46 ASN A HD21 6  
ATOM 8534  H HD22 . ASN A 1 47 ? 153.745 7.881   14.189  1.00 0.00 ? 46 ASN A HD22 6  
ATOM 8535  N N    . ASN A 1 48 ? 157.309 10.798  11.180  1.00 0.00 ? 47 ASN A N    6  
ATOM 8536  C CA   . ASN A 1 48 ? 157.581 12.209  11.456  1.00 0.00 ? 47 ASN A CA   6  
ATOM 8537  C C    . ASN A 1 48 ? 159.082 12.487  11.393  1.00 0.00 ? 47 ASN A C    6  
ATOM 8538  O O    . ASN A 1 48 ? 159.551 13.209  10.512  1.00 0.00 ? 47 ASN A O    6  
ATOM 8539  C CB   . ASN A 1 48 ? 157.026 12.611  12.827  1.00 0.00 ? 47 ASN A CB   6  
ATOM 8540  C CG   . ASN A 1 48 ? 155.678 13.301  12.724  1.00 0.00 ? 47 ASN A CG   6  
ATOM 8541  O OD1  . ASN A 1 48 ? 155.566 14.387  12.157  1.00 0.00 ? 47 ASN A OD1  6  
ATOM 8542  N ND2  . ASN A 1 48 ? 154.643 12.672  13.273  1.00 0.00 ? 47 ASN A ND2  6  
ATOM 8543  H H    . ASN A 1 48 ? 158.024 10.143  11.320  1.00 0.00 ? 47 ASN A H    6  
ATOM 8544  H HA   . ASN A 1 48 ? 157.089 12.794  10.692  1.00 0.00 ? 47 ASN A HA   6  
ATOM 8545  H HB2  . ASN A 1 48 ? 156.913 11.728  13.436  1.00 0.00 ? 47 ASN A HB2  6  
ATOM 8546  H HB3  . ASN A 1 48 ? 157.719 13.287  13.306  1.00 0.00 ? 47 ASN A HB3  6  
ATOM 8547  H HD21 . ASN A 1 48 ? 154.802 11.810  13.711  1.00 0.00 ? 47 ASN A HD21 6  
ATOM 8548  H HD22 . ASN A 1 48 ? 153.762 13.096  13.215  1.00 0.00 ? 47 ASN A HD22 6  
ATOM 8549  N N    . GLU A 1 49 ? 159.830 11.898  12.327  1.00 0.00 ? 48 GLU A N    6  
ATOM 8550  C CA   . GLU A 1 49 ? 161.281 12.069  12.376  1.00 0.00 ? 48 GLU A CA   6  
ATOM 8551  C C    . GLU A 1 49 ? 162.008 10.716  12.389  1.00 0.00 ? 48 GLU A C    6  
ATOM 8552  O O    . GLU A 1 49 ? 163.208 10.654  12.667  1.00 0.00 ? 48 GLU A O    6  
ATOM 8553  C CB   . GLU A 1 49 ? 161.672 12.887  13.611  1.00 0.00 ? 48 GLU A CB   6  
ATOM 8554  C CG   . GLU A 1 49 ? 161.261 14.349  13.529  1.00 0.00 ? 48 GLU A CG   6  
ATOM 8555  C CD   . GLU A 1 49 ? 162.343 15.289  14.023  1.00 0.00 ? 48 GLU A CD   6  
ATOM 8556  O OE1  . GLU A 1 49 ? 163.355 15.457  13.309  1.00 0.00 ? 48 GLU A OE1  6  
ATOM 8557  O OE2  . GLU A 1 49 ? 162.179 15.858  15.122  1.00 0.00 ? 48 GLU A OE2  6  
ATOM 8558  H H    . GLU A 1 49 ? 159.397 11.331  12.998  1.00 0.00 ? 48 GLU A H    6  
ATOM 8559  H HA   . GLU A 1 49 ? 161.579 12.612  11.491  1.00 0.00 ? 48 GLU A HA   6  
ATOM 8560  H HB2  . GLU A 1 49 ? 161.203 12.451  14.480  1.00 0.00 ? 48 GLU A HB2  6  
ATOM 8561  H HB3  . GLU A 1 49 ? 162.745 12.843  13.733  1.00 0.00 ? 48 GLU A HB3  6  
ATOM 8562  H HG2  . GLU A 1 49 ? 161.039 14.590  12.500  1.00 0.00 ? 48 GLU A HG2  6  
ATOM 8563  H HG3  . GLU A 1 49 ? 160.376 14.494  14.131  1.00 0.00 ? 48 GLU A HG3  6  
ATOM 8564  N N    . LEU A 1 50 ? 161.282 9.632   12.083  1.00 0.00 ? 49 LEU A N    6  
ATOM 8565  C CA   . LEU A 1 50 ? 161.869 8.292   12.059  1.00 0.00 ? 49 LEU A CA   6  
ATOM 8566  C C    . LEU A 1 50 ? 161.494 7.554   10.775  1.00 0.00 ? 49 LEU A C    6  
ATOM 8567  O O    . LEU A 1 50 ? 160.327 7.539   10.377  1.00 0.00 ? 49 LEU A O    6  
ATOM 8568  C CB   . LEU A 1 50 ? 161.411 7.486   13.280  1.00 0.00 ? 49 LEU A CB   6  
ATOM 8569  C CG   . LEU A 1 50 ? 162.285 6.276   13.624  1.00 0.00 ? 49 LEU A CG   6  
ATOM 8570  C CD1  . LEU A 1 50 ? 163.451 6.692   14.510  1.00 0.00 ? 49 LEU A CD1  6  
ATOM 8571  C CD2  . LEU A 1 50 ? 161.452 5.196   14.301  1.00 0.00 ? 49 LEU A CD2  6  
ATOM 8572  H H    . LEU A 1 50 ? 160.333 9.734   11.864  1.00 0.00 ? 49 LEU A H    6  
ATOM 8573  H HA   . LEU A 1 50 ? 162.943 8.403   12.094  1.00 0.00 ? 49 LEU A HA   6  
ATOM 8574  H HB2  . LEU A 1 50 ? 161.394 8.147   14.135  1.00 0.00 ? 49 LEU A HB2  6  
ATOM 8575  H HB3  . LEU A 1 50 ? 160.406 7.135   13.098  1.00 0.00 ? 49 LEU A HB3  6  
ATOM 8576  H HG   . LEU A 1 50 ? 162.691 5.862   12.713  1.00 0.00 ? 49 LEU A HG   6  
ATOM 8577  H HD11 . LEU A 1 50 ? 163.767 7.689   14.244  1.00 0.00 ? 49 LEU A HD11 6  
ATOM 8578  H HD12 . LEU A 1 50 ? 164.273 6.004   14.370  1.00 0.00 ? 49 LEU A HD12 6  
ATOM 8579  H HD13 . LEU A 1 50 ? 163.141 6.676   15.545  1.00 0.00 ? 49 LEU A HD13 6  
ATOM 8580  H HD21 . LEU A 1 50 ? 160.777 5.653   15.010  1.00 0.00 ? 49 LEU A HD21 6  
ATOM 8581  H HD22 . LEU A 1 50 ? 162.104 4.507   14.818  1.00 0.00 ? 49 LEU A HD22 6  
ATOM 8582  H HD23 . LEU A 1 50 ? 160.881 4.661   13.556  1.00 0.00 ? 49 LEU A HD23 6  
ATOM 8583  N N    . SER A 1 51 ? 162.491 6.939   10.133  1.00 0.00 ? 50 SER A N    6  
ATOM 8584  C CA   . SER A 1 51 ? 162.268 6.194   8.895   1.00 0.00 ? 50 SER A CA   6  
ATOM 8585  C C    . SER A 1 51 ? 162.443 4.694   9.121   1.00 0.00 ? 50 SER A C    6  
ATOM 8586  O O    . SER A 1 51 ? 163.477 4.251   9.622   1.00 0.00 ? 50 SER A O    6  
ATOM 8587  C CB   . SER A 1 51 ? 163.229 6.670   7.801   1.00 0.00 ? 50 SER A CB   6  
ATOM 8588  O OG   . SER A 1 51 ? 162.640 7.691   7.015   1.00 0.00 ? 50 SER A OG   6  
ATOM 8589  H H    . SER A 1 51 ? 163.397 6.985   10.503  1.00 0.00 ? 50 SER A H    6  
ATOM 8590  H HA   . SER A 1 51 ? 161.254 6.382   8.576   1.00 0.00 ? 50 SER A HA   6  
ATOM 8591  H HB2  . SER A 1 51 ? 164.130 7.057   8.257   1.00 0.00 ? 50 SER A HB2  6  
ATOM 8592  H HB3  . SER A 1 51 ? 163.481 5.838   7.159   1.00 0.00 ? 50 SER A HB3  6  
ATOM 8593  H HG   . SER A 1 51 ? 162.049 7.297   6.369   1.00 0.00 ? 50 SER A HG   6  
ATOM 8594  N N    . ILE A 1 52 ? 161.425 3.920   8.745   1.00 0.00 ? 51 ILE A N    6  
ATOM 8595  C CA   . ILE A 1 52 ? 161.459 2.468   8.904   1.00 0.00 ? 51 ILE A CA   6  
ATOM 8596  C C    . ILE A 1 52 ? 161.453 1.770   7.543   1.00 0.00 ? 51 ILE A C    6  
ATOM 8597  O O    . ILE A 1 52 ? 160.674 2.125   6.656   1.00 0.00 ? 51 ILE A O    6  
ATOM 8598  C CB   . ILE A 1 52 ? 160.266 1.964   9.748   1.00 0.00 ? 51 ILE A CB   6  
ATOM 8599  C CG1  . ILE A 1 52 ? 160.126 2.798   11.028  1.00 0.00 ? 51 ILE A CG1  6  
ATOM 8600  C CG2  . ILE A 1 52 ? 160.435 0.488   10.089  1.00 0.00 ? 51 ILE A CG2  6  
ATOM 8601  C CD1  . ILE A 1 52 ? 158.810 2.594   11.750  1.00 0.00 ? 51 ILE A CD1  6  
ATOM 8602  H H    . ILE A 1 52 ? 160.628 4.336   8.350   1.00 0.00 ? 51 ILE A H    6  
ATOM 8603  H HA   . ILE A 1 52 ? 162.373 2.211   9.421   1.00 0.00 ? 51 ILE A HA   6  
ATOM 8604  H HB   . ILE A 1 52 ? 159.367 2.070   9.159   1.00 0.00 ? 51 ILE A HB   6  
ATOM 8605  H HG12 . ILE A 1 52 ? 160.920 2.534   11.710  1.00 0.00 ? 51 ILE A HG12 6  
ATOM 8606  H HG13 . ILE A 1 52 ? 160.207 3.846   10.779  1.00 0.00 ? 51 ILE A HG13 6  
ATOM 8607  H HG21 . ILE A 1 52 ? 159.973 0.282   11.043  1.00 0.00 ? 51 ILE A HG21 6  
ATOM 8608  H HG22 . ILE A 1 52 ? 161.487 0.247   10.140  1.00 0.00 ? 51 ILE A HG22 6  
ATOM 8609  H HG23 . ILE A 1 52 ? 159.966 -0.115  9.325   1.00 0.00 ? 51 ILE A HG23 6  
ATOM 8610  H HD11 . ILE A 1 52 ? 158.061 2.261   11.048  1.00 0.00 ? 51 ILE A HD11 6  
ATOM 8611  H HD12 . ILE A 1 52 ? 158.497 3.526   12.196  1.00 0.00 ? 51 ILE A HD12 6  
ATOM 8612  H HD13 . ILE A 1 52 ? 158.936 1.850   12.523  1.00 0.00 ? 51 ILE A HD13 6  
ATOM 8613  N N    . LEU A 1 53 ? 162.332 0.779   7.387   1.00 0.00 ? 52 LEU A N    6  
ATOM 8614  C CA   . LEU A 1 53 ? 162.436 0.031   6.137   1.00 0.00 ? 52 LEU A CA   6  
ATOM 8615  C C    . LEU A 1 53 ? 161.546 -1.208  6.171   1.00 0.00 ? 52 LEU A C    6  
ATOM 8616  O O    . LEU A 1 53 ? 161.683 -2.061  7.050   1.00 0.00 ? 52 LEU A O    6  
ATOM 8617  C CB   . LEU A 1 53 ? 163.893 -0.371  5.879   1.00 0.00 ? 52 LEU A CB   6  
ATOM 8618  C CG   . LEU A 1 53 ? 164.244 -0.638  4.412   1.00 0.00 ? 52 LEU A CG   6  
ATOM 8619  C CD1  . LEU A 1 53 ? 165.674 -0.207  4.114   1.00 0.00 ? 52 LEU A CD1  6  
ATOM 8620  C CD2  . LEU A 1 53 ? 164.048 -2.108  4.069   1.00 0.00 ? 52 LEU A CD2  6  
ATOM 8621  H H    . LEU A 1 53 ? 162.925 0.547   8.132   1.00 0.00 ? 52 LEU A H    6  
ATOM 8622  H HA   . LEU A 1 53 ? 162.104 0.676   5.338   1.00 0.00 ? 52 LEU A HA   6  
ATOM 8623  H HB2  . LEU A 1 53 ? 164.529 0.424   6.241   1.00 0.00 ? 52 LEU A HB2  6  
ATOM 8624  H HB3  . LEU A 1 53 ? 164.105 -1.264  6.446   1.00 0.00 ? 52 LEU A HB3  6  
ATOM 8625  H HG   . LEU A 1 53 ? 163.586 -0.058  3.782   1.00 0.00 ? 52 LEU A HG   6  
ATOM 8626  H HD11 . LEU A 1 53 ? 165.675 0.815   3.765   1.00 0.00 ? 52 LEU A HD11 6  
ATOM 8627  H HD12 . LEU A 1 53 ? 166.091 -0.847  3.351   1.00 0.00 ? 52 LEU A HD12 6  
ATOM 8628  H HD13 . LEU A 1 53 ? 166.270 -0.282  5.012   1.00 0.00 ? 52 LEU A HD13 6  
ATOM 8629  H HD21 . LEU A 1 53 ? 164.322 -2.276  3.037   1.00 0.00 ? 52 LEU A HD21 6  
ATOM 8630  H HD22 . LEU A 1 53 ? 163.013 -2.378  4.214   1.00 0.00 ? 52 LEU A HD22 6  
ATOM 8631  H HD23 . LEU A 1 53 ? 164.672 -2.715  4.709   1.00 0.00 ? 52 LEU A HD23 6  
ATOM 8632  N N    . LEU A 1 54 ? 160.631 -1.297  5.207   1.00 0.00 ? 53 LEU A N    6  
ATOM 8633  C CA   . LEU A 1 54 ? 159.710 -2.427  5.119   1.00 0.00 ? 53 LEU A CA   6  
ATOM 8634  C C    . LEU A 1 54 ? 160.383 -3.634  4.470   1.00 0.00 ? 53 LEU A C    6  
ATOM 8635  O O    . LEU A 1 54 ? 160.301 -3.828  3.256   1.00 0.00 ? 53 LEU A O    6  
ATOM 8636  C CB   . LEU A 1 54 ? 158.460 -2.026  4.330   1.00 0.00 ? 53 LEU A CB   6  
ATOM 8637  C CG   . LEU A 1 54 ? 157.329 -1.431  5.171   1.00 0.00 ? 53 LEU A CG   6  
ATOM 8638  C CD1  . LEU A 1 54 ? 156.524 -0.427  4.359   1.00 0.00 ? 53 LEU A CD1  6  
ATOM 8639  C CD2  . LEU A 1 54 ? 156.431 -2.535  5.704   1.00 0.00 ? 53 LEU A CD2  6  
ATOM 8640  H H    . LEU A 1 54 ? 160.574 -0.584  4.537   1.00 0.00 ? 53 LEU A H    6  
ATOM 8641  H HA   . LEU A 1 54 ? 159.417 -2.692  6.125   1.00 0.00 ? 53 LEU A HA   6  
ATOM 8642  H HB2  . LEU A 1 54 ? 158.750 -1.300  3.585   1.00 0.00 ? 53 LEU A HB2  6  
ATOM 8643  H HB3  . LEU A 1 54 ? 158.081 -2.903  3.825   1.00 0.00 ? 53 LEU A HB3  6  
ATOM 8644  H HG   . LEU A 1 54 ? 157.755 -0.909  6.016   1.00 0.00 ? 53 LEU A HG   6  
ATOM 8645  H HD11 . LEU A 1 54 ? 157.141 0.429   4.130   1.00 0.00 ? 53 LEU A HD11 6  
ATOM 8646  H HD12 . LEU A 1 54 ? 155.665 -0.109  4.931   1.00 0.00 ? 53 LEU A HD12 6  
ATOM 8647  H HD13 . LEU A 1 54 ? 156.193 -0.889  3.440   1.00 0.00 ? 53 LEU A HD13 6  
ATOM 8648  H HD21 . LEU A 1 54 ? 155.457 -2.129  5.930   1.00 0.00 ? 53 LEU A HD21 6  
ATOM 8649  H HD22 . LEU A 1 54 ? 156.865 -2.948  6.601   1.00 0.00 ? 53 LEU A HD22 6  
ATOM 8650  H HD23 . LEU A 1 54 ? 156.333 -3.312  4.960   1.00 0.00 ? 53 LEU A HD23 6  
ATOM 8651  N N    . LYS A 1 55 ? 161.050 -4.444  5.293   1.00 0.00 ? 54 LYS A N    6  
ATOM 8652  C CA   . LYS A 1 55 ? 161.741 -5.639  4.804   1.00 0.00 ? 54 LYS A CA   6  
ATOM 8653  C C    . LYS A 1 55 ? 160.844 -6.877  4.890   1.00 0.00 ? 54 LYS A C    6  
ATOM 8654  O O    . LYS A 1 55 ? 160.954 -7.786  4.065   1.00 0.00 ? 54 LYS A O    6  
ATOM 8655  C CB   . LYS A 1 55 ? 163.043 -5.873  5.583   1.00 0.00 ? 54 LYS A CB   6  
ATOM 8656  C CG   . LYS A 1 55 ? 162.860 -5.997  7.090   1.00 0.00 ? 54 LYS A CG   6  
ATOM 8657  C CD   . LYS A 1 55 ? 163.589 -4.889  7.835   1.00 0.00 ? 54 LYS A CD   6  
ATOM 8658  C CE   . LYS A 1 55 ? 164.109 -5.365  9.183   1.00 0.00 ? 54 LYS A CE   6  
ATOM 8659  N NZ   . LYS A 1 55 ? 163.006 -5.587  10.162  1.00 0.00 ? 54 LYS A NZ   6  
ATOM 8660  H H    . LYS A 1 55 ? 161.077 -4.234  6.250   1.00 0.00 ? 54 LYS A H    6  
ATOM 8661  H HA   . LYS A 1 55 ? 161.986 -5.469  3.767   1.00 0.00 ? 54 LYS A HA   6  
ATOM 8662  H HB2  . LYS A 1 55 ? 163.499 -6.785  5.226   1.00 0.00 ? 54 LYS A HB2  6  
ATOM 8663  H HB3  . LYS A 1 55 ? 163.714 -5.049  5.390   1.00 0.00 ? 54 LYS A HB3  6  
ATOM 8664  H HG2  . LYS A 1 55 ? 161.807 -5.939  7.322   1.00 0.00 ? 54 LYS A HG2  6  
ATOM 8665  H HG3  . LYS A 1 55 ? 163.249 -6.953  7.411   1.00 0.00 ? 54 LYS A HG3  6  
ATOM 8666  H HD2  . LYS A 1 55 ? 164.425 -4.556  7.236   1.00 0.00 ? 54 LYS A HD2  6  
ATOM 8667  H HD3  . LYS A 1 55 ? 162.907 -4.066  7.992   1.00 0.00 ? 54 LYS A HD3  6  
ATOM 8668  H HE2  . LYS A 1 55 ? 164.647 -6.292  9.042   1.00 0.00 ? 54 LYS A HE2  6  
ATOM 8669  H HE3  . LYS A 1 55 ? 164.783 -4.617  9.577   1.00 0.00 ? 54 LYS A HE3  6  
ATOM 8670  H HZ1  . LYS A 1 55 ? 163.355 -6.133  10.976  1.00 0.00 ? 54 LYS A HZ1  6  
ATOM 8671  H HZ2  . LYS A 1 55 ? 162.228 -6.113  9.713   1.00 0.00 ? 54 LYS A HZ2  6  
ATOM 8672  H HZ3  . LYS A 1 55 ? 162.640 -4.675  10.502  1.00 0.00 ? 54 LYS A HZ3  6  
ATOM 8673  N N    . ASN A 1 56 ? 159.959 -6.907  5.890   1.00 0.00 ? 55 ASN A N    6  
ATOM 8674  C CA   . ASN A 1 56 ? 159.047 -8.032  6.078   1.00 0.00 ? 55 ASN A CA   6  
ATOM 8675  C C    . ASN A 1 56 ? 157.676 -7.549  6.557   1.00 0.00 ? 55 ASN A C    6  
ATOM 8676  O O    . ASN A 1 56 ? 157.459 -6.348  6.729   1.00 0.00 ? 55 ASN A O    6  
ATOM 8677  C CB   . ASN A 1 56 ? 159.638 -9.030  7.084   1.00 0.00 ? 55 ASN A CB   6  
ATOM 8678  C CG   . ASN A 1 56 ? 159.590 -10.463 6.578   1.00 0.00 ? 55 ASN A CG   6  
ATOM 8679  O OD1  . ASN A 1 56 ? 158.704 -10.832 5.807   1.00 0.00 ? 55 ASN A OD1  6  
ATOM 8680  N ND2  . ASN A 1 56 ? 160.543 -11.281 7.014   1.00 0.00 ? 55 ASN A ND2  6  
ATOM 8681  H H    . ASN A 1 56 ? 159.918 -6.154  6.516   1.00 0.00 ? 55 ASN A H    6  
ATOM 8682  H HA   . ASN A 1 56 ? 158.927 -8.524  5.125   1.00 0.00 ? 55 ASN A HA   6  
ATOM 8683  H HB2  . ASN A 1 56 ? 160.668 -8.771  7.273   1.00 0.00 ? 55 ASN A HB2  6  
ATOM 8684  H HB3  . ASN A 1 56 ? 159.082 -8.974  8.009   1.00 0.00 ? 55 ASN A HB3  6  
ATOM 8685  H HD21 . ASN A 1 56 ? 161.218 -10.924 7.629   1.00 0.00 ? 55 ASN A HD21 6  
ATOM 8686  H HD22 . ASN A 1 56 ? 160.532 -12.211 6.702   1.00 0.00 ? 55 ASN A HD22 6  
ATOM 8687  N N    . GLN A 1 57 ? 156.756 -8.494  6.772   1.00 0.00 ? 56 GLN A N    6  
ATOM 8688  C CA   . GLN A 1 57 ? 155.406 -8.163  7.235   1.00 0.00 ? 56 GLN A CA   6  
ATOM 8689  C C    . GLN A 1 57 ? 155.442 -7.506  8.616   1.00 0.00 ? 56 GLN A C    6  
ATOM 8690  O O    . GLN A 1 57 ? 154.593 -6.673  8.928   1.00 0.00 ? 56 GLN A O    6  
ATOM 8691  C CB   . GLN A 1 57 ? 154.522 -9.413  7.283   1.00 0.00 ? 56 GLN A CB   6  
ATOM 8692  C CG   . GLN A 1 57 ? 153.788 -9.697  5.980   1.00 0.00 ? 56 GLN A CG   6  
ATOM 8693  C CD   . GLN A 1 57 ? 152.642 -8.733  5.730   1.00 0.00 ? 56 GLN A CD   6  
ATOM 8694  O OE1  . GLN A 1 57 ? 152.856 -7.587  5.334   1.00 0.00 ? 56 GLN A OE1  6  
ATOM 8695  N NE2  . GLN A 1 57 ? 151.415 -9.191  5.957   1.00 0.00 ? 56 GLN A NE2  6  
ATOM 8696  H H    . GLN A 1 57 ? 156.992 -9.434  6.619   1.00 0.00 ? 56 GLN A H    6  
ATOM 8697  H HA   . GLN A 1 57 ? 154.982 -7.462  6.531   1.00 0.00 ? 56 GLN A HA   6  
ATOM 8698  H HB2  . GLN A 1 57 ? 155.138 -10.268 7.517   1.00 0.00 ? 56 GLN A HB2  6  
ATOM 8699  H HB3  . GLN A 1 57 ? 153.786 -9.287  8.063   1.00 0.00 ? 56 GLN A HB3  6  
ATOM 8700  H HG2  . GLN A 1 57 ? 154.489 -9.618  5.162   1.00 0.00 ? 56 GLN A HG2  6  
ATOM 8701  H HG3  . GLN A 1 57 ? 153.393 -10.701 6.017   1.00 0.00 ? 56 GLN A HG3  6  
ATOM 8702  H HE21 . GLN A 1 57 ? 151.314 -10.115 6.269   1.00 0.00 ? 56 GLN A HE21 6  
ATOM 8703  H HE22 . GLN A 1 57 ? 150.659 -8.586  5.803   1.00 0.00 ? 56 GLN A HE22 6  
ATOM 8704  N N    . ASP A 1 58 ? 156.429 -7.886  9.436   1.00 0.00 ? 57 ASP A N    6  
ATOM 8705  C CA   . ASP A 1 58 ? 156.572 -7.327  10.782  1.00 0.00 ? 57 ASP A CA   6  
ATOM 8706  C C    . ASP A 1 58 ? 156.602 -5.799  10.743  1.00 0.00 ? 57 ASP A C    6  
ATOM 8707  O O    . ASP A 1 58 ? 155.959 -5.139  11.558  1.00 0.00 ? 57 ASP A O    6  
ATOM 8708  C CB   . ASP A 1 58 ? 157.848 -7.850  11.451  1.00 0.00 ? 57 ASP A CB   6  
ATOM 8709  C CG   . ASP A 1 58 ? 157.590 -9.053  12.338  1.00 0.00 ? 57 ASP A CG   6  
ATOM 8710  O OD1  . ASP A 1 58 ? 157.410 -10.163 11.796  1.00 0.00 ? 57 ASP A OD1  6  
ATOM 8711  O OD2  . ASP A 1 58 ? 157.575 -8.884  13.577  1.00 0.00 ? 57 ASP A OD2  6  
ATOM 8712  H H    . ASP A 1 58 ? 157.074 -8.558  9.129   1.00 0.00 ? 57 ASP A H    6  
ATOM 8713  H HA   . ASP A 1 58 ? 155.717 -7.643  11.363  1.00 0.00 ? 57 ASP A HA   6  
ATOM 8714  H HB2  . ASP A 1 58 ? 158.557 -8.135  10.688  1.00 0.00 ? 57 ASP A HB2  6  
ATOM 8715  H HB3  . ASP A 1 58 ? 158.275 -7.064  12.057  1.00 0.00 ? 57 ASP A HB3  6  
ATOM 8716  N N    . ASP A 1 59 ? 157.353 -5.246  9.790   1.00 0.00 ? 58 ASP A N    6  
ATOM 8717  C CA   . ASP A 1 59 ? 157.466 -3.795  9.643   1.00 0.00 ? 58 ASP A CA   6  
ATOM 8718  C C    . ASP A 1 59 ? 156.131 -3.176  9.226   1.00 0.00 ? 58 ASP A C    6  
ATOM 8719  O O    . ASP A 1 59 ? 155.754 -2.109  9.715   1.00 0.00 ? 58 ASP A O    6  
ATOM 8720  C CB   . ASP A 1 59 ? 158.549 -3.449  8.618   1.00 0.00 ? 58 ASP A CB   6  
ATOM 8721  C CG   . ASP A 1 59 ? 159.947 -3.716  9.140   1.00 0.00 ? 58 ASP A CG   6  
ATOM 8722  O OD1  . ASP A 1 59 ? 160.512 -2.830  9.815   1.00 0.00 ? 58 ASP A OD1  6  
ATOM 8723  O OD2  . ASP A 1 59 ? 160.478 -4.815  8.874   1.00 0.00 ? 58 ASP A OD2  6  
ATOM 8724  H H    . ASP A 1 59 ? 157.842 -5.827  9.169   1.00 0.00 ? 58 ASP A H    6  
ATOM 8725  H HA   . ASP A 1 59 ? 157.749 -3.389  10.603  1.00 0.00 ? 58 ASP A HA   6  
ATOM 8726  H HB2  . ASP A 1 59 ? 158.398 -4.045  7.731   1.00 0.00 ? 58 ASP A HB2  6  
ATOM 8727  H HB3  . ASP A 1 59 ? 158.472 -2.402  8.361   1.00 0.00 ? 58 ASP A HB3  6  
ATOM 8728  N N    . LEU A 1 60 ? 155.416 -3.853  8.327   1.00 0.00 ? 59 LEU A N    6  
ATOM 8729  C CA   . LEU A 1 60 ? 154.120 -3.369  7.855   1.00 0.00 ? 59 LEU A CA   6  
ATOM 8730  C C    . LEU A 1 60 ? 153.074 -3.452  8.965   1.00 0.00 ? 59 LEU A C    6  
ATOM 8731  O O    . LEU A 1 60 ? 152.264 -2.541  9.135   1.00 0.00 ? 59 LEU A O    6  
ATOM 8732  C CB   . LEU A 1 60 ? 153.658 -4.178  6.639   1.00 0.00 ? 59 LEU A CB   6  
ATOM 8733  C CG   . LEU A 1 60 ? 152.428 -3.619  5.917   1.00 0.00 ? 59 LEU A CG   6  
ATOM 8734  C CD1  . LEU A 1 60 ? 152.841 -2.610  4.856   1.00 0.00 ? 59 LEU A CD1  6  
ATOM 8735  C CD2  . LEU A 1 60 ? 151.613 -4.746  5.298   1.00 0.00 ? 59 LEU A CD2  6  
ATOM 8736  H H    . LEU A 1 60 ? 155.765 -4.700  7.978   1.00 0.00 ? 59 LEU A H    6  
ATOM 8737  H HA   . LEU A 1 60 ? 154.239 -2.335  7.565   1.00 0.00 ? 59 LEU A HA   6  
ATOM 8738  H HB2  . LEU A 1 60 ? 154.474 -4.227  5.934   1.00 0.00 ? 59 LEU A HB2  6  
ATOM 8739  H HB3  . LEU A 1 60 ? 153.429 -5.181  6.968   1.00 0.00 ? 59 LEU A HB3  6  
ATOM 8740  H HG   . LEU A 1 60 ? 151.801 -3.108  6.634   1.00 0.00 ? 59 LEU A HG   6  
ATOM 8741  H HD11 . LEU A 1 60 ? 153.426 -3.105  4.095   1.00 0.00 ? 59 LEU A HD11 6  
ATOM 8742  H HD12 . LEU A 1 60 ? 153.432 -1.829  5.313   1.00 0.00 ? 59 LEU A HD12 6  
ATOM 8743  H HD13 . LEU A 1 60 ? 151.959 -2.177  4.407   1.00 0.00 ? 59 LEU A HD13 6  
ATOM 8744  H HD21 . LEU A 1 60 ? 152.261 -5.379  4.711   1.00 0.00 ? 59 LEU A HD21 6  
ATOM 8745  H HD22 . LEU A 1 60 ? 150.846 -4.329  4.663   1.00 0.00 ? 59 LEU A HD22 6  
ATOM 8746  H HD23 . LEU A 1 60 ? 151.153 -5.330  6.082   1.00 0.00 ? 59 LEU A HD23 6  
ATOM 8747  N N    . ASP A 1 61 ? 153.103 -4.554  9.716   1.00 0.00 ? 60 ASP A N    6  
ATOM 8748  C CA   . ASP A 1 61 ? 152.161 -4.771  10.814  1.00 0.00 ? 60 ASP A CA   6  
ATOM 8749  C C    . ASP A 1 61 ? 152.376 -3.760  11.939  1.00 0.00 ? 60 ASP A C    6  
ATOM 8750  O O    . ASP A 1 61 ? 151.414 -3.255  12.517  1.00 0.00 ? 60 ASP A O    6  
ATOM 8751  C CB   . ASP A 1 61 ? 152.298 -6.191  11.367  1.00 0.00 ? 60 ASP A CB   6  
ATOM 8752  C CG   . ASP A 1 61 ? 151.119 -6.592  12.235  1.00 0.00 ? 60 ASP A CG   6  
ATOM 8753  O OD1  . ASP A 1 61 ? 149.963 -6.432  11.785  1.00 0.00 ? 60 ASP A OD1  6  
ATOM 8754  O OD2  . ASP A 1 61 ? 151.351 -7.067  13.366  1.00 0.00 ? 60 ASP A OD2  6  
ATOM 8755  H H    . ASP A 1 61 ? 153.777 -5.242  9.525   1.00 0.00 ? 60 ASP A H    6  
ATOM 8756  H HA   . ASP A 1 61 ? 151.163 -4.644  10.420  1.00 0.00 ? 60 ASP A HA   6  
ATOM 8757  H HB2  . ASP A 1 61 ? 152.368 -6.886  10.544  1.00 0.00 ? 60 ASP A HB2  6  
ATOM 8758  H HB3  . ASP A 1 61 ? 153.197 -6.252  11.963  1.00 0.00 ? 60 ASP A HB3  6  
ATOM 8759  N N    . LYS A 1 62 ? 153.642 -3.466  12.239  1.00 0.00 ? 61 LYS A N    6  
ATOM 8760  C CA   . LYS A 1 62 ? 153.981 -2.509  13.291  1.00 0.00 ? 61 LYS A CA   6  
ATOM 8761  C C    . LYS A 1 62 ? 153.448 -1.121  12.940  1.00 0.00 ? 61 LYS A C    6  
ATOM 8762  O O    . LYS A 1 62 ? 152.994 -0.381  13.814  1.00 0.00 ? 61 LYS A O    6  
ATOM 8763  C CB   . LYS A 1 62 ? 155.501 -2.449  13.490  1.00 0.00 ? 61 LYS A CB   6  
ATOM 8764  C CG   . LYS A 1 62 ? 155.951 -2.742  14.914  1.00 0.00 ? 61 LYS A CG   6  
ATOM 8765  C CD   . LYS A 1 62 ? 156.403 -4.186  15.072  1.00 0.00 ? 61 LYS A CD   6  
ATOM 8766  C CE   . LYS A 1 62 ? 157.528 -4.312  16.089  1.00 0.00 ? 61 LYS A CE   6  
ATOM 8767  N NZ   . LYS A 1 62 ? 157.757 -5.727  16.499  1.00 0.00 ? 61 LYS A NZ   6  
ATOM 8768  H H    . LYS A 1 62 ? 154.366 -3.900  11.738  1.00 0.00 ? 61 LYS A H    6  
ATOM 8769  H HA   . LYS A 1 62 ? 153.515 -2.843  14.208  1.00 0.00 ? 61 LYS A HA   6  
ATOM 8770  H HB2  . LYS A 1 62 ? 155.966 -3.169  12.834  1.00 0.00 ? 61 LYS A HB2  6  
ATOM 8771  H HB3  . LYS A 1 62 ? 155.846 -1.461  13.224  1.00 0.00 ? 61 LYS A HB3  6  
ATOM 8772  H HG2  . LYS A 1 62 ? 156.776 -2.089  15.160  1.00 0.00 ? 61 LYS A HG2  6  
ATOM 8773  H HG3  . LYS A 1 62 ? 155.128 -2.554  15.589  1.00 0.00 ? 61 LYS A HG3  6  
ATOM 8774  H HD2  . LYS A 1 62 ? 155.565 -4.781  15.403  1.00 0.00 ? 61 LYS A HD2  6  
ATOM 8775  H HD3  . LYS A 1 62 ? 156.751 -4.552  14.117  1.00 0.00 ? 61 LYS A HD3  6  
ATOM 8776  H HE2  . LYS A 1 62 ? 158.435 -3.923  15.651  1.00 0.00 ? 61 LYS A HE2  6  
ATOM 8777  H HE3  . LYS A 1 62 ? 157.273 -3.729  16.962  1.00 0.00 ? 61 LYS A HE3  6  
ATOM 8778  H HZ1  . LYS A 1 62 ? 158.498 -6.156  15.908  1.00 0.00 ? 61 LYS A HZ1  6  
ATOM 8779  H HZ2  . LYS A 1 62 ? 156.881 -6.279  16.392  1.00 0.00 ? 61 LYS A HZ2  6  
ATOM 8780  H HZ3  . LYS A 1 62 ? 158.057 -5.766  17.495  1.00 0.00 ? 61 LYS A HZ3  6  
ATOM 8781  N N    . ALA A 1 63 ? 153.500 -0.781  11.650  1.00 0.00 ? 62 ALA A N    6  
ATOM 8782  C CA   . ALA A 1 63 ? 153.017 0.513   11.173  1.00 0.00 ? 62 ALA A CA   6  
ATOM 8783  C C    . ALA A 1 63 ? 151.517 0.671   11.417  1.00 0.00 ? 62 ALA A C    6  
ATOM 8784  O O    . ALA A 1 63 ? 151.050 1.757   11.763  1.00 0.00 ? 62 ALA A O    6  
ATOM 8785  C CB   . ALA A 1 63 ? 153.330 0.683   9.693   1.00 0.00 ? 62 ALA A CB   6  
ATOM 8786  H H    . ALA A 1 63 ? 153.869 -1.419  11.003  1.00 0.00 ? 62 ALA A H    6  
ATOM 8787  H HA   . ALA A 1 63 ? 153.542 1.284   11.718  1.00 0.00 ? 62 ALA A HA   6  
ATOM 8788  H HB1  . ALA A 1 63 ? 154.303 1.138   9.581   1.00 0.00 ? 62 ALA A HB1  6  
ATOM 8789  H HB2  . ALA A 1 63 ? 152.582 1.317   9.239   1.00 0.00 ? 62 ALA A HB2  6  
ATOM 8790  H HB3  . ALA A 1 63 ? 153.325 -0.282  9.208   1.00 0.00 ? 62 ALA A HB3  6  
ATOM 8791  N N    . ILE A 1 64 ? 150.765 -0.418  11.235  1.00 0.00 ? 63 ILE A N    6  
ATOM 8792  C CA   . ILE A 1 64 ? 149.316 -0.392  11.438  1.00 0.00 ? 63 ILE A CA   6  
ATOM 8793  C C    . ILE A 1 64 ? 148.972 -0.067  12.892  1.00 0.00 ? 63 ILE A C    6  
ATOM 8794  O O    . ILE A 1 64 ? 148.060 0.717   13.158  1.00 0.00 ? 63 ILE A O    6  
ATOM 8795  C CB   . ILE A 1 64 ? 148.651 -1.734  11.047  1.00 0.00 ? 63 ILE A CB   6  
ATOM 8796  C CG1  . ILE A 1 64 ? 149.026 -2.123  9.612   1.00 0.00 ? 63 ILE A CG1  6  
ATOM 8797  C CG2  . ILE A 1 64 ? 147.137 -1.638  11.192  1.00 0.00 ? 63 ILE A CG2  6  
ATOM 8798  C CD1  . ILE A 1 64 ? 148.690 -3.557  9.262   1.00 0.00 ? 63 ILE A CD1  6  
ATOM 8799  H H    . ILE A 1 64 ? 151.194 -1.256  10.960  1.00 0.00 ? 63 ILE A H    6  
ATOM 8800  H HA   . ILE A 1 64 ? 148.910 0.383   10.804  1.00 0.00 ? 63 ILE A HA   6  
ATOM 8801  H HB   . ILE A 1 64 ? 149.006 -2.498  11.723  1.00 0.00 ? 63 ILE A HB   6  
ATOM 8802  H HG12 . ILE A 1 64 ? 148.497 -1.483  8.923   1.00 0.00 ? 63 ILE A HG12 6  
ATOM 8803  H HG13 . ILE A 1 64 ? 150.088 -1.989  9.475   1.00 0.00 ? 63 ILE A HG13 6  
ATOM 8804  H HG21 . ILE A 1 64 ? 146.781 -0.761  10.672  1.00 0.00 ? 63 ILE A HG21 6  
ATOM 8805  H HG22 . ILE A 1 64 ? 146.881 -1.565  12.238  1.00 0.00 ? 63 ILE A HG22 6  
ATOM 8806  H HG23 . ILE A 1 64 ? 146.677 -2.519  10.770  1.00 0.00 ? 63 ILE A HG23 6  
ATOM 8807  H HD11 . ILE A 1 64 ? 148.863 -3.721  8.209   1.00 0.00 ? 63 ILE A HD11 6  
ATOM 8808  H HD12 . ILE A 1 64 ? 147.652 -3.750  9.490   1.00 0.00 ? 63 ILE A HD12 6  
ATOM 8809  H HD13 . ILE A 1 64 ? 149.315 -4.225  9.838   1.00 0.00 ? 63 ILE A HD13 6  
ATOM 8810  N N    . ASP A 1 65 ? 149.707 -0.673  13.826  1.00 0.00 ? 64 ASP A N    6  
ATOM 8811  C CA   . ASP A 1 65 ? 149.482 -0.448  15.255  1.00 0.00 ? 64 ASP A CA   6  
ATOM 8812  C C    . ASP A 1 65 ? 149.528 1.043   15.592  1.00 0.00 ? 64 ASP A C    6  
ATOM 8813  O O    . ASP A 1 65 ? 148.668 1.551   16.313  1.00 0.00 ? 64 ASP A O    6  
ATOM 8814  C CB   . ASP A 1 65 ? 150.532 -1.198  16.085  1.00 0.00 ? 64 ASP A CB   6  
ATOM 8815  C CG   . ASP A 1 65 ? 150.232 -2.682  16.221  1.00 0.00 ? 64 ASP A CG   6  
ATOM 8816  O OD1  . ASP A 1 65 ? 149.869 -3.315  15.206  1.00 0.00 ? 64 ASP A OD1  6  
ATOM 8817  O OD2  . ASP A 1 65 ? 150.368 -3.212  17.344  1.00 0.00 ? 64 ASP A OD2  6  
ATOM 8818  H H    . ASP A 1 65 ? 150.420 -1.286  13.548  1.00 0.00 ? 64 ASP A H    6  
ATOM 8819  H HA   . ASP A 1 65 ? 148.502 -0.830  15.499  1.00 0.00 ? 64 ASP A HA   6  
ATOM 8820  H HB2  . ASP A 1 65 ? 151.496 -1.091  15.613  1.00 0.00 ? 64 ASP A HB2  6  
ATOM 8821  H HB3  . ASP A 1 65 ? 150.571 -0.767  17.074  1.00 0.00 ? 64 ASP A HB3  6  
ATOM 8822  N N    . ILE A 1 66 ? 150.532 1.738   15.059  1.00 0.00 ? 65 ILE A N    6  
ATOM 8823  C CA   . ILE A 1 66 ? 150.684 3.170   15.300  1.00 0.00 ? 65 ILE A CA   6  
ATOM 8824  C C    . ILE A 1 66 ? 149.577 3.961   14.603  1.00 0.00 ? 65 ILE A C    6  
ATOM 8825  O O    . ILE A 1 66 ? 149.024 4.902   15.175  1.00 0.00 ? 65 ILE A O    6  
ATOM 8826  C CB   . ILE A 1 66 ? 152.059 3.688   14.822  1.00 0.00 ? 65 ILE A CB   6  
ATOM 8827  C CG1  . ILE A 1 66 ? 153.188 2.822   15.394  1.00 0.00 ? 65 ILE A CG1  6  
ATOM 8828  C CG2  . ILE A 1 66 ? 152.244 5.146   15.226  1.00 0.00 ? 65 ILE A CG2  6  
ATOM 8829  C CD1  . ILE A 1 66 ? 154.303 2.551   14.407  1.00 0.00 ? 65 ILE A CD1  6  
ATOM 8830  H H    . ILE A 1 66 ? 151.183 1.277   14.488  1.00 0.00 ? 65 ILE A H    6  
ATOM 8831  H HA   . ILE A 1 66 ? 150.612 3.336   16.365  1.00 0.00 ? 65 ILE A HA   6  
ATOM 8832  H HB   . ILE A 1 66 ? 152.084 3.634   13.744  1.00 0.00 ? 65 ILE A HB   6  
ATOM 8833  H HG12 . ILE A 1 66 ? 153.618 3.319   16.250  1.00 0.00 ? 65 ILE A HG12 6  
ATOM 8834  H HG13 . ILE A 1 66 ? 152.782 1.870   15.704  1.00 0.00 ? 65 ILE A HG13 6  
ATOM 8835  H HG21 . ILE A 1 66 ? 151.493 5.751   14.740  1.00 0.00 ? 65 ILE A HG21 6  
ATOM 8836  H HG22 . ILE A 1 66 ? 153.225 5.481   14.925  1.00 0.00 ? 65 ILE A HG22 6  
ATOM 8837  H HG23 . ILE A 1 66 ? 152.144 5.239   16.297  1.00 0.00 ? 65 ILE A HG23 6  
ATOM 8838  H HD11 . ILE A 1 66 ? 154.585 3.473   13.921  1.00 0.00 ? 65 ILE A HD11 6  
ATOM 8839  H HD12 . ILE A 1 66 ? 153.964 1.843   13.667  1.00 0.00 ? 65 ILE A HD12 6  
ATOM 8840  H HD13 . ILE A 1 66 ? 155.156 2.145   14.930  1.00 0.00 ? 65 ILE A HD13 6  
ATOM 8841  N N    . LEU A 1 67 ? 149.258 3.571   13.367  1.00 0.00 ? 66 LEU A N    6  
ATOM 8842  C CA   . LEU A 1 67 ? 148.214 4.242   12.595  1.00 0.00 ? 66 LEU A CA   6  
ATOM 8843  C C    . LEU A 1 67 ? 146.857 4.134   13.296  1.00 0.00 ? 66 LEU A C    6  
ATOM 8844  O O    . LEU A 1 67 ? 146.123 5.119   13.387  1.00 0.00 ? 66 LEU A O    6  
ATOM 8845  C CB   . LEU A 1 67 ? 148.128 3.647   11.186  1.00 0.00 ? 66 LEU A CB   6  
ATOM 8846  C CG   . LEU A 1 67 ? 147.452 4.540   10.141  1.00 0.00 ? 66 LEU A CG   6  
ATOM 8847  C CD1  . LEU A 1 67 ? 148.305 5.767   9.847   1.00 0.00 ? 66 LEU A CD1  6  
ATOM 8848  C CD2  . LEU A 1 67 ? 147.184 3.753   8.866   1.00 0.00 ? 66 LEU A CD2  6  
ATOM 8849  H H    . LEU A 1 67 ? 149.735 2.813   12.967  1.00 0.00 ? 66 LEU A H    6  
ATOM 8850  H HA   . LEU A 1 67 ? 148.482 5.285   12.519  1.00 0.00 ? 66 LEU A HA   6  
ATOM 8851  H HB2  . LEU A 1 67 ? 149.132 3.430   10.849  1.00 0.00 ? 66 LEU A HB2  6  
ATOM 8852  H HB3  . LEU A 1 67 ? 147.578 2.720   11.243  1.00 0.00 ? 66 LEU A HB3  6  
ATOM 8853  H HG   . LEU A 1 67 ? 146.503 4.881   10.530  1.00 0.00 ? 66 LEU A HG   6  
ATOM 8854  H HD11 . LEU A 1 67 ? 148.043 6.559   10.532  1.00 0.00 ? 66 LEU A HD11 6  
ATOM 8855  H HD12 . LEU A 1 67 ? 148.128 6.096   8.833   1.00 0.00 ? 66 LEU A HD12 6  
ATOM 8856  H HD13 . LEU A 1 67 ? 149.349 5.518   9.967   1.00 0.00 ? 66 LEU A HD13 6  
ATOM 8857  H HD21 . LEU A 1 67 ? 147.916 2.966   8.768   1.00 0.00 ? 66 LEU A HD21 6  
ATOM 8858  H HD22 . LEU A 1 67 ? 147.250 4.414   8.015   1.00 0.00 ? 66 LEU A HD22 6  
ATOM 8859  H HD23 . LEU A 1 67 ? 146.195 3.322   8.911   1.00 0.00 ? 66 LEU A HD23 6  
ATOM 8860  N N    . ASP A 1 68 ? 146.533 2.935   13.792  1.00 0.00 ? 67 ASP A N    6  
ATOM 8861  C CA   . ASP A 1 68 ? 145.265 2.704   14.489  1.00 0.00 ? 67 ASP A CA   6  
ATOM 8862  C C    . ASP A 1 68 ? 145.161 3.574   15.743  1.00 0.00 ? 67 ASP A C    6  
ATOM 8863  O O    . ASP A 1 68 ? 144.094 4.104   16.052  1.00 0.00 ? 67 ASP A O    6  
ATOM 8864  C CB   . ASP A 1 68 ? 145.114 1.224   14.865  1.00 0.00 ? 67 ASP A CB   6  
ATOM 8865  C CG   . ASP A 1 68 ? 144.492 0.390   13.757  1.00 0.00 ? 67 ASP A CG   6  
ATOM 8866  O OD1  . ASP A 1 68 ? 143.487 0.837   13.162  1.00 0.00 ? 67 ASP A OD1  6  
ATOM 8867  O OD2  . ASP A 1 68 ? 145.008 -0.716  13.489  1.00 0.00 ? 67 ASP A OD2  6  
ATOM 8868  H H    . ASP A 1 68 ? 147.163 2.190   13.688  1.00 0.00 ? 67 ASP A H    6  
ATOM 8869  H HA   . ASP A 1 68 ? 144.466 2.977   13.815  1.00 0.00 ? 67 ASP A HA   6  
ATOM 8870  H HB2  . ASP A 1 68 ? 146.087 0.814   15.091  1.00 0.00 ? 67 ASP A HB2  6  
ATOM 8871  H HB3  . ASP A 1 68 ? 144.485 1.147   15.741  1.00 0.00 ? 67 ASP A HB3  6  
ATOM 8872  N N    . ARG A 1 69 ? 146.279 3.722   16.458  1.00 0.00 ? 68 ARG A N    6  
ATOM 8873  C CA   . ARG A 1 69 ? 146.316 4.534   17.675  1.00 0.00 ? 68 ARG A CA   6  
ATOM 8874  C C    . ARG A 1 69 ? 146.000 6.000   17.373  1.00 0.00 ? 68 ARG A C    6  
ATOM 8875  O O    . ARG A 1 69 ? 145.384 6.688   18.187  1.00 0.00 ? 68 ARG A O    6  
ATOM 8876  C CB   . ARG A 1 69 ? 147.687 4.429   18.349  1.00 0.00 ? 68 ARG A CB   6  
ATOM 8877  C CG   . ARG A 1 69 ? 147.767 3.327   19.394  1.00 0.00 ? 68 ARG A CG   6  
ATOM 8878  C CD   . ARG A 1 69 ? 148.442 3.809   20.671  1.00 0.00 ? 68 ARG A CD   6  
ATOM 8879  N NE   . ARG A 1 69 ? 149.784 4.342   20.424  1.00 0.00 ? 68 ARG A NE   6  
ATOM 8880  C CZ   . ARG A 1 69 ? 150.866 3.586   20.210  1.00 0.00 ? 68 ARG A CZ   6  
ATOM 8881  N NH1  . ARG A 1 69 ? 150.774 2.257   20.203  1.00 0.00 ? 68 ARG A NH1  6  
ATOM 8882  N NH2  . ARG A 1 69 ? 152.046 4.162   20.002  1.00 0.00 ? 68 ARG A NH2  6  
ATOM 8883  H H    . ARG A 1 69 ? 147.100 3.279   16.156  1.00 0.00 ? 68 ARG A H    6  
ATOM 8884  H HA   . ARG A 1 69 ? 145.566 4.151   18.349  1.00 0.00 ? 68 ARG A HA   6  
ATOM 8885  H HB2  . ARG A 1 69 ? 148.435 4.235   17.594  1.00 0.00 ? 68 ARG A HB2  6  
ATOM 8886  H HB3  . ARG A 1 69 ? 147.911 5.371   18.831  1.00 0.00 ? 68 ARG A HB3  6  
ATOM 8887  H HG2  . ARG A 1 69 ? 146.767 2.997   19.633  1.00 0.00 ? 68 ARG A HG2  6  
ATOM 8888  H HG3  . ARG A 1 69 ? 148.333 2.501   18.987  1.00 0.00 ? 68 ARG A HG3  6  
ATOM 8889  H HD2  . ARG A 1 69 ? 147.834 4.584   21.113  1.00 0.00 ? 68 ARG A HD2  6  
ATOM 8890  H HD3  . ARG A 1 69 ? 148.516 2.978   21.357  1.00 0.00 ? 68 ARG A HD3  6  
ATOM 8891  H HE   . ARG A 1 69 ? 149.884 5.318   20.420  1.00 0.00 ? 68 ARG A HE   6  
ATOM 8892  H HH11 . ARG A 1 69 ? 149.891 1.814   20.358  1.00 0.00 ? 68 ARG A HH11 6  
ATOM 8893  H HH12 . ARG A 1 69 ? 151.589 1.700   20.041  1.00 0.00 ? 68 ARG A HH12 6  
ATOM 8894  H HH21 . ARG A 1 69 ? 152.125 5.159   20.006  1.00 0.00 ? 68 ARG A HH21 6  
ATOM 8895  H HH22 . ARG A 1 69 ? 152.857 3.598   19.842  1.00 0.00 ? 68 ARG A HH22 6  
ATOM 8896  N N    . SER A 1 70 ? 146.425 6.472   16.200  1.00 0.00 ? 69 SER A N    6  
ATOM 8897  C CA   . SER A 1 70 ? 146.183 7.856   15.799  1.00 0.00 ? 69 SER A CA   6  
ATOM 8898  C C    . SER A 1 70 ? 144.826 8.003   15.109  1.00 0.00 ? 69 SER A C    6  
ATOM 8899  O O    . SER A 1 70 ? 144.576 7.388   14.070  1.00 0.00 ? 69 SER A O    6  
ATOM 8900  C CB   . SER A 1 70 ? 147.296 8.343   14.869  1.00 0.00 ? 69 SER A CB   6  
ATOM 8901  O OG   . SER A 1 70 ? 147.154 9.726   14.583  1.00 0.00 ? 69 SER A OG   6  
ATOM 8902  H H    . SER A 1 70 ? 146.913 5.876   15.593  1.00 0.00 ? 69 SER A H    6  
ATOM 8903  H HA   . SER A 1 70 ? 146.184 8.461   16.692  1.00 0.00 ? 69 SER A HA   6  
ATOM 8904  H HB2  . SER A 1 70 ? 148.252 8.183   15.344  1.00 0.00 ? 69 SER A HB2  6  
ATOM 8905  H HB3  . SER A 1 70 ? 147.255 7.788   13.943  1.00 0.00 ? 69 SER A HB3  6  
ATOM 8906  H HG   . SER A 1 70 ? 148.001 10.085  14.308  1.00 0.00 ? 69 SER A HG   6  
ATOM 8907  N N    . SER A 1 71 ? 143.958 8.833   15.690  1.00 0.00 ? 70 SER A N    6  
ATOM 8908  C CA   . SER A 1 71 ? 142.627 9.076   15.132  1.00 0.00 ? 70 SER A CA   6  
ATOM 8909  C C    . SER A 1 71 ? 142.690 10.044  13.948  1.00 0.00 ? 70 SER A C    6  
ATOM 8910  O O    . SER A 1 71 ? 141.893 9.939   13.014  1.00 0.00 ? 70 SER A O    6  
ATOM 8911  C CB   . SER A 1 71 ? 141.689 9.634   16.207  1.00 0.00 ? 70 SER A CB   6  
ATOM 8912  O OG   . SER A 1 71 ? 141.476 8.687   17.241  1.00 0.00 ? 70 SER A OG   6  
ATOM 8913  H H    . SER A 1 71 ? 144.222 9.299   16.511  1.00 0.00 ? 70 SER A H    6  
ATOM 8914  H HA   . SER A 1 71 ? 142.237 8.131   14.786  1.00 0.00 ? 70 SER A HA   6  
ATOM 8915  H HB2  . SER A 1 71 ? 142.124 10.525  16.635  1.00 0.00 ? 70 SER A HB2  6  
ATOM 8916  H HB3  . SER A 1 71 ? 140.736 9.879   15.759  1.00 0.00 ? 70 SER A HB3  6  
ATOM 8917  H HG   . SER A 1 71 ? 142.232 8.683   17.833  1.00 0.00 ? 70 SER A HG   6  
ATOM 8918  N N    . SER A 1 72 ? 143.637 10.988  13.992  1.00 0.00 ? 71 SER A N    6  
ATOM 8919  C CA   . SER A 1 72 ? 143.797 11.976  12.922  1.00 0.00 ? 71 SER A CA   6  
ATOM 8920  C C    . SER A 1 72 ? 144.827 11.519  11.880  1.00 0.00 ? 71 SER A C    6  
ATOM 8921  O O    . SER A 1 72 ? 145.568 12.336  11.326  1.00 0.00 ? 71 SER A O    6  
ATOM 8922  C CB   . SER A 1 72 ? 144.215 13.327  13.513  1.00 0.00 ? 71 SER A CB   6  
ATOM 8923  O OG   . SER A 1 72 ? 145.320 13.187  14.393  1.00 0.00 ? 71 SER A OG   6  
ATOM 8924  H H    . SER A 1 72 ? 144.241 11.023  14.764  1.00 0.00 ? 71 SER A H    6  
ATOM 8925  H HA   . SER A 1 72 ? 142.841 12.091  12.435  1.00 0.00 ? 71 SER A HA   6  
ATOM 8926  H HB2  . SER A 1 72 ? 144.493 13.997  12.713  1.00 0.00 ? 71 SER A HB2  6  
ATOM 8927  H HB3  . SER A 1 72 ? 143.386 13.748  14.061  1.00 0.00 ? 71 SER A HB3  6  
ATOM 8928  H HG   . SER A 1 72 ? 146.017 12.684  13.963  1.00 0.00 ? 71 SER A HG   6  
ATOM 8929  N N    . MET A 1 73 ? 144.866 10.214  11.612  1.00 0.00 ? 72 MET A N    6  
ATOM 8930  C CA   . MET A 1 73 ? 145.799 9.658   10.638  1.00 0.00 ? 72 MET A CA   6  
ATOM 8931  C C    . MET A 1 73 ? 145.189 8.447   9.931   1.00 0.00 ? 72 MET A C    6  
ATOM 8932  O O    . MET A 1 73 ? 145.470 7.301   10.286  1.00 0.00 ? 72 MET A O    6  
ATOM 8933  C CB   . MET A 1 73 ? 147.111 9.269   11.327  1.00 0.00 ? 72 MET A CB   6  
ATOM 8934  C CG   . MET A 1 73 ? 148.341 9.484   10.462  1.00 0.00 ? 72 MET A CG   6  
ATOM 8935  S SD   . MET A 1 73 ? 149.860 9.581   11.429  1.00 0.00 ? 72 MET A SD   6  
ATOM 8936  C CE   . MET A 1 73 ? 150.387 7.870   11.404  1.00 0.00 ? 72 MET A CE   6  
ATOM 8937  H H    . MET A 1 73 ? 144.252 9.612   12.078  1.00 0.00 ? 72 MET A H    6  
ATOM 8938  H HA   . MET A 1 73 ? 146.002 10.422  9.901   1.00 0.00 ? 72 MET A HA   6  
ATOM 8939  H HB2  . MET A 1 73 ? 147.222 9.861   12.224  1.00 0.00 ? 72 MET A HB2  6  
ATOM 8940  H HB3  . MET A 1 73 ? 147.067 8.224   11.600  1.00 0.00 ? 72 MET A HB3  6  
ATOM 8941  H HG2  . MET A 1 73 ? 148.424 8.661   9.767   1.00 0.00 ? 72 MET A HG2  6  
ATOM 8942  H HG3  . MET A 1 73 ? 148.220 10.406  9.912   1.00 0.00 ? 72 MET A HG3  6  
ATOM 8943  H HE1  . MET A 1 73 ? 151.235 7.746   12.061  1.00 0.00 ? 72 MET A HE1  6  
ATOM 8944  H HE2  . MET A 1 73 ? 150.668 7.595   10.398  1.00 0.00 ? 72 MET A HE2  6  
ATOM 8945  H HE3  . MET A 1 73 ? 149.578 7.238   11.738  1.00 0.00 ? 72 MET A HE3  6  
ATOM 8946  N N    . LYS A 1 74 ? 144.350 8.710   8.926   1.00 0.00 ? 73 LYS A N    6  
ATOM 8947  C CA   . LYS A 1 74 ? 143.699 7.640   8.166   1.00 0.00 ? 73 LYS A CA   6  
ATOM 8948  C C    . LYS A 1 74 ? 144.366 7.441   6.799   1.00 0.00 ? 73 LYS A C    6  
ATOM 8949  O O    . LYS A 1 74 ? 143.710 7.056   5.828   1.00 0.00 ? 73 LYS A O    6  
ATOM 8950  C CB   . LYS A 1 74 ? 142.206 7.949   7.983   1.00 0.00 ? 73 LYS A CB   6  
ATOM 8951  C CG   . LYS A 1 74 ? 141.392 7.818   9.262   1.00 0.00 ? 73 LYS A CG   6  
ATOM 8952  C CD   . LYS A 1 74 ? 141.064 6.363   9.570   1.00 0.00 ? 73 LYS A CD   6  
ATOM 8953  C CE   . LYS A 1 74 ? 141.531 5.964   10.963  1.00 0.00 ? 73 LYS A CE   6  
ATOM 8954  N NZ   . LYS A 1 74 ? 140.454 6.116   11.984  1.00 0.00 ? 73 LYS A NZ   6  
ATOM 8955  H H    . LYS A 1 74 ? 144.165 9.643   8.689   1.00 0.00 ? 73 LYS A H    6  
ATOM 8956  H HA   . LYS A 1 74 ? 143.799 6.727   8.734   1.00 0.00 ? 73 LYS A HA   6  
ATOM 8957  H HB2  . LYS A 1 74 ? 142.101 8.960   7.617   1.00 0.00 ? 73 LYS A HB2  6  
ATOM 8958  H HB3  . LYS A 1 74 ? 141.797 7.268   7.251   1.00 0.00 ? 73 LYS A HB3  6  
ATOM 8959  H HG2  . LYS A 1 74 ? 141.960 8.231   10.082  1.00 0.00 ? 73 LYS A HG2  6  
ATOM 8960  H HG3  . LYS A 1 74 ? 140.471 8.369   9.147   1.00 0.00 ? 73 LYS A HG3  6  
ATOM 8961  H HD2  . LYS A 1 74 ? 139.995 6.225   9.506   1.00 0.00 ? 73 LYS A HD2  6  
ATOM 8962  H HD3  . LYS A 1 74 ? 141.553 5.732   8.842   1.00 0.00 ? 73 LYS A HD3  6  
ATOM 8963  H HE2  . LYS A 1 74 ? 141.847 4.932   10.940  1.00 0.00 ? 73 LYS A HE2  6  
ATOM 8964  H HE3  . LYS A 1 74 ? 142.369 6.588   11.240  1.00 0.00 ? 73 LYS A HE3  6  
ATOM 8965  H HZ1  . LYS A 1 74 ? 140.866 6.386   12.901  1.00 0.00 ? 73 LYS A HZ1  6  
ATOM 8966  H HZ2  . LYS A 1 74 ? 139.943 5.218   12.100  1.00 0.00 ? 73 LYS A HZ2  6  
ATOM 8967  H HZ3  . LYS A 1 74 ? 139.779 6.851   11.689  1.00 0.00 ? 73 LYS A HZ3  6  
ATOM 8968  N N    . SER A 1 75 ? 145.676 7.696   6.733   1.00 0.00 ? 74 SER A N    6  
ATOM 8969  C CA   . SER A 1 75 ? 146.435 7.540   5.493   1.00 0.00 ? 74 SER A CA   6  
ATOM 8970  C C    . SER A 1 75 ? 147.916 7.324   5.792   1.00 0.00 ? 74 SER A C    6  
ATOM 8971  O O    . SER A 1 75 ? 148.462 7.925   6.719   1.00 0.00 ? 74 SER A O    6  
ATOM 8972  C CB   . SER A 1 75 ? 146.259 8.771   4.596   1.00 0.00 ? 74 SER A CB   6  
ATOM 8973  O OG   . SER A 1 75 ? 145.080 8.673   3.815   1.00 0.00 ? 74 SER A OG   6  
ATOM 8974  H H    . SER A 1 75 ? 146.146 7.993   7.540   1.00 0.00 ? 74 SER A H    6  
ATOM 8975  H HA   . SER A 1 75 ? 146.052 6.671   4.977   1.00 0.00 ? 74 SER A HA   6  
ATOM 8976  H HB2  . SER A 1 75 ? 146.195 9.657   5.211   1.00 0.00 ? 74 SER A HB2  6  
ATOM 8977  H HB3  . SER A 1 75 ? 147.108 8.854   3.935   1.00 0.00 ? 74 SER A HB3  6  
ATOM 8978  H HG   . SER A 1 75 ? 144.313 8.650   4.394   1.00 0.00 ? 74 SER A HG   6  
ATOM 8979  N N    . LEU A 1 76 ? 148.564 6.464   5.003   1.00 0.00 ? 75 LEU A N    6  
ATOM 8980  C CA   . LEU A 1 76 ? 149.986 6.177   5.192   1.00 0.00 ? 75 LEU A CA   6  
ATOM 8981  C C    . LEU A 1 76 ? 150.804 6.618   3.980   1.00 0.00 ? 75 LEU A C    6  
ATOM 8982  O O    . LEU A 1 76 ? 150.452 6.320   2.837   1.00 0.00 ? 75 LEU A O    6  
ATOM 8983  C CB   . LEU A 1 76 ? 150.219 4.685   5.474   1.00 0.00 ? 75 LEU A CB   6  
ATOM 8984  C CG   . LEU A 1 76 ? 149.226 3.717   4.825   1.00 0.00 ? 75 LEU A CG   6  
ATOM 8985  C CD1  . LEU A 1 76 ? 149.923 2.425   4.430   1.00 0.00 ? 75 LEU A CD1  6  
ATOM 8986  C CD2  . LEU A 1 76 ? 148.069 3.427   5.769   1.00 0.00 ? 75 LEU A CD2  6  
ATOM 8987  H H    . LEU A 1 76 ? 148.076 6.017   4.278   1.00 0.00 ? 75 LEU A H    6  
ATOM 8988  H HA   . LEU A 1 76 ? 150.317 6.746   6.048   1.00 0.00 ? 75 LEU A HA   6  
ATOM 8989  H HB2  . LEU A 1 76 ? 151.210 4.429   5.129   1.00 0.00 ? 75 LEU A HB2  6  
ATOM 8990  H HB3  . LEU A 1 76 ? 150.182 4.538   6.543   1.00 0.00 ? 75 LEU A HB3  6  
ATOM 8991  H HG   . LEU A 1 76 ? 148.825 4.167   3.930   1.00 0.00 ? 75 LEU A HG   6  
ATOM 8992  H HD11 . LEU A 1 76 ? 149.184 1.681   4.174   1.00 0.00 ? 75 LEU A HD11 6  
ATOM 8993  H HD12 . LEU A 1 76 ? 150.521 2.070   5.256   1.00 0.00 ? 75 LEU A HD12 6  
ATOM 8994  H HD13 . LEU A 1 76 ? 150.559 2.608   3.578   1.00 0.00 ? 75 LEU A HD13 6  
ATOM 8995  H HD21 . LEU A 1 76 ? 147.393 2.727   5.303   1.00 0.00 ? 75 LEU A HD21 6  
ATOM 8996  H HD22 . LEU A 1 76 ? 147.544 4.345   5.986   1.00 0.00 ? 75 LEU A HD22 6  
ATOM 8997  H HD23 . LEU A 1 76 ? 148.449 3.004   6.687   1.00 0.00 ? 75 LEU A HD23 6  
ATOM 8998  N N    . ARG A 1 77 ? 151.900 7.333   4.244   1.00 0.00 ? 76 ARG A N    6  
ATOM 8999  C CA   . ARG A 1 77 ? 152.776 7.825   3.184   1.00 0.00 ? 76 ARG A CA   6  
ATOM 9000  C C    . ARG A 1 77 ? 154.002 6.928   3.025   1.00 0.00 ? 76 ARG A C    6  
ATOM 9001  O O    . ARG A 1 77 ? 154.806 6.789   3.950   1.00 0.00 ? 76 ARG A O    6  
ATOM 9002  C CB   . ARG A 1 77 ? 153.223 9.260   3.483   1.00 0.00 ? 76 ARG A CB   6  
ATOM 9003  C CG   . ARG A 1 77 ? 152.192 10.317  3.115   1.00 0.00 ? 76 ARG A CG   6  
ATOM 9004  C CD   . ARG A 1 77 ? 152.180 11.463  4.117   1.00 0.00 ? 76 ARG A CD   6  
ATOM 9005  N NE   . ARG A 1 77 ? 153.491 12.104  4.252   1.00 0.00 ? 76 ARG A NE   6  
ATOM 9006  C CZ   . ARG A 1 77 ? 153.683 13.306  4.803   1.00 0.00 ? 76 ARG A CZ   6  
ATOM 9007  N NH1  . ARG A 1 77 ? 152.652 14.010  5.265   1.00 0.00 ? 76 ARG A NH1  6  
ATOM 9008  N NH2  . ARG A 1 77 ? 154.910 13.809  4.894   1.00 0.00 ? 76 ARG A NH2  6  
ATOM 9009  H H    . ARG A 1 77 ? 152.123 7.536   5.178   1.00 0.00 ? 76 ARG A H    6  
ATOM 9010  H HA   . ARG A 1 77 ? 152.216 7.817   2.261   1.00 0.00 ? 76 ARG A HA   6  
ATOM 9011  H HB2  . ARG A 1 77 ? 153.434 9.346   4.539   1.00 0.00 ? 76 ARG A HB2  6  
ATOM 9012  H HB3  . ARG A 1 77 ? 154.127 9.464   2.929   1.00 0.00 ? 76 ARG A HB3  6  
ATOM 9013  H HG2  . ARG A 1 77 ? 152.427 10.711  2.137   1.00 0.00 ? 76 ARG A HG2  6  
ATOM 9014  H HG3  . ARG A 1 77 ? 151.213 9.860   3.094   1.00 0.00 ? 76 ARG A HG3  6  
ATOM 9015  H HD2  . ARG A 1 77 ? 151.465 12.202  3.787   1.00 0.00 ? 76 ARG A HD2  6  
ATOM 9016  H HD3  . ARG A 1 77 ? 151.877 11.078  5.081   1.00 0.00 ? 76 ARG A HD3  6  
ATOM 9017  H HE   . ARG A 1 77 ? 154.272 11.611  3.917   1.00 0.00 ? 76 ARG A HE   6  
ATOM 9018  H HH11 . ARG A 1 77 ? 151.724 13.643  5.204   1.00 0.00 ? 76 ARG A HH11 6  
ATOM 9019  H HH12 . ARG A 1 77 ? 152.805 14.910  5.675   1.00 0.00 ? 76 ARG A HH12 6  
ATOM 9020  H HH21 . ARG A 1 77 ? 155.692 13.288  4.551   1.00 0.00 ? 76 ARG A HH21 6  
ATOM 9021  H HH22 . ARG A 1 77 ? 155.053 14.709  5.306   1.00 0.00 ? 76 ARG A HH22 6  
ATOM 9022  N N    . ILE A 1 78 ? 154.140 6.327   1.844   1.00 0.00 ? 77 ILE A N    6  
ATOM 9023  C CA   . ILE A 1 78 ? 155.268 5.446   1.553   1.00 0.00 ? 77 ILE A CA   6  
ATOM 9024  C C    . ILE A 1 78 ? 156.002 5.904   0.294   1.00 0.00 ? 77 ILE A C    6  
ATOM 9025  O O    . ILE A 1 78 ? 155.377 6.186   -0.731  1.00 0.00 ? 77 ILE A O    6  
ATOM 9026  C CB   . ILE A 1 78 ? 154.815 3.980   1.371   1.00 0.00 ? 77 ILE A CB   6  
ATOM 9027  C CG1  . ILE A 1 78 ? 153.914 3.544   2.531   1.00 0.00 ? 77 ILE A CG1  6  
ATOM 9028  C CG2  . ILE A 1 78 ? 156.022 3.058   1.260   1.00 0.00 ? 77 ILE A CG2  6  
ATOM 9029  C CD1  . ILE A 1 78 ? 152.469 3.345   2.130   1.00 0.00 ? 77 ILE A CD1  6  
ATOM 9030  H H    . ILE A 1 78 ? 153.467 6.481   1.148   1.00 0.00 ? 77 ILE A H    6  
ATOM 9031  H HA   . ILE A 1 78 ? 155.950 5.491   2.390   1.00 0.00 ? 77 ILE A HA   6  
ATOM 9032  H HB   . ILE A 1 78 ? 154.258 3.913   0.448   1.00 0.00 ? 77 ILE A HB   6  
ATOM 9033  H HG12 . ILE A 1 78 ? 154.278 2.608   2.930   1.00 0.00 ? 77 ILE A HG12 6  
ATOM 9034  H HG13 . ILE A 1 78 ? 153.943 4.295   3.307   1.00 0.00 ? 77 ILE A HG13 6  
ATOM 9035  H HG21 . ILE A 1 78 ? 156.778 3.365   1.969   1.00 0.00 ? 77 ILE A HG21 6  
ATOM 9036  H HG22 . ILE A 1 78 ? 156.424 3.110   0.259   1.00 0.00 ? 77 ILE A HG22 6  
ATOM 9037  H HG23 . ILE A 1 78 ? 155.719 2.044   1.474   1.00 0.00 ? 77 ILE A HG23 6  
ATOM 9038  H HD11 . ILE A 1 78 ? 151.846 4.043   2.669   1.00 0.00 ? 77 ILE A HD11 6  
ATOM 9039  H HD12 . ILE A 1 78 ? 152.166 2.335   2.366   1.00 0.00 ? 77 ILE A HD12 6  
ATOM 9040  H HD13 . ILE A 1 78 ? 152.363 3.513   1.069   1.00 0.00 ? 77 ILE A HD13 6  
ATOM 9041  N N    . LEU A 1 79 ? 157.330 5.980   0.380   1.00 0.00 ? 78 LEU A N    6  
ATOM 9042  C CA   . LEU A 1 79 ? 158.153 6.407   -0.749  1.00 0.00 ? 78 LEU A CA   6  
ATOM 9043  C C    . LEU A 1 79 ? 158.804 5.203   -1.428  1.00 0.00 ? 78 LEU A C    6  
ATOM 9044  O O    . LEU A 1 79 ? 159.569 4.466   -0.802  1.00 0.00 ? 78 LEU A O    6  
ATOM 9045  C CB   . LEU A 1 79 ? 159.231 7.392   -0.280  1.00 0.00 ? 78 LEU A CB   6  
ATOM 9046  C CG   . LEU A 1 79 ? 158.723 8.568   0.564   1.00 0.00 ? 78 LEU A CG   6  
ATOM 9047  C CD1  . LEU A 1 79 ? 159.738 8.937   1.637   1.00 0.00 ? 78 LEU A CD1  6  
ATOM 9048  C CD2  . LEU A 1 79 ? 158.418 9.768   -0.321  1.00 0.00 ? 78 LEU A CD2  6  
ATOM 9049  H H    . LEU A 1 79 ? 157.767 5.744   1.226   1.00 0.00 ? 78 LEU A H    6  
ATOM 9050  H HA   . LEU A 1 79 ? 157.508 6.904   -1.460  1.00 0.00 ? 78 LEU A HA   6  
ATOM 9051  H HB2  . LEU A 1 79 ? 159.957 6.844   0.305   1.00 0.00 ? 78 LEU A HB2  6  
ATOM 9052  H HB3  . LEU A 1 79 ? 159.726 7.792   -1.152  1.00 0.00 ? 78 LEU A HB3  6  
ATOM 9053  H HG   . LEU A 1 79 ? 157.808 8.277   1.060   1.00 0.00 ? 78 LEU A HG   6  
ATOM 9054  H HD11 . LEU A 1 79 ? 159.220 9.277   2.521   1.00 0.00 ? 78 LEU A HD11 6  
ATOM 9055  H HD12 . LEU A 1 79 ? 160.380 9.725   1.270   1.00 0.00 ? 78 LEU A HD12 6  
ATOM 9056  H HD13 . LEU A 1 79 ? 160.336 8.071   1.881   1.00 0.00 ? 78 LEU A HD13 6  
ATOM 9057  H HD21 . LEU A 1 79 ? 158.098 10.597  0.293   1.00 0.00 ? 78 LEU A HD21 6  
ATOM 9058  H HD22 . LEU A 1 79 ? 157.633 9.513   -1.017  1.00 0.00 ? 78 LEU A HD22 6  
ATOM 9059  H HD23 . LEU A 1 79 ? 159.307 10.048  -0.868  1.00 0.00 ? 78 LEU A HD23 6  
ATOM 9060  N N    . LEU A 1 80 ? 158.492 5.008   -2.711  1.00 0.00 ? 79 LEU A N    6  
ATOM 9061  C CA   . LEU A 1 80 ? 159.041 3.891   -3.480  1.00 0.00 ? 79 LEU A CA   6  
ATOM 9062  C C    . LEU A 1 80 ? 160.306 4.310   -4.227  1.00 0.00 ? 79 LEU A C    6  
ATOM 9063  O O    . LEU A 1 80 ? 160.270 5.213   -5.065  1.00 0.00 ? 79 LEU A O    6  
ATOM 9064  C CB   . LEU A 1 80 ? 158.002 3.372   -4.486  1.00 0.00 ? 79 LEU A CB   6  
ATOM 9065  C CG   . LEU A 1 80 ? 156.583 3.190   -3.936  1.00 0.00 ? 79 LEU A CG   6  
ATOM 9066  C CD1  . LEU A 1 80 ? 155.553 3.767   -4.897  1.00 0.00 ? 79 LEU A CD1  6  
ATOM 9067  C CD2  . LEU A 1 80 ? 156.299 1.720   -3.674  1.00 0.00 ? 79 LEU A CD2  6  
ATOM 9068  H H    . LEU A 1 80 ? 157.874 5.630   -3.152  1.00 0.00 ? 79 LEU A H    6  
ATOM 9069  H HA   . LEU A 1 80 ? 159.288 3.098   -2.789  1.00 0.00 ? 79 LEU A HA   6  
ATOM 9070  H HB2  . LEU A 1 80 ? 157.958 4.067   -5.312  1.00 0.00 ? 79 LEU A HB2  6  
ATOM 9071  H HB3  . LEU A 1 80 ? 158.343 2.418   -4.861  1.00 0.00 ? 79 LEU A HB3  6  
ATOM 9072  H HG   . LEU A 1 80 ? 156.495 3.719   -2.998  1.00 0.00 ? 79 LEU A HG   6  
ATOM 9073  H HD11 . LEU A 1 80 ? 155.106 2.968   -5.470  1.00 0.00 ? 79 LEU A HD11 6  
ATOM 9074  H HD12 . LEU A 1 80 ? 156.034 4.464   -5.567  1.00 0.00 ? 79 LEU A HD12 6  
ATOM 9075  H HD13 . LEU A 1 80 ? 154.786 4.279   -4.336  1.00 0.00 ? 79 LEU A HD13 6  
ATOM 9076  H HD21 . LEU A 1 80 ? 155.593 1.630   -2.863  1.00 0.00 ? 79 LEU A HD21 6  
ATOM 9077  H HD22 . LEU A 1 80 ? 157.218 1.217   -3.409  1.00 0.00 ? 79 LEU A HD22 6  
ATOM 9078  H HD23 . LEU A 1 80 ? 155.885 1.269   -4.563  1.00 0.00 ? 79 LEU A HD23 6  
ATOM 9079  N N    . LEU A 1 81 ? 161.422 3.643   -3.926  1.00 0.00 ? 80 LEU A N    6  
ATOM 9080  C CA   . LEU A 1 81 ? 162.697 3.942   -4.578  1.00 0.00 ? 80 LEU A CA   6  
ATOM 9081  C C    . LEU A 1 81 ? 163.364 2.666   -5.085  1.00 0.00 ? 80 LEU A C    6  
ATOM 9082  O O    . LEU A 1 81 ? 163.399 1.655   -4.384  1.00 0.00 ? 80 LEU A O    6  
ATOM 9083  C CB   . LEU A 1 81 ? 163.639 4.679   -3.617  1.00 0.00 ? 80 LEU A CB   6  
ATOM 9084  C CG   . LEU A 1 81 ? 164.107 3.871   -2.400  1.00 0.00 ? 80 LEU A CG   6  
ATOM 9085  C CD1  . LEU A 1 81 ? 165.425 3.167   -2.691  1.00 0.00 ? 80 LEU A CD1  6  
ATOM 9086  C CD2  . LEU A 1 81 ? 164.245 4.775   -1.185  1.00 0.00 ? 80 LEU A CD2  6  
ATOM 9087  H H    . LEU A 1 81 ? 161.386 2.929   -3.254  1.00 0.00 ? 80 LEU A H    6  
ATOM 9088  H HA   . LEU A 1 81 ? 162.492 4.582   -5.422  1.00 0.00 ? 80 LEU A HA   6  
ATOM 9089  H HB2  . LEU A 1 81 ? 164.513 4.990   -4.173  1.00 0.00 ? 80 LEU A HB2  6  
ATOM 9090  H HB3  . LEU A 1 81 ? 163.131 5.563   -3.259  1.00 0.00 ? 80 LEU A HB3  6  
ATOM 9091  H HG   . LEU A 1 81 ? 163.369 3.116   -2.173  1.00 0.00 ? 80 LEU A HG   6  
ATOM 9092  H HD11 . LEU A 1 81 ? 165.559 3.076   -3.759  1.00 0.00 ? 80 LEU A HD11 6  
ATOM 9093  H HD12 . LEU A 1 81 ? 165.414 2.184   -2.244  1.00 0.00 ? 80 LEU A HD12 6  
ATOM 9094  H HD13 . LEU A 1 81 ? 166.241 3.741   -2.274  1.00 0.00 ? 80 LEU A HD13 6  
ATOM 9095  H HD21 . LEU A 1 81 ? 163.397 5.442   -1.133  1.00 0.00 ? 80 LEU A HD21 6  
ATOM 9096  H HD22 . LEU A 1 81 ? 165.154 5.354   -1.267  1.00 0.00 ? 80 LEU A HD22 6  
ATOM 9097  H HD23 . LEU A 1 81 ? 164.283 4.171   -0.290  1.00 0.00 ? 80 LEU A HD23 6  
ATOM 9098  N N    . SER A 1 82 ? 163.898 2.723   -6.303  1.00 0.00 ? 81 SER A N    6  
ATOM 9099  C CA   . SER A 1 82 ? 164.570 1.570   -6.898  1.00 0.00 ? 81 SER A CA   6  
ATOM 9100  C C    . SER A 1 82 ? 165.935 1.344   -6.250  1.00 0.00 ? 81 SER A C    6  
ATOM 9101  O O    . SER A 1 82 ? 166.614 2.298   -5.865  1.00 0.00 ? 81 SER A O    6  
ATOM 9102  C CB   . SER A 1 82 ? 164.733 1.766   -8.409  1.00 0.00 ? 81 SER A CB   6  
ATOM 9103  O OG   . SER A 1 82 ? 165.408 2.979   -8.700  1.00 0.00 ? 81 SER A OG   6  
ATOM 9104  H H    . SER A 1 82 ? 163.844 3.559   -6.812  1.00 0.00 ? 81 SER A H    6  
ATOM 9105  H HA   . SER A 1 82 ? 163.956 0.701   -6.721  1.00 0.00 ? 81 SER A HA   6  
ATOM 9106  H HB2  . SER A 1 82 ? 165.304 0.944   -8.817  1.00 0.00 ? 81 SER A HB2  6  
ATOM 9107  H HB3  . SER A 1 82 ? 163.758 1.791   -8.872  1.00 0.00 ? 81 SER A HB3  6  
ATOM 9108  H HG   . SER A 1 82 ? 165.396 3.133   -9.648  1.00 0.00 ? 81 SER A HG   6  
ATOM 9109  N N    . GLN A 1 83 ? 166.333 0.078   -6.134  1.00 0.00 ? 82 GLN A N    6  
ATOM 9110  C CA   . GLN A 1 83 ? 167.619 -0.269  -5.532  1.00 0.00 ? 82 GLN A CA   6  
ATOM 9111  C C    . GLN A 1 83 ? 168.701 -0.469  -6.600  1.00 0.00 ? 82 GLN A C    6  
ATOM 9112  O O    . GLN A 1 83 ? 169.576 -1.327  -6.459  1.00 0.00 ? 82 GLN A O    6  
ATOM 9113  C CB   . GLN A 1 83 ? 167.479 -1.532  -4.678  1.00 0.00 ? 82 GLN A CB   6  
ATOM 9114  C CG   . GLN A 1 83 ? 168.447 -1.583  -3.506  1.00 0.00 ? 82 GLN A CG   6  
ATOM 9115  C CD   . GLN A 1 83 ? 167.929 -0.839  -2.290  1.00 0.00 ? 82 GLN A CD   6  
ATOM 9116  O OE1  . GLN A 1 83 ? 167.283 -1.423  -1.421  1.00 0.00 ? 82 GLN A OE1  6  
ATOM 9117  N NE2  . GLN A 1 83 ? 168.211 0.458   -2.222  1.00 0.00 ? 82 GLN A NE2  6  
ATOM 9118  H H    . GLN A 1 83 ? 165.749 -0.639  -6.460  1.00 0.00 ? 82 GLN A H    6  
ATOM 9119  H HA   . GLN A 1 83 ? 167.915 0.551   -4.894  1.00 0.00 ? 82 GLN A HA   6  
ATOM 9120  H HB2  . GLN A 1 83 ? 166.473 -1.579  -4.288  1.00 0.00 ? 82 GLN A HB2  6  
ATOM 9121  H HB3  . GLN A 1 83 ? 167.655 -2.398  -5.300  1.00 0.00 ? 82 GLN A HB3  6  
ATOM 9122  H HG2  . GLN A 1 83 ? 168.612 -2.614  -3.236  1.00 0.00 ? 82 GLN A HG2  6  
ATOM 9123  H HG3  . GLN A 1 83 ? 169.383 -1.137  -3.811  1.00 0.00 ? 82 GLN A HG3  6  
ATOM 9124  H HE21 . GLN A 1 83 ? 168.731 0.859   -2.950  1.00 0.00 ? 82 GLN A HE21 6  
ATOM 9125  H HE22 . GLN A 1 83 ? 167.886 0.961   -1.447  1.00 0.00 ? 82 GLN A HE22 6  
ATOM 9126  N N    . ASP A 1 84 ? 168.639 0.335   -7.663  1.00 0.00 ? 83 ASP A N    6  
ATOM 9127  C CA   . ASP A 1 84 ? 169.612 0.254   -8.749  1.00 0.00 ? 83 ASP A CA   6  
ATOM 9128  C C    . ASP A 1 84 ? 170.096 1.649   -9.142  1.00 0.00 ? 83 ASP A C    6  
ATOM 9129  O O    . ASP A 1 84 ? 169.670 2.204   -10.158 1.00 0.00 ? 83 ASP A O    6  
ATOM 9130  C CB   . ASP A 1 84 ? 168.998 -0.452  -9.963  1.00 0.00 ? 83 ASP A CB   6  
ATOM 9131  C CG   . ASP A 1 84 ? 168.570 -1.875  -9.656  1.00 0.00 ? 83 ASP A CG   6  
ATOM 9132  O OD1  . ASP A 1 84 ? 169.456 -2.729  -9.438  1.00 0.00 ? 83 ASP A OD1  6  
ATOM 9133  O OD2  . ASP A 1 84 ? 167.348 -2.135  -9.631  1.00 0.00 ? 83 ASP A OD2  6  
ATOM 9134  H H    . ASP A 1 84 ? 167.925 1.002   -7.717  1.00 0.00 ? 83 ASP A H    6  
ATOM 9135  H HA   . ASP A 1 84 ? 170.455 -0.320  -8.397  1.00 0.00 ? 83 ASP A HA   6  
ATOM 9136  H HB2  . ASP A 1 84 ? 168.130 0.100   -10.291 1.00 0.00 ? 83 ASP A HB2  6  
ATOM 9137  H HB3  . ASP A 1 84 ? 169.725 -0.478  -10.761 1.00 0.00 ? 83 ASP A HB3  6  
ATOM 9138  N N    . ARG A 1 85 ? 170.987 2.213   -8.326  1.00 0.00 ? 84 ARG A N    6  
ATOM 9139  C CA   . ARG A 1 85 ? 171.530 3.544   -8.583  1.00 0.00 ? 84 ARG A CA   6  
ATOM 9140  C C    . ARG A 1 85 ? 173.030 3.475   -8.871  1.00 0.00 ? 84 ARG A C    6  
ATOM 9141  O O    . ARG A 1 85 ? 173.853 3.471   -7.952  1.00 0.00 ? 84 ARG A O    6  
ATOM 9142  C CB   . ARG A 1 85 ? 171.245 4.482   -7.400  1.00 0.00 ? 84 ARG A CB   6  
ATOM 9143  C CG   . ARG A 1 85 ? 171.634 3.913   -6.043  1.00 0.00 ? 84 ARG A CG   6  
ATOM 9144  C CD   . ARG A 1 85 ? 172.533 4.869   -5.275  1.00 0.00 ? 84 ARG A CD   6  
ATOM 9145  N NE   . ARG A 1 85 ? 173.342 4.178   -4.273  1.00 0.00 ? 84 ARG A NE   6  
ATOM 9146  C CZ   . ARG A 1 85 ? 174.432 4.697   -3.704  1.00 0.00 ? 84 ARG A CZ   6  
ATOM 9147  N NH1  . ARG A 1 85 ? 174.845 5.924   -4.021  1.00 0.00 ? 84 ARG A NH1  6  
ATOM 9148  N NH2  . ARG A 1 85 ? 175.111 3.988   -2.811  1.00 0.00 ? 84 ARG A NH2  6  
ATOM 9149  H H    . ARG A 1 85 ? 171.284 1.721   -7.533  1.00 0.00 ? 84 ARG A H    6  
ATOM 9150  H HA   . ARG A 1 85 ? 171.033 3.934   -9.459  1.00 0.00 ? 84 ARG A HA   6  
ATOM 9151  H HB2  . ARG A 1 85 ? 171.790 5.403   -7.547  1.00 0.00 ? 84 ARG A HB2  6  
ATOM 9152  H HB3  . ARG A 1 85 ? 170.187 4.704   -7.381  1.00 0.00 ? 84 ARG A HB3  6  
ATOM 9153  H HG2  . ARG A 1 85 ? 170.738 3.737   -5.466  1.00 0.00 ? 84 ARG A HG2  6  
ATOM 9154  H HG3  . ARG A 1 85 ? 172.158 2.980   -6.190  1.00 0.00 ? 84 ARG A HG3  6  
ATOM 9155  H HD2  . ARG A 1 85 ? 173.191 5.362   -5.975  1.00 0.00 ? 84 ARG A HD2  6  
ATOM 9156  H HD3  . ARG A 1 85 ? 171.917 5.605   -4.782  1.00 0.00 ? 84 ARG A HD3  6  
ATOM 9157  H HE   . ARG A 1 85 ? 173.061 3.275   -4.012  1.00 0.00 ? 84 ARG A HE   6  
ATOM 9158  H HH11 . ARG A 1 85 ? 174.339 6.467   -4.690  1.00 0.00 ? 84 ARG A HH11 6  
ATOM 9159  H HH12 . ARG A 1 85 ? 175.664 6.304   -3.589  1.00 0.00 ? 84 ARG A HH12 6  
ATOM 9160  H HH21 . ARG A 1 85 ? 174.806 3.068   -2.566  1.00 0.00 ? 84 ARG A HH21 6  
ATOM 9161  H HH22 . ARG A 1 85 ? 175.929 4.372   -2.382  1.00 0.00 ? 84 ARG A HH22 6  
ATOM 9162  N N    . ASN A 1 86 ? 173.371 3.418   -10.162 1.00 0.00 ? 85 ASN A N    6  
ATOM 9163  C CA   . ASN A 1 86 ? 174.764 3.345   -10.607 1.00 0.00 ? 85 ASN A CA   6  
ATOM 9164  C C    . ASN A 1 86 ? 175.462 2.098   -10.059 1.00 0.00 ? 85 ASN A C    6  
ATOM 9165  O O    . ASN A 1 86 ? 176.395 2.195   -9.259  1.00 0.00 ? 85 ASN A O    6  
ATOM 9166  C CB   . ASN A 1 86 ? 175.529 4.610   -10.195 1.00 0.00 ? 85 ASN A CB   6  
ATOM 9167  C CG   . ASN A 1 86 ? 175.710 5.577   -11.350 1.00 0.00 ? 85 ASN A CG   6  
ATOM 9168  O OD1  . ASN A 1 86 ? 174.897 6.478   -11.549 1.00 0.00 ? 85 ASN A OD1  6  
ATOM 9169  N ND2  . ASN A 1 86 ? 176.779 5.395   -12.120 1.00 0.00 ? 85 ASN A ND2  6  
ATOM 9170  H H    . ASN A 1 86 ? 172.662 3.423   -10.838 1.00 0.00 ? 85 ASN A H    6  
ATOM 9171  H HA   . ASN A 1 86 ? 174.756 3.283   -11.686 1.00 0.00 ? 85 ASN A HA   6  
ATOM 9172  H HB2  . ASN A 1 86 ? 174.985 5.114   -9.412  1.00 0.00 ? 85 ASN A HB2  6  
ATOM 9173  H HB3  . ASN A 1 86 ? 176.505 4.330   -9.828  1.00 0.00 ? 85 ASN A HB3  6  
ATOM 9174  H HD21 . ASN A 1 86 ? 177.386 4.655   -11.907 1.00 0.00 ? 85 ASN A HD21 6  
ATOM 9175  H HD22 . ASN A 1 86 ? 176.916 6.009   -12.871 1.00 0.00 ? 85 ASN A HD22 6  
ATOM 9176  N N    . LEU A 1 87 ? 175.007 0.923   -10.500 1.00 0.00 ? 86 LEU A N    6  
ATOM 9177  C CA   . LEU A 1 87 ? 175.592 -0.343  -10.059 1.00 0.00 ? 86 LEU A CA   6  
ATOM 9178  C C    . LEU A 1 87 ? 175.073 -1.515  -10.898 1.00 0.00 ? 86 LEU A C    6  
ATOM 9179  O O    . LEU A 1 87 ? 174.075 -2.149  -10.547 1.00 0.00 ? 86 LEU A O    6  
ATOM 9180  C CB   . LEU A 1 87 ? 175.298 -0.582  -8.572  1.00 0.00 ? 86 LEU A CB   6  
ATOM 9181  C CG   . LEU A 1 87 ? 176.436 -1.240  -7.783  1.00 0.00 ? 86 LEU A CG   6  
ATOM 9182  C CD1  . LEU A 1 87 ? 176.759 -0.428  -6.538  1.00 0.00 ? 86 LEU A CD1  6  
ATOM 9183  C CD2  . LEU A 1 87 ? 176.070 -2.669  -7.412  1.00 0.00 ? 86 LEU A CD2  6  
ATOM 9184  H H    . LEU A 1 87 ? 174.263 0.907   -11.139 1.00 0.00 ? 86 LEU A H    6  
ATOM 9185  H HA   . LEU A 1 87 ? 176.660 -0.271  -10.194 1.00 0.00 ? 86 LEU A HA   6  
ATOM 9186  H HB2  . LEU A 1 87 ? 175.074 0.370   -8.113  1.00 0.00 ? 86 LEU A HB2  6  
ATOM 9187  H HB3  . LEU A 1 87 ? 174.425 -1.214  -8.493  1.00 0.00 ? 86 LEU A HB3  6  
ATOM 9188  H HG   . LEU A 1 87 ? 177.322 -1.270  -8.401  1.00 0.00 ? 86 LEU A HG   6  
ATOM 9189  H HD11 . LEU A 1 87 ? 177.505 -0.946  -5.953  1.00 0.00 ? 86 LEU A HD11 6  
ATOM 9190  H HD12 . LEU A 1 87 ? 175.863 -0.301  -5.949  1.00 0.00 ? 86 LEU A HD12 6  
ATOM 9191  H HD13 . LEU A 1 87 ? 177.140 0.541   -6.829  1.00 0.00 ? 86 LEU A HD13 6  
ATOM 9192  H HD21 . LEU A 1 87 ? 176.588 -2.951  -6.507  1.00 0.00 ? 86 LEU A HD21 6  
ATOM 9193  H HD22 . LEU A 1 87 ? 176.358 -3.334  -8.213  1.00 0.00 ? 86 LEU A HD22 6  
ATOM 9194  H HD23 . LEU A 1 87 ? 175.004 -2.738  -7.253  1.00 0.00 ? 86 LEU A HD23 6  
ATOM 9195  N N    . GLU A 1 88 ? 175.760 -1.797  -12.007 1.00 0.00 ? 87 GLU A N    6  
ATOM 9196  C CA   . GLU A 1 88 ? 175.372 -2.895  -12.898 1.00 0.00 ? 87 GLU A CA   6  
ATOM 9197  C C    . GLU A 1 88 ? 176.409 -4.023  -12.882 1.00 0.00 ? 87 GLU A C    6  
ATOM 9198  O O    . GLU A 1 88 ? 176.054 -5.197  -12.984 1.00 0.00 ? 87 GLU A O    6  
ATOM 9199  C CB   . GLU A 1 88 ? 175.182 -2.384  -14.330 1.00 0.00 ? 87 GLU A CB   6  
ATOM 9200  C CG   . GLU A 1 88 ? 173.998 -1.442  -14.494 1.00 0.00 ? 87 GLU A CG   6  
ATOM 9201  C CD   . GLU A 1 88 ? 173.339 -1.559  -15.856 1.00 0.00 ? 87 GLU A CD   6  
ATOM 9202  O OE1  . GLU A 1 88 ? 172.821 -2.650  -16.176 1.00 0.00 ? 87 GLU A OE1  6  
ATOM 9203  O OE2  . GLU A 1 88 ? 173.341 -0.558  -16.603 1.00 0.00 ? 87 GLU A OE2  6  
ATOM 9204  H H    . GLU A 1 88 ? 176.545 -1.255  -12.233 1.00 0.00 ? 87 GLU A H    6  
ATOM 9205  H HA   . GLU A 1 88 ? 174.431 -3.289  -12.542 1.00 0.00 ? 87 GLU A HA   6  
ATOM 9206  H HB2  . GLU A 1 88 ? 176.076 -1.861  -14.635 1.00 0.00 ? 87 GLU A HB2  6  
ATOM 9207  H HB3  . GLU A 1 88 ? 175.032 -3.232  -14.983 1.00 0.00 ? 87 GLU A HB3  6  
ATOM 9208  H HG2  . GLU A 1 88 ? 173.264 -1.670  -13.736 1.00 0.00 ? 87 GLU A HG2  6  
ATOM 9209  H HG3  . GLU A 1 88 ? 174.344 -0.426  -14.364 1.00 0.00 ? 87 GLU A HG3  6  
ATOM 9210  N N    . HIS A 1 89 ? 177.691 -3.658  -12.759 1.00 0.00 ? 88 HIS A N    6  
ATOM 9211  C CA   . HIS A 1 89 ? 178.786 -4.635  -12.731 1.00 0.00 ? 88 HIS A CA   6  
ATOM 9212  C C    . HIS A 1 89 ? 178.931 -5.369  -14.074 1.00 0.00 ? 88 HIS A C    6  
ATOM 9213  O O    . HIS A 1 89 ? 179.424 -6.500  -14.117 1.00 0.00 ? 88 HIS A O    6  
ATOM 9214  C CB   . HIS A 1 89 ? 178.574 -5.650  -11.598 1.00 0.00 ? 88 HIS A CB   6  
ATOM 9215  C CG   . HIS A 1 89 ? 179.517 -5.482  -10.444 1.00 0.00 ? 88 HIS A CG   6  
ATOM 9216  N ND1  . HIS A 1 89 ? 180.829 -5.078  -10.588 1.00 0.00 ? 88 HIS A ND1  6  
ATOM 9217  C CD2  . HIS A 1 89 ? 179.330 -5.672  -9.115  1.00 0.00 ? 88 HIS A CD2  6  
ATOM 9218  C CE1  . HIS A 1 89 ? 181.406 -5.028  -9.399  1.00 0.00 ? 88 HIS A CE1  6  
ATOM 9219  N NE2  . HIS A 1 89 ? 180.518 -5.384  -8.490  1.00 0.00 ? 88 HIS A NE2  6  
ATOM 9220  H H    . HIS A 1 89 ? 177.909 -2.707  -12.685 1.00 0.00 ? 88 HIS A H    6  
ATOM 9221  H HA   . HIS A 1 89 ? 179.700 -4.091  -12.541 1.00 0.00 ? 88 HIS A HA   6  
ATOM 9222  H HB2  . HIS A 1 89 ? 177.568 -5.551  -11.218 1.00 0.00 ? 88 HIS A HB2  6  
ATOM 9223  H HB3  . HIS A 1 89 ? 178.705 -6.648  -11.989 1.00 0.00 ? 88 HIS A HB3  6  
ATOM 9224  H HD1  . HIS A 1 89 ? 181.272 -4.861  -11.435 1.00 0.00 ? 88 HIS A HD1  6  
ATOM 9225  H HD2  . HIS A 1 89 ? 178.414 -5.994  -8.637  1.00 0.00 ? 88 HIS A HD2  6  
ATOM 9226  H HE1  . HIS A 1 89 ? 182.429 -4.743  -9.206  1.00 0.00 ? 88 HIS A HE1  6  
ATOM 9227  H HE2  . HIS A 1 89 ? 180.712 -5.537  -7.542  1.00 0.00 ? 88 HIS A HE2  6  
ATOM 9228  N N    . HIS A 1 90 ? 178.512 -4.717  -15.165 1.00 0.00 ? 89 HIS A N    6  
ATOM 9229  C CA   . HIS A 1 90 ? 178.597 -5.295  -16.512 1.00 0.00 ? 89 HIS A CA   6  
ATOM 9230  C C    . HIS A 1 90 ? 177.621 -6.464  -16.684 1.00 0.00 ? 89 HIS A C    6  
ATOM 9231  O O    . HIS A 1 90 ? 176.637 -6.351  -17.416 1.00 0.00 ? 89 HIS A O    6  
ATOM 9232  C CB   . HIS A 1 90 ? 180.029 -5.742  -16.829 1.00 0.00 ? 89 HIS A CB   6  
ATOM 9233  C CG   . HIS A 1 90 ? 180.537 -5.236  -18.146 1.00 0.00 ? 89 HIS A CG   6  
ATOM 9234  N ND1  . HIS A 1 90 ? 180.712 -6.046  -19.249 1.00 0.00 ? 89 HIS A ND1  6  
ATOM 9235  C CD2  . HIS A 1 90 ? 180.906 -3.991  -18.535 1.00 0.00 ? 89 HIS A CD2  6  
ATOM 9236  C CE1  . HIS A 1 90 ? 181.169 -5.323  -20.256 1.00 0.00 ? 89 HIS A CE1  6  
ATOM 9237  N NE2  . HIS A 1 90 ? 181.295 -4.074  -19.850 1.00 0.00 ? 89 HIS A NE2  6  
ATOM 9238  H H    . HIS A 1 90 ? 178.139 -3.817  -15.064 1.00 0.00 ? 89 HIS A H    6  
ATOM 9239  H HA   . HIS A 1 90 ? 178.317 -4.519  -17.211 1.00 0.00 ? 89 HIS A HA   6  
ATOM 9240  H HB2  . HIS A 1 90 ? 180.691 -5.382  -16.057 1.00 0.00 ? 89 HIS A HB2  6  
ATOM 9241  H HB3  . HIS A 1 90 ? 180.064 -6.822  -16.851 1.00 0.00 ? 89 HIS A HB3  6  
ATOM 9242  H HD1  . HIS A 1 90 ? 180.527 -7.007  -19.288 1.00 0.00 ? 89 HIS A HD1  6  
ATOM 9243  H HD2  . HIS A 1 90 ? 180.893 -3.099  -17.925 1.00 0.00 ? 89 HIS A HD2  6  
ATOM 9244  H HE1  . HIS A 1 90 ? 181.398 -5.691  -21.247 1.00 0.00 ? 89 HIS A HE1  6  
ATOM 9245  H HE2  . HIS A 1 90 ? 181.714 -3.353  -20.365 1.00 0.00 ? 89 HIS A HE2  6  
ATOM 9246  N N    . HIS A 1 91 ? 177.892 -7.580  -16.004 1.00 0.00 ? 90 HIS A N    6  
ATOM 9247  C CA   . HIS A 1 91 ? 177.028 -8.756  -16.080 1.00 0.00 ? 90 HIS A CA   6  
ATOM 9248  C C    . HIS A 1 91 ? 176.081 -8.795  -14.874 1.00 0.00 ? 90 HIS A C    6  
ATOM 9249  O O    . HIS A 1 91 ? 175.912 -7.788  -14.184 1.00 0.00 ? 90 HIS A O    6  
ATOM 9250  C CB   . HIS A 1 91 ? 177.870 -10.041 -16.144 1.00 0.00 ? 90 HIS A CB   6  
ATOM 9251  C CG   . HIS A 1 91 ? 178.873 -10.069 -17.262 1.00 0.00 ? 90 HIS A CG   6  
ATOM 9252  N ND1  . HIS A 1 91 ? 178.769 -9.291  -18.399 1.00 0.00 ? 90 HIS A ND1  6  
ATOM 9253  C CD2  . HIS A 1 91 ? 180.004 -10.801 -17.414 1.00 0.00 ? 90 HIS A CD2  6  
ATOM 9254  C CE1  . HIS A 1 91 ? 179.790 -9.545  -19.199 1.00 0.00 ? 90 HIS A CE1  6  
ATOM 9255  N NE2  . HIS A 1 91 ? 180.553 -10.456 -18.624 1.00 0.00 ? 90 HIS A NE2  6  
ATOM 9256  H H    . HIS A 1 91 ? 178.687 -7.610  -15.430 1.00 0.00 ? 90 HIS A H    6  
ATOM 9257  H HA   . HIS A 1 91 ? 176.438 -8.675  -16.982 1.00 0.00 ? 90 HIS A HA   6  
ATOM 9258  H HB2  . HIS A 1 91 ? 178.410 -10.156 -15.216 1.00 0.00 ? 90 HIS A HB2  6  
ATOM 9259  H HB3  . HIS A 1 91 ? 177.210 -10.886 -16.274 1.00 0.00 ? 90 HIS A HB3  6  
ATOM 9260  H HD1  . HIS A 1 91 ? 178.055 -8.648  -18.589 1.00 0.00 ? 90 HIS A HD1  6  
ATOM 9261  H HD2  . HIS A 1 91 ? 180.398 -11.523 -16.713 1.00 0.00 ? 90 HIS A HD2  6  
ATOM 9262  H HE1  . HIS A 1 91 ? 179.968 -9.087  -20.160 1.00 0.00 ? 90 HIS A HE1  6  
ATOM 9263  H HE2  . HIS A 1 91 ? 181.337 -10.878 -19.035 1.00 0.00 ? 90 HIS A HE2  6  
ATOM 9264  N N    . HIS A 1 92 ? 175.466 -9.957  -14.623 1.00 0.00 ? 91 HIS A N    6  
ATOM 9265  C CA   . HIS A 1 92 ? 174.540 -10.124 -13.498 1.00 0.00 ? 91 HIS A CA   6  
ATOM 9266  C C    . HIS A 1 92 ? 173.259 -9.318  -13.712 1.00 0.00 ? 91 HIS A C    6  
ATOM 9267  O O    . HIS A 1 92 ? 173.155 -8.166  -13.285 1.00 0.00 ? 91 HIS A O    6  
ATOM 9268  C CB   . HIS A 1 92 ? 175.206 -9.712  -12.177 1.00 0.00 ? 91 HIS A CB   6  
ATOM 9269  C CG   . HIS A 1 92 ? 175.621 -10.868 -11.319 1.00 0.00 ? 91 HIS A CG   6  
ATOM 9270  N ND1  . HIS A 1 92 ? 176.408 -10.724 -10.196 1.00 0.00 ? 91 HIS A ND1  6  
ATOM 9271  C CD2  . HIS A 1 92 ? 175.354 -12.192 -11.422 1.00 0.00 ? 91 HIS A CD2  6  
ATOM 9272  C CE1  . HIS A 1 92 ? 176.609 -11.909 -9.647  1.00 0.00 ? 91 HIS A CE1  6  
ATOM 9273  N NE2  . HIS A 1 92 ? 175.979 -12.816 -10.371 1.00 0.00 ? 91 HIS A NE2  6  
ATOM 9274  H H    . HIS A 1 92 ? 175.638 -10.722 -15.208 1.00 0.00 ? 91 HIS A H    6  
ATOM 9275  H HA   . HIS A 1 92 ? 174.279 -11.170 -13.444 1.00 0.00 ? 91 HIS A HA   6  
ATOM 9276  H HB2  . HIS A 1 92 ? 176.088 -9.130  -12.394 1.00 0.00 ? 91 HIS A HB2  6  
ATOM 9277  H HB3  . HIS A 1 92 ? 174.515 -9.107  -11.607 1.00 0.00 ? 91 HIS A HB3  6  
ATOM 9278  H HD1  . HIS A 1 92 ? 176.766 -9.879  -9.852  1.00 0.00 ? 91 HIS A HD1  6  
ATOM 9279  H HD2  . HIS A 1 92 ? 174.760 -12.669 -12.189 1.00 0.00 ? 91 HIS A HD2  6  
ATOM 9280  H HE1  . HIS A 1 92 ? 177.188 -12.103 -8.756  1.00 0.00 ? 91 HIS A HE1  6  
ATOM 9281  H HE2  . HIS A 1 92 ? 176.019 -13.783 -10.225 1.00 0.00 ? 91 HIS A HE2  6  
ATOM 9282  N N    . HIS A 1 93 ? 172.285 -9.939  -14.378 1.00 0.00 ? 92 HIS A N    6  
ATOM 9283  C CA   . HIS A 1 93 ? 170.999 -9.294  -14.656 1.00 0.00 ? 92 HIS A CA   6  
ATOM 9284  C C    . HIS A 1 93 ? 170.318 -8.823  -13.370 1.00 0.00 ? 92 HIS A C    6  
ATOM 9285  O O    . HIS A 1 93 ? 169.700 -7.758  -13.345 1.00 0.00 ? 92 HIS A O    6  
ATOM 9286  C CB   . HIS A 1 93 ? 170.066 -10.248 -15.414 1.00 0.00 ? 92 HIS A CB   6  
ATOM 9287  C CG   . HIS A 1 93 ? 169.893 -11.583 -14.751 1.00 0.00 ? 92 HIS A CG   6  
ATOM 9288  N ND1  . HIS A 1 93 ? 168.881 -11.855 -13.853 1.00 0.00 ? 92 HIS A ND1  6  
ATOM 9289  C CD2  . HIS A 1 93 ? 170.617 -12.723 -14.853 1.00 0.00 ? 92 HIS A CD2  6  
ATOM 9290  C CE1  . HIS A 1 93 ? 168.992 -13.102 -13.432 1.00 0.00 ? 92 HIS A CE1  6  
ATOM 9291  N NE2  . HIS A 1 93 ? 170.038 -13.651 -14.023 1.00 0.00 ? 92 HIS A NE2  6  
ATOM 9292  H H    . HIS A 1 93 ? 172.435 -10.856 -14.689 1.00 0.00 ? 92 HIS A H    6  
ATOM 9293  H HA   . HIS A 1 93 ? 171.194 -8.432  -15.278 1.00 0.00 ? 92 HIS A HA   6  
ATOM 9294  H HB2  . HIS A 1 93 ? 169.091 -9.793  -15.497 1.00 0.00 ? 92 HIS A HB2  6  
ATOM 9295  H HB3  . HIS A 1 93 ? 170.461 -10.417 -16.405 1.00 0.00 ? 92 HIS A HB3  6  
ATOM 9296  H HD1  . HIS A 1 93 ? 168.186 -11.226 -13.567 1.00 0.00 ? 92 HIS A HD1  6  
ATOM 9297  H HD2  . HIS A 1 93 ? 171.486 -12.876 -15.476 1.00 0.00 ? 92 HIS A HD2  6  
ATOM 9298  H HE1  . HIS A 1 93 ? 168.335 -13.592 -12.727 1.00 0.00 ? 92 HIS A HE1  6  
ATOM 9299  H HE2  . HIS A 1 93 ? 170.429 -14.517 -13.782 1.00 0.00 ? 92 HIS A HE2  6  
ATOM 9300  N N    . HIS A 1 94 ? 170.432 -9.623  -12.307 1.00 0.00 ? 93 HIS A N    6  
ATOM 9301  C CA   . HIS A 1 94 ? 169.827 -9.286  -11.021 1.00 0.00 ? 93 HIS A CA   6  
ATOM 9302  C C    . HIS A 1 94 ? 170.820 -8.541  -10.130 1.00 0.00 ? 93 HIS A C    6  
ATOM 9303  O O    . HIS A 1 94 ? 171.975 -9.005  -10.008 1.00 0.00 ? 93 HIS A O    6  
ATOM 9304  C CB   . HIS A 1 94 ? 169.341 -10.554 -10.312 1.00 0.00 ? 93 HIS A CB   6  
ATOM 9305  C CG   . HIS A 1 94 ? 167.995 -10.407 -9.663  1.00 0.00 ? 93 HIS A CG   6  
ATOM 9306  N ND1  . HIS A 1 94 ? 166.863 -10.022 -10.352 1.00 0.00 ? 93 HIS A ND1  6  
ATOM 9307  C CD2  . HIS A 1 94 ? 167.601 -10.605 -8.381  1.00 0.00 ? 93 HIS A CD2  6  
ATOM 9308  C CE1  . HIS A 1 94 ? 165.834 -9.989  -9.523  1.00 0.00 ? 93 HIS A CE1  6  
ATOM 9309  N NE2  . HIS A 1 94 ? 166.255 -10.338 -8.321  1.00 0.00 ? 93 HIS A NE2  6  
ATOM 9310  O OXT  . HIS A 1 94 ? 170.434 -7.497  -9.564  1.00 0.00 ? 93 HIS A OXT  6  
ATOM 9311  H H    . HIS A 1 94 ? 170.937 -10.459 -12.390 1.00 0.00 ? 93 HIS A H    6  
ATOM 9312  H HA   . HIS A 1 94 ? 168.981 -8.643  -11.213 1.00 0.00 ? 93 HIS A HA   6  
ATOM 9313  H HB2  . HIS A 1 94 ? 169.277 -11.357 -11.030 1.00 0.00 ? 93 HIS A HB2  6  
ATOM 9314  H HB3  . HIS A 1 94 ? 170.054 -10.822 -9.545  1.00 0.00 ? 93 HIS A HB3  6  
ATOM 9315  H HD1  . HIS A 1 94 ? 166.820 -9.802  -11.306 1.00 0.00 ? 93 HIS A HD1  6  
ATOM 9316  H HD2  . HIS A 1 94 ? 168.230 -10.916 -7.558  1.00 0.00 ? 93 HIS A HD2  6  
ATOM 9317  H HE1  . HIS A 1 94 ? 164.820 -9.726  -9.784  1.00 0.00 ? 93 HIS A HE1  6  
ATOM 9318  H HE2  . HIS A 1 94 ? 165.718 -10.302 -7.502  1.00 0.00 ? 93 HIS A HE2  6  
ATOM 9319  N N    . GLN A 1 2  ? 135.000 -3.726  -0.125  1.00 0.00 ? 1  GLN A N    7  
ATOM 9320  C CA   . GLN A 1 2  ? 135.120 -2.450  0.637   1.00 0.00 ? 1  GLN A CA   7  
ATOM 9321  C C    . GLN A 1 2  ? 136.334 -2.464  1.569   1.00 0.00 ? 1  GLN A C    7  
ATOM 9322  O O    . GLN A 1 2  ? 137.072 -3.450  1.623   1.00 0.00 ? 1  GLN A O    7  
ATOM 9323  C CB   . GLN A 1 2  ? 133.830 -2.231  1.434   1.00 0.00 ? 1  GLN A CB   7  
ATOM 9324  C CG   . GLN A 1 2  ? 132.837 -1.311  0.741   1.00 0.00 ? 1  GLN A CG   7  
ATOM 9325  C CD   . GLN A 1 2  ? 133.245 0.148   0.822   1.00 0.00 ? 1  GLN A CD   7  
ATOM 9326  O OE1  . GLN A 1 2  ? 133.254 0.740   1.900   1.00 0.00 ? 1  GLN A OE1  7  
ATOM 9327  N NE2  . GLN A 1 2  ? 133.587 0.736   -0.319  1.00 0.00 ? 1  GLN A NE2  7  
ATOM 9328  H HA   . GLN A 1 2  ? 135.238 -1.644  -0.072  1.00 0.00 ? 1  GLN A HA   7  
ATOM 9329  H HB2  . GLN A 1 2  ? 133.352 -3.185  1.596   1.00 0.00 ? 1  GLN A HB2  7  
ATOM 9330  H HB3  . GLN A 1 2  ? 134.081 -1.797  2.391   1.00 0.00 ? 1  GLN A HB3  7  
ATOM 9331  H HG2  . GLN A 1 2  ? 132.768 -1.594  -0.299  1.00 0.00 ? 1  GLN A HG2  7  
ATOM 9332  H HG3  . GLN A 1 2  ? 131.871 -1.426  1.210   1.00 0.00 ? 1  GLN A HG3  7  
ATOM 9333  H HE21 . GLN A 1 2  ? 133.557 0.206   -1.143  1.00 0.00 ? 1  GLN A HE21 7  
ATOM 9334  H HE22 . GLN A 1 2  ? 133.860 1.677   -0.290  1.00 0.00 ? 1  GLN A HE22 7  
ATOM 9335  N N    . SER A 1 3  ? 136.542 -1.356  2.292   1.00 0.00 ? 2  SER A N    7  
ATOM 9336  C CA   . SER A 1 3  ? 137.676 -1.226  3.211   1.00 0.00 ? 2  SER A CA   7  
ATOM 9337  C C    . SER A 1 3  ? 139.001 -1.263  2.446   1.00 0.00 ? 2  SER A C    7  
ATOM 9338  O O    . SER A 1 3  ? 140.020 -1.729  2.962   1.00 0.00 ? 2  SER A O    7  
ATOM 9339  C CB   . SER A 1 3  ? 137.643 -2.331  4.273   1.00 0.00 ? 2  SER A CB   7  
ATOM 9340  O OG   . SER A 1 3  ? 136.590 -2.116  5.197   1.00 0.00 ? 2  SER A OG   7  
ATOM 9341  H H    . SER A 1 3  ? 135.923 -0.602  2.195   1.00 0.00 ? 2  SER A H    7  
ATOM 9342  H HA   . SER A 1 3  ? 137.591 -0.268  3.705   1.00 0.00 ? 2  SER A HA   7  
ATOM 9343  H HB2  . SER A 1 3  ? 137.494 -3.285  3.792   1.00 0.00 ? 2  SER A HB2  7  
ATOM 9344  H HB3  . SER A 1 3  ? 138.580 -2.340  4.809   1.00 0.00 ? 2  SER A HB3  7  
ATOM 9345  H HG   . SER A 1 3  ? 136.787 -2.569  6.021   1.00 0.00 ? 2  SER A HG   7  
ATOM 9346  N N    . ASP A 1 4  ? 138.976 -0.762  1.210   1.00 0.00 ? 3  ASP A N    7  
ATOM 9347  C CA   . ASP A 1 4  ? 140.165 -0.729  0.365   1.00 0.00 ? 3  ASP A CA   7  
ATOM 9348  C C    . ASP A 1 4  ? 141.027 0.480   0.707   1.00 0.00 ? 3  ASP A C    7  
ATOM 9349  O O    . ASP A 1 4  ? 140.670 1.617   0.393   1.00 0.00 ? 3  ASP A O    7  
ATOM 9350  C CB   . ASP A 1 4  ? 139.764 -0.682  -1.113  1.00 0.00 ? 3  ASP A CB   7  
ATOM 9351  C CG   . ASP A 1 4  ? 139.250 -2.015  -1.624  1.00 0.00 ? 3  ASP A CG   7  
ATOM 9352  O OD1  . ASP A 1 4  ? 138.340 -2.587  -0.985  1.00 0.00 ? 3  ASP A OD1  7  
ATOM 9353  O OD2  . ASP A 1 4  ? 139.756 -2.486  -2.663  1.00 0.00 ? 3  ASP A OD2  7  
ATOM 9354  H H    . ASP A 1 4  ? 138.136 -0.402  0.858   1.00 0.00 ? 3  ASP A H    7  
ATOM 9355  H HA   . ASP A 1 4  ? 140.732 -1.629  0.550   1.00 0.00 ? 3  ASP A HA   7  
ATOM 9356  H HB2  . ASP A 1 4  ? 138.985 0.055   -1.243  1.00 0.00 ? 3  ASP A HB2  7  
ATOM 9357  H HB3  . ASP A 1 4  ? 140.624 -0.397  -1.702  1.00 0.00 ? 3  ASP A HB3  7  
ATOM 9358  N N    . VAL A 1 5  ? 142.161 0.229   1.356   1.00 0.00 ? 4  VAL A N    7  
ATOM 9359  C CA   . VAL A 1 5  ? 143.071 1.303   1.744   1.00 0.00 ? 4  VAL A CA   7  
ATOM 9360  C C    . VAL A 1 5  ? 143.900 1.772   0.549   1.00 0.00 ? 4  VAL A C    7  
ATOM 9361  O O    . VAL A 1 5  ? 144.407 0.957   -0.224  1.00 0.00 ? 4  VAL A O    7  
ATOM 9362  C CB   . VAL A 1 5  ? 144.018 0.869   2.886   1.00 0.00 ? 4  VAL A CB   7  
ATOM 9363  C CG1  . VAL A 1 5  ? 144.806 2.063   3.407   1.00 0.00 ? 4  VAL A CG1  7  
ATOM 9364  C CG2  . VAL A 1 5  ? 143.237 0.211   4.017   1.00 0.00 ? 4  VAL A CG2  7  
ATOM 9365  H H    . VAL A 1 5  ? 142.390 -0.698  1.581   1.00 0.00 ? 4  VAL A H    7  
ATOM 9366  H HA   . VAL A 1 5  ? 142.471 2.130   2.098   1.00 0.00 ? 4  VAL A HA   7  
ATOM 9367  H HB   . VAL A 1 5  ? 144.719 0.146   2.493   1.00 0.00 ? 4  VAL A HB   7  
ATOM 9368  H HG11 . VAL A 1 5  ? 145.774 2.092   2.929   1.00 0.00 ? 4  VAL A HG11 7  
ATOM 9369  H HG12 . VAL A 1 5  ? 144.935 1.972   4.475   1.00 0.00 ? 4  VAL A HG12 7  
ATOM 9370  H HG13 . VAL A 1 5  ? 144.268 2.973   3.186   1.00 0.00 ? 4  VAL A HG13 7  
ATOM 9371  H HG21 . VAL A 1 5  ? 142.705 0.969   4.575   1.00 0.00 ? 4  VAL A HG21 7  
ATOM 9372  H HG22 . VAL A 1 5  ? 143.921 -0.305  4.674   1.00 0.00 ? 4  VAL A HG22 7  
ATOM 9373  H HG23 . VAL A 1 5  ? 142.531 -0.494  3.606   1.00 0.00 ? 4  VAL A HG23 7  
ATOM 9374  N N    . ARG A 1 6  ? 144.029 3.092   0.402   1.00 0.00 ? 5  ARG A N    7  
ATOM 9375  C CA   . ARG A 1 6  ? 144.791 3.672   -0.701  1.00 0.00 ? 5  ARG A CA   7  
ATOM 9376  C C    . ARG A 1 6  ? 146.268 3.792   -0.337  1.00 0.00 ? 5  ARG A C    7  
ATOM 9377  O O    . ARG A 1 6  ? 146.653 4.641   0.471   1.00 0.00 ? 5  ARG A O    7  
ATOM 9378  C CB   . ARG A 1 6  ? 144.226 5.048   -1.070  1.00 0.00 ? 5  ARG A CB   7  
ATOM 9379  C CG   . ARG A 1 6  ? 143.759 5.146   -2.514  1.00 0.00 ? 5  ARG A CG   7  
ATOM 9380  C CD   . ARG A 1 6  ? 142.491 4.337   -2.752  1.00 0.00 ? 5  ARG A CD   7  
ATOM 9381  N NE   . ARG A 1 6  ? 141.374 4.808   -1.933  1.00 0.00 ? 5  ARG A NE   7  
ATOM 9382  C CZ   . ARG A 1 6  ? 140.679 5.922   -2.184  1.00 0.00 ? 5  ARG A CZ   7  
ATOM 9383  N NH1  . ARG A 1 6  ? 140.984 6.686   -3.230  1.00 0.00 ? 5  ARG A NH1  7  
ATOM 9384  N NH2  . ARG A 1 6  ? 139.676 6.272   -1.386  1.00 0.00 ? 5  ARG A NH2  7  
ATOM 9385  H H    . ARG A 1 6  ? 143.598 3.689   1.049   1.00 0.00 ? 5  ARG A H    7  
ATOM 9386  H HA   . ARG A 1 6  ? 144.695 3.015   -1.553  1.00 0.00 ? 5  ARG A HA   7  
ATOM 9387  H HB2  . ARG A 1 6  ? 143.385 5.264   -0.428  1.00 0.00 ? 5  ARG A HB2  7  
ATOM 9388  H HB3  . ARG A 1 6  ? 144.990 5.795   -0.911  1.00 0.00 ? 5  ARG A HB3  7  
ATOM 9389  H HG2  . ARG A 1 6  ? 143.561 6.181   -2.748  1.00 0.00 ? 5  ARG A HG2  7  
ATOM 9390  H HG3  . ARG A 1 6  ? 144.540 4.772   -3.161  1.00 0.00 ? 5  ARG A HG3  7  
ATOM 9391  H HD2  . ARG A 1 6  ? 142.219 4.417   -3.794  1.00 0.00 ? 5  ARG A HD2  7  
ATOM 9392  H HD3  . ARG A 1 6  ? 142.689 3.302   -2.513  1.00 0.00 ? 5  ARG A HD3  7  
ATOM 9393  H HE   . ARG A 1 6  ? 141.126 4.264   -1.154  1.00 0.00 ? 5  ARG A HE   7  
ATOM 9394  H HH11 . ARG A 1 6  ? 141.737 6.432   -3.836  1.00 0.00 ? 5  ARG A HH11 7  
ATOM 9395  H HH12 . ARG A 1 6  ? 140.459 7.519   -3.412  1.00 0.00 ? 5  ARG A HH12 7  
ATOM 9396  H HH21 . ARG A 1 6  ? 139.441 5.702   -0.598  1.00 0.00 ? 5  ARG A HH21 7  
ATOM 9397  H HH22 . ARG A 1 6  ? 139.155 7.105   -1.573  1.00 0.00 ? 5  ARG A HH22 7  
ATOM 9398  N N    . ILE A 1 7  ? 147.088 2.933   -0.936  1.00 0.00 ? 6  ILE A N    7  
ATOM 9399  C CA   . ILE A 1 7  ? 148.523 2.934   -0.676  1.00 0.00 ? 6  ILE A CA   7  
ATOM 9400  C C    . ILE A 1 7  ? 149.299 3.435   -1.893  1.00 0.00 ? 6  ILE A C    7  
ATOM 9401  O O    . ILE A 1 7  ? 149.212 2.855   -2.978  1.00 0.00 ? 6  ILE A O    7  
ATOM 9402  C CB   . ILE A 1 7  ? 149.027 1.523   -0.295  1.00 0.00 ? 6  ILE A CB   7  
ATOM 9403  C CG1  . ILE A 1 7  ? 148.125 0.902   0.778   1.00 0.00 ? 6  ILE A CG1  7  
ATOM 9404  C CG2  . ILE A 1 7  ? 150.469 1.583   0.193   1.00 0.00 ? 6  ILE A CG2  7  
ATOM 9405  C CD1  . ILE A 1 7  ? 148.396 -0.567  1.022   1.00 0.00 ? 6  ILE A CD1  7  
ATOM 9406  H H    . ILE A 1 7  ? 146.720 2.280   -1.569  1.00 0.00 ? 6  ILE A H    7  
ATOM 9407  H HA   . ILE A 1 7  ? 148.709 3.598   0.155   1.00 0.00 ? 6  ILE A HA   7  
ATOM 9408  H HB   . ILE A 1 7  ? 148.999 0.905   -1.179  1.00 0.00 ? 6  ILE A HB   7  
ATOM 9409  H HG12 . ILE A 1 7  ? 148.275 1.425   1.711   1.00 0.00 ? 6  ILE A HG12 7  
ATOM 9410  H HG13 . ILE A 1 7  ? 147.093 1.004   0.476   1.00 0.00 ? 6  ILE A HG13 7  
ATOM 9411  H HG21 . ILE A 1 7  ? 150.483 1.631   1.271   1.00 0.00 ? 6  ILE A HG21 7  
ATOM 9412  H HG22 . ILE A 1 7  ? 150.953 2.459   -0.213  1.00 0.00 ? 6  ILE A HG22 7  
ATOM 9413  H HG23 . ILE A 1 7  ? 150.995 0.699   -0.134  1.00 0.00 ? 6  ILE A HG23 7  
ATOM 9414  H HD11 . ILE A 1 7  ? 148.891 -0.688  1.974   1.00 0.00 ? 6  ILE A HD11 7  
ATOM 9415  H HD12 . ILE A 1 7  ? 149.028 -0.953  0.236   1.00 0.00 ? 6  ILE A HD12 7  
ATOM 9416  H HD13 . ILE A 1 7  ? 147.461 -1.108  1.031   1.00 0.00 ? 6  ILE A HD13 7  
ATOM 9417  N N    . LYS A 1 8  ? 150.056 4.516   -1.704  1.00 0.00 ? 7  LYS A N    7  
ATOM 9418  C CA   . LYS A 1 8  ? 150.851 5.097   -2.781  1.00 0.00 ? 7  LYS A CA   7  
ATOM 9419  C C    . LYS A 1 8  ? 152.316 4.687   -2.651  1.00 0.00 ? 7  LYS A C    7  
ATOM 9420  O O    . LYS A 1 8  ? 152.970 4.994   -1.651  1.00 0.00 ? 7  LYS A O    7  
ATOM 9421  C CB   . LYS A 1 8  ? 150.729 6.623   -2.770  1.00 0.00 ? 7  LYS A CB   7  
ATOM 9422  C CG   . LYS A 1 8  ? 151.386 7.299   -3.965  1.00 0.00 ? 7  LYS A CG   7  
ATOM 9423  C CD   . LYS A 1 8  ? 152.280 8.452   -3.532  1.00 0.00 ? 7  LYS A CD   7  
ATOM 9424  C CE   . LYS A 1 8  ? 151.590 9.797   -3.711  1.00 0.00 ? 7  LYS A CE   7  
ATOM 9425  N NZ   . LYS A 1 8  ? 150.379 9.926   -2.851  1.00 0.00 ? 7  LYS A NZ   7  
ATOM 9426  H H    . LYS A 1 8  ? 150.081 4.931   -0.816  1.00 0.00 ? 7  LYS A H    7  
ATOM 9427  H HA   . LYS A 1 8  ? 150.466 4.720   -3.718  1.00 0.00 ? 7  LYS A HA   7  
ATOM 9428  H HB2  . LYS A 1 8  ? 149.683 6.889   -2.764  1.00 0.00 ? 7  LYS A HB2  7  
ATOM 9429  H HB3  . LYS A 1 8  ? 151.193 7.002   -1.871  1.00 0.00 ? 7  LYS A HB3  7  
ATOM 9430  H HG2  . LYS A 1 8  ? 151.984 6.573   -4.496  1.00 0.00 ? 7  LYS A HG2  7  
ATOM 9431  H HG3  . LYS A 1 8  ? 150.614 7.679   -4.620  1.00 0.00 ? 7  LYS A HG3  7  
ATOM 9432  H HD2  . LYS A 1 8  ? 152.534 8.325   -2.491  1.00 0.00 ? 7  LYS A HD2  7  
ATOM 9433  H HD3  . LYS A 1 8  ? 153.181 8.438   -4.128  1.00 0.00 ? 7  LYS A HD3  7  
ATOM 9434  H HE2  . LYS A 1 8  ? 152.287 10.581  -3.454  1.00 0.00 ? 7  LYS A HE2  7  
ATOM 9435  H HE3  . LYS A 1 8  ? 151.299 9.903   -4.746  1.00 0.00 ? 7  LYS A HE3  7  
ATOM 9436  H HZ1  . LYS A 1 8  ? 150.075 10.920  -2.806  1.00 0.00 ? 7  LYS A HZ1  7  
ATOM 9437  H HZ2  . LYS A 1 8  ? 150.587 9.596   -1.887  1.00 0.00 ? 7  LYS A HZ2  7  
ATOM 9438  H HZ3  . LYS A 1 8  ? 149.602 9.354   -3.239  1.00 0.00 ? 7  LYS A HZ3  7  
ATOM 9439  N N    . PHE A 1 9  ? 152.825 3.995   -3.669  1.00 0.00 ? 8  PHE A N    7  
ATOM 9440  C CA   . PHE A 1 9  ? 154.214 3.541   -3.678  1.00 0.00 ? 8  PHE A CA   7  
ATOM 9441  C C    . PHE A 1 9  ? 155.072 4.463   -4.542  1.00 0.00 ? 8  PHE A C    7  
ATOM 9442  O O    . PHE A 1 9  ? 154.742 4.718   -5.702  1.00 0.00 ? 8  PHE A O    7  
ATOM 9443  C CB   . PHE A 1 9  ? 154.300 2.102   -4.199  1.00 0.00 ? 8  PHE A CB   7  
ATOM 9444  C CG   . PHE A 1 9  ? 153.363 1.151   -3.506  1.00 0.00 ? 8  PHE A CG   7  
ATOM 9445  C CD1  . PHE A 1 9  ? 153.720 0.555   -2.307  1.00 0.00 ? 8  PHE A CD1  7  
ATOM 9446  C CD2  . PHE A 1 9  ? 152.124 0.857   -4.054  1.00 0.00 ? 8  PHE A CD2  7  
ATOM 9447  C CE1  . PHE A 1 9  ? 152.858 -0.316  -1.667  1.00 0.00 ? 8  PHE A CE1  7  
ATOM 9448  C CE2  . PHE A 1 9  ? 151.259 -0.013  -3.419  1.00 0.00 ? 8  PHE A CE2  7  
ATOM 9449  C CZ   . PHE A 1 9  ? 151.627 -0.601  -2.224  1.00 0.00 ? 8  PHE A CZ   7  
ATOM 9450  H H    . PHE A 1 9  ? 152.252 3.785   -4.436  1.00 0.00 ? 8  PHE A H    7  
ATOM 9451  H HA   . PHE A 1 9  ? 154.582 3.571   -2.662  1.00 0.00 ? 8  PHE A HA   7  
ATOM 9452  H HB2  . PHE A 1 9  ? 154.061 2.094   -5.253  1.00 0.00 ? 8  PHE A HB2  7  
ATOM 9453  H HB3  . PHE A 1 9  ? 155.307 1.737   -4.063  1.00 0.00 ? 8  PHE A HB3  7  
ATOM 9454  H HD1  . PHE A 1 9  ? 154.683 0.776   -1.870  1.00 0.00 ? 8  PHE A HD1  7  
ATOM 9455  H HD2  . PHE A 1 9  ? 151.836 1.314   -4.988  1.00 0.00 ? 8  PHE A HD2  7  
ATOM 9456  H HE1  . PHE A 1 9  ? 153.148 -0.774  -0.733  1.00 0.00 ? 8  PHE A HE1  7  
ATOM 9457  H HE2  . PHE A 1 9  ? 150.297 -0.234  -3.856  1.00 0.00 ? 8  PHE A HE2  7  
ATOM 9458  H HZ   . PHE A 1 9  ? 150.952 -1.281  -1.725  1.00 0.00 ? 8  PHE A HZ   7  
ATOM 9459  N N    . GLU A 1 10 ? 156.170 4.963   -3.972  1.00 0.00 ? 9  GLU A N    7  
ATOM 9460  C CA   . GLU A 1 10 ? 157.066 5.862   -4.697  1.00 0.00 ? 9  GLU A CA   7  
ATOM 9461  C C    . GLU A 1 10 ? 158.468 5.267   -4.825  1.00 0.00 ? 9  GLU A C    7  
ATOM 9462  O O    . GLU A 1 10 ? 159.053 4.808   -3.841  1.00 0.00 ? 9  GLU A O    7  
ATOM 9463  C CB   . GLU A 1 10 ? 157.137 7.224   -4.000  1.00 0.00 ? 9  GLU A CB   7  
ATOM 9464  C CG   . GLU A 1 10 ? 157.789 8.308   -4.848  1.00 0.00 ? 9  GLU A CG   7  
ATOM 9465  C CD   . GLU A 1 10 ? 158.084 9.574   -4.064  1.00 0.00 ? 9  GLU A CD   7  
ATOM 9466  O OE1  . GLU A 1 10 ? 158.812 9.492   -3.052  1.00 0.00 ? 9  GLU A OE1  7  
ATOM 9467  O OE2  . GLU A 1 10 ? 157.589 10.648  -4.466  1.00 0.00 ? 9  GLU A OE2  7  
ATOM 9468  H H    . GLU A 1 10 ? 156.378 4.727   -3.044  1.00 0.00 ? 9  GLU A H    7  
ATOM 9469  H HA   . GLU A 1 10 ? 156.660 5.999   -5.688  1.00 0.00 ? 9  GLU A HA   7  
ATOM 9470  H HB2  . GLU A 1 10 ? 156.134 7.543   -3.756  1.00 0.00 ? 9  GLU A HB2  7  
ATOM 9471  H HB3  . GLU A 1 10 ? 157.705 7.120   -3.087  1.00 0.00 ? 9  GLU A HB3  7  
ATOM 9472  H HG2  . GLU A 1 10 ? 158.718 7.927   -5.245  1.00 0.00 ? 9  GLU A HG2  7  
ATOM 9473  H HG3  . GLU A 1 10 ? 157.126 8.555   -5.665  1.00 0.00 ? 9  GLU A HG3  7  
ATOM 9474  N N    . HIS A 1 11 ? 159.000 5.292   -6.047  1.00 0.00 ? 10 HIS A N    7  
ATOM 9475  C CA   . HIS A 1 11 ? 160.335 4.770   -6.322  1.00 0.00 ? 10 HIS A CA   7  
ATOM 9476  C C    . HIS A 1 11 ? 161.056 5.653   -7.338  1.00 0.00 ? 10 HIS A C    7  
ATOM 9477  O O    . HIS A 1 11 ? 160.581 5.832   -8.461  1.00 0.00 ? 10 HIS A O    7  
ATOM 9478  C CB   . HIS A 1 11 ? 160.252 3.333   -6.845  1.00 0.00 ? 10 HIS A CB   7  
ATOM 9479  C CG   . HIS A 1 11 ? 161.547 2.588   -6.745  1.00 0.00 ? 10 HIS A CG   7  
ATOM 9480  N ND1  . HIS A 1 11 ? 162.190 2.040   -7.836  1.00 0.00 ? 10 HIS A ND1  7  
ATOM 9481  C CD2  . HIS A 1 11 ? 162.322 2.302   -5.673  1.00 0.00 ? 10 HIS A CD2  7  
ATOM 9482  C CE1  . HIS A 1 11 ? 163.303 1.448   -7.438  1.00 0.00 ? 10 HIS A CE1  7  
ATOM 9483  N NE2  . HIS A 1 11 ? 163.406 1.595   -6.130  1.00 0.00 ? 10 HIS A NE2  7  
ATOM 9484  H H    . HIS A 1 11 ? 158.481 5.677   -6.785  1.00 0.00 ? 10 HIS A H    7  
ATOM 9485  H HA   . HIS A 1 11 ? 160.890 4.777   -5.396  1.00 0.00 ? 10 HIS A HA   7  
ATOM 9486  H HB2  . HIS A 1 11 ? 159.512 2.791   -6.274  1.00 0.00 ? 10 HIS A HB2  7  
ATOM 9487  H HB3  . HIS A 1 11 ? 159.956 3.351   -7.883  1.00 0.00 ? 10 HIS A HB3  7  
ATOM 9488  H HD1  . HIS A 1 11 ? 161.880 2.083   -8.764  1.00 0.00 ? 10 HIS A HD1  7  
ATOM 9489  H HD2  . HIS A 1 11 ? 162.126 2.582   -4.648  1.00 0.00 ? 10 HIS A HD2  7  
ATOM 9490  H HE1  . HIS A 1 11 ? 164.009 0.934   -8.074  1.00 0.00 ? 10 HIS A HE1  7  
ATOM 9491  H HE2  . HIS A 1 11 ? 164.107 1.201   -5.570  1.00 0.00 ? 10 HIS A HE2  7  
ATOM 9492  N N    . ASN A 1 12 ? 162.204 6.201   -6.934  1.00 0.00 ? 11 ASN A N    7  
ATOM 9493  C CA   . ASN A 1 12 ? 163.005 7.070   -7.802  1.00 0.00 ? 11 ASN A CA   7  
ATOM 9494  C C    . ASN A 1 12 ? 162.187 8.258   -8.316  1.00 0.00 ? 11 ASN A C    7  
ATOM 9495  O O    . ASN A 1 12 ? 162.372 8.708   -9.450  1.00 0.00 ? 11 ASN A O    7  
ATOM 9496  C CB   . ASN A 1 12 ? 163.570 6.270   -8.982  1.00 0.00 ? 11 ASN A CB   7  
ATOM 9497  C CG   . ASN A 1 12 ? 164.655 5.295   -8.561  1.00 0.00 ? 11 ASN A CG   7  
ATOM 9498  O OD1  . ASN A 1 12 ? 164.493 4.546   -7.597  1.00 0.00 ? 11 ASN A OD1  7  
ATOM 9499  N ND2  . ASN A 1 12 ? 165.770 5.297   -9.285  1.00 0.00 ? 11 ASN A ND2  7  
ATOM 9500  H H    . ASN A 1 12 ? 162.523 6.015   -6.027  1.00 0.00 ? 11 ASN A H    7  
ATOM 9501  H HA   . ASN A 1 12 ? 163.828 7.448   -7.214  1.00 0.00 ? 11 ASN A HA   7  
ATOM 9502  H HB2  . ASN A 1 12 ? 162.771 5.712   -9.446  1.00 0.00 ? 11 ASN A HB2  7  
ATOM 9503  H HB3  . ASN A 1 12 ? 163.989 6.957   -9.704  1.00 0.00 ? 11 ASN A HB3  7  
ATOM 9504  H HD21 . ASN A 1 12 ? 165.832 5.918   -10.041 1.00 0.00 ? 11 ASN A HD21 7  
ATOM 9505  H HD22 . ASN A 1 12 ? 166.485 4.676   -9.034  1.00 0.00 ? 11 ASN A HD22 7  
ATOM 9506  N N    . GLY A 1 13 ? 161.280 8.764   -7.478  1.00 0.00 ? 12 GLY A N    7  
ATOM 9507  C CA   . GLY A 1 13 ? 160.448 9.893   -7.869  1.00 0.00 ? 12 GLY A CA   7  
ATOM 9508  C C    . GLY A 1 13 ? 159.153 9.474   -8.556  1.00 0.00 ? 12 GLY A C    7  
ATOM 9509  O O    . GLY A 1 13 ? 158.237 10.286  -8.701  1.00 0.00 ? 12 GLY A O    7  
ATOM 9510  H H    . GLY A 1 13 ? 161.174 8.370   -6.587  1.00 0.00 ? 12 GLY A H    7  
ATOM 9511  H HA2  . GLY A 1 13 ? 160.203 10.464  -6.986  1.00 0.00 ? 12 GLY A HA2  7  
ATOM 9512  H HA3  . GLY A 1 13 ? 161.010 10.521  -8.543  1.00 0.00 ? 12 GLY A HA3  7  
ATOM 9513  N N    . GLU A 1 14 ? 159.069 8.208   -8.974  1.00 0.00 ? 13 GLU A N    7  
ATOM 9514  C CA   . GLU A 1 14 ? 157.873 7.695   -9.638  1.00 0.00 ? 13 GLU A CA   7  
ATOM 9515  C C    . GLU A 1 14 ? 156.891 7.138   -8.611  1.00 0.00 ? 13 GLU A C    7  
ATOM 9516  O O    . GLU A 1 14 ? 157.201 6.180   -7.903  1.00 0.00 ? 13 GLU A O    7  
ATOM 9517  C CB   . GLU A 1 14 ? 158.246 6.607   -10.649 1.00 0.00 ? 13 GLU A CB   7  
ATOM 9518  C CG   . GLU A 1 14 ? 159.075 7.117   -11.819 1.00 0.00 ? 13 GLU A CG   7  
ATOM 9519  C CD   . GLU A 1 14 ? 160.204 6.176   -12.192 1.00 0.00 ? 13 GLU A CD   7  
ATOM 9520  O OE1  . GLU A 1 14 ? 161.257 6.215   -11.519 1.00 0.00 ? 13 GLU A OE1  7  
ATOM 9521  O OE2  . GLU A 1 14 ? 160.036 5.400   -13.155 1.00 0.00 ? 13 GLU A OE2  7  
ATOM 9522  H H    . GLU A 1 14 ? 159.825 7.603   -8.828  1.00 0.00 ? 13 GLU A H    7  
ATOM 9523  H HA   . GLU A 1 14 ? 157.404 8.516   -10.160 1.00 0.00 ? 13 GLU A HA   7  
ATOM 9524  H HB2  . GLU A 1 14 ? 158.813 5.840   -10.142 1.00 0.00 ? 13 GLU A HB2  7  
ATOM 9525  H HB3  . GLU A 1 14 ? 157.340 6.170   -11.042 1.00 0.00 ? 13 GLU A HB3  7  
ATOM 9526  H HG2  . GLU A 1 14 ? 158.429 7.234   -12.676 1.00 0.00 ? 13 GLU A HG2  7  
ATOM 9527  H HG3  . GLU A 1 14 ? 159.497 8.075   -11.554 1.00 0.00 ? 13 GLU A HG3  7  
ATOM 9528  N N    . ARG A 1 15 ? 155.711 7.752   -8.529  1.00 0.00 ? 14 ARG A N    7  
ATOM 9529  C CA   . ARG A 1 15 ? 154.687 7.322   -7.577  1.00 0.00 ? 14 ARG A CA   7  
ATOM 9530  C C    . ARG A 1 15 ? 153.499 6.675   -8.290  1.00 0.00 ? 14 ARG A C    7  
ATOM 9531  O O    . ARG A 1 15 ? 153.119 7.088   -9.387  1.00 0.00 ? 14 ARG A O    7  
ATOM 9532  C CB   . ARG A 1 15 ? 154.212 8.507   -6.724  1.00 0.00 ? 14 ARG A CB   7  
ATOM 9533  C CG   . ARG A 1 15 ? 153.922 9.772   -7.519  1.00 0.00 ? 14 ARG A CG   7  
ATOM 9534  C CD   . ARG A 1 15 ? 155.164 10.638  -7.666  1.00 0.00 ? 14 ARG A CD   7  
ATOM 9535  N NE   . ARG A 1 15 ? 155.276 11.211  -9.005  1.00 0.00 ? 14 ARG A NE   7  
ATOM 9536  C CZ   . ARG A 1 15 ? 154.592 12.282  -9.418  1.00 0.00 ? 14 ARG A CZ   7  
ATOM 9537  N NH1  . ARG A 1 15 ? 153.750 12.904  -8.596  1.00 0.00 ? 14 ARG A NH1  7  
ATOM 9538  N NH2  . ARG A 1 15 ? 154.752 12.732  -10.657 1.00 0.00 ? 14 ARG A NH2  7  
ATOM 9539  H H    . ARG A 1 15 ? 155.527 8.514   -9.118  1.00 0.00 ? 14 ARG A H    7  
ATOM 9540  H HA   . ARG A 1 15 ? 155.138 6.588   -6.928  1.00 0.00 ? 14 ARG A HA   7  
ATOM 9541  H HB2  . ARG A 1 15 ? 153.308 8.221   -6.207  1.00 0.00 ? 14 ARG A HB2  7  
ATOM 9542  H HB3  . ARG A 1 15 ? 154.975 8.735   -5.993  1.00 0.00 ? 14 ARG A HB3  7  
ATOM 9543  H HG2  . ARG A 1 15 ? 153.568 9.496   -8.501  1.00 0.00 ? 14 ARG A HG2  7  
ATOM 9544  H HG3  . ARG A 1 15 ? 153.158 10.339  -7.006  1.00 0.00 ? 14 ARG A HG3  7  
ATOM 9545  H HD2  . ARG A 1 15 ? 155.116 11.439  -6.944  1.00 0.00 ? 14 ARG A HD2  7  
ATOM 9546  H HD3  . ARG A 1 15 ? 156.037 10.031  -7.470  1.00 0.00 ? 14 ARG A HD3  7  
ATOM 9547  H HE   . ARG A 1 15 ? 155.893 10.776  -9.632  1.00 0.00 ? 14 ARG A HE   7  
ATOM 9548  H HH11 . ARG A 1 15 ? 153.623 12.572  -7.662  1.00 0.00 ? 14 ARG A HH11 7  
ATOM 9549  H HH12 . ARG A 1 15 ? 153.244 13.707  -8.913  1.00 0.00 ? 14 ARG A HH12 7  
ATOM 9550  H HH21 . ARG A 1 15 ? 155.383 12.269  -11.281 1.00 0.00 ? 14 ARG A HH21 7  
ATOM 9551  H HH22 . ARG A 1 15 ? 154.243 13.534  -10.969 1.00 0.00 ? 14 ARG A HH22 7  
ATOM 9552  N N    . ARG A 1 16 ? 152.920 5.654   -7.655  1.00 0.00 ? 15 ARG A N    7  
ATOM 9553  C CA   . ARG A 1 16 ? 151.777 4.940   -8.222  1.00 0.00 ? 15 ARG A CA   7  
ATOM 9554  C C    . ARG A 1 16 ? 150.681 4.732   -7.174  1.00 0.00 ? 15 ARG A C    7  
ATOM 9555  O O    . ARG A 1 16 ? 150.968 4.426   -6.015  1.00 0.00 ? 15 ARG A O    7  
ATOM 9556  C CB   . ARG A 1 16 ? 152.227 3.589   -8.786  1.00 0.00 ? 15 ARG A CB   7  
ATOM 9557  C CG   . ARG A 1 16 ? 153.142 3.705   -9.995  1.00 0.00 ? 15 ARG A CG   7  
ATOM 9558  C CD   . ARG A 1 16 ? 152.836 2.635   -11.033 1.00 0.00 ? 15 ARG A CD   7  
ATOM 9559  N NE   . ARG A 1 16 ? 153.803 2.643   -12.129 1.00 0.00 ? 15 ARG A NE   7  
ATOM 9560  C CZ   . ARG A 1 16 ? 153.797 3.534   -13.125 1.00 0.00 ? 15 ARG A CZ   7  
ATOM 9561  N NH1  . ARG A 1 16 ? 152.874 4.493   -13.166 1.00 0.00 ? 15 ARG A NH1  7  
ATOM 9562  N NH2  . ARG A 1 16 ? 154.717 3.466   -14.081 1.00 0.00 ? 15 ARG A NH2  7  
ATOM 9563  H H    . ARG A 1 16 ? 153.273 5.373   -6.784  1.00 0.00 ? 15 ARG A H    7  
ATOM 9564  H HA   . ARG A 1 16 ? 151.378 5.541   -9.026  1.00 0.00 ? 15 ARG A HA   7  
ATOM 9565  H HB2  . ARG A 1 16 ? 152.755 3.049   -8.013  1.00 0.00 ? 15 ARG A HB2  7  
ATOM 9566  H HB3  . ARG A 1 16 ? 151.353 3.024   -9.074  1.00 0.00 ? 15 ARG A HB3  7  
ATOM 9567  H HG2  . ARG A 1 16 ? 153.009 4.677   -10.446 1.00 0.00 ? 15 ARG A HG2  7  
ATOM 9568  H HG3  . ARG A 1 16 ? 154.167 3.594   -9.670  1.00 0.00 ? 15 ARG A HG3  7  
ATOM 9569  H HD2  . ARG A 1 16 ? 152.857 1.668   -10.553 1.00 0.00 ? 15 ARG A HD2  7  
ATOM 9570  H HD3  . ARG A 1 16 ? 151.849 2.815   -11.434 1.00 0.00 ? 15 ARG A HD3  7  
ATOM 9571  H HE   . ARG A 1 16 ? 154.495 1.947   -12.125 1.00 0.00 ? 15 ARG A HE   7  
ATOM 9572  H HH11 . ARG A 1 16 ? 152.179 4.553   -12.450 1.00 0.00 ? 15 ARG A HH11 7  
ATOM 9573  H HH12 . ARG A 1 16 ? 152.877 5.157   -13.916 1.00 0.00 ? 15 ARG A HH12 7  
ATOM 9574  H HH21 . ARG A 1 16 ? 155.413 2.749   -14.055 1.00 0.00 ? 15 ARG A HH21 7  
ATOM 9575  H HH22 . ARG A 1 16 ? 154.714 4.132   -14.827 1.00 0.00 ? 15 ARG A HH22 7  
ATOM 9576  N N    . ILE A 1 17 ? 149.426 4.903   -7.594  1.00 0.00 ? 16 ILE A N    7  
ATOM 9577  C CA   . ILE A 1 17 ? 148.282 4.739   -6.698  1.00 0.00 ? 16 ILE A CA   7  
ATOM 9578  C C    . ILE A 1 17 ? 147.590 3.395   -6.924  1.00 0.00 ? 16 ILE A C    7  
ATOM 9579  O O    . ILE A 1 17 ? 147.082 3.124   -8.014  1.00 0.00 ? 16 ILE A O    7  
ATOM 9580  C CB   . ILE A 1 17 ? 147.248 5.872   -6.890  1.00 0.00 ? 16 ILE A CB   7  
ATOM 9581  C CG1  . ILE A 1 17 ? 147.936 7.241   -6.870  1.00 0.00 ? 16 ILE A CG1  7  
ATOM 9582  C CG2  . ILE A 1 17 ? 146.170 5.800   -5.815  1.00 0.00 ? 16 ILE A CG2  7  
ATOM 9583  C CD1  . ILE A 1 17 ? 148.323 7.745   -8.244  1.00 0.00 ? 16 ILE A CD1  7  
ATOM 9584  H H    . ILE A 1 17 ? 149.266 5.148   -8.529  1.00 0.00 ? 16 ILE A H    7  
ATOM 9585  H HA   . ILE A 1 17 ? 148.646 4.780   -5.681  1.00 0.00 ? 16 ILE A HA   7  
ATOM 9586  H HB   . ILE A 1 17 ? 146.771 5.732   -7.848  1.00 0.00 ? 16 ILE A HB   7  
ATOM 9587  H HG12 . ILE A 1 17 ? 147.269 7.966   -6.429  1.00 0.00 ? 16 ILE A HG12 7  
ATOM 9588  H HG13 . ILE A 1 17 ? 148.835 7.176   -6.275  1.00 0.00 ? 16 ILE A HG13 7  
ATOM 9589  H HG21 . ILE A 1 17 ? 145.383 5.135   -6.140  1.00 0.00 ? 16 ILE A HG21 7  
ATOM 9590  H HG22 . ILE A 1 17 ? 145.761 6.785   -5.649  1.00 0.00 ? 16 ILE A HG22 7  
ATOM 9591  H HG23 . ILE A 1 17 ? 146.599 5.428   -4.897  1.00 0.00 ? 16 ILE A HG23 7  
ATOM 9592  H HD11 . ILE A 1 17 ? 147.904 8.729   -8.399  1.00 0.00 ? 16 ILE A HD11 7  
ATOM 9593  H HD12 . ILE A 1 17 ? 147.942 7.070   -8.997  1.00 0.00 ? 16 ILE A HD12 7  
ATOM 9594  H HD13 . ILE A 1 17 ? 149.399 7.797   -8.320  1.00 0.00 ? 16 ILE A HD13 7  
ATOM 9595  N N    . ILE A 1 18 ? 147.568 2.558   -5.884  1.00 0.00 ? 17 ILE A N    7  
ATOM 9596  C CA   . ILE A 1 18 ? 146.932 1.244   -5.964  1.00 0.00 ? 17 ILE A CA   7  
ATOM 9597  C C    . ILE A 1 18 ? 146.115 0.954   -4.705  1.00 0.00 ? 17 ILE A C    7  
ATOM 9598  O O    . ILE A 1 18 ? 146.609 1.102   -3.585  1.00 0.00 ? 17 ILE A O    7  
ATOM 9599  C CB   . ILE A 1 18 ? 147.971 0.117   -6.163  1.00 0.00 ? 17 ILE A CB   7  
ATOM 9600  C CG1  . ILE A 1 18 ? 148.917 0.456   -7.319  1.00 0.00 ? 17 ILE A CG1  7  
ATOM 9601  C CG2  . ILE A 1 18 ? 147.274 -1.215  -6.418  1.00 0.00 ? 17 ILE A CG2  7  
ATOM 9602  C CD1  . ILE A 1 18 ? 150.186 1.152   -6.879  1.00 0.00 ? 17 ILE A CD1  7  
ATOM 9603  H H    . ILE A 1 18 ? 147.987 2.833   -5.041  1.00 0.00 ? 17 ILE A H    7  
ATOM 9604  H HA   . ILE A 1 18 ? 146.268 1.248   -6.817  1.00 0.00 ? 17 ILE A HA   7  
ATOM 9605  H HB   . ILE A 1 18 ? 148.546 0.024   -5.254  1.00 0.00 ? 17 ILE A HB   7  
ATOM 9606  H HG12 . ILE A 1 18 ? 149.198 -0.455  -7.826  1.00 0.00 ? 17 ILE A HG12 7  
ATOM 9607  H HG13 . ILE A 1 18 ? 148.406 1.106   -8.016  1.00 0.00 ? 17 ILE A HG13 7  
ATOM 9608  H HG21 . ILE A 1 18 ? 146.276 -1.186  -6.008  1.00 0.00 ? 17 ILE A HG21 7  
ATOM 9609  H HG22 . ILE A 1 18 ? 147.833 -2.009  -5.946  1.00 0.00 ? 17 ILE A HG22 7  
ATOM 9610  H HG23 . ILE A 1 18 ? 147.221 -1.396  -7.482  1.00 0.00 ? 17 ILE A HG23 7  
ATOM 9611  H HD11 . ILE A 1 18 ? 150.442 1.920   -7.594  1.00 0.00 ? 17 ILE A HD11 7  
ATOM 9612  H HD12 . ILE A 1 18 ? 150.990 0.432   -6.821  1.00 0.00 ? 17 ILE A HD12 7  
ATOM 9613  H HD13 . ILE A 1 18 ? 150.033 1.601   -5.909  1.00 0.00 ? 17 ILE A HD13 7  
ATOM 9614  N N    . ALA A 1 19 ? 144.862 0.539   -4.899  1.00 0.00 ? 18 ALA A N    7  
ATOM 9615  C CA   . ALA A 1 19 ? 143.974 0.224   -3.782  1.00 0.00 ? 18 ALA A CA   7  
ATOM 9616  C C    . ALA A 1 19 ? 144.085 -1.247  -3.389  1.00 0.00 ? 18 ALA A C    7  
ATOM 9617  O O    . ALA A 1 19 ? 144.236 -2.119  -4.247  1.00 0.00 ? 18 ALA A O    7  
ATOM 9618  C CB   . ALA A 1 19 ? 142.534 0.571   -4.134  1.00 0.00 ? 18 ALA A CB   7  
ATOM 9619  H H    . ALA A 1 19 ? 144.529 0.440   -5.815  1.00 0.00 ? 18 ALA A H    7  
ATOM 9620  H HA   . ALA A 1 19 ? 144.271 0.833   -2.939  1.00 0.00 ? 18 ALA A HA   7  
ATOM 9621  H HB1  . ALA A 1 19 ? 142.392 0.482   -5.200  1.00 0.00 ? 18 ALA A HB1  7  
ATOM 9622  H HB2  . ALA A 1 19 ? 142.323 1.584   -3.826  1.00 0.00 ? 18 ALA A HB2  7  
ATOM 9623  H HB3  . ALA A 1 19 ? 141.865 -0.107  -3.624  1.00 0.00 ? 18 ALA A HB3  7  
ATOM 9624  N N    . PHE A 1 20 ? 144.007 -1.515  -2.086  1.00 0.00 ? 19 PHE A N    7  
ATOM 9625  C CA   . PHE A 1 20 ? 144.097 -2.880  -1.574  1.00 0.00 ? 19 PHE A CA   7  
ATOM 9626  C C    . PHE A 1 20 ? 143.004 -3.149  -0.542  1.00 0.00 ? 19 PHE A C    7  
ATOM 9627  O O    . PHE A 1 20 ? 142.954 -2.502  0.506   1.00 0.00 ? 19 PHE A O    7  
ATOM 9628  C CB   . PHE A 1 20 ? 145.477 -3.122  -0.954  1.00 0.00 ? 19 PHE A CB   7  
ATOM 9629  C CG   . PHE A 1 20 ? 146.575 -3.282  -1.970  1.00 0.00 ? 19 PHE A CG   7  
ATOM 9630  C CD1  . PHE A 1 20 ? 146.550 -4.331  -2.876  1.00 0.00 ? 19 PHE A CD1  7  
ATOM 9631  C CD2  . PHE A 1 20 ? 147.629 -2.384  -2.020  1.00 0.00 ? 19 PHE A CD2  7  
ATOM 9632  C CE1  . PHE A 1 20 ? 147.555 -4.480  -3.812  1.00 0.00 ? 19 PHE A CE1  7  
ATOM 9633  C CE2  . PHE A 1 20 ? 148.637 -2.529  -2.953  1.00 0.00 ? 19 PHE A CE2  7  
ATOM 9634  C CZ   . PHE A 1 20 ? 148.600 -3.579  -3.851  1.00 0.00 ? 19 PHE A CZ   7  
ATOM 9635  H H    . PHE A 1 20 ? 143.887 -0.776  -1.453  1.00 0.00 ? 19 PHE A H    7  
ATOM 9636  H HA   . PHE A 1 20 ? 143.964 -3.555  -2.406  1.00 0.00 ? 19 PHE A HA   7  
ATOM 9637  H HB2  . PHE A 1 20 ? 145.731 -2.285  -0.321  1.00 0.00 ? 19 PHE A HB2  7  
ATOM 9638  H HB3  . PHE A 1 20 ? 145.442 -4.020  -0.356  1.00 0.00 ? 19 PHE A HB3  7  
ATOM 9639  H HD1  . PHE A 1 20 ? 145.733 -5.037  -2.847  1.00 0.00 ? 19 PHE A HD1  7  
ATOM 9640  H HD2  . PHE A 1 20 ? 147.659 -1.562  -1.319  1.00 0.00 ? 19 PHE A HD2  7  
ATOM 9641  H HE1  . PHE A 1 20 ? 147.524 -5.302  -4.511  1.00 0.00 ? 19 PHE A HE1  7  
ATOM 9642  H HE2  . PHE A 1 20 ? 149.453 -1.823  -2.981  1.00 0.00 ? 19 PHE A HE2  7  
ATOM 9643  H HZ   . PHE A 1 20 ? 149.387 -3.693  -4.581  1.00 0.00 ? 19 PHE A HZ   7  
ATOM 9644  N N    . SER A 1 21 ? 142.130 -4.109  -0.847  1.00 0.00 ? 20 SER A N    7  
ATOM 9645  C CA   . SER A 1 21 ? 141.034 -4.471  0.049   1.00 0.00 ? 20 SER A CA   7  
ATOM 9646  C C    . SER A 1 21 ? 141.567 -5.054  1.358   1.00 0.00 ? 20 SER A C    7  
ATOM 9647  O O    . SER A 1 21 ? 142.412 -5.950  1.349   1.00 0.00 ? 20 SER A O    7  
ATOM 9648  C CB   . SER A 1 21 ? 140.105 -5.479  -0.634  1.00 0.00 ? 20 SER A CB   7  
ATOM 9649  O OG   . SER A 1 21 ? 138.998 -5.802  0.191   1.00 0.00 ? 20 SER A OG   7  
ATOM 9650  H H    . SER A 1 21 ? 142.226 -4.587  -1.698  1.00 0.00 ? 20 SER A H    7  
ATOM 9651  H HA   . SER A 1 21 ? 140.476 -3.574  0.270   1.00 0.00 ? 20 SER A HA   7  
ATOM 9652  H HB2  . SER A 1 21 ? 139.737 -5.055  -1.557  1.00 0.00 ? 20 SER A HB2  7  
ATOM 9653  H HB3  . SER A 1 21 ? 140.656 -6.383  -0.849  1.00 0.00 ? 20 SER A HB3  7  
ATOM 9654  H HG   . SER A 1 21 ? 138.472 -5.014  0.349   1.00 0.00 ? 20 SER A HG   7  
ATOM 9655  N N    . ARG A 1 22 ? 141.068 -4.539  2.481   1.00 0.00 ? 21 ARG A N    7  
ATOM 9656  C CA   . ARG A 1 22 ? 141.497 -5.006  3.797   1.00 0.00 ? 21 ARG A CA   7  
ATOM 9657  C C    . ARG A 1 22 ? 140.901 -6.377  4.123   1.00 0.00 ? 21 ARG A C    7  
ATOM 9658  O O    . ARG A 1 22 ? 139.903 -6.786  3.528   1.00 0.00 ? 21 ARG A O    7  
ATOM 9659  C CB   . ARG A 1 22 ? 141.099 -3.997  4.876   1.00 0.00 ? 21 ARG A CB   7  
ATOM 9660  C CG   . ARG A 1 22 ? 142.183 -2.976  5.184   1.00 0.00 ? 21 ARG A CG   7  
ATOM 9661  C CD   . ARG A 1 22 ? 142.327 -2.750  6.681   1.00 0.00 ? 21 ARG A CD   7  
ATOM 9662  N NE   . ARG A 1 22 ? 141.657 -1.526  7.121   1.00 0.00 ? 21 ARG A NE   7  
ATOM 9663  C CZ   . ARG A 1 22 ? 141.274 -1.295  8.380   1.00 0.00 ? 21 ARG A CZ   7  
ATOM 9664  N NH1  . ARG A 1 22 ? 141.495 -2.200  9.330   1.00 0.00 ? 21 ARG A NH1  7  
ATOM 9665  N NH2  . ARG A 1 22 ? 140.670 -0.155  8.691   1.00 0.00 ? 21 ARG A NH2  7  
ATOM 9666  H H    . ARG A 1 22 ? 140.398 -3.826  2.423   1.00 0.00 ? 21 ARG A H    7  
ATOM 9667  H HA   . ARG A 1 22 ? 142.573 -5.092  3.778   1.00 0.00 ? 21 ARG A HA   7  
ATOM 9668  H HB2  . ARG A 1 22 ? 140.217 -3.466  4.548   1.00 0.00 ? 21 ARG A HB2  7  
ATOM 9669  H HB3  . ARG A 1 22 ? 140.868 -4.531  5.786   1.00 0.00 ? 21 ARG A HB3  7  
ATOM 9670  H HG2  . ARG A 1 22 ? 143.123 -3.333  4.792   1.00 0.00 ? 21 ARG A HG2  7  
ATOM 9671  H HG3  . ARG A 1 22 ? 141.925 -2.040  4.711   1.00 0.00 ? 21 ARG A HG3  7  
ATOM 9672  H HD2  . ARG A 1 22 ? 141.894 -3.592  7.201   1.00 0.00 ? 21 ARG A HD2  7  
ATOM 9673  H HD3  . ARG A 1 22 ? 143.378 -2.681  6.922   1.00 0.00 ? 21 ARG A HD3  7  
ATOM 9674  H HE   . ARG A 1 22 ? 141.482 -0.839  6.443   1.00 0.00 ? 21 ARG A HE   7  
ATOM 9675  H HH11 . ARG A 1 22 ? 141.951 -3.062  9.109   1.00 0.00 ? 21 ARG A HH11 7  
ATOM 9676  H HH12 . ARG A 1 22 ? 141.205 -2.017  10.270  1.00 0.00 ? 21 ARG A HH12 7  
ATOM 9677  H HH21 . ARG A 1 22 ? 140.501 0.532   7.983   1.00 0.00 ? 21 ARG A HH21 7  
ATOM 9678  H HH22 . ARG A 1 22 ? 140.383 0.019   9.633   1.00 0.00 ? 21 ARG A HH22 7  
ATOM 9679  N N    . PRO A 1 23 ? 141.509 -7.109  5.080   1.00 0.00 ? 22 PRO A N    7  
ATOM 9680  C CA   . PRO A 1 23 ? 142.700 -6.651  5.809   1.00 0.00 ? 22 PRO A CA   7  
ATOM 9681  C C    . PRO A 1 23 ? 143.966 -6.703  4.955   1.00 0.00 ? 22 PRO A C    7  
ATOM 9682  O O    . PRO A 1 23 ? 144.264 -7.723  4.330   1.00 0.00 ? 22 PRO A O    7  
ATOM 9683  C CB   . PRO A 1 23 ? 142.800 -7.638  6.973   1.00 0.00 ? 22 PRO A CB   7  
ATOM 9684  C CG   . PRO A 1 23 ? 142.160 -8.884  6.467   1.00 0.00 ? 22 PRO A CG   7  
ATOM 9685  C CD   . PRO A 1 23 ? 141.073 -8.446  5.522   1.00 0.00 ? 22 PRO A CD   7  
ATOM 9686  H HA   . PRO A 1 23 ? 142.569 -5.651  6.194   1.00 0.00 ? 22 PRO A HA   7  
ATOM 9687  H HB2  . PRO A 1 23 ? 143.839 -7.799  7.223   1.00 0.00 ? 22 PRO A HB2  7  
ATOM 9688  H HB3  . PRO A 1 23 ? 142.274 -7.243  7.829   1.00 0.00 ? 22 PRO A HB3  7  
ATOM 9689  H HG2  . PRO A 1 23 ? 142.889 -9.485  5.945   1.00 0.00 ? 22 PRO A HG2  7  
ATOM 9690  H HG3  . PRO A 1 23 ? 141.737 -9.439  7.292   1.00 0.00 ? 22 PRO A HG3  7  
ATOM 9691  H HD2  . PRO A 1 23 ? 141.007 -9.125  4.684   1.00 0.00 ? 22 PRO A HD2  7  
ATOM 9692  H HD3  . PRO A 1 23 ? 140.126 -8.390  6.037   1.00 0.00 ? 22 PRO A HD3  7  
ATOM 9693  N N    . VAL A 1 24 ? 144.709 -5.597  4.937   1.00 0.00 ? 23 VAL A N    7  
ATOM 9694  C CA   . VAL A 1 24 ? 145.944 -5.514  4.162   1.00 0.00 ? 23 VAL A CA   7  
ATOM 9695  C C    . VAL A 1 24 ? 147.049 -6.360  4.798   1.00 0.00 ? 23 VAL A C    7  
ATOM 9696  O O    . VAL A 1 24 ? 147.367 -6.203  5.978   1.00 0.00 ? 23 VAL A O    7  
ATOM 9697  C CB   . VAL A 1 24 ? 146.422 -4.049  4.012   1.00 0.00 ? 23 VAL A CB   7  
ATOM 9698  C CG1  . VAL A 1 24 ? 146.743 -3.436  5.368   1.00 0.00 ? 23 VAL A CG1  7  
ATOM 9699  C CG2  . VAL A 1 24 ? 147.626 -3.966  3.082   1.00 0.00 ? 23 VAL A CG2  7  
ATOM 9700  H H    . VAL A 1 24 ? 144.420 -4.819  5.457   1.00 0.00 ? 23 VAL A H    7  
ATOM 9701  H HA   . VAL A 1 24 ? 145.737 -5.902  3.174   1.00 0.00 ? 23 VAL A HA   7  
ATOM 9702  H HB   . VAL A 1 24 ? 145.619 -3.476  3.570   1.00 0.00 ? 23 VAL A HB   7  
ATOM 9703  H HG11 . VAL A 1 24 ? 146.942 -2.380  5.249   1.00 0.00 ? 23 VAL A HG11 7  
ATOM 9704  H HG12 . VAL A 1 24 ? 147.613 -3.920  5.786   1.00 0.00 ? 23 VAL A HG12 7  
ATOM 9705  H HG13 . VAL A 1 24 ? 145.903 -3.570  6.033   1.00 0.00 ? 23 VAL A HG13 7  
ATOM 9706  H HG21 . VAL A 1 24 ? 148.104 -4.932  3.022   1.00 0.00 ? 23 VAL A HG21 7  
ATOM 9707  H HG22 . VAL A 1 24 ? 148.329 -3.241  3.466   1.00 0.00 ? 23 VAL A HG22 7  
ATOM 9708  H HG23 . VAL A 1 24 ? 147.300 -3.664  2.098   1.00 0.00 ? 23 VAL A HG23 7  
ATOM 9709  N N    . LYS A 1 25 ? 147.621 -7.264  4.006   1.00 0.00 ? 24 LYS A N    7  
ATOM 9710  C CA   . LYS A 1 25 ? 148.684 -8.144  4.481   1.00 0.00 ? 24 LYS A CA   7  
ATOM 9711  C C    . LYS A 1 25 ? 150.049 -7.659  4.000   1.00 0.00 ? 24 LYS A C    7  
ATOM 9712  O O    . LYS A 1 25 ? 150.202 -7.261  2.844   1.00 0.00 ? 24 LYS A O    7  
ATOM 9713  C CB   . LYS A 1 25 ? 148.438 -9.576  3.994   1.00 0.00 ? 24 LYS A CB   7  
ATOM 9714  C CG   . LYS A 1 25 ? 148.262 -10.585 5.118   1.00 0.00 ? 24 LYS A CG   7  
ATOM 9715  C CD   . LYS A 1 25 ? 146.819 -11.053 5.224   1.00 0.00 ? 24 LYS A CD   7  
ATOM 9716  C CE   . LYS A 1 25 ? 146.712 -12.369 5.979   1.00 0.00 ? 24 LYS A CE   7  
ATOM 9717  N NZ   . LYS A 1 25 ? 145.718 -13.291 5.359   1.00 0.00 ? 24 LYS A NZ   7  
ATOM 9718  H H    . LYS A 1 25 ? 147.319 -7.343  3.076   1.00 0.00 ? 24 LYS A H    7  
ATOM 9719  H HA   . LYS A 1 25 ? 148.669 -8.132  5.561   1.00 0.00 ? 24 LYS A HA   7  
ATOM 9720  H HB2  . LYS A 1 25 ? 147.546 -9.588  3.386   1.00 0.00 ? 24 LYS A HB2  7  
ATOM 9721  H HB3  . LYS A 1 25 ? 149.277 -9.887  3.389   1.00 0.00 ? 24 LYS A HB3  7  
ATOM 9722  H HG2  . LYS A 1 25 ? 148.893 -11.439 4.923   1.00 0.00 ? 24 LYS A HG2  7  
ATOM 9723  H HG3  . LYS A 1 25 ? 148.552 -10.125 6.052   1.00 0.00 ? 24 LYS A HG3  7  
ATOM 9724  H HD2  . LYS A 1 25 ? 146.245 -10.302 5.747   1.00 0.00 ? 24 LYS A HD2  7  
ATOM 9725  H HD3  . LYS A 1 25 ? 146.420 -11.184 4.229   1.00 0.00 ? 24 LYS A HD3  7  
ATOM 9726  H HE2  . LYS A 1 25 ? 147.679 -12.848 5.980   1.00 0.00 ? 24 LYS A HE2  7  
ATOM 9727  H HE3  . LYS A 1 25 ? 146.413 -12.162 6.996   1.00 0.00 ? 24 LYS A HE3  7  
ATOM 9728  H HZ1  . LYS A 1 25 ? 146.018 -14.279 5.486   1.00 0.00 ? 24 LYS A HZ1  7  
ATOM 9729  H HZ2  . LYS A 1 25 ? 145.631 -13.095 4.341   1.00 0.00 ? 24 LYS A HZ2  7  
ATOM 9730  H HZ3  . LYS A 1 25 ? 144.786 -13.165 5.804   1.00 0.00 ? 24 LYS A HZ3  7  
ATOM 9731  N N    . TYR A 1 26 ? 151.041 -7.706  4.892   1.00 0.00 ? 25 TYR A N    7  
ATOM 9732  C CA   . TYR A 1 26 ? 152.401 -7.281  4.556   1.00 0.00 ? 25 TYR A CA   7  
ATOM 9733  C C    . TYR A 1 26 ? 152.923 -8.048  3.343   1.00 0.00 ? 25 TYR A C    7  
ATOM 9734  O O    . TYR A 1 26 ? 153.503 -7.460  2.429   1.00 0.00 ? 25 TYR A O    7  
ATOM 9735  C CB   . TYR A 1 26 ? 153.339 -7.490  5.752   1.00 0.00 ? 25 TYR A CB   7  
ATOM 9736  C CG   . TYR A 1 26 ? 154.760 -7.026  5.505   1.00 0.00 ? 25 TYR A CG   7  
ATOM 9737  C CD1  . TYR A 1 26 ? 155.707 -7.880  4.949   1.00 0.00 ? 25 TYR A CD1  7  
ATOM 9738  C CD2  . TYR A 1 26 ? 155.154 -5.734  5.829   1.00 0.00 ? 25 TYR A CD2  7  
ATOM 9739  C CE1  . TYR A 1 26 ? 157.003 -7.458  4.722   1.00 0.00 ? 25 TYR A CE1  7  
ATOM 9740  C CE2  . TYR A 1 26 ? 156.448 -5.304  5.604   1.00 0.00 ? 25 TYR A CE2  7  
ATOM 9741  C CZ   . TYR A 1 26 ? 157.369 -6.169  5.051   1.00 0.00 ? 25 TYR A CZ   7  
ATOM 9742  O OH   . TYR A 1 26 ? 158.659 -5.745  4.825   1.00 0.00 ? 25 TYR A OH   7  
ATOM 9743  H H    . TYR A 1 26 ? 150.856 -8.040  5.794   1.00 0.00 ? 25 TYR A H    7  
ATOM 9744  H HA   . TYR A 1 26 ? 152.369 -6.228  4.315   1.00 0.00 ? 25 TYR A HA   7  
ATOM 9745  H HB2  . TYR A 1 26 ? 152.956 -6.944  6.600   1.00 0.00 ? 25 TYR A HB2  7  
ATOM 9746  H HB3  . TYR A 1 26 ? 153.370 -8.542  5.994   1.00 0.00 ? 25 TYR A HB3  7  
ATOM 9747  H HD1  . TYR A 1 26 ? 155.418 -8.888  4.691   1.00 0.00 ? 25 TYR A HD1  7  
ATOM 9748  H HD2  . TYR A 1 26 ? 154.431 -5.058  6.262   1.00 0.00 ? 25 TYR A HD2  7  
ATOM 9749  H HE1  . TYR A 1 26 ? 157.724 -8.135  4.289   1.00 0.00 ? 25 TYR A HE1  7  
ATOM 9750  H HE2  . TYR A 1 26 ? 156.733 -4.296  5.862   1.00 0.00 ? 25 TYR A HE2  7  
ATOM 9751  H HH   . TYR A 1 26 ? 159.002 -5.316  5.613   1.00 0.00 ? 25 TYR A HH   7  
ATOM 9752  N N    . GLU A 1 27 ? 152.707 -9.365  3.340   1.00 0.00 ? 26 GLU A N    7  
ATOM 9753  C CA   . GLU A 1 27 ? 153.152 -10.213 2.236   1.00 0.00 ? 26 GLU A CA   7  
ATOM 9754  C C    . GLU A 1 27 ? 152.430 -9.850  0.941   1.00 0.00 ? 26 GLU A C    7  
ATOM 9755  O O    . GLU A 1 27 ? 153.036 -9.836  -0.128  1.00 0.00 ? 26 GLU A O    7  
ATOM 9756  C CB   . GLU A 1 27 ? 152.917 -11.692 2.562   1.00 0.00 ? 26 GLU A CB   7  
ATOM 9757  C CG   . GLU A 1 27 ? 154.103 -12.583 2.224   1.00 0.00 ? 26 GLU A CG   7  
ATOM 9758  C CD   . GLU A 1 27 ? 153.838 -13.489 1.036   1.00 0.00 ? 26 GLU A CD   7  
ATOM 9759  O OE1  . GLU A 1 27 ? 153.613 -12.964 -0.076  1.00 0.00 ? 26 GLU A OE1  7  
ATOM 9760  O OE2  . GLU A 1 27 ? 153.858 -14.725 1.217   1.00 0.00 ? 26 GLU A OE2  7  
ATOM 9761  H H    . GLU A 1 27 ? 152.236 -9.773  4.097   1.00 0.00 ? 26 GLU A H    7  
ATOM 9762  H HA   . GLU A 1 27 ? 154.210 -10.047 2.101   1.00 0.00 ? 26 GLU A HA   7  
ATOM 9763  H HB2  . GLU A 1 27 ? 152.710 -11.791 3.618   1.00 0.00 ? 26 GLU A HB2  7  
ATOM 9764  H HB3  . GLU A 1 27 ? 152.061 -12.041 2.002   1.00 0.00 ? 26 GLU A HB3  7  
ATOM 9765  H HG2  . GLU A 1 27 ? 154.953 -11.959 1.997   1.00 0.00 ? 26 GLU A HG2  7  
ATOM 9766  H HG3  . GLU A 1 27 ? 154.329 -13.198 3.083   1.00 0.00 ? 26 GLU A HG3  7  
ATOM 9767  N N    . ASP A 1 28 ? 151.133 -9.556  1.043   1.00 0.00 ? 27 ASP A N    7  
ATOM 9768  C CA   . ASP A 1 28 ? 150.333 -9.194  -0.126  1.00 0.00 ? 27 ASP A CA   7  
ATOM 9769  C C    . ASP A 1 28 ? 150.842 -7.903  -0.762  1.00 0.00 ? 27 ASP A C    7  
ATOM 9770  O O    . ASP A 1 28 ? 150.968 -7.812  -1.984  1.00 0.00 ? 27 ASP A O    7  
ATOM 9771  C CB   . ASP A 1 28 ? 148.856 -9.042  0.258   1.00 0.00 ? 27 ASP A CB   7  
ATOM 9772  C CG   . ASP A 1 28 ? 148.000 -10.180 -0.266  1.00 0.00 ? 27 ASP A CG   7  
ATOM 9773  O OD1  . ASP A 1 28 ? 148.364 -11.352 -0.036  1.00 0.00 ? 27 ASP A OD1  7  
ATOM 9774  O OD2  . ASP A 1 28 ? 146.964 -9.897  -0.904  1.00 0.00 ? 27 ASP A OD2  7  
ATOM 9775  H H    . ASP A 1 28 ? 150.704 -9.584  1.925   1.00 0.00 ? 27 ASP A H    7  
ATOM 9776  H HA   . ASP A 1 28 ? 150.426 -9.993  -0.847  1.00 0.00 ? 27 ASP A HA   7  
ATOM 9777  H HB2  . ASP A 1 28 ? 148.770 -9.019  1.335   1.00 0.00 ? 27 ASP A HB2  7  
ATOM 9778  H HB3  . ASP A 1 28 ? 148.478 -8.115  -0.148  1.00 0.00 ? 27 ASP A HB3  7  
ATOM 9779  N N    . VAL A 1 29 ? 151.136 -6.908  0.073   1.00 0.00 ? 28 VAL A N    7  
ATOM 9780  C CA   . VAL A 1 29 ? 151.635 -5.626  -0.415  1.00 0.00 ? 28 VAL A CA   7  
ATOM 9781  C C    . VAL A 1 29 ? 153.037 -5.776  -1.005  1.00 0.00 ? 28 VAL A C    7  
ATOM 9782  O O    . VAL A 1 29 ? 153.307 -5.303  -2.110  1.00 0.00 ? 28 VAL A O    7  
ATOM 9783  C CB   . VAL A 1 29 ? 151.665 -4.559  0.702   1.00 0.00 ? 28 VAL A CB   7  
ATOM 9784  C CG1  . VAL A 1 29 ? 152.089 -3.209  0.141   1.00 0.00 ? 28 VAL A CG1  7  
ATOM 9785  C CG2  . VAL A 1 29 ? 150.309 -4.452  1.390   1.00 0.00 ? 28 VAL A CG2  7  
ATOM 9786  H H    . VAL A 1 29 ? 151.019 -7.041  1.038   1.00 0.00 ? 28 VAL A H    7  
ATOM 9787  H HA   . VAL A 1 29 ? 150.965 -5.285  -1.191  1.00 0.00 ? 28 VAL A HA   7  
ATOM 9788  H HB   . VAL A 1 29 ? 152.395 -4.860  1.440   1.00 0.00 ? 28 VAL A HB   7  
ATOM 9789  H HG11 . VAL A 1 29 ? 152.023 -2.460  0.916   1.00 0.00 ? 28 VAL A HG11 7  
ATOM 9790  H HG12 . VAL A 1 29 ? 151.438 -2.939  -0.677  1.00 0.00 ? 28 VAL A HG12 7  
ATOM 9791  H HG13 . VAL A 1 29 ? 153.107 -3.271  -0.215  1.00 0.00 ? 28 VAL A HG13 7  
ATOM 9792  H HG21 . VAL A 1 29 ? 149.722 -3.681  0.913   1.00 0.00 ? 28 VAL A HG21 7  
ATOM 9793  H HG22 . VAL A 1 29 ? 150.453 -4.202  2.431   1.00 0.00 ? 28 VAL A HG22 7  
ATOM 9794  H HG23 . VAL A 1 29 ? 149.791 -5.397  1.316   1.00 0.00 ? 28 VAL A HG23 7  
ATOM 9795  N N    . GLU A 1 30 ? 153.923 -6.442  -0.264  1.00 0.00 ? 29 GLU A N    7  
ATOM 9796  C CA   . GLU A 1 30 ? 155.296 -6.659  -0.714  1.00 0.00 ? 29 GLU A CA   7  
ATOM 9797  C C    . GLU A 1 30 ? 155.333 -7.534  -1.964  1.00 0.00 ? 29 GLU A C    7  
ATOM 9798  O O    . GLU A 1 30 ? 156.124 -7.291  -2.873  1.00 0.00 ? 29 GLU A O    7  
ATOM 9799  C CB   . GLU A 1 30 ? 156.128 -7.300  0.400   1.00 0.00 ? 29 GLU A CB   7  
ATOM 9800  C CG   . GLU A 1 30 ? 157.197 -6.380  0.966   1.00 0.00 ? 29 GLU A CG   7  
ATOM 9801  C CD   . GLU A 1 30 ? 158.592 -6.753  0.502   1.00 0.00 ? 29 GLU A CD   7  
ATOM 9802  O OE1  . GLU A 1 30 ? 159.178 -7.690  1.083   1.00 0.00 ? 29 GLU A OE1  7  
ATOM 9803  O OE2  . GLU A 1 30 ? 159.095 -6.111  -0.444  1.00 0.00 ? 29 GLU A OE2  7  
ATOM 9804  H H    . GLU A 1 30 ? 153.644 -6.797  0.608   1.00 0.00 ? 29 GLU A H    7  
ATOM 9805  H HA   . GLU A 1 30 ? 155.719 -5.695  -0.955  1.00 0.00 ? 29 GLU A HA   7  
ATOM 9806  H HB2  . GLU A 1 30 ? 155.469 -7.590  1.206   1.00 0.00 ? 29 GLU A HB2  7  
ATOM 9807  H HB3  . GLU A 1 30 ? 156.613 -8.183  0.010   1.00 0.00 ? 29 GLU A HB3  7  
ATOM 9808  H HG2  . GLU A 1 30 ? 156.987 -5.368  0.652   1.00 0.00 ? 29 GLU A HG2  7  
ATOM 9809  H HG3  . GLU A 1 30 ? 157.165 -6.434  2.044   1.00 0.00 ? 29 GLU A HG3  7  
ATOM 9810  N N    . HIS A 1 31 ? 154.471 -8.548  -2.006  1.00 0.00 ? 30 HIS A N    7  
ATOM 9811  C CA   . HIS A 1 31 ? 154.406 -9.454  -3.151  1.00 0.00 ? 30 HIS A CA   7  
ATOM 9812  C C    . HIS A 1 31 ? 154.115 -8.684  -4.442  1.00 0.00 ? 30 HIS A C    7  
ATOM 9813  O O    . HIS A 1 31 ? 154.685 -8.981  -5.491  1.00 0.00 ? 30 HIS A O    7  
ATOM 9814  C CB   . HIS A 1 31 ? 153.336 -10.525 -2.915  1.00 0.00 ? 30 HIS A CB   7  
ATOM 9815  C CG   . HIS A 1 31 ? 153.246 -11.543 -4.008  1.00 0.00 ? 30 HIS A CG   7  
ATOM 9816  N ND1  . HIS A 1 31 ? 152.178 -11.621 -4.877  1.00 0.00 ? 30 HIS A ND1  7  
ATOM 9817  C CD2  . HIS A 1 31 ? 154.094 -12.536 -4.367  1.00 0.00 ? 30 HIS A CD2  7  
ATOM 9818  C CE1  . HIS A 1 31 ? 152.371 -12.619 -5.720  1.00 0.00 ? 30 HIS A CE1  7  
ATOM 9819  N NE2  . HIS A 1 31 ? 153.527 -13.190 -5.432  1.00 0.00 ? 30 HIS A NE2  7  
ATOM 9820  H H    . HIS A 1 31 ? 153.861 -8.690  -1.250  1.00 0.00 ? 30 HIS A H    7  
ATOM 9821  H HA   . HIS A 1 31 ? 155.368 -9.935  -3.245  1.00 0.00 ? 30 HIS A HA   7  
ATOM 9822  H HB2  . HIS A 1 31 ? 153.560 -11.049 -1.997  1.00 0.00 ? 30 HIS A HB2  7  
ATOM 9823  H HB3  . HIS A 1 31 ? 152.372 -10.046 -2.823  1.00 0.00 ? 30 HIS A HB3  7  
ATOM 9824  H HD1  . HIS A 1 31 ? 151.395 -11.031 -4.876  1.00 0.00 ? 30 HIS A HD1  7  
ATOM 9825  H HD2  . HIS A 1 31 ? 155.041 -12.767 -3.901  1.00 0.00 ? 30 HIS A HD2  7  
ATOM 9826  H HE1  . HIS A 1 31 ? 151.698 -12.919 -6.509  1.00 0.00 ? 30 HIS A HE1  7  
ATOM 9827  H HE2  . HIS A 1 31 ? 153.857 -14.024 -5.826  1.00 0.00 ? 30 HIS A HE2  7  
ATOM 9828  N N    . LYS A 1 32 ? 153.235 -7.686  -4.352  1.00 0.00 ? 31 LYS A N    7  
ATOM 9829  C CA   . LYS A 1 32 ? 152.880 -6.868  -5.510  1.00 0.00 ? 31 LYS A CA   7  
ATOM 9830  C C    . LYS A 1 32 ? 154.052 -5.985  -5.939  1.00 0.00 ? 31 LYS A C    7  
ATOM 9831  O O    . LYS A 1 32 ? 154.387 -5.921  -7.121  1.00 0.00 ? 31 LYS A O    7  
ATOM 9832  C CB   . LYS A 1 32 ? 151.655 -6.001  -5.197  1.00 0.00 ? 31 LYS A CB   7  
ATOM 9833  C CG   . LYS A 1 32 ? 150.700 -5.856  -6.371  1.00 0.00 ? 31 LYS A CG   7  
ATOM 9834  C CD   . LYS A 1 32 ? 149.478 -6.749  -6.212  1.00 0.00 ? 31 LYS A CD   7  
ATOM 9835  C CE   . LYS A 1 32 ? 148.391 -6.388  -7.214  1.00 0.00 ? 31 LYS A CE   7  
ATOM 9836  N NZ   . LYS A 1 32 ? 147.037 -6.804  -6.749  1.00 0.00 ? 31 LYS A NZ   7  
ATOM 9837  H H    . LYS A 1 32 ? 152.819 -7.490  -3.485  1.00 0.00 ? 31 LYS A H    7  
ATOM 9838  H HA   . LYS A 1 32 ? 152.636 -7.536  -6.323  1.00 0.00 ? 31 LYS A HA   7  
ATOM 9839  H HB2  . LYS A 1 32 ? 151.116 -6.445  -4.373  1.00 0.00 ? 31 LYS A HB2  7  
ATOM 9840  H HB3  . LYS A 1 32 ? 151.989 -5.016  -4.908  1.00 0.00 ? 31 LYS A HB3  7  
ATOM 9841  H HG2  . LYS A 1 32 ? 150.376 -4.828  -6.435  1.00 0.00 ? 31 LYS A HG2  7  
ATOM 9842  H HG3  . LYS A 1 32 ? 151.218 -6.129  -7.278  1.00 0.00 ? 31 LYS A HG3  7  
ATOM 9843  H HD2  . LYS A 1 32 ? 149.772 -7.777  -6.370  1.00 0.00 ? 31 LYS A HD2  7  
ATOM 9844  H HD3  . LYS A 1 32 ? 149.088 -6.634  -5.211  1.00 0.00 ? 31 LYS A HD3  7  
ATOM 9845  H HE2  . LYS A 1 32 ? 148.397 -5.319  -7.360  1.00 0.00 ? 31 LYS A HE2  7  
ATOM 9846  H HE3  . LYS A 1 32 ? 148.607 -6.880  -8.151  1.00 0.00 ? 31 LYS A HE3  7  
ATOM 9847  H HZ1  . LYS A 1 32 ? 146.331 -6.088  -7.020  1.00 0.00 ? 31 LYS A HZ1  7  
ATOM 9848  H HZ2  . LYS A 1 32 ? 147.026 -6.908  -5.714  1.00 0.00 ? 31 LYS A HZ2  7  
ATOM 9849  H HZ3  . LYS A 1 32 ? 146.774 -7.712  -7.180  1.00 0.00 ? 31 LYS A HZ3  7  
ATOM 9850  N N    . VAL A 1 33 ? 154.673 -5.309  -4.974  1.00 0.00 ? 32 VAL A N    7  
ATOM 9851  C CA   . VAL A 1 33 ? 155.808 -4.433  -5.260  1.00 0.00 ? 32 VAL A CA   7  
ATOM 9852  C C    . VAL A 1 33 ? 157.034 -5.232  -5.704  1.00 0.00 ? 32 VAL A C    7  
ATOM 9853  O O    . VAL A 1 33 ? 157.719 -4.855  -6.656  1.00 0.00 ? 32 VAL A O    7  
ATOM 9854  C CB   . VAL A 1 33 ? 156.185 -3.567  -4.040  1.00 0.00 ? 32 VAL A CB   7  
ATOM 9855  C CG1  . VAL A 1 33 ? 157.256 -2.554  -4.416  1.00 0.00 ? 32 VAL A CG1  7  
ATOM 9856  C CG2  . VAL A 1 33 ? 154.955 -2.868  -3.475  1.00 0.00 ? 32 VAL A CG2  7  
ATOM 9857  H H    . VAL A 1 33 ? 154.362 -5.404  -4.047  1.00 0.00 ? 32 VAL A H    7  
ATOM 9858  H HA   . VAL A 1 33 ? 155.518 -3.773  -6.064  1.00 0.00 ? 32 VAL A HA   7  
ATOM 9859  H HB   . VAL A 1 33 ? 156.588 -4.215  -3.275  1.00 0.00 ? 32 VAL A HB   7  
ATOM 9860  H HG11 . VAL A 1 33 ? 156.859 -1.866  -5.148  1.00 0.00 ? 32 VAL A HG11 7  
ATOM 9861  H HG12 . VAL A 1 33 ? 158.108 -3.071  -4.833  1.00 0.00 ? 32 VAL A HG12 7  
ATOM 9862  H HG13 . VAL A 1 33 ? 157.561 -2.008  -3.537  1.00 0.00 ? 32 VAL A HG13 7  
ATOM 9863  H HG21 . VAL A 1 33 ? 154.552 -3.453  -2.662  1.00 0.00 ? 32 VAL A HG21 7  
ATOM 9864  H HG22 . VAL A 1 33 ? 154.208 -2.768  -4.250  1.00 0.00 ? 32 VAL A HG22 7  
ATOM 9865  H HG23 . VAL A 1 33 ? 155.231 -1.889  -3.112  1.00 0.00 ? 32 VAL A HG23 7  
ATOM 9866  N N    . THR A 1 34 ? 157.306 -6.337  -5.010  1.00 0.00 ? 33 THR A N    7  
ATOM 9867  C CA   . THR A 1 34 ? 158.449 -7.189  -5.331  1.00 0.00 ? 33 THR A CA   7  
ATOM 9868  C C    . THR A 1 34 ? 158.344 -7.738  -6.755  1.00 0.00 ? 33 THR A C    7  
ATOM 9869  O O    . THR A 1 34 ? 159.347 -7.837  -7.457  1.00 0.00 ? 33 THR A O    7  
ATOM 9870  C CB   . THR A 1 34 ? 158.567 -8.340  -4.323  1.00 0.00 ? 33 THR A CB   7  
ATOM 9871  O OG1  . THR A 1 34 ? 158.718 -7.842  -3.004  1.00 0.00 ? 33 THR A OG1  7  
ATOM 9872  C CG2  . THR A 1 34 ? 159.735 -9.266  -4.592  1.00 0.00 ? 33 THR A CG2  7  
ATOM 9873  H H    . THR A 1 34 ? 156.722 -6.586  -4.260  1.00 0.00 ? 33 THR A H    7  
ATOM 9874  H HA   . THR A 1 34 ? 159.337 -6.576  -5.264  1.00 0.00 ? 33 THR A HA   7  
ATOM 9875  H HB   . THR A 1 34 ? 157.662 -8.931  -4.357  1.00 0.00 ? 33 THR A HB   7  
ATOM 9876  H HG1  . THR A 1 34 ? 159.357 -7.123  -2.997  1.00 0.00 ? 33 THR A HG1  7  
ATOM 9877  H HG21 . THR A 1 34 ? 159.384 -10.285 -4.635  1.00 0.00 ? 33 THR A HG21 7  
ATOM 9878  H HG22 . THR A 1 34 ? 160.462 -9.168  -3.796  1.00 0.00 ? 33 THR A HG22 7  
ATOM 9879  H HG23 . THR A 1 34 ? 160.194 -9.005  -5.532  1.00 0.00 ? 33 THR A HG23 7  
ATOM 9880  N N    . THR A 1 35 ? 157.129 -8.095  -7.177  1.00 0.00 ? 34 THR A N    7  
ATOM 9881  C CA   . THR A 1 35 ? 156.915 -8.632  -8.522  1.00 0.00 ? 34 THR A CA   7  
ATOM 9882  C C    . THR A 1 35 ? 157.070 -7.545  -9.591  1.00 0.00 ? 34 THR A C    7  
ATOM 9883  O O    . THR A 1 35 ? 157.691 -7.778  -10.629 1.00 0.00 ? 34 THR A O    7  
ATOM 9884  C CB   . THR A 1 35 ? 155.532 -9.289  -8.635  1.00 0.00 ? 34 THR A CB   7  
ATOM 9885  O OG1  . THR A 1 35 ? 155.394 -10.339 -7.693  1.00 0.00 ? 34 THR A OG1  7  
ATOM 9886  C CG2  . THR A 1 35 ? 155.250 -9.870  -10.006 1.00 0.00 ? 34 THR A CG2  7  
ATOM 9887  H H    . THR A 1 35 ? 156.361 -7.997  -6.573  1.00 0.00 ? 34 THR A H    7  
ATOM 9888  H HA   . THR A 1 35 ? 157.670 -9.385  -8.694  1.00 0.00 ? 34 THR A HA   7  
ATOM 9889  H HB   . THR A 1 35 ? 154.774 -8.548  -8.429  1.00 0.00 ? 34 THR A HB   7  
ATOM 9890  H HG1  . THR A 1 35 ? 156.176 -10.897 -7.712  1.00 0.00 ? 34 THR A HG1  7  
ATOM 9891  H HG21 . THR A 1 35 ? 154.202 -9.757  -10.236 1.00 0.00 ? 34 THR A HG21 7  
ATOM 9892  H HG22 . THR A 1 35 ? 155.510 -10.919 -10.012 1.00 0.00 ? 34 THR A HG22 7  
ATOM 9893  H HG23 . THR A 1 35 ? 155.838 -9.350  -10.747 1.00 0.00 ? 34 THR A HG23 7  
ATOM 9894  N N    . VAL A 1 36 ? 156.498 -6.364  -9.344  1.00 0.00 ? 35 VAL A N    7  
ATOM 9895  C CA   . VAL A 1 36 ? 156.579 -5.263  -10.308 1.00 0.00 ? 35 VAL A CA   7  
ATOM 9896  C C    . VAL A 1 36 ? 158.024 -4.809  -10.517 1.00 0.00 ? 35 VAL A C    7  
ATOM 9897  O O    . VAL A 1 36 ? 158.487 -4.698  -11.653 1.00 0.00 ? 35 VAL A O    7  
ATOM 9898  C CB   . VAL A 1 36 ? 155.728 -4.049  -9.875  1.00 0.00 ? 35 VAL A CB   7  
ATOM 9899  C CG1  . VAL A 1 36 ? 155.774 -2.957  -10.937 1.00 0.00 ? 35 VAL A CG1  7  
ATOM 9900  C CG2  . VAL A 1 36 ? 154.289 -4.465  -9.597  1.00 0.00 ? 35 VAL A CG2  7  
ATOM 9901  H H    . VAL A 1 36 ? 156.008 -6.232  -8.503  1.00 0.00 ? 35 VAL A H    7  
ATOM 9902  H HA   . VAL A 1 36 ? 156.191 -5.626  -11.250 1.00 0.00 ? 35 VAL A HA   7  
ATOM 9903  H HB   . VAL A 1 36 ? 156.146 -3.648  -8.963  1.00 0.00 ? 35 VAL A HB   7  
ATOM 9904  H HG11 . VAL A 1 36 ? 154.825 -2.443  -10.969 1.00 0.00 ? 35 VAL A HG11 7  
ATOM 9905  H HG12 . VAL A 1 36 ? 155.976 -3.401  -11.901 1.00 0.00 ? 35 VAL A HG12 7  
ATOM 9906  H HG13 . VAL A 1 36 ? 156.557 -2.253  -10.695 1.00 0.00 ? 35 VAL A HG13 7  
ATOM 9907  H HG21 . VAL A 1 36 ? 154.234 -5.540  -9.512  1.00 0.00 ? 35 VAL A HG21 7  
ATOM 9908  H HG22 . VAL A 1 36 ? 153.654 -4.136  -10.407 1.00 0.00 ? 35 VAL A HG22 7  
ATOM 9909  H HG23 . VAL A 1 36 ? 153.957 -4.014  -8.674  1.00 0.00 ? 35 VAL A HG23 7  
ATOM 9910  N N    . PHE A 1 37 ? 158.732 -4.541  -9.418  1.00 0.00 ? 36 PHE A N    7  
ATOM 9911  C CA   . PHE A 1 37 ? 160.127 -4.096  -9.492  1.00 0.00 ? 36 PHE A CA   7  
ATOM 9912  C C    . PHE A 1 37 ? 161.098 -5.272  -9.632  1.00 0.00 ? 36 PHE A C    7  
ATOM 9913  O O    . PHE A 1 37 ? 162.246 -5.085  -10.039 1.00 0.00 ? 36 PHE A O    7  
ATOM 9914  C CB   . PHE A 1 37 ? 160.489 -3.270  -8.255  1.00 0.00 ? 36 PHE A CB   7  
ATOM 9915  C CG   . PHE A 1 37 ? 159.740 -1.972  -8.166  1.00 0.00 ? 36 PHE A CG   7  
ATOM 9916  C CD1  . PHE A 1 37 ? 160.176 -0.857  -8.863  1.00 0.00 ? 36 PHE A CD1  7  
ATOM 9917  C CD2  . PHE A 1 37 ? 158.596 -1.869  -7.392  1.00 0.00 ? 36 PHE A CD2  7  
ATOM 9918  C CE1  . PHE A 1 37 ? 159.486 0.337   -8.787  1.00 0.00 ? 36 PHE A CE1  7  
ATOM 9919  C CE2  . PHE A 1 37 ? 157.902 -0.679  -7.313  1.00 0.00 ? 36 PHE A CE2  7  
ATOM 9920  C CZ   . PHE A 1 37 ? 158.347 0.425   -8.010  1.00 0.00 ? 36 PHE A CZ   7  
ATOM 9921  H H    . PHE A 1 37 ? 158.309 -4.641  -8.539  1.00 0.00 ? 36 PHE A H    7  
ATOM 9922  H HA   . PHE A 1 37 ? 160.221 -3.468  -10.365 1.00 0.00 ? 36 PHE A HA   7  
ATOM 9923  H HB2  . PHE A 1 37 ? 160.270 -3.845  -7.367  1.00 0.00 ? 36 PHE A HB2  7  
ATOM 9924  H HB3  . PHE A 1 37 ? 161.546 -3.045  -8.280  1.00 0.00 ? 36 PHE A HB3  7  
ATOM 9925  H HD1  . PHE A 1 37 ? 161.067 -0.926  -9.471  1.00 0.00 ? 36 PHE A HD1  7  
ATOM 9926  H HD2  . PHE A 1 37 ? 158.248 -2.732  -6.845  1.00 0.00 ? 36 PHE A HD2  7  
ATOM 9927  H HE1  . PHE A 1 37 ? 159.836 1.200   -9.333  1.00 0.00 ? 36 PHE A HE1  7  
ATOM 9928  H HE2  . PHE A 1 37 ? 157.012 -0.612  -6.706  1.00 0.00 ? 36 PHE A HE2  7  
ATOM 9929  H HZ   . PHE A 1 37 ? 157.806 1.354   -7.950  1.00 0.00 ? 36 PHE A HZ   7  
ATOM 9930  N N    . GLY A 1 38 ? 160.640 -6.477  -9.288  1.00 0.00 ? 37 GLY A N    7  
ATOM 9931  C CA   . GLY A 1 38 ? 161.487 -7.656  -9.379  1.00 0.00 ? 37 GLY A CA   7  
ATOM 9932  C C    . GLY A 1 38 ? 162.614 -7.661  -8.355  1.00 0.00 ? 37 GLY A C    7  
ATOM 9933  O O    . GLY A 1 38 ? 163.616 -8.355  -8.538  1.00 0.00 ? 37 GLY A O    7  
ATOM 9934  H H    . GLY A 1 38 ? 159.720 -6.567  -8.964  1.00 0.00 ? 37 GLY A H    7  
ATOM 9935  H HA2  . GLY A 1 38 ? 160.878 -8.533  -9.227  1.00 0.00 ? 37 GLY A HA2  7  
ATOM 9936  H HA3  . GLY A 1 38 ? 161.917 -7.699  -10.368 1.00 0.00 ? 37 GLY A HA3  7  
ATOM 9937  N N    . GLN A 1 39 ? 162.455 -6.889  -7.276  1.00 0.00 ? 38 GLN A N    7  
ATOM 9938  C CA   . GLN A 1 39 ? 163.471 -6.811  -6.227  1.00 0.00 ? 38 GLN A CA   7  
ATOM 9939  C C    . GLN A 1 39 ? 162.831 -6.532  -4.866  1.00 0.00 ? 38 GLN A C    7  
ATOM 9940  O O    . GLN A 1 39 ? 161.775 -5.903  -4.789  1.00 0.00 ? 38 GLN A O    7  
ATOM 9941  C CB   . GLN A 1 39 ? 164.485 -5.709  -6.551  1.00 0.00 ? 38 GLN A CB   7  
ATOM 9942  C CG   . GLN A 1 39 ? 165.394 -6.028  -7.729  1.00 0.00 ? 38 GLN A CG   7  
ATOM 9943  C CD   . GLN A 1 39 ? 166.127 -4.803  -8.242  1.00 0.00 ? 38 GLN A CD   7  
ATOM 9944  O OE1  . GLN A 1 39 ? 166.007 -4.440  -9.412  1.00 0.00 ? 38 GLN A OE1  7  
ATOM 9945  N NE2  . GLN A 1 39 ? 166.892 -4.157  -7.367  1.00 0.00 ? 38 GLN A NE2  7  
ATOM 9946  H H    . GLN A 1 39 ? 161.636 -6.359  -7.183  1.00 0.00 ? 38 GLN A H    7  
ATOM 9947  H HA   . GLN A 1 39 ? 163.983 -7.762  -6.188  1.00 0.00 ? 38 GLN A HA   7  
ATOM 9948  H HB2  . GLN A 1 39 ? 163.948 -4.800  -6.778  1.00 0.00 ? 38 GLN A HB2  7  
ATOM 9949  H HB3  . GLN A 1 39 ? 165.104 -5.541  -5.683  1.00 0.00 ? 38 GLN A HB3  7  
ATOM 9950  H HG2  . GLN A 1 39 ? 166.122 -6.762  -7.418  1.00 0.00 ? 38 GLN A HG2  7  
ATOM 9951  H HG3  . GLN A 1 39 ? 164.795 -6.432  -8.530  1.00 0.00 ? 38 GLN A HG3  7  
ATOM 9952  H HE21 . GLN A 1 39 ? 166.941 -4.501  -6.450  1.00 0.00 ? 38 GLN A HE21 7  
ATOM 9953  H HE22 . GLN A 1 39 ? 167.375 -3.362  -7.675  1.00 0.00 ? 38 GLN A HE22 7  
ATOM 9954  N N    . PRO A 1 40 ? 163.469 -6.989  -3.771  1.00 0.00 ? 39 PRO A N    7  
ATOM 9955  C CA   . PRO A 1 40 ? 162.960 -6.776  -2.413  1.00 0.00 ? 39 PRO A CA   7  
ATOM 9956  C C    . PRO A 1 40 ? 163.182 -5.340  -1.933  1.00 0.00 ? 39 PRO A C    7  
ATOM 9957  O O    . PRO A 1 40 ? 164.256 -5.003  -1.427  1.00 0.00 ? 39 PRO A O    7  
ATOM 9958  C CB   . PRO A 1 40 ? 163.776 -7.762  -1.574  1.00 0.00 ? 39 PRO A CB   7  
ATOM 9959  C CG   . PRO A 1 40 ? 165.063 -7.910  -2.311  1.00 0.00 ? 39 PRO A CG   7  
ATOM 9960  C CD   . PRO A 1 40 ? 164.739 -7.745  -3.773  1.00 0.00 ? 39 PRO A CD   7  
ATOM 9961  H HA   . PRO A 1 40 ? 161.910 -7.020  -2.342  1.00 0.00 ? 39 PRO A HA   7  
ATOM 9962  H HB2  . PRO A 1 40 ? 163.929 -7.356  -0.584  1.00 0.00 ? 39 PRO A HB2  7  
ATOM 9963  H HB3  . PRO A 1 40 ? 163.249 -8.703  -1.506  1.00 0.00 ? 39 PRO A HB3  7  
ATOM 9964  H HG2  . PRO A 1 40 ? 165.755 -7.146  -1.993  1.00 0.00 ? 39 PRO A HG2  7  
ATOM 9965  H HG3  . PRO A 1 40 ? 165.477 -8.891  -2.129  1.00 0.00 ? 39 PRO A HG3  7  
ATOM 9966  H HD2  . PRO A 1 40 ? 165.518 -7.184  -4.268  1.00 0.00 ? 39 PRO A HD2  7  
ATOM 9967  H HD3  . PRO A 1 40 ? 164.612 -8.709  -4.242  1.00 0.00 ? 39 PRO A HD3  7  
ATOM 9968  N N    . LEU A 1 41 ? 162.164 -4.498  -2.103  1.00 0.00 ? 40 LEU A N    7  
ATOM 9969  C CA   . LEU A 1 41 ? 162.250 -3.098  -1.693  1.00 0.00 ? 40 LEU A CA   7  
ATOM 9970  C C    . LEU A 1 41 ? 161.700 -2.900  -0.280  1.00 0.00 ? 40 LEU A C    7  
ATOM 9971  O O    . LEU A 1 41 ? 160.745 -3.567  0.125   1.00 0.00 ? 40 LEU A O    7  
ATOM 9972  C CB   . LEU A 1 41 ? 161.492 -2.206  -2.681  1.00 0.00 ? 40 LEU A CB   7  
ATOM 9973  C CG   . LEU A 1 41 ? 162.237 -1.905  -3.984  1.00 0.00 ? 40 LEU A CG   7  
ATOM 9974  C CD1  . LEU A 1 41 ? 162.017 -3.013  -5.002  1.00 0.00 ? 40 LEU A CD1  7  
ATOM 9975  C CD2  . LEU A 1 41 ? 161.795 -0.566  -4.551  1.00 0.00 ? 40 LEU A CD2  7  
ATOM 9976  H H    . LEU A 1 41 ? 161.337 -4.824  -2.517  1.00 0.00 ? 40 LEU A H    7  
ATOM 9977  H HA   . LEU A 1 41 ? 163.292 -2.818  -1.700  1.00 0.00 ? 40 LEU A HA   7  
ATOM 9978  H HB2  . LEU A 1 41 ? 160.556 -2.689  -2.926  1.00 0.00 ? 40 LEU A HB2  7  
ATOM 9979  H HB3  . LEU A 1 41 ? 161.275 -1.268  -2.192  1.00 0.00 ? 40 LEU A HB3  7  
ATOM 9980  H HG   . LEU A 1 41 ? 163.296 -1.848  -3.779  1.00 0.00 ? 40 LEU A HG   7  
ATOM 9981  H HD11 . LEU A 1 41 ? 161.984 -2.589  -5.995  1.00 0.00 ? 40 LEU A HD11 7  
ATOM 9982  H HD12 . LEU A 1 41 ? 161.084 -3.515  -4.795  1.00 0.00 ? 40 LEU A HD12 7  
ATOM 9983  H HD13 . LEU A 1 41 ? 162.828 -3.723  -4.942  1.00 0.00 ? 40 LEU A HD13 7  
ATOM 9984  H HD21 . LEU A 1 41 ? 160.719 -0.492  -4.503  1.00 0.00 ? 40 LEU A HD21 7  
ATOM 9985  H HD22 . LEU A 1 41 ? 162.116 -0.487  -5.580  1.00 0.00 ? 40 LEU A HD22 7  
ATOM 9986  H HD23 . LEU A 1 41 ? 162.238 0.233   -3.974  1.00 0.00 ? 40 LEU A HD23 7  
ATOM 9987  N N    . ASP A 1 42 ? 162.310 -1.974  0.463   1.00 0.00 ? 41 ASP A N    7  
ATOM 9988  C CA   . ASP A 1 42 ? 161.890 -1.676  1.832   1.00 0.00 ? 41 ASP A CA   7  
ATOM 9989  C C    . ASP A 1 42 ? 160.867 -0.542  1.849   1.00 0.00 ? 41 ASP A C    7  
ATOM 9990  O O    . ASP A 1 42 ? 161.079 0.501   1.231   1.00 0.00 ? 41 ASP A O    7  
ATOM 9991  C CB   . ASP A 1 42 ? 163.103 -1.294  2.692   1.00 0.00 ? 41 ASP A CB   7  
ATOM 9992  C CG   . ASP A 1 42 ? 163.039 -1.859  4.106   1.00 0.00 ? 41 ASP A CG   7  
ATOM 9993  O OD1  . ASP A 1 42 ? 162.078 -2.594  4.421   1.00 0.00 ? 41 ASP A OD1  7  
ATOM 9994  O OD2  . ASP A 1 42 ? 163.953 -1.558  4.902   1.00 0.00 ? 41 ASP A OD2  7  
ATOM 9995  H H    . ASP A 1 42 ? 163.064 -1.475  0.079   1.00 0.00 ? 41 ASP A H    7  
ATOM 9996  H HA   . ASP A 1 42 ? 161.436 -2.566  2.240   1.00 0.00 ? 41 ASP A HA   7  
ATOM 9997  H HB2  . ASP A 1 42 ? 163.999 -1.665  2.220   1.00 0.00 ? 41 ASP A HB2  7  
ATOM 9998  H HB3  . ASP A 1 42 ? 163.161 -0.217  2.760   1.00 0.00 ? 41 ASP A HB3  7  
ATOM 9999  N N    . LEU A 1 43 ? 159.759 -0.752  2.561   1.00 0.00 ? 42 LEU A N    7  
ATOM 10000 C CA   . LEU A 1 43 ? 158.704 0.258   2.657   1.00 0.00 ? 42 LEU A CA   7  
ATOM 10001 C C    . LEU A 1 43 ? 158.943 1.187   3.849   1.00 0.00 ? 42 LEU A C    7  
ATOM 10002 O O    . LEU A 1 43 ? 158.694 0.816   4.999   1.00 0.00 ? 42 LEU A O    7  
ATOM 10003 C CB   . LEU A 1 43 ? 157.331 -0.414  2.778   1.00 0.00 ? 42 LEU A CB   7  
ATOM 10004 C CG   . LEU A 1 43 ? 156.830 -1.112  1.508   1.00 0.00 ? 42 LEU A CG   7  
ATOM 10005 C CD1  . LEU A 1 43 ? 157.135 -2.603  1.560   1.00 0.00 ? 42 LEU A CD1  7  
ATOM 10006 C CD2  . LEU A 1 43 ? 155.337 -0.876  1.322   1.00 0.00 ? 42 LEU A CD2  7  
ATOM 10007 H H    . LEU A 1 43 ? 159.647 -1.605  3.032   1.00 0.00 ? 42 LEU A H    7  
ATOM 10008 H HA   . LEU A 1 43 ? 158.727 0.845   1.750   1.00 0.00 ? 42 LEU A HA   7  
ATOM 10009 H HB2  . LEU A 1 43 ? 157.382 -1.146  3.571   1.00 0.00 ? 42 LEU A HB2  7  
ATOM 10010 H HB3  . LEU A 1 43 ? 156.610 0.340   3.055   1.00 0.00 ? 42 LEU A HB3  7  
ATOM 10011 H HG   . LEU A 1 43 ? 157.343 -0.698  0.652   1.00 0.00 ? 42 LEU A HG   7  
ATOM 10012 H HD11 . LEU A 1 43 ? 156.264 -3.138  1.909   1.00 0.00 ? 42 LEU A HD11 7  
ATOM 10013 H HD12 . LEU A 1 43 ? 157.960 -2.780  2.234   1.00 0.00 ? 42 LEU A HD12 7  
ATOM 10014 H HD13 . LEU A 1 43 ? 157.398 -2.950  0.572   1.00 0.00 ? 42 LEU A HD13 7  
ATOM 10015 H HD21 . LEU A 1 43 ? 155.060 0.065   1.774   1.00 0.00 ? 42 LEU A HD21 7  
ATOM 10016 H HD22 . LEU A 1 43 ? 154.784 -1.676  1.791   1.00 0.00 ? 42 LEU A HD22 7  
ATOM 10017 H HD23 . LEU A 1 43 ? 155.106 -0.850  0.267   1.00 0.00 ? 42 LEU A HD23 7  
ATOM 10018 N N    . HIS A 1 44 ? 159.431 2.395   3.564   1.00 0.00 ? 43 HIS A N    7  
ATOM 10019 C CA   . HIS A 1 44 ? 159.711 3.383   4.607   1.00 0.00 ? 43 HIS A CA   7  
ATOM 10020 C C    . HIS A 1 44 ? 158.531 4.337   4.796   1.00 0.00 ? 43 HIS A C    7  
ATOM 10021 O O    . HIS A 1 44 ? 158.139 5.043   3.866   1.00 0.00 ? 43 HIS A O    7  
ATOM 10022 C CB   . HIS A 1 44 ? 160.967 4.184   4.252   1.00 0.00 ? 43 HIS A CB   7  
ATOM 10023 C CG   . HIS A 1 44 ? 162.213 3.675   4.906   1.00 0.00 ? 43 HIS A CG   7  
ATOM 10024 N ND1  . HIS A 1 44 ? 162.477 3.833   6.250   1.00 0.00 ? 43 HIS A ND1  7  
ATOM 10025 C CD2  . HIS A 1 44 ? 163.279 3.017   4.389   1.00 0.00 ? 43 HIS A CD2  7  
ATOM 10026 C CE1  . HIS A 1 44 ? 163.651 3.296   6.532   1.00 0.00 ? 43 HIS A CE1  7  
ATOM 10027 N NE2  . HIS A 1 44 ? 164.156 2.794   5.420   1.00 0.00 ? 43 HIS A NE2  7  
ATOM 10028 H H    . HIS A 1 44 ? 159.612 2.629   2.628   1.00 0.00 ? 43 HIS A H    7  
ATOM 10029 H HA   . HIS A 1 44 ? 159.883 2.852   5.531   1.00 0.00 ? 43 HIS A HA   7  
ATOM 10030 H HB2  . HIS A 1 44 ? 161.117 4.150   3.184   1.00 0.00 ? 43 HIS A HB2  7  
ATOM 10031 H HB3  . HIS A 1 44 ? 160.828 5.211   4.557   1.00 0.00 ? 43 HIS A HB3  7  
ATOM 10032 H HD1  . HIS A 1 44 ? 161.890 4.271   6.901   1.00 0.00 ? 43 HIS A HD1  7  
ATOM 10033 H HD2  . HIS A 1 44 ? 163.412 2.722   3.357   1.00 0.00 ? 43 HIS A HD2  7  
ATOM 10034 H HE1  . HIS A 1 44 ? 164.119 3.275   7.505   1.00 0.00 ? 43 HIS A HE1  7  
ATOM 10035 H HE2  . HIS A 1 44 ? 164.996 2.293   5.356   1.00 0.00 ? 43 HIS A HE2  7  
ATOM 10036 N N    . TYR A 1 45 ? 157.976 4.359   6.008   1.00 0.00 ? 44 TYR A N    7  
ATOM 10037 C CA   . TYR A 1 45 ? 156.851 5.231   6.323   1.00 0.00 ? 44 TYR A CA   7  
ATOM 10038 C C    . TYR A 1 45 ? 157.334 6.491   7.044   1.00 0.00 ? 44 TYR A C    7  
ATOM 10039 O O    . TYR A 1 45 ? 157.938 6.411   8.114   1.00 0.00 ? 44 TYR A O    7  
ATOM 10040 C CB   . TYR A 1 45 ? 155.830 4.478   7.187   1.00 0.00 ? 44 TYR A CB   7  
ATOM 10041 C CG   . TYR A 1 45 ? 154.749 5.359   7.778   1.00 0.00 ? 44 TYR A CG   7  
ATOM 10042 C CD1  . TYR A 1 45 ? 154.979 6.080   8.942   1.00 0.00 ? 44 TYR A CD1  7  
ATOM 10043 C CD2  . TYR A 1 45 ? 153.503 5.466   7.174   1.00 0.00 ? 44 TYR A CD2  7  
ATOM 10044 C CE1  . TYR A 1 45 ? 153.997 6.886   9.489   1.00 0.00 ? 44 TYR A CE1  7  
ATOM 10045 C CE2  . TYR A 1 45 ? 152.516 6.269   7.713   1.00 0.00 ? 44 TYR A CE2  7  
ATOM 10046 C CZ   . TYR A 1 45 ? 152.767 6.977   8.871   1.00 0.00 ? 44 TYR A CZ   7  
ATOM 10047 O OH   . TYR A 1 45 ? 151.787 7.780   9.410   1.00 0.00 ? 44 TYR A OH   7  
ATOM 10048 H H    . TYR A 1 45 ? 158.337 3.779   6.712   1.00 0.00 ? 44 TYR A H    7  
ATOM 10049 H HA   . TYR A 1 45 ? 156.382 5.517   5.393   1.00 0.00 ? 44 TYR A HA   7  
ATOM 10050 H HB2  . TYR A 1 45 ? 155.347 3.724   6.583   1.00 0.00 ? 44 TYR A HB2  7  
ATOM 10051 H HB3  . TYR A 1 45 ? 156.349 3.995   8.003   1.00 0.00 ? 44 TYR A HB3  7  
ATOM 10052 H HD1  . TYR A 1 45 ? 155.945 6.004   9.421   1.00 0.00 ? 44 TYR A HD1  7  
ATOM 10053 H HD2  . TYR A 1 45 ? 153.310 4.909   6.270   1.00 0.00 ? 44 TYR A HD2  7  
ATOM 10054 H HE1  . TYR A 1 45 ? 154.196 7.440   10.394  1.00 0.00 ? 44 TYR A HE1  7  
ATOM 10055 H HE2  . TYR A 1 45 ? 151.553 6.340   7.229   1.00 0.00 ? 44 TYR A HE2  7  
ATOM 10056 H HH   . TYR A 1 45 ? 151.102 7.234   9.802   1.00 0.00 ? 44 TYR A HH   7  
ATOM 10057 N N    . MET A 1 46 ? 157.063 7.652   6.450   1.00 0.00 ? 45 MET A N    7  
ATOM 10058 C CA   . MET A 1 46 ? 157.467 8.930   7.034   1.00 0.00 ? 45 MET A CA   7  
ATOM 10059 C C    . MET A 1 46 ? 156.243 9.778   7.375   1.00 0.00 ? 45 MET A C    7  
ATOM 10060 O O    . MET A 1 46 ? 155.362 9.972   6.536   1.00 0.00 ? 45 MET A O    7  
ATOM 10061 C CB   . MET A 1 46 ? 158.378 9.693   6.068   1.00 0.00 ? 45 MET A CB   7  
ATOM 10062 C CG   . MET A 1 46 ? 159.695 8.987   5.780   1.00 0.00 ? 45 MET A CG   7  
ATOM 10063 S SD   . MET A 1 46 ? 161.127 9.939   6.326   1.00 0.00 ? 45 MET A SD   7  
ATOM 10064 C CE   . MET A 1 46 ? 161.922 10.293  4.760   1.00 0.00 ? 45 MET A CE   7  
ATOM 10065 H H    . MET A 1 46 ? 156.577 7.651   5.598   1.00 0.00 ? 45 MET A H    7  
ATOM 10066 H HA   . MET A 1 46 ? 158.012 8.724   7.944   1.00 0.00 ? 45 MET A HA   7  
ATOM 10067 H HB2  . MET A 1 46 ? 157.856 9.829   5.132   1.00 0.00 ? 45 MET A HB2  7  
ATOM 10068 H HB3  . MET A 1 46 ? 158.599 10.662  6.490   1.00 0.00 ? 45 MET A HB3  7  
ATOM 10069 H HG2  . MET A 1 46 ? 159.698 8.035   6.290   1.00 0.00 ? 45 MET A HG2  7  
ATOM 10070 H HG3  . MET A 1 46 ? 159.774 8.823   4.715   1.00 0.00 ? 45 MET A HG3  7  
ATOM 10071 H HE1  . MET A 1 46 ? 161.611 9.565   4.025   1.00 0.00 ? 45 MET A HE1  7  
ATOM 10072 H HE2  . MET A 1 46 ? 162.994 10.245  4.883   1.00 0.00 ? 45 MET A HE2  7  
ATOM 10073 H HE3  . MET A 1 46 ? 161.641 11.282  4.429   1.00 0.00 ? 45 MET A HE3  7  
ATOM 10074 N N    . ASN A 1 47 ? 156.197 10.285  8.608   1.00 0.00 ? 46 ASN A N    7  
ATOM 10075 C CA   . ASN A 1 47 ? 155.078 11.116  9.051   1.00 0.00 ? 46 ASN A CA   7  
ATOM 10076 C C    . ASN A 1 47 ? 155.356 12.591  8.771   1.00 0.00 ? 46 ASN A C    7  
ATOM 10077 O O    . ASN A 1 47 ? 154.531 13.286  8.177   1.00 0.00 ? 46 ASN A O    7  
ATOM 10078 C CB   . ASN A 1 47 ? 154.815 10.906  10.546  1.00 0.00 ? 46 ASN A CB   7  
ATOM 10079 C CG   . ASN A 1 47 ? 153.346 11.052  10.905  1.00 0.00 ? 46 ASN A CG   7  
ATOM 10080 O OD1  . ASN A 1 47 ? 152.583 11.706  10.194  1.00 0.00 ? 46 ASN A OD1  7  
ATOM 10081 N ND2  . ASN A 1 47 ? 152.942 10.447  12.017  1.00 0.00 ? 46 ASN A ND2  7  
ATOM 10082 H H    . ASN A 1 47 ? 156.932 10.099  9.231   1.00 0.00 ? 46 ASN A H    7  
ATOM 10083 H HA   . ASN A 1 47 ? 154.202 10.816  8.495   1.00 0.00 ? 46 ASN A HA   7  
ATOM 10084 H HB2  . ASN A 1 47 ? 155.136 9.913   10.824  1.00 0.00 ? 46 ASN A HB2  7  
ATOM 10085 H HB3  . ASN A 1 47 ? 155.381 11.633  11.110  1.00 0.00 ? 46 ASN A HB3  7  
ATOM 10086 H HD21 . ASN A 1 47 ? 153.602 9.944   12.540  1.00 0.00 ? 46 ASN A HD21 7  
ATOM 10087 H HD22 . ASN A 1 47 ? 152.000 10.529  12.271  1.00 0.00 ? 46 ASN A HD22 7  
ATOM 10088 N N    . ASN A 1 48 ? 156.529 13.056  9.200   1.00 0.00 ? 47 ASN A N    7  
ATOM 10089 C CA   . ASN A 1 48 ? 156.937 14.443  8.997   1.00 0.00 ? 47 ASN A CA   7  
ATOM 10090 C C    . ASN A 1 48 ? 158.395 14.637  9.412   1.00 0.00 ? 47 ASN A C    7  
ATOM 10091 O O    . ASN A 1 48 ? 159.249 14.953  8.583   1.00 0.00 ? 47 ASN A O    7  
ATOM 10092 C CB   . ASN A 1 48 ? 156.032 15.398  9.785   1.00 0.00 ? 47 ASN A CB   7  
ATOM 10093 C CG   . ASN A 1 48 ? 156.250 16.848  9.397   1.00 0.00 ? 47 ASN A CG   7  
ATOM 10094 O OD1  . ASN A 1 48 ? 155.673 17.336  8.426   1.00 0.00 ? 47 ASN A OD1  7  
ATOM 10095 N ND2  . ASN A 1 48 ? 157.088 17.546  10.156  1.00 0.00 ? 47 ASN A ND2  7  
ATOM 10096 H H    . ASN A 1 48 ? 157.140 12.445  9.663   1.00 0.00 ? 47 ASN A H    7  
ATOM 10097 H HA   . ASN A 1 48 ? 156.846 14.662  7.943   1.00 0.00 ? 47 ASN A HA   7  
ATOM 10098 H HB2  . ASN A 1 48 ? 155.000 15.146  9.594   1.00 0.00 ? 47 ASN A HB2  7  
ATOM 10099 H HB3  . ASN A 1 48 ? 156.235 15.290  10.840  1.00 0.00 ? 47 ASN A HB3  7  
ATOM 10100 H HD21 . ASN A 1 48 ? 157.514 17.094  10.914  1.00 0.00 ? 47 ASN A HD21 7  
ATOM 10101 H HD22 . ASN A 1 48 ? 157.250 18.484  9.923   1.00 0.00 ? 47 ASN A HD22 7  
ATOM 10102 N N    . GLU A 1 49 ? 158.669 14.436  10.701  1.00 0.00 ? 48 GLU A N    7  
ATOM 10103 C CA   . GLU A 1 49 ? 160.020 14.577  11.236  1.00 0.00 ? 48 GLU A CA   7  
ATOM 10104 C C    . GLU A 1 49 ? 160.616 13.217  11.615  1.00 0.00 ? 48 GLU A C    7  
ATOM 10105 O O    . GLU A 1 49 ? 161.837 13.049  11.617  1.00 0.00 ? 48 GLU A O    7  
ATOM 10106 C CB   . GLU A 1 49 ? 160.012 15.498  12.460  1.00 0.00 ? 48 GLU A CB   7  
ATOM 10107 C CG   . GLU A 1 49 ? 160.331 16.949  12.135  1.00 0.00 ? 48 GLU A CG   7  
ATOM 10108 C CD   . GLU A 1 49 ? 160.767 17.741  13.354  1.00 0.00 ? 48 GLU A CD   7  
ATOM 10109 O OE1  . GLU A 1 49 ? 160.060 17.689  14.383  1.00 0.00 ? 48 GLU A OE1  7  
ATOM 10110 O OE2  . GLU A 1 49 ? 161.816 18.416  13.279  1.00 0.00 ? 48 GLU A OE2  7  
ATOM 10111 H H    . GLU A 1 49 ? 157.942 14.182  11.307  1.00 0.00 ? 48 GLU A H    7  
ATOM 10112 H HA   . GLU A 1 49 ? 160.636 15.022  10.469  1.00 0.00 ? 48 GLU A HA   7  
ATOM 10113 H HB2  . GLU A 1 49 ? 159.035 15.460  12.917  1.00 0.00 ? 48 GLU A HB2  7  
ATOM 10114 H HB3  . GLU A 1 49 ? 160.745 15.141  13.169  1.00 0.00 ? 48 GLU A HB3  7  
ATOM 10115 H HG2  . GLU A 1 49 ? 161.127 16.975  11.406  1.00 0.00 ? 48 GLU A HG2  7  
ATOM 10116 H HG3  . GLU A 1 49 ? 159.449 17.413  11.720  1.00 0.00 ? 48 GLU A HG3  7  
ATOM 10117 N N    . LEU A 1 50 ? 159.752 12.251  11.942  1.00 0.00 ? 49 LEU A N    7  
ATOM 10118 C CA   . LEU A 1 50 ? 160.204 10.916  12.327  1.00 0.00 ? 49 LEU A CA   7  
ATOM 10119 C C    . LEU A 1 50 ? 159.966 9.906   11.207  1.00 0.00 ? 49 LEU A C    7  
ATOM 10120 O O    . LEU A 1 50 ? 158.920 9.924   10.553  1.00 0.00 ? 49 LEU A O    7  
ATOM 10121 C CB   . LEU A 1 50 ? 159.485 10.459  13.601  1.00 0.00 ? 49 LEU A CB   7  
ATOM 10122 C CG   . LEU A 1 50 ? 160.294 9.524   14.505  1.00 0.00 ? 49 LEU A CG   7  
ATOM 10123 C CD1  . LEU A 1 50 ? 160.003 9.813   15.971  1.00 0.00 ? 49 LEU A CD1  7  
ATOM 10124 C CD2  . LEU A 1 50 ? 159.993 8.068   14.175  1.00 0.00 ? 49 LEU A CD2  7  
ATOM 10125 H H    . LEU A 1 50 ? 158.791 12.439  11.927  1.00 0.00 ? 49 LEU A H    7  
ATOM 10126 H HA   . LEU A 1 50 ? 161.263 10.971  12.525  1.00 0.00 ? 49 LEU A HA   7  
ATOM 10127 H HB2  . LEU A 1 50 ? 159.220 11.337  14.172  1.00 0.00 ? 49 LEU A HB2  7  
ATOM 10128 H HB3  . LEU A 1 50 ? 158.577 9.950   13.315  1.00 0.00 ? 49 LEU A HB3  7  
ATOM 10129 H HG   . LEU A 1 50 ? 161.348 9.694   14.336  1.00 0.00 ? 49 LEU A HG   7  
ATOM 10130 H HD11 . LEU A 1 50 ? 159.148 9.234   16.290  1.00 0.00 ? 49 LEU A HD11 7  
ATOM 10131 H HD12 . LEU A 1 50 ? 159.791 10.865  16.094  1.00 0.00 ? 49 LEU A HD12 7  
ATOM 10132 H HD13 . LEU A 1 50 ? 160.862 9.546   16.568  1.00 0.00 ? 49 LEU A HD13 7  
ATOM 10133 H HD21 . LEU A 1 50 ? 158.951 7.861   14.372  1.00 0.00 ? 49 LEU A HD21 7  
ATOM 10134 H HD22 . LEU A 1 50 ? 160.608 7.425   14.787  1.00 0.00 ? 49 LEU A HD22 7  
ATOM 10135 H HD23 . LEU A 1 50 ? 160.206 7.883   13.133  1.00 0.00 ? 49 LEU A HD23 7  
ATOM 10136 N N    . SER A 1 51 ? 160.943 9.023   11.000  1.00 0.00 ? 50 SER A N    7  
ATOM 10137 C CA   . SER A 1 51 ? 160.848 7.995   9.967   1.00 0.00 ? 50 SER A CA   7  
ATOM 10138 C C    . SER A 1 51 ? 160.694 6.610   10.590  1.00 0.00 ? 50 SER A C    7  
ATOM 10139 O O    . SER A 1 51 ? 161.465 6.228   11.473  1.00 0.00 ? 50 SER A O    7  
ATOM 10140 C CB   . SER A 1 51 ? 162.088 8.022   9.068   1.00 0.00 ? 50 SER A CB   7  
ATOM 10141 O OG   . SER A 1 51 ? 161.899 7.221   7.915   1.00 0.00 ? 50 SER A OG   7  
ATOM 10142 H H    . SER A 1 51 ? 161.746 9.061   11.560  1.00 0.00 ? 50 SER A H    7  
ATOM 10143 H HA   . SER A 1 51 ? 159.975 8.207   9.368   1.00 0.00 ? 50 SER A HA   7  
ATOM 10144 H HB2  . SER A 1 51 ? 162.285 9.038   8.758   1.00 0.00 ? 50 SER A HB2  7  
ATOM 10145 H HB3  . SER A 1 51 ? 162.937 7.643   9.619   1.00 0.00 ? 50 SER A HB3  7  
ATOM 10146 H HG   . SER A 1 51 ? 162.059 6.300   8.134   1.00 0.00 ? 50 SER A HG   7  
ATOM 10147 N N    . ILE A 1 52 ? 159.696 5.863   10.122  1.00 0.00 ? 51 ILE A N    7  
ATOM 10148 C CA   . ILE A 1 52 ? 159.439 4.517   10.626  1.00 0.00 ? 51 ILE A CA   7  
ATOM 10149 C C    . ILE A 1 52 ? 159.545 3.486   9.501   1.00 0.00 ? 51 ILE A C    7  
ATOM 10150 O O    . ILE A 1 52 ? 159.005 3.685   8.412   1.00 0.00 ? 51 ILE A O    7  
ATOM 10151 C CB   . ILE A 1 52 ? 158.043 4.415   11.283  1.00 0.00 ? 51 ILE A CB   7  
ATOM 10152 C CG1  . ILE A 1 52 ? 157.842 5.544   12.303  1.00 0.00 ? 51 ILE A CG1  7  
ATOM 10153 C CG2  . ILE A 1 52 ? 157.864 3.057   11.951  1.00 0.00 ? 51 ILE A CG2  7  
ATOM 10154 C CD1  . ILE A 1 52 ? 156.428 6.085   12.340  1.00 0.00 ? 51 ILE A CD1  7  
ATOM 10155 H H    . ILE A 1 52 ? 159.119 6.224   9.415   1.00 0.00 ? 51 ILE A H    7  
ATOM 10156 H HA   . ILE A 1 52 ? 160.184 4.294   11.376  1.00 0.00 ? 51 ILE A HA   7  
ATOM 10157 H HB   . ILE A 1 52 ? 157.299 4.505   10.506  1.00 0.00 ? 51 ILE A HB   7  
ATOM 10158 H HG12 . ILE A 1 52 ? 158.078 5.175   13.289  1.00 0.00 ? 51 ILE A HG12 7  
ATOM 10159 H HG13 . ILE A 1 52 ? 158.504 6.362   12.062  1.00 0.00 ? 51 ILE A HG13 7  
ATOM 10160 H HG21 . ILE A 1 52 ? 158.528 2.338   11.494  1.00 0.00 ? 51 ILE A HG21 7  
ATOM 10161 H HG22 . ILE A 1 52 ? 156.842 2.729   11.830  1.00 0.00 ? 51 ILE A HG22 7  
ATOM 10162 H HG23 . ILE A 1 52 ? 158.093 3.140   13.003  1.00 0.00 ? 51 ILE A HG23 7  
ATOM 10163 H HD11 . ILE A 1 52 ? 156.244 6.672   11.452  1.00 0.00 ? 51 ILE A HD11 7  
ATOM 10164 H HD12 . ILE A 1 52 ? 156.304 6.707   13.214  1.00 0.00 ? 51 ILE A HD12 7  
ATOM 10165 H HD13 . ILE A 1 52 ? 155.729 5.264   12.380  1.00 0.00 ? 51 ILE A HD13 7  
ATOM 10166 N N    . LEU A 1 53 ? 160.243 2.386   9.775   1.00 0.00 ? 52 LEU A N    7  
ATOM 10167 C CA   . LEU A 1 53 ? 160.422 1.321   8.790   1.00 0.00 ? 52 LEU A CA   7  
ATOM 10168 C C    . LEU A 1 53 ? 159.439 0.178   9.046   1.00 0.00 ? 52 LEU A C    7  
ATOM 10169 O O    . LEU A 1 53 ? 159.253 -0.246  10.187  1.00 0.00 ? 52 LEU A O    7  
ATOM 10170 C CB   . LEU A 1 53 ? 161.863 0.798   8.832   1.00 0.00 ? 52 LEU A CB   7  
ATOM 10171 C CG   . LEU A 1 53 ? 162.366 0.158   7.534   1.00 0.00 ? 52 LEU A CG   7  
ATOM 10172 C CD1  . LEU A 1 53 ? 163.884 0.242   7.449   1.00 0.00 ? 52 LEU A CD1  7  
ATOM 10173 C CD2  . LEU A 1 53 ? 161.906 -1.290  7.436   1.00 0.00 ? 52 LEU A CD2  7  
ATOM 10174 H H    . LEU A 1 53 ? 160.647 2.285   10.662  1.00 0.00 ? 52 LEU A H    7  
ATOM 10175 H HA   . LEU A 1 53 ? 160.227 1.736   7.812   1.00 0.00 ? 52 LEU A HA   7  
ATOM 10176 H HB2  . LEU A 1 53 ? 162.513 1.626   9.075   1.00 0.00 ? 52 LEU A HB2  7  
ATOM 10177 H HB3  . LEU A 1 53 ? 161.934 0.064   9.621   1.00 0.00 ? 52 LEU A HB3  7  
ATOM 10178 H HG   . LEU A 1 53 ? 161.957 0.697   6.693   1.00 0.00 ? 52 LEU A HG   7  
ATOM 10179 H HD11 . LEU A 1 53 ? 164.175 0.451   6.430   1.00 0.00 ? 52 LEU A HD11 7  
ATOM 10180 H HD12 . LEU A 1 53 ? 164.315 -0.697  7.760   1.00 0.00 ? 52 LEU A HD12 7  
ATOM 10181 H HD13 . LEU A 1 53 ? 164.239 1.033   8.094   1.00 0.00 ? 52 LEU A HD13 7  
ATOM 10182 H HD21 . LEU A 1 53 ? 161.543 -1.484  6.438   1.00 0.00 ? 52 LEU A HD21 7  
ATOM 10183 H HD22 . LEU A 1 53 ? 161.113 -1.467  8.147   1.00 0.00 ? 52 LEU A HD22 7  
ATOM 10184 H HD23 . LEU A 1 53 ? 162.735 -1.947  7.651   1.00 0.00 ? 52 LEU A HD23 7  
ATOM 10185 N N    . LEU A 1 54 ? 158.811 -0.312  7.976   1.00 0.00 ? 53 LEU A N    7  
ATOM 10186 C CA   . LEU A 1 54 ? 157.844 -1.404  8.084   1.00 0.00 ? 53 LEU A CA   7  
ATOM 10187 C C    . LEU A 1 54 ? 158.546 -2.737  8.342   1.00 0.00 ? 53 LEU A C    7  
ATOM 10188 O O    . LEU A 1 54 ? 158.851 -3.485  7.411   1.00 0.00 ? 53 LEU A O    7  
ATOM 10189 C CB   . LEU A 1 54 ? 156.993 -1.490  6.811   1.00 0.00 ? 53 LEU A CB   7  
ATOM 10190 C CG   . LEU A 1 54 ? 155.716 -0.646  6.829   1.00 0.00 ? 53 LEU A CG   7  
ATOM 10191 C CD1  . LEU A 1 54 ? 155.168 -0.471  5.419   1.00 0.00 ? 53 LEU A CD1  7  
ATOM 10192 C CD2  . LEU A 1 54 ? 154.673 -1.281  7.734   1.00 0.00 ? 53 LEU A CD2  7  
ATOM 10193 H H    . LEU A 1 54 ? 159.003 0.069   7.093   1.00 0.00 ? 53 LEU A H    7  
ATOM 10194 H HA   . LEU A 1 54 ? 157.197 -1.187  8.922   1.00 0.00 ? 53 LEU A HA   7  
ATOM 10195 H HB2  . LEU A 1 54 ? 157.600 -1.172  5.976   1.00 0.00 ? 53 LEU A HB2  7  
ATOM 10196 H HB3  . LEU A 1 54 ? 156.714 -2.521  6.659   1.00 0.00 ? 53 LEU A HB3  7  
ATOM 10197 H HG   . LEU A 1 54 ? 155.946 0.334   7.220   1.00 0.00 ? 53 LEU A HG   7  
ATOM 10198 H HD11 . LEU A 1 54 ? 155.469 -1.309  4.807   1.00 0.00 ? 53 LEU A HD11 7  
ATOM 10199 H HD12 . LEU A 1 54 ? 155.555 0.443   4.994   1.00 0.00 ? 53 LEU A HD12 7  
ATOM 10200 H HD13 . LEU A 1 54 ? 154.089 -0.422  5.455   1.00 0.00 ? 53 LEU A HD13 7  
ATOM 10201 H HD21 . LEU A 1 54 ? 154.723 -2.356  7.645   1.00 0.00 ? 53 LEU A HD21 7  
ATOM 10202 H HD22 . LEU A 1 54 ? 153.689 -0.942  7.443   1.00 0.00 ? 53 LEU A HD22 7  
ATOM 10203 H HD23 . LEU A 1 54 ? 154.862 -0.995  8.758   1.00 0.00 ? 53 LEU A HD23 7  
ATOM 10204 N N    . LYS A 1 55 ? 158.799 -3.023  9.618   1.00 0.00 ? 54 LYS A N    7  
ATOM 10205 C CA   . LYS A 1 55 ? 159.464 -4.259  10.018  1.00 0.00 ? 54 LYS A CA   7  
ATOM 10206 C C    . LYS A 1 55 ? 158.482 -5.431  10.050  1.00 0.00 ? 54 LYS A C    7  
ATOM 10207 O O    . LYS A 1 55 ? 158.840 -6.559  9.706   1.00 0.00 ? 54 LYS A O    7  
ATOM 10208 C CB   . LYS A 1 55 ? 160.115 -4.078  11.392  1.00 0.00 ? 54 LYS A CB   7  
ATOM 10209 C CG   . LYS A 1 55 ? 160.964 -5.259  11.834  1.00 0.00 ? 54 LYS A CG   7  
ATOM 10210 C CD   . LYS A 1 55 ? 162.287 -5.314  11.084  1.00 0.00 ? 54 LYS A CD   7  
ATOM 10211 C CE   . LYS A 1 55 ? 163.349 -6.066  11.875  1.00 0.00 ? 54 LYS A CE   7  
ATOM 10212 N NZ   . LYS A 1 55 ? 163.565 -7.449  11.358  1.00 0.00 ? 54 LYS A NZ   7  
ATOM 10213 H H    . LYS A 1 55 ? 158.530 -2.384  10.312  1.00 0.00 ? 54 LYS A H    7  
ATOM 10214 H HA   . LYS A 1 55 ? 160.232 -4.470  9.292   1.00 0.00 ? 54 LYS A HA   7  
ATOM 10215 H HB2  . LYS A 1 55 ? 160.743 -3.201  11.365  1.00 0.00 ? 54 LYS A HB2  7  
ATOM 10216 H HB3  . LYS A 1 55 ? 159.336 -3.928  12.126  1.00 0.00 ? 54 LYS A HB3  7  
ATOM 10217 H HG2  . LYS A 1 55 ? 161.165 -5.165  12.891  1.00 0.00 ? 54 LYS A HG2  7  
ATOM 10218 H HG3  . LYS A 1 55 ? 160.417 -6.172  11.650  1.00 0.00 ? 54 LYS A HG3  7  
ATOM 10219 H HD2  . LYS A 1 55 ? 162.134 -5.813  10.139  1.00 0.00 ? 54 LYS A HD2  7  
ATOM 10220 H HD3  . LYS A 1 55 ? 162.631 -4.305  10.907  1.00 0.00 ? 54 LYS A HD3  7  
ATOM 10221 H HE2  . LYS A 1 55 ? 164.278 -5.521  11.813  1.00 0.00 ? 54 LYS A HE2  7  
ATOM 10222 H HE3  . LYS A 1 55 ? 163.036 -6.123  12.908  1.00 0.00 ? 54 LYS A HE3  7  
ATOM 10223 H HZ1  . LYS A 1 55 ? 163.681 -8.113  12.151  1.00 0.00 ? 54 LYS A HZ1  7  
ATOM 10224 H HZ2  . LYS A 1 55 ? 164.420 -7.481  10.768  1.00 0.00 ? 54 LYS A HZ2  7  
ATOM 10225 H HZ3  . LYS A 1 55 ? 162.751 -7.751  10.784  1.00 0.00 ? 54 LYS A HZ3  7  
ATOM 10226 N N    . ASN A 1 56 ? 157.247 -5.158  10.471  1.00 0.00 ? 55 ASN A N    7  
ATOM 10227 C CA   . ASN A 1 56 ? 156.216 -6.192  10.553  1.00 0.00 ? 55 ASN A CA   7  
ATOM 10228 C C    . ASN A 1 56 ? 154.818 -5.595  10.387  1.00 0.00 ? 55 ASN A C    7  
ATOM 10229 O O    . ASN A 1 56 ? 154.666 -4.380  10.238  1.00 0.00 ? 55 ASN A O    7  
ATOM 10230 C CB   . ASN A 1 56 ? 156.321 -6.933  11.890  1.00 0.00 ? 55 ASN A CB   7  
ATOM 10231 C CG   . ASN A 1 56 ? 156.078 -8.421  11.743  1.00 0.00 ? 55 ASN A CG   7  
ATOM 10232 O OD1  . ASN A 1 56 ? 156.870 -9.132  11.124  1.00 0.00 ? 55 ASN A OD1  7  
ATOM 10233 N ND2  . ASN A 1 56 ? 154.977 -8.901  12.309  1.00 0.00 ? 55 ASN A ND2  7  
ATOM 10234 H H    . ASN A 1 56 ? 157.024 -4.242  10.736  1.00 0.00 ? 55 ASN A H    7  
ATOM 10235 H HA   . ASN A 1 56 ? 156.389 -6.893  9.750   1.00 0.00 ? 55 ASN A HA   7  
ATOM 10236 H HB2  . ASN A 1 56 ? 157.311 -6.788  12.299  1.00 0.00 ? 55 ASN A HB2  7  
ATOM 10237 H HB3  . ASN A 1 56 ? 155.591 -6.532  12.578  1.00 0.00 ? 55 ASN A HB3  7  
ATOM 10238 H HD21 . ASN A 1 56 ? 154.390 -8.277  12.784  1.00 0.00 ? 55 ASN A HD21 7  
ATOM 10239 H HD22 . ASN A 1 56 ? 154.797 -9.860  12.227  1.00 0.00 ? 55 ASN A HD22 7  
ATOM 10240 N N    . GLN A 1 57 ? 153.798 -6.458  10.415  1.00 0.00 ? 56 GLN A N    7  
ATOM 10241 C CA   . GLN A 1 57 ? 152.411 -6.015  10.270  1.00 0.00 ? 56 GLN A CA   7  
ATOM 10242 C C    . GLN A 1 57 ? 152.041 -5.004  11.353  1.00 0.00 ? 56 GLN A C    7  
ATOM 10243 O O    . GLN A 1 57 ? 151.248 -4.094  11.112  1.00 0.00 ? 56 GLN A O    7  
ATOM 10244 C CB   . GLN A 1 57 ? 151.453 -7.210  10.321  1.00 0.00 ? 56 GLN A CB   7  
ATOM 10245 C CG   . GLN A 1 57 ? 151.394 -7.996  9.019   1.00 0.00 ? 56 GLN A CG   7  
ATOM 10246 C CD   . GLN A 1 57 ? 150.073 -8.717  8.820   1.00 0.00 ? 56 GLN A CD   7  
ATOM 10247 O OE1  . GLN A 1 57 ? 150.037 -9.939  8.670   1.00 0.00 ? 56 GLN A OE1  7  
ATOM 10248 N NE2  . GLN A 1 57 ? 148.977 -7.964  8.812   1.00 0.00 ? 56 GLN A NE2  7  
ATOM 10249 H H    . GLN A 1 57 ? 153.984 -7.413  10.536  1.00 0.00 ? 56 GLN A H    7  
ATOM 10250 H HA   . GLN A 1 57 ? 152.321 -5.536  9.306   1.00 0.00 ? 56 GLN A HA   7  
ATOM 10251 H HB2  . GLN A 1 57 ? 151.769 -7.878  11.108  1.00 0.00 ? 56 GLN A HB2  7  
ATOM 10252 H HB3  . GLN A 1 57 ? 150.460 -6.848  10.544  1.00 0.00 ? 56 GLN A HB3  7  
ATOM 10253 H HG2  . GLN A 1 57 ? 151.538 -7.312  8.195   1.00 0.00 ? 56 GLN A HG2  7  
ATOM 10254 H HG3  . GLN A 1 57 ? 152.190 -8.727  9.020   1.00 0.00 ? 56 GLN A HG3  7  
ATOM 10255 H HE21 . GLN A 1 57 ? 149.077 -6.997  8.932   1.00 0.00 ? 56 GLN A HE21 7  
ATOM 10256 H HE22 . GLN A 1 57 ? 148.112 -8.408  8.682   1.00 0.00 ? 56 GLN A HE22 7  
ATOM 10257 N N    . ASP A 1 58 ? 152.625 -5.163  12.544  1.00 0.00 ? 57 ASP A N    7  
ATOM 10258 C CA   . ASP A 1 58 ? 152.357 -4.253  13.657  1.00 0.00 ? 57 ASP A CA   7  
ATOM 10259 C C    . ASP A 1 58 ? 152.622 -2.804  13.251  1.00 0.00 ? 57 ASP A C    7  
ATOM 10260 O O    . ASP A 1 58 ? 151.835 -1.909  13.564  1.00 0.00 ? 57 ASP A O    7  
ATOM 10261 C CB   . ASP A 1 58 ? 153.219 -4.617  14.869  1.00 0.00 ? 57 ASP A CB   7  
ATOM 10262 C CG   . ASP A 1 58 ? 152.522 -5.582  15.808  1.00 0.00 ? 57 ASP A CG   7  
ATOM 10263 O OD1  . ASP A 1 58 ? 152.250 -6.727  15.389  1.00 0.00 ? 57 ASP A OD1  7  
ATOM 10264 O OD2  . ASP A 1 58 ? 152.251 -5.193  16.964  1.00 0.00 ? 57 ASP A OD2  7  
ATOM 10265 H H    . ASP A 1 58 ? 153.251 -5.905  12.675  1.00 0.00 ? 57 ASP A H    7  
ATOM 10266 H HA   . ASP A 1 58 ? 151.315 -4.355  13.924  1.00 0.00 ? 57 ASP A HA   7  
ATOM 10267 H HB2  . ASP A 1 58 ? 154.136 -5.076  14.528  1.00 0.00 ? 57 ASP A HB2  7  
ATOM 10268 H HB3  . ASP A 1 58 ? 153.455 -3.717  15.417  1.00 0.00 ? 57 ASP A HB3  7  
ATOM 10269 N N    . ASP A 1 59 ? 153.732 -2.582  12.548  1.00 0.00 ? 58 ASP A N    7  
ATOM 10270 C CA   . ASP A 1 59 ? 154.101 -1.245  12.092  1.00 0.00 ? 58 ASP A CA   7  
ATOM 10271 C C    . ASP A 1 59 ? 153.115 -0.743  11.040  1.00 0.00 ? 58 ASP A C    7  
ATOM 10272 O O    . ASP A 1 59 ? 152.731 0.427   11.044  1.00 0.00 ? 58 ASP A O    7  
ATOM 10273 C CB   . ASP A 1 59 ? 155.524 -1.248  11.519  1.00 0.00 ? 58 ASP A CB   7  
ATOM 10274 C CG   . ASP A 1 59 ? 156.584 -1.459  12.585  1.00 0.00 ? 58 ASP A CG   7  
ATOM 10275 O OD1  . ASP A 1 59 ? 156.615 -2.554  13.185  1.00 0.00 ? 58 ASP A OD1  7  
ATOM 10276 O OD2  . ASP A 1 59 ? 157.387 -0.530  12.814  1.00 0.00 ? 58 ASP A OD2  7  
ATOM 10277 H H    . ASP A 1 59 ? 154.316 -3.340  12.328  1.00 0.00 ? 58 ASP A H    7  
ATOM 10278 H HA   . ASP A 1 59 ? 154.063 -0.584  12.943  1.00 0.00 ? 58 ASP A HA   7  
ATOM 10279 H HB2  . ASP A 1 59 ? 155.610 -2.044  10.794  1.00 0.00 ? 58 ASP A HB2  7  
ATOM 10280 H HB3  . ASP A 1 59 ? 155.710 -0.302  11.032  1.00 0.00 ? 58 ASP A HB3  7  
ATOM 10281 N N    . LEU A 1 60 ? 152.705 -1.637  10.143  1.00 0.00 ? 59 LEU A N    7  
ATOM 10282 C CA   . LEU A 1 60 ? 151.758 -1.288  9.088   1.00 0.00 ? 59 LEU A CA   7  
ATOM 10283 C C    . LEU A 1 60 ? 150.398 -0.905  9.672   1.00 0.00 ? 59 LEU A C    7  
ATOM 10284 O O    . LEU A 1 60 ? 149.793 0.082   9.254   1.00 0.00 ? 59 LEU A O    7  
ATOM 10285 C CB   . LEU A 1 60 ? 151.595 -2.455  8.114   1.00 0.00 ? 59 LEU A CB   7  
ATOM 10286 C CG   . LEU A 1 60 ? 150.764 -2.146  6.868   1.00 0.00 ? 59 LEU A CG   7  
ATOM 10287 C CD1  . LEU A 1 60 ? 151.637 -1.519  5.791   1.00 0.00 ? 59 LEU A CD1  7  
ATOM 10288 C CD2  . LEU A 1 60 ? 150.087 -3.409  6.355   1.00 0.00 ? 59 LEU A CD2  7  
ATOM 10289 H H    . LEU A 1 60 ? 153.044 -2.556  10.194  1.00 0.00 ? 59 LEU A H    7  
ATOM 10290 H HA   . LEU A 1 60 ? 152.158 -0.440  8.554   1.00 0.00 ? 59 LEU A HA   7  
ATOM 10291 H HB2  . LEU A 1 60 ? 152.578 -2.772  7.798   1.00 0.00 ? 59 LEU A HB2  7  
ATOM 10292 H HB3  . LEU A 1 60 ? 151.124 -3.271  8.640   1.00 0.00 ? 59 LEU A HB3  7  
ATOM 10293 H HG   . LEU A 1 60 ? 149.993 -1.433  7.126   1.00 0.00 ? 59 LEU A HG   7  
ATOM 10294 H HD11 . LEU A 1 60 ? 151.028 -1.257  4.939   1.00 0.00 ? 59 LEU A HD11 7  
ATOM 10295 H HD12 . LEU A 1 60 ? 152.397 -2.224  5.488   1.00 0.00 ? 59 LEU A HD12 7  
ATOM 10296 H HD13 . LEU A 1 60 ? 152.108 -0.630  6.183   1.00 0.00 ? 59 LEU A HD13 7  
ATOM 10297 H HD21 . LEU A 1 60 ? 149.661 -3.220  5.380   1.00 0.00 ? 59 LEU A HD21 7  
ATOM 10298 H HD22 . LEU A 1 60 ? 149.303 -3.699  7.039   1.00 0.00 ? 59 LEU A HD22 7  
ATOM 10299 H HD23 . LEU A 1 60 ? 150.813 -4.204  6.283   1.00 0.00 ? 59 LEU A HD23 7  
ATOM 10300 N N    . ASP A 1 61 ? 149.927 -1.695  10.638  1.00 0.00 ? 60 ASP A N    7  
ATOM 10301 C CA   . ASP A 1 61 ? 148.636 -1.444  11.282  1.00 0.00 ? 60 ASP A CA   7  
ATOM 10302 C C    . ASP A 1 61 ? 148.642 -0.112  12.026  1.00 0.00 ? 60 ASP A C    7  
ATOM 10303 O O    . ASP A 1 61 ? 147.647 0.617   12.019  1.00 0.00 ? 60 ASP A O    7  
ATOM 10304 C CB   . ASP A 1 61 ? 148.293 -2.574  12.254  1.00 0.00 ? 60 ASP A CB   7  
ATOM 10305 C CG   . ASP A 1 61 ? 147.245 -3.516  11.698  1.00 0.00 ? 60 ASP A CG   7  
ATOM 10306 O OD1  . ASP A 1 61 ? 146.043 -3.186  11.783  1.00 0.00 ? 60 ASP A OD1  7  
ATOM 10307 O OD2  . ASP A 1 61 ? 147.627 -4.585  11.173  1.00 0.00 ? 60 ASP A OD2  7  
ATOM 10308 H H    . ASP A 1 61 ? 150.461 -2.467  10.925  1.00 0.00 ? 60 ASP A H    7  
ATOM 10309 H HA   . ASP A 1 61 ? 147.883 -1.406  10.508  1.00 0.00 ? 60 ASP A HA   7  
ATOM 10310 H HB2  . ASP A 1 61 ? 149.187 -3.143  12.467  1.00 0.00 ? 60 ASP A HB2  7  
ATOM 10311 H HB3  . ASP A 1 61 ? 147.917 -2.148  13.172  1.00 0.00 ? 60 ASP A HB3  7  
ATOM 10312 N N    . LYS A 1 62 ? 149.770 0.199   12.665  1.00 0.00 ? 61 LYS A N    7  
ATOM 10313 C CA   . LYS A 1 62 ? 149.912 1.446   13.412  1.00 0.00 ? 61 LYS A CA   7  
ATOM 10314 C C    . LYS A 1 62 ? 149.791 2.648   12.475  1.00 0.00 ? 61 LYS A C    7  
ATOM 10315 O O    . LYS A 1 62 ? 149.138 3.639   12.805  1.00 0.00 ? 61 LYS A O    7  
ATOM 10316 C CB   . LYS A 1 62 ? 151.260 1.483   14.142  1.00 0.00 ? 61 LYS A CB   7  
ATOM 10317 C CG   . LYS A 1 62 ? 151.228 0.854   15.527  1.00 0.00 ? 61 LYS A CG   7  
ATOM 10318 C CD   . LYS A 1 62 ? 152.608 0.845   16.169  1.00 0.00 ? 61 LYS A CD   7  
ATOM 10319 C CE   . LYS A 1 62 ? 152.923 -0.506  16.797  1.00 0.00 ? 61 LYS A CE   7  
ATOM 10320 N NZ   . LYS A 1 62 ? 154.344 -0.605  17.239  1.00 0.00 ? 61 LYS A NZ   7  
ATOM 10321 H H    . LYS A 1 62 ? 150.527 -0.426  12.630  1.00 0.00 ? 61 LYS A H    7  
ATOM 10322 H HA   . LYS A 1 62 ? 149.115 1.490   14.140  1.00 0.00 ? 61 LYS A HA   7  
ATOM 10323 H HB2  . LYS A 1 62 ? 151.991 0.953   13.548  1.00 0.00 ? 61 LYS A HB2  7  
ATOM 10324 H HB3  . LYS A 1 62 ? 151.572 2.511   14.245  1.00 0.00 ? 61 LYS A HB3  7  
ATOM 10325 H HG2  . LYS A 1 62 ? 150.555 1.421   16.154  1.00 0.00 ? 61 LYS A HG2  7  
ATOM 10326 H HG3  . LYS A 1 62 ? 150.873 -0.163  15.442  1.00 0.00 ? 61 LYS A HG3  7  
ATOM 10327 H HD2  . LYS A 1 62 ? 153.348 1.059   15.412  1.00 0.00 ? 61 LYS A HD2  7  
ATOM 10328 H HD3  . LYS A 1 62 ? 152.644 1.606   16.936  1.00 0.00 ? 61 LYS A HD3  7  
ATOM 10329 H HE2  . LYS A 1 62 ? 152.280 -0.647  17.653  1.00 0.00 ? 61 LYS A HE2  7  
ATOM 10330 H HE3  . LYS A 1 62 ? 152.726 -1.280  16.069  1.00 0.00 ? 61 LYS A HE3  7  
ATOM 10331 H HZ1  . LYS A 1 62 ? 154.422 -0.367  18.249  1.00 0.00 ? 61 LYS A HZ1  7  
ATOM 10332 H HZ2  . LYS A 1 62 ? 154.938 0.050   16.693  1.00 0.00 ? 61 LYS A HZ2  7  
ATOM 10333 H HZ3  . LYS A 1 62 ? 154.696 -1.575  17.096  1.00 0.00 ? 61 LYS A HZ3  7  
ATOM 10334 N N    . ALA A 1 63 ? 150.417 2.543   11.300  1.00 0.00 ? 62 ALA A N    7  
ATOM 10335 C CA   . ALA A 1 63 ? 150.378 3.613   10.306  1.00 0.00 ? 62 ALA A CA   7  
ATOM 10336 C C    . ALA A 1 63 ? 148.952 3.863   9.820   1.00 0.00 ? 62 ALA A C    7  
ATOM 10337 O O    . ALA A 1 63 ? 148.518 5.010   9.722   1.00 0.00 ? 62 ALA A O    7  
ATOM 10338 C CB   . ALA A 1 63 ? 151.284 3.280   9.130   1.00 0.00 ? 62 ALA A CB   7  
ATOM 10339 H H    . ALA A 1 63 ? 150.914 1.722   11.097  1.00 0.00 ? 62 ALA A H    7  
ATOM 10340 H HA   . ALA A 1 63 ? 150.750 4.514   10.773  1.00 0.00 ? 62 ALA A HA   7  
ATOM 10341 H HB1  . ALA A 1 63 ? 152.296 3.143   9.482   1.00 0.00 ? 62 ALA A HB1  7  
ATOM 10342 H HB2  . ALA A 1 63 ? 151.257 4.090   8.416   1.00 0.00 ? 62 ALA A HB2  7  
ATOM 10343 H HB3  . ALA A 1 63 ? 150.940 2.373   8.657   1.00 0.00 ? 62 ALA A HB3  7  
ATOM 10344 N N    . ILE A 1 64 ? 148.226 2.785   9.519   1.00 0.00 ? 63 ILE A N    7  
ATOM 10345 C CA   . ILE A 1 64 ? 146.848 2.903   9.046   1.00 0.00 ? 63 ILE A CA   7  
ATOM 10346 C C    . ILE A 1 64 ? 145.944 3.491   10.128  1.00 0.00 ? 63 ILE A C    7  
ATOM 10347 O O    . ILE A 1 64 ? 145.132 4.371   9.853   1.00 0.00 ? 63 ILE A O    7  
ATOM 10348 C CB   . ILE A 1 64 ? 146.269 1.544   8.589   1.00 0.00 ? 63 ILE A CB   7  
ATOM 10349 C CG1  . ILE A 1 64 ? 147.167 0.903   7.528   1.00 0.00 ? 63 ILE A CG1  7  
ATOM 10350 C CG2  . ILE A 1 64 ? 144.856 1.728   8.048   1.00 0.00 ? 63 ILE A CG2  7  
ATOM 10351 C CD1  . ILE A 1 64 ? 147.281 1.716   6.256   1.00 0.00 ? 63 ILE A CD1  7  
ATOM 10352 H H    . ILE A 1 64 ? 148.625 1.893   9.618   1.00 0.00 ? 63 ILE A H    7  
ATOM 10353 H HA   . ILE A 1 64 ? 146.850 3.571   8.196   1.00 0.00 ? 63 ILE A HA   7  
ATOM 10354 H HB   . ILE A 1 64 ? 146.216 0.892   9.449   1.00 0.00 ? 63 ILE A HB   7  
ATOM 10355 H HG12 . ILE A 1 64 ? 148.160 0.783   7.932   1.00 0.00 ? 63 ILE A HG12 7  
ATOM 10356 H HG13 . ILE A 1 64 ? 146.770 -0.068  7.268   1.00 0.00 ? 63 ILE A HG13 7  
ATOM 10357 H HG21 . ILE A 1 64 ? 144.754 2.724   7.641   1.00 0.00 ? 63 ILE A HG21 7  
ATOM 10358 H HG22 . ILE A 1 64 ? 144.143 1.593   8.848   1.00 0.00 ? 63 ILE A HG22 7  
ATOM 10359 H HG23 . ILE A 1 64 ? 144.668 1.002   7.272   1.00 0.00 ? 63 ILE A HG23 7  
ATOM 10360 H HD11 . ILE A 1 64 ? 147.853 2.610   6.450   1.00 0.00 ? 63 ILE A HD11 7  
ATOM 10361 H HD12 . ILE A 1 64 ? 146.294 1.988   5.912   1.00 0.00 ? 63 ILE A HD12 7  
ATOM 10362 H HD13 . ILE A 1 64 ? 147.777 1.130   5.497   1.00 0.00 ? 63 ILE A HD13 7  
ATOM 10363 N N    . ASP A 1 65 ? 146.090 2.995   11.358  1.00 0.00 ? 64 ASP A N    7  
ATOM 10364 C CA   . ASP A 1 65 ? 145.282 3.469   12.482  1.00 0.00 ? 64 ASP A CA   7  
ATOM 10365 C C    . ASP A 1 65 ? 145.443 4.975   12.688  1.00 0.00 ? 64 ASP A C    7  
ATOM 10366 O O    . ASP A 1 65 ? 144.457 5.691   12.873  1.00 0.00 ? 64 ASP A O    7  
ATOM 10367 C CB   . ASP A 1 65 ? 145.660 2.720   13.766  1.00 0.00 ? 64 ASP A CB   7  
ATOM 10368 C CG   . ASP A 1 65 ? 144.975 1.369   13.883  1.00 0.00 ? 64 ASP A CG   7  
ATOM 10369 O OD1  . ASP A 1 65 ? 144.698 0.746   12.836  1.00 0.00 ? 64 ASP A OD1  7  
ATOM 10370 O OD2  . ASP A 1 65 ? 144.721 0.931   15.024  1.00 0.00 ? 64 ASP A OD2  7  
ATOM 10371 H H    . ASP A 1 65 ? 146.756 2.289   11.513  1.00 0.00 ? 64 ASP A H    7  
ATOM 10372 H HA   . ASP A 1 65 ? 144.247 3.264   12.251  1.00 0.00 ? 64 ASP A HA   7  
ATOM 10373 H HB2  . ASP A 1 65 ? 146.727 2.562   13.781  1.00 0.00 ? 64 ASP A HB2  7  
ATOM 10374 H HB3  . ASP A 1 65 ? 145.379 3.319   14.621  1.00 0.00 ? 64 ASP A HB3  7  
ATOM 10375 N N    . ILE A 1 66 ? 146.687 5.452   12.652  1.00 0.00 ? 65 ILE A N    7  
ATOM 10376 C CA   . ILE A 1 66 ? 146.964 6.876   12.833  1.00 0.00 ? 65 ILE A CA   7  
ATOM 10377 C C    . ILE A 1 66 ? 146.480 7.685   11.629  1.00 0.00 ? 65 ILE A C    7  
ATOM 10378 O O    . ILE A 1 66 ? 145.859 8.738   11.789  1.00 0.00 ? 65 ILE A O    7  
ATOM 10379 C CB   . ILE A 1 66 ? 148.470 7.150   13.048  1.00 0.00 ? 65 ILE A CB   7  
ATOM 10380 C CG1  . ILE A 1 66 ? 149.014 6.301   14.202  1.00 0.00 ? 65 ILE A CG1  7  
ATOM 10381 C CG2  . ILE A 1 66 ? 148.704 8.630   13.318  1.00 0.00 ? 65 ILE A CG2  7  
ATOM 10382 C CD1  . ILE A 1 66 ? 150.492 5.999   14.083  1.00 0.00 ? 65 ILE A CD1  7  
ATOM 10383 H H    . ILE A 1 66 ? 147.434 4.835   12.497  1.00 0.00 ? 65 ILE A H    7  
ATOM 10384 H HA   . ILE A 1 66 ? 146.431 7.207   13.712  1.00 0.00 ? 65 ILE A HA   7  
ATOM 10385 H HB   . ILE A 1 66 ? 148.993 6.888   12.140  1.00 0.00 ? 65 ILE A HB   7  
ATOM 10386 H HG12 . ILE A 1 66 ? 148.857 6.825   15.133  1.00 0.00 ? 65 ILE A HG12 7  
ATOM 10387 H HG13 . ILE A 1 66 ? 148.484 5.360   14.231  1.00 0.00 ? 65 ILE A HG13 7  
ATOM 10388 H HG21 . ILE A 1 66 ? 148.221 9.216   12.550  1.00 0.00 ? 65 ILE A HG21 7  
ATOM 10389 H HG22 . ILE A 1 66 ? 149.764 8.834   13.313  1.00 0.00 ? 65 ILE A HG22 7  
ATOM 10390 H HG23 . ILE A 1 66 ? 148.292 8.890   14.282  1.00 0.00 ? 65 ILE A HG23 7  
ATOM 10391 H HD11 . ILE A 1 66 ? 150.712 5.664   13.079  1.00 0.00 ? 65 ILE A HD11 7  
ATOM 10392 H HD12 . ILE A 1 66 ? 150.760 5.224   14.787  1.00 0.00 ? 65 ILE A HD12 7  
ATOM 10393 H HD13 . ILE A 1 66 ? 151.060 6.892   14.296  1.00 0.00 ? 65 ILE A HD13 7  
ATOM 10394 N N    . LEU A 1 67 ? 146.775 7.190   10.428  1.00 0.00 ? 66 LEU A N    7  
ATOM 10395 C CA   . LEU A 1 67 ? 146.376 7.869   9.197   1.00 0.00 ? 66 LEU A CA   7  
ATOM 10396 C C    . LEU A 1 67 ? 144.853 7.935   9.065   1.00 0.00 ? 66 LEU A C    7  
ATOM 10397 O O    . LEU A 1 67 ? 144.299 8.988   8.749   1.00 0.00 ? 66 LEU A O    7  
ATOM 10398 C CB   . LEU A 1 67 ? 146.983 7.163   7.982   1.00 0.00 ? 66 LEU A CB   7  
ATOM 10399 C CG   . LEU A 1 67 ? 147.327 8.074   6.799   1.00 0.00 ? 66 LEU A CG   7  
ATOM 10400 C CD1  . LEU A 1 67 ? 148.277 9.184   7.228   1.00 0.00 ? 66 LEU A CD1  7  
ATOM 10401 C CD2  . LEU A 1 67 ? 147.931 7.259   5.664   1.00 0.00 ? 66 LEU A CD2  7  
ATOM 10402 H H    . LEU A 1 67 ? 147.276 6.349   10.367  1.00 0.00 ? 66 LEU A H    7  
ATOM 10403 H HA   . LEU A 1 67 ? 146.761 8.877   9.242   1.00 0.00 ? 66 LEU A HA   7  
ATOM 10404 H HB2  . LEU A 1 67 ? 147.887 6.664   8.298   1.00 0.00 ? 66 LEU A HB2  7  
ATOM 10405 H HB3  . LEU A 1 67 ? 146.282 6.416   7.640   1.00 0.00 ? 66 LEU A HB3  7  
ATOM 10406 H HG   . LEU A 1 67 ? 146.421 8.534   6.433   1.00 0.00 ? 66 LEU A HG   7  
ATOM 10407 H HD11 . LEU A 1 67 ? 148.883 8.842   8.055   1.00 0.00 ? 66 LEU A HD11 7  
ATOM 10408 H HD12 . LEU A 1 67 ? 147.706 10.048  7.535   1.00 0.00 ? 66 LEU A HD12 7  
ATOM 10409 H HD13 . LEU A 1 67 ? 148.917 9.452   6.400   1.00 0.00 ? 66 LEU A HD13 7  
ATOM 10410 H HD21 . LEU A 1 67 ? 148.346 6.343   6.059   1.00 0.00 ? 66 LEU A HD21 7  
ATOM 10411 H HD22 . LEU A 1 67 ? 148.713 7.830   5.186   1.00 0.00 ? 66 LEU A HD22 7  
ATOM 10412 H HD23 . LEU A 1 67 ? 147.164 7.023   4.942   1.00 0.00 ? 66 LEU A HD23 7  
ATOM 10413 N N    . ASP A 1 68 ? 144.182 6.807   9.312   1.00 0.00 ? 67 ASP A N    7  
ATOM 10414 C CA   . ASP A 1 68 ? 142.720 6.739   9.224   1.00 0.00 ? 67 ASP A CA   7  
ATOM 10415 C C    . ASP A 1 68 ? 142.071 7.739   10.182  1.00 0.00 ? 67 ASP A C    7  
ATOM 10416 O O    . ASP A 1 68 ? 141.090 8.396   9.834   1.00 0.00 ? 67 ASP A O    7  
ATOM 10417 C CB   . ASP A 1 68 ? 142.228 5.318   9.536   1.00 0.00 ? 67 ASP A CB   7  
ATOM 10418 C CG   . ASP A 1 68 ? 142.260 4.396   8.326   1.00 0.00 ? 67 ASP A CG   7  
ATOM 10419 O OD1  . ASP A 1 68 ? 143.138 4.577   7.455   1.00 0.00 ? 67 ASP A OD1  7  
ATOM 10420 O OD2  . ASP A 1 68 ? 141.405 3.486   8.253   1.00 0.00 ? 67 ASP A OD2  7  
ATOM 10421 H H    . ASP A 1 68 ? 144.682 6.000   9.561   1.00 0.00 ? 67 ASP A H    7  
ATOM 10422 H HA   . ASP A 1 68 ? 142.438 6.995   8.212   1.00 0.00 ? 67 ASP A HA   7  
ATOM 10423 H HB2  . ASP A 1 68 ? 142.853 4.889   10.304  1.00 0.00 ? 67 ASP A HB2  7  
ATOM 10424 H HB3  . ASP A 1 68 ? 141.210 5.371   9.896   1.00 0.00 ? 67 ASP A HB3  7  
ATOM 10425 N N    . ARG A 1 69 ? 142.633 7.851   11.387  1.00 0.00 ? 68 ARG A N    7  
ATOM 10426 C CA   . ARG A 1 69 ? 142.120 8.777   12.395  1.00 0.00 ? 68 ARG A CA   7  
ATOM 10427 C C    . ARG A 1 69 ? 142.353 10.231  11.977  1.00 0.00 ? 68 ARG A C    7  
ATOM 10428 O O    . ARG A 1 69 ? 141.545 11.109  12.283  1.00 0.00 ? 68 ARG A O    7  
ATOM 10429 C CB   . ARG A 1 69 ? 142.788 8.514   13.746  1.00 0.00 ? 68 ARG A CB   7  
ATOM 10430 C CG   . ARG A 1 69 ? 142.061 9.148   14.921  1.00 0.00 ? 68 ARG A CG   7  
ATOM 10431 C CD   . ARG A 1 69 ? 143.038 9.723   15.936  1.00 0.00 ? 68 ARG A CD   7  
ATOM 10432 N NE   . ARG A 1 69 ? 142.425 10.767  16.758  1.00 0.00 ? 68 ARG A NE   7  
ATOM 10433 C CZ   . ARG A 1 69 ? 143.118 11.663  17.468  1.00 0.00 ? 68 ARG A CZ   7  
ATOM 10434 N NH1  . ARG A 1 69 ? 144.448 11.642  17.473  1.00 0.00 ? 68 ARG A NH1  7  
ATOM 10435 N NH2  . ARG A 1 69 ? 142.476 12.582  18.180  1.00 0.00 ? 68 ARG A NH2  7  
ATOM 10436 H H    . ARG A 1 69 ? 143.417 7.302   11.599  1.00 0.00 ? 68 ARG A H    7  
ATOM 10437 H HA   . ARG A 1 69 ? 141.057 8.607   12.490  1.00 0.00 ? 68 ARG A HA   7  
ATOM 10438 H HB2  . ARG A 1 69 ? 142.834 7.448   13.911  1.00 0.00 ? 68 ARG A HB2  7  
ATOM 10439 H HB3  . ARG A 1 69 ? 143.794 8.908   13.718  1.00 0.00 ? 68 ARG A HB3  7  
ATOM 10440 H HG2  . ARG A 1 69 ? 141.428 9.943   14.554  1.00 0.00 ? 68 ARG A HG2  7  
ATOM 10441 H HG3  . ARG A 1 69 ? 141.454 8.396   15.404  1.00 0.00 ? 68 ARG A HG3  7  
ATOM 10442 H HD2  . ARG A 1 69 ? 143.379 8.926   16.579  1.00 0.00 ? 68 ARG A HD2  7  
ATOM 10443 H HD3  . ARG A 1 69 ? 143.880 10.143  15.406  1.00 0.00 ? 68 ARG A HD3  7  
ATOM 10444 H HE   . ARG A 1 69 ? 141.446 10.807  16.781  1.00 0.00 ? 68 ARG A HE   7  
ATOM 10445 H HH11 . ARG A 1 69 ? 144.942 10.952  16.943  1.00 0.00 ? 68 ARG A HH11 7  
ATOM 10446 H HH12 . ARG A 1 69 ? 144.957 12.317  18.008  1.00 0.00 ? 68 ARG A HH12 7  
ATOM 10447 H HH21 . ARG A 1 69 ? 141.477 12.604  18.185  1.00 0.00 ? 68 ARG A HH21 7  
ATOM 10448 H HH22 . ARG A 1 69 ? 142.992 13.254  18.712  1.00 0.00 ? 68 ARG A HH22 7  
ATOM 10449 N N    . SER A 1 70 ? 143.463 10.476  11.279  1.00 0.00 ? 69 SER A N    7  
ATOM 10450 C CA   . SER A 1 70 ? 143.803 11.819  10.818  1.00 0.00 ? 69 SER A CA   7  
ATOM 10451 C C    . SER A 1 70 ? 143.066 12.154  9.523   1.00 0.00 ? 69 SER A C    7  
ATOM 10452 O O    . SER A 1 70 ? 143.317 11.549  8.480   1.00 0.00 ? 69 SER A O    7  
ATOM 10453 C CB   . SER A 1 70 ? 145.316 11.943  10.604  1.00 0.00 ? 69 SER A CB   7  
ATOM 10454 O OG   . SER A 1 70 ? 145.657 13.195  10.030  1.00 0.00 ? 69 SER A OG   7  
ATOM 10455 H H    . SER A 1 70 ? 144.067 9.733   11.068  1.00 0.00 ? 69 SER A H    7  
ATOM 10456 H HA   . SER A 1 70 ? 143.499 12.519  11.582  1.00 0.00 ? 69 SER A HA   7  
ATOM 10457 H HB2  . SER A 1 70 ? 145.820 11.849  11.553  1.00 0.00 ? 69 SER A HB2  7  
ATOM 10458 H HB3  . SER A 1 70 ? 145.648 11.157  9.941   1.00 0.00 ? 69 SER A HB3  7  
ATOM 10459 H HG   . SER A 1 70 ? 146.613 13.277  9.981   1.00 0.00 ? 69 SER A HG   7  
ATOM 10460 N N    . SER A 1 71 ? 142.160 13.129  9.595   1.00 0.00 ? 70 SER A N    7  
ATOM 10461 C CA   . SER A 1 71 ? 141.392 13.553  8.425   1.00 0.00 ? 70 SER A CA   7  
ATOM 10462 C C    . SER A 1 71 ? 142.253 14.394  7.479   1.00 0.00 ? 70 SER A C    7  
ATOM 10463 O O    . SER A 1 71 ? 142.026 14.401  6.269   1.00 0.00 ? 70 SER A O    7  
ATOM 10464 C CB   . SER A 1 71 ? 140.159 14.353  8.854   1.00 0.00 ? 70 SER A CB   7  
ATOM 10465 O OG   . SER A 1 71 ? 139.078 13.496  9.188   1.00 0.00 ? 70 SER A OG   7  
ATOM 10466 H H    . SER A 1 71 ? 142.009 13.579  10.453  1.00 0.00 ? 70 SER A H    7  
ATOM 10467 H HA   . SER A 1 71 ? 141.069 12.666  7.902   1.00 0.00 ? 70 SER A HA   7  
ATOM 10468 H HB2  . SER A 1 71 ? 140.404 14.954  9.717   1.00 0.00 ? 70 SER A HB2  7  
ATOM 10469 H HB3  . SER A 1 71 ? 139.853 14.999  8.043   1.00 0.00 ? 70 SER A HB3  7  
ATOM 10470 H HG   . SER A 1 71 ? 139.344 12.900  9.893   1.00 0.00 ? 70 SER A HG   7  
ATOM 10471 N N    . SER A 1 72 ? 143.239 15.102  8.040   1.00 0.00 ? 71 SER A N    7  
ATOM 10472 C CA   . SER A 1 72 ? 144.135 15.947  7.247   1.00 0.00 ? 71 SER A CA   7  
ATOM 10473 C C    . SER A 1 72 ? 144.814 15.143  6.136   1.00 0.00 ? 71 SER A C    7  
ATOM 10474 O O    . SER A 1 72 ? 145.049 15.658  5.043   1.00 0.00 ? 71 SER A O    7  
ATOM 10475 C CB   . SER A 1 72 ? 145.197 16.599  8.140   1.00 0.00 ? 71 SER A CB   7  
ATOM 10476 O OG   . SER A 1 72 ? 144.733 16.745  9.473   1.00 0.00 ? 71 SER A OG   7  
ATOM 10477 H H    . SER A 1 72 ? 143.367 15.056  9.012   1.00 0.00 ? 71 SER A H    7  
ATOM 10478 H HA   . SER A 1 72 ? 143.537 16.724  6.794   1.00 0.00 ? 71 SER A HA   7  
ATOM 10479 H HB2  . SER A 1 72 ? 146.085 15.984  8.148   1.00 0.00 ? 71 SER A HB2  7  
ATOM 10480 H HB3  . SER A 1 72 ? 145.441 17.575  7.748   1.00 0.00 ? 71 SER A HB3  7  
ATOM 10481 H HG   . SER A 1 72 ? 145.180 16.111  10.039  1.00 0.00 ? 71 SER A HG   7  
ATOM 10482 N N    . MET A 1 73 ? 145.125 13.878  6.425   1.00 0.00 ? 72 MET A N    7  
ATOM 10483 C CA   . MET A 1 73 ? 145.772 13.003  5.453   1.00 0.00 ? 72 MET A CA   7  
ATOM 10484 C C    . MET A 1 73 ? 144.804 11.938  4.942   1.00 0.00 ? 72 MET A C    7  
ATOM 10485 O O    . MET A 1 73 ? 143.844 11.576  5.626   1.00 0.00 ? 72 MET A O    7  
ATOM 10486 C CB   . MET A 1 73 ? 146.997 12.332  6.077   1.00 0.00 ? 72 MET A CB   7  
ATOM 10487 C CG   . MET A 1 73 ? 148.318 12.876  5.561   1.00 0.00 ? 72 MET A CG   7  
ATOM 10488 S SD   . MET A 1 73 ? 148.706 12.286  3.902   1.00 0.00 ? 72 MET A SD   7  
ATOM 10489 C CE   . MET A 1 73 ? 150.099 11.212  4.239   1.00 0.00 ? 72 MET A CE   7  
ATOM 10490 H H    . MET A 1 73 ? 144.912 13.524  7.314   1.00 0.00 ? 72 MET A H    7  
ATOM 10491 H HA   . MET A 1 73 ? 146.091 13.610  4.619   1.00 0.00 ? 72 MET A HA   7  
ATOM 10492 H HB2  . MET A 1 73 ? 146.967 12.475  7.147   1.00 0.00 ? 72 MET A HB2  7  
ATOM 10493 H HB3  . MET A 1 73 ? 146.962 11.273  5.864   1.00 0.00 ? 72 MET A HB3  7  
ATOM 10494 H HG2  . MET A 1 73 ? 148.265 13.955  5.541   1.00 0.00 ? 72 MET A HG2  7  
ATOM 10495 H HG3  . MET A 1 73 ? 149.105 12.568  6.232   1.00 0.00 ? 72 MET A HG3  7  
ATOM 10496 H HE1  . MET A 1 73 ? 150.408 11.333  5.266   1.00 0.00 ? 72 MET A HE1  7  
ATOM 10497 H HE2  . MET A 1 73 ? 150.917 11.468  3.584   1.00 0.00 ? 72 MET A HE2  7  
ATOM 10498 H HE3  . MET A 1 73 ? 149.810 10.185  4.069   1.00 0.00 ? 72 MET A HE3  7  
ATOM 10499 N N    . LYS A 1 74 ? 145.070 11.436  3.735   1.00 0.00 ? 73 LYS A N    7  
ATOM 10500 C CA   . LYS A 1 74 ? 144.235 10.404  3.123   1.00 0.00 ? 73 LYS A CA   7  
ATOM 10501 C C    . LYS A 1 74 ? 145.099 9.302   2.512   1.00 0.00 ? 73 LYS A C    7  
ATOM 10502 O O    . LYS A 1 74 ? 144.904 8.119   2.798   1.00 0.00 ? 73 LYS A O    7  
ATOM 10503 C CB   . LYS A 1 74 ? 143.323 11.014  2.052   1.00 0.00 ? 73 LYS A CB   7  
ATOM 10504 C CG   . LYS A 1 74 ? 142.273 11.960  2.614   1.00 0.00 ? 73 LYS A CG   7  
ATOM 10505 C CD   . LYS A 1 74 ? 141.029 11.209  3.069   1.00 0.00 ? 73 LYS A CD   7  
ATOM 10506 C CE   . LYS A 1 74 ? 140.486 11.762  4.379   1.00 0.00 ? 73 LYS A CE   7  
ATOM 10507 N NZ   . LYS A 1 74 ? 140.466 10.734  5.459   1.00 0.00 ? 73 LYS A NZ   7  
ATOM 10508 H H    . LYS A 1 74 ? 145.853 11.766  3.246   1.00 0.00 ? 73 LYS A H    7  
ATOM 10509 H HA   . LYS A 1 74 ? 143.622 9.972   3.899   1.00 0.00 ? 73 LYS A HA   7  
ATOM 10510 H HB2  . LYS A 1 74 ? 143.931 11.562  1.347   1.00 0.00 ? 73 LYS A HB2  7  
ATOM 10511 H HB3  . LYS A 1 74 ? 142.816 10.215  1.531   1.00 0.00 ? 73 LYS A HB3  7  
ATOM 10512 H HG2  . LYS A 1 74 ? 142.692 12.487  3.458   1.00 0.00 ? 73 LYS A HG2  7  
ATOM 10513 H HG3  . LYS A 1 74 ? 141.994 12.669  1.848   1.00 0.00 ? 73 LYS A HG3  7  
ATOM 10514 H HD2  . LYS A 1 74 ? 140.268 11.301  2.309   1.00 0.00 ? 73 LYS A HD2  7  
ATOM 10515 H HD3  . LYS A 1 74 ? 141.280 10.167  3.204   1.00 0.00 ? 73 LYS A HD3  7  
ATOM 10516 H HE2  . LYS A 1 74 ? 141.108 12.587  4.694   1.00 0.00 ? 73 LYS A HE2  7  
ATOM 10517 H HE3  . LYS A 1 74 ? 139.479 12.116  4.214   1.00 0.00 ? 73 LYS A HE3  7  
ATOM 10518 H HZ1  . LYS A 1 74 ? 141.416 10.629  5.871   1.00 0.00 ? 73 LYS A HZ1  7  
ATOM 10519 H HZ2  . LYS A 1 74 ? 140.163 9.816   5.076   1.00 0.00 ? 73 LYS A HZ2  7  
ATOM 10520 H HZ3  . LYS A 1 74 ? 139.804 11.018  6.210   1.00 0.00 ? 73 LYS A HZ3  7  
ATOM 10521 N N    . SER A 1 75 ? 146.060 9.697   1.673   1.00 0.00 ? 74 SER A N    7  
ATOM 10522 C CA   . SER A 1 75 ? 146.961 8.744   1.026   1.00 0.00 ? 74 SER A CA   7  
ATOM 10523 C C    . SER A 1 75 ? 148.065 8.294   1.985   1.00 0.00 ? 74 SER A C    7  
ATOM 10524 O O    . SER A 1 75 ? 148.230 8.863   3.066   1.00 0.00 ? 74 SER A O    7  
ATOM 10525 C CB   . SER A 1 75 ? 147.583 9.364   -0.230  1.00 0.00 ? 74 SER A CB   7  
ATOM 10526 O OG   . SER A 1 75 ? 147.826 10.752  -0.059  1.00 0.00 ? 74 SER A OG   7  
ATOM 10527 H H    . SER A 1 75 ? 146.168 10.653  1.487   1.00 0.00 ? 74 SER A H    7  
ATOM 10528 H HA   . SER A 1 75 ? 146.378 7.881   0.739   1.00 0.00 ? 74 SER A HA   7  
ATOM 10529 H HB2  . SER A 1 75 ? 148.521 8.873   -0.443  1.00 0.00 ? 74 SER A HB2  7  
ATOM 10530 H HB3  . SER A 1 75 ? 146.909 9.228   -1.064  1.00 0.00 ? 74 SER A HB3  7  
ATOM 10531 H HG   . SER A 1 75 ? 148.372 10.891  0.720   1.00 0.00 ? 74 SER A HG   7  
ATOM 10532 N N    . LEU A 1 76 ? 148.820 7.270   1.581   1.00 0.00 ? 75 LEU A N    7  
ATOM 10533 C CA   . LEU A 1 76 ? 149.910 6.744   2.403   1.00 0.00 ? 75 LEU A CA   7  
ATOM 10534 C C    . LEU A 1 76 ? 151.268 7.038   1.767   1.00 0.00 ? 75 LEU A C    7  
ATOM 10535 O O    . LEU A 1 76 ? 151.533 6.632   0.634   1.00 0.00 ? 75 LEU A O    7  
ATOM 10536 C CB   . LEU A 1 76 ? 149.744 5.234   2.607   1.00 0.00 ? 75 LEU A CB   7  
ATOM 10537 C CG   . LEU A 1 76 ? 149.864 4.756   4.057   1.00 0.00 ? 75 LEU A CG   7  
ATOM 10538 C CD1  . LEU A 1 76 ? 148.870 3.638   4.335   1.00 0.00 ? 75 LEU A CD1  7  
ATOM 10539 C CD2  . LEU A 1 76 ? 151.285 4.297   4.355   1.00 0.00 ? 75 LEU A CD2  7  
ATOM 10540 H H    . LEU A 1 76 ? 148.641 6.858   0.710   1.00 0.00 ? 75 LEU A H    7  
ATOM 10541 H HA   . LEU A 1 76 ? 149.864 7.234   3.364   1.00 0.00 ? 75 LEU A HA   7  
ATOM 10542 H HB2  . LEU A 1 76 ? 148.770 4.948   2.234   1.00 0.00 ? 75 LEU A HB2  7  
ATOM 10543 H HB3  . LEU A 1 76 ? 150.497 4.727   2.021   1.00 0.00 ? 75 LEU A HB3  7  
ATOM 10544 H HG   . LEU A 1 76 ? 149.633 5.578   4.720   1.00 0.00 ? 75 LEU A HG   7  
ATOM 10545 H HD11 . LEU A 1 76 ? 147.972 4.055   4.767   1.00 0.00 ? 75 LEU A HD11 7  
ATOM 10546 H HD12 . LEU A 1 76 ? 149.306 2.930   5.025   1.00 0.00 ? 75 LEU A HD12 7  
ATOM 10547 H HD13 . LEU A 1 76 ? 148.624 3.135   3.412   1.00 0.00 ? 75 LEU A HD13 7  
ATOM 10548 H HD21 . LEU A 1 76 ? 151.261 3.493   5.075   1.00 0.00 ? 75 LEU A HD21 7  
ATOM 10549 H HD22 . LEU A 1 76 ? 151.853 5.123   4.757   1.00 0.00 ? 75 LEU A HD22 7  
ATOM 10550 H HD23 . LEU A 1 76 ? 151.750 3.950   3.445   1.00 0.00 ? 75 LEU A HD23 7  
ATOM 10551 N N    . ARG A 1 77 ? 152.123 7.746   2.505   1.00 0.00 ? 76 ARG A N    7  
ATOM 10552 C CA   . ARG A 1 77 ? 153.454 8.095   2.015   1.00 0.00 ? 76 ARG A CA   7  
ATOM 10553 C C    . ARG A 1 77 ? 154.468 7.010   2.377   1.00 0.00 ? 76 ARG A C    7  
ATOM 10554 O O    . ARG A 1 77 ? 154.840 6.859   3.544   1.00 0.00 ? 76 ARG A O    7  
ATOM 10555 C CB   . ARG A 1 77 ? 153.900 9.445   2.589   1.00 0.00 ? 76 ARG A CB   7  
ATOM 10556 C CG   . ARG A 1 77 ? 154.249 10.476  1.526   1.00 0.00 ? 76 ARG A CG   7  
ATOM 10557 C CD   . ARG A 1 77 ? 153.851 11.879  1.958   1.00 0.00 ? 76 ARG A CD   7  
ATOM 10558 N NE   . ARG A 1 77 ? 154.316 12.895  1.015   1.00 0.00 ? 76 ARG A NE   7  
ATOM 10559 C CZ   . ARG A 1 77 ? 153.742 13.137  -0.167  1.00 0.00 ? 76 ARG A CZ   7  
ATOM 10560 N NH1  . ARG A 1 77 ? 152.681 12.434  -0.559  1.00 0.00 ? 76 ARG A NH1  7  
ATOM 10561 N NH2  . ARG A 1 77 ? 154.232 14.084  -0.960  1.00 0.00 ? 76 ARG A NH2  7  
ATOM 10562 H H    . ARG A 1 77 ? 151.852 8.040   3.401   1.00 0.00 ? 76 ARG A H    7  
ATOM 10563 H HA   . ARG A 1 77 ? 153.399 8.172   0.939   1.00 0.00 ? 76 ARG A HA   7  
ATOM 10564 H HB2  . ARG A 1 77 ? 153.104 9.845   3.200   1.00 0.00 ? 76 ARG A HB2  7  
ATOM 10565 H HB3  . ARG A 1 77 ? 154.772 9.290   3.207   1.00 0.00 ? 76 ARG A HB3  7  
ATOM 10566 H HG2  . ARG A 1 77 ? 155.314 10.452  1.351   1.00 0.00 ? 76 ARG A HG2  7  
ATOM 10567 H HG3  . ARG A 1 77 ? 153.727 10.229  0.613   1.00 0.00 ? 76 ARG A HG3  7  
ATOM 10568 H HD2  . ARG A 1 77 ? 152.774 11.930  2.025   1.00 0.00 ? 76 ARG A HD2  7  
ATOM 10569 H HD3  . ARG A 1 77 ? 154.280 12.079  2.930   1.00 0.00 ? 76 ARG A HD3  7  
ATOM 10570 H HE   . ARG A 1 77 ? 155.098 13.428  1.277   1.00 0.00 ? 76 ARG A HE   7  
ATOM 10571 H HH11 . ARG A 1 77 ? 152.307 11.718  0.031   1.00 0.00 ? 76 ARG A HH11 7  
ATOM 10572 H HH12 . ARG A 1 77 ? 152.257 12.621  -1.444  1.00 0.00 ? 76 ARG A HH12 7  
ATOM 10573 H HH21 . ARG A 1 77 ? 155.030 14.615  -0.672  1.00 0.00 ? 76 ARG A HH21 7  
ATOM 10574 H HH22 . ARG A 1 77 ? 153.804 14.267  -1.845  1.00 0.00 ? 76 ARG A HH22 7  
ATOM 10575 N N    . ILE A 1 78 ? 154.908 6.255   1.370   1.00 0.00 ? 77 ILE A N    7  
ATOM 10576 C CA   . ILE A 1 78 ? 155.878 5.183   1.578   1.00 0.00 ? 77 ILE A CA   7  
ATOM 10577 C C    . ILE A 1 78 ? 157.051 5.306   0.606   1.00 0.00 ? 77 ILE A C    7  
ATOM 10578 O O    . ILE A 1 78 ? 156.856 5.489   -0.598  1.00 0.00 ? 77 ILE A O    7  
ATOM 10579 C CB   . ILE A 1 78 ? 155.229 3.790   1.410   1.00 0.00 ? 77 ILE A CB   7  
ATOM 10580 C CG1  . ILE A 1 78 ? 153.924 3.702   2.209   1.00 0.00 ? 77 ILE A CG1  7  
ATOM 10581 C CG2  . ILE A 1 78 ? 156.194 2.693   1.846   1.00 0.00 ? 77 ILE A CG2  7  
ATOM 10582 C CD1  . ILE A 1 78 ? 153.091 2.483   1.875   1.00 0.00 ? 77 ILE A CD1  7  
ATOM 10583 H H    . ILE A 1 78 ? 154.572 6.423   0.465   1.00 0.00 ? 77 ILE A H    7  
ATOM 10584 H HA   . ILE A 1 78 ? 156.251 5.264   2.589   1.00 0.00 ? 77 ILE A HA   7  
ATOM 10585 H HB   . ILE A 1 78 ? 155.011 3.645   0.362   1.00 0.00 ? 77 ILE A HB   7  
ATOM 10586 H HG12 . ILE A 1 78 ? 154.156 3.665   3.262   1.00 0.00 ? 77 ILE A HG12 7  
ATOM 10587 H HG13 . ILE A 1 78 ? 153.326 4.578   2.007   1.00 0.00 ? 77 ILE A HG13 7  
ATOM 10588 H HG21 . ILE A 1 78 ? 155.975 2.402   2.863   1.00 0.00 ? 77 ILE A HG21 7  
ATOM 10589 H HG22 . ILE A 1 78 ? 157.209 3.058   1.787   1.00 0.00 ? 77 ILE A HG22 7  
ATOM 10590 H HG23 . ILE A 1 78 ? 156.082 1.838   1.195   1.00 0.00 ? 77 ILE A HG23 7  
ATOM 10591 H HD11 . ILE A 1 78 ? 153.204 1.745   2.656   1.00 0.00 ? 77 ILE A HD11 7  
ATOM 10592 H HD12 . ILE A 1 78 ? 153.421 2.066   0.935   1.00 0.00 ? 77 ILE A HD12 7  
ATOM 10593 H HD13 . ILE A 1 78 ? 152.052 2.769   1.798   1.00 0.00 ? 77 ILE A HD13 7  
ATOM 10594 N N    . LEU A 1 79 ? 158.267 5.201   1.139   1.00 0.00 ? 78 LEU A N    7  
ATOM 10595 C CA   . LEU A 1 79 ? 159.480 5.294   0.331   1.00 0.00 ? 78 LEU A CA   7  
ATOM 10596 C C    . LEU A 1 79 ? 160.062 3.904   0.077   1.00 0.00 ? 78 LEU A C    7  
ATOM 10597 O O    . LEU A 1 79 ? 160.413 3.191   1.017   1.00 0.00 ? 78 LEU A O    7  
ATOM 10598 C CB   . LEU A 1 79 ? 160.514 6.176   1.037   1.00 0.00 ? 78 LEU A CB   7  
ATOM 10599 C CG   . LEU A 1 79 ? 161.519 6.875   0.115   1.00 0.00 ? 78 LEU A CG   7  
ATOM 10600 C CD1  . LEU A 1 79 ? 160.951 8.190   -0.400  1.00 0.00 ? 78 LEU A CD1  7  
ATOM 10601 C CD2  . LEU A 1 79 ? 162.835 7.109   0.845   1.00 0.00 ? 78 LEU A CD2  7  
ATOM 10602 H H    . LEU A 1 79 ? 158.352 5.053   2.106   1.00 0.00 ? 78 LEU A H    7  
ATOM 10603 H HA   . LEU A 1 79 ? 159.217 5.744   -0.615  1.00 0.00 ? 78 LEU A HA   7  
ATOM 10604 H HB2  . LEU A 1 79 ? 159.986 6.933   1.598   1.00 0.00 ? 78 LEU A HB2  7  
ATOM 10605 H HB3  . LEU A 1 79 ? 161.066 5.560   1.731   1.00 0.00 ? 78 LEU A HB3  7  
ATOM 10606 H HG   . LEU A 1 79 ? 161.717 6.242   -0.737  1.00 0.00 ? 78 LEU A HG   7  
ATOM 10607 H HD11 . LEU A 1 79 ? 160.498 8.733   0.417   1.00 0.00 ? 78 LEU A HD11 7  
ATOM 10608 H HD12 . LEU A 1 79 ? 160.205 7.990   -1.155  1.00 0.00 ? 78 LEU A HD12 7  
ATOM 10609 H HD13 . LEU A 1 79 ? 161.745 8.783   -0.828  1.00 0.00 ? 78 LEU A HD13 7  
ATOM 10610 H HD21 . LEU A 1 79 ? 163.505 6.285   0.652   1.00 0.00 ? 78 LEU A HD21 7  
ATOM 10611 H HD22 . LEU A 1 79 ? 162.651 7.182   1.907   1.00 0.00 ? 78 LEU A HD22 7  
ATOM 10612 H HD23 . LEU A 1 79 ? 163.283 8.027   0.495   1.00 0.00 ? 78 LEU A HD23 7  
ATOM 10613 N N    . LEU A 1 80 ? 160.155 3.524   -1.198  1.00 0.00 ? 79 LEU A N    7  
ATOM 10614 C CA   . LEU A 1 80 ? 160.690 2.214   -1.572  1.00 0.00 ? 79 LEU A CA   7  
ATOM 10615 C C    . LEU A 1 80 ? 162.189 2.299   -1.867  1.00 0.00 ? 79 LEU A C    7  
ATOM 10616 O O    . LEU A 1 80 ? 162.636 3.177   -2.606  1.00 0.00 ? 79 LEU A O    7  
ATOM 10617 C CB   . LEU A 1 80 ? 159.948 1.663   -2.795  1.00 0.00 ? 79 LEU A CB   7  
ATOM 10618 C CG   . LEU A 1 80 ? 158.422 1.613   -2.663  1.00 0.00 ? 79 LEU A CG   7  
ATOM 10619 C CD1  . LEU A 1 80 ? 157.758 1.952   -3.990  1.00 0.00 ? 79 LEU A CD1  7  
ATOM 10620 C CD2  . LEU A 1 80 ? 157.972 0.243   -2.172  1.00 0.00 ? 79 LEU A CD2  7  
ATOM 10621 H H    . LEU A 1 80 ? 159.853 4.135   -1.903  1.00 0.00 ? 79 LEU A H    7  
ATOM 10622 H HA   . LEU A 1 80 ? 160.537 1.545   -0.739  1.00 0.00 ? 79 LEU A HA   7  
ATOM 10623 H HB2  . LEU A 1 80 ? 160.196 2.278   -3.647  1.00 0.00 ? 79 LEU A HB2  7  
ATOM 10624 H HB3  . LEU A 1 80 ? 160.304 0.661   -2.981  1.00 0.00 ? 79 LEU A HB3  7  
ATOM 10625 H HG   . LEU A 1 80 ? 158.107 2.348   -1.938  1.00 0.00 ? 79 LEU A HG   7  
ATOM 10626 H HD11 . LEU A 1 80 ? 158.477 2.421   -4.645  1.00 0.00 ? 79 LEU A HD11 7  
ATOM 10627 H HD12 . LEU A 1 80 ? 156.936 2.629   -3.816  1.00 0.00 ? 79 LEU A HD12 7  
ATOM 10628 H HD13 . LEU A 1 80 ? 157.388 1.047   -4.450  1.00 0.00 ? 79 LEU A HD13 7  
ATOM 10629 H HD21 . LEU A 1 80 ? 158.073 0.195   -1.098  1.00 0.00 ? 79 LEU A HD21 7  
ATOM 10630 H HD22 . LEU A 1 80 ? 158.583 -0.522  -2.626  1.00 0.00 ? 79 LEU A HD22 7  
ATOM 10631 H HD23 . LEU A 1 80 ? 156.938 0.085   -2.443  1.00 0.00 ? 79 LEU A HD23 7  
ATOM 10632 N N    . LEU A 1 81 ? 162.959 1.380   -1.280  1.00 0.00 ? 80 LEU A N    7  
ATOM 10633 C CA   . LEU A 1 81 ? 164.409 1.347   -1.476  1.00 0.00 ? 80 LEU A CA   7  
ATOM 10634 C C    . LEU A 1 81 ? 164.912 -0.093  -1.562  1.00 0.00 ? 80 LEU A C    7  
ATOM 10635 O O    . LEU A 1 81 ? 164.469 -0.959  -0.808  1.00 0.00 ? 80 LEU A O    7  
ATOM 10636 C CB   . LEU A 1 81 ? 165.120 2.083   -0.333  1.00 0.00 ? 80 LEU A CB   7  
ATOM 10637 C CG   . LEU A 1 81 ? 164.715 3.551   -0.150  1.00 0.00 ? 80 LEU A CG   7  
ATOM 10638 C CD1  . LEU A 1 81 ? 163.481 3.661   0.734   1.00 0.00 ? 80 LEU A CD1  7  
ATOM 10639 C CD2  . LEU A 1 81 ? 165.866 4.357   0.439   1.00 0.00 ? 80 LEU A CD2  7  
ATOM 10640 H H    . LEU A 1 81 ? 162.543 0.708   -0.700  1.00 0.00 ? 80 LEU A H    7  
ATOM 10641 H HA   . LEU A 1 81 ? 164.629 1.848   -2.407  1.00 0.00 ? 80 LEU A HA   7  
ATOM 10642 H HB2  . LEU A 1 81 ? 164.915 1.557   0.588   1.00 0.00 ? 80 LEU A HB2  7  
ATOM 10643 H HB3  . LEU A 1 81 ? 166.184 2.048   -0.518  1.00 0.00 ? 80 LEU A HB3  7  
ATOM 10644 H HG   . LEU A 1 81 ? 164.471 3.972   -1.114  1.00 0.00 ? 80 LEU A HG   7  
ATOM 10645 H HD11 . LEU A 1 81 ? 163.776 3.953   1.731   1.00 0.00 ? 80 LEU A HD11 7  
ATOM 10646 H HD12 . LEU A 1 81 ? 162.977 2.707   0.772   1.00 0.00 ? 80 LEU A HD12 7  
ATOM 10647 H HD13 . LEU A 1 81 ? 162.812 4.404   0.325   1.00 0.00 ? 80 LEU A HD13 7  
ATOM 10648 H HD21 . LEU A 1 81 ? 166.796 3.830   0.278   1.00 0.00 ? 80 LEU A HD21 7  
ATOM 10649 H HD22 . LEU A 1 81 ? 165.707 4.491   1.499   1.00 0.00 ? 80 LEU A HD22 7  
ATOM 10650 H HD23 . LEU A 1 81 ? 165.912 5.322   -0.043  1.00 0.00 ? 80 LEU A HD23 7  
ATOM 10651 N N    . SER A 1 82 ? 165.836 -0.342  -2.489  1.00 0.00 ? 81 SER A N    7  
ATOM 10652 C CA   . SER A 1 82 ? 166.398 -1.679  -2.679  1.00 0.00 ? 81 SER A CA   7  
ATOM 10653 C C    . SER A 1 82 ? 167.199 -2.125  -1.457  1.00 0.00 ? 81 SER A C    7  
ATOM 10654 O O    . SER A 1 82 ? 167.996 -1.361  -0.912  1.00 0.00 ? 81 SER A O    7  
ATOM 10655 C CB   . SER A 1 82 ? 167.288 -1.711  -3.924  1.00 0.00 ? 81 SER A CB   7  
ATOM 10656 O OG   . SER A 1 82 ? 166.552 -2.121  -5.064  1.00 0.00 ? 81 SER A OG   7  
ATOM 10657 H H    . SER A 1 82 ? 166.147 0.391   -3.061  1.00 0.00 ? 81 SER A H    7  
ATOM 10658 H HA   . SER A 1 82 ? 165.574 -2.363  -2.821  1.00 0.00 ? 81 SER A HA   7  
ATOM 10659 H HB2  . SER A 1 82 ? 167.688 -0.724  -4.105  1.00 0.00 ? 81 SER A HB2  7  
ATOM 10660 H HB3  . SER A 1 82 ? 168.101 -2.405  -3.766  1.00 0.00 ? 81 SER A HB3  7  
ATOM 10661 H HG   . SER A 1 82 ? 166.231 -3.017  -4.932  1.00 0.00 ? 81 SER A HG   7  
ATOM 10662 N N    . GLN A 1 83 ? 166.980 -3.371  -1.036  1.00 0.00 ? 82 GLN A N    7  
ATOM 10663 C CA   . GLN A 1 83 ? 167.679 -3.931  0.120   1.00 0.00 ? 82 GLN A CA   7  
ATOM 10664 C C    . GLN A 1 83 ? 168.723 -4.968  -0.312  1.00 0.00 ? 82 GLN A C    7  
ATOM 10665 O O    . GLN A 1 83 ? 168.968 -5.947  0.396   1.00 0.00 ? 82 GLN A O    7  
ATOM 10666 C CB   . GLN A 1 83 ? 166.666 -4.564  1.083   1.00 0.00 ? 82 GLN A CB   7  
ATOM 10667 C CG   . GLN A 1 83 ? 167.247 -4.938  2.440   1.00 0.00 ? 82 GLN A CG   7  
ATOM 10668 C CD   . GLN A 1 83 ? 166.806 -3.999  3.547   1.00 0.00 ? 82 GLN A CD   7  
ATOM 10669 O OE1  . GLN A 1 83 ? 165.633 -3.966  3.916   1.00 0.00 ? 82 GLN A OE1  7  
ATOM 10670 N NE2  . GLN A 1 83 ? 167.747 -3.231  4.087   1.00 0.00 ? 82 GLN A NE2  7  
ATOM 10671 H H    . GLN A 1 83 ? 166.333 -3.930  -1.516  1.00 0.00 ? 82 GLN A H    7  
ATOM 10672 H HA   . GLN A 1 83 ? 168.184 -3.121  0.626   1.00 0.00 ? 82 GLN A HA   7  
ATOM 10673 H HB2  . GLN A 1 83 ? 165.858 -3.865  1.244   1.00 0.00 ? 82 GLN A HB2  7  
ATOM 10674 H HB3  . GLN A 1 83 ? 166.268 -5.459  0.627   1.00 0.00 ? 82 GLN A HB3  7  
ATOM 10675 H HG2  . GLN A 1 83 ? 166.923 -5.937  2.690   1.00 0.00 ? 82 GLN A HG2  7  
ATOM 10676 H HG3  . GLN A 1 83 ? 168.325 -4.917  2.376   1.00 0.00 ? 82 GLN A HG3  7  
ATOM 10677 H HE21 . GLN A 1 83 ? 168.662 -3.312  3.747   1.00 0.00 ? 82 GLN A HE21 7  
ATOM 10678 H HE22 . GLN A 1 83 ? 167.486 -2.615  4.804   1.00 0.00 ? 82 GLN A HE22 7  
ATOM 10679 N N    . ASP A 1 84 ? 169.343 -4.745  -1.475  1.00 0.00 ? 83 ASP A N    7  
ATOM 10680 C CA   . ASP A 1 84 ? 170.363 -5.658  -1.988  1.00 0.00 ? 83 ASP A CA   7  
ATOM 10681 C C    . ASP A 1 84 ? 171.306 -4.936  -2.952  1.00 0.00 ? 83 ASP A C    7  
ATOM 10682 O O    . ASP A 1 84 ? 170.979 -4.747  -4.125  1.00 0.00 ? 83 ASP A O    7  
ATOM 10683 C CB   . ASP A 1 84 ? 169.704 -6.858  -2.687  1.00 0.00 ? 83 ASP A CB   7  
ATOM 10684 C CG   . ASP A 1 84 ? 170.162 -8.195  -2.126  1.00 0.00 ? 83 ASP A CG   7  
ATOM 10685 O OD1  . ASP A 1 84 ? 170.504 -8.257  -0.926  1.00 0.00 ? 83 ASP A OD1  7  
ATOM 10686 O OD2  . ASP A 1 84 ? 170.172 -9.183  -2.889  1.00 0.00 ? 83 ASP A OD2  7  
ATOM 10687 H H    . ASP A 1 84 ? 169.113 -3.948  -1.996  1.00 0.00 ? 83 ASP A H    7  
ATOM 10688 H HA   . ASP A 1 84 ? 170.935 -6.015  -1.145  1.00 0.00 ? 83 ASP A HA   7  
ATOM 10689 H HB2  . ASP A 1 84 ? 168.633 -6.790  -2.570  1.00 0.00 ? 83 ASP A HB2  7  
ATOM 10690 H HB3  . ASP A 1 84 ? 169.946 -6.830  -3.741  1.00 0.00 ? 83 ASP A HB3  7  
ATOM 10691 N N    . ARG A 1 85 ? 172.475 -4.532  -2.449  1.00 0.00 ? 84 ARG A N    7  
ATOM 10692 C CA   . ARG A 1 85 ? 173.465 -3.826  -3.269  1.00 0.00 ? 84 ARG A CA   7  
ATOM 10693 C C    . ARG A 1 85 ? 174.096 -4.767  -4.295  1.00 0.00 ? 84 ARG A C    7  
ATOM 10694 O O    . ARG A 1 85 ? 174.152 -4.456  -5.486  1.00 0.00 ? 84 ARG A O    7  
ATOM 10695 C CB   . ARG A 1 85 ? 174.553 -3.211  -2.382  1.00 0.00 ? 84 ARG A CB   7  
ATOM 10696 C CG   . ARG A 1 85 ? 174.234 -1.796  -1.919  1.00 0.00 ? 84 ARG A CG   7  
ATOM 10697 C CD   . ARG A 1 85 ? 173.595 -1.786  -0.537  1.00 0.00 ? 84 ARG A CD   7  
ATOM 10698 N NE   . ARG A 1 85 ? 174.568 -2.044  0.526   1.00 0.00 ? 84 ARG A NE   7  
ATOM 10699 C CZ   . ARG A 1 85 ? 174.359 -1.761  1.815   1.00 0.00 ? 84 ARG A CZ   7  
ATOM 10700 N NH1  . ARG A 1 85 ? 173.213 -1.209  2.209   1.00 0.00 ? 84 ARG A NH1  7  
ATOM 10701 N NH2  . ARG A 1 85 ? 175.297 -2.031  2.716   1.00 0.00 ? 84 ARG A NH2  7  
ATOM 10702 H H    . ARG A 1 85 ? 172.676 -4.709  -1.506  1.00 0.00 ? 84 ARG A H    7  
ATOM 10703 H HA   . ARG A 1 85 ? 172.953 -3.037  -3.795  1.00 0.00 ? 84 ARG A HA   7  
ATOM 10704 H HB2  . ARG A 1 85 ? 174.681 -3.833  -1.508  1.00 0.00 ? 84 ARG A HB2  7  
ATOM 10705 H HB3  . ARG A 1 85 ? 175.481 -3.186  -2.933  1.00 0.00 ? 84 ARG A HB3  7  
ATOM 10706 H HG2  . ARG A 1 85 ? 175.149 -1.225  -1.885  1.00 0.00 ? 84 ARG A HG2  7  
ATOM 10707 H HG3  . ARG A 1 85 ? 173.551 -1.344  -2.624  1.00 0.00 ? 84 ARG A HG3  7  
ATOM 10708 H HD2  . ARG A 1 85 ? 173.148 -0.817  -0.372  1.00 0.00 ? 84 ARG A HD2  7  
ATOM 10709 H HD3  . ARG A 1 85 ? 172.828 -2.546  -0.503  1.00 0.00 ? 84 ARG A HD3  7  
ATOM 10710 H HE   . ARG A 1 85 ? 175.423 -2.450  0.267   1.00 0.00 ? 84 ARG A HE   7  
ATOM 10711 H HH11 . ARG A 1 85 ? 172.499 -1.003  1.542   1.00 0.00 ? 84 ARG A HH11 7  
ATOM 10712 H HH12 . ARG A 1 85 ? 173.067 -0.999  3.177   1.00 0.00 ? 84 ARG A HH12 7  
ATOM 10713 H HH21 . ARG A 1 85 ? 176.161 -2.447  2.430   1.00 0.00 ? 84 ARG A HH21 7  
ATOM 10714 H HH22 . ARG A 1 85 ? 175.141 -1.817  3.681   1.00 0.00 ? 84 ARG A HH22 7  
ATOM 10715 N N    . ASN A 1 86 ? 174.561 -5.919  -3.815  1.00 0.00 ? 85 ASN A N    7  
ATOM 10716 C CA   . ASN A 1 86 ? 175.186 -6.936  -4.665  1.00 0.00 ? 85 ASN A CA   7  
ATOM 10717 C C    . ASN A 1 86 ? 176.502 -6.444  -5.269  1.00 0.00 ? 85 ASN A C    7  
ATOM 10718 O O    . ASN A 1 86 ? 176.511 -5.548  -6.113  1.00 0.00 ? 85 ASN A O    7  
ATOM 10719 C CB   . ASN A 1 86 ? 174.227 -7.366  -5.784  1.00 0.00 ? 85 ASN A CB   7  
ATOM 10720 C CG   . ASN A 1 86 ? 173.415 -8.592  -5.413  1.00 0.00 ? 85 ASN A CG   7  
ATOM 10721 O OD1  . ASN A 1 86 ? 172.464 -8.508  -4.636  1.00 0.00 ? 85 ASN A OD1  7  
ATOM 10722 N ND2  . ASN A 1 86 ? 173.787 -9.740  -5.969  1.00 0.00 ? 85 ASN A ND2  7  
ATOM 10723 H H    . ASN A 1 86 ? 174.475 -6.094  -2.857  1.00 0.00 ? 85 ASN A H    7  
ATOM 10724 H HA   . ASN A 1 86 ? 175.395 -7.794  -4.044  1.00 0.00 ? 85 ASN A HA   7  
ATOM 10725 H HB2  . ASN A 1 86 ? 173.545 -6.558  -5.998  1.00 0.00 ? 85 ASN A HB2  7  
ATOM 10726 H HB3  . ASN A 1 86 ? 174.798 -7.592  -6.673  1.00 0.00 ? 85 ASN A HB3  7  
ATOM 10727 H HD21 . ASN A 1 86 ? 174.554 -9.732  -6.580  1.00 0.00 ? 85 ASN A HD21 7  
ATOM 10728 H HD22 . ASN A 1 86 ? 173.279 -10.547 -5.747  1.00 0.00 ? 85 ASN A HD22 7  
ATOM 10729 N N    . LEU A 1 87 ? 177.614 -7.051  -4.842  1.00 0.00 ? 86 LEU A N    7  
ATOM 10730 C CA   . LEU A 1 87 ? 178.936 -6.688  -5.354  1.00 0.00 ? 86 LEU A CA   7  
ATOM 10731 C C    . LEU A 1 87 ? 179.345 -7.605  -6.517  1.00 0.00 ? 86 LEU A C    7  
ATOM 10732 O O    . LEU A 1 87 ? 180.530 -7.889  -6.711  1.00 0.00 ? 86 LEU A O    7  
ATOM 10733 C CB   . LEU A 1 87 ? 179.982 -6.759  -4.232  1.00 0.00 ? 86 LEU A CB   7  
ATOM 10734 C CG   . LEU A 1 87 ? 181.239 -5.910  -4.452  1.00 0.00 ? 86 LEU A CG   7  
ATOM 10735 C CD1  . LEU A 1 87 ? 181.048 -4.510  -3.889  1.00 0.00 ? 86 LEU A CD1  7  
ATOM 10736 C CD2  . LEU A 1 87 ? 182.448 -6.580  -3.817  1.00 0.00 ? 86 LEU A CD2  7  
ATOM 10737 H H    . LEU A 1 87 ? 177.542 -7.767  -4.175  1.00 0.00 ? 86 LEU A H    7  
ATOM 10738 H HA   . LEU A 1 87 ? 178.881 -5.672  -5.718  1.00 0.00 ? 86 LEU A HA   7  
ATOM 10739 H HB2  . LEU A 1 87 ? 179.515 -6.440  -3.312  1.00 0.00 ? 86 LEU A HB2  7  
ATOM 10740 H HB3  . LEU A 1 87 ? 180.288 -7.789  -4.120  1.00 0.00 ? 86 LEU A HB3  7  
ATOM 10741 H HG   . LEU A 1 87 ? 181.424 -5.822  -5.513  1.00 0.00 ? 86 LEU A HG   7  
ATOM 10742 H HD11 . LEU A 1 87 ? 180.683 -4.577  -2.875  1.00 0.00 ? 86 LEU A HD11 7  
ATOM 10743 H HD12 . LEU A 1 87 ? 180.336 -3.971  -4.495  1.00 0.00 ? 86 LEU A HD12 7  
ATOM 10744 H HD13 . LEU A 1 87 ? 181.994 -3.988  -3.896  1.00 0.00 ? 86 LEU A HD13 7  
ATOM 10745 H HD21 . LEU A 1 87 ? 182.614 -6.165  -2.833  1.00 0.00 ? 86 LEU A HD21 7  
ATOM 10746 H HD22 . LEU A 1 87 ? 183.320 -6.408  -4.431  1.00 0.00 ? 86 LEU A HD22 7  
ATOM 10747 H HD23 . LEU A 1 87 ? 182.270 -7.642  -3.733  1.00 0.00 ? 86 LEU A HD23 7  
ATOM 10748 N N    . GLU A 1 88 ? 178.354 -8.056  -7.294  1.00 0.00 ? 87 GLU A N    7  
ATOM 10749 C CA   . GLU A 1 88 ? 178.600 -8.926  -8.439  1.00 0.00 ? 87 GLU A CA   7  
ATOM 10750 C C    . GLU A 1 88 ? 177.906 -8.373  -9.685  1.00 0.00 ? 87 GLU A C    7  
ATOM 10751 O O    . GLU A 1 88 ? 177.007 -7.536  -9.579  1.00 0.00 ? 87 GLU A O    7  
ATOM 10752 C CB   . GLU A 1 88 ? 178.110 -10.348 -8.144  1.00 0.00 ? 87 GLU A CB   7  
ATOM 10753 C CG   . GLU A 1 88 ? 179.086 -11.436 -8.578  1.00 0.00 ? 87 GLU A CG   7  
ATOM 10754 C CD   . GLU A 1 88 ? 179.921 -11.984 -7.432  1.00 0.00 ? 87 GLU A CD   7  
ATOM 10755 O OE1  . GLU A 1 88 ? 179.364 -12.197 -6.334  1.00 0.00 ? 87 GLU A OE1  7  
ATOM 10756 O OE2  . GLU A 1 88 ? 181.133 -12.208 -7.638  1.00 0.00 ? 87 GLU A OE2  7  
ATOM 10757 H H    . GLU A 1 88 ? 177.433 -7.790  -7.096  1.00 0.00 ? 87 GLU A H    7  
ATOM 10758 H HA   . GLU A 1 88 ? 179.666 -8.949  -8.615  1.00 0.00 ? 87 GLU A HA   7  
ATOM 10759 H HB2  . GLU A 1 88 ? 177.944 -10.445 -7.082  1.00 0.00 ? 87 GLU A HB2  7  
ATOM 10760 H HB3  . GLU A 1 88 ? 177.174 -10.509 -8.660  1.00 0.00 ? 87 GLU A HB3  7  
ATOM 10761 H HG2  . GLU A 1 88 ? 178.526 -12.250 -9.012  1.00 0.00 ? 87 GLU A HG2  7  
ATOM 10762 H HG3  . GLU A 1 88 ? 179.752 -11.024 -9.323  1.00 0.00 ? 87 GLU A HG3  7  
ATOM 10763 N N    . HIS A 1 89 ? 178.334 -8.843  -10.859 1.00 0.00 ? 88 HIS A N    7  
ATOM 10764 C CA   . HIS A 1 89 ? 177.766 -8.399  -12.136 1.00 0.00 ? 88 HIS A CA   7  
ATOM 10765 C C    . HIS A 1 89 ? 178.158 -6.954  -12.442 1.00 0.00 ? 88 HIS A C    7  
ATOM 10766 O O    . HIS A 1 89 ? 178.318 -6.136  -11.534 1.00 0.00 ? 88 HIS A O    7  
ATOM 10767 C CB   . HIS A 1 89 ? 176.238 -8.534  -12.131 1.00 0.00 ? 88 HIS A CB   7  
ATOM 10768 C CG   . HIS A 1 89 ? 175.726 -9.615  -13.032 1.00 0.00 ? 88 HIS A CG   7  
ATOM 10769 N ND1  . HIS A 1 89 ? 176.086 -9.726  -14.360 1.00 0.00 ? 88 HIS A ND1  7  
ATOM 10770 C CD2  . HIS A 1 89 ? 174.871 -10.636 -12.790 1.00 0.00 ? 88 HIS A CD2  7  
ATOM 10771 C CE1  . HIS A 1 89 ? 175.475 -10.769 -14.893 1.00 0.00 ? 88 HIS A CE1  7  
ATOM 10772 N NE2  . HIS A 1 89 ? 174.733 -11.337 -13.961 1.00 0.00 ? 88 HIS A NE2  7  
ATOM 10773 H H    . HIS A 1 89 ? 179.057 -9.505  -10.868 1.00 0.00 ? 88 HIS A H    7  
ATOM 10774 H HA   . HIS A 1 89 ? 178.168 -9.035  -12.910 1.00 0.00 ? 88 HIS A HA   7  
ATOM 10775 H HB2  . HIS A 1 89 ? 175.904 -8.754  -11.128 1.00 0.00 ? 88 HIS A HB2  7  
ATOM 10776 H HB3  . HIS A 1 89 ? 175.800 -7.600  -12.451 1.00 0.00 ? 88 HIS A HB3  7  
ATOM 10777 H HD1  . HIS A 1 89 ? 176.695 -9.128  -14.840 1.00 0.00 ? 88 HIS A HD1  7  
ATOM 10778 H HD2  . HIS A 1 89 ? 174.387 -10.858 -11.847 1.00 0.00 ? 88 HIS A HD2  7  
ATOM 10779 H HE1  . HIS A 1 89 ? 175.569 -11.103 -15.916 1.00 0.00 ? 88 HIS A HE1  7  
ATOM 10780 H HE2  . HIS A 1 89 ? 174.216 -12.163 -14.074 1.00 0.00 ? 88 HIS A HE2  7  
ATOM 10781 N N    . HIS A 1 90 ? 178.311 -6.647  -13.730 1.00 0.00 ? 89 HIS A N    7  
ATOM 10782 C CA   . HIS A 1 90 ? 178.685 -5.301  -14.161 1.00 0.00 ? 89 HIS A CA   7  
ATOM 10783 C C    . HIS A 1 90 ? 177.838 -4.851  -15.353 1.00 0.00 ? 89 HIS A C    7  
ATOM 10784 O O    . HIS A 1 90 ? 177.291 -3.748  -15.352 1.00 0.00 ? 89 HIS A O    7  
ATOM 10785 C CB   . HIS A 1 90 ? 180.173 -5.254  -14.527 1.00 0.00 ? 89 HIS A CB   7  
ATOM 10786 C CG   . HIS A 1 90 ? 181.049 -4.724  -13.431 1.00 0.00 ? 89 HIS A CG   7  
ATOM 10787 N ND1  . HIS A 1 90 ? 181.895 -3.647  -13.598 1.00 0.00 ? 89 HIS A ND1  7  
ATOM 10788 C CD2  . HIS A 1 90 ? 181.209 -5.129  -12.148 1.00 0.00 ? 89 HIS A CD2  7  
ATOM 10789 C CE1  . HIS A 1 90 ? 182.536 -3.414  -12.466 1.00 0.00 ? 89 HIS A CE1  7  
ATOM 10790 N NE2  . HIS A 1 90 ? 182.137 -4.298  -11.570 1.00 0.00 ? 89 HIS A NE2  7  
ATOM 10791 H H    . HIS A 1 90 ? 178.170 -7.342  -14.405 1.00 0.00 ? 89 HIS A H    7  
ATOM 10792 H HA   . HIS A 1 90 ? 178.506 -4.628  -13.336 1.00 0.00 ? 89 HIS A HA   7  
ATOM 10793 H HB2  . HIS A 1 90 ? 180.508 -6.251  -14.766 1.00 0.00 ? 89 HIS A HB2  7  
ATOM 10794 H HB3  . HIS A 1 90 ? 180.303 -4.620  -15.392 1.00 0.00 ? 89 HIS A HB3  7  
ATOM 10795 H HD1  . HIS A 1 90 ? 182.009 -3.130  -14.423 1.00 0.00 ? 89 HIS A HD1  7  
ATOM 10796 H HD2  . HIS A 1 90 ? 180.700 -5.953  -11.669 1.00 0.00 ? 89 HIS A HD2  7  
ATOM 10797 H HE1  . HIS A 1 90 ? 183.263 -2.631  -12.301 1.00 0.00 ? 89 HIS A HE1  7  
ATOM 10798 H HE2  . HIS A 1 90 ? 182.353 -4.268  -10.615 1.00 0.00 ? 89 HIS A HE2  7  
ATOM 10799 N N    . HIS A 1 91 ? 177.737 -5.712  -16.368 1.00 0.00 ? 90 HIS A N    7  
ATOM 10800 C CA   . HIS A 1 91 ? 176.958 -5.402  -17.564 1.00 0.00 ? 90 HIS A CA   7  
ATOM 10801 C C    . HIS A 1 91 ? 176.698 -6.662  -18.390 1.00 0.00 ? 90 HIS A C    7  
ATOM 10802 O O    . HIS A 1 91 ? 177.633 -7.302  -18.876 1.00 0.00 ? 90 HIS A O    7  
ATOM 10803 C CB   . HIS A 1 91 ? 177.673 -4.345  -18.419 1.00 0.00 ? 90 HIS A CB   7  
ATOM 10804 C CG   . HIS A 1 91 ? 179.000 -4.786  -18.967 1.00 0.00 ? 90 HIS A CG   7  
ATOM 10805 N ND1  . HIS A 1 91 ? 180.008 -5.316  -18.183 1.00 0.00 ? 90 HIS A ND1  7  
ATOM 10806 C CD2  . HIS A 1 91 ? 179.482 -4.772  -20.232 1.00 0.00 ? 90 HIS A CD2  7  
ATOM 10807 C CE1  . HIS A 1 91 ? 181.049 -5.604  -18.943 1.00 0.00 ? 90 HIS A CE1  7  
ATOM 10808 N NE2  . HIS A 1 91 ? 180.755 -5.285  -20.189 1.00 0.00 ? 90 HIS A NE2  7  
ATOM 10809 H H    . HIS A 1 91 ? 178.197 -6.576  -16.311 1.00 0.00 ? 90 HIS A H    7  
ATOM 10810 H HA   . HIS A 1 91 ? 176.008 -5.003  -17.241 1.00 0.00 ? 90 HIS A HA   7  
ATOM 10811 H HB2  . HIS A 1 91 ? 177.042 -4.086  -19.256 1.00 0.00 ? 90 HIS A HB2  7  
ATOM 10812 H HB3  . HIS A 1 91 ? 177.839 -3.463  -17.818 1.00 0.00 ? 90 HIS A HB3  7  
ATOM 10813 H HD1  . HIS A 1 91 ? 179.966 -5.458  -17.217 1.00 0.00 ? 90 HIS A HD1  7  
ATOM 10814 H HD2  . HIS A 1 91 ? 178.962 -4.418  -21.112 1.00 0.00 ? 90 HIS A HD2  7  
ATOM 10815 H HE1  . HIS A 1 91 ? 181.982 -6.027  -18.603 1.00 0.00 ? 90 HIS A HE1  7  
ATOM 10816 H HE2  . HIS A 1 91 ? 181.374 -5.339  -20.948 1.00 0.00 ? 90 HIS A HE2  7  
ATOM 10817 N N    . HIS A 1 92 ? 175.423 -7.015  -18.544 1.00 0.00 ? 91 HIS A N    7  
ATOM 10818 C CA   . HIS A 1 92 ? 175.045 -8.198  -19.311 1.00 0.00 ? 91 HIS A CA   7  
ATOM 10819 C C    . HIS A 1 92 ? 173.789 -7.939  -20.140 1.00 0.00 ? 91 HIS A C    7  
ATOM 10820 O O    . HIS A 1 92 ? 172.704 -7.736  -19.592 1.00 0.00 ? 91 HIS A O    7  
ATOM 10821 C CB   . HIS A 1 92 ? 174.819 -9.391  -18.380 1.00 0.00 ? 91 HIS A CB   7  
ATOM 10822 C CG   . HIS A 1 92 ? 175.280 -10.691 -18.961 1.00 0.00 ? 91 HIS A CG   7  
ATOM 10823 N ND1  . HIS A 1 92 ? 174.847 -11.168 -20.182 1.00 0.00 ? 91 HIS A ND1  7  
ATOM 10824 C CD2  . HIS A 1 92 ? 176.146 -11.615 -18.484 1.00 0.00 ? 91 HIS A CD2  7  
ATOM 10825 C CE1  . HIS A 1 92 ? 175.426 -12.329 -20.429 1.00 0.00 ? 91 HIS A CE1  7  
ATOM 10826 N NE2  . HIS A 1 92 ? 176.219 -12.622 -19.415 1.00 0.00 ? 91 HIS A NE2  7  
ATOM 10827 H H    . HIS A 1 92 ? 174.721 -6.468  -18.132 1.00 0.00 ? 91 HIS A H    7  
ATOM 10828 H HA   . HIS A 1 92 ? 175.860 -8.428  -19.981 1.00 0.00 ? 91 HIS A HA   7  
ATOM 10829 H HB2  . HIS A 1 92 ? 175.357 -9.228  -17.458 1.00 0.00 ? 91 HIS A HB2  7  
ATOM 10830 H HB3  . HIS A 1 92 ? 173.763 -9.477  -18.166 1.00 0.00 ? 91 HIS A HB3  7  
ATOM 10831 H HD1  . HIS A 1 92 ? 174.210 -10.721 -20.778 1.00 0.00 ? 91 HIS A HD1  7  
ATOM 10832 H HD2  . HIS A 1 92 ? 176.682 -11.568 -17.546 1.00 0.00 ? 91 HIS A HD2  7  
ATOM 10833 H HE1  . HIS A 1 92 ? 175.278 -12.934 -21.310 1.00 0.00 ? 91 HIS A HE1  7  
ATOM 10834 H HE2  . HIS A 1 92 ? 176.712 -13.462 -19.307 1.00 0.00 ? 91 HIS A HE2  7  
ATOM 10835 N N    . HIS A 1 93 ? 173.945 -7.950  -21.463 1.00 0.00 ? 92 HIS A N    7  
ATOM 10836 C CA   . HIS A 1 93 ? 172.827 -7.720  -22.376 1.00 0.00 ? 92 HIS A CA   7  
ATOM 10837 C C    . HIS A 1 93 ? 173.158 -8.226  -23.779 1.00 0.00 ? 92 HIS A C    7  
ATOM 10838 O O    . HIS A 1 93 ? 174.308 -8.156  -24.216 1.00 0.00 ? 92 HIS A O    7  
ATOM 10839 C CB   . HIS A 1 93 ? 172.471 -6.228  -22.423 1.00 0.00 ? 92 HIS A CB   7  
ATOM 10840 C CG   . HIS A 1 93 ? 173.581 -5.356  -22.928 1.00 0.00 ? 92 HIS A CG   7  
ATOM 10841 N ND1  . HIS A 1 93 ? 173.611 -4.844  -24.208 1.00 0.00 ? 92 HIS A ND1  7  
ATOM 10842 C CD2  . HIS A 1 93 ? 174.704 -4.909  -22.319 1.00 0.00 ? 92 HIS A CD2  7  
ATOM 10843 C CE1  . HIS A 1 93 ? 174.705 -4.121  -24.364 1.00 0.00 ? 92 HIS A CE1  7  
ATOM 10844 N NE2  . HIS A 1 93 ? 175.385 -4.143  -23.233 1.00 0.00 ? 92 HIS A NE2  7  
ATOM 10845 H H    . HIS A 1 93 ? 174.837 -8.119  -21.836 1.00 0.00 ? 92 HIS A H    7  
ATOM 10846 H HA   . HIS A 1 93 ? 171.977 -8.271  -22.000 1.00 0.00 ? 92 HIS A HA   7  
ATOM 10847 H HB2  . HIS A 1 93 ? 171.621 -6.091  -23.074 1.00 0.00 ? 92 HIS A HB2  7  
ATOM 10848 H HB3  . HIS A 1 93 ? 172.212 -5.897  -21.429 1.00 0.00 ? 92 HIS A HB3  7  
ATOM 10849 H HD1  . HIS A 1 93 ? 172.933 -4.992  -24.900 1.00 0.00 ? 92 HIS A HD1  7  
ATOM 10850 H HD2  . HIS A 1 93 ? 175.008 -5.114  -21.302 1.00 0.00 ? 92 HIS A HD2  7  
ATOM 10851 H HE1  . HIS A 1 93 ? 174.992 -3.597  -25.264 1.00 0.00 ? 92 HIS A HE1  7  
ATOM 10852 H HE2  . HIS A 1 93 ? 176.287 -3.781  -23.111 1.00 0.00 ? 92 HIS A HE2  7  
ATOM 10853 N N    . HIS A 1 94 ? 172.145 -8.732  -24.479 1.00 0.00 ? 93 HIS A N    7  
ATOM 10854 C CA   . HIS A 1 94 ? 172.330 -9.249  -25.835 1.00 0.00 ? 93 HIS A CA   7  
ATOM 10855 C C    . HIS A 1 94 ? 171.717 -8.310  -26.875 1.00 0.00 ? 93 HIS A C    7  
ATOM 10856 O O    . HIS A 1 94 ? 172.106 -8.410  -28.057 1.00 0.00 ? 93 HIS A O    7  
ATOM 10857 C CB   . HIS A 1 94 ? 171.711 -10.645 -25.962 1.00 0.00 ? 93 HIS A CB   7  
ATOM 10858 C CG   . HIS A 1 94 ? 172.701 -11.761 -25.813 1.00 0.00 ? 93 HIS A CG   7  
ATOM 10859 N ND1  . HIS A 1 94 ? 172.562 -12.981 -26.444 1.00 0.00 ? 93 HIS A ND1  7  
ATOM 10860 C CD2  . HIS A 1 94 ? 173.851 -11.838 -25.100 1.00 0.00 ? 93 HIS A CD2  7  
ATOM 10861 C CE1  . HIS A 1 94 ? 173.582 -13.759 -26.124 1.00 0.00 ? 93 HIS A CE1  7  
ATOM 10862 N NE2  . HIS A 1 94 ? 174.376 -13.089 -25.311 1.00 0.00 ? 93 HIS A NE2  7  
ATOM 10863 O OXT  . HIS A 1 94 ? 170.855 -7.485  -26.500 1.00 0.00 ? 93 HIS A OXT  7  
ATOM 10864 H H    . HIS A 1 94 ? 171.251 -8.759  -24.077 1.00 0.00 ? 93 HIS A H    7  
ATOM 10865 H HA   . HIS A 1 94 ? 173.392 -9.319  -26.018 1.00 0.00 ? 93 HIS A HA   7  
ATOM 10866 H HB2  . HIS A 1 94 ? 170.958 -10.767 -25.198 1.00 0.00 ? 93 HIS A HB2  7  
ATOM 10867 H HB3  . HIS A 1 94 ? 171.248 -10.737 -26.934 1.00 0.00 ? 93 HIS A HB3  7  
ATOM 10868 H HD1  . HIS A 1 94 ? 171.826 -13.238 -27.037 1.00 0.00 ? 93 HIS A HD1  7  
ATOM 10869 H HD2  . HIS A 1 94 ? 174.274 -11.060 -24.480 1.00 0.00 ? 93 HIS A HD2  7  
ATOM 10870 H HE1  . HIS A 1 94 ? 173.738 -14.770 -26.469 1.00 0.00 ? 93 HIS A HE1  7  
ATOM 10871 H HE2  . HIS A 1 94 ? 175.191 -13.442 -24.897 1.00 0.00 ? 93 HIS A HE2  7  
ATOM 10872 N N    . GLN A 1 2  ? 136.883 -10.466 8.624   1.00 0.00 ? 1  GLN A N    8  
ATOM 10873 C CA   . GLN A 1 2  ? 138.003 -9.527  8.915   1.00 0.00 ? 1  GLN A CA   8  
ATOM 10874 C C    . GLN A 1 2  ? 139.211 -9.805  8.015   1.00 0.00 ? 1  GLN A C    8  
ATOM 10875 O O    . GLN A 1 2  ? 140.091 -10.595 8.364   1.00 0.00 ? 1  GLN A O    8  
ATOM 10876 C CB   . GLN A 1 2  ? 138.390 -9.668  10.393  1.00 0.00 ? 1  GLN A CB   8  
ATOM 10877 C CG   . GLN A 1 2  ? 137.616 -8.736  11.316  1.00 0.00 ? 1  GLN A CG   8  
ATOM 10878 C CD   . GLN A 1 2  ? 137.126 -9.421  12.579  1.00 0.00 ? 1  GLN A CD   8  
ATOM 10879 O OE1  . GLN A 1 2  ? 135.922 -9.506  12.823  1.00 0.00 ? 1  GLN A OE1  8  
ATOM 10880 N NE2  . GLN A 1 2  ? 138.055 -9.911  13.394  1.00 0.00 ? 1  GLN A NE2  8  
ATOM 10881 H HA   . GLN A 1 2  ? 137.658 -8.519  8.734   1.00 0.00 ? 1  GLN A HA   8  
ATOM 10882 H HB2  . GLN A 1 2  ? 138.207 -10.686 10.706  1.00 0.00 ? 1  GLN A HB2  8  
ATOM 10883 H HB3  . GLN A 1 2  ? 139.443 -9.452  10.499  1.00 0.00 ? 1  GLN A HB3  8  
ATOM 10884 H HG2  . GLN A 1 2  ? 138.258 -7.916  11.598  1.00 0.00 ? 1  GLN A HG2  8  
ATOM 10885 H HG3  . GLN A 1 2  ? 136.761 -8.351  10.779  1.00 0.00 ? 1  GLN A HG3  8  
ATOM 10886 H HE21 . GLN A 1 2  ? 138.996 -9.809  13.141  1.00 0.00 ? 1  GLN A HE21 8  
ATOM 10887 H HE22 . GLN A 1 2  ? 137.760 -10.353 14.218  1.00 0.00 ? 1  GLN A HE22 8  
ATOM 10888 N N    . SER A 1 3  ? 139.241 -9.150  6.852   1.00 0.00 ? 2  SER A N    8  
ATOM 10889 C CA   . SER A 1 3  ? 140.332 -9.323  5.894   1.00 0.00 ? 2  SER A CA   8  
ATOM 10890 C C    . SER A 1 3  ? 140.486 -8.087  5.005   1.00 0.00 ? 2  SER A C    8  
ATOM 10891 O O    . SER A 1 3  ? 139.664 -7.171  5.059   1.00 0.00 ? 2  SER A O    8  
ATOM 10892 C CB   . SER A 1 3  ? 140.075 -10.556 5.025   1.00 0.00 ? 2  SER A CB   8  
ATOM 10893 O OG   . SER A 1 3  ? 140.022 -11.735 5.811   1.00 0.00 ? 2  SER A OG   8  
ATOM 10894 H H    . SER A 1 3  ? 138.509 -8.537  6.629   1.00 0.00 ? 2  SER A H    8  
ATOM 10895 H HA   . SER A 1 3  ? 141.244 -9.469  6.450   1.00 0.00 ? 2  SER A HA   8  
ATOM 10896 H HB2  . SER A 1 3  ? 139.133 -10.439 4.511   1.00 0.00 ? 2  SER A HB2  8  
ATOM 10897 H HB3  . SER A 1 3  ? 140.869 -10.654 4.300   1.00 0.00 ? 2  SER A HB3  8  
ATOM 10898 H HG   . SER A 1 3  ? 140.862 -11.859 6.258   1.00 0.00 ? 2  SER A HG   8  
ATOM 10899 N N    . ASP A 1 4  ? 141.547 -8.077  4.185   1.00 0.00 ? 3  ASP A N    8  
ATOM 10900 C CA   . ASP A 1 4  ? 141.830 -6.966  3.268   1.00 0.00 ? 3  ASP A CA   8  
ATOM 10901 C C    . ASP A 1 4  ? 142.194 -5.691  4.028   1.00 0.00 ? 3  ASP A C    8  
ATOM 10902 O O    . ASP A 1 4  ? 141.342 -5.076  4.672   1.00 0.00 ? 3  ASP A O    8  
ATOM 10903 C CB   . ASP A 1 4  ? 140.636 -6.704  2.342   1.00 0.00 ? 3  ASP A CB   8  
ATOM 10904 C CG   . ASP A 1 4  ? 140.517 -7.739  1.239   1.00 0.00 ? 3  ASP A CG   8  
ATOM 10905 O OD1  . ASP A 1 4  ? 141.342 -7.707  0.302   1.00 0.00 ? 3  ASP A OD1  8  
ATOM 10906 O OD2  . ASP A 1 4  ? 139.599 -8.583  1.315   1.00 0.00 ? 3  ASP A OD2  8  
ATOM 10907 H H    . ASP A 1 4  ? 142.158 -8.844  4.196   1.00 0.00 ? 3  ASP A H    8  
ATOM 10908 H HA   . ASP A 1 4  ? 142.677 -7.255  2.663   1.00 0.00 ? 3  ASP A HA   8  
ATOM 10909 H HB2  . ASP A 1 4  ? 139.728 -6.718  2.923   1.00 0.00 ? 3  ASP A HB2  8  
ATOM 10910 H HB3  . ASP A 1 4  ? 140.750 -5.731  1.886   1.00 0.00 ? 3  ASP A HB3  8  
ATOM 10911 N N    . VAL A 1 5  ? 143.467 -5.298  3.942   1.00 0.00 ? 4  VAL A N    8  
ATOM 10912 C CA   . VAL A 1 5  ? 143.952 -4.093  4.616   1.00 0.00 ? 4  VAL A CA   8  
ATOM 10913 C C    . VAL A 1 5  ? 143.886 -2.883  3.686   1.00 0.00 ? 4  VAL A C    8  
ATOM 10914 O O    . VAL A 1 5  ? 144.350 -2.942  2.546   1.00 0.00 ? 4  VAL A O    8  
ATOM 10915 C CB   . VAL A 1 5  ? 145.407 -4.259  5.114   1.00 0.00 ? 4  VAL A CB   8  
ATOM 10916 C CG1  . VAL A 1 5  ? 145.808 -3.088  6.001   1.00 0.00 ? 4  VAL A CG1  8  
ATOM 10917 C CG2  . VAL A 1 5  ? 145.583 -5.576  5.857   1.00 0.00 ? 4  VAL A CG2  8  
ATOM 10918 H H    . VAL A 1 5  ? 144.095 -5.831  3.409   1.00 0.00 ? 4  VAL A H    8  
ATOM 10919 H HA   . VAL A 1 5  ? 143.318 -3.912  5.473   1.00 0.00 ? 4  VAL A HA   8  
ATOM 10920 H HB   . VAL A 1 5  ? 146.061 -4.267  4.252   1.00 0.00 ? 4  VAL A HB   8  
ATOM 10921 H HG11 . VAL A 1 5  ? 146.859 -3.160  6.240   1.00 0.00 ? 4  VAL A HG11 8  
ATOM 10922 H HG12 . VAL A 1 5  ? 145.230 -3.113  6.912   1.00 0.00 ? 4  VAL A HG12 8  
ATOM 10923 H HG13 . VAL A 1 5  ? 145.620 -2.160  5.481   1.00 0.00 ? 4  VAL A HG13 8  
ATOM 10924 H HG21 . VAL A 1 5  ? 145.118 -6.372  5.296   1.00 0.00 ? 4  VAL A HG21 8  
ATOM 10925 H HG22 . VAL A 1 5  ? 145.122 -5.503  6.830   1.00 0.00 ? 4  VAL A HG22 8  
ATOM 10926 H HG23 . VAL A 1 5  ? 146.637 -5.785  5.973   1.00 0.00 ? 4  VAL A HG23 8  
ATOM 10927 N N    . ARG A 1 6  ? 143.311 -1.785  4.179   1.00 0.00 ? 5  ARG A N    8  
ATOM 10928 C CA   . ARG A 1 6  ? 143.193 -0.561  3.388   1.00 0.00 ? 5  ARG A CA   8  
ATOM 10929 C C    . ARG A 1 6  ? 144.446 0.302   3.535   1.00 0.00 ? 5  ARG A C    8  
ATOM 10930 O O    . ARG A 1 6  ? 144.733 0.813   4.619   1.00 0.00 ? 5  ARG A O    8  
ATOM 10931 C CB   . ARG A 1 6  ? 141.957 0.239   3.813   1.00 0.00 ? 5  ARG A CB   8  
ATOM 10932 C CG   . ARG A 1 6  ? 140.685 -0.155  3.079   1.00 0.00 ? 5  ARG A CG   8  
ATOM 10933 C CD   . ARG A 1 6  ? 139.472 0.559   3.656   1.00 0.00 ? 5  ARG A CD   8  
ATOM 10934 N NE   . ARG A 1 6  ? 138.898 1.518   2.713   1.00 0.00 ? 5  ARG A NE   8  
ATOM 10935 C CZ   . ARG A 1 6  ? 138.112 1.179   1.687   1.00 0.00 ? 5  ARG A CZ   8  
ATOM 10936 N NH1  . ARG A 1 6  ? 137.814 -0.099  1.456   1.00 0.00 ? 5  ARG A NH1  8  
ATOM 10937 N NH2  . ARG A 1 6  ? 137.625 2.121   0.887   1.00 0.00 ? 5  ARG A NH2  8  
ATOM 10938 H H    . ARG A 1 6  ? 142.963 -1.798  5.096   1.00 0.00 ? 5  ARG A H    8  
ATOM 10939 H HA   . ARG A 1 6  ? 143.088 -0.847  2.352   1.00 0.00 ? 5  ARG A HA   8  
ATOM 10940 H HB2  . ARG A 1 6  ? 141.793 0.094   4.870   1.00 0.00 ? 5  ARG A HB2  8  
ATOM 10941 H HB3  . ARG A 1 6  ? 142.141 1.287   3.628   1.00 0.00 ? 5  ARG A HB3  8  
ATOM 10942 H HG2  . ARG A 1 6  ? 140.785 0.109   2.036   1.00 0.00 ? 5  ARG A HG2  8  
ATOM 10943 H HG3  . ARG A 1 6  ? 140.542 -1.221  3.171   1.00 0.00 ? 5  ARG A HG3  8  
ATOM 10944 H HD2  . ARG A 1 6  ? 138.723 -0.176  3.908   1.00 0.00 ? 5  ARG A HD2  8  
ATOM 10945 H HD3  . ARG A 1 6  ? 139.772 1.085   4.551   1.00 0.00 ? 5  ARG A HD3  8  
ATOM 10946 H HE   . ARG A 1 6  ? 139.104 2.467   2.855   1.00 0.00 ? 5  ARG A HE   8  
ATOM 10947 H HH11 . ARG A 1 6  ? 138.179 -0.816  2.051   1.00 0.00 ? 5  ARG A HH11 8  
ATOM 10948 H HH12 . ARG A 1 6  ? 137.224 -0.344  0.686   1.00 0.00 ? 5  ARG A HH12 8  
ATOM 10949 H HH21 . ARG A 1 6  ? 137.846 3.082   1.053   1.00 0.00 ? 5  ARG A HH21 8  
ATOM 10950 H HH22 . ARG A 1 6  ? 137.035 1.871   0.118   1.00 0.00 ? 5  ARG A HH22 8  
ATOM 10951 N N    . ILE A 1 7  ? 145.191 0.459   2.440   1.00 0.00 ? 6  ILE A N    8  
ATOM 10952 C CA   . ILE A 1 7  ? 146.416 1.259   2.451   1.00 0.00 ? 6  ILE A CA   8  
ATOM 10953 C C    . ILE A 1 7  ? 146.214 2.590   1.726   1.00 0.00 ? 6  ILE A C    8  
ATOM 10954 O O    . ILE A 1 7  ? 145.822 2.616   0.557   1.00 0.00 ? 6  ILE A O    8  
ATOM 10955 C CB   . ILE A 1 7  ? 147.594 0.497   1.797   1.00 0.00 ? 6  ILE A CB   8  
ATOM 10956 C CG1  . ILE A 1 7  ? 147.670 -0.939  2.329   1.00 0.00 ? 6  ILE A CG1  8  
ATOM 10957 C CG2  . ILE A 1 7  ? 148.912 1.227   2.038   1.00 0.00 ? 6  ILE A CG2  8  
ATOM 10958 C CD1  . ILE A 1 7  ? 147.928 -1.028  3.821   1.00 0.00 ? 6  ILE A CD1  8  
ATOM 10959 H H    . ILE A 1 7  ? 144.912 0.025   1.605   1.00 0.00 ? 6  ILE A H    8  
ATOM 10960 H HA   . ILE A 1 7  ? 146.673 1.457   3.481   1.00 0.00 ? 6  ILE A HA   8  
ATOM 10961 H HB   . ILE A 1 7  ? 147.422 0.466   0.731   1.00 0.00 ? 6  ILE A HB   8  
ATOM 10962 H HG12 . ILE A 1 7  ? 146.737 -1.441  2.125   1.00 0.00 ? 6  ILE A HG12 8  
ATOM 10963 H HG13 . ILE A 1 7  ? 148.470 -1.460  1.822   1.00 0.00 ? 6  ILE A HG13 8  
ATOM 10964 H HG21 . ILE A 1 7  ? 148.719 2.270   2.237   1.00 0.00 ? 6  ILE A HG21 8  
ATOM 10965 H HG22 . ILE A 1 7  ? 149.536 1.139   1.161   1.00 0.00 ? 6  ILE A HG22 8  
ATOM 10966 H HG23 . ILE A 1 7  ? 149.419 0.786   2.884   1.00 0.00 ? 6  ILE A HG23 8  
ATOM 10967 H HD11 . ILE A 1 7  ? 148.990 -0.966  4.008   1.00 0.00 ? 6  ILE A HD11 8  
ATOM 10968 H HD12 . ILE A 1 7  ? 147.551 -1.969  4.195   1.00 0.00 ? 6  ILE A HD12 8  
ATOM 10969 H HD13 . ILE A 1 7  ? 147.426 -0.215  4.323   1.00 0.00 ? 6  ILE A HD13 8  
ATOM 10970 N N    . LYS A 1 8  ? 146.488 3.693   2.427   1.00 0.00 ? 7  LYS A N    8  
ATOM 10971 C CA   . LYS A 1 8  ? 146.343 5.030   1.852   1.00 0.00 ? 7  LYS A CA   8  
ATOM 10972 C C    . LYS A 1 8  ? 147.711 5.664   1.604   1.00 0.00 ? 7  LYS A C    8  
ATOM 10973 O O    . LYS A 1 8  ? 148.434 5.992   2.547   1.00 0.00 ? 7  LYS A O    8  
ATOM 10974 C CB   . LYS A 1 8  ? 145.508 5.924   2.777   1.00 0.00 ? 7  LYS A CB   8  
ATOM 10975 C CG   . LYS A 1 8  ? 145.269 7.322   2.223   1.00 0.00 ? 7  LYS A CG   8  
ATOM 10976 C CD   . LYS A 1 8  ? 143.889 7.448   1.595   1.00 0.00 ? 7  LYS A CD   8  
ATOM 10977 C CE   . LYS A 1 8  ? 143.062 8.533   2.270   1.00 0.00 ? 7  LYS A CE   8  
ATOM 10978 N NZ   . LYS A 1 8  ? 141.626 8.151   2.383   1.00 0.00 ? 7  LYS A NZ   8  
ATOM 10979 H H    . LYS A 1 8  ? 146.800 3.604   3.353   1.00 0.00 ? 7  LYS A H    8  
ATOM 10980 H HA   . LYS A 1 8  ? 145.831 4.930   0.907   1.00 0.00 ? 7  LYS A HA   8  
ATOM 10981 H HB2  . LYS A 1 8  ? 144.549 5.455   2.940   1.00 0.00 ? 7  LYS A HB2  8  
ATOM 10982 H HB3  . LYS A 1 8  ? 146.018 6.018   3.724   1.00 0.00 ? 7  LYS A HB3  8  
ATOM 10983 H HG2  . LYS A 1 8  ? 145.355 8.037   3.026   1.00 0.00 ? 7  LYS A HG2  8  
ATOM 10984 H HG3  . LYS A 1 8  ? 146.016 7.534   1.471   1.00 0.00 ? 7  LYS A HG3  8  
ATOM 10985 H HD2  . LYS A 1 8  ? 144.002 7.695   0.550   1.00 0.00 ? 7  LYS A HD2  8  
ATOM 10986 H HD3  . LYS A 1 8  ? 143.375 6.504   1.691   1.00 0.00 ? 7  LYS A HD3  8  
ATOM 10987 H HE2  . LYS A 1 8  ? 143.456 8.706   3.260   1.00 0.00 ? 7  LYS A HE2  8  
ATOM 10988 H HE3  . LYS A 1 8  ? 143.140 9.441   1.689   1.00 0.00 ? 7  LYS A HE3  8  
ATOM 10989 H HZ1  . LYS A 1 8  ? 141.185 8.132   1.440   1.00 0.00 ? 7  LYS A HZ1  8  
ATOM 10990 H HZ2  . LYS A 1 8  ? 141.119 8.840   2.975   1.00 0.00 ? 7  LYS A HZ2  8  
ATOM 10991 H HZ3  . LYS A 1 8  ? 141.537 7.209   2.814   1.00 0.00 ? 7  LYS A HZ3  8  
ATOM 10992 N N    . PHE A 1 9  ? 148.061 5.837   0.330   1.00 0.00 ? 8  PHE A N    8  
ATOM 10993 C CA   . PHE A 1 9  ? 149.344 6.432   -0.037  1.00 0.00 ? 8  PHE A CA   8  
ATOM 10994 C C    . PHE A 1 9  ? 149.151 7.754   -0.779  1.00 0.00 ? 8  PHE A C    8  
ATOM 10995 O O    . PHE A 1 9  ? 148.157 7.944   -1.484  1.00 0.00 ? 8  PHE A O    8  
ATOM 10996 C CB   . PHE A 1 9  ? 150.172 5.461   -0.892  1.00 0.00 ? 8  PHE A CB   8  
ATOM 10997 C CG   . PHE A 1 9  ? 149.405 4.814   -2.016  1.00 0.00 ? 8  PHE A CG   8  
ATOM 10998 C CD1  . PHE A 1 9  ? 148.600 3.710   -1.781  1.00 0.00 ? 8  PHE A CD1  8  
ATOM 10999 C CD2  . PHE A 1 9  ? 149.496 5.308   -3.307  1.00 0.00 ? 8  PHE A CD2  8  
ATOM 11000 C CE1  . PHE A 1 9  ? 147.899 3.116   -2.812  1.00 0.00 ? 8  PHE A CE1  8  
ATOM 11001 C CE2  . PHE A 1 9  ? 148.799 4.716   -4.341  1.00 0.00 ? 8  PHE A CE2  8  
ATOM 11002 C CZ   . PHE A 1 9  ? 147.999 3.619   -4.094  1.00 0.00 ? 8  PHE A CZ   8  
ATOM 11003 H H    . PHE A 1 9  ? 147.442 5.560   -0.379  1.00 0.00 ? 8  PHE A H    8  
ATOM 11004 H HA   . PHE A 1 9  ? 149.882 6.632   0.877   1.00 0.00 ? 8  PHE A HA   8  
ATOM 11005 H HB2  . PHE A 1 9  ? 151.003 5.996   -1.326  1.00 0.00 ? 8  PHE A HB2  8  
ATOM 11006 H HB3  . PHE A 1 9  ? 150.554 4.676   -0.256  1.00 0.00 ? 8  PHE A HB3  8  
ATOM 11007 H HD1  . PHE A 1 9  ? 148.521 3.316   -0.779  1.00 0.00 ? 8  PHE A HD1  8  
ATOM 11008 H HD2  . PHE A 1 9  ? 150.121 6.167   -3.503  1.00 0.00 ? 8  PHE A HD2  8  
ATOM 11009 H HE1  . PHE A 1 9  ? 147.274 2.257   -2.614  1.00 0.00 ? 8  PHE A HE1  8  
ATOM 11010 H HE2  . PHE A 1 9  ? 148.879 5.112   -5.344  1.00 0.00 ? 8  PHE A HE2  8  
ATOM 11011 H HZ   . PHE A 1 9  ? 147.452 3.155   -4.902  1.00 0.00 ? 8  PHE A HZ   8  
ATOM 11012 N N    . GLU A 1 10 ? 150.111 8.665   -0.610  1.00 0.00 ? 9  GLU A N    8  
ATOM 11013 C CA   . GLU A 1 10 ? 150.055 9.972   -1.258  1.00 0.00 ? 9  GLU A CA   8  
ATOM 11014 C C    . GLU A 1 10 ? 151.233 10.164  -2.210  1.00 0.00 ? 9  GLU A C    8  
ATOM 11015 O O    . GLU A 1 10 ? 152.364 9.775   -1.906  1.00 0.00 ? 9  GLU A O    8  
ATOM 11016 C CB   . GLU A 1 10 ? 150.044 11.093  -0.212  1.00 0.00 ? 9  GLU A CB   8  
ATOM 11017 C CG   . GLU A 1 10 ? 149.738 12.467  -0.796  1.00 0.00 ? 9  GLU A CG   8  
ATOM 11018 C CD   . GLU A 1 10 ? 149.213 13.447  0.237   1.00 0.00 ? 9  GLU A CD   8  
ATOM 11019 O OE1  . GLU A 1 10 ? 148.148 13.176  0.830   1.00 0.00 ? 9  GLU A OE1  8  
ATOM 11020 O OE2  . GLU A 1 10 ? 149.866 14.490  0.451   1.00 0.00 ? 9  GLU A OE2  8  
ATOM 11021 H H    . GLU A 1 10 ? 150.876 8.451   -0.036  1.00 0.00 ? 9  GLU A H    8  
ATOM 11022 H HA   . GLU A 1 10 ? 149.140 10.018  -1.828  1.00 0.00 ? 9  GLU A HA   8  
ATOM 11023 H HB2  . GLU A 1 10 ? 149.296 10.866  0.534   1.00 0.00 ? 9  GLU A HB2  8  
ATOM 11024 H HB3  . GLU A 1 10 ? 151.013 11.136  0.265   1.00 0.00 ? 9  GLU A HB3  8  
ATOM 11025 H HG2  . GLU A 1 10 ? 150.644 12.871  -1.222  1.00 0.00 ? 9  GLU A HG2  8  
ATOM 11026 H HG3  . GLU A 1 10 ? 148.996 12.355  -1.574  1.00 0.00 ? 9  GLU A HG3  8  
ATOM 11027 N N    . HIS A 1 11 ? 150.956 10.767  -3.362  1.00 0.00 ? 10 HIS A N    8  
ATOM 11028 C CA   . HIS A 1 11 ? 151.978 11.019  -4.368  1.00 0.00 ? 10 HIS A CA   8  
ATOM 11029 C C    . HIS A 1 11 ? 151.693 12.326  -5.101  1.00 0.00 ? 10 HIS A C    8  
ATOM 11030 O O    . HIS A 1 11 ? 150.690 12.442  -5.806  1.00 0.00 ? 10 HIS A O    8  
ATOM 11031 C CB   . HIS A 1 11 ? 152.037 9.860   -5.365  1.00 0.00 ? 10 HIS A CB   8  
ATOM 11032 C CG   . HIS A 1 11 ? 153.097 10.018  -6.410  1.00 0.00 ? 10 HIS A CG   8  
ATOM 11033 N ND1  . HIS A 1 11 ? 152.819 10.328  -7.724  1.00 0.00 ? 10 HIS A ND1  8  
ATOM 11034 C CD2  . HIS A 1 11 ? 154.442 9.901   -6.328  1.00 0.00 ? 10 HIS A CD2  8  
ATOM 11035 C CE1  . HIS A 1 11 ? 153.949 10.390  -8.407  1.00 0.00 ? 10 HIS A CE1  8  
ATOM 11036 N NE2  . HIS A 1 11 ? 154.947 10.137  -7.582  1.00 0.00 ? 10 HIS A NE2  8  
ATOM 11037 H H    . HIS A 1 11 ? 150.034 11.051  -3.540  1.00 0.00 ? 10 HIS A H    8  
ATOM 11038 H HA   . HIS A 1 11 ? 152.930 11.100  -3.863  1.00 0.00 ? 10 HIS A HA   8  
ATOM 11039 H HB2  . HIS A 1 11 ? 152.233 8.944   -4.829  1.00 0.00 ? 10 HIS A HB2  8  
ATOM 11040 H HB3  . HIS A 1 11 ? 151.083 9.780   -5.867  1.00 0.00 ? 10 HIS A HB3  8  
ATOM 11041 H HD1  . HIS A 1 11 ? 151.928 10.485  -8.100  1.00 0.00 ? 10 HIS A HD1  8  
ATOM 11042 H HD2  . HIS A 1 11 ? 155.012 9.667   -5.442  1.00 0.00 ? 10 HIS A HD2  8  
ATOM 11043 H HE1  . HIS A 1 11 ? 154.039 10.607  -9.462  1.00 0.00 ? 10 HIS A HE1  8  
ATOM 11044 H HE2  . HIS A 1 11 ? 155.891 10.077  -7.837  1.00 0.00 ? 10 HIS A HE2  8  
ATOM 11045 N N    . ASN A 1 12 ? 152.580 13.306  -4.926  1.00 0.00 ? 11 ASN A N    8  
ATOM 11046 C CA   . ASN A 1 12 ? 152.428 14.612  -5.568  1.00 0.00 ? 11 ASN A CA   8  
ATOM 11047 C C    . ASN A 1 12 ? 151.106 15.277  -5.163  1.00 0.00 ? 11 ASN A C    8  
ATOM 11048 O O    . ASN A 1 12 ? 150.477 15.973  -5.965  1.00 0.00 ? 11 ASN A O    8  
ATOM 11049 C CB   . ASN A 1 12 ? 152.503 14.466  -7.093  1.00 0.00 ? 11 ASN A CB   8  
ATOM 11050 C CG   . ASN A 1 12 ? 153.277 15.596  -7.744  1.00 0.00 ? 11 ASN A CG   8  
ATOM 11051 O OD1  . ASN A 1 12 ? 154.402 15.901  -7.348  1.00 0.00 ? 11 ASN A OD1  8  
ATOM 11052 N ND2  . ASN A 1 12 ? 152.680 16.225  -8.751  1.00 0.00 ? 11 ASN A ND2  8  
ATOM 11053 H H    . ASN A 1 12 ? 153.357 13.148  -4.350  1.00 0.00 ? 11 ASN A H    8  
ATOM 11054 H HA   . ASN A 1 12 ? 153.244 15.237  -5.236  1.00 0.00 ? 11 ASN A HA   8  
ATOM 11055 H HB2  . ASN A 1 12 ? 152.991 13.534  -7.335  1.00 0.00 ? 11 ASN A HB2  8  
ATOM 11056 H HB3  . ASN A 1 12 ? 151.501 14.460  -7.497  1.00 0.00 ? 11 ASN A HB3  8  
ATOM 11057 H HD21 . ASN A 1 12 ? 151.784 15.929  -9.016  1.00 0.00 ? 11 ASN A HD21 8  
ATOM 11058 H HD22 . ASN A 1 12 ? 153.160 16.959  -9.186  1.00 0.00 ? 11 ASN A HD22 8  
ATOM 11059 N N    . GLY A 1 13 ? 150.692 15.058  -3.912  1.00 0.00 ? 12 GLY A N    8  
ATOM 11060 C CA   . GLY A 1 13 ? 149.452 15.638  -3.419  1.00 0.00 ? 12 GLY A CA   8  
ATOM 11061 C C    . GLY A 1 13 ? 148.214 14.841  -3.822  1.00 0.00 ? 12 GLY A C    8  
ATOM 11062 O O    . GLY A 1 13 ? 147.091 15.325  -3.673  1.00 0.00 ? 12 GLY A O    8  
ATOM 11063 H H    . GLY A 1 13 ? 151.233 14.499  -3.318  1.00 0.00 ? 12 GLY A H    8  
ATOM 11064 H HA2  . GLY A 1 13 ? 149.496 15.687  -2.341  1.00 0.00 ? 12 GLY A HA2  8  
ATOM 11065 H HA3  . GLY A 1 13 ? 149.360 16.642  -3.807  1.00 0.00 ? 12 GLY A HA3  8  
ATOM 11066 N N    . GLU A 1 14 ? 148.415 13.619  -4.328  1.00 0.00 ? 13 GLU A N    8  
ATOM 11067 C CA   . GLU A 1 14 ? 147.305 12.762  -4.745  1.00 0.00 ? 13 GLU A CA   8  
ATOM 11068 C C    . GLU A 1 14 ? 147.171 11.560  -3.814  1.00 0.00 ? 13 GLU A C    8  
ATOM 11069 O O    . GLU A 1 14 ? 148.114 10.784  -3.652  1.00 0.00 ? 13 GLU A O    8  
ATOM 11070 C CB   . GLU A 1 14 ? 147.511 12.286  -6.187  1.00 0.00 ? 13 GLU A CB   8  
ATOM 11071 C CG   . GLU A 1 14 ? 147.386 13.395  -7.222  1.00 0.00 ? 13 GLU A CG   8  
ATOM 11072 C CD   . GLU A 1 14 ? 145.956 13.609  -7.680  1.00 0.00 ? 13 GLU A CD   8  
ATOM 11073 O OE1  . GLU A 1 14 ? 145.436 12.752  -8.427  1.00 0.00 ? 13 GLU A OE1  8  
ATOM 11074 O OE2  . GLU A 1 14 ? 145.356 14.633  -7.291  1.00 0.00 ? 13 GLU A OE2  8  
ATOM 11075 H H    . GLU A 1 14 ? 149.330 13.283  -4.420  1.00 0.00 ? 13 GLU A H    8  
ATOM 11076 H HA   . GLU A 1 14 ? 146.397 13.346  -4.694  1.00 0.00 ? 13 GLU A HA   8  
ATOM 11077 H HB2  . GLU A 1 14 ? 148.496 11.852  -6.275  1.00 0.00 ? 13 GLU A HB2  8  
ATOM 11078 H HB3  . GLU A 1 14 ? 146.773 11.530  -6.412  1.00 0.00 ? 13 GLU A HB3  8  
ATOM 11079 H HG2  . GLU A 1 14 ? 147.750 14.315  -6.790  1.00 0.00 ? 13 GLU A HG2  8  
ATOM 11080 H HG3  . GLU A 1 14 ? 147.989 13.138  -8.080  1.00 0.00 ? 13 GLU A HG3  8  
ATOM 11081 N N    . ARG A 1 15 ? 145.994 11.414  -3.201  1.00 0.00 ? 14 ARG A N    8  
ATOM 11082 C CA   . ARG A 1 15 ? 145.735 10.306  -2.280  1.00 0.00 ? 14 ARG A CA   8  
ATOM 11083 C C    . ARG A 1 15 ? 145.094 9.124   -3.006  1.00 0.00 ? 14 ARG A C    8  
ATOM 11084 O O    . ARG A 1 15 ? 144.230 9.307   -3.865  1.00 0.00 ? 14 ARG A O    8  
ATOM 11085 C CB   . ARG A 1 15 ? 144.828 10.758  -1.129  1.00 0.00 ? 14 ARG A CB   8  
ATOM 11086 C CG   . ARG A 1 15 ? 145.452 11.820  -0.237  1.00 0.00 ? 14 ARG A CG   8  
ATOM 11087 C CD   . ARG A 1 15 ? 145.196 13.222  -0.771  1.00 0.00 ? 14 ARG A CD   8  
ATOM 11088 N NE   . ARG A 1 15 ? 145.376 14.243  0.260   1.00 0.00 ? 14 ARG A NE   8  
ATOM 11089 C CZ   . ARG A 1 15 ? 144.464 14.534  1.193   1.00 0.00 ? 14 ARG A CZ   8  
ATOM 11090 N NH1  . ARG A 1 15 ? 143.308 13.874  1.238   1.00 0.00 ? 14 ARG A NH1  8  
ATOM 11091 N NH2  . ARG A 1 15 ? 144.712 15.486  2.087   1.00 0.00 ? 14 ARG A NH2  8  
ATOM 11092 H H    . ARG A 1 15 ? 145.283 12.068  -3.371  1.00 0.00 ? 14 ARG A H    8  
ATOM 11093 H HA   . ARG A 1 15 ? 146.684 9.989   -1.873  1.00 0.00 ? 14 ARG A HA   8  
ATOM 11094 H HB2  . ARG A 1 15 ? 143.912 11.156  -1.540  1.00 0.00 ? 14 ARG A HB2  8  
ATOM 11095 H HB3  . ARG A 1 15 ? 144.593 9.900   -0.516  1.00 0.00 ? 14 ARG A HB3  8  
ATOM 11096 H HG2  . ARG A 1 15 ? 145.026 11.740  0.751   1.00 0.00 ? 14 ARG A HG2  8  
ATOM 11097 H HG3  . ARG A 1 15 ? 146.518 11.653  -0.187  1.00 0.00 ? 14 ARG A HG3  8  
ATOM 11098 H HD2  . ARG A 1 15 ? 145.885 13.418  -1.580  1.00 0.00 ? 14 ARG A HD2  8  
ATOM 11099 H HD3  . ARG A 1 15 ? 144.183 13.274  -1.143  1.00 0.00 ? 14 ARG A HD3  8  
ATOM 11100 H HE   . ARG A 1 15 ? 146.221 14.742  0.257   1.00 0.00 ? 14 ARG A HE   8  
ATOM 11101 H HH11 . ARG A 1 15 ? 143.115 13.154  0.573   1.00 0.00 ? 14 ARG A HH11 8  
ATOM 11102 H HH12 . ARG A 1 15 ? 142.630 14.100  1.939   1.00 0.00 ? 14 ARG A HH12 8  
ATOM 11103 H HH21 . ARG A 1 15 ? 145.580 15.983  2.061   1.00 0.00 ? 14 ARG A HH21 8  
ATOM 11104 H HH22 . ARG A 1 15 ? 144.030 15.708  2.785   1.00 0.00 ? 14 ARG A HH22 8  
ATOM 11105 N N    . ARG A 1 16 ? 145.523 7.911   -2.653  1.00 0.00 ? 15 ARG A N    8  
ATOM 11106 C CA   . ARG A 1 16 ? 144.990 6.697   -3.268  1.00 0.00 ? 15 ARG A CA   8  
ATOM 11107 C C    . ARG A 1 16 ? 144.777 5.598   -2.226  1.00 0.00 ? 15 ARG A C    8  
ATOM 11108 O O    . ARG A 1 16 ? 145.626 5.380   -1.359  1.00 0.00 ? 15 ARG A O    8  
ATOM 11109 C CB   . ARG A 1 16 ? 145.934 6.200   -4.367  1.00 0.00 ? 15 ARG A CB   8  
ATOM 11110 C CG   . ARG A 1 16 ? 145.724 6.878   -5.711  1.00 0.00 ? 15 ARG A CG   8  
ATOM 11111 C CD   . ARG A 1 16 ? 144.470 6.366   -6.403  1.00 0.00 ? 15 ARG A CD   8  
ATOM 11112 N NE   . ARG A 1 16 ? 144.022 7.264   -7.468  1.00 0.00 ? 15 ARG A NE   8  
ATOM 11113 C CZ   . ARG A 1 16 ? 142.796 7.243   -7.999  1.00 0.00 ? 15 ARG A CZ   8  
ATOM 11114 N NH1  . ARG A 1 16 ? 141.888 6.368   -7.572  1.00 0.00 ? 15 ARG A NH1  8  
ATOM 11115 N NH2  . ARG A 1 16 ? 142.478 8.101   -8.962  1.00 0.00 ? 15 ARG A NH2  8  
ATOM 11116 H H    . ARG A 1 16 ? 146.214 7.830   -1.961  1.00 0.00 ? 15 ARG A H    8  
ATOM 11117 H HA   . ARG A 1 16 ? 144.036 6.944   -3.710  1.00 0.00 ? 15 ARG A HA   8  
ATOM 11118 H HB2  . ARG A 1 16 ? 146.953 6.377   -4.056  1.00 0.00 ? 15 ARG A HB2  8  
ATOM 11119 H HB3  . ARG A 1 16 ? 145.787 5.138   -4.498  1.00 0.00 ? 15 ARG A HB3  8  
ATOM 11120 H HG2  . ARG A 1 16 ? 145.629 7.943   -5.556  1.00 0.00 ? 15 ARG A HG2  8  
ATOM 11121 H HG3  . ARG A 1 16 ? 146.579 6.679   -6.341  1.00 0.00 ? 15 ARG A HG3  8  
ATOM 11122 H HD2  . ARG A 1 16 ? 144.680 5.396   -6.829  1.00 0.00 ? 15 ARG A HD2  8  
ATOM 11123 H HD3  . ARG A 1 16 ? 143.683 6.273   -5.670  1.00 0.00 ? 15 ARG A HD3  8  
ATOM 11124 H HE   . ARG A 1 16 ? 144.669 7.919   -7.806  1.00 0.00 ? 15 ARG A HE   8  
ATOM 11125 H HH11 . ARG A 1 16 ? 142.117 5.717   -6.850  1.00 0.00 ? 15 ARG A HH11 8  
ATOM 11126 H HH12 . ARG A 1 16 ? 140.972 6.362   -7.976  1.00 0.00 ? 15 ARG A HH12 8  
ATOM 11127 H HH21 . ARG A 1 16 ? 143.154 8.761   -9.289  1.00 0.00 ? 15 ARG A HH21 8  
ATOM 11128 H HH22 . ARG A 1 16 ? 141.560 8.088   -9.361  1.00 0.00 ? 15 ARG A HH22 8  
ATOM 11129 N N    . ILE A 1 17 ? 143.636 4.911   -2.319  1.00 0.00 ? 16 ILE A N    8  
ATOM 11130 C CA   . ILE A 1 17 ? 143.302 3.833   -1.388  1.00 0.00 ? 16 ILE A CA   8  
ATOM 11131 C C    . ILE A 1 17 ? 143.183 2.493   -2.113  1.00 0.00 ? 16 ILE A C    8  
ATOM 11132 O O    . ILE A 1 17 ? 142.479 2.385   -3.119  1.00 0.00 ? 16 ILE A O    8  
ATOM 11133 C CB   . ILE A 1 17 ? 141.974 4.110   -0.647  1.00 0.00 ? 16 ILE A CB   8  
ATOM 11134 C CG1  . ILE A 1 17 ? 141.926 5.556   -0.144  1.00 0.00 ? 16 ILE A CG1  8  
ATOM 11135 C CG2  . ILE A 1 17 ? 141.796 3.135   0.511   1.00 0.00 ? 16 ILE A CG2  8  
ATOM 11136 C CD1  . ILE A 1 17 ? 141.040 6.457   -0.977  1.00 0.00 ? 16 ILE A CD1  8  
ATOM 11137 H H    . ILE A 1 17 ? 143.002 5.136   -3.032  1.00 0.00 ? 16 ILE A H    8  
ATOM 11138 H HA   . ILE A 1 17 ? 144.093 3.767   -0.655  1.00 0.00 ? 16 ILE A HA   8  
ATOM 11139 H HB   . ILE A 1 17 ? 141.163 3.952   -1.342  1.00 0.00 ? 16 ILE A HB   8  
ATOM 11140 H HG12 . ILE A 1 17 ? 141.551 5.567   0.868   1.00 0.00 ? 16 ILE A HG12 8  
ATOM 11141 H HG13 . ILE A 1 17 ? 142.925 5.968   -0.158  1.00 0.00 ? 16 ILE A HG13 8  
ATOM 11142 H HG21 . ILE A 1 17 ? 141.299 2.244   0.156   1.00 0.00 ? 16 ILE A HG21 8  
ATOM 11143 H HG22 . ILE A 1 17 ? 141.199 3.596   1.283   1.00 0.00 ? 16 ILE A HG22 8  
ATOM 11144 H HG23 . ILE A 1 17 ? 142.764 2.872   0.913   1.00 0.00 ? 16 ILE A HG23 8  
ATOM 11145 H HD11 . ILE A 1 17 ? 140.662 5.907   -1.826  1.00 0.00 ? 16 ILE A HD11 8  
ATOM 11146 H HD12 . ILE A 1 17 ? 141.613 7.304   -1.325  1.00 0.00 ? 16 ILE A HD12 8  
ATOM 11147 H HD13 . ILE A 1 17 ? 140.213 6.805   -0.377  1.00 0.00 ? 16 ILE A HD13 8  
ATOM 11148 N N    . ILE A 1 18 ? 143.869 1.474   -1.593  1.00 0.00 ? 17 ILE A N    8  
ATOM 11149 C CA   . ILE A 1 18 ? 143.832 0.139   -2.188  1.00 0.00 ? 17 ILE A CA   8  
ATOM 11150 C C    . ILE A 1 18 ? 143.800 -0.944  -1.110  1.00 0.00 ? 17 ILE A C    8  
ATOM 11151 O O    . ILE A 1 18 ? 144.617 -0.940  -0.187  1.00 0.00 ? 17 ILE A O    8  
ATOM 11152 C CB   . ILE A 1 18 ? 145.041 -0.111  -3.117  1.00 0.00 ? 17 ILE A CB   8  
ATOM 11153 C CG1  . ILE A 1 18 ? 145.205 1.046   -4.109  1.00 0.00 ? 17 ILE A CG1  8  
ATOM 11154 C CG2  . ILE A 1 18 ? 144.877 -1.431  -3.862  1.00 0.00 ? 17 ILE A CG2  8  
ATOM 11155 C CD1  . ILE A 1 18 ? 146.386 0.882   -5.042  1.00 0.00 ? 17 ILE A CD1  8  
ATOM 11156 H H    . ILE A 1 18 ? 144.408 1.622   -0.787  1.00 0.00 ? 17 ILE A H    8  
ATOM 11157 H HA   . ILE A 1 18 ? 142.931 0.067   -2.780  1.00 0.00 ? 17 ILE A HA   8  
ATOM 11158 H HB   . ILE A 1 18 ? 145.928 -0.180  -2.505  1.00 0.00 ? 17 ILE A HB   8  
ATOM 11159 H HG12 . ILE A 1 18 ? 144.314 1.121   -4.713  1.00 0.00 ? 17 ILE A HG12 8  
ATOM 11160 H HG13 . ILE A 1 18 ? 145.341 1.966   -3.559  1.00 0.00 ? 17 ILE A HG13 8  
ATOM 11161 H HG21 . ILE A 1 18 ? 143.883 -1.489  -4.280  1.00 0.00 ? 17 ILE A HG21 8  
ATOM 11162 H HG22 . ILE A 1 18 ? 145.028 -2.253  -3.177  1.00 0.00 ? 17 ILE A HG22 8  
ATOM 11163 H HG23 . ILE A 1 18 ? 145.605 -1.488  -4.657  1.00 0.00 ? 17 ILE A HG23 8  
ATOM 11164 H HD11 . ILE A 1 18 ? 146.308 -0.063  -5.558  1.00 0.00 ? 17 ILE A HD11 8  
ATOM 11165 H HD12 . ILE A 1 18 ? 147.302 0.905   -4.470  1.00 0.00 ? 17 ILE A HD12 8  
ATOM 11166 H HD13 . ILE A 1 18 ? 146.390 1.686   -5.762  1.00 0.00 ? 17 ILE A HD13 8  
ATOM 11167 N N    . ALA A 1 19 ? 142.851 -1.872  -1.239  1.00 0.00 ? 18 ALA A N    8  
ATOM 11168 C CA   . ALA A 1 19 ? 142.710 -2.966  -0.282  1.00 0.00 ? 18 ALA A CA   8  
ATOM 11169 C C    . ALA A 1 19 ? 143.532 -4.180  -0.712  1.00 0.00 ? 18 ALA A C    8  
ATOM 11170 O O    . ALA A 1 19 ? 143.511 -4.572  -1.880  1.00 0.00 ? 18 ALA A O    8  
ATOM 11171 C CB   . ALA A 1 19 ? 141.245 -3.349  -0.122  1.00 0.00 ? 18 ALA A CB   8  
ATOM 11172 H H    . ALA A 1 19 ? 142.232 -1.821  -1.998  1.00 0.00 ? 18 ALA A H    8  
ATOM 11173 H HA   . ALA A 1 19 ? 143.073 -2.620  0.675   1.00 0.00 ? 18 ALA A HA   8  
ATOM 11174 H HB1  . ALA A 1 19 ? 141.026 -4.205  -0.744  1.00 0.00 ? 18 ALA A HB1  8  
ATOM 11175 H HB2  . ALA A 1 19 ? 140.620 -2.519  -0.419  1.00 0.00 ? 18 ALA A HB2  8  
ATOM 11176 H HB3  . ALA A 1 19 ? 141.048 -3.596  0.911   1.00 0.00 ? 18 ALA A HB3  8  
ATOM 11177 N N    . PHE A 1 20 ? 144.255 -4.768  0.240   1.00 0.00 ? 19 PHE A N    8  
ATOM 11178 C CA   . PHE A 1 20 ? 145.088 -5.936  -0.036  1.00 0.00 ? 19 PHE A CA   8  
ATOM 11179 C C    . PHE A 1 20 ? 144.806 -7.059  0.961   1.00 0.00 ? 19 PHE A C    8  
ATOM 11180 O O    . PHE A 1 20 ? 144.955 -6.879  2.172   1.00 0.00 ? 19 PHE A O    8  
ATOM 11181 C CB   . PHE A 1 20 ? 146.570 -5.553  0.015   1.00 0.00 ? 19 PHE A CB   8  
ATOM 11182 C CG   . PHE A 1 20 ? 147.099 -5.014  -1.286  1.00 0.00 ? 19 PHE A CG   8  
ATOM 11183 C CD1  . PHE A 1 20 ? 147.283 -5.852  -2.374  1.00 0.00 ? 19 PHE A CD1  8  
ATOM 11184 C CD2  . PHE A 1 20 ? 147.410 -3.670  -1.420  1.00 0.00 ? 19 PHE A CD2  8  
ATOM 11185 C CE1  . PHE A 1 20 ? 147.768 -5.360  -3.571  1.00 0.00 ? 19 PHE A CE1  8  
ATOM 11186 C CE2  . PHE A 1 20 ? 147.896 -3.173  -2.615  1.00 0.00 ? 19 PHE A CE2  8  
ATOM 11187 C CZ   . PHE A 1 20 ? 148.074 -4.019  -3.692  1.00 0.00 ? 19 PHE A CZ   8  
ATOM 11188 H H    . PHE A 1 20 ? 144.230 -4.406  1.152   1.00 0.00 ? 19 PHE A H    8  
ATOM 11189 H HA   . PHE A 1 20 ? 144.849 -6.286  -1.029  1.00 0.00 ? 19 PHE A HA   8  
ATOM 11190 H HB2  . PHE A 1 20 ? 146.712 -4.795  0.771   1.00 0.00 ? 19 PHE A HB2  8  
ATOM 11191 H HB3  . PHE A 1 20 ? 147.151 -6.427  0.275   1.00 0.00 ? 19 PHE A HB3  8  
ATOM 11192 H HD1  . PHE A 1 20 ? 147.044 -6.901  -2.282  1.00 0.00 ? 19 PHE A HD1  8  
ATOM 11193 H HD2  . PHE A 1 20 ? 147.271 -3.007  -0.578  1.00 0.00 ? 19 PHE A HD2  8  
ATOM 11194 H HE1  . PHE A 1 20 ? 147.907 -6.025  -4.412  1.00 0.00 ? 19 PHE A HE1  8  
ATOM 11195 H HE2  . PHE A 1 20 ? 148.134 -2.124  -2.707  1.00 0.00 ? 19 PHE A HE2  8  
ATOM 11196 H HZ   . PHE A 1 20 ? 148.454 -3.633  -4.626  1.00 0.00 ? 19 PHE A HZ   8  
ATOM 11197 N N    . SER A 1 21 ? 144.401 -8.220  0.443   1.00 0.00 ? 20 SER A N    8  
ATOM 11198 C CA   . SER A 1 21 ? 144.101 -9.379  1.283   1.00 0.00 ? 20 SER A CA   8  
ATOM 11199 C C    . SER A 1 21 ? 145.366 -9.899  1.967   1.00 0.00 ? 20 SER A C    8  
ATOM 11200 O O    . SER A 1 21 ? 146.424 -10.002 1.342   1.00 0.00 ? 20 SER A O    8  
ATOM 11201 C CB   . SER A 1 21 ? 143.458 -10.492 0.448   1.00 0.00 ? 20 SER A CB   8  
ATOM 11202 O OG   . SER A 1 21 ? 143.936 -10.474 -0.888  1.00 0.00 ? 20 SER A OG   8  
ATOM 11203 H H    . SER A 1 21 ? 144.305 -8.300  -0.529  1.00 0.00 ? 20 SER A H    8  
ATOM 11204 H HA   . SER A 1 21 ? 143.401 -9.064  2.043   1.00 0.00 ? 20 SER A HA   8  
ATOM 11205 H HB2  . SER A 1 21 ? 143.693 -11.451 0.885   1.00 0.00 ? 20 SER A HB2  8  
ATOM 11206 H HB3  . SER A 1 21 ? 142.386 -10.355 0.435   1.00 0.00 ? 20 SER A HB3  8  
ATOM 11207 H HG   . SER A 1 21 ? 143.197 -10.379 -1.493  1.00 0.00 ? 20 SER A HG   8  
ATOM 11208 N N    . ARG A 1 22 ? 145.249 -10.223 3.255   1.00 0.00 ? 21 ARG A N    8  
ATOM 11209 C CA   . ARG A 1 22 ? 146.383 -10.730 4.028   1.00 0.00 ? 21 ARG A CA   8  
ATOM 11210 C C    . ARG A 1 22 ? 146.651 -12.201 3.707   1.00 0.00 ? 21 ARG A C    8  
ATOM 11211 O O    . ARG A 1 22 ? 145.721 -12.958 3.420   1.00 0.00 ? 21 ARG A O    8  
ATOM 11212 C CB   . ARG A 1 22 ? 146.125 -10.567 5.530   1.00 0.00 ? 21 ARG A CB   8  
ATOM 11213 C CG   . ARG A 1 22 ? 145.633 -9.183  5.922   1.00 0.00 ? 21 ARG A CG   8  
ATOM 11214 C CD   . ARG A 1 22 ? 145.281 -9.117  7.400   1.00 0.00 ? 21 ARG A CD   8  
ATOM 11215 N NE   . ARG A 1 22 ? 144.509 -7.918  7.722   1.00 0.00 ? 21 ARG A NE   8  
ATOM 11216 C CZ   . ARG A 1 22 ? 144.420 -7.391  8.945   1.00 0.00 ? 21 ARG A CZ   8  
ATOM 11217 N NH1  . ARG A 1 22 ? 145.030 -7.968  9.978   1.00 0.00 ? 21 ARG A NH1  8  
ATOM 11218 N NH2  . ARG A 1 22 ? 143.713 -6.283  9.136   1.00 0.00 ? 21 ARG A NH2  8  
ATOM 11219 H H    . ARG A 1 22 ? 144.381 -10.118 3.696   1.00 0.00 ? 21 ARG A H    8  
ATOM 11220 H HA   . ARG A 1 22 ? 147.252 -10.149 3.756   1.00 0.00 ? 21 ARG A HA   8  
ATOM 11221 H HB2  . ARG A 1 22 ? 145.382 -11.289 5.835   1.00 0.00 ? 21 ARG A HB2  8  
ATOM 11222 H HB3  . ARG A 1 22 ? 147.043 -10.763 6.063   1.00 0.00 ? 21 ARG A HB3  8  
ATOM 11223 H HG2  . ARG A 1 22 ? 146.410 -8.463  5.715   1.00 0.00 ? 21 ARG A HG2  8  
ATOM 11224 H HG3  . ARG A 1 22 ? 144.754 -8.946  5.341   1.00 0.00 ? 21 ARG A HG3  8  
ATOM 11225 H HD2  . ARG A 1 22 ? 144.699 -9.989  7.659   1.00 0.00 ? 21 ARG A HD2  8  
ATOM 11226 H HD3  . ARG A 1 22 ? 146.196 -9.111  7.974   1.00 0.00 ? 21 ARG A HD3  8  
ATOM 11227 H HE   . ARG A 1 22 ? 144.037 -7.476  6.986   1.00 0.00 ? 21 ARG A HE   8  
ATOM 11228 H HH11 . ARG A 1 22 ? 145.560 -8.805  9.846   1.00 0.00 ? 21 ARG A HH11 8  
ATOM 11229 H HH12 . ARG A 1 22 ? 144.959 -7.564  10.891  1.00 0.00 ? 21 ARG A HH12 8  
ATOM 11230 H HH21 . ARG A 1 22 ? 143.249 -5.846  8.366   1.00 0.00 ? 21 ARG A HH21 8  
ATOM 11231 H HH22 . ARG A 1 22 ? 143.646 -5.883  10.051  1.00 0.00 ? 21 ARG A HH22 8  
ATOM 11232 N N    . PRO A 1 23 ? 147.930 -12.631 3.750   1.00 0.00 ? 22 PRO A N    8  
ATOM 11233 C CA   . PRO A 1 23 ? 149.064 -11.760 4.088   1.00 0.00 ? 22 PRO A CA   8  
ATOM 11234 C C    . PRO A 1 23 ? 149.484 -10.862 2.923   1.00 0.00 ? 22 PRO A C    8  
ATOM 11235 O O    . PRO A 1 23 ? 149.617 -11.325 1.789   1.00 0.00 ? 22 PRO A O    8  
ATOM 11236 C CB   . PRO A 1 23 ? 150.174 -12.756 4.420   1.00 0.00 ? 22 PRO A CB   8  
ATOM 11237 C CG   . PRO A 1 23 ? 149.864 -13.955 3.590   1.00 0.00 ? 22 PRO A CG   8  
ATOM 11238 C CD   . PRO A 1 23 ? 148.363 -14.014 3.472   1.00 0.00 ? 22 PRO A CD   8  
ATOM 11239 H HA   . PRO A 1 23 ? 148.853 -11.151 4.955   1.00 0.00 ? 22 PRO A HA   8  
ATOM 11240 H HB2  . PRO A 1 23 ? 151.133 -12.331 4.159   1.00 0.00 ? 22 PRO A HB2  8  
ATOM 11241 H HB3  . PRO A 1 23 ? 150.151 -12.989 5.474   1.00 0.00 ? 22 PRO A HB3  8  
ATOM 11242 H HG2  . PRO A 1 23 ? 150.312 -13.850 2.613   1.00 0.00 ? 22 PRO A HG2  8  
ATOM 11243 H HG3  . PRO A 1 23 ? 150.235 -14.844 4.079   1.00 0.00 ? 22 PRO A HG3  8  
ATOM 11244 H HD2  . PRO A 1 23 ? 148.074 -14.312 2.475   1.00 0.00 ? 22 PRO A HD2  8  
ATOM 11245 H HD3  . PRO A 1 23 ? 147.955 -14.697 4.202   1.00 0.00 ? 22 PRO A HD3  8  
ATOM 11246 N N    . VAL A 1 24 ? 149.696 -9.578  3.213   1.00 0.00 ? 23 VAL A N    8  
ATOM 11247 C CA   . VAL A 1 24 ? 150.106 -8.618  2.191   1.00 0.00 ? 23 VAL A CA   8  
ATOM 11248 C C    . VAL A 1 24 ? 151.613 -8.696  1.935   1.00 0.00 ? 23 VAL A C    8  
ATOM 11249 O O    . VAL A 1 24 ? 152.419 -8.546  2.855   1.00 0.00 ? 23 VAL A O    8  
ATOM 11250 C CB   . VAL A 1 24 ? 149.715 -7.170  2.578   1.00 0.00 ? 23 VAL A CB   8  
ATOM 11251 C CG1  . VAL A 1 24 ? 150.430 -6.729  3.849   1.00 0.00 ? 23 VAL A CG1  8  
ATOM 11252 C CG2  . VAL A 1 24 ? 150.009 -6.210  1.433   1.00 0.00 ? 23 VAL A CG2  8  
ATOM 11253 H H    . VAL A 1 24 ? 149.578 -9.271  4.137   1.00 0.00 ? 23 VAL A H    8  
ATOM 11254 H HA   . VAL A 1 24 ? 149.587 -8.872  1.278   1.00 0.00 ? 23 VAL A HA   8  
ATOM 11255 H HB   . VAL A 1 24 ? 148.651 -7.149  2.769   1.00 0.00 ? 23 VAL A HB   8  
ATOM 11256 H HG11 . VAL A 1 24 ? 151.480 -6.589  3.640   1.00 0.00 ? 23 VAL A HG11 8  
ATOM 11257 H HG12 . VAL A 1 24 ? 150.312 -7.485  4.610   1.00 0.00 ? 23 VAL A HG12 8  
ATOM 11258 H HG13 . VAL A 1 24 ? 150.006 -5.798  4.196   1.00 0.00 ? 23 VAL A HG13 8  
ATOM 11259 H HG21 . VAL A 1 24 ? 149.566 -6.588  0.522   1.00 0.00 ? 23 VAL A HG21 8  
ATOM 11260 H HG22 . VAL A 1 24 ? 151.077 -6.120  1.303   1.00 0.00 ? 23 VAL A HG22 8  
ATOM 11261 H HG23 . VAL A 1 24 ? 149.591 -5.240  1.661   1.00 0.00 ? 23 VAL A HG23 8  
ATOM 11262 N N    . LYS A 1 25 ? 151.985 -8.935  0.679   1.00 0.00 ? 24 LYS A N    8  
ATOM 11263 C CA   . LYS A 1 25 ? 153.393 -9.036  0.301   1.00 0.00 ? 24 LYS A CA   8  
ATOM 11264 C C    . LYS A 1 25 ? 153.867 -7.761  -0.387  1.00 0.00 ? 24 LYS A C    8  
ATOM 11265 O O    . LYS A 1 25 ? 153.120 -7.139  -1.146  1.00 0.00 ? 24 LYS A O    8  
ATOM 11266 C CB   . LYS A 1 25 ? 153.614 -10.231 -0.632  1.00 0.00 ? 24 LYS A CB   8  
ATOM 11267 C CG   . LYS A 1 25 ? 153.249 -11.570 -0.015  1.00 0.00 ? 24 LYS A CG   8  
ATOM 11268 C CD   . LYS A 1 25 ? 154.165 -11.917 1.147   1.00 0.00 ? 24 LYS A CD   8  
ATOM 11269 C CE   . LYS A 1 25 ? 154.240 -13.419 1.365   1.00 0.00 ? 24 LYS A CE   8  
ATOM 11270 N NZ   . LYS A 1 25 ? 155.461 -14.015 0.750   1.00 0.00 ? 24 LYS A NZ   8  
ATOM 11271 H H    . LYS A 1 25 ? 151.297 -9.049  -0.011  1.00 0.00 ? 24 LYS A H    8  
ATOM 11272 H HA   . LYS A 1 25 ? 153.969 -9.182  1.202   1.00 0.00 ? 24 LYS A HA   8  
ATOM 11273 H HB2  . LYS A 1 25 ? 153.015 -10.093 -1.519  1.00 0.00 ? 24 LYS A HB2  8  
ATOM 11274 H HB3  . LYS A 1 25 ? 154.656 -10.261 -0.915  1.00 0.00 ? 24 LYS A HB3  8  
ATOM 11275 H HG2  . LYS A 1 25 ? 152.231 -11.527 0.342   1.00 0.00 ? 24 LYS A HG2  8  
ATOM 11276 H HG3  . LYS A 1 25 ? 153.335 -12.337 -0.771  1.00 0.00 ? 24 LYS A HG3  8  
ATOM 11277 H HD2  . LYS A 1 25 ? 155.155 -11.543 0.936   1.00 0.00 ? 24 LYS A HD2  8  
ATOM 11278 H HD3  . LYS A 1 25 ? 153.784 -11.450 2.045   1.00 0.00 ? 24 LYS A HD3  8  
ATOM 11279 H HE2  . LYS A 1 25 ? 154.250 -13.616 2.426   1.00 0.00 ? 24 LYS A HE2  8  
ATOM 11280 H HE3  . LYS A 1 25 ? 153.366 -13.877 0.924   1.00 0.00 ? 24 LYS A HE3  8  
ATOM 11281 H HZ1  . LYS A 1 25 ? 156.224 -14.073 1.454   1.00 0.00 ? 24 LYS A HZ1  8  
ATOM 11282 H HZ2  . LYS A 1 25 ? 155.785 -13.430 -0.047  1.00 0.00 ? 24 LYS A HZ2  8  
ATOM 11283 H HZ3  . LYS A 1 25 ? 155.254 -14.972 0.401   1.00 0.00 ? 24 LYS A HZ3  8  
ATOM 11284 N N    . TYR A 1 26 ? 155.118 -7.383  -0.125  1.00 0.00 ? 25 TYR A N    8  
ATOM 11285 C CA   . TYR A 1 26 ? 155.703 -6.187  -0.729  1.00 0.00 ? 25 TYR A CA   8  
ATOM 11286 C C    . TYR A 1 26 ? 155.717 -6.306  -2.253  1.00 0.00 ? 25 TYR A C    8  
ATOM 11287 O O    . TYR A 1 26 ? 155.412 -5.345  -2.959  1.00 0.00 ? 25 TYR A O    8  
ATOM 11288 C CB   . TYR A 1 26 ? 157.129 -5.967  -0.212  1.00 0.00 ? 25 TYR A CB   8  
ATOM 11289 C CG   . TYR A 1 26 ? 157.809 -4.742  -0.790  1.00 0.00 ? 25 TYR A CG   8  
ATOM 11290 C CD1  . TYR A 1 26 ? 158.544 -4.821  -1.967  1.00 0.00 ? 25 TYR A CD1  8  
ATOM 11291 C CD2  . TYR A 1 26 ? 157.718 -3.510  -0.156  1.00 0.00 ? 25 TYR A CD2  8  
ATOM 11292 C CE1  . TYR A 1 26 ? 159.167 -3.706  -2.494  1.00 0.00 ? 25 TYR A CE1  8  
ATOM 11293 C CE2  . TYR A 1 26 ? 158.338 -2.392  -0.678  1.00 0.00 ? 25 TYR A CE2  8  
ATOM 11294 C CZ   . TYR A 1 26 ? 159.062 -2.495  -1.847  1.00 0.00 ? 25 TYR A CZ   8  
ATOM 11295 O OH   . TYR A 1 26 ? 159.678 -1.382  -2.371  1.00 0.00 ? 25 TYR A OH   8  
ATOM 11296 H H    . TYR A 1 26 ? 155.663 -7.927  0.480   1.00 0.00 ? 25 TYR A H    8  
ATOM 11297 H HA   . TYR A 1 26 ? 155.093 -5.340  -0.450  1.00 0.00 ? 25 TYR A HA   8  
ATOM 11298 H HB2  . TYR A 1 26 ? 157.102 -5.853  0.861   1.00 0.00 ? 25 TYR A HB2  8  
ATOM 11299 H HB3  . TYR A 1 26 ? 157.730 -6.829  -0.461  1.00 0.00 ? 25 TYR A HB3  8  
ATOM 11300 H HD1  . TYR A 1 26 ? 158.625 -5.771  -2.474  1.00 0.00 ? 25 TYR A HD1  8  
ATOM 11301 H HD2  . TYR A 1 26 ? 157.151 -3.430  0.760   1.00 0.00 ? 25 TYR A HD2  8  
ATOM 11302 H HE1  . TYR A 1 26 ? 159.734 -3.788  -3.410  1.00 0.00 ? 25 TYR A HE1  8  
ATOM 11303 H HE2  . TYR A 1 26 ? 158.254 -1.442  -0.170  1.00 0.00 ? 25 TYR A HE2  8  
ATOM 11304 H HH   . TYR A 1 26 ? 160.613 -1.398  -2.153  1.00 0.00 ? 25 TYR A HH   8  
ATOM 11305 N N    . GLU A 1 27 ? 156.073 -7.494  -2.748  1.00 0.00 ? 26 GLU A N    8  
ATOM 11306 C CA   . GLU A 1 27 ? 156.131 -7.748  -4.187  1.00 0.00 ? 26 GLU A CA   8  
ATOM 11307 C C    . GLU A 1 27 ? 154.777 -7.483  -4.848  1.00 0.00 ? 26 GLU A C    8  
ATOM 11308 O O    . GLU A 1 27 ? 154.714 -6.900  -5.931  1.00 0.00 ? 26 GLU A O    8  
ATOM 11309 C CB   . GLU A 1 27 ? 156.561 -9.194  -4.454  1.00 0.00 ? 26 GLU A CB   8  
ATOM 11310 C CG   . GLU A 1 27 ? 157.281 -9.380  -5.781  1.00 0.00 ? 26 GLU A CG   8  
ATOM 11311 C CD   . GLU A 1 27 ? 157.889 -10.762 -5.940  1.00 0.00 ? 26 GLU A CD   8  
ATOM 11312 O OE1  . GLU A 1 27 ? 157.256 -11.750 -5.509  1.00 0.00 ? 26 GLU A OE1  8  
ATOM 11313 O OE2  . GLU A 1 27 ? 159.000 -10.856 -6.502  1.00 0.00 ? 26 GLU A OE2  8  
ATOM 11314 H H    . GLU A 1 27 ? 156.307 -8.218  -2.128  1.00 0.00 ? 26 GLU A H    8  
ATOM 11315 H HA   . GLU A 1 27 ? 156.865 -7.079  -4.612  1.00 0.00 ? 26 GLU A HA   8  
ATOM 11316 H HB2  . GLU A 1 27 ? 157.223 -9.515  -3.663  1.00 0.00 ? 26 GLU A HB2  8  
ATOM 11317 H HB3  . GLU A 1 27 ? 155.684 -9.824  -4.455  1.00 0.00 ? 26 GLU A HB3  8  
ATOM 11318 H HG2  . GLU A 1 27 ? 156.575 -9.221  -6.581  1.00 0.00 ? 26 GLU A HG2  8  
ATOM 11319 H HG3  . GLU A 1 27 ? 158.071 -8.646  -5.851  1.00 0.00 ? 26 GLU A HG3  8  
ATOM 11320 N N    . ASP A 1 28 ? 153.696 -7.908  -4.189  1.00 0.00 ? 27 ASP A N    8  
ATOM 11321 C CA   . ASP A 1 28 ? 152.345 -7.712  -4.719  1.00 0.00 ? 27 ASP A CA   8  
ATOM 11322 C C    . ASP A 1 28 ? 152.016 -6.225  -4.850  1.00 0.00 ? 27 ASP A C    8  
ATOM 11323 O O    . ASP A 1 28 ? 151.470 -5.791  -5.865  1.00 0.00 ? 27 ASP A O    8  
ATOM 11324 C CB   . ASP A 1 28 ? 151.303 -8.389  -3.819  1.00 0.00 ? 27 ASP A CB   8  
ATOM 11325 C CG   . ASP A 1 28 ? 151.409 -9.905  -3.814  1.00 0.00 ? 27 ASP A CG   8  
ATOM 11326 O OD1  . ASP A 1 28 ? 151.757 -10.487 -4.863  1.00 0.00 ? 27 ASP A OD1  8  
ATOM 11327 O OD2  . ASP A 1 28 ? 151.137 -10.511 -2.756  1.00 0.00 ? 27 ASP A OD2  8  
ATOM 11328 H H    . ASP A 1 28 ? 153.809 -8.364  -3.328  1.00 0.00 ? 27 ASP A H    8  
ATOM 11329 H HA   . ASP A 1 28 ? 152.307 -8.162  -5.700  1.00 0.00 ? 27 ASP A HA   8  
ATOM 11330 H HB2  . ASP A 1 28 ? 151.430 -8.038  -2.806  1.00 0.00 ? 27 ASP A HB2  8  
ATOM 11331 H HB3  . ASP A 1 28 ? 150.315 -8.119  -4.163  1.00 0.00 ? 27 ASP A HB3  8  
ATOM 11332 N N    . VAL A 1 29 ? 152.354 -5.448  -3.822  1.00 0.00 ? 28 VAL A N    8  
ATOM 11333 C CA   . VAL A 1 29 ? 152.090 -4.014  -3.839  1.00 0.00 ? 28 VAL A CA   8  
ATOM 11334 C C    . VAL A 1 29 ? 153.011 -3.302  -4.829  1.00 0.00 ? 28 VAL A C    8  
ATOM 11335 O O    . VAL A 1 29 ? 152.552 -2.503  -5.646  1.00 0.00 ? 28 VAL A O    8  
ATOM 11336 C CB   . VAL A 1 29 ? 152.251 -3.377  -2.440  1.00 0.00 ? 28 VAL A CB   8  
ATOM 11337 C CG1  . VAL A 1 29 ? 151.835 -1.911  -2.470  1.00 0.00 ? 28 VAL A CG1  8  
ATOM 11338 C CG2  . VAL A 1 29 ? 151.444 -4.142  -1.398  1.00 0.00 ? 28 VAL A CG2  8  
ATOM 11339 H H    . VAL A 1 29 ? 152.790 -5.848  -3.039  1.00 0.00 ? 28 VAL A H    8  
ATOM 11340 H HA   . VAL A 1 29 ? 151.065 -3.874  -4.156  1.00 0.00 ? 28 VAL A HA   8  
ATOM 11341 H HB   . VAL A 1 29 ? 153.294 -3.425  -2.163  1.00 0.00 ? 28 VAL A HB   8  
ATOM 11342 H HG11 . VAL A 1 29 ? 152.525 -1.329  -1.878  1.00 0.00 ? 28 VAL A HG11 8  
ATOM 11343 H HG12 . VAL A 1 29 ? 150.839 -1.810  -2.064  1.00 0.00 ? 28 VAL A HG12 8  
ATOM 11344 H HG13 . VAL A 1 29 ? 151.845 -1.554  -3.489  1.00 0.00 ? 28 VAL A HG13 8  
ATOM 11345 H HG21 . VAL A 1 29 ? 151.470 -5.197  -1.623  1.00 0.00 ? 28 VAL A HG21 8  
ATOM 11346 H HG22 . VAL A 1 29 ? 150.421 -3.797  -1.410  1.00 0.00 ? 28 VAL A HG22 8  
ATOM 11347 H HG23 . VAL A 1 29 ? 151.869 -3.972  -0.419  1.00 0.00 ? 28 VAL A HG23 8  
ATOM 11348 N N    . GLU A 1 30 ? 154.310 -3.599  -4.753  1.00 0.00 ? 29 GLU A N    8  
ATOM 11349 C CA   . GLU A 1 30 ? 155.295 -2.986  -5.644  1.00 0.00 ? 29 GLU A CA   8  
ATOM 11350 C C    . GLU A 1 30 ? 154.976 -3.275  -7.111  1.00 0.00 ? 29 GLU A C    8  
ATOM 11351 O O    . GLU A 1 30 ? 155.113 -2.397  -7.963  1.00 0.00 ? 29 GLU A O    8  
ATOM 11352 C CB   . GLU A 1 30 ? 156.704 -3.483  -5.312  1.00 0.00 ? 29 GLU A CB   8  
ATOM 11353 C CG   . GLU A 1 30 ? 157.757 -2.390  -5.370  1.00 0.00 ? 29 GLU A CG   8  
ATOM 11354 C CD   . GLU A 1 30 ? 158.951 -2.778  -6.219  1.00 0.00 ? 29 GLU A CD   8  
ATOM 11355 O OE1  . GLU A 1 30 ? 159.879 -3.415  -5.681  1.00 0.00 ? 29 GLU A OE1  8  
ATOM 11356 O OE2  . GLU A 1 30 ? 158.956 -2.448  -7.422  1.00 0.00 ? 29 GLU A OE2  8  
ATOM 11357 H H    . GLU A 1 30 ? 154.613 -4.247  -4.080  1.00 0.00 ? 29 GLU A H    8  
ATOM 11358 H HA   . GLU A 1 30 ? 155.257 -1.918  -5.488  1.00 0.00 ? 29 GLU A HA   8  
ATOM 11359 H HB2  . GLU A 1 30 ? 156.703 -3.900  -4.316  1.00 0.00 ? 29 GLU A HB2  8  
ATOM 11360 H HB3  . GLU A 1 30 ? 156.978 -4.254  -6.017  1.00 0.00 ? 29 GLU A HB3  8  
ATOM 11361 H HG2  . GLU A 1 30 ? 157.311 -1.499  -5.788  1.00 0.00 ? 29 GLU A HG2  8  
ATOM 11362 H HG3  . GLU A 1 30 ? 158.097 -2.183  -4.367  1.00 0.00 ? 29 GLU A HG3  8  
ATOM 11363 N N    . HIS A 1 31 ? 154.553 -4.505  -7.399  1.00 0.00 ? 30 HIS A N    8  
ATOM 11364 C CA   . HIS A 1 31 ? 154.216 -4.900  -8.766  1.00 0.00 ? 30 HIS A CA   8  
ATOM 11365 C C    . HIS A 1 31 ? 153.121 -4.001  -9.344  1.00 0.00 ? 30 HIS A C    8  
ATOM 11366 O O    . HIS A 1 31 ? 153.230 -3.525  -10.475 1.00 0.00 ? 30 HIS A O    8  
ATOM 11367 C CB   . HIS A 1 31 ? 153.763 -6.364  -8.804  1.00 0.00 ? 30 HIS A CB   8  
ATOM 11368 C CG   . HIS A 1 31 ? 154.880 -7.350  -8.978  1.00 0.00 ? 30 HIS A CG   8  
ATOM 11369 N ND1  . HIS A 1 31 ? 155.994 -7.112  -9.758  1.00 0.00 ? 30 HIS A ND1  8  
ATOM 11370 C CD2  . HIS A 1 31 ? 155.040 -8.596  -8.471  1.00 0.00 ? 30 HIS A CD2  8  
ATOM 11371 C CE1  . HIS A 1 31 ? 156.787 -8.170  -9.723  1.00 0.00 ? 30 HIS A CE1  8  
ATOM 11372 N NE2  . HIS A 1 31 ? 156.232 -9.083  -8.947  1.00 0.00 ? 30 HIS A NE2  8  
ATOM 11373 H H    . HIS A 1 31 ? 154.462 -5.162  -6.676  1.00 0.00 ? 30 HIS A H    8  
ATOM 11374 H HA   . HIS A 1 31 ? 155.105 -4.792  -9.368  1.00 0.00 ? 30 HIS A HA   8  
ATOM 11375 H HB2  . HIS A 1 31 ? 153.261 -6.600  -7.879  1.00 0.00 ? 30 HIS A HB2  8  
ATOM 11376 H HB3  . HIS A 1 31 ? 153.072 -6.498  -9.623  1.00 0.00 ? 30 HIS A HB3  8  
ATOM 11377 H HD1  . HIS A 1 31 ? 156.179 -6.290  -10.259 1.00 0.00 ? 30 HIS A HD1  8  
ATOM 11378 H HD2  . HIS A 1 31 ? 154.356 -9.110  -7.812  1.00 0.00 ? 30 HIS A HD2  8  
ATOM 11379 H HE1  . HIS A 1 31 ? 157.728 -8.272  -10.246 1.00 0.00 ? 30 HIS A HE1  8  
ATOM 11380 H HE2  . HIS A 1 31 ? 156.675 -9.900  -8.635  1.00 0.00 ? 30 HIS A HE2  8  
ATOM 11381 N N    . LYS A 1 32 ? 152.067 -3.772  -8.560  1.00 0.00 ? 31 LYS A N    8  
ATOM 11382 C CA   . LYS A 1 32 ? 150.957 -2.931  -8.997  1.00 0.00 ? 31 LYS A CA   8  
ATOM 11383 C C    . LYS A 1 32 ? 151.367 -1.460  -9.044  1.00 0.00 ? 31 LYS A C    8  
ATOM 11384 O O    . LYS A 1 32 ? 151.116 -0.775  -10.034 1.00 0.00 ? 31 LYS A O    8  
ATOM 11385 C CB   . LYS A 1 32 ? 149.748 -3.109  -8.069  1.00 0.00 ? 31 LYS A CB   8  
ATOM 11386 C CG   . LYS A 1 32 ? 148.623 -3.930  -8.688  1.00 0.00 ? 31 LYS A CG   8  
ATOM 11387 C CD   . LYS A 1 32 ? 148.013 -4.902  -7.686  1.00 0.00 ? 31 LYS A CD   8  
ATOM 11388 C CE   . LYS A 1 32 ? 146.610 -4.477  -7.273  1.00 0.00 ? 31 LYS A CE   8  
ATOM 11389 N NZ   . LYS A 1 32 ? 145.552 -5.190  -8.048  1.00 0.00 ? 31 LYS A NZ   8  
ATOM 11390 H H    . LYS A 1 32 ? 152.036 -4.178  -7.668  1.00 0.00 ? 31 LYS A H    8  
ATOM 11391 H HA   . LYS A 1 32 ? 150.680 -3.242  -9.993  1.00 0.00 ? 31 LYS A HA   8  
ATOM 11392 H HB2  . LYS A 1 32 ? 150.072 -3.602  -7.164  1.00 0.00 ? 31 LYS A HB2  8  
ATOM 11393 H HB3  . LYS A 1 32 ? 149.355 -2.135  -7.817  1.00 0.00 ? 31 LYS A HB3  8  
ATOM 11394 H HG2  . LYS A 1 32 ? 147.853 -3.260  -9.037  1.00 0.00 ? 31 LYS A HG2  8  
ATOM 11395 H HG3  . LYS A 1 32 ? 149.019 -4.490  -9.523  1.00 0.00 ? 31 LYS A HG3  8  
ATOM 11396 H HD2  . LYS A 1 32 ? 147.963 -5.882  -8.137  1.00 0.00 ? 31 LYS A HD2  8  
ATOM 11397 H HD3  . LYS A 1 32 ? 148.642 -4.942  -6.808  1.00 0.00 ? 31 LYS A HD3  8  
ATOM 11398 H HE2  . LYS A 1 32 ? 146.477 -4.691  -6.222  1.00 0.00 ? 31 LYS A HE2  8  
ATOM 11399 H HE3  . LYS A 1 32 ? 146.508 -3.414  -7.436  1.00 0.00 ? 31 LYS A HE3  8  
ATOM 11400 H HZ1  . LYS A 1 32 ? 145.871 -6.150  -8.294  1.00 0.00 ? 31 LYS A HZ1  8  
ATOM 11401 H HZ2  . LYS A 1 32 ? 145.340 -4.672  -8.924  1.00 0.00 ? 31 LYS A HZ2  8  
ATOM 11402 H HZ3  . LYS A 1 32 ? 144.682 -5.261  -7.482  1.00 0.00 ? 31 LYS A HZ3  8  
ATOM 11403 N N    . VAL A 1 33 ? 151.999 -0.980  -7.971  1.00 0.00 ? 32 VAL A N    8  
ATOM 11404 C CA   . VAL A 1 33 ? 152.438 0.415   -7.900  1.00 0.00 ? 32 VAL A CA   8  
ATOM 11405 C C    . VAL A 1 33 ? 153.366 0.767   -9.063  1.00 0.00 ? 32 VAL A C    8  
ATOM 11406 O O    . VAL A 1 33 ? 153.199 1.805   -9.705  1.00 0.00 ? 32 VAL A O    8  
ATOM 11407 C CB   . VAL A 1 33 ? 153.155 0.724   -6.568  1.00 0.00 ? 32 VAL A CB   8  
ATOM 11408 C CG1  . VAL A 1 33 ? 153.539 2.194   -6.494  1.00 0.00 ? 32 VAL A CG1  8  
ATOM 11409 C CG2  . VAL A 1 33 ? 152.281 0.338   -5.382  1.00 0.00 ? 32 VAL A CG2  8  
ATOM 11410 H H    . VAL A 1 33 ? 152.172 -1.577  -7.212  1.00 0.00 ? 32 VAL A H    8  
ATOM 11411 H HA   . VAL A 1 33 ? 151.558 1.038   -7.961  1.00 0.00 ? 32 VAL A HA   8  
ATOM 11412 H HB   . VAL A 1 33 ? 154.061 0.137   -6.526  1.00 0.00 ? 32 VAL A HB   8  
ATOM 11413 H HG11 . VAL A 1 33 ? 154.572 2.311   -6.785  1.00 0.00 ? 32 VAL A HG11 8  
ATOM 11414 H HG12 . VAL A 1 33 ? 153.406 2.551   -5.484  1.00 0.00 ? 32 VAL A HG12 8  
ATOM 11415 H HG13 . VAL A 1 33 ? 152.910 2.763   -7.162  1.00 0.00 ? 32 VAL A HG13 8  
ATOM 11416 H HG21 . VAL A 1 33 ? 151.889 1.229   -4.915  1.00 0.00 ? 32 VAL A HG21 8  
ATOM 11417 H HG22 . VAL A 1 33 ? 152.872 -0.213  -4.666  1.00 0.00 ? 32 VAL A HG22 8  
ATOM 11418 H HG23 . VAL A 1 33 ? 151.463 -0.280  -5.722  1.00 0.00 ? 32 VAL A HG23 8  
ATOM 11419 N N    . THR A 1 34 ? 154.339 -0.104  -9.332  1.00 0.00 ? 33 THR A N    8  
ATOM 11420 C CA   . THR A 1 34 ? 155.284 0.119   -10.422 1.00 0.00 ? 33 THR A CA   8  
ATOM 11421 C C    . THR A 1 34 ? 154.560 0.186   -11.769 1.00 0.00 ? 33 THR A C    8  
ATOM 11422 O O    . THR A 1 34 ? 154.916 0.992   -12.626 1.00 0.00 ? 33 THR A O    8  
ATOM 11423 C CB   . THR A 1 34 ? 156.353 -0.981  -10.447 1.00 0.00 ? 33 THR A CB   8  
ATOM 11424 O OG1  . THR A 1 34 ? 157.073 -1.015  -9.225  1.00 0.00 ? 33 THR A OG1  8  
ATOM 11425 C CG2  . THR A 1 34 ? 157.363 -0.816  -11.564 1.00 0.00 ? 33 THR A CG2  8  
ATOM 11426 H H    . THR A 1 34 ? 154.420 -0.916  -8.788  1.00 0.00 ? 33 THR A H    8  
ATOM 11427 H HA   . THR A 1 34 ? 155.766 1.069   -10.243 1.00 0.00 ? 33 THR A HA   8  
ATOM 11428 H HB   . THR A 1 34 ? 155.868 -1.937  -10.578 1.00 0.00 ? 33 THR A HB   8  
ATOM 11429 H HG1  . THR A 1 34 ? 157.205 -0.121  -8.899  1.00 0.00 ? 33 THR A HG1  8  
ATOM 11430 H HG21 . THR A 1 34 ? 157.680 -1.787  -11.909 1.00 0.00 ? 33 THR A HG21 8  
ATOM 11431 H HG22 . THR A 1 34 ? 158.218 -0.265  -11.195 1.00 0.00 ? 33 THR A HG22 8  
ATOM 11432 H HG23 . THR A 1 34 ? 156.911 -0.278  -12.382 1.00 0.00 ? 33 THR A HG23 8  
ATOM 11433 N N    . THR A 1 35 ? 153.546 -0.662  -11.950 1.00 0.00 ? 34 THR A N    8  
ATOM 11434 C CA   . THR A 1 35 ? 152.780 -0.687  -13.197 1.00 0.00 ? 34 THR A CA   8  
ATOM 11435 C C    . THR A 1 35 ? 151.892 0.554   -13.335 1.00 0.00 ? 34 THR A C    8  
ATOM 11436 O O    . THR A 1 35 ? 151.797 1.134   -14.418 1.00 0.00 ? 34 THR A O    8  
ATOM 11437 C CB   . THR A 1 35 ? 151.927 -1.957  -13.278 1.00 0.00 ? 34 THR A CB   8  
ATOM 11438 O OG1  . THR A 1 35 ? 152.740 -3.114  -13.174 1.00 0.00 ? 34 THR A OG1  8  
ATOM 11439 C CG2  . THR A 1 35 ? 151.134 -2.068  -14.565 1.00 0.00 ? 34 THR A CG2  8  
ATOM 11440 H H    . THR A 1 35 ? 153.308 -1.284  -11.230 1.00 0.00 ? 34 THR A H    8  
ATOM 11441 H HA   . THR A 1 35 ? 153.487 -0.692  -14.013 1.00 0.00 ? 34 THR A HA   8  
ATOM 11442 H HB   . THR A 1 35 ? 151.225 -1.960  -12.456 1.00 0.00 ? 34 THR A HB   8  
ATOM 11443 H HG1  . THR A 1 35 ? 152.881 -3.325  -12.246 1.00 0.00 ? 34 THR A HG1  8  
ATOM 11444 H HG21 . THR A 1 35 ? 150.085 -1.918  -14.356 1.00 0.00 ? 34 THR A HG21 8  
ATOM 11445 H HG22 . THR A 1 35 ? 151.279 -3.048  -14.995 1.00 0.00 ? 34 THR A HG22 8  
ATOM 11446 H HG23 . THR A 1 35 ? 151.472 -1.316  -15.263 1.00 0.00 ? 34 THR A HG23 8  
ATOM 11447 N N    . VAL A 1 36 ? 151.241 0.956   -12.240 1.00 0.00 ? 35 VAL A N    8  
ATOM 11448 C CA   . VAL A 1 36 ? 150.360 2.127   -12.259 1.00 0.00 ? 35 VAL A CA   8  
ATOM 11449 C C    . VAL A 1 36 ? 151.131 3.389   -12.651 1.00 0.00 ? 35 VAL A C    8  
ATOM 11450 O O    . VAL A 1 36 ? 150.707 4.133   -13.534 1.00 0.00 ? 35 VAL A O    8  
ATOM 11451 C CB   . VAL A 1 36 ? 149.674 2.359   -10.892 1.00 0.00 ? 35 VAL A CB   8  
ATOM 11452 C CG1  . VAL A 1 36 ? 148.683 3.513   -10.973 1.00 0.00 ? 35 VAL A CG1  8  
ATOM 11453 C CG2  . VAL A 1 36 ? 148.978 1.093   -10.411 1.00 0.00 ? 35 VAL A CG2  8  
ATOM 11454 H H    . VAL A 1 36 ? 151.351 0.453   -11.404 1.00 0.00 ? 35 VAL A H    8  
ATOM 11455 H HA   . VAL A 1 36 ? 149.590 1.947   -12.997 1.00 0.00 ? 35 VAL A HA   8  
ATOM 11456 H HB   . VAL A 1 36 ? 150.435 2.620   -10.171 1.00 0.00 ? 35 VAL A HB   8  
ATOM 11457 H HG11 . VAL A 1 36 ? 147.840 3.222   -11.581 1.00 0.00 ? 35 VAL A HG11 8  
ATOM 11458 H HG12 . VAL A 1 36 ? 149.166 4.372   -11.414 1.00 0.00 ? 35 VAL A HG12 8  
ATOM 11459 H HG13 . VAL A 1 36 ? 148.341 3.763   -9.979  1.00 0.00 ? 35 VAL A HG13 8  
ATOM 11460 H HG21 . VAL A 1 36 ? 149.128 0.302   -11.130 1.00 0.00 ? 35 VAL A HG21 8  
ATOM 11461 H HG22 . VAL A 1 36 ? 147.920 1.281   -10.299 1.00 0.00 ? 35 VAL A HG22 8  
ATOM 11462 H HG23 . VAL A 1 36 ? 149.392 0.795   -9.459  1.00 0.00 ? 35 VAL A HG23 8  
ATOM 11463 N N    . PHE A 1 37 ? 152.265 3.622   -11.987 1.00 0.00 ? 36 PHE A N    8  
ATOM 11464 C CA   . PHE A 1 37 ? 153.094 4.796   -12.266 1.00 0.00 ? 36 PHE A CA   8  
ATOM 11465 C C    . PHE A 1 37 ? 154.032 4.563   -13.453 1.00 0.00 ? 36 PHE A C    8  
ATOM 11466 O O    . PHE A 1 37 ? 154.448 5.515   -14.115 1.00 0.00 ? 36 PHE A O    8  
ATOM 11467 C CB   . PHE A 1 37 ? 153.913 5.176   -11.030 1.00 0.00 ? 36 PHE A CB   8  
ATOM 11468 C CG   . PHE A 1 37 ? 153.072 5.603   -9.860  1.00 0.00 ? 36 PHE A CG   8  
ATOM 11469 C CD1  . PHE A 1 37 ? 152.338 6.778   -9.909  1.00 0.00 ? 36 PHE A CD1  8  
ATOM 11470 C CD2  . PHE A 1 37 ? 153.016 4.830   -8.713  1.00 0.00 ? 36 PHE A CD2  8  
ATOM 11471 C CE1  . PHE A 1 37 ? 151.563 7.172   -8.835  1.00 0.00 ? 36 PHE A CE1  8  
ATOM 11472 C CE2  . PHE A 1 37 ? 152.243 5.219   -7.636  1.00 0.00 ? 36 PHE A CE2  8  
ATOM 11473 C CZ   . PHE A 1 37 ? 151.516 6.391   -7.697  1.00 0.00 ? 36 PHE A CZ   8  
ATOM 11474 H H    . PHE A 1 37 ? 152.549 2.991   -11.292 1.00 0.00 ? 36 PHE A H    8  
ATOM 11475 H HA   . PHE A 1 37 ? 152.432 5.614   -12.507 1.00 0.00 ? 36 PHE A HA   8  
ATOM 11476 H HB2  . PHE A 1 37 ? 154.503 4.326   -10.722 1.00 0.00 ? 36 PHE A HB2  8  
ATOM 11477 H HB3  . PHE A 1 37 ? 154.573 5.993   -11.282 1.00 0.00 ? 36 PHE A HB3  8  
ATOM 11478 H HD1  . PHE A 1 37 ? 152.373 7.389   -10.800 1.00 0.00 ? 36 PHE A HD1  8  
ATOM 11479 H HD2  . PHE A 1 37 ? 153.584 3.913   -8.663  1.00 0.00 ? 36 PHE A HD2  8  
ATOM 11480 H HE1  . PHE A 1 37 ? 150.995 8.090   -8.886  1.00 0.00 ? 36 PHE A HE1  8  
ATOM 11481 H HE2  . PHE A 1 37 ? 152.208 4.607   -6.748  1.00 0.00 ? 36 PHE A HE2  8  
ATOM 11482 H HZ   . PHE A 1 37 ? 150.912 6.698   -6.856  1.00 0.00 ? 36 PHE A HZ   8  
ATOM 11483 N N    . GLY A 1 38 ? 154.373 3.299   -13.710 1.00 0.00 ? 37 GLY A N    8  
ATOM 11484 C CA   . GLY A 1 38 ? 155.270 2.973   -14.808 1.00 0.00 ? 37 GLY A CA   8  
ATOM 11485 C C    . GLY A 1 38 ? 156.741 3.000   -14.405 1.00 0.00 ? 37 GLY A C    8  
ATOM 11486 O O    . GLY A 1 38 ? 157.620 3.001   -15.269 1.00 0.00 ? 37 GLY A O    8  
ATOM 11487 H H    . GLY A 1 38 ? 154.020 2.581   -13.144 1.00 0.00 ? 37 GLY A H    8  
ATOM 11488 H HA2  . GLY A 1 38 ? 155.028 1.987   -15.174 1.00 0.00 ? 37 GLY A HA2  8  
ATOM 11489 H HA3  . GLY A 1 38 ? 155.116 3.685   -15.605 1.00 0.00 ? 37 GLY A HA3  8  
ATOM 11490 N N    . GLN A 1 39 ? 157.011 3.022   -13.095 1.00 0.00 ? 38 GLN A N    8  
ATOM 11491 C CA   . GLN A 1 39 ? 158.384 3.052   -12.588 1.00 0.00 ? 38 GLN A CA   8  
ATOM 11492 C C    . GLN A 1 39 ? 158.459 2.454   -11.182 1.00 0.00 ? 38 GLN A C    8  
ATOM 11493 O O    . GLN A 1 39 ? 157.485 2.502   -10.429 1.00 0.00 ? 38 GLN A O    8  
ATOM 11494 C CB   . GLN A 1 39 ? 158.905 4.492   -12.552 1.00 0.00 ? 38 GLN A CB   8  
ATOM 11495 C CG   . GLN A 1 39 ? 159.558 4.949   -13.847 1.00 0.00 ? 38 GLN A CG   8  
ATOM 11496 C CD   . GLN A 1 39 ? 159.915 6.423   -13.823 1.00 0.00 ? 38 GLN A CD   8  
ATOM 11497 O OE1  . GLN A 1 39 ? 159.501 7.187   -14.695 1.00 0.00 ? 38 GLN A OE1  8  
ATOM 11498 N NE2  . GLN A 1 39 ? 160.684 6.833   -12.819 1.00 0.00 ? 38 GLN A NE2  8  
ATOM 11499 H H    . GLN A 1 39 ? 156.271 3.019   -12.454 1.00 0.00 ? 38 GLN A H    8  
ATOM 11500 H HA   . GLN A 1 39 ? 159.001 2.467   -13.254 1.00 0.00 ? 38 GLN A HA   8  
ATOM 11501 H HB2  . GLN A 1 39 ? 158.080 5.154   -12.340 1.00 0.00 ? 38 GLN A HB2  8  
ATOM 11502 H HB3  . GLN A 1 39 ? 159.634 4.576   -11.759 1.00 0.00 ? 38 GLN A HB3  8  
ATOM 11503 H HG2  . GLN A 1 39 ? 160.461 4.377   -14.004 1.00 0.00 ? 38 GLN A HG2  8  
ATOM 11504 H HG3  . GLN A 1 39 ? 158.874 4.772   -14.663 1.00 0.00 ? 38 GLN A HG3  8  
ATOM 11505 H HE21 . GLN A 1 39 ? 160.977 6.170   -12.159 1.00 0.00 ? 38 GLN A HE21 8  
ATOM 11506 H HE22 . GLN A 1 39 ? 160.926 7.781   -12.779 1.00 0.00 ? 38 GLN A HE22 8  
ATOM 11507 N N    . PRO A 1 40 ? 159.622 1.886   -10.806 1.00 0.00 ? 39 PRO A N    8  
ATOM 11508 C CA   . PRO A 1 40 ? 159.818 1.286   -9.481  1.00 0.00 ? 39 PRO A CA   8  
ATOM 11509 C C    . PRO A 1 40 ? 159.922 2.341   -8.375  1.00 0.00 ? 39 PRO A C    8  
ATOM 11510 O O    . PRO A 1 40 ? 161.018 2.685   -7.925  1.00 0.00 ? 39 PRO A O    8  
ATOM 11511 C CB   . PRO A 1 40 ? 161.133 0.517   -9.634  1.00 0.00 ? 39 PRO A CB   8  
ATOM 11512 C CG   . PRO A 1 40 ? 161.875 1.248   -10.699 1.00 0.00 ? 39 PRO A CG   8  
ATOM 11513 C CD   . PRO A 1 40 ? 160.835 1.788   -11.643 1.00 0.00 ? 39 PRO A CD   8  
ATOM 11514 H HA   . PRO A 1 40 ? 159.023 0.597   -9.240  1.00 0.00 ? 39 PRO A HA   8  
ATOM 11515 H HB2  . PRO A 1 40 ? 161.672 0.526   -8.697  1.00 0.00 ? 39 PRO A HB2  8  
ATOM 11516 H HB3  . PRO A 1 40 ? 160.926 -0.502  -9.927  1.00 0.00 ? 39 PRO A HB3  8  
ATOM 11517 H HG2  . PRO A 1 40 ? 162.437 2.058   -10.261 1.00 0.00 ? 39 PRO A HG2  8  
ATOM 11518 H HG3  . PRO A 1 40 ? 162.536 0.570   -11.218 1.00 0.00 ? 39 PRO A HG3  8  
ATOM 11519 H HD2  . PRO A 1 40 ? 161.130 2.760   -12.009 1.00 0.00 ? 39 PRO A HD2  8  
ATOM 11520 H HD3  . PRO A 1 40 ? 160.681 1.104   -12.464 1.00 0.00 ? 39 PRO A HD3  8  
ATOM 11521 N N    . LEU A 1 41 ? 158.768 2.854   -7.945  1.00 0.00 ? 40 LEU A N    8  
ATOM 11522 C CA   . LEU A 1 41 ? 158.717 3.870   -6.895  1.00 0.00 ? 40 LEU A CA   8  
ATOM 11523 C C    . LEU A 1 41 ? 158.974 3.249   -5.524  1.00 0.00 ? 40 LEU A C    8  
ATOM 11524 O O    . LEU A 1 41 ? 158.491 2.154   -5.230  1.00 0.00 ? 40 LEU A O    8  
ATOM 11525 C CB   . LEU A 1 41 ? 157.357 4.575   -6.898  1.00 0.00 ? 40 LEU A CB   8  
ATOM 11526 C CG   . LEU A 1 41 ? 157.214 5.719   -7.906  1.00 0.00 ? 40 LEU A CG   8  
ATOM 11527 C CD1  . LEU A 1 41 ? 156.935 5.177   -9.302  1.00 0.00 ? 40 LEU A CD1  8  
ATOM 11528 C CD2  . LEU A 1 41 ? 156.110 6.671   -7.469  1.00 0.00 ? 40 LEU A CD2  8  
ATOM 11529 H H    . LEU A 1 41 ? 157.929 2.542   -8.346  1.00 0.00 ? 40 LEU A H    8  
ATOM 11530 H HA   . LEU A 1 41 ? 159.491 4.596   -7.098  1.00 0.00 ? 40 LEU A HA   8  
ATOM 11531 H HB2  . LEU A 1 41 ? 156.594 3.839   -7.109  1.00 0.00 ? 40 LEU A HB2  8  
ATOM 11532 H HB3  . LEU A 1 41 ? 157.182 4.974   -5.910  1.00 0.00 ? 40 LEU A HB3  8  
ATOM 11533 H HG   . LEU A 1 41 ? 158.139 6.274   -7.944  1.00 0.00 ? 40 LEU A HG   8  
ATOM 11534 H HD11 . LEU A 1 41 ? 156.433 5.933   -9.887  1.00 0.00 ? 40 LEU A HD11 8  
ATOM 11535 H HD12 . LEU A 1 41 ? 156.306 4.301   -9.230  1.00 0.00 ? 40 LEU A HD12 8  
ATOM 11536 H HD13 . LEU A 1 41 ? 157.867 4.914   -9.778  1.00 0.00 ? 40 LEU A HD13 8  
ATOM 11537 H HD21 . LEU A 1 41 ? 156.485 7.323   -6.694  1.00 0.00 ? 40 LEU A HD21 8  
ATOM 11538 H HD22 . LEU A 1 41 ? 155.275 6.103   -7.088  1.00 0.00 ? 40 LEU A HD22 8  
ATOM 11539 H HD23 . LEU A 1 41 ? 155.788 7.262   -8.314  1.00 0.00 ? 40 LEU A HD23 8  
ATOM 11540 N N    . ASP A 1 42 ? 159.733 3.958   -4.689  1.00 0.00 ? 41 ASP A N    8  
ATOM 11541 C CA   . ASP A 1 42 ? 160.054 3.481   -3.347  1.00 0.00 ? 41 ASP A CA   8  
ATOM 11542 C C    . ASP A 1 42 ? 158.971 3.887   -2.347  1.00 0.00 ? 41 ASP A C    8  
ATOM 11543 O O    . ASP A 1 42 ? 158.487 5.021   -2.367  1.00 0.00 ? 41 ASP A O    8  
ATOM 11544 C CB   . ASP A 1 42 ? 161.413 4.033   -2.899  1.00 0.00 ? 41 ASP A CB   8  
ATOM 11545 C CG   . ASP A 1 42 ? 162.475 2.953   -2.765  1.00 0.00 ? 41 ASP A CG   8  
ATOM 11546 O OD1  . ASP A 1 42 ? 162.150 1.850   -2.273  1.00 0.00 ? 41 ASP A OD1  8  
ATOM 11547 O OD2  . ASP A 1 42 ? 163.635 3.215   -3.146  1.00 0.00 ? 41 ASP A OD2  8  
ATOM 11548 H H    . ASP A 1 42 ? 160.084 4.826   -4.983  1.00 0.00 ? 41 ASP A H    8  
ATOM 11549 H HA   . ASP A 1 42 ? 160.107 2.404   -3.384  1.00 0.00 ? 41 ASP A HA   8  
ATOM 11550 H HB2  . ASP A 1 42 ? 161.754 4.755   -3.626  1.00 0.00 ? 41 ASP A HB2  8  
ATOM 11551 H HB3  . ASP A 1 42 ? 161.297 4.520   -1.942  1.00 0.00 ? 41 ASP A HB3  8  
ATOM 11552 N N    . LEU A 1 43 ? 158.597 2.950   -1.475  1.00 0.00 ? 42 LEU A N    8  
ATOM 11553 C CA   . LEU A 1 43 ? 157.572 3.199   -0.462  1.00 0.00 ? 42 LEU A CA   8  
ATOM 11554 C C    . LEU A 1 43 ? 158.184 3.824   0.791   1.00 0.00 ? 42 LEU A C    8  
ATOM 11555 O O    . LEU A 1 43 ? 159.040 3.222   1.440   1.00 0.00 ? 42 LEU A O    8  
ATOM 11556 C CB   . LEU A 1 43 ? 156.856 1.892   -0.100  1.00 0.00 ? 42 LEU A CB   8  
ATOM 11557 C CG   . LEU A 1 43 ? 155.900 1.357   -1.169  1.00 0.00 ? 42 LEU A CG   8  
ATOM 11558 C CD1  . LEU A 1 43 ? 155.817 -0.161  -1.102  1.00 0.00 ? 42 LEU A CD1  8  
ATOM 11559 C CD2  . LEU A 1 43 ? 154.519 1.976   -1.008  1.00 0.00 ? 42 LEU A CD2  8  
ATOM 11560 H H    . LEU A 1 43 ? 159.023 2.066   -1.512  1.00 0.00 ? 42 LEU A H    8  
ATOM 11561 H HA   . LEU A 1 43 ? 156.853 3.888   -0.881  1.00 0.00 ? 42 LEU A HA   8  
ATOM 11562 H HB2  . LEU A 1 43 ? 157.607 1.139   0.093   1.00 0.00 ? 42 LEU A HB2  8  
ATOM 11563 H HB3  . LEU A 1 43 ? 156.293 2.055   0.807   1.00 0.00 ? 42 LEU A HB3  8  
ATOM 11564 H HG   . LEU A 1 43 ? 156.276 1.626   -2.146  1.00 0.00 ? 42 LEU A HG   8  
ATOM 11565 H HD11 . LEU A 1 43 ? 154.978 -0.503  -1.690  1.00 0.00 ? 42 LEU A HD11 8  
ATOM 11566 H HD12 . LEU A 1 43 ? 155.688 -0.471  -0.075  1.00 0.00 ? 42 LEU A HD12 8  
ATOM 11567 H HD13 . LEU A 1 43 ? 156.728 -0.588  -1.495  1.00 0.00 ? 42 LEU A HD13 8  
ATOM 11568 H HD21 . LEU A 1 43 ? 154.139 1.756   -0.021  1.00 0.00 ? 42 LEU A HD21 8  
ATOM 11569 H HD22 . LEU A 1 43 ? 153.851 1.567   -1.751  1.00 0.00 ? 42 LEU A HD22 8  
ATOM 11570 H HD23 . LEU A 1 43 ? 154.588 3.046   -1.136  1.00 0.00 ? 42 LEU A HD23 8  
ATOM 11571 N N    . HIS A 1 44 ? 157.742 5.037   1.124   1.00 0.00 ? 43 HIS A N    8  
ATOM 11572 C CA   . HIS A 1 44 ? 158.248 5.748   2.297   1.00 0.00 ? 43 HIS A CA   8  
ATOM 11573 C C    . HIS A 1 44 ? 157.190 5.814   3.398   1.00 0.00 ? 43 HIS A C    8  
ATOM 11574 O O    . HIS A 1 44 ? 156.112 6.375   3.199   1.00 0.00 ? 43 HIS A O    8  
ATOM 11575 C CB   . HIS A 1 44 ? 158.682 7.167   1.910   1.00 0.00 ? 43 HIS A CB   8  
ATOM 11576 C CG   . HIS A 1 44 ? 159.969 7.224   1.144   1.00 0.00 ? 43 HIS A CG   8  
ATOM 11577 N ND1  . HIS A 1 44 ? 160.771 8.345   1.106   1.00 0.00 ? 43 HIS A ND1  8  
ATOM 11578 C CD2  . HIS A 1 44 ? 160.590 6.295   0.378   1.00 0.00 ? 43 HIS A CD2  8  
ATOM 11579 C CE1  . HIS A 1 44 ? 161.827 8.104   0.350   1.00 0.00 ? 43 HIS A CE1  8  
ATOM 11580 N NE2  . HIS A 1 44 ? 161.742 6.867   -0.103  1.00 0.00 ? 43 HIS A NE2  8  
ATOM 11581 H H    . HIS A 1 44 ? 157.060 5.467   0.564   1.00 0.00 ? 43 HIS A H    8  
ATOM 11582 H HA   . HIS A 1 44 ? 159.105 5.208   2.669   1.00 0.00 ? 43 HIS A HA   8  
ATOM 11583 H HB2  . HIS A 1 44 ? 157.914 7.616   1.298   1.00 0.00 ? 43 HIS A HB2  8  
ATOM 11584 H HB3  . HIS A 1 44 ? 158.804 7.753   2.809   1.00 0.00 ? 43 HIS A HB3  8  
ATOM 11585 H HD1  . HIS A 1 44 ? 160.591 9.193   1.564   1.00 0.00 ? 43 HIS A HD1  8  
ATOM 11586 H HD2  . HIS A 1 44 ? 160.243 5.290   0.183   1.00 0.00 ? 43 HIS A HD2  8  
ATOM 11587 H HE1  . HIS A 1 44 ? 162.625 8.801   0.139   1.00 0.00 ? 43 HIS A HE1  8  
ATOM 11588 H HE2  . HIS A 1 44 ? 162.337 6.469   -0.772  1.00 0.00 ? 43 HIS A HE2  8  
ATOM 11589 N N    . TYR A 1 45 ? 157.505 5.242   4.560   1.00 0.00 ? 44 TYR A N    8  
ATOM 11590 C CA   . TYR A 1 45 ? 156.581 5.242   5.689   1.00 0.00 ? 44 TYR A CA   8  
ATOM 11591 C C    . TYR A 1 45 ? 157.203 5.947   6.896   1.00 0.00 ? 44 TYR A C    8  
ATOM 11592 O O    . TYR A 1 45 ? 158.319 5.625   7.309   1.00 0.00 ? 44 TYR A O    8  
ATOM 11593 C CB   . TYR A 1 45 ? 156.190 3.804   6.051   1.00 0.00 ? 44 TYR A CB   8  
ATOM 11594 C CG   . TYR A 1 45 ? 155.469 3.675   7.376   1.00 0.00 ? 44 TYR A CG   8  
ATOM 11595 C CD1  . TYR A 1 45 ? 156.179 3.632   8.569   1.00 0.00 ? 44 TYR A CD1  8  
ATOM 11596 C CD2  . TYR A 1 45 ? 154.083 3.595   7.433   1.00 0.00 ? 44 TYR A CD2  8  
ATOM 11597 C CE1  . TYR A 1 45 ? 155.529 3.513   9.782   1.00 0.00 ? 44 TYR A CE1  8  
ATOM 11598 C CE2  . TYR A 1 45 ? 153.426 3.476   8.642   1.00 0.00 ? 44 TYR A CE2  8  
ATOM 11599 C CZ   . TYR A 1 45 ? 154.152 3.436   9.814   1.00 0.00 ? 44 TYR A CZ   8  
ATOM 11600 O OH   . TYR A 1 45 ? 153.498 3.316   11.021  1.00 0.00 ? 44 TYR A OH   8  
ATOM 11601 H H    . TYR A 1 45 ? 158.380 4.810   4.663   1.00 0.00 ? 44 TYR A H    8  
ATOM 11602 H HA   . TYR A 1 45 ? 155.694 5.782   5.391   1.00 0.00 ? 44 TYR A HA   8  
ATOM 11603 H HB2  . TYR A 1 45 ? 155.539 3.413   5.284   1.00 0.00 ? 44 TYR A HB2  8  
ATOM 11604 H HB3  . TYR A 1 45 ? 157.084 3.198   6.099   1.00 0.00 ? 44 TYR A HB3  8  
ATOM 11605 H HD1  . TYR A 1 45 ? 157.257 3.695   8.539   1.00 0.00 ? 44 TYR A HD1  8  
ATOM 11606 H HD2  . TYR A 1 45 ? 153.517 3.626   6.513   1.00 0.00 ? 44 TYR A HD2  8  
ATOM 11607 H HE1  . TYR A 1 45 ? 156.098 3.481   10.697  1.00 0.00 ? 44 TYR A HE1  8  
ATOM 11608 H HE2  . TYR A 1 45 ? 152.347 3.415   8.666   1.00 0.00 ? 44 TYR A HE2  8  
ATOM 11609 H HH   . TYR A 1 45 ? 153.858 3.948   11.647  1.00 0.00 ? 44 TYR A HH   8  
ATOM 11610 N N    . MET A 1 46 ? 156.467 6.905   7.459   1.00 0.00 ? 45 MET A N    8  
ATOM 11611 C CA   . MET A 1 46 ? 156.935 7.655   8.623   1.00 0.00 ? 45 MET A CA   8  
ATOM 11612 C C    . MET A 1 46 ? 156.118 7.284   9.858   1.00 0.00 ? 45 MET A C    8  
ATOM 11613 O O    . MET A 1 46 ? 154.904 7.487   9.890   1.00 0.00 ? 45 MET A O    8  
ATOM 11614 C CB   . MET A 1 46 ? 156.838 9.163   8.364   1.00 0.00 ? 45 MET A CB   8  
ATOM 11615 C CG   . MET A 1 46 ? 157.387 9.591   7.011   1.00 0.00 ? 45 MET A CG   8  
ATOM 11616 S SD   . MET A 1 46 ? 158.218 11.190  7.073   1.00 0.00 ? 45 MET A SD   8  
ATOM 11617 C CE   . MET A 1 46 ? 156.825 12.306  6.914   1.00 0.00 ? 45 MET A CE   8  
ATOM 11618 H H    . MET A 1 46 ? 155.585 7.109   7.085   1.00 0.00 ? 45 MET A H    8  
ATOM 11619 H HA   . MET A 1 46 ? 157.968 7.392   8.795   1.00 0.00 ? 45 MET A HA   8  
ATOM 11620 H HB2  . MET A 1 46 ? 155.801 9.459   8.417   1.00 0.00 ? 45 MET A HB2  8  
ATOM 11621 H HB3  . MET A 1 46 ? 157.390 9.683   9.133   1.00 0.00 ? 45 MET A HB3  8  
ATOM 11622 H HG2  . MET A 1 46 ? 158.093 8.848   6.671   1.00 0.00 ? 45 MET A HG2  8  
ATOM 11623 H HG3  . MET A 1 46 ? 156.567 9.653   6.309   1.00 0.00 ? 45 MET A HG3  8  
ATOM 11624 H HE1  . MET A 1 46 ? 156.755 12.652  5.895   1.00 0.00 ? 45 MET A HE1  8  
ATOM 11625 H HE2  . MET A 1 46 ? 156.964 13.150  7.573   1.00 0.00 ? 45 MET A HE2  8  
ATOM 11626 H HE3  . MET A 1 46 ? 155.915 11.788  7.181   1.00 0.00 ? 45 MET A HE3  8  
ATOM 11627 N N    . ASN A 1 47 ? 156.790 6.736   10.872  1.00 0.00 ? 46 ASN A N    8  
ATOM 11628 C CA   . ASN A 1 47 ? 156.122 6.333   12.111  1.00 0.00 ? 46 ASN A CA   8  
ATOM 11629 C C    . ASN A 1 47 ? 155.467 7.534   12.792  1.00 0.00 ? 46 ASN A C    8  
ATOM 11630 O O    . ASN A 1 47 ? 154.241 7.624   12.865  1.00 0.00 ? 46 ASN A O    8  
ATOM 11631 C CB   . ASN A 1 47 ? 157.117 5.668   13.070  1.00 0.00 ? 46 ASN A CB   8  
ATOM 11632 C CG   . ASN A 1 47 ? 157.018 4.154   13.053  1.00 0.00 ? 46 ASN A CG   8  
ATOM 11633 O OD1  . ASN A 1 47 ? 155.924 3.592   12.999  1.00 0.00 ? 46 ASN A OD1  8  
ATOM 11634 N ND2  . ASN A 1 47 ? 158.164 3.482   13.101  1.00 0.00 ? 46 ASN A ND2  8  
ATOM 11635 H H    . ASN A 1 47 ? 157.757 6.597   10.784  1.00 0.00 ? 46 ASN A H    8  
ATOM 11636 H HA   . ASN A 1 47 ? 155.353 5.619   11.854  1.00 0.00 ? 46 ASN A HA   8  
ATOM 11637 H HB2  . ASN A 1 47 ? 158.121 5.949   12.788  1.00 0.00 ? 46 ASN A HB2  8  
ATOM 11638 H HB3  . ASN A 1 47 ? 156.922 6.011   14.075  1.00 0.00 ? 46 ASN A HB3  8  
ATOM 11639 H HD21 . ASN A 1 47 ? 159.000 3.991   13.143  1.00 0.00 ? 46 ASN A HD21 8  
ATOM 11640 H HD22 . ASN A 1 47 ? 158.125 2.503   13.092  1.00 0.00 ? 46 ASN A HD22 8  
ATOM 11641 N N    . ASN A 1 48 ? 156.296 8.455   13.280  1.00 0.00 ? 47 ASN A N    8  
ATOM 11642 C CA   . ASN A 1 48 ? 155.811 9.660   13.948  1.00 0.00 ? 47 ASN A CA   8  
ATOM 11643 C C    . ASN A 1 48 ? 156.803 10.807  13.762  1.00 0.00 ? 47 ASN A C    8  
ATOM 11644 O O    . ASN A 1 48 ? 156.464 11.845  13.193  1.00 0.00 ? 47 ASN A O    8  
ATOM 11645 C CB   . ASN A 1 48 ? 155.580 9.392   15.441  1.00 0.00 ? 47 ASN A CB   8  
ATOM 11646 C CG   . ASN A 1 48 ? 154.110 9.436   15.817  1.00 0.00 ? 47 ASN A CG   8  
ATOM 11647 O OD1  . ASN A 1 48 ? 153.656 10.367  16.482  1.00 0.00 ? 47 ASN A OD1  8  
ATOM 11648 N ND2  . ASN A 1 48 ? 153.356 8.427   15.394  1.00 0.00 ? 47 ASN A ND2  8  
ATOM 11649 H H    . ASN A 1 48 ? 157.262 8.323   13.183  1.00 0.00 ? 47 ASN A H    8  
ATOM 11650 H HA   . ASN A 1 48 ? 154.872 9.935   13.491  1.00 0.00 ? 47 ASN A HA   8  
ATOM 11651 H HB2  . ASN A 1 48 ? 155.965 8.414   15.689  1.00 0.00 ? 47 ASN A HB2  8  
ATOM 11652 H HB3  . ASN A 1 48 ? 156.104 10.138  16.021  1.00 0.00 ? 47 ASN A HB3  8  
ATOM 11653 H HD21 . ASN A 1 48 ? 153.783 7.717   14.869  1.00 0.00 ? 47 ASN A HD21 8  
ATOM 11654 H HD22 . ASN A 1 48 ? 152.403 8.435   15.620  1.00 0.00 ? 47 ASN A HD22 8  
ATOM 11655 N N    . GLU A 1 49 ? 158.034 10.603  14.236  1.00 0.00 ? 48 GLU A N    8  
ATOM 11656 C CA   . GLU A 1 49 ? 159.087 11.609  14.116  1.00 0.00 ? 48 GLU A CA   8  
ATOM 11657 C C    . GLU A 1 49 ? 160.299 11.070  13.338  1.00 0.00 ? 48 GLU A C    8  
ATOM 11658 O O    . GLU A 1 49 ? 161.358 11.702  13.320  1.00 0.00 ? 48 GLU A O    8  
ATOM 11659 C CB   . GLU A 1 49 ? 159.525 12.074  15.508  1.00 0.00 ? 48 GLU A CB   8  
ATOM 11660 C CG   . GLU A 1 49 ? 158.821 13.337  15.980  1.00 0.00 ? 48 GLU A CG   8  
ATOM 11661 C CD   . GLU A 1 49 ? 159.050 13.621  17.452  1.00 0.00 ? 48 GLU A CD   8  
ATOM 11662 O OE1  . GLU A 1 49 ? 158.690 12.764  18.288  1.00 0.00 ? 48 GLU A OE1  8  
ATOM 11663 O OE2  . GLU A 1 49 ? 159.588 14.702  17.772  1.00 0.00 ? 48 GLU A OE2  8  
ATOM 11664 H H    . GLU A 1 49 ? 158.240 9.751   14.673  1.00 0.00 ? 48 GLU A H    8  
ATOM 11665 H HA   . GLU A 1 49 ? 158.678 12.453  13.579  1.00 0.00 ? 48 GLU A HA   8  
ATOM 11666 H HB2  . GLU A 1 49 ? 159.318 11.288  16.219  1.00 0.00 ? 48 GLU A HB2  8  
ATOM 11667 H HB3  . GLU A 1 49 ? 160.588 12.265  15.495  1.00 0.00 ? 48 GLU A HB3  8  
ATOM 11668 H HG2  . GLU A 1 49 ? 159.190 14.175  15.407  1.00 0.00 ? 48 GLU A HG2  8  
ATOM 11669 H HG3  . GLU A 1 49 ? 157.759 13.227  15.810  1.00 0.00 ? 48 GLU A HG3  8  
ATOM 11670 N N    . LEU A 1 50 ? 160.142 9.906   12.693  1.00 0.00 ? 49 LEU A N    8  
ATOM 11671 C CA   . LEU A 1 50 ? 161.228 9.299   11.920  1.00 0.00 ? 49 LEU A CA   8  
ATOM 11672 C C    . LEU A 1 50 ? 160.745 8.881   10.530  1.00 0.00 ? 49 LEU A C    8  
ATOM 11673 O O    . LEU A 1 50 ? 159.545 8.702   10.308  1.00 0.00 ? 49 LEU A O    8  
ATOM 11674 C CB   . LEU A 1 50 ? 161.791 8.076   12.659  1.00 0.00 ? 49 LEU A CB   8  
ATOM 11675 C CG   . LEU A 1 50 ? 163.164 8.271   13.317  1.00 0.00 ? 49 LEU A CG   8  
ATOM 11676 C CD1  . LEU A 1 50 ? 164.218 8.627   12.278  1.00 0.00 ? 49 LEU A CD1  8  
ATOM 11677 C CD2  . LEU A 1 50 ? 163.095 9.339   14.400  1.00 0.00 ? 49 LEU A CD2  8  
ATOM 11678 H H    . LEU A 1 50 ? 159.279 9.447   12.735  1.00 0.00 ? 49 LEU A H    8  
ATOM 11679 H HA   . LEU A 1 50 ? 162.009 10.036  11.810  1.00 0.00 ? 49 LEU A HA   8  
ATOM 11680 H HB2  . LEU A 1 50 ? 161.086 7.791   13.427  1.00 0.00 ? 49 LEU A HB2  8  
ATOM 11681 H HB3  . LEU A 1 50 ? 161.871 7.264   11.952  1.00 0.00 ? 49 LEU A HB3  8  
ATOM 11682 H HG   . LEU A 1 50 ? 163.462 7.344   13.783  1.00 0.00 ? 49 LEU A HG   8  
ATOM 11683 H HD11 . LEU A 1 50 ? 164.205 9.693   12.101  1.00 0.00 ? 49 LEU A HD11 8  
ATOM 11684 H HD12 . LEU A 1 50 ? 164.007 8.106   11.356  1.00 0.00 ? 49 LEU A HD12 8  
ATOM 11685 H HD13 . LEU A 1 50 ? 165.193 8.336   12.641  1.00 0.00 ? 49 LEU A HD13 8  
ATOM 11686 H HD21 . LEU A 1 50 ? 163.378 10.295  13.984  1.00 0.00 ? 49 LEU A HD21 8  
ATOM 11687 H HD22 . LEU A 1 50 ? 163.772 9.083   15.202  1.00 0.00 ? 49 LEU A HD22 8  
ATOM 11688 H HD23 . LEU A 1 50 ? 162.088 9.399   14.785  1.00 0.00 ? 49 LEU A HD23 8  
ATOM 11689 N N    . SER A 1 51 ? 161.690 8.723   9.599   1.00 0.00 ? 50 SER A N    8  
ATOM 11690 C CA   . SER A 1 51 ? 161.369 8.321   8.229   1.00 0.00 ? 50 SER A CA   8  
ATOM 11691 C C    . SER A 1 51 ? 162.020 6.984   7.883   1.00 0.00 ? 50 SER A C    8  
ATOM 11692 O O    . SER A 1 51 ? 163.246 6.861   7.891   1.00 0.00 ? 50 SER A O    8  
ATOM 11693 C CB   . SER A 1 51 ? 161.826 9.392   7.232   1.00 0.00 ? 50 SER A CB   8  
ATOM 11694 O OG   . SER A 1 51 ? 163.092 9.924   7.590   1.00 0.00 ? 50 SER A OG   8  
ATOM 11695 H H    . SER A 1 51 ? 162.628 8.877   9.840   1.00 0.00 ? 50 SER A H    8  
ATOM 11696 H HA   . SER A 1 51 ? 160.296 8.214   8.160   1.00 0.00 ? 50 SER A HA   8  
ATOM 11697 H HB2  . SER A 1 51 ? 161.901 8.955   6.248   1.00 0.00 ? 50 SER A HB2  8  
ATOM 11698 H HB3  . SER A 1 51 ? 161.105 10.195  7.214   1.00 0.00 ? 50 SER A HB3  8  
ATOM 11699 H HG   . SER A 1 51 ? 163.785 9.436   7.136   1.00 0.00 ? 50 SER A HG   8  
ATOM 11700 N N    . ILE A 1 52 ? 161.191 5.985   7.574   1.00 0.00 ? 51 ILE A N    8  
ATOM 11701 C CA   . ILE A 1 52 ? 161.685 4.657   7.218   1.00 0.00 ? 51 ILE A CA   8  
ATOM 11702 C C    . ILE A 1 52 ? 161.373 4.334   5.758   1.00 0.00 ? 51 ILE A C    8  
ATOM 11703 O O    . ILE A 1 52 ? 160.254 4.552   5.287   1.00 0.00 ? 51 ILE A O    8  
ATOM 11704 C CB   . ILE A 1 52 ? 161.079 3.560   8.121   1.00 0.00 ? 51 ILE A CB   8  
ATOM 11705 C CG1  . ILE A 1 52 ? 161.234 3.929   9.602   1.00 0.00 ? 51 ILE A CG1  8  
ATOM 11706 C CG2  . ILE A 1 52 ? 161.734 2.214   7.838   1.00 0.00 ? 51 ILE A CG2  8  
ATOM 11707 C CD1  . ILE A 1 52 ? 160.078 3.469   10.464  1.00 0.00 ? 51 ILE A CD1  8  
ATOM 11708 H H    . ILE A 1 52 ? 160.224 6.146   7.582   1.00 0.00 ? 51 ILE A H    8  
ATOM 11709 H HA   . ILE A 1 52 ? 162.757 4.654   7.354   1.00 0.00 ? 51 ILE A HA   8  
ATOM 11710 H HB   . ILE A 1 52 ? 160.029 3.476   7.887   1.00 0.00 ? 51 ILE A HB   8  
ATOM 11711 H HG12 . ILE A 1 52 ? 162.134 3.473   9.987   1.00 0.00 ? 51 ILE A HG12 8  
ATOM 11712 H HG13 . ILE A 1 52 ? 161.312 5.002   9.695   1.00 0.00 ? 51 ILE A HG13 8  
ATOM 11713 H HG21 . ILE A 1 52 ? 162.804 2.342   7.758   1.00 0.00 ? 51 ILE A HG21 8  
ATOM 11714 H HG22 . ILE A 1 52 ? 161.350 1.814   6.911   1.00 0.00 ? 51 ILE A HG22 8  
ATOM 11715 H HG23 . ILE A 1 52 ? 161.513 1.529   8.643   1.00 0.00 ? 51 ILE A HG23 8  
ATOM 11716 H HD11 . ILE A 1 52 ? 159.180 3.994   10.172  1.00 0.00 ? 51 ILE A HD11 8  
ATOM 11717 H HD12 . ILE A 1 52 ? 160.297 3.680   11.500  1.00 0.00 ? 51 ILE A HD12 8  
ATOM 11718 H HD13 . ILE A 1 52 ? 159.933 2.407   10.335  1.00 0.00 ? 51 ILE A HD13 8  
ATOM 11719 N N    . LEU A 1 53 ? 162.372 3.814   5.046   1.00 0.00 ? 52 LEU A N    8  
ATOM 11720 C CA   . LEU A 1 53 ? 162.214 3.460   3.638   1.00 0.00 ? 52 LEU A CA   8  
ATOM 11721 C C    . LEU A 1 53 ? 161.895 1.975   3.481   1.00 0.00 ? 52 LEU A C    8  
ATOM 11722 O O    . LEU A 1 53 ? 162.652 1.117   3.940   1.00 0.00 ? 52 LEU A O    8  
ATOM 11723 C CB   . LEU A 1 53 ? 163.485 3.806   2.858   1.00 0.00 ? 52 LEU A CB   8  
ATOM 11724 C CG   . LEU A 1 53 ? 163.271 4.116   1.374   1.00 0.00 ? 52 LEU A CG   8  
ATOM 11725 C CD1  . LEU A 1 53 ? 164.244 5.188   0.904   1.00 0.00 ? 52 LEU A CD1  8  
ATOM 11726 C CD2  . LEU A 1 53 ? 163.419 2.854   0.536   1.00 0.00 ? 52 LEU A CD2  8  
ATOM 11727 H H    . LEU A 1 53 ? 163.238 3.665   5.480   1.00 0.00 ? 52 LEU A H    8  
ATOM 11728 H HA   . LEU A 1 53 ? 161.391 4.036   3.242   1.00 0.00 ? 52 LEU A HA   8  
ATOM 11729 H HB2  . LEU A 1 53 ? 163.943 4.667   3.323   1.00 0.00 ? 52 LEU A HB2  8  
ATOM 11730 H HB3  . LEU A 1 53 ? 164.167 2.972   2.933   1.00 0.00 ? 52 LEU A HB3  8  
ATOM 11731 H HG   . LEU A 1 53 ? 162.269 4.494   1.234   1.00 0.00 ? 52 LEU A HG   8  
ATOM 11732 H HD11 . LEU A 1 53 ? 165.239 4.950   1.253   1.00 0.00 ? 52 LEU A HD11 8  
ATOM 11733 H HD12 . LEU A 1 53 ? 163.943 6.146   1.300   1.00 0.00 ? 52 LEU A HD12 8  
ATOM 11734 H HD13 . LEU A 1 53 ? 164.242 5.227   -0.175  1.00 0.00 ? 52 LEU A HD13 8  
ATOM 11735 H HD21 . LEU A 1 53 ? 163.333 1.985   1.171   1.00 0.00 ? 52 LEU A HD21 8  
ATOM 11736 H HD22 . LEU A 1 53 ? 164.385 2.852   0.052   1.00 0.00 ? 52 LEU A HD22 8  
ATOM 11737 H HD23 . LEU A 1 53 ? 162.642 2.829   -0.213  1.00 0.00 ? 52 LEU A HD23 8  
ATOM 11738 N N    . LEU A 1 54 ? 160.773 1.680   2.828   1.00 0.00 ? 53 LEU A N    8  
ATOM 11739 C CA   . LEU A 1 54 ? 160.354 0.300   2.605   1.00 0.00 ? 53 LEU A CA   8  
ATOM 11740 C C    . LEU A 1 54 ? 160.872 -0.216  1.263   1.00 0.00 ? 53 LEU A C    8  
ATOM 11741 O O    . LEU A 1 54 ? 160.142 -0.235  0.270   1.00 0.00 ? 53 LEU A O    8  
ATOM 11742 C CB   . LEU A 1 54 ? 158.824 0.191   2.658   1.00 0.00 ? 53 LEU A CB   8  
ATOM 11743 C CG   . LEU A 1 54 ? 158.182 0.639   3.975   1.00 0.00 ? 53 LEU A CG   8  
ATOM 11744 C CD1  . LEU A 1 54 ? 156.791 1.207   3.727   1.00 0.00 ? 53 LEU A CD1  8  
ATOM 11745 C CD2  . LEU A 1 54 ? 158.119 -0.520  4.959   1.00 0.00 ? 53 LEU A CD2  8  
ATOM 11746 H H    . LEU A 1 54 ? 160.215 2.409   2.483   1.00 0.00 ? 53 LEU A H    8  
ATOM 11747 H HA   . LEU A 1 54 ? 160.775 -0.306  3.395   1.00 0.00 ? 53 LEU A HA   8  
ATOM 11748 H HB2  . LEU A 1 54 ? 158.417 0.793   1.859   1.00 0.00 ? 53 LEU A HB2  8  
ATOM 11749 H HB3  . LEU A 1 54 ? 158.553 -0.840  2.482   1.00 0.00 ? 53 LEU A HB3  8  
ATOM 11750 H HG   . LEU A 1 54 ? 158.786 1.419   4.414   1.00 0.00 ? 53 LEU A HG   8  
ATOM 11751 H HD11 . LEU A 1 54 ? 156.592 1.991   4.441   1.00 0.00 ? 53 LEU A HD11 8  
ATOM 11752 H HD12 . LEU A 1 54 ? 156.056 0.424   3.839   1.00 0.00 ? 53 LEU A HD12 8  
ATOM 11753 H HD13 . LEU A 1 54 ? 156.738 1.609   2.727   1.00 0.00 ? 53 LEU A HD13 8  
ATOM 11754 H HD21 . LEU A 1 54 ? 158.367 -0.166  5.949   1.00 0.00 ? 53 LEU A HD21 8  
ATOM 11755 H HD22 . LEU A 1 54 ? 158.824 -1.283  4.663   1.00 0.00 ? 53 LEU A HD22 8  
ATOM 11756 H HD23 . LEU A 1 54 ? 157.122 -0.935  4.965   1.00 0.00 ? 53 LEU A HD23 8  
ATOM 11757 N N    . LYS A 1 55 ? 162.136 -0.633  1.242   1.00 0.00 ? 54 LYS A N    8  
ATOM 11758 C CA   . LYS A 1 55 ? 162.755 -1.154  0.026   1.00 0.00 ? 54 LYS A CA   8  
ATOM 11759 C C    . LYS A 1 55 ? 162.855 -2.681  0.073   1.00 0.00 ? 54 LYS A C    8  
ATOM 11760 O O    . LYS A 1 55 ? 162.762 -3.345  -0.961  1.00 0.00 ? 54 LYS A O    8  
ATOM 11761 C CB   . LYS A 1 55 ? 164.144 -0.542  -0.171  1.00 0.00 ? 54 LYS A CB   8  
ATOM 11762 C CG   . LYS A 1 55 ? 164.827 -0.969  -1.462  1.00 0.00 ? 54 LYS A CG   8  
ATOM 11763 C CD   . LYS A 1 55 ? 165.557 0.193   -2.121  1.00 0.00 ? 54 LYS A CD   8  
ATOM 11764 C CE   . LYS A 1 55 ? 166.489 -0.280  -3.229  1.00 0.00 ? 54 LYS A CE   8  
ATOM 11765 N NZ   . LYS A 1 55 ? 165.884 -0.116  -4.584  1.00 0.00 ? 54 LYS A NZ   8  
ATOM 11766 H H    . LYS A 1 55 ? 162.667 -0.591  2.065   1.00 0.00 ? 54 LYS A H    8  
ATOM 11767 H HA   . LYS A 1 55 ? 162.129 -0.875  -0.807  1.00 0.00 ? 54 LYS A HA   8  
ATOM 11768 H HB2  . LYS A 1 55 ? 164.051 0.534   -0.177  1.00 0.00 ? 54 LYS A HB2  8  
ATOM 11769 H HB3  . LYS A 1 55 ? 164.773 -0.834  0.657   1.00 0.00 ? 54 LYS A HB3  8  
ATOM 11770 H HG2  . LYS A 1 55 ? 165.539 -1.748  -1.238  1.00 0.00 ? 54 LYS A HG2  8  
ATOM 11771 H HG3  . LYS A 1 55 ? 164.080 -1.347  -2.145  1.00 0.00 ? 54 LYS A HG3  8  
ATOM 11772 H HD2  . LYS A 1 55 ? 164.828 0.870   -2.541  1.00 0.00 ? 54 LYS A HD2  8  
ATOM 11773 H HD3  . LYS A 1 55 ? 166.138 0.709   -1.371  1.00 0.00 ? 54 LYS A HD3  8  
ATOM 11774 H HE2  . LYS A 1 55 ? 167.402 0.295   -3.182  1.00 0.00 ? 54 LYS A HE2  8  
ATOM 11775 H HE3  . LYS A 1 55 ? 166.715 -1.324  -3.070  1.00 0.00 ? 54 LYS A HE3  8  
ATOM 11776 H HZ1  . LYS A 1 55 ? 165.400 -0.992  -4.868  1.00 0.00 ? 54 LYS A HZ1  8  
ATOM 11777 H HZ2  . LYS A 1 55 ? 166.625 0.098   -5.283  1.00 0.00 ? 54 LYS A HZ2  8  
ATOM 11778 H HZ3  . LYS A 1 55 ? 165.194 0.663   -4.580  1.00 0.00 ? 54 LYS A HZ3  8  
ATOM 11779 N N    . ASN A 1 56 ? 163.047 -3.231  1.276   1.00 0.00 ? 55 ASN A N    8  
ATOM 11780 C CA   . ASN A 1 56 ? 163.163 -4.678  1.453   1.00 0.00 ? 55 ASN A CA   8  
ATOM 11781 C C    . ASN A 1 56 ? 161.918 -5.251  2.125   1.00 0.00 ? 55 ASN A C    8  
ATOM 11782 O O    . ASN A 1 56 ? 161.108 -4.512  2.688   1.00 0.00 ? 55 ASN A O    8  
ATOM 11783 C CB   . ASN A 1 56 ? 164.401 -5.015  2.290   1.00 0.00 ? 55 ASN A CB   8  
ATOM 11784 C CG   . ASN A 1 56 ? 165.686 -4.497  1.669   1.00 0.00 ? 55 ASN A CG   8  
ATOM 11785 O OD1  . ASN A 1 56 ? 165.930 -4.681  0.476   1.00 0.00 ? 55 ASN A OD1  8  
ATOM 11786 N ND2  . ASN A 1 56 ? 166.515 -3.841  2.475   1.00 0.00 ? 55 ASN A ND2  8  
ATOM 11787 H H    . ASN A 1 56 ? 163.114 -2.651  2.064   1.00 0.00 ? 55 ASN A H    8  
ATOM 11788 H HA   . ASN A 1 56 ? 163.267 -5.125  0.476   1.00 0.00 ? 55 ASN A HA   8  
ATOM 11789 H HB2  . ASN A 1 56 ? 164.295 -4.574  3.271   1.00 0.00 ? 55 ASN A HB2  8  
ATOM 11790 H HB3  . ASN A 1 56 ? 164.479 -6.088  2.390   1.00 0.00 ? 55 ASN A HB3  8  
ATOM 11791 H HD21 . ASN A 1 56 ? 166.257 -3.729  3.414   1.00 0.00 ? 55 ASN A HD21 8  
ATOM 11792 H HD22 . ASN A 1 56 ? 167.350 -3.496  2.096   1.00 0.00 ? 55 ASN A HD22 8  
ATOM 11793 N N    . GLN A 1 57 ? 161.778 -6.578  2.069   1.00 0.00 ? 56 GLN A N    8  
ATOM 11794 C CA   . GLN A 1 57 ? 160.637 -7.258  2.681   1.00 0.00 ? 56 GLN A CA   8  
ATOM 11795 C C    . GLN A 1 57 ? 160.622 -7.046  4.195   1.00 0.00 ? 56 GLN A C    8  
ATOM 11796 O O    . GLN A 1 57 ? 159.555 -6.924  4.799   1.00 0.00 ? 56 GLN A O    8  
ATOM 11797 C CB   . GLN A 1 57 ? 160.671 -8.757  2.369   1.00 0.00 ? 56 GLN A CB   8  
ATOM 11798 C CG   . GLN A 1 57 ? 159.631 -9.194  1.349   1.00 0.00 ? 56 GLN A CG   8  
ATOM 11799 C CD   . GLN A 1 57 ? 158.341 -9.663  1.995   1.00 0.00 ? 56 GLN A CD   8  
ATOM 11800 O OE1  . GLN A 1 57 ? 158.220 -10.822 2.394   1.00 0.00 ? 56 GLN A OE1  8  
ATOM 11801 N NE2  . GLN A 1 57 ? 157.367 -8.765  2.102   1.00 0.00 ? 56 GLN A NE2  8  
ATOM 11802 H H    . GLN A 1 57 ? 162.462 -7.